NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
509442 2ytt 10178 cing 4-filtered-FRED STAR entry full 354


data_FRED_restraints_with_modified_coordinates_PDB_code_2ytt

# This FRED archive file contains, for PDB entry <2ytt>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, WF Vranken, C Schulte, J Lin, JR Wedell, CJ Penkett, GW Vuister, 
# G Vriend, JL Markley, and EL Ulrich (2009). The NMR Restraints Grid at BMRB for 
# 5,266 Protein and Nucleic Acid PDB Entries. J Biomol. NMR 45, 389?396.




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.PDB_coordinate_file_version  .
    _Entry.Sf_category                  entry_information
    _Entry.ID                           1
    _Entry.Title                        "Data for entry 1"
    _Entry.NMR_STAR_version             3.1.0.8
    _Entry.Experimental_method          NMR
    _Entry.Details                      .

save_


save_assembly_2ytt
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2ytt
    _Assembly.Number_of_components  2
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "all other bound"
    _Assembly.Molecular_mass        4909.53

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $Zinc_finger_protein_473 A . 1 1 
       2 . 2 $ZINC_ION                B . 1 1 
    stop_

    loop_
       _PDBX_nonpoly_scheme.Entity_assembly_ID
       _PDBX_nonpoly_scheme.Entity_ID
       _PDBX_nonpoly_scheme.Mon_ID
       _PDBX_nonpoly_scheme.Comp_index_ID
       _PDBX_nonpoly_scheme.Comp_ID
       _PDBX_nonpoly_scheme.Entry_ID
       _PDBX_nonpoly_scheme.Assembly_ID

       2 2 ZN 1 ZN 1 1 
    stop_

save_


save_Zinc_finger_protein_473
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "Zinc finger protein 473"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  GSSGSSGEGEKPYQCSECGKSFSGSYRLTQHWITHTREKPSGPSSG
    _Entity.Number_of_monomers           46

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

        1 GLY . 1 1 
        2 SER . 1 1 
        3 SER . 1 1 
        4 GLY . 1 1 
        5 SER . 1 1 
        6 SER . 1 1 
        7 GLY . 1 1 
        8 GLU . 1 1 
        9 GLY . 1 1 
       10 GLU . 1 1 
       11 LYS . 1 1 
       12 PRO . 1 1 
       13 TYR . 1 1 
       14 GLN . 1 1 
       15 CYS . 1 1 
       16 SER . 1 1 
       17 GLU . 1 1 
       18 CYS . 1 1 
       19 GLY . 1 1 
       20 LYS . 1 1 
       21 SER . 1 1 
       22 PHE . 1 1 
       23 SER . 1 1 
       24 GLY . 1 1 
       25 SER . 1 1 
       26 TYR . 1 1 
       27 ARG . 1 1 
       28 LEU . 1 1 
       29 THR . 1 1 
       30 GLN . 1 1 
       31 HIS . 1 1 
       32 TRP . 1 1 
       33 ILE . 1 1 
       34 THR . 1 1 
       35 HIS . 1 1 
       36 THR . 1 1 
       37 ARG . 1 1 
       38 GLU . 1 1 
       39 LYS . 1 1 
       40 PRO . 1 1 
       41 SER . 1 1 
       42 GLY . 1 1 
       43 PRO . 1 1 
       44 SER . 1 1 
       45 SER . 1 1 
       46 GLY . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       GLY  1  1 1 1 
       SER  2  2 1 1 
       SER  3  3 1 1 
       GLY  4  4 1 1 
       SER  5  5 1 1 
       SER  6  6 1 1 
       GLY  7  7 1 1 
       GLU  8  8 1 1 
       GLY  9  9 1 1 
       GLU 10 10 1 1 
       LYS 11 11 1 1 
       PRO 12 12 1 1 
       TYR 13 13 1 1 
       GLN 14 14 1 1 
       CYS 15 15 1 1 
       SER 16 16 1 1 
       GLU 17 17 1 1 
       CYS 18 18 1 1 
       GLY 19 19 1 1 
       LYS 20 20 1 1 
       SER 21 21 1 1 
       PHE 22 22 1 1 
       SER 23 23 1 1 
       GLY 24 24 1 1 
       SER 25 25 1 1 
       TYR 26 26 1 1 
       ARG 27 27 1 1 
       LEU 28 28 1 1 
       THR 29 29 1 1 
       GLN 30 30 1 1 
       HIS 31 31 1 1 
       TRP 32 32 1 1 
       ILE 33 33 1 1 
       THR 34 34 1 1 
       HIS 35 35 1 1 
       THR 36 36 1 1 
       ARG 37 37 1 1 
       GLU 38 38 1 1 
       LYS 39 39 1 1 
       PRO 40 40 1 1 
       SER 41 41 1 1 
       GLY 42 42 1 1 
       PRO 43 43 1 1 
       SER 44 44 1 1 
       SER 45 45 1 1 
       GLY 46 46 1 1 
    stop_

save_


save_ZINC_ION
    _Entity.Sf_category  entity
    _Entity.Entry_ID     1
    _Entity.ID           2
    _Entity.Name         "ZINC ION"
    _Entity.Type         non-polymer

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

       1 ZN $ZN 1 2 
    stop_

save_


save_ZN
    _Chem_comp.Sf_category  chem_comp
    _Chem_comp.Entry_ID     1
    _Chem_comp.ID           ZN
    _Chem_comp.Type         non-polymer

save_


save_DYANA/DIANA_distance_constraints_2_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     "general distance"
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

        1 1 . . . 1 1 
        2 1 . . . 1 1 
        3 1 . . . 1 1 
        4 1 . . . 1 1 
        5 1 . . . 1 1 
        6 1 . . . 1 1 
        7 1 . . . 1 1 
        8 1 . . . 1 1 
        9 1 . . . 1 1 
       10 1 . . . 1 1 
       11 1 . . . 1 1 
       12 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

        1 1 1 1 1 15 CYS SG  .  15 CYSS SG  1 1 
        1 1 2 2 2  1 ZN  ZN  . 181 ZN   ZN  1 1 
        2 1 1 1 1 15 CYS CB  .  15 CYSS CB  1 1 
        2 1 2 2 2  1 ZN  ZN  . 181 ZN   ZN  1 1 
        3 1 1 1 1 18 CYS SG  .  18 CYSS SG  1 1 
        3 1 2 2 2  1 ZN  ZN  . 181 ZN   ZN  1 1 
        4 1 1 1 1 18 CYS CB  .  18 CYSS CB  1 1 
        4 1 2 2 2  1 ZN  ZN  . 181 ZN   ZN  1 1 
        5 1 1 1 1 31 HIS NE2 .  31 HIS  NE2 1 1 
        5 1 2 2 2  1 ZN  ZN  . 181 ZN   ZN  1 1 
        6 1 1 1 1 35 HIS NE2 .  35 HIS  NE2 1 1 
        6 1 2 2 2  1 ZN  ZN  . 181 ZN   ZN  1 1 
        7 1 1 1 1 15 CYS SG  .  15 CYSS SG  1 1 
        7 1 2 1 1 18 CYS SG  .  18 CYSS SG  1 1 
        8 1 1 1 1 15 CYS SG  .  15 CYSS SG  1 1 
        8 1 2 1 1 31 HIS NE2 .  31 HIS  NE2 1 1 
        9 1 1 1 1 15 CYS SG  .  15 CYSS SG  1 1 
        9 1 2 1 1 35 HIS NE2 .  35 HIS  NE2 1 1 
       10 1 1 1 1 18 CYS SG  .  18 CYSS SG  1 1 
       10 1 2 1 1 31 HIS NE2 .  31 HIS  NE2 1 1 
       11 1 1 1 1 18 CYS SG  .  18 CYSS SG  1 1 
       11 1 2 1 1 35 HIS NE2 .  35 HIS  NE2 1 1 
       12 1 1 1 1 31 HIS NE2 .  31 HIS  NE2 1 1 
       12 1 2 1 1 35 HIS NE2 .  35 HIS  NE2 1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

        1 1 . . . . . . 2.19 2.39 1 1 
        2 1 . . . . . . 3.25 3.51 1 1 
        3 1 . . . . . . 2.19 2.39 1 1 
        4 1 . . . . . . 3.25 3.51 1 1 
        5 1 . . . . . .  1.9  2.1 1 1 
        6 1 . . . . . .  1.9  2.1 1 1 
        7 1 . . . . . . 3.56 3.96 1 1 
        8 1 . . . . . . 3.32 3.72 1 1 
        9 1 . . . . . . 3.32 3.72 1 1 
       10 1 . . . . . . 3.32 3.72 1 1 
       11 1 . . . . . . 3.32 3.72 1 1 
       12 1 . . . . . .  3.0  3.6 1 1 
    stop_

save_


save_DYANA/DIANA_distance_constraints_4_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  2
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

         1 1 . . . 1 2 
         2 1 . . . 1 2 
         3 1 . . . 1 2 
         4 1 . . . 1 2 
         5 1 . . . 1 2 
         6 1 . . . 1 2 
         7 1 . . . 1 2 
         8 1 . . . 1 2 
         9 1 . . . 1 2 
        10 1 . . . 1 2 
        11 1 . . . 1 2 
        12 1 . . . 1 2 
        13 1 . . . 1 2 
        14 1 . . . 1 2 
        15 1 . . . 1 2 
        16 1 . . . 1 2 
        17 1 . . . 1 2 
        18 1 . . . 1 2 
        19 1 . . . 1 2 
        20 1 . . . 1 2 
        21 1 . . . 1 2 
        22 1 . . . 1 2 
        23 1 . . . 1 2 
        24 1 . . . 1 2 
        25 1 . . . 1 2 
        26 1 . . . 1 2 
        27 1 . . . 1 2 
        28 1 . . . 1 2 
        29 1 . . . 1 2 
        30 1 . . . 1 2 
        31 1 . . . 1 2 
        32 1 . . . 1 2 
        33 1 . . . 1 2 
        34 1 . . . 1 2 
        35 1 . . . 1 2 
        36 1 . . . 1 2 
        37 1 . . . 1 2 
        38 1 . . . 1 2 
        39 1 . . . 1 2 
        40 1 . . . 1 2 
        41 1 . . . 1 2 
        42 1 . . . 1 2 
        43 1 . . . 1 2 
        44 1 . . . 1 2 
        45 1 . . . 1 2 
        46 1 . . . 1 2 
        47 1 . . . 1 2 
        48 1 . . . 1 2 
        49 1 . . . 1 2 
        50 1 . . . 1 2 
        51 1 . . . 1 2 
        52 1 . . . 1 2 
        53 1 . . . 1 2 
        54 1 . . . 1 2 
        55 1 . . . 1 2 
        56 1 . . . 1 2 
        57 1 . . . 1 2 
        58 1 . . . 1 2 
        59 1 . . . 1 2 
        60 1 . . . 1 2 
        61 1 . . . 1 2 
        62 1 . . . 1 2 
        63 1 . . . 1 2 
        64 1 . . . 1 2 
        65 1 . . . 1 2 
        66 1 . . . 1 2 
        67 1 . . . 1 2 
        68 1 . . . 1 2 
        69 1 . . . 1 2 
        70 1 . . . 1 2 
        71 1 . . . 1 2 
        72 1 . . . 1 2 
        73 1 . . . 1 2 
        74 1 . . . 1 2 
        75 1 . . . 1 2 
        76 1 . . . 1 2 
        77 1 . . . 1 2 
        78 1 . . . 1 2 
        79 1 . . . 1 2 
        80 1 . . . 1 2 
        81 1 . . . 1 2 
        82 1 . . . 1 2 
        83 1 . . . 1 2 
        84 1 . . . 1 2 
        85 1 . . . 1 2 
        86 1 . . . 1 2 
        87 1 . . . 1 2 
        88 1 . . . 1 2 
        89 1 . . . 1 2 
        90 1 . . . 1 2 
        91 1 . . . 1 2 
        92 1 . . . 1 2 
        93 1 . . . 1 2 
        94 1 . . . 1 2 
        95 1 . . . 1 2 
        96 1 . . . 1 2 
        97 1 . . . 1 2 
        98 1 . . . 1 2 
        99 1 . . . 1 2 
       100 1 . . . 1 2 
       101 1 . . . 1 2 
       102 1 . . . 1 2 
       103 1 . . . 1 2 
       104 1 . . . 1 2 
       105 1 . . . 1 2 
       106 1 . . . 1 2 
       107 1 . . . 1 2 
       108 1 . . . 1 2 
       109 1 . . . 1 2 
       110 1 . . . 1 2 
       111 1 . . . 1 2 
       112 1 . . . 1 2 
       113 1 . . . 1 2 
       114 1 . . . 1 2 
       115 1 . . . 1 2 
       116 1 . . . 1 2 
       117 1 . . . 1 2 
       118 1 . . . 1 2 
       119 1 . . . 1 2 
       120 1 . . . 1 2 
       121 1 . . . 1 2 
       122 1 . . . 1 2 
       123 1 . . . 1 2 
       124 1 . . . 1 2 
       125 1 . . . 1 2 
       126 1 . . . 1 2 
       127 1 . . . 1 2 
       128 1 . . . 1 2 
       129 1 . . . 1 2 
       130 1 . . . 1 2 
       131 1 . . . 1 2 
       132 1 . . . 1 2 
       133 1 . . . 1 2 
       134 1 . . . 1 2 
       135 1 . . . 1 2 
       136 1 . . . 1 2 
       137 1 . . . 1 2 
       138 1 . . . 1 2 
       139 1 . . . 1 2 
       140 1 . . . 1 2 
       141 1 . . . 1 2 
       142 1 . . . 1 2 
       143 1 . . . 1 2 
       144 1 . . . 1 2 
       145 1 . . . 1 2 
       146 1 . . . 1 2 
       147 1 . . . 1 2 
       148 1 . . . 1 2 
       149 1 . . . 1 2 
       150 1 . . . 1 2 
       151 1 . . . 1 2 
       152 1 . . . 1 2 
       153 1 . . . 1 2 
       154 1 . . . 1 2 
       155 1 . . . 1 2 
       156 1 . . . 1 2 
       157 1 . . . 1 2 
       158 1 . . . 1 2 
       159 1 . . . 1 2 
       160 1 . . . 1 2 
       161 1 . . . 1 2 
       162 1 . . . 1 2 
       163 1 . . . 1 2 
       164 1 . . . 1 2 
       165 1 . . . 1 2 
       166 1 . . . 1 2 
       167 1 . . . 1 2 
       168 1 . . . 1 2 
       169 1 . . . 1 2 
       170 1 . . . 1 2 
       171 1 . . . 1 2 
       172 1 . . . 1 2 
       173 1 . . . 1 2 
       174 1 . . . 1 2 
       175 1 . . . 1 2 
       176 1 . . . 1 2 
       177 1 . . . 1 2 
       178 1 . . . 1 2 
       179 1 . . . 1 2 
       180 1 . . . 1 2 
       181 1 . . . 1 2 
       182 1 . . . 1 2 
       183 1 . . . 1 2 
       184 1 . . . 1 2 
       185 1 . . . 1 2 
       186 1 . . . 1 2 
       187 1 . . . 1 2 
       188 1 . . . 1 2 
       189 1 . . . 1 2 
       190 1 . . . 1 2 
       191 1 . . . 1 2 
       192 1 . . . 1 2 
       193 1 . . . 1 2 
       194 1 . . . 1 2 
       195 1 . . . 1 2 
       196 1 . . . 1 2 
       197 1 . . . 1 2 
       198 1 . . . 1 2 
       199 1 . . . 1 2 
       200 1 . . . 1 2 
       201 1 . . . 1 2 
       202 1 . . . 1 2 
       203 1 . . . 1 2 
       204 1 . . . 1 2 
       205 1 . . . 1 2 
       206 1 . . . 1 2 
       207 1 . . . 1 2 
       208 1 . . . 1 2 
       209 1 . . . 1 2 
       210 1 . . . 1 2 
       211 1 . . . 1 2 
       212 1 . . . 1 2 
       213 1 . . . 1 2 
       214 1 . . . 1 2 
       215 1 . . . 1 2 
       216 1 . . . 1 2 
       217 1 . . . 1 2 
       218 1 . . . 1 2 
       219 1 . . . 1 2 
       220 1 . . . 1 2 
       221 1 . . . 1 2 
       222 1 . . . 1 2 
       223 1 . . . 1 2 
       224 1 . . . 1 2 
       225 1 . . . 1 2 
       226 1 . . . 1 2 
       227 1 . . . 1 2 
       228 1 . . . 1 2 
       229 1 . . . 1 2 
       230 1 . . . 1 2 
       231 1 . . . 1 2 
       232 1 . . . 1 2 
       233 1 . . . 1 2 
       234 1 . . . 1 2 
       235 1 . . . 1 2 
       236 1 . . . 1 2 
       237 1 . . . 1 2 
       238 1 . . . 1 2 
       239 1 . . . 1 2 
       240 1 . . . 1 2 
       241 1 . . . 1 2 
       242 1 . . . 1 2 
       243 1 . . . 1 2 
       244 1 . . . 1 2 
       245 1 . . . 1 2 
       246 1 . . . 1 2 
       247 1 . . . 1 2 
       248 1 . . . 1 2 
       249 1 . . . 1 2 
       250 1 . . . 1 2 
       251 1 . . . 1 2 
       252 1 . . . 1 2 
       253 1 . . . 1 2 
       254 1 . . . 1 2 
       255 1 . . . 1 2 
       256 1 . . . 1 2 
       257 1 . . . 1 2 
       258 1 . . . 1 2 
       259 1 . . . 1 2 
       260 1 . . . 1 2 
       261 1 . . . 1 2 
       262 1 . . . 1 2 
       263 1 . . . 1 2 
       264 1 . . . 1 2 
       265 1 . . . 1 2 
       266 1 . . . 1 2 
       267 1 . . . 1 2 
       268 1 . . . 1 2 
       269 1 . . . 1 2 
       270 1 . . . 1 2 
       271 1 . . . 1 2 
       272 1 . . . 1 2 
       273 1 . . . 1 2 
       274 1 . . . 1 2 
       275 1 . . . 1 2 
       276 1 . . . 1 2 
       277 1 . . . 1 2 
       278 1 . . . 1 2 
       279 1 . . . 1 2 
       280 1 . . . 1 2 
       281 1 . . . 1 2 
       282 1 . . . 1 2 
       283 1 . . . 1 2 
       284 1 . . . 1 2 
       285 1 . . . 1 2 
       286 1 . . . 1 2 
       287 1 . . . 1 2 
       288 1 . . . 1 2 
       289 1 . . . 1 2 
       290 1 . . . 1 2 
       291 1 . . . 1 2 
       292 1 . . . 1 2 
       293 1 . . . 1 2 
       294 1 . . . 1 2 
       295 1 . . . 1 2 
       296 1 . . . 1 2 
       297 1 . . . 1 2 
       298 1 . . . 1 2 
       299 1 . . . 1 2 
       300 1 . . . 1 2 
       301 1 . . . 1 2 
       302 1 . . . 1 2 
       303 1 . . . 1 2 
       304 1 . . . 1 2 
       305 1 . . . 1 2 
       306 1 . . . 1 2 
       307 1 . . . 1 2 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

         1 1 1 1 1 16 SER H    . 16 SER  HN   1 2 
         1 1 2 1 1 17 GLU H    . 17 GLU  HN   1 2 
         2 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
         2 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
         3 1 1 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
         3 1 2 1 1 29 THR H    . 29 THR  HN   1 2 
         4 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
         4 1 2 1 1 17 GLU HB2  . 17 GLU  HB2  1 2 
         5 1 1 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
         5 1 2 1 1 29 THR H    . 29 THR  HN   1 2 
         6 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
         6 1 2 1 1 17 GLU HB3  . 17 GLU  HB3  1 2 
         7 1 1 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
         7 1 2 1 1 29 THR H    . 29 THR  HN   1 2 
         8 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
         8 1 2 1 1 17 GLU HG3  . 17 GLU  HG3  1 2 
         9 1 1 1 1 32 TRP HB3  . 32 TRP  HB3  1 2 
         9 1 2 1 1 33 ILE H    . 33 ILE  HN   1 2 
        10 1 1 1 1 32 TRP H    . 32 TRP  HN   1 2 
        10 1 2 1 1 33 ILE H    . 33 ILE  HN   1 2 
        11 1 1 1 1 33 ILE H    . 33 ILE  HN   1 2 
        11 1 2 1 1 33 ILE HB   . 33 ILE  HB   1 2 
        12 1 1 1 1 33 ILE H    . 33 ILE  HN   1 2 
        12 1 2 1 1 33 ILE HG13 . 33 ILE  HG13 1 2 
        13 1 1 1 1 33 ILE H    . 33 ILE  HN   1 2 
        13 1 2 1 1 33 ILE HG12 . 33 ILE  HG12 1 2 
        14 1 1 1 1 20 LYS QD   . 20 LYS  QD   1 2 
        14 1 2 1 1 21 SER H    . 21 SER  HN   1 2 
        15 1 1 1 1 10 GLU HA   . 10 GLU  HA   1 2 
        15 1 2 1 1 11 LYS H    . 11 LYS  HN   1 2 
        16 1 1 1 1 11 LYS H    . 11 LYS  HN   1 2 
        16 1 2 1 1 11 LYS QB   . 11 LYS  QB   1 2 
        17 1 1 1 1 17 GLU HB2  . 17 GLU  HB2  1 2 
        17 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
        18 1 1 1 1 17 GLU HB3  . 17 GLU  HB3  1 2 
        18 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
        19 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
        19 1 2 1 1 20 LYS H    . 20 LYS  HN   1 2 
        20 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
        20 1 2 1 1 20 LYS H    . 20 LYS  HN   1 2 
        21 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
        21 1 2 1 1 20 LYS HB2  . 20 LYS  HB2  1 2 
        22 1 1 1 1 13 TYR HA   . 13 TYR  HA   1 2 
        22 1 2 1 1 14 GLN H    . 14 GLN  HN   1 2 
        23 1 1 1 1 36 THR HB   . 36 THR  HB   1 2 
        23 1 2 1 1 37 ARG H    . 37 ARG  HN   1 2 
        24 1 1 1 1 32 TRP H    . 32 TRP  HN   1 2 
        24 1 2 1 1 32 TRP HB3  . 32 TRP  HB3  1 2 
        25 1 1 1 1 13 TYR QB   . 13 TYR  QB   1 2 
        25 1 2 1 1 14 GLN H    . 14 GLN  HN   1 2 
        26 1 1 1 1 14 GLN H    . 14 GLN  HN   1 2 
        26 1 2 1 1 14 GLN QG   . 14 GLN  QG   1 2 
        27 1 1 1 1 14 GLN H    . 14 GLN  HN   1 2 
        27 1 2 1 1 14 GLN HB2  . 14 GLN  HB2  1 2 
        28 1 1 1 1 14 GLN H    . 14 GLN  HN   1 2 
        28 1 2 1 1 14 GLN HB3  . 14 GLN  HB3  1 2 
        29 1 1 1 1 37 ARG H    . 37 ARG  HN   1 2 
        29 1 2 1 1 37 ARG QG   . 37 ARG  QG   1 2 
        30 1 1 1 1 14 GLN H    . 14 GLN  HN   1 2 
        30 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
        31 1 1 1 1 36 THR H    . 36 THR  HN   1 2 
        31 1 2 1 1 36 THR MG   . 36 THR  QG2  1 2 
        32 1 1 1 1 14 GLN QG   . 14 GLN  QG   1 2 
        32 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
        33 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
        33 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
        34 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
        34 1 2 1 1 29 THR H    . 29 THR  HN   1 2 
        35 1 1 1 1 27 ARG H    . 27 ARG  HN   1 2 
        35 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
        36 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
        36 1 2 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
        37 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
        37 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
        38 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
        38 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
        39 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
        39 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
        40 1 1 1 1 13 TYR QB   . 13 TYR  QB   1 2 
        40 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
        41 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
        41 1 2 1 1 32 TRP HE1  . 32 TRP  HE1  1 2 
        42 1 1 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
        42 1 2 1 1 32 TRP HE1  . 32 TRP  HE1  1 2 
        43 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
        43 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
        44 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
        44 1 2 1 1 21 SER HA   . 21 SER  HA   1 2 
        45 1 1 1 1 14 GLN HA   . 14 GLN  HA   1 2 
        45 1 2 1 1 15 CYS H    . 15 CYSS HN   1 2 
        46 1 1 1 1 14 GLN QG   . 14 GLN  QG   1 2 
        46 1 2 1 1 15 CYS H    . 15 CYSS HN   1 2 
        47 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
        47 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
        48 1 1 1 1 33 ILE H    . 33 ILE  HN   1 2 
        48 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
        49 1 1 1 1 12 PRO HA   . 12 PRO  HA   1 2 
        49 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
        50 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
        50 1 2 1 1 13 TYR QB   . 13 TYR  QB   1 2 
        51 1 1 1 1 12 PRO HB3  . 12 PRO  HB3  1 2 
        51 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
        52 1 1 1 1 33 ILE HB   . 33 ILE  HB   1 2 
        52 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
        53 1 1 1 1 12 PRO HG2  . 12 PRO  HG2  1 2 
        53 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
        54 1 1 1 1 34 THR H    . 34 THR  HN   1 2 
        54 1 2 1 1 37 ARG QG   . 37 ARG  QG   1 2 
        55 1 1 1 1 34 THR H    . 34 THR  HN   1 2 
        55 1 2 1 1 34 THR MG   . 34 THR  QG2  1 2 
        56 1 1 1 1 22 PHE H    . 22 PHE  HN   1 2 
        56 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
        57 1 1 1 1 21 SER HA   . 21 SER  HA   1 2 
        57 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
        58 1 1 1 1 13 TYR QB   . 13 TYR  QB   1 2 
        58 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
        59 1 1 1 1 14 GLN HA   . 14 GLN  HA   1 2 
        59 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
        60 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
        60 1 2 1 1 32 TRP H    . 32 TRP  HN   1 2 
        61 1 1 1 1 29 THR H    . 29 THR  HN   1 2 
        61 1 2 1 1 30 GLN H    . 30 GLN  HN   1 2 
        62 1 1 1 1 30 GLN H    . 30 GLN  HN   1 2 
        62 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        63 1 1 1 1 29 THR HB   . 29 THR  HB   1 2 
        63 1 2 1 1 30 GLN H    . 30 GLN  HN   1 2 
        64 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
        64 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        65 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
        65 1 2 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
        66 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
        66 1 2 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
        67 1 1 1 1 35 HIS H    . 35 HIS  HN   1 2 
        67 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
        68 1 1 1 1 35 HIS H    . 35 HIS  HN   1 2 
        68 1 2 1 1 36 THR H    . 36 THR  HN   1 2 
        69 1 1 1 1 34 THR H    . 34 THR  HN   1 2 
        69 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
        70 1 1 1 1 35 HIS H    . 35 HIS  HN   1 2 
        70 1 2 1 1 35 HIS HB2  . 35 HIS  HB2  1 2 
        71 1 1 1 1 35 HIS H    . 35 HIS  HN   1 2 
        71 1 2 1 1 35 HIS HB3  . 35 HIS  HB3  1 2 
        72 1 1 1 1 34 THR MG   . 34 THR  QG2  1 2 
        72 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
        73 1 1 1 1 27 ARG H    . 27 ARG  HN   1 2 
        73 1 2 1 1 27 ARG QD   . 27 ARG  QD   1 2 
        74 1 1 1 1 26 TYR HB3  . 26 TYR  HB3  1 2 
        74 1 2 1 1 27 ARG H    . 27 ARG  HN   1 2 
        75 1 1 1 1 26 TYR HB2  . 26 TYR  HB2  1 2 
        75 1 2 1 1 27 ARG H    . 27 ARG  HN   1 2 
        76 1 1 1 1 27 ARG H    . 27 ARG  HN   1 2 
        76 1 2 1 1 27 ARG QB   . 27 ARG  QB   1 2 
        77 1 1 1 1 24 GLY H    . 24 GLY  HN   1 2 
        77 1 2 1 1 27 ARG QB   . 27 ARG  QB   1 2 
        78 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
        78 1 2 1 1 24 GLY H    . 24 GLY  HN   1 2 
        79 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
        79 1 2 1 1 24 GLY H    . 24 GLY  HN   1 2 
        80 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
        80 1 2 1 1 24 GLY H    . 24 GLY  HN   1 2 
        81 1 1 1 1 21 SER HA   . 21 SER  HA   1 2 
        81 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
        82 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
        82 1 2 1 1 28 LEU HA   . 28 LEU  HA   1 2 
        83 1 1 1 1 13 TYR QB   . 13 TYR  QB   1 2 
        83 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
        84 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
        84 1 2 1 1 27 ARG QB   . 27 ARG  QB   1 2 
        85 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
        85 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
        86 1 1 1 1 14 GLN QG   . 14 GLN  QG   1 2 
        86 1 2 1 1 19 GLY HA2  . 19 GLY  HA1  1 2 
        87 1 1 1 1 29 THR HA   . 29 THR  HA   1 2 
        87 1 2 1 1 32 TRP H    . 32 TRP  HN   1 2 
        88 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
        88 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
        89 1 1 1 1 22 PHE QE   . 22 PHE  QE   1 2 
        89 1 2 1 1 28 LEU HA   . 28 LEU  HA   1 2 
        90 1 1 1 1 29 THR HA   . 29 THR  HA   1 2 
        90 1 2 1 1 32 TRP HB3  . 32 TRP  HB3  1 2 
        91 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
        91 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
        92 1 1 1 1 20 LYS HB2  . 20 LYS  HB2  1 2 
        92 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
        93 1 1 1 1 22 PHE QE   . 22 PHE  QE   1 2 
        93 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
        94 1 1 1 1 21 SER QB   . 21 SER  QB   1 2 
        94 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
        95 1 1 1 1 21 SER H    . 21 SER  HN   1 2 
        95 1 2 1 1 21 SER QB   . 21 SER  QB   1 2 
        96 1 1 1 1 14 GLN HA   . 14 GLN  HA   1 2 
        96 1 2 1 1 21 SER QB   . 21 SER  QB   1 2 
        97 1 1 1 1 20 LYS HA   . 20 LYS  HA   1 2 
        97 1 2 1 1 21 SER QB   . 21 SER  QB   1 2 
        98 1 1 1 1 14 GLN QG   . 14 GLN  QG   1 2 
        98 1 2 1 1 21 SER QB   . 21 SER  QB   1 2 
        99 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
        99 1 2 1 1 27 ARG QB   . 27 ARG  QB   1 2 
       100 1 1 1 1 11 LYS QB   . 11 LYS  QB   1 2 
       100 1 2 1 1 21 SER QB   . 21 SER  QB   1 2 
       101 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       101 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       102 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       102 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       103 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       103 1 2 1 1 27 ARG QB   . 27 ARG  QB   1 2 
       104 1 1 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       104 1 2 1 1 31 HIS HE1  . 31 HIS  HE1  1 2 
       105 1 1 1 1 37 ARG HA   . 37 ARG  HA   1 2 
       105 1 2 1 1 37 ARG QD   . 37 ARG  QD   1 2 
       106 1 1 1 1 20 LYS QD   . 20 LYS  QD   1 2 
       106 1 2 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       107 1 1 1 1 20 LYS HB3  . 20 LYS  HB3  1 2 
       107 1 2 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       108 1 1 1 1 29 THR H    . 29 THR  HN   1 2 
       108 1 2 1 1 29 THR MG   . 29 THR  QG2  1 2 
       109 1 1 1 1 29 THR MG   . 29 THR  QG2  1 2 
       109 1 2 1 1 30 GLN H    . 30 GLN  HN   1 2 
       110 1 1 1 1 27 ARG HA   . 27 ARG  HA   1 2 
       110 1 2 1 1 27 ARG QD   . 27 ARG  QD   1 2 
       111 1 1 1 1 29 THR HA   . 29 THR  HA   1 2 
       111 1 2 1 1 29 THR MG   . 29 THR  QG2  1 2 
       112 1 1 1 1 27 ARG QB   . 27 ARG  QB   1 2 
       112 1 2 1 1 27 ARG QD   . 27 ARG  QD   1 2 
       113 1 1 1 1 34 THR HA   . 34 THR  HA   1 2 
       113 1 2 1 1 37 ARG QG   . 37 ARG  QG   1 2 
       114 1 1 1 1 34 THR HA   . 34 THR  HA   1 2 
       114 1 2 1 1 34 THR MG   . 34 THR  QG2  1 2 
       115 1 1 1 1 36 THR HA   . 36 THR  HA   1 2 
       115 1 2 1 1 36 THR MG   . 36 THR  QG2  1 2 
       116 1 1 1 1 33 ILE HA   . 33 ILE  HA   1 2 
       116 1 2 1 1 33 ILE HG13 . 33 ILE  HG13 1 2 
       117 1 1 1 1 33 ILE HA   . 33 ILE  HA   1 2 
       117 1 2 1 1 33 ILE HG12 . 33 ILE  HG12 1 2 
       118 1 1 1 1 33 ILE HA   . 33 ILE  HA   1 2 
       118 1 2 1 1 33 ILE MG   . 33 ILE  QG2  1 2 
       119 1 1 1 1 33 ILE H    . 33 ILE  HN   1 2 
       119 1 2 1 1 34 THR MG   . 34 THR  QG2  1 2 
       120 1 1 1 1 33 ILE HB   . 33 ILE  HB   1 2 
       120 1 2 1 1 34 THR MG   . 34 THR  QG2  1 2 
       121 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       121 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       122 1 1 1 1 32 TRP HE3  . 32 TRP  HE3  1 2 
       122 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       123 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       123 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       124 1 1 1 1 17 GLU HB2  . 17 GLU  HB2  1 2 
       124 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       125 1 1 1 1 17 GLU HB3  . 17 GLU  HB3  1 2 
       125 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       126 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       126 1 2 1 1 25 SER HB3  . 25 SER  HB3  1 2 
       127 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       127 1 2 1 1 25 SER HB2  . 25 SER  HB2  1 2 
       128 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       128 1 2 1 1 32 TRP HD1  . 32 TRP  HD1  1 2 
       129 1 1 1 1 32 TRP HD1  . 32 TRP  HD1  1 2 
       129 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       130 1 1 1 1 32 TRP HA   . 32 TRP  HA   1 2 
       130 1 2 1 1 32 TRP HD1  . 32 TRP  HD1  1 2 
       131 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       131 1 2 1 1 32 TRP HD1  . 32 TRP  HD1  1 2 
       132 1 1 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       132 1 2 1 1 32 TRP HD1  . 32 TRP  HD1  1 2 
       133 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       133 1 2 1 1 32 TRP HD1  . 32 TRP  HD1  1 2 
       134 1 1 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       134 1 2 1 1 32 TRP HD1  . 32 TRP  HD1  1 2 
       135 1 1 1 1 26 TYR HA   . 26 TYR  HA   1 2 
       135 1 2 1 1 29 THR MG   . 29 THR  QG2  1 2 
       136 1 1 1 1 26 TYR HA   . 26 TYR  HA   1 2 
       136 1 2 1 1 29 THR H    . 29 THR  HN   1 2 
       137 1 1 1 1 32 TRP HA   . 32 TRP  HA   1 2 
       137 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
       138 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       138 1 2 1 1 32 TRP HA   . 32 TRP  HA   1 2 
       139 1 1 1 1 32 TRP HA   . 32 TRP  HA   1 2 
       139 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       140 1 1 1 1 25 SER HA   . 25 SER  HA   1 2 
       140 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       141 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       141 1 2 1 1 25 SER HA   . 25 SER  HA   1 2 
       142 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       142 1 2 1 1 25 SER HA   . 25 SER  HA   1 2 
       143 1 1 1 1 13 TYR QB   . 13 TYR  QB   1 2 
       143 1 2 1 1 25 SER HA   . 25 SER  HA   1 2 
       144 1 1 1 1 25 SER HA   . 25 SER  HA   1 2 
       144 1 2 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       145 1 1 1 1 25 SER HA   . 25 SER  HA   1 2 
       145 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       146 1 1 1 1 25 SER HA   . 25 SER  HA   1 2 
       146 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       147 1 1 1 1 12 PRO HG2  . 12 PRO  HG2  1 2 
       147 1 2 1 1 13 TYR QB   . 13 TYR  QB   1 2 
       148 1 1 1 1 13 TYR QB   . 13 TYR  QB   1 2 
       148 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       149 1 1 1 1 33 ILE MG   . 33 ILE  QG2  1 2 
       149 1 2 1 1 37 ARG QD   . 37 ARG  QD   1 2 
       150 1 1 1 1 33 ILE MG   . 33 ILE  QG2  1 2 
       150 1 2 1 1 37 ARG QG   . 37 ARG  QG   1 2 
       151 1 1 1 1 33 ILE MG   . 33 ILE  QG2  1 2 
       151 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
       152 1 1 1 1 33 ILE H    . 33 ILE  HN   1 2 
       152 1 2 1 1 33 ILE MG   . 33 ILE  QG2  1 2 
       153 1 1 1 1 33 ILE MG   . 33 ILE  QG2  1 2 
       153 1 2 1 1 34 THR HA   . 34 THR  HA   1 2 
       154 1 1 1 1 18 CYS HA   . 18 CYSS HA   1 2 
       154 1 2 1 1 35 HIS HE1  . 35 HIS  HE1  1 2 
       155 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       155 1 2 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
       156 1 1 1 1 30 GLN HA   . 30 GLN  HA   1 2 
       156 1 2 1 1 30 GLN HG3  . 30 GLN  HG3  1 2 
       157 1 1 1 1 20 LYS HA   . 20 LYS  HA   1 2 
       157 1 2 1 1 21 SER H    . 21 SER  HN   1 2 
       158 1 1 1 1 20 LYS HA   . 20 LYS  HA   1 2 
       158 1 2 1 1 20 LYS HG2  . 20 LYS  HG2  1 2 
       159 1 1 1 1 20 LYS HA   . 20 LYS  HA   1 2 
       159 1 2 1 1 20 LYS QD   . 20 LYS  QD   1 2 
       160 1 1 1 1 20 LYS HA   . 20 LYS  HA   1 2 
       160 1 2 1 1 20 LYS HG3  . 20 LYS  HG3  1 2 
       161 1 1 1 1 10 GLU H    . 10 GLU  HN   1 2 
       161 1 2 1 1 10 GLU HG2  . 10 GLU  HG2  1 2 
       162 1 1 1 1 10 GLU H    . 10 GLU  HN   1 2 
       162 1 2 1 1 10 GLU HG3  . 10 GLU  HG3  1 2 
       163 1 1 1 1 14 GLN HA   . 14 GLN  HA   1 2 
       163 1 2 1 1 21 SER HA   . 21 SER  HA   1 2 
       164 1 1 1 1 14 GLN QG   . 14 GLN  QG   1 2 
       164 1 2 1 1 21 SER HA   . 21 SER  HA   1 2 
       165 1 1 1 1 13 TYR HA   . 13 TYR  HA   1 2 
       165 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       166 1 1 1 1 32 TRP HA   . 32 TRP  HA   1 2 
       166 1 2 1 1 32 TRP HE3  . 32 TRP  HE3  1 2 
       167 1 1 1 1 29 THR HA   . 29 THR  HA   1 2 
       167 1 2 1 1 32 TRP HE3  . 32 TRP  HE3  1 2 
       168 1 1 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       168 1 2 1 1 32 TRP HE3  . 32 TRP  HE3  1 2 
       169 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       169 1 2 1 1 17 GLU HG2  . 17 GLU  HG2  1 2 
       170 1 1 1 1 10 GLU HA   . 10 GLU  HA   1 2 
       170 1 2 1 1 11 LYS QB   . 11 LYS  QB   1 2 
       171 1 1 1 1 37 ARG HA   . 37 ARG  HA   1 2 
       171 1 2 1 1 37 ARG QG   . 37 ARG  QG   1 2 
       172 1 1 1 1 33 ILE H    . 33 ILE  HN   1 2 
       172 1 2 1 1 33 ILE MD   . 33 ILE  QD1  1 2 
       173 1 1 1 1 30 GLN HA   . 30 GLN  HA   1 2 
       173 1 2 1 1 33 ILE MD   . 33 ILE  QD1  1 2 
       174 1 1 1 1 33 ILE HB   . 33 ILE  HB   1 2 
       174 1 2 1 1 33 ILE MD   . 33 ILE  QD1  1 2 
       175 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       175 1 2 1 1 20 LYS HB3  . 20 LYS  HB3  1 2 
       176 1 1 1 1 20 LYS HB3  . 20 LYS  HB3  1 2 
       176 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       177 1 1 1 1 20 LYS HB2  . 20 LYS  HB2  1 2 
       177 1 2 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       178 1 1 1 1 14 GLN HA   . 14 GLN  HA   1 2 
       178 1 2 1 1 14 GLN QG   . 14 GLN  QG   1 2 
       179 1 1 1 1 14 GLN QG   . 14 GLN  QG   1 2 
       179 1 2 1 1 19 GLY HA3  . 19 GLY  HA2  1 2 
       180 1 1 1 1 30 GLN HA   . 30 GLN  HA   1 2 
       180 1 2 1 1 30 GLN HG2  . 30 GLN  HG2  1 2 
       181 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       181 1 2 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       182 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       182 1 2 1 1 25 SER HB3  . 25 SER  HB3  1 2 
       183 1 1 1 1 18 CYS HB2  . 18 CYSS HB2  1 2 
       183 1 2 1 1 35 HIS HE1  . 35 HIS  HE1  1 2 
       184 1 1 1 1 12 PRO HG2  . 12 PRO  HG2  1 2 
       184 1 2 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       185 1 1 1 1 12 PRO HG3  . 12 PRO  HG3  1 2 
       185 1 2 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       186 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       186 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       187 1 1 1 1 26 TYR QE   . 26 TYR  QE   1 2 
       187 1 2 1 1 30 GLN HG2  . 30 GLN  HG2  1 2 
       188 1 1 1 1 26 TYR QE   . 26 TYR  QE   1 2 
       188 1 2 1 1 30 GLN HG3  . 30 GLN  HG3  1 2 
       189 1 1 1 1 20 LYS QD   . 20 LYS  QD   1 2 
       189 1 2 1 1 31 HIS HE1  . 31 HIS  HE1  1 2 
       190 1 1 1 1 18 CYS HB3  . 18 CYSS HB3  1 2 
       190 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       191 1 1 1 1 18 CYS HB2  . 18 CYSS HB2  1 2 
       191 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       192 1 1 1 1 18 CYS HB3  . 18 CYSS HB3  1 2 
       192 1 2 1 1 35 HIS HE1  . 35 HIS  HE1  1 2 
       193 1 1 1 1 12 PRO HB2  . 12 PRO  HB2  1 2 
       193 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       194 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       194 1 2 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       195 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       195 1 2 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       196 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       196 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       197 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       197 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       198 1 1 1 1 14 GLN HA   . 14 GLN  HA   1 2 
       198 1 2 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       199 1 1 1 1 14 GLN HA   . 14 GLN  HA   1 2 
       199 1 2 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       200 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       200 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       201 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       201 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       202 1 1 1 1 27 ARG QB   . 27 ARG  QB   1 2 
       202 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       203 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       203 1 2 1 1 32 TRP HZ2  . 32 TRP  HZ2  1 2 
       204 1 1 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       204 1 2 1 1 32 TRP HZ2  . 32 TRP  HZ2  1 2 
       205 1 1 1 1 39 LYS HA   . 39 LYS  HA   1 2 
       205 1 2 1 1 40 PRO HD2  . 40 PRO  HD2  1 2 
       206 1 1 1 1 39 LYS HA   . 39 LYS  HA   1 2 
       206 1 2 1 1 40 PRO HD3  . 40 PRO  HD3  1 2 
       207 1 1 1 1 32 TRP H    . 32 TRP  HN   1 2 
       207 1 2 1 1 32 TRP HB2  . 32 TRP  HB2  1 2 
       208 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       208 1 2 1 1 20 LYS QD   . 20 LYS  QD   1 2 
       209 1 1 1 1 32 TRP HB2  . 32 TRP  HB2  1 2 
       209 1 2 1 1 33 ILE H    . 33 ILE  HN   1 2 
       210 1 1 1 1 29 THR HA   . 29 THR  HA   1 2 
       210 1 2 1 1 32 TRP HB2  . 32 TRP  HB2  1 2 
       211 1 1 1 1 11 LYS HA   . 11 LYS  HA   1 2 
       211 1 2 1 1 12 PRO HD2  . 12 PRO  HD2  1 2 
       212 1 1 1 1 11 LYS HA   . 11 LYS  HA   1 2 
       212 1 2 1 1 12 PRO HD3  . 12 PRO  HD3  1 2 
       213 1 1 1 1 11 LYS QB   . 11 LYS  QB   1 2 
       213 1 2 1 1 12 PRO HD2  . 12 PRO  HD2  1 2 
       214 1 1 1 1 11 LYS QB   . 11 LYS  QB   1 2 
       214 1 2 1 1 12 PRO HD3  . 12 PRO  HD3  1 2 
       215 1 1 1 1 27 ARG H    . 27 ARG  HN   1 2 
       215 1 2 1 1 27 ARG HG3  . 27 ARG  HG3  1 2 
       216 1 1 1 1 27 ARG H    . 27 ARG  HN   1 2 
       216 1 2 1 1 27 ARG HG2  . 27 ARG  HG2  1 2 
       217 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       217 1 2 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
       218 1 1 1 1 12 PRO HG3  . 12 PRO  HG3  1 2 
       218 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       219 1 1 1 1 11 LYS HA   . 11 LYS  HA   1 2 
       219 1 2 1 1 12 PRO HG2  . 12 PRO  HG2  1 2 
       220 1 1 1 1 12 PRO HG2  . 12 PRO  HG2  1 2 
       220 1 2 1 1 13 TYR HA   . 13 TYR  HA   1 2 
       221 1 1 1 1 11 LYS HA   . 11 LYS  HA   1 2 
       221 1 2 1 1 12 PRO HG3  . 12 PRO  HG3  1 2 
       222 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       222 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       223 1 1 1 1 34 THR HB   . 34 THR  HB   1 2 
       223 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
       224 1 1 1 1 13 TYR HA   . 13 TYR  HA   1 2 
       224 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       225 1 1 1 1 26 TYR HA   . 26 TYR  HA   1 2 
       225 1 2 1 1 26 TYR QD   . 26 TYR  QD   1 2 
       226 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       226 1 2 1 1 25 SER HB2  . 25 SER  HB2  1 2 
       227 1 1 1 1 12 PRO HG2  . 12 PRO  HG2  1 2 
       227 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       228 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       228 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       229 1 1 1 1 14 GLN H    . 14 GLN  HN   1 2 
       229 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       230 1 1 1 1 13 TYR HA   . 13 TYR  HA   1 2 
       230 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       231 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       231 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       232 1 1 1 1 13 TYR QB   . 13 TYR  QB   1 2 
       232 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       233 1 1 1 1 29 THR H    . 29 THR  HN   1 2 
       233 1 2 1 1 29 THR HB   . 29 THR  HB   1 2 
       234 1 1 1 1 27 ARG HA   . 27 ARG  HA   1 2 
       234 1 2 1 1 27 ARG HG3  . 27 ARG  HG3  1 2 
       235 1 1 1 1 27 ARG HA   . 27 ARG  HA   1 2 
       235 1 2 1 1 27 ARG HG2  . 27 ARG  HG2  1 2 
       236 1 1 1 1 10 GLU H    . 10 GLU  HN   1 2 
       236 1 2 1 1 10 GLU QG   . 10 GLU  QG   1 2 
       237 1 1 1 1 11 LYS QB   . 11 LYS  QB   1 2 
       237 1 2 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       238 1 1 1 1 11 LYS QG   . 11 LYS  QG   1 2 
       238 1 2 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       239 1 1 1 1 12 PRO QB   . 12 PRO  QB   1 2 
       239 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       240 1 1 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       240 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       241 1 1 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       241 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       242 1 1 1 1 13 TYR QB   . 13 TYR  QB   1 2 
       242 1 2 1 1 22 PHE QB   . 22 PHE  QB   1 2 
       243 1 1 1 1 13 TYR QB   . 13 TYR  QB   1 2 
       243 1 2 1 1 28 LEU QB   . 28 LEU  QB   1 2 
       244 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       244 1 2 1 1 24 GLY QA   . 24 GLY  QA   1 2 
       245 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       245 1 2 1 1 24 GLY QA   . 24 GLY  QA   1 2 
       246 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       246 1 2 1 1 25 SER QB   . 25 SER  QB   1 2 
       247 1 1 1 1 14 GLN HA   . 14 GLN  HA   1 2 
       247 1 2 1 1 15 CYS QB   . 15 CYSS QB   1 2 
       248 1 1 1 1 14 GLN QB   . 14 GLN  QB   1 2 
       248 1 2 1 1 21 SER QB   . 21 SER  QB   1 2 
       249 1 1 1 1 14 GLN QG   . 14 GLN  QG   1 2 
       249 1 2 1 1 19 GLY QA   . 19 GLY  QA   1 2 
       250 1 1 1 1 14 GLN QE   . 14 GLN  QE2  1 2 
       250 1 2 1 1 19 GLY QA   . 19 GLY  QA   1 2 
       251 1 1 1 1 15 CYS QB   . 15 CYSS QB   1 2 
       251 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       252 1 1 1 1 15 CYS QB   . 15 CYSS QB   1 2 
       252 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       253 1 1 1 1 15 CYS QB   . 15 CYSS QB   1 2 
       253 1 2 1 1 20 LYS H    . 20 LYS  HN   1 2 
       254 1 1 1 1 15 CYS QB   . 15 CYSS QB   1 2 
       254 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       255 1 1 1 1 15 CYS QB   . 15 CYSS QB   1 2 
       255 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       256 1 1 1 1 15 CYS QB   . 15 CYSS QB   1 2 
       256 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       257 1 1 1 1 15 CYS QB   . 15 CYSS QB   1 2 
       257 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       258 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       258 1 2 1 1 17 GLU QG   . 17 GLU  QG   1 2 
       259 1 1 1 1 17 GLU HA   . 17 GLU  HA   1 2 
       259 1 2 1 1 17 GLU QG   . 17 GLU  QG   1 2 
       260 1 1 1 1 17 GLU QB   . 17 GLU  QB   1 2 
       260 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       261 1 1 1 1 18 CYS H    . 18 CYSS HN   1 2 
       261 1 2 1 1 18 CYS QB   . 18 CYSS QB   1 2 
       262 1 1 1 1 18 CYS QB   . 18 CYSS QB   1 2 
       262 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       263 1 1 1 1 18 CYS QB   . 18 CYSS QB   1 2 
       263 1 2 1 1 35 HIS HE1  . 35 HIS  HE1  1 2 
       264 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       264 1 2 1 1 20 LYS QB   . 20 LYS  QB   1 2 
       265 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       265 1 2 1 1 20 LYS QG   . 20 LYS  QG   1 2 
       266 1 1 1 1 20 LYS HA   . 20 LYS  HA   1 2 
       266 1 2 1 1 20 LYS QG   . 20 LYS  QG   1 2 
       267 1 1 1 1 20 LYS QB   . 20 LYS  QB   1 2 
       267 1 2 1 1 21 SER H    . 21 SER  HN   1 2 
       268 1 1 1 1 20 LYS QB   . 20 LYS  QB   1 2 
       268 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       269 1 1 1 1 20 LYS QB   . 20 LYS  QB   1 2 
       269 1 2 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       270 1 1 1 1 20 LYS QG   . 20 LYS  QG   1 2 
       270 1 2 1 1 21 SER H    . 21 SER  HN   1 2 
       271 1 1 1 1 20 LYS QG   . 20 LYS  QG   1 2 
       271 1 2 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       272 1 1 1 1 22 PHE H    . 22 PHE  HN   1 2 
       272 1 2 1 1 22 PHE QB   . 22 PHE  QB   1 2 
       273 1 1 1 1 22 PHE QB   . 22 PHE  QB   1 2 
       273 1 2 1 1 24 GLY H    . 24 GLY  HN   1 2 
       274 1 1 1 1 22 PHE QB   . 22 PHE  QB   1 2 
       274 1 2 1 1 27 ARG QB   . 27 ARG  QB   1 2 
       275 1 1 1 1 22 PHE QB   . 22 PHE  QB   1 2 
       275 1 2 1 1 28 LEU QB   . 28 LEU  QB   1 2 
       276 1 1 1 1 22 PHE QB   . 22 PHE  QB   1 2 
       276 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       277 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       277 1 2 1 1 28 LEU QB   . 28 LEU  QB   1 2 
       278 1 1 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       278 1 2 1 1 31 HIS QB   . 31 HIS  QB   1 2 
       279 1 1 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       279 1 2 1 1 31 HIS QB   . 31 HIS  QB   1 2 
       280 1 1 1 1 23 SER QB   . 23 SER  QB   1 2 
       280 1 2 1 1 24 GLY H    . 24 GLY  HN   1 2 
       281 1 1 1 1 25 SER HA   . 25 SER  HA   1 2 
       281 1 2 1 1 28 LEU QB   . 28 LEU  QB   1 2 
       282 1 1 1 1 26 TYR QB   . 26 TYR  QB   1 2 
       282 1 2 1 1 27 ARG H    . 27 ARG  HN   1 2 
       283 1 1 1 1 27 ARG H    . 27 ARG  HN   1 2 
       283 1 2 1 1 27 ARG QG   . 27 ARG  QG   1 2 
       284 1 1 1 1 27 ARG HA   . 27 ARG  HA   1 2 
       284 1 2 1 1 27 ARG QG   . 27 ARG  QG   1 2 
       285 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
       285 1 2 1 1 28 LEU QB   . 28 LEU  QB   1 2 
       286 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       286 1 2 1 1 31 HIS QB   . 31 HIS  QB   1 2 
       287 1 1 1 1 28 LEU QB   . 28 LEU  QB   1 2 
       287 1 2 1 1 29 THR H    . 29 THR  HN   1 2 
       288 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       288 1 2 1 1 31 HIS QB   . 31 HIS  QB   1 2 
       289 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       289 1 2 1 1 32 TRP QB   . 32 TRP  QB   1 2 
       290 1 1 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       290 1 2 1 1 32 TRP QB   . 32 TRP  QB   1 2 
       291 1 1 1 1 29 THR HA   . 29 THR  HA   1 2 
       291 1 2 1 1 32 TRP QB   . 32 TRP  QB   1 2 
       292 1 1 1 1 30 GLN H    . 30 GLN  HN   1 2 
       292 1 2 1 1 30 GLN QB   . 30 GLN  QB   1 2 
       293 1 1 1 1 30 GLN H    . 30 GLN  HN   1 2 
       293 1 2 1 1 30 GLN QG   . 30 GLN  QG   1 2 
       294 1 1 1 1 30 GLN HA   . 30 GLN  HA   1 2 
       294 1 2 1 1 30 GLN QG   . 30 GLN  QG   1 2 
       295 1 1 1 1 30 GLN QB   . 30 GLN  QB   1 2 
       295 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
       296 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
       296 1 2 1 1 31 HIS QB   . 31 HIS  QB   1 2 
       297 1 1 1 1 31 HIS QB   . 31 HIS  QB   1 2 
       297 1 2 1 1 32 TRP H    . 32 TRP  HN   1 2 
       298 1 1 1 1 32 TRP H    . 32 TRP  HN   1 2 
       298 1 2 1 1 32 TRP QB   . 32 TRP  QB   1 2 
       299 1 1 1 1 32 TRP HA   . 32 TRP  HA   1 2 
       299 1 2 1 1 35 HIS QB   . 35 HIS  QB   1 2 
       300 1 1 1 1 32 TRP QB   . 32 TRP  QB   1 2 
       300 1 2 1 1 32 TRP HE3  . 32 TRP  HE3  1 2 
       301 1 1 1 1 32 TRP QB   . 32 TRP  QB   1 2 
       301 1 2 1 1 33 ILE H    . 33 ILE  HN   1 2 
       302 1 1 1 1 33 ILE H    . 33 ILE  HN   1 2 
       302 1 2 1 1 33 ILE QG   . 33 ILE  QG1  1 2 
       303 1 1 1 1 33 ILE HA   . 33 ILE  HA   1 2 
       303 1 2 1 1 33 ILE QG   . 33 ILE  QG1  1 2 
       304 1 1 1 1 33 ILE QG   . 33 ILE  QG1  1 2 
       304 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
       305 1 1 1 1 35 HIS H    . 35 HIS  HN   1 2 
       305 1 2 1 1 35 HIS QB   . 35 HIS  QB   1 2 
       306 1 1 1 1 39 LYS HA   . 39 LYS  HA   1 2 
       306 1 2 1 1 40 PRO QD   . 40 PRO  QD   1 2 
       307 1 1 1 1 39 LYS QB   . 39 LYS  QB   1 2 
       307 1 2 1 1 40 PRO QD   . 40 PRO  QD   1 2 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

         1 1 . . . . . . . 4.48 1 2 
         2 1 . . . . . . . 3.45 1 2 
         3 1 . . . . . . . 4.46 1 2 
         4 1 . . . . . . .  3.7 1 2 
         5 1 . . . . . . . 4.46 1 2 
         6 1 . . . . . . .  3.7 1 2 
         7 1 . . . . . . . 4.74 1 2 
         8 1 . . . . . . . 4.61 1 2 
         9 1 . . . . . . . 4.53 1 2 
        10 1 . . . . . . . 4.04 1 2 
        11 1 . . . . . . . 3.47 1 2 
        12 1 . . . . . . . 3.89 1 2 
        13 1 . . . . . . . 3.89 1 2 
        14 1 . . . . . . .  5.5 1 2 
        15 1 . . . . . . . 3.31 1 2 
        16 1 . . . . . . . 3.75 1 2 
        17 1 . . . . . . . 4.09 1 2 
        18 1 . . . . . . . 4.09 1 2 
        19 1 . . . . . . . 4.31 1 2 
        20 1 . . . . . . . 4.31 1 2 
        21 1 . . . . . . . 3.94 1 2 
        22 1 . . . . . . . 3.19 1 2 
        23 1 . . . . . . . 4.34 1 2 
        24 1 . . . . . . . 3.79 1 2 
        25 1 . . . . . . . 4.22 1 2 
        26 1 . . . . . . . 4.39 1 2 
        27 1 . . . . . . . 3.89 1 2 
        28 1 . . . . . . . 3.89 1 2 
        29 1 . . . . . . . 4.53 1 2 
        30 1 . . . . . . . 4.51 1 2 
        31 1 . . . . . . . 4.34 1 2 
        32 1 . . . . . . . 4.93 1 2 
        33 1 . . . . . . . 4.66 1 2 
        34 1 . . . . . . . 3.69 1 2 
        35 1 . . . . . . . 3.96 1 2 
        36 1 . . . . . . . 3.68 1 2 
        37 1 . . . . . . . 3.68 1 2 
        38 1 . . . . . . . 4.44 1 2 
        39 1 . . . . . . . 4.92 1 2 
        40 1 . . . . . . . 5.27 1 2 
        41 1 . . . . . . .  4.1 1 2 
        42 1 . . . . . . . 4.71 1 2 
        43 1 . . . . . . . 4.64 1 2 
        44 1 . . . . . . . 4.23 1 2 
        45 1 . . . . . . . 3.28 1 2 
        46 1 . . . . . . . 4.08 1 2 
        47 1 . . . . . . . 4.47 1 2 
        48 1 . . . . . . .  3.7 1 2 
        49 1 . . . . . . . 3.46 1 2 
        50 1 . . . . . . . 3.66 1 2 
        51 1 . . . . . . . 4.55 1 2 
        52 1 . . . . . . . 4.29 1 2 
        53 1 . . . . . . . 4.75 1 2 
        54 1 . . . . . . .  5.5 1 2 
        55 1 . . . . . . . 3.47 1 2 
        56 1 . . . . . . . 3.72 1 2 
        57 1 . . . . . . . 3.23 1 2 
        58 1 . . . . . . . 4.22 1 2 
        59 1 . . . . . . . 4.39 1 2 
        60 1 . . . . . . . 3.85 1 2 
        61 1 . . . . . . . 3.88 1 2 
        62 1 . . . . . . . 3.87 1 2 
        63 1 . . . . . . . 3.78 1 2 
        64 1 . . . . . . . 4.14 1 2 
        65 1 . . . . . . . 3.61 1 2 
        66 1 . . . . . . . 3.61 1 2 
        67 1 . . . . . . . 4.67 1 2 
        68 1 . . . . . . .  4.0 1 2 
        69 1 . . . . . . . 3.71 1 2 
        70 1 . . . . . . . 4.03 1 2 
        71 1 . . . . . . . 4.03 1 2 
        72 1 . . . . . . . 4.48 1 2 
        73 1 . . . . . . . 4.88 1 2 
        74 1 . . . . . . . 4.33 1 2 
        75 1 . . . . . . . 4.33 1 2 
        76 1 . . . . . . . 3.44 1 2 
        77 1 . . . . . . . 4.37 1 2 
        78 1 . . . . . . . 4.65 1 2 
        79 1 . . . . . . . 4.55 1 2 
        80 1 . . . . . . . 4.55 1 2 
        81 1 . . . . . . . 4.31 1 2 
        82 1 . . . . . . .  4.4 1 2 
        83 1 . . . . . . . 5.02 1 2 
        84 1 . . . . . . . 3.87 1 2 
        85 1 . . . . . . .  3.7 1 2 
        86 1 . . . . . . . 4.84 1 2 
        87 1 . . . . . . . 4.52 1 2 
        88 1 . . . . . . . 4.53 1 2 
        89 1 . . . . . . .  5.0 1 2 
        90 1 . . . . . . . 4.14 1 2 
        91 1 . . . . . . . 4.53 1 2 
        92 1 . . . . . . . 4.46 1 2 
        93 1 . . . . . . . 4.32 1 2 
        94 1 . . . . . . . 3.71 1 2 
        95 1 . . . . . . . 3.45 1 2 
        96 1 . . . . . . . 4.31 1 2 
        97 1 . . . . . . . 4.45 1 2 
        98 1 . . . . . . . 4.01 1 2 
        99 1 . . . . . . . 4.32 1 2 
       100 1 . . . . . . . 3.73 1 2 
       101 1 . . . . . . . 3.74 1 2 
       102 1 . . . . . . . 3.36 1 2 
       103 1 . . . . . . . 4.32 1 2 
       104 1 . . . . . . . 4.69 1 2 
       105 1 . . . . . . . 4.68 1 2 
       106 1 . . . . . . . 4.94 1 2 
       107 1 . . . . . . . 4.83 1 2 
       108 1 . . . . . . . 4.05 1 2 
       109 1 . . . . . . . 4.18 1 2 
       110 1 . . . . . . . 3.77 1 2 
       111 1 . . . . . . . 3.47 1 2 
       112 1 . . . . . . . 3.32 1 2 
       113 1 . . . . . . . 4.62 1 2 
       114 1 . . . . . . . 3.33 1 2 
       115 1 . . . . . . . 3.37 1 2 
       116 1 . . . . . . . 4.07 1 2 
       117 1 . . . . . . . 4.07 1 2 
       118 1 . . . . . . . 3.48 1 2 
       119 1 . . . . . . . 5.08 1 2 
       120 1 . . . . . . . 4.55 1 2 
       121 1 . . . . . . . 4.69 1 2 
       122 1 . . . . . . .  4.7 1 2 
       123 1 . . . . . . . 4.75 1 2 
       124 1 . . . . . . . 4.94 1 2 
       125 1 . . . . . . . 4.94 1 2 
       126 1 . . . . . . . 5.01 1 2 
       127 1 . . . . . . . 4.68 1 2 
       128 1 . . . . . . . 4.66 1 2 
       129 1 . . . . . . . 4.76 1 2 
       130 1 . . . . . . . 4.06 1 2 
       131 1 . . . . . . . 4.55 1 2 
       132 1 . . . . . . . 4.19 1 2 
       133 1 . . . . . . . 4.09 1 2 
       134 1 . . . . . . . 4.72 1 2 
       135 1 . . . . . . . 4.73 1 2 
       136 1 . . . . . . . 4.58 1 2 
       137 1 . . . . . . .  4.9 1 2 
       138 1 . . . . . . . 4.26 1 2 
       139 1 . . . . . . . 3.68 1 2 
       140 1 . . . . . . . 4.57 1 2 
       141 1 . . . . . . . 4.52 1 2 
       142 1 . . . . . . . 4.77 1 2 
       143 1 . . . . . . . 4.83 1 2 
       144 1 . . . . . . . 4.34 1 2 
       145 1 . . . . . . . 4.34 1 2 
       146 1 . . . . . . . 4.36 1 2 
       147 1 . . . . . . . 4.98 1 2 
       148 1 . . . . . . . 3.93 1 2 
       149 1 . . . . . . . 4.84 1 2 
       150 1 . . . . . . . 4.41 1 2 
       151 1 . . . . . . . 4.53 1 2 
       152 1 . . . . . . .  3.9 1 2 
       153 1 . . . . . . . 4.58 1 2 
       154 1 . . . . . . . 4.59 1 2 
       155 1 . . . . . . . 4.49 1 2 
       156 1 . . . . . . . 4.25 1 2 
       157 1 . . . . . . . 3.02 1 2 
       158 1 . . . . . . . 3.99 1 2 
       159 1 . . . . . . . 4.45 1 2 
       160 1 . . . . . . . 3.99 1 2 
       161 1 . . . . . . .  5.5 1 2 
       162 1 . . . . . . .  5.5 1 2 
       163 1 . . . . . . . 3.53 1 2 
       164 1 . . . . . . . 4.58 1 2 
       165 1 . . . . . . . 4.74 1 2 
       166 1 . . . . . . . 4.53 1 2 
       167 1 . . . . . . . 5.14 1 2 
       168 1 . . . . . . . 5.43 1 2 
       169 1 . . . . . . . 4.61 1 2 
       170 1 . . . . . . . 5.04 1 2 
       171 1 . . . . . . . 3.88 1 2 
       172 1 . . . . . . . 4.44 1 2 
       173 1 . . . . . . . 3.63 1 2 
       174 1 . . . . . . . 3.56 1 2 
       175 1 . . . . . . . 3.94 1 2 
       176 1 . . . . . . . 4.46 1 2 
       177 1 . . . . . . . 4.83 1 2 
       178 1 . . . . . . . 3.93 1 2 
       179 1 . . . . . . . 4.84 1 2 
       180 1 . . . . . . . 4.25 1 2 
       181 1 . . . . . . .  5.1 1 2 
       182 1 . . . . . . . 4.68 1 2 
       183 1 . . . . . . . 3.91 1 2 
       184 1 . . . . . . . 4.74 1 2 
       185 1 . . . . . . . 5.43 1 2 
       186 1 . . . . . . . 4.91 1 2 
       187 1 . . . . . . . 4.58 1 2 
       188 1 . . . . . . . 4.58 1 2 
       189 1 . . . . . . . 4.05 1 2 
       190 1 . . . . . . . 5.01 1 2 
       191 1 . . . . . . . 5.01 1 2 
       192 1 . . . . . . . 3.91 1 2 
       193 1 . . . . . . . 4.55 1 2 
       194 1 . . . . . . . 3.65 1 2 
       195 1 . . . . . . . 3.65 1 2 
       196 1 . . . . . . . 4.11 1 2 
       197 1 . . . . . . . 4.11 1 2 
       198 1 . . . . . . . 4.81 1 2 
       199 1 . . . . . . . 4.81 1 2 
       200 1 . . . . . . . 4.28 1 2 
       201 1 . . . . . . . 4.28 1 2 
       202 1 . . . . . . . 4.44 1 2 
       203 1 . . . . . . . 5.16 1 2 
       204 1 . . . . . . . 5.33 1 2 
       205 1 . . . . . . . 3.57 1 2 
       206 1 . . . . . . . 3.57 1 2 
       207 1 . . . . . . . 3.79 1 2 
       208 1 . . . . . . . 4.74 1 2 
       209 1 . . . . . . . 4.53 1 2 
       210 1 . . . . . . . 4.14 1 2 
       211 1 . . . . . . . 3.26 1 2 
       212 1 . . . . . . . 3.26 1 2 
       213 1 . . . . . . . 4.14 1 2 
       214 1 . . . . . . . 4.14 1 2 
       215 1 . . . . . . .  4.9 1 2 
       216 1 . . . . . . .  4.9 1 2 
       217 1 . . . . . . . 4.49 1 2 
       218 1 . . . . . . . 5.01 1 2 
       219 1 . . . . . . .  5.1 1 2 
       220 1 . . . . . . .  5.5 1 2 
       221 1 . . . . . . .  4.8 1 2 
       222 1 . . . . . . . 4.01 1 2 
       223 1 . . . . . . .  4.9 1 2 
       224 1 . . . . . . .  3.8 1 2 
       225 1 . . . . . . . 3.78 1 2 
       226 1 . . . . . . . 5.01 1 2 
       227 1 . . . . . . . 4.03 1 2 
       228 1 . . . . . . . 3.87 1 2 
       229 1 . . . . . . . 4.57 1 2 
       230 1 . . . . . . . 4.02 1 2 
       231 1 . . . . . . . 4.29 1 2 
       232 1 . . . . . . . 3.56 1 2 
       233 1 . . . . . . .  3.7 1 2 
       234 1 . . . . . . . 4.16 1 2 
       235 1 . . . . . . . 4.16 1 2 
       236 1 . . . . . . . 4.84 1 2 
       237 1 . . . . . . . 3.53 1 2 
       238 1 . . . . . . . 4.82 1 2 
       239 1 . . . . . . .  5.0 1 2 
       240 1 . . . . . . . 4.27 1 2 
       241 1 . . . . . . .  4.8 1 2 
       242 1 . . . . . . . 4.15 1 2 
       243 1 . . . . . . . 4.15 1 2 
       244 1 . . . . . . .  4.5 1 2 
       245 1 . . . . . . . 4.54 1 2 
       246 1 . . . . . . .  4.0 1 2 
       247 1 . . . . . . . 4.23 1 2 
       248 1 . . . . . . . 4.48 1 2 
       249 1 . . . . . . . 3.96 1 2 
       250 1 . . . . . . . 4.52 1 2 
       251 1 . . . . . . . 4.25 1 2 
       252 1 . . . . . . . 3.89 1 2 
       253 1 . . . . . . . 3.57 1 2 
       254 1 . . . . . . . 5.09 1 2 
       255 1 . . . . . . . 3.88 1 2 
       256 1 . . . . . . . 3.59 1 2 
       257 1 . . . . . . . 3.41 1 2 
       258 1 . . . . . . . 3.88 1 2 
       259 1 . . . . . . . 3.72 1 2 
       260 1 . . . . . . . 3.57 1 2 
       261 1 . . . . . . . 3.67 1 2 
       262 1 . . . . . . . 4.38 1 2 
       263 1 . . . . . . .  3.3 1 2 
       264 1 . . . . . . . 3.32 1 2 
       265 1 . . . . . . . 4.55 1 2 
       266 1 . . . . . . . 3.49 1 2 
       267 1 . . . . . . . 3.83 1 2 
       268 1 . . . . . . . 3.88 1 2 
       269 1 . . . . . . . 4.13 1 2 
       270 1 . . . . . . .  4.3 1 2 
       271 1 . . . . . . . 4.64 1 2 
       272 1 . . . . . . . 3.62 1 2 
       273 1 . . . . . . . 3.94 1 2 
       274 1 . . . . . . . 3.77 1 2 
       275 1 . . . . . . . 4.39 1 2 
       276 1 . . . . . . .  4.5 1 2 
       277 1 . . . . . . . 4.48 1 2 
       278 1 . . . . . . . 4.44 1 2 
       279 1 . . . . . . . 4.61 1 2 
       280 1 . . . . . . . 4.11 1 2 
       281 1 . . . . . . . 3.59 1 2 
       282 1 . . . . . . .  3.7 1 2 
       283 1 . . . . . . . 4.29 1 2 
       284 1 . . . . . . .  3.6 1 2 
       285 1 . . . . . . . 3.16 1 2 
       286 1 . . . . . . . 3.61 1 2 
       287 1 . . . . . . . 3.64 1 2 
       288 1 . . . . . . . 4.39 1 2 
       289 1 . . . . . . . 5.34 1 2 
       290 1 . . . . . . . 4.62 1 2 
       291 1 . . . . . . . 3.49 1 2 
       292 1 . . . . . . . 3.67 1 2 
       293 1 . . . . . . . 3.37 1 2 
       294 1 . . . . . . .  3.6 1 2 
       295 1 . . . . . . .  4.0 1 2 
       296 1 . . . . . . . 3.13 1 2 
       297 1 . . . . . . . 4.25 1 2 
       298 1 . . . . . . .  3.3 1 2 
       299 1 . . . . . . . 4.67 1 2 
       300 1 . . . . . . . 3.67 1 2 
       301 1 . . . . . . . 3.83 1 2 
       302 1 . . . . . . . 3.35 1 2 
       303 1 . . . . . . . 3.55 1 2 
       304 1 . . . . . . . 4.97 1 2 
       305 1 . . . . . . . 3.41 1 2 
       306 1 . . . . . . . 3.13 1 2 
       307 1 . . . . . . . 4.54 1 2 
    stop_

save_


save_DYANA/DIANA_dihedral_5
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

        1 PHI  1 1  9 GLY C 1 1 10 GLU N  1 1 10 GLU CA 1 1 10 GLU C     -121.0 -60.999996 . 10 GLU  . . 10 GLU  . . 10 GLU  . . 10 GLU  . 1 1 
        2 PSI  1 1 10 GLU N 1 1 10 GLU CA 1 1 10 GLU C  1 1 11 LYS N      106.0      166.0 . 10 GLU  . . 10 GLU  . . 10 GLU  . . 10 GLU  . 1 1 
        3 PHI  1 1 10 GLU C 1 1 11 LYS N  1 1 11 LYS CA 1 1 11 LYS C     -118.0      -58.0 . 11 LYS  . . 11 LYS  . . 11 LYS  . . 11 LYS  . 1 1 
        4 PSI  1 1 11 LYS N 1 1 11 LYS CA 1 1 11 LYS C  1 1 12 PRO N      118.0      178.0 . 11 LYS  . . 11 LYS  . . 11 LYS  . . 11 LYS  . 1 1 
        5 PHI  1 1 13 TYR C 1 1 14 GLN N  1 1 14 GLN CA 1 1 14 GLN C     -140.0      -80.0 . 14 GLN  . . 14 GLN  . . 14 GLN  . . 14 GLN  . 1 1 
        6 PSI  1 1 14 GLN N 1 1 14 GLN CA 1 1 14 GLN C  1 1 15 CYS N      103.0  162.99998 . 14 GLN  . . 14 GLN  . . 14 GLN  . . 14 GLN  . 1 1 
        7 PHI  1 1 14 GLN C 1 1 15 CYS N  1 1 15 CYS CA 1 1 15 CYS C     -105.0 -44.999996 . 15 CYSS . . 15 CYSS . . 15 CYSS . . 15 CYSS . 1 1 
        8 PSI  1 1 15 CYS N 1 1 15 CYS CA 1 1 15 CYS C  1 1 16 SER N       99.0      159.0 . 15 CYSS . . 15 CYSS . . 15 CYSS . . 15 CYSS . 1 1 
        9 PHI  1 1 20 LYS C 1 1 21 SER N  1 1 21 SER CA 1 1 21 SER C     -140.0      -80.0 . 21 SER  . . 21 SER  . . 21 SER  . . 21 SER  . 1 1 
       10 PSI  1 1 21 SER N 1 1 21 SER CA 1 1 21 SER C  1 1 22 PHE N      112.0      172.0 . 21 SER  . . 21 SER  . . 21 SER  . . 21 SER  . 1 1 
       11 PHI  1 1 21 SER C 1 1 22 PHE N  1 1 22 PHE CA 1 1 22 PHE C     -160.0     -100.0 . 22 PHE  . . 22 PHE  . . 22 PHE  . . 22 PHE  . 1 1 
       12 PSI  1 1 22 PHE N 1 1 22 PHE CA 1 1 22 PHE C  1 1 23 SER N      114.0      174.0 . 22 PHE  . . 22 PHE  . . 22 PHE  . . 22 PHE  . 1 1 
       13 PHI  1 1 24 GLY C 1 1 25 SER N  1 1 25 SER CA 1 1 25 SER C      -87.0 -26.999998 . 25 SER  . . 25 SER  . . 25 SER  . . 25 SER  . 1 1 
       14 PSI  1 1 25 SER N 1 1 25 SER CA 1 1 25 SER C  1 1 26 TYR N      -71.0      -11.0 . 25 SER  . . 25 SER  . . 25 SER  . . 25 SER  . 1 1 
       15 PHI  1 1 25 SER C 1 1 26 TYR N  1 1 26 TYR CA 1 1 26 TYR C  -89.99999      -30.0 . 26 TYR  . . 26 TYR  . . 26 TYR  . . 26 TYR  . 1 1 
       16 PSI  1 1 26 TYR N 1 1 26 TYR CA 1 1 26 TYR C  1 1 27 ARG N      -73.0      -13.0 . 26 TYR  . . 26 TYR  . . 26 TYR  . . 26 TYR  . 1 1 
       17 PHI  1 1 26 TYR C 1 1 27 ARG N  1 1 27 ARG CA 1 1 27 ARG C      -99.0      -39.0 . 27 ARG  . . 27 ARG  . . 27 ARG  . . 27 ARG  . 1 1 
       18 PSI  1 1 27 ARG N 1 1 27 ARG CA 1 1 27 ARG C  1 1 28 LEU N  -66.99999       -7.0 . 27 ARG  . . 27 ARG  . . 27 ARG  . . 27 ARG  . 1 1 
       19 PHI  1 1 27 ARG C 1 1 28 LEU N  1 1 28 LEU CA 1 1 28 LEU C      -94.0      -34.0 . 28 LEU  . . 28 LEU  . . 28 LEU  . . 28 LEU  . 1 1 
       20 PSI  1 1 28 LEU N 1 1 28 LEU CA 1 1 28 LEU C  1 1 29 THR N      -72.0 -11.999999 . 28 LEU  . . 28 LEU  . . 28 LEU  . . 28 LEU  . 1 1 
       21 PHI  1 1 28 LEU C 1 1 29 THR N  1 1 29 THR CA 1 1 29 THR C      -92.0      -32.0 . 29 THR  . . 29 THR  . . 29 THR  . . 29 THR  . 1 1 
       22 PSI  1 1 29 THR N 1 1 29 THR CA 1 1 29 THR C  1 1 30 GLN N      -73.0      -13.0 . 29 THR  . . 29 THR  . . 29 THR  . . 29 THR  . 1 1 
       23 PHI  1 1 29 THR C 1 1 30 GLN N  1 1 30 GLN CA 1 1 30 GLN C      -93.0      -33.0 . 30 GLN  . . 30 GLN  . . 30 GLN  . . 30 GLN  . 1 1 
       24 PSI  1 1 30 GLN N 1 1 30 GLN CA 1 1 30 GLN C  1 1 31 HIS N      -66.0 -5.9999995 . 30 GLN  . . 30 GLN  . . 30 GLN  . . 30 GLN  . 1 1 
       25 PHI  1 1 30 GLN C 1 1 31 HIS N  1 1 31 HIS CA 1 1 31 HIS C      -99.0      -39.0 . 31 HIS  . . 31 HIS  . . 31 HIS  . . 31 HIS  . 1 1 
       26 PSI  1 1 31 HIS N 1 1 31 HIS CA 1 1 31 HIS C  1 1 32 TRP N  -66.99999       -7.0 . 31 HIS  . . 31 HIS  . . 31 HIS  . . 31 HIS  . 1 1 
       27 PHI  1 1 31 HIS C 1 1 32 TRP N  1 1 32 TRP CA 1 1 32 TRP C      -94.0      -34.0 . 32 TRP  . . 32 TRP  . . 32 TRP  . . 32 TRP  . 1 1 
       28 PSI  1 1 32 TRP N 1 1 32 TRP CA 1 1 32 TRP C  1 1 33 ILE N      -75.0      -15.0 . 32 TRP  . . 32 TRP  . . 32 TRP  . . 32 TRP  . 1 1 
       29 PHI  1 1 32 TRP C 1 1 33 ILE N  1 1 33 ILE CA 1 1 33 ILE C      -98.0      -38.0 . 33 ILE  . . 33 ILE  . . 33 ILE  . . 33 ILE  . 1 1 
       30 PSI  1 1 33 ILE N 1 1 33 ILE CA 1 1 33 ILE C  1 1 34 THR N      -69.0       -9.0 . 33 ILE  . . 33 ILE  . . 33 ILE  . . 33 ILE  . 1 1 
       31 PHI  1 1 33 ILE C 1 1 34 THR N  1 1 34 THR CA 1 1 34 THR C     -105.0 -44.999996 . 34 THR  . . 34 THR  . . 34 THR  . . 34 THR  . 1 1 
       32 PSI  1 1 34 THR N 1 1 34 THR CA 1 1 34 THR C  1 1 35 HIS N      -60.0        0.0 . 34 THR  . . 34 THR  . . 34 THR  . . 34 THR  . 1 1 
       33 PHI  1 1 34 THR C 1 1 35 HIS N  1 1 35 HIS CA 1 1 35 HIS C     -125.0      -65.0 . 35 HIS  . . 35 HIS  . . 35 HIS  . . 35 HIS  . 1 1 
       34 PSI  1 1 35 HIS N 1 1 35 HIS CA 1 1 35 HIS C  1 1 36 THR N      -39.0       21.0 . 35 HIS  . . 35 HIS  . . 35 HIS  . . 35 HIS  . 1 1 
       35 CHI1 1 1 18 CYS N 1 1 18 CYS CA 1 1 18 CYS CB 1 1 18 CYS SG      30.0   89.99999 . 18 CYSS . . 18 CYSS . . 18 CYSS . . 18 CYSS . 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1  1 GLY C    C   -3.595 -24.959 -16.018 1.00 . A A .   1 GLY C    1 1 
        1     2 1 1  1 GLY CA   C   -3.065 -26.336 -16.367 1.00 . A A .   1 GLY CA   1 1 
        1     3 1 1  1 GLY H1   H   -1.174 -27.285 -16.299 1.00 . A A .   1 GLY H1   1 1 
        1     4 1 1  1 GLY HA2  H   -3.372 -26.584 -17.372 1.00 . A A .   1 GLY HA2  1 1 
        1     5 1 1  1 GLY HA3  H   -3.491 -27.056 -15.683 1.00 . A A .   1 GLY HA3  1 1 
        1     6 1 1  1 GLY N    N   -1.618 -26.411 -16.285 1.00 . A A .   1 GLY N    1 1 
        1     7 1 1  1 GLY O    O   -4.000 -24.201 -16.899 1.00 . A A .   1 GLY O    1 1 
        1     8 1 1  2 SER C    C   -3.034 -22.642 -13.403 1.00 . A A .   2 SER C    1 1 
        1     9 1 1  2 SER CA   C   -4.081 -23.342 -14.265 1.00 . A A .   2 SER CA   1 1 
        1    10 1 1  2 SER CB   C   -5.376 -23.518 -13.470 1.00 . A A .   2 SER CB   1 1 
        1    11 1 1  2 SER H    H   -3.256 -25.282 -14.074 1.00 . A A .   2 SER H    1 1 
        1    12 1 1  2 SER HA   H   -4.282 -22.732 -15.133 1.00 . A A .   2 SER HA   1 1 
        1    13 1 1  2 SER HB2  H   -5.891 -22.571 -13.411 1.00 . A A .   2 SER HB2  1 1 
        1    14 1 1  2 SER HB3  H   -6.006 -24.240 -13.969 1.00 . A A .   2 SER HB3  1 1 
        1    15 1 1  2 SER HG   H   -5.540 -24.822 -12.017 1.00 . A A .   2 SER HG   1 1 
        1    16 1 1  2 SER N    N   -3.592 -24.635 -14.729 1.00 . A A .   2 SER N    1 1 
        1    17 1 1  2 SER O    O   -3.355 -22.056 -12.369 1.00 . A A .   2 SER O    1 1 
        1    18 1 1  2 SER OG   O   -5.110 -23.975 -12.155 1.00 . A A .   2 SER OG   1 1 
        1    19 1 1  3 SER C    C    0.293 -21.407 -14.062 1.00 . A A .   3 SER C    1 1 
        1    20 1 1  3 SER CA   C   -0.683 -22.085 -13.106 1.00 . A A .   3 SER CA   1 1 
        1    21 1 1  3 SER CB   C    0.054 -23.128 -12.263 1.00 . A A .   3 SER CB   1 1 
        1    22 1 1  3 SER H    H   -1.587 -23.190 -14.669 1.00 . A A .   3 SER H    1 1 
        1    23 1 1  3 SER HA   H   -1.105 -21.338 -12.450 1.00 . A A .   3 SER HA   1 1 
        1    24 1 1  3 SER HB2  H    0.068 -24.069 -12.792 1.00 . A A .   3 SER HB2  1 1 
        1    25 1 1  3 SER HB3  H    1.067 -22.797 -12.090 1.00 . A A .   3 SER HB3  1 1 
        1    26 1 1  3 SER HG   H   -0.882 -22.470 -10.673 1.00 . A A .   3 SER HG   1 1 
        1    27 1 1  3 SER N    N   -1.779 -22.708 -13.838 1.00 . A A .   3 SER N    1 1 
        1    28 1 1  3 SER O    O    0.592 -21.929 -15.135 1.00 . A A .   3 SER O    1 1 
        1    29 1 1  3 SER OG   O   -0.586 -23.318 -11.012 1.00 . A A .   3 SER OG   1 1 
        1    30 1 1  4 GLY C    C    1.377 -18.034 -14.601 1.00 . A A .   4 GLY C    1 1 
        1    31 1 1  4 GLY CA   C    1.723 -19.506 -14.497 1.00 . A A .   4 GLY CA   1 1 
        1    32 1 1  4 GLY H    H    0.512 -19.870 -12.798 1.00 . A A .   4 GLY H    1 1 
        1    33 1 1  4 GLY HA2  H    2.713 -19.604 -14.077 1.00 . A A .   4 GLY HA2  1 1 
        1    34 1 1  4 GLY HA3  H    1.718 -19.936 -15.488 1.00 . A A .   4 GLY HA3  1 1 
        1    35 1 1  4 GLY N    N    0.786 -20.238 -13.664 1.00 . A A .   4 GLY N    1 1 
        1    36 1 1  4 GLY O    O    0.483 -17.548 -13.909 1.00 . A A .   4 GLY O    1 1 
        1    37 1 1  5 SER C    C    0.376 -15.559 -15.504 1.00 . A A .   5 SER C    1 1 
        1    38 1 1  5 SER CA   C    1.857 -15.893 -15.656 1.00 . A A .   5 SER CA   1 1 
        1    39 1 1  5 SER CB   C    2.352 -15.452 -17.035 1.00 . A A .   5 SER CB   1 1 
        1    40 1 1  5 SER H    H    2.789 -17.764 -15.991 1.00 . A A .   5 SER H    1 1 
        1    41 1 1  5 SER HA   H    2.413 -15.364 -14.897 1.00 . A A .   5 SER HA   1 1 
        1    42 1 1  5 SER HB2  H    2.365 -14.374 -17.082 1.00 . A A .   5 SER HB2  1 1 
        1    43 1 1  5 SER HB3  H    3.351 -15.832 -17.194 1.00 . A A .   5 SER HB3  1 1 
        1    44 1 1  5 SER HG   H    0.729 -15.387 -18.131 1.00 . A A .   5 SER HG   1 1 
        1    45 1 1  5 SER N    N    2.089 -17.320 -15.468 1.00 . A A .   5 SER N    1 1 
        1    46 1 1  5 SER O    O    0.013 -14.583 -14.848 1.00 . A A .   5 SER O    1 1 
        1    47 1 1  5 SER OG   O    1.508 -15.944 -18.062 1.00 . A A .   5 SER OG   1 1 
        1    48 1 1  6 SER C    C   -2.569 -17.164 -15.099 1.00 . A A .   6 SER C    1 1 
        1    49 1 1  6 SER CA   C   -1.916 -16.167 -16.053 1.00 . A A .   6 SER CA   1 1 
        1    50 1 1  6 SER CB   C   -2.534 -16.299 -17.446 1.00 . A A .   6 SER CB   1 1 
        1    51 1 1  6 SER H    H   -0.124 -17.138 -16.624 1.00 . A A .   6 SER H    1 1 
        1    52 1 1  6 SER HA   H   -2.090 -15.167 -15.684 1.00 . A A .   6 SER HA   1 1 
        1    53 1 1  6 SER HB2  H   -2.180 -17.207 -17.910 1.00 . A A .   6 SER HB2  1 1 
        1    54 1 1  6 SER HB3  H   -3.610 -16.335 -17.358 1.00 . A A .   6 SER HB3  1 1 
        1    55 1 1  6 SER HG   H   -1.984 -14.438 -17.715 1.00 . A A .   6 SER HG   1 1 
        1    56 1 1  6 SER N    N   -0.474 -16.377 -16.116 1.00 . A A .   6 SER N    1 1 
        1    57 1 1  6 SER O    O   -2.988 -18.246 -15.506 1.00 . A A .   6 SER O    1 1 
        1    58 1 1  6 SER OG   O   -2.179 -15.199 -18.267 1.00 . A A .   6 SER OG   1 1 
        1    59 1 1  7 GLY C    C   -4.606 -17.159 -12.368 1.00 . A A .   7 GLY C    1 1 
        1    60 1 1  7 GLY CA   C   -3.253 -17.659 -12.833 1.00 . A A .   7 GLY CA   1 1 
        1    61 1 1  7 GLY H    H   -2.299 -15.913 -13.559 1.00 . A A .   7 GLY H    1 1 
        1    62 1 1  7 GLY HA2  H   -3.371 -18.645 -13.259 1.00 . A A .   7 GLY HA2  1 1 
        1    63 1 1  7 GLY HA3  H   -2.593 -17.724 -11.980 1.00 . A A .   7 GLY HA3  1 1 
        1    64 1 1  7 GLY N    N   -2.650 -16.789 -13.826 1.00 . A A .   7 GLY N    1 1 
        1    65 1 1  7 GLY O    O   -5.258 -16.380 -13.061 1.00 . A A .   7 GLY O    1 1 
        1    66 1 1  8 GLU C    C   -6.122 -16.284  -9.434 1.00 . A A .   8 GLU C    1 1 
        1    67 1 1  8 GLU CA   C   -6.314 -17.205 -10.635 1.00 . A A .   8 GLU CA   1 1 
        1    68 1 1  8 GLU CB   C   -7.128 -18.434 -10.225 1.00 . A A .   8 GLU CB   1 1 
        1    69 1 1  8 GLU CD   C   -8.598 -20.349 -10.968 1.00 . A A .   8 GLU CD   1 1 
        1    70 1 1  8 GLU CG   C   -7.884 -19.075 -11.377 1.00 . A A .   8 GLU CG   1 1 
        1    71 1 1  8 GLU H    H   -4.463 -18.230 -10.684 1.00 . A A .   8 GLU H    1 1 
        1    72 1 1  8 GLU HA   H   -6.852 -16.668 -11.402 1.00 . A A .   8 GLU HA   1 1 
        1    73 1 1  8 GLU HB2  H   -6.459 -19.170  -9.806 1.00 . A A .   8 GLU HB2  1 1 
        1    74 1 1  8 GLU HB3  H   -7.844 -18.141  -9.471 1.00 . A A .   8 GLU HB3  1 1 
        1    75 1 1  8 GLU HG2  H   -8.617 -18.373 -11.745 1.00 . A A .   8 GLU HG2  1 1 
        1    76 1 1  8 GLU HG3  H   -7.184 -19.309 -12.165 1.00 . A A .   8 GLU HG3  1 1 
        1    77 1 1  8 GLU N    N   -5.028 -17.610 -11.191 1.00 . A A .   8 GLU N    1 1 
        1    78 1 1  8 GLU O    O   -5.999 -16.744  -8.299 1.00 . A A .   8 GLU O    1 1 
        1    79 1 1  8 GLU OE1  O   -7.934 -21.248 -10.411 1.00 . A A .   8 GLU OE1  1 1 
        1    80 1 1  8 GLU OE2  O   -9.820 -20.447 -11.206 1.00 . A A .   8 GLU OE2  1 1 
        1    81 1 1  9 GLY C    C   -5.384 -12.688  -9.123 1.00 . A A .   9 GLY C    1 1 
        1    82 1 1  9 GLY CA   C   -5.919 -14.015  -8.623 1.00 . A A .   9 GLY CA   1 1 
        1    83 1 1  9 GLY H    H   -6.200 -14.671 -10.617 1.00 . A A .   9 GLY H    1 1 
        1    84 1 1  9 GLY HA2  H   -6.870 -13.849  -8.140 1.00 . A A .   9 GLY HA2  1 1 
        1    85 1 1  9 GLY HA3  H   -5.225 -14.420  -7.901 1.00 . A A .   9 GLY HA3  1 1 
        1    86 1 1  9 GLY N    N   -6.097 -14.980  -9.692 1.00 . A A .   9 GLY N    1 1 
        1    87 1 1  9 GLY O    O   -4.523 -12.080  -8.489 1.00 . A A .   9 GLY O    1 1 
        1    88 1 1 10 GLU C    C   -6.553  -9.916 -10.730 1.00 . A A .  10 GLU C    1 1 
        1    89 1 1 10 GLU CA   C   -5.461 -10.975 -10.851 1.00 . A A .  10 GLU CA   1 1 
        1    90 1 1 10 GLU CB   C   -5.086 -11.172 -12.322 1.00 . A A .  10 GLU CB   1 1 
        1    91 1 1 10 GLU CD   C   -7.101 -10.442 -13.659 1.00 . A A .  10 GLU CD   1 1 
        1    92 1 1 10 GLU CG   C   -6.251 -11.608 -13.194 1.00 . A A .  10 GLU CG   1 1 
        1    93 1 1 10 GLU H    H   -6.579 -12.769 -10.725 1.00 . A A .  10 GLU H    1 1 
        1    94 1 1 10 GLU HA   H   -4.590 -10.641 -10.309 1.00 . A A .  10 GLU HA   1 1 
        1    95 1 1 10 GLU HB2  H   -4.701 -10.240 -12.710 1.00 . A A .  10 GLU HB2  1 1 
        1    96 1 1 10 GLU HB3  H   -4.314 -11.924 -12.386 1.00 . A A .  10 GLU HB3  1 1 
        1    97 1 1 10 GLU HG2  H   -5.863 -12.119 -14.062 1.00 . A A .  10 GLU HG2  1 1 
        1    98 1 1 10 GLU HG3  H   -6.874 -12.285 -12.628 1.00 . A A .  10 GLU HG3  1 1 
        1    99 1 1 10 GLU N    N   -5.895 -12.238 -10.266 1.00 . A A .  10 GLU N    1 1 
        1   100 1 1 10 GLU O    O   -7.729 -10.190 -10.969 1.00 . A A .  10 GLU O    1 1 
        1   101 1 1 10 GLU OE1  O   -6.527  -9.461 -14.178 1.00 . A A .  10 GLU OE1  1 1 
        1   102 1 1 10 GLU OE2  O   -8.338 -10.509 -13.504 1.00 . A A .  10 GLU OE2  1 1 
        1   103 1 1 11 LYS C    C   -6.795  -6.487 -11.201 1.00 . A A .  11 LYS C    1 1 
        1   104 1 1 11 LYS CA   C   -7.096  -7.602 -10.205 1.00 . A A .  11 LYS CA   1 1 
        1   105 1 1 11 LYS CB   C   -7.043  -7.053  -8.777 1.00 . A A .  11 LYS CB   1 1 
        1   106 1 1 11 LYS CD   C   -9.017  -8.054  -7.589 1.00 . A A .  11 LYS CD   1 1 
        1   107 1 1 11 LYS CE   C   -9.514  -6.830  -6.836 1.00 . A A .  11 LYS CE   1 1 
        1   108 1 1 11 LYS CG   C   -7.503  -8.047  -7.725 1.00 . A A .  11 LYS CG   1 1 
        1   109 1 1 11 LYS H    H   -5.203  -8.548 -10.181 1.00 . A A .  11 LYS H    1 1 
        1   110 1 1 11 LYS HA   H   -8.087  -7.983 -10.398 1.00 . A A .  11 LYS HA   1 1 
        1   111 1 1 11 LYS HB2  H   -6.026  -6.767  -8.552 1.00 . A A .  11 LYS HB2  1 1 
        1   112 1 1 11 LYS HB3  H   -7.676  -6.178  -8.717 1.00 . A A .  11 LYS HB3  1 1 
        1   113 1 1 11 LYS HD2  H   -9.459  -8.060  -8.574 1.00 . A A .  11 LYS HD2  1 1 
        1   114 1 1 11 LYS HD3  H   -9.317  -8.943  -7.052 1.00 . A A .  11 LYS HD3  1 1 
        1   115 1 1 11 LYS HE2  H   -8.895  -5.985  -7.099 1.00 . A A .  11 LYS HE2  1 1 
        1   116 1 1 11 LYS HE3  H  -10.535  -6.633  -7.130 1.00 . A A .  11 LYS HE3  1 1 
        1   117 1 1 11 LYS HG2  H   -7.174  -9.036  -8.009 1.00 . A A .  11 LYS HG2  1 1 
        1   118 1 1 11 LYS HG3  H   -7.067  -7.779  -6.774 1.00 . A A .  11 LYS HG3  1 1 
        1   119 1 1 11 LYS HZ1  H  -10.425  -6.998  -4.963 1.00 . A A .  11 LYS HZ1  1 1 
        1   120 1 1 11 LYS HZ2  H   -8.894  -6.278  -4.919 1.00 . A A .  11 LYS HZ2  1 1 
        1   121 1 1 11 LYS HZ3  H   -9.036  -7.949  -5.138 1.00 . A A .  11 LYS HZ3  1 1 
        1   122 1 1 11 LYS N    N   -6.154  -8.705 -10.357 1.00 . A A .  11 LYS N    1 1 
        1   123 1 1 11 LYS NZ   N   -9.464  -7.027  -5.361 1.00 . A A .  11 LYS NZ   1 1 
        1   124 1 1 11 LYS O    O   -5.648  -6.255 -11.582 1.00 . A A .  11 LYS O    1 1 
        1   125 1 1 12 PRO C    C   -7.029  -3.460 -11.984 1.00 . A A .  12 PRO C    1 1 
        1   126 1 1 12 PRO CA   C   -7.722  -4.675 -12.590 1.00 . A A .  12 PRO CA   1 1 
        1   127 1 1 12 PRO CB   C   -9.173  -4.343 -12.944 1.00 . A A .  12 PRO CB   1 1 
        1   128 1 1 12 PRO CD   C   -9.245  -6.000 -11.223 1.00 . A A .  12 PRO CD   1 1 
        1   129 1 1 12 PRO CG   C   -9.963  -4.795 -11.764 1.00 . A A .  12 PRO CG   1 1 
        1   130 1 1 12 PRO HA   H   -7.194  -4.981 -13.482 1.00 . A A .  12 PRO HA   1 1 
        1   131 1 1 12 PRO HB2  H   -9.273  -3.278 -13.102 1.00 . A A .  12 PRO HB2  1 1 
        1   132 1 1 12 PRO HB3  H   -9.461  -4.874 -13.838 1.00 . A A .  12 PRO HB3  1 1 
        1   133 1 1 12 PRO HD2  H   -9.329  -6.038 -10.147 1.00 . A A .  12 PRO HD2  1 1 
        1   134 1 1 12 PRO HD3  H   -9.638  -6.904 -11.665 1.00 . A A .  12 PRO HD3  1 1 
        1   135 1 1 12 PRO HG2  H   -9.995  -4.013 -11.022 1.00 . A A .  12 PRO HG2  1 1 
        1   136 1 1 12 PRO HG3  H  -10.963  -5.062 -12.073 1.00 . A A .  12 PRO HG3  1 1 
        1   137 1 1 12 PRO N    N   -7.849  -5.779 -11.634 1.00 . A A .  12 PRO N    1 1 
        1   138 1 1 12 PRO O    O   -6.648  -2.530 -12.696 1.00 . A A .  12 PRO O    1 1 
        1   139 1 1 13 TYR C    C   -5.077  -2.875  -9.092 1.00 . A A .  13 TYR C    1 1 
        1   140 1 1 13 TYR CA   C   -6.223  -2.370  -9.963 1.00 . A A .  13 TYR CA   1 1 
        1   141 1 1 13 TYR CB   C   -7.241  -1.621  -9.101 1.00 . A A .  13 TYR CB   1 1 
        1   142 1 1 13 TYR CD1  C   -8.277  -0.013 -10.750 1.00 . A A .  13 TYR CD1  1 1 
        1   143 1 1 13 TYR CD2  C   -9.680  -1.663  -9.755 1.00 . A A .  13 TYR CD2  1 1 
        1   144 1 1 13 TYR CE1  C   -9.352   0.477 -11.465 1.00 . A A .  13 TYR CE1  1 1 
        1   145 1 1 13 TYR CE2  C  -10.760  -1.180 -10.468 1.00 . A A .  13 TYR CE2  1 1 
        1   146 1 1 13 TYR CG   C   -8.421  -1.089  -9.883 1.00 . A A .  13 TYR CG   1 1 
        1   147 1 1 13 TYR CZ   C  -10.592  -0.110 -11.321 1.00 . A A .  13 TYR CZ   1 1 
        1   148 1 1 13 TYR H    H   -7.193  -4.241 -10.152 1.00 . A A .  13 TYR H    1 1 
        1   149 1 1 13 TYR HA   H   -5.825  -1.692 -10.704 1.00 . A A .  13 TYR HA   1 1 
        1   150 1 1 13 TYR HB2  H   -7.620  -2.288  -8.343 1.00 . A A .  13 TYR HB2  1 1 
        1   151 1 1 13 TYR HB3  H   -6.753  -0.783  -8.626 1.00 . A A .  13 TYR HB3  1 1 
        1   152 1 1 13 TYR HD1  H   -7.304   0.445 -10.861 1.00 . A A .  13 TYR HD1  1 1 
        1   153 1 1 13 TYR HD2  H   -9.809  -2.501  -9.086 1.00 . A A .  13 TYR HD2  1 1 
        1   154 1 1 13 TYR HE1  H   -9.220   1.315 -12.134 1.00 . A A .  13 TYR HE1  1 1 
        1   155 1 1 13 TYR HE2  H  -11.732  -1.640 -10.355 1.00 . A A .  13 TYR HE2  1 1 
        1   156 1 1 13 TYR HH   H  -12.330   0.706 -11.424 1.00 . A A .  13 TYR HH   1 1 
        1   157 1 1 13 TYR N    N   -6.868  -3.473 -10.666 1.00 . A A .  13 TYR N    1 1 
        1   158 1 1 13 TYR O    O   -4.915  -2.446  -7.951 1.00 . A A .  13 TYR O    1 1 
        1   159 1 1 13 TYR OH   O  -11.665   0.374 -12.033 1.00 . A A .  13 TYR OH   1 1 
        1   160 1 1 14 GLN C    C   -1.861  -3.620  -9.265 1.00 . A A .  14 GLN C    1 1 
        1   161 1 1 14 GLN CA   C   -3.152  -4.354  -8.916 1.00 . A A .  14 GLN CA   1 1 
        1   162 1 1 14 GLN CB   C   -3.008  -5.843  -9.232 1.00 . A A .  14 GLN CB   1 1 
        1   163 1 1 14 GLN CD   C   -1.543  -7.890  -9.008 1.00 . A A .  14 GLN CD   1 1 
        1   164 1 1 14 GLN CG   C   -1.901  -6.528  -8.446 1.00 . A A .  14 GLN CG   1 1 
        1   165 1 1 14 GLN H    H   -4.464  -4.091 -10.556 1.00 . A A .  14 GLN H    1 1 
        1   166 1 1 14 GLN HA   H   -3.344  -4.236  -7.860 1.00 . A A .  14 GLN HA   1 1 
        1   167 1 1 14 GLN HB2  H   -3.940  -6.339  -9.006 1.00 . A A .  14 GLN HB2  1 1 
        1   168 1 1 14 GLN HB3  H   -2.795  -5.957 -10.285 1.00 . A A .  14 GLN HB3  1 1 
        1   169 1 1 14 GLN HE21 H    0.223  -7.829  -8.095 1.00 . A A .  14 GLN HE21 1 1 
        1   170 1 1 14 GLN HE22 H   -0.094  -9.250  -9.025 1.00 . A A .  14 GLN HE22 1 1 
        1   171 1 1 14 GLN HG2  H   -1.020  -5.903  -8.471 1.00 . A A .  14 GLN HG2  1 1 
        1   172 1 1 14 GLN HG3  H   -2.226  -6.650  -7.424 1.00 . A A .  14 GLN HG3  1 1 
        1   173 1 1 14 GLN N    N   -4.283  -3.789  -9.642 1.00 . A A .  14 GLN N    1 1 
        1   174 1 1 14 GLN NE2  N   -0.351  -8.372  -8.677 1.00 . A A .  14 GLN NE2  1 1 
        1   175 1 1 14 GLN O    O   -1.493  -3.512 -10.435 1.00 . A A .  14 GLN O    1 1 
        1   176 1 1 14 GLN OE1  O   -2.329  -8.502  -9.731 1.00 . A A .  14 GLN OE1  1 1 
        1   177 1 1 15 CYS C    C    1.034  -3.195  -9.314 1.00 . A A .  15 CYS C    1 1 
        1   178 1 1 15 CYS CA   C    0.073  -2.394  -8.440 1.00 . A A .  15 CYS CA   1 1 
        1   179 1 1 15 CYS CB   C    0.728  -2.087  -7.092 1.00 . A A .  15 CYS CB   1 1 
        1   180 1 1 15 CYS H    H   -1.521  -3.237  -7.332 1.00 . A A .  15 CYS H    1 1 
        1   181 1 1 15 CYS HA   H   -0.157  -1.464  -8.938 1.00 . A A .  15 CYS HA   1 1 
        1   182 1 1 15 CYS HB2  H   -0.013  -1.667  -6.428 1.00 . A A .  15 CYS HB2  1 1 
        1   183 1 1 15 CYS HB3  H    1.105  -3.006  -6.666 1.00 . A A .  15 CYS HB3  1 1 
        1   184 1 1 15 CYS N    N   -1.177  -3.118  -8.242 1.00 . A A .  15 CYS N    1 1 
        1   185 1 1 15 CYS O    O    0.965  -4.423  -9.366 1.00 . A A .  15 CYS O    1 1 
        1   186 1 1 15 CYS SG   S    2.114  -0.910  -7.189 1.00 . A A .  15 CYS SG   1 1 
        1   187 1 1 16 SER C    C    4.319  -2.946 -10.343 1.00 . A A .  16 SER C    1 1 
        1   188 1 1 16 SER CA   C    2.902  -3.136 -10.873 1.00 . A A .  16 SER CA   1 1 
        1   189 1 1 16 SER CB   C    2.797  -2.572 -12.292 1.00 . A A .  16 SER CB   1 1 
        1   190 1 1 16 SER H    H    1.934  -1.514  -9.916 1.00 . A A .  16 SER H    1 1 
        1   191 1 1 16 SER HA   H    2.677  -4.192 -10.898 1.00 . A A .  16 SER HA   1 1 
        1   192 1 1 16 SER HB2  H    1.763  -2.574 -12.601 1.00 . A A .  16 SER HB2  1 1 
        1   193 1 1 16 SER HB3  H    3.174  -1.559 -12.302 1.00 . A A .  16 SER HB3  1 1 
        1   194 1 1 16 SER HG   H    4.395  -3.576 -12.814 1.00 . A A .  16 SER HG   1 1 
        1   195 1 1 16 SER N    N    1.929  -2.491  -9.999 1.00 . A A .  16 SER N    1 1 
        1   196 1 1 16 SER O    O    5.161  -3.837 -10.458 1.00 . A A .  16 SER O    1 1 
        1   197 1 1 16 SER OG   O    3.549  -3.349 -13.207 1.00 . A A .  16 SER OG   1 1 
        1   198 1 1 17 GLU C    C    6.321  -2.532  -8.202 1.00 . A A .  17 GLU C    1 1 
        1   199 1 1 17 GLU CA   C    5.891  -1.472  -9.212 1.00 . A A .  17 GLU CA   1 1 
        1   200 1 1 17 GLU CB   C    5.882  -0.093  -8.548 1.00 . A A .  17 GLU CB   1 1 
        1   201 1 1 17 GLU CD   C    7.408   1.546  -7.379 1.00 . A A .  17 GLU CD   1 1 
        1   202 1 1 17 GLU CG   C    6.988   0.096  -7.523 1.00 . A A .  17 GLU CG   1 1 
        1   203 1 1 17 GLU H    H    3.863  -1.109  -9.698 1.00 . A A .  17 GLU H    1 1 
        1   204 1 1 17 GLU HA   H    6.597  -1.463 -10.029 1.00 . A A .  17 GLU HA   1 1 
        1   205 1 1 17 GLU HB2  H    5.994   0.662  -9.312 1.00 . A A .  17 GLU HB2  1 1 
        1   206 1 1 17 GLU HB3  H    4.933   0.048  -8.052 1.00 . A A .  17 GLU HB3  1 1 
        1   207 1 1 17 GLU HG2  H    6.638  -0.258  -6.565 1.00 . A A .  17 GLU HG2  1 1 
        1   208 1 1 17 GLU HG3  H    7.847  -0.484  -7.828 1.00 . A A .  17 GLU HG3  1 1 
        1   209 1 1 17 GLU N    N    4.575  -1.779  -9.760 1.00 . A A .  17 GLU N    1 1 
        1   210 1 1 17 GLU O    O    7.411  -3.095  -8.302 1.00 . A A .  17 GLU O    1 1 
        1   211 1 1 17 GLU OE1  O    7.125   2.340  -8.299 1.00 . A A .  17 GLU OE1  1 1 
        1   212 1 1 17 GLU OE2  O    8.021   1.885  -6.345 1.00 . A A .  17 GLU OE2  1 1 
        1   213 1 1 18 CYS C    C    4.776  -4.965  -6.289 1.00 . A A .  18 CYS C    1 1 
        1   214 1 1 18 CYS CA   C    5.745  -3.790  -6.199 1.00 . A A .  18 CYS CA   1 1 
        1   215 1 1 18 CYS CB   C    5.663  -3.152  -4.811 1.00 . A A .  18 CYS CB   1 1 
        1   216 1 1 18 CYS H    H    4.603  -2.316  -7.202 1.00 . A A .  18 CYS H    1 1 
        1   217 1 1 18 CYS HA   H    6.748  -4.153  -6.360 1.00 . A A .  18 CYS HA   1 1 
        1   218 1 1 18 CYS HB2  H    6.079  -3.835  -4.085 1.00 . A A .  18 CYS HB2  1 1 
        1   219 1 1 18 CYS HB3  H    6.239  -2.238  -4.808 1.00 . A A .  18 CYS HB3  1 1 
        1   220 1 1 18 CYS N    N    5.456  -2.799  -7.229 1.00 . A A .  18 CYS N    1 1 
        1   221 1 1 18 CYS O    O    5.174  -6.122  -6.161 1.00 . A A .  18 CYS O    1 1 
        1   222 1 1 18 CYS SG   S    3.970  -2.743  -4.279 1.00 . A A .  18 CYS SG   1 1 
        1   223 1 1 19 GLY C    C    1.629  -5.794  -5.375 1.00 . A A .  19 GLY C    1 1 
        1   224 1 1 19 GLY CA   C    2.495  -5.700  -6.615 1.00 . A A .  19 GLY CA   1 1 
        1   225 1 1 19 GLY H    H    3.242  -3.718  -6.605 1.00 . A A .  19 GLY H    1 1 
        1   226 1 1 19 GLY HA2  H    1.865  -5.493  -7.467 1.00 . A A .  19 GLY HA2  1 1 
        1   227 1 1 19 GLY HA3  H    2.990  -6.648  -6.767 1.00 . A A .  19 GLY HA3  1 1 
        1   228 1 1 19 GLY N    N    3.501  -4.659  -6.511 1.00 . A A .  19 GLY N    1 1 
        1   229 1 1 19 GLY O    O    2.000  -6.441  -4.396 1.00 . A A .  19 GLY O    1 1 
        1   230 1 1 20 LYS C    C   -1.879  -4.874  -4.746 1.00 . A A .  20 LYS C    1 1 
        1   231 1 1 20 LYS CA   C   -0.453  -5.156  -4.285 1.00 . A A .  20 LYS CA   1 1 
        1   232 1 1 20 LYS CB   C   -0.028  -4.120  -3.242 1.00 . A A .  20 LYS CB   1 1 
        1   233 1 1 20 LYS CD   C    0.699  -5.300  -1.147 1.00 . A A .  20 LYS CD   1 1 
        1   234 1 1 20 LYS CE   C    0.525  -6.793  -1.379 1.00 . A A .  20 LYS CE   1 1 
        1   235 1 1 20 LYS CG   C   -0.404  -4.500  -1.820 1.00 . A A .  20 LYS CG   1 1 
        1   236 1 1 20 LYS H    H    0.229  -4.645  -6.223 1.00 . A A .  20 LYS H    1 1 
        1   237 1 1 20 LYS HA   H   -0.419  -6.138  -3.839 1.00 . A A .  20 LYS HA   1 1 
        1   238 1 1 20 LYS HB2  H    1.044  -3.998  -3.289 1.00 . A A .  20 LYS HB2  1 1 
        1   239 1 1 20 LYS HB3  H   -0.500  -3.177  -3.477 1.00 . A A .  20 LYS HB3  1 1 
        1   240 1 1 20 LYS HD2  H    1.652  -4.993  -1.550 1.00 . A A .  20 LYS HD2  1 1 
        1   241 1 1 20 LYS HD3  H    0.676  -5.104  -0.084 1.00 . A A .  20 LYS HD3  1 1 
        1   242 1 1 20 LYS HE2  H   -0.508  -7.053  -1.207 1.00 . A A .  20 LYS HE2  1 1 
        1   243 1 1 20 LYS HE3  H    0.788  -7.018  -2.402 1.00 . A A .  20 LYS HE3  1 1 
        1   244 1 1 20 LYS HG2  H   -0.579  -3.599  -1.251 1.00 . A A .  20 LYS HG2  1 1 
        1   245 1 1 20 LYS HG3  H   -1.306  -5.095  -1.842 1.00 . A A .  20 LYS HG3  1 1 
        1   246 1 1 20 LYS HZ1  H    2.082  -8.139  -1.021 1.00 . A A .  20 LYS HZ1  1 1 
        1   247 1 1 20 LYS HZ2  H    0.801  -8.264   0.078 1.00 . A A .  20 LYS HZ2  1 1 
        1   248 1 1 20 LYS HZ3  H    1.890  -6.975   0.191 1.00 . A A .  20 LYS HZ3  1 1 
        1   249 1 1 20 LYS N    N    0.470  -5.144  -5.414 1.00 . A A .  20 LYS N    1 1 
        1   250 1 1 20 LYS NZ   N    1.385  -7.599  -0.469 1.00 . A A .  20 LYS NZ   1 1 
        1   251 1 1 20 LYS O    O   -2.174  -3.795  -5.259 1.00 . A A .  20 LYS O    1 1 
        1   252 1 1 21 SER C    C   -4.942  -4.919  -3.913 1.00 . A A .  21 SER C    1 1 
        1   253 1 1 21 SER CA   C   -4.156  -5.708  -4.957 1.00 . A A .  21 SER CA   1 1 
        1   254 1 1 21 SER CB   C   -4.795  -7.084  -5.159 1.00 . A A .  21 SER CB   1 1 
        1   255 1 1 21 SER H    H   -2.465  -6.688  -4.144 1.00 . A A .  21 SER H    1 1 
        1   256 1 1 21 SER HA   H   -4.181  -5.169  -5.892 1.00 . A A .  21 SER HA   1 1 
        1   257 1 1 21 SER HB2  H   -4.525  -7.727  -4.336 1.00 . A A .  21 SER HB2  1 1 
        1   258 1 1 21 SER HB3  H   -5.869  -6.977  -5.196 1.00 . A A .  21 SER HB3  1 1 
        1   259 1 1 21 SER HG   H   -4.255  -7.001  -7.040 1.00 . A A .  21 SER HG   1 1 
        1   260 1 1 21 SER N    N   -2.761  -5.851  -4.558 1.00 . A A .  21 SER N    1 1 
        1   261 1 1 21 SER O    O   -4.516  -4.792  -2.765 1.00 . A A .  21 SER O    1 1 
        1   262 1 1 21 SER OG   O   -4.353  -7.678  -6.367 1.00 . A A .  21 SER OG   1 1 
        1   263 1 1 22 PHE C    C   -8.386  -3.622  -3.898 1.00 . A A .  22 PHE C    1 1 
        1   264 1 1 22 PHE CA   C   -6.936  -3.612  -3.424 1.00 . A A .  22 PHE CA   1 1 
        1   265 1 1 22 PHE CB   C   -6.428  -2.172  -3.330 1.00 . A A .  22 PHE CB   1 1 
        1   266 1 1 22 PHE CD1  C   -4.862  -2.210  -1.369 1.00 . A A .  22 PHE CD1  1 1 
        1   267 1 1 22 PHE CD2  C   -3.954  -1.802  -3.536 1.00 . A A .  22 PHE CD2  1 1 
        1   268 1 1 22 PHE CE1  C   -3.600  -2.106  -0.817 1.00 . A A .  22 PHE CE1  1 1 
        1   269 1 1 22 PHE CE2  C   -2.689  -1.696  -2.990 1.00 . A A .  22 PHE CE2  1 1 
        1   270 1 1 22 PHE CG   C   -5.054  -2.059  -2.733 1.00 . A A .  22 PHE CG   1 1 
        1   271 1 1 22 PHE CZ   C   -2.511  -1.850  -1.629 1.00 . A A .  22 PHE CZ   1 1 
        1   272 1 1 22 PHE H    H   -6.376  -4.526  -5.250 1.00 . A A .  22 PHE H    1 1 
        1   273 1 1 22 PHE HA   H   -6.886  -4.067  -2.446 1.00 . A A .  22 PHE HA   1 1 
        1   274 1 1 22 PHE HB2  H   -6.394  -1.745  -4.321 1.00 . A A .  22 PHE HB2  1 1 
        1   275 1 1 22 PHE HB3  H   -7.106  -1.598  -2.717 1.00 . A A .  22 PHE HB3  1 1 
        1   276 1 1 22 PHE HD1  H   -5.712  -2.412  -0.734 1.00 . A A .  22 PHE HD1  1 1 
        1   277 1 1 22 PHE HD2  H   -4.092  -1.682  -4.601 1.00 . A A .  22 PHE HD2  1 1 
        1   278 1 1 22 PHE HE1  H   -3.463  -2.226   0.247 1.00 . A A .  22 PHE HE1  1 1 
        1   279 1 1 22 PHE HE2  H   -1.840  -1.496  -3.627 1.00 . A A .  22 PHE HE2  1 1 
        1   280 1 1 22 PHE HZ   H   -1.524  -1.767  -1.200 1.00 . A A .  22 PHE HZ   1 1 
        1   281 1 1 22 PHE N    N   -6.090  -4.390  -4.322 1.00 . A A .  22 PHE N    1 1 
        1   282 1 1 22 PHE O    O   -8.658  -3.633  -5.098 1.00 . A A .  22 PHE O    1 1 
        1   283 1 1 23 SER C    C  -11.217  -2.237  -3.659 1.00 . A A .  23 SER C    1 1 
        1   284 1 1 23 SER CA   C  -10.737  -3.630  -3.264 1.00 . A A .  23 SER CA   1 1 
        1   285 1 1 23 SER CB   C  -11.544  -4.142  -2.070 1.00 . A A .  23 SER CB   1 1 
        1   286 1 1 23 SER H    H   -9.034  -3.608  -2.006 1.00 . A A .  23 SER H    1 1 
        1   287 1 1 23 SER HA   H  -10.883  -4.298  -4.100 1.00 . A A .  23 SER HA   1 1 
        1   288 1 1 23 SER HB2  H  -11.158  -5.101  -1.762 1.00 . A A .  23 SER HB2  1 1 
        1   289 1 1 23 SER HB3  H  -11.457  -3.440  -1.253 1.00 . A A .  23 SER HB3  1 1 
        1   290 1 1 23 SER HG   H  -13.419  -4.471  -1.610 1.00 . A A .  23 SER HG   1 1 
        1   291 1 1 23 SER N    N   -9.314  -3.617  -2.946 1.00 . A A .  23 SER N    1 1 
        1   292 1 1 23 SER O    O  -11.828  -1.529  -2.859 1.00 . A A .  23 SER O    1 1 
        1   293 1 1 23 SER OG   O  -12.914  -4.286  -2.404 1.00 . A A .  23 SER OG   1 1 
        1   294 1 1 24 GLY C    C  -10.172   0.307  -5.823 1.00 . A A .  24 GLY C    1 1 
        1   295 1 1 24 GLY CA   C  -11.346  -0.543  -5.379 1.00 . A A .  24 GLY CA   1 1 
        1   296 1 1 24 GLY H    H  -10.446  -2.456  -5.493 1.00 . A A .  24 GLY H    1 1 
        1   297 1 1 24 GLY HA2  H  -12.019  -0.673  -6.214 1.00 . A A .  24 GLY HA2  1 1 
        1   298 1 1 24 GLY HA3  H  -11.868  -0.028  -4.586 1.00 . A A .  24 GLY HA3  1 1 
        1   299 1 1 24 GLY N    N  -10.936  -1.849  -4.899 1.00 . A A .  24 GLY N    1 1 
        1   300 1 1 24 GLY O    O   -9.088   0.230  -5.244 1.00 . A A .  24 GLY O    1 1 
        1   301 1 1 25 SER C    C   -8.853   2.960  -6.311 1.00 . A A .  25 SER C    1 1 
        1   302 1 1 25 SER CA   C   -9.335   1.982  -7.378 1.00 . A A .  25 SER CA   1 1 
        1   303 1 1 25 SER CB   C   -9.840   2.751  -8.601 1.00 . A A .  25 SER CB   1 1 
        1   304 1 1 25 SER H    H  -11.272   1.134  -7.273 1.00 . A A .  25 SER H    1 1 
        1   305 1 1 25 SER HA   H   -8.508   1.354  -7.675 1.00 . A A .  25 SER HA   1 1 
        1   306 1 1 25 SER HB2  H  -10.440   2.095  -9.213 1.00 . A A .  25 SER HB2  1 1 
        1   307 1 1 25 SER HB3  H  -10.440   3.587  -8.274 1.00 . A A .  25 SER HB3  1 1 
        1   308 1 1 25 SER HG   H   -8.938   3.082 -10.308 1.00 . A A .  25 SER HG   1 1 
        1   309 1 1 25 SER N    N  -10.386   1.118  -6.854 1.00 . A A .  25 SER N    1 1 
        1   310 1 1 25 SER O    O   -7.666   3.008  -5.987 1.00 . A A .  25 SER O    1 1 
        1   311 1 1 25 SER OG   O   -8.760   3.239  -9.378 1.00 . A A .  25 SER OG   1 1 
        1   312 1 1 26 TYR C    C   -8.428   4.157  -3.761 1.00 . A A .  26 TYR C    1 1 
        1   313 1 1 26 TYR CA   C   -9.454   4.719  -4.741 1.00 . A A .  26 TYR CA   1 1 
        1   314 1 1 26 TYR CB   C  -10.716   5.143  -3.988 1.00 . A A .  26 TYR CB   1 1 
        1   315 1 1 26 TYR CD1  C   -9.579   6.844  -2.508 1.00 . A A .  26 TYR CD1  1 1 
        1   316 1 1 26 TYR CD2  C  -11.569   7.495  -3.648 1.00 . A A .  26 TYR CD2  1 1 
        1   317 1 1 26 TYR CE1  C   -9.487   8.100  -1.941 1.00 . A A .  26 TYR CE1  1 1 
        1   318 1 1 26 TYR CE2  C  -11.484   8.754  -3.087 1.00 . A A .  26 TYR CE2  1 1 
        1   319 1 1 26 TYR CG   C  -10.619   6.519  -3.370 1.00 . A A .  26 TYR CG   1 1 
        1   320 1 1 26 TYR CZ   C  -10.442   9.052  -2.233 1.00 . A A .  26 TYR CZ   1 1 
        1   321 1 1 26 TYR H    H  -10.712   3.655  -6.069 1.00 . A A .  26 TYR H    1 1 
        1   322 1 1 26 TYR HA   H   -9.031   5.585  -5.230 1.00 . A A .  26 TYR HA   1 1 
        1   323 1 1 26 TYR HB2  H  -11.551   5.145  -4.671 1.00 . A A .  26 TYR HB2  1 1 
        1   324 1 1 26 TYR HB3  H  -10.908   4.435  -3.195 1.00 . A A .  26 TYR HB3  1 1 
        1   325 1 1 26 TYR HD1  H   -8.833   6.096  -2.282 1.00 . A A .  26 TYR HD1  1 1 
        1   326 1 1 26 TYR HD2  H  -12.384   7.259  -4.317 1.00 . A A .  26 TYR HD2  1 1 
        1   327 1 1 26 TYR HE1  H   -8.671   8.334  -1.273 1.00 . A A .  26 TYR HE1  1 1 
        1   328 1 1 26 TYR HE2  H  -12.232   9.500  -3.315 1.00 . A A .  26 TYR HE2  1 1 
        1   329 1 1 26 TYR HH   H  -10.668  10.271  -0.764 1.00 . A A .  26 TYR HH   1 1 
        1   330 1 1 26 TYR N    N   -9.782   3.739  -5.769 1.00 . A A .  26 TYR N    1 1 
        1   331 1 1 26 TYR O    O   -7.425   4.803  -3.457 1.00 . A A .  26 TYR O    1 1 
        1   332 1 1 26 TYR OH   O  -10.354  10.305  -1.671 1.00 . A A .  26 TYR OH   1 1 
        1   333 1 1 27 ARG C    C   -6.366   2.246  -2.876 1.00 . A A .  27 ARG C    1 1 
        1   334 1 1 27 ARG CA   C   -7.788   2.300  -2.325 1.00 . A A .  27 ARG CA   1 1 
        1   335 1 1 27 ARG CB   C   -8.279   0.885  -2.012 1.00 . A A .  27 ARG CB   1 1 
        1   336 1 1 27 ARG CD   C   -9.384  -0.553  -0.272 1.00 . A A .  27 ARG CD   1 1 
        1   337 1 1 27 ARG CG   C   -9.310   0.831  -0.896 1.00 . A A .  27 ARG CG   1 1 
        1   338 1 1 27 ARG CZ   C  -10.915  -0.297   1.635 1.00 . A A .  27 ARG CZ   1 1 
        1   339 1 1 27 ARG H    H   -9.504   2.485  -3.551 1.00 . A A .  27 ARG H    1 1 
        1   340 1 1 27 ARG HA   H   -7.787   2.881  -1.415 1.00 . A A .  27 ARG HA   1 1 
        1   341 1 1 27 ARG HB2  H   -8.723   0.465  -2.902 1.00 . A A .  27 ARG HB2  1 1 
        1   342 1 1 27 ARG HB3  H   -7.434   0.280  -1.720 1.00 . A A .  27 ARG HB3  1 1 
        1   343 1 1 27 ARG HD2  H   -9.281  -1.292  -1.053 1.00 . A A .  27 ARG HD2  1 1 
        1   344 1 1 27 ARG HD3  H   -8.573  -0.659   0.433 1.00 . A A .  27 ARG HD3  1 1 
        1   345 1 1 27 ARG HE   H  -11.334  -1.303  -0.036 1.00 . A A .  27 ARG HE   1 1 
        1   346 1 1 27 ARG HG2  H   -9.038   1.544  -0.132 1.00 . A A .  27 ARG HG2  1 1 
        1   347 1 1 27 ARG HG3  H  -10.278   1.087  -1.301 1.00 . A A .  27 ARG HG3  1 1 
        1   348 1 1 27 ARG HH11 H   -9.123   0.608   1.856 1.00 . A A .  27 ARG HH11 1 1 
        1   349 1 1 27 ARG HH12 H  -10.211   0.781   3.193 1.00 . A A .  27 ARG HH12 1 1 
        1   350 1 1 27 ARG HH21 H  -12.776  -1.082   1.717 1.00 . A A .  27 ARG HH21 1 1 
        1   351 1 1 27 ARG HH22 H  -12.289  -0.182   3.113 1.00 . A A .  27 ARG HH22 1 1 
        1   352 1 1 27 ARG N    N   -8.688   2.950  -3.271 1.00 . A A .  27 ARG N    1 1 
        1   353 1 1 27 ARG NE   N  -10.649  -0.773   0.423 1.00 . A A .  27 ARG NE   1 1 
        1   354 1 1 27 ARG NH1  N  -10.008   0.422   2.281 1.00 . A A .  27 ARG NH1  1 1 
        1   355 1 1 27 ARG NH2  N  -12.090  -0.540   2.201 1.00 . A A .  27 ARG NH2  1 1 
        1   356 1 1 27 ARG O    O   -5.414   2.649  -2.207 1.00 . A A .  27 ARG O    1 1 
        1   357 1 1 28 LEU C    C   -4.092   2.892  -4.494 1.00 . A A .  28 LEU C    1 1 
        1   358 1 1 28 LEU CA   C   -4.924   1.637  -4.740 1.00 . A A .  28 LEU CA   1 1 
        1   359 1 1 28 LEU CB   C   -5.090   1.408  -6.244 1.00 . A A .  28 LEU CB   1 1 
        1   360 1 1 28 LEU CD1  C   -3.209  -0.204  -6.625 1.00 . A A .  28 LEU CD1  1 1 
        1   361 1 1 28 LEU CD2  C   -4.075   1.175  -8.524 1.00 . A A .  28 LEU CD2  1 1 
        1   362 1 1 28 LEU CG   C   -3.805   1.136  -7.027 1.00 . A A .  28 LEU CG   1 1 
        1   363 1 1 28 LEU H    H   -7.025   1.440  -4.582 1.00 . A A .  28 LEU H    1 1 
        1   364 1 1 28 LEU HA   H   -4.412   0.790  -4.309 1.00 . A A .  28 LEU HA   1 1 
        1   365 1 1 28 LEU HB2  H   -5.745   0.561  -6.379 1.00 . A A .  28 LEU HB2  1 1 
        1   366 1 1 28 LEU HB3  H   -5.554   2.290  -6.662 1.00 . A A .  28 LEU HB3  1 1 
        1   367 1 1 28 LEU HD11 H   -2.461  -0.496  -7.347 1.00 . A A .  28 LEU HD11 1 1 
        1   368 1 1 28 LEU HD12 H   -3.989  -0.950  -6.594 1.00 . A A .  28 LEU HD12 1 1 
        1   369 1 1 28 LEU HD13 H   -2.754  -0.118  -5.649 1.00 . A A .  28 LEU HD13 1 1 
        1   370 1 1 28 LEU HD21 H   -5.132   1.047  -8.703 1.00 . A A .  28 LEU HD21 1 1 
        1   371 1 1 28 LEU HD22 H   -3.528   0.379  -9.008 1.00 . A A .  28 LEU HD22 1 1 
        1   372 1 1 28 LEU HD23 H   -3.754   2.127  -8.923 1.00 . A A .  28 LEU HD23 1 1 
        1   373 1 1 28 LEU HG   H   -3.081   1.906  -6.796 1.00 . A A .  28 LEU HG   1 1 
        1   374 1 1 28 LEU N    N   -6.230   1.745  -4.099 1.00 . A A .  28 LEU N    1 1 
        1   375 1 1 28 LEU O    O   -2.979   2.820  -3.971 1.00 . A A .  28 LEU O    1 1 
        1   376 1 1 29 THR C    C   -3.191   5.345  -3.370 1.00 . A A .  29 THR C    1 1 
        1   377 1 1 29 THR CA   C   -3.948   5.313  -4.693 1.00 . A A .  29 THR CA   1 1 
        1   378 1 1 29 THR CB   C   -4.931   6.498  -4.738 1.00 . A A .  29 THR CB   1 1 
        1   379 1 1 29 THR CG2  C   -4.187   7.822  -4.638 1.00 . A A .  29 THR CG2  1 1 
        1   380 1 1 29 THR H    H   -5.528   4.035  -5.285 1.00 . A A .  29 THR H    1 1 
        1   381 1 1 29 THR HA   H   -3.242   5.427  -5.504 1.00 . A A .  29 THR HA   1 1 
        1   382 1 1 29 THR HB   H   -5.606   6.418  -3.898 1.00 . A A .  29 THR HB   1 1 
        1   383 1 1 29 THR HG1  H   -6.417   7.084  -5.894 1.00 . A A .  29 THR HG1  1 1 
        1   384 1 1 29 THR HG21 H   -3.593   7.968  -5.527 1.00 . A A .  29 THR HG21 1 1 
        1   385 1 1 29 THR HG22 H   -3.542   7.808  -3.772 1.00 . A A .  29 THR HG22 1 1 
        1   386 1 1 29 THR HG23 H   -4.899   8.628  -4.543 1.00 . A A .  29 THR HG23 1 1 
        1   387 1 1 29 THR N    N   -4.639   4.043  -4.873 1.00 . A A .  29 THR N    1 1 
        1   388 1 1 29 THR O    O   -1.963   5.416  -3.350 1.00 . A A .  29 THR O    1 1 
        1   389 1 1 29 THR OG1  O   -5.688   6.461  -5.952 1.00 . A A .  29 THR OG1  1 1 
        1   390 1 1 30 GLN C    C   -2.028   4.516  -0.921 1.00 . A A .  30 GLN C    1 1 
        1   391 1 1 30 GLN CA   C   -3.329   5.313  -0.941 1.00 . A A .  30 GLN CA   1 1 
        1   392 1 1 30 GLN CB   C   -4.303   4.748   0.094 1.00 . A A .  30 GLN CB   1 1 
        1   393 1 1 30 GLN CD   C   -6.073   5.323   1.803 1.00 . A A .  30 GLN CD   1 1 
        1   394 1 1 30 GLN CG   C   -5.378   5.735   0.520 1.00 . A A .  30 GLN CG   1 1 
        1   395 1 1 30 GLN H    H   -4.906   5.234  -2.350 1.00 . A A .  30 GLN H    1 1 
        1   396 1 1 30 GLN HA   H   -3.111   6.341  -0.694 1.00 . A A .  30 GLN HA   1 1 
        1   397 1 1 30 GLN HB2  H   -4.787   3.877  -0.322 1.00 . A A .  30 GLN HB2  1 1 
        1   398 1 1 30 GLN HB3  H   -3.746   4.455   0.972 1.00 . A A .  30 GLN HB3  1 1 
        1   399 1 1 30 GLN HE21 H   -7.452   6.730   1.536 1.00 . A A .  30 GLN HE21 1 1 
        1   400 1 1 30 GLN HE22 H   -7.631   5.763   2.956 1.00 . A A .  30 GLN HE22 1 1 
        1   401 1 1 30 GLN HG2  H   -4.922   6.702   0.670 1.00 . A A .  30 GLN HG2  1 1 
        1   402 1 1 30 GLN HG3  H   -6.116   5.804  -0.266 1.00 . A A .  30 GLN HG3  1 1 
        1   403 1 1 30 GLN N    N   -3.932   5.290  -2.268 1.00 . A A .  30 GLN N    1 1 
        1   404 1 1 30 GLN NE2  N   -7.162   6.008   2.133 1.00 . A A .  30 GLN NE2  1 1 
        1   405 1 1 30 GLN O    O   -1.012   4.981  -0.404 1.00 . A A .  30 GLN O    1 1 
        1   406 1 1 30 GLN OE1  O   -5.636   4.400   2.490 1.00 . A A .  30 GLN OE1  1 1 
        1   407 1 1 31 HIS C    C    0.188   3.055  -2.427 1.00 . A A .  31 HIS C    1 1 
        1   408 1 1 31 HIS CA   C   -0.891   2.453  -1.532 1.00 . A A .  31 HIS CA   1 1 
        1   409 1 1 31 HIS CB   C   -1.272   1.061  -2.039 1.00 . A A .  31 HIS CB   1 1 
        1   410 1 1 31 HIS CD2  C    0.107  -0.081  -3.916 1.00 . A A .  31 HIS CD2  1 1 
        1   411 1 1 31 HIS CE1  C    1.800  -0.762  -2.701 1.00 . A A .  31 HIS CE1  1 1 
        1   412 1 1 31 HIS CG   C   -0.125   0.308  -2.641 1.00 . A A .  31 HIS CG   1 1 
        1   413 1 1 31 HIS H    H   -2.907   2.999  -1.881 1.00 . A A .  31 HIS H    1 1 
        1   414 1 1 31 HIS HA   H   -0.503   2.367  -0.529 1.00 . A A .  31 HIS HA   1 1 
        1   415 1 1 31 HIS HB2  H   -1.655   0.478  -1.215 1.00 . A A .  31 HIS HB2  1 1 
        1   416 1 1 31 HIS HB3  H   -2.039   1.157  -2.794 1.00 . A A .  31 HIS HB3  1 1 
        1   417 1 1 31 HIS HD1  H    1.080  -0.006  -0.941 1.00 . A A .  31 HIS HD1  1 1 
        1   418 1 1 31 HIS HD2  H   -0.534   0.097  -4.768 1.00 . A A .  31 HIS HD2  1 1 
        1   419 1 1 31 HIS HE1  H    2.734  -1.214  -2.402 1.00 . A A .  31 HIS HE1  1 1 
        1   420 1 1 31 HIS N    N   -2.067   3.314  -1.486 1.00 . A A .  31 HIS N    1 1 
        1   421 1 1 31 HIS ND1  N    0.954  -0.134  -1.904 1.00 . A A .  31 HIS ND1  1 1 
        1   422 1 1 31 HIS NE2  N    1.309  -0.744  -3.927 1.00 . A A .  31 HIS NE2  1 1 
        1   423 1 1 31 HIS O    O    1.334   3.218  -2.008 1.00 . A A .  31 HIS O    1 1 
        1   424 1 1 32 TRP C    C    1.580   5.066  -3.956 1.00 . A A .  32 TRP C    1 1 
        1   425 1 1 32 TRP CA   C    0.751   3.966  -4.611 1.00 . A A .  32 TRP CA   1 1 
        1   426 1 1 32 TRP CB   C   -0.001   4.528  -5.818 1.00 . A A .  32 TRP CB   1 1 
        1   427 1 1 32 TRP CD1  C   -0.652   2.247  -6.788 1.00 . A A .  32 TRP CD1  1 1 
        1   428 1 1 32 TRP CD2  C    0.066   3.723  -8.311 1.00 . A A .  32 TRP CD2  1 1 
        1   429 1 1 32 TRP CE2  C   -0.257   2.520  -8.968 1.00 . A A .  32 TRP CE2  1 1 
        1   430 1 1 32 TRP CE3  C    0.538   4.799  -9.068 1.00 . A A .  32 TRP CE3  1 1 
        1   431 1 1 32 TRP CG   C   -0.195   3.527  -6.917 1.00 . A A .  32 TRP CG   1 1 
        1   432 1 1 32 TRP CH2  C    0.344   3.434 -11.062 1.00 . A A .  32 TRP CH2  1 1 
        1   433 1 1 32 TRP CZ2  C   -0.120   2.365 -10.345 1.00 . A A .  32 TRP CZ2  1 1 
        1   434 1 1 32 TRP CZ3  C    0.673   4.643 -10.434 1.00 . A A .  32 TRP CZ3  1 1 
        1   435 1 1 32 TRP H    H   -1.114   3.229  -3.933 1.00 . A A .  32 TRP H    1 1 
        1   436 1 1 32 TRP HA   H    1.414   3.182  -4.945 1.00 . A A .  32 TRP HA   1 1 
        1   437 1 1 32 TRP HB2  H   -0.976   4.867  -5.501 1.00 . A A .  32 TRP HB2  1 1 
        1   438 1 1 32 TRP HB3  H    0.553   5.364  -6.221 1.00 . A A .  32 TRP HB3  1 1 
        1   439 1 1 32 TRP HD1  H   -0.935   1.794  -5.850 1.00 . A A .  32 TRP HD1  1 1 
        1   440 1 1 32 TRP HE1  H   -0.985   0.715  -8.186 1.00 . A A .  32 TRP HE1  1 1 
        1   441 1 1 32 TRP HE3  H    0.797   5.739  -8.603 1.00 . A A .  32 TRP HE3  1 1 
        1   442 1 1 32 TRP HH2  H    0.466   3.357 -12.131 1.00 . A A .  32 TRP HH2  1 1 
        1   443 1 1 32 TRP HZ2  H   -0.370   1.440 -10.844 1.00 . A A .  32 TRP HZ2  1 1 
        1   444 1 1 32 TRP HZ3  H    1.037   5.463 -11.036 1.00 . A A .  32 TRP HZ3  1 1 
        1   445 1 1 32 TRP N    N   -0.186   3.383  -3.658 1.00 . A A .  32 TRP N    1 1 
        1   446 1 1 32 TRP NE1  N   -0.691   1.635  -8.017 1.00 . A A .  32 TRP NE1  1 1 
        1   447 1 1 32 TRP O    O    2.665   5.404  -4.431 1.00 . A A .  32 TRP O    1 1 
        1   448 1 1 33 ILE C    C    3.180   6.261  -1.787 1.00 . A A .  33 ILE C    1 1 
        1   449 1 1 33 ILE CA   C    1.758   6.680  -2.145 1.00 . A A .  33 ILE CA   1 1 
        1   450 1 1 33 ILE CB   C    1.009   7.069  -0.856 1.00 . A A .  33 ILE CB   1 1 
        1   451 1 1 33 ILE CD1  C   -0.458   8.954  -1.736 1.00 . A A .  33 ILE CD1  1 1 
        1   452 1 1 33 ILE CG1  C   -0.407   7.545  -1.187 1.00 . A A .  33 ILE CG1  1 1 
        1   453 1 1 33 ILE CG2  C    1.775   8.148  -0.105 1.00 . A A .  33 ILE CG2  1 1 
        1   454 1 1 33 ILE H    H    0.195   5.307  -2.535 1.00 . A A .  33 ILE H    1 1 
        1   455 1 1 33 ILE HA   H    1.800   7.547  -2.789 1.00 . A A .  33 ILE HA   1 1 
        1   456 1 1 33 ILE HB   H    0.949   6.197  -0.224 1.00 . A A .  33 ILE HB   1 1 
        1   457 1 1 33 ILE HD11 H   -1.452   9.161  -2.105 1.00 . A A .  33 ILE HD11 1 1 
        1   458 1 1 33 ILE HD12 H   -0.213   9.655  -0.952 1.00 . A A .  33 ILE HD12 1 1 
        1   459 1 1 33 ILE HD13 H    0.252   9.053  -2.543 1.00 . A A .  33 ILE HD13 1 1 
        1   460 1 1 33 ILE HG12 H   -0.838   6.887  -1.925 1.00 . A A .  33 ILE HG12 1 1 
        1   461 1 1 33 ILE HG13 H   -1.007   7.516  -0.289 1.00 . A A .  33 ILE HG13 1 1 
        1   462 1 1 33 ILE HG21 H    1.793   9.053  -0.694 1.00 . A A .  33 ILE HG21 1 1 
        1   463 1 1 33 ILE HG22 H    1.287   8.344   0.839 1.00 . A A .  33 ILE HG22 1 1 
        1   464 1 1 33 ILE HG23 H    2.785   7.814   0.075 1.00 . A A .  33 ILE HG23 1 1 
        1   465 1 1 33 ILE N    N    1.063   5.619  -2.865 1.00 . A A .  33 ILE N    1 1 
        1   466 1 1 33 ILE O    O    4.136   6.999  -2.026 1.00 . A A .  33 ILE O    1 1 
        1   467 1 1 34 THR C    C    5.625   4.683  -1.958 1.00 . A A .  34 THR C    1 1 
        1   468 1 1 34 THR CA   C    4.618   4.552  -0.821 1.00 . A A .  34 THR CA   1 1 
        1   469 1 1 34 THR CB   C    4.531   3.074  -0.395 1.00 . A A .  34 THR CB   1 1 
        1   470 1 1 34 THR CG2  C    4.329   2.173  -1.604 1.00 . A A .  34 THR CG2  1 1 
        1   471 1 1 34 THR H    H    2.514   4.528  -1.046 1.00 . A A .  34 THR H    1 1 
        1   472 1 1 34 THR HA   H    4.966   5.128   0.024 1.00 . A A .  34 THR HA   1 1 
        1   473 1 1 34 THR HB   H    3.686   2.956   0.269 1.00 . A A .  34 THR HB   1 1 
        1   474 1 1 34 THR HG1  H    5.873   1.750   0.184 1.00 . A A .  34 THR HG1  1 1 
        1   475 1 1 34 THR HG21 H    3.405   2.435  -2.097 1.00 . A A .  34 THR HG21 1 1 
        1   476 1 1 34 THR HG22 H    4.287   1.143  -1.283 1.00 . A A .  34 THR HG22 1 1 
        1   477 1 1 34 THR HG23 H    5.152   2.303  -2.291 1.00 . A A .  34 THR HG23 1 1 
        1   478 1 1 34 THR N    N    3.313   5.070  -1.212 1.00 . A A .  34 THR N    1 1 
        1   479 1 1 34 THR O    O    6.835   4.642  -1.736 1.00 . A A .  34 THR O    1 1 
        1   480 1 1 34 THR OG1  O    5.725   2.692   0.297 1.00 . A A .  34 THR OG1  1 1 
        1   481 1 1 35 HIS C    C    6.245   6.449  -4.653 1.00 . A A .  35 HIS C    1 1 
        1   482 1 1 35 HIS CA   C    5.973   4.978  -4.349 1.00 . A A .  35 HIS CA   1 1 
        1   483 1 1 35 HIS CB   C    5.327   4.306  -5.561 1.00 . A A .  35 HIS CB   1 1 
        1   484 1 1 35 HIS CD2  C    3.891   2.147  -5.600 1.00 . A A .  35 HIS CD2  1 1 
        1   485 1 1 35 HIS CE1  C    5.362   0.768  -4.739 1.00 . A A .  35 HIS CE1  1 1 
        1   486 1 1 35 HIS CG   C    5.015   2.857  -5.346 1.00 . A A .  35 HIS CG   1 1 
        1   487 1 1 35 HIS H    H    4.144   4.864  -3.289 1.00 . A A .  35 HIS H    1 1 
        1   488 1 1 35 HIS HA   H    6.911   4.489  -4.135 1.00 . A A .  35 HIS HA   1 1 
        1   489 1 1 35 HIS HB2  H    4.402   4.813  -5.795 1.00 . A A .  35 HIS HB2  1 1 
        1   490 1 1 35 HIS HB3  H    5.996   4.381  -6.406 1.00 . A A .  35 HIS HB3  1 1 
        1   491 1 1 35 HIS HD1  H    6.828   2.177  -4.516 1.00 . A A .  35 HIS HD1  1 1 
        1   492 1 1 35 HIS HD2  H    2.974   2.527  -6.028 1.00 . A A .  35 HIS HD2  1 1 
        1   493 1 1 35 HIS HE1  H    5.833  -0.127  -4.360 1.00 . A A .  35 HIS HE1  1 1 
        1   494 1 1 35 HIS N    N    5.117   4.840  -3.176 1.00 . A A .  35 HIS N    1 1 
        1   495 1 1 35 HIS ND1  N    5.917   1.965  -4.806 1.00 . A A .  35 HIS ND1  1 1 
        1   496 1 1 35 HIS NE2  N    4.133   0.851  -5.215 1.00 . A A .  35 HIS NE2  1 1 
        1   497 1 1 35 HIS O    O    6.609   6.806  -5.774 1.00 . A A .  35 HIS O    1 1 
        1   498 1 1 36 THR C    C    7.337   9.237  -2.823 1.00 . A A .  36 THR C    1 1 
        1   499 1 1 36 THR CA   C    6.288   8.731  -3.807 1.00 . A A .  36 THR CA   1 1 
        1   500 1 1 36 THR CB   C    4.986   9.528  -3.607 1.00 . A A .  36 THR CB   1 1 
        1   501 1 1 36 THR CG2  C    5.224  11.015  -3.823 1.00 . A A .  36 THR CG2  1 1 
        1   502 1 1 36 THR H    H    5.774   6.954  -2.777 1.00 . A A .  36 THR H    1 1 
        1   503 1 1 36 THR HA   H    6.640   8.903  -4.814 1.00 . A A .  36 THR HA   1 1 
        1   504 1 1 36 THR HB   H    4.641   9.377  -2.595 1.00 . A A .  36 THR HB   1 1 
        1   505 1 1 36 THR HG1  H    4.031   9.569  -5.332 1.00 . A A .  36 THR HG1  1 1 
        1   506 1 1 36 THR HG21 H    6.108  11.319  -3.284 1.00 . A A .  36 THR HG21 1 1 
        1   507 1 1 36 THR HG22 H    4.373  11.572  -3.460 1.00 . A A .  36 THR HG22 1 1 
        1   508 1 1 36 THR HG23 H    5.358  11.209  -4.876 1.00 . A A .  36 THR HG23 1 1 
        1   509 1 1 36 THR N    N    6.065   7.299  -3.647 1.00 . A A .  36 THR N    1 1 
        1   510 1 1 36 THR O    O    8.278   9.932  -3.207 1.00 . A A .  36 THR O    1 1 
        1   511 1 1 36 THR OG1  O    3.982   9.064  -4.517 1.00 . A A .  36 THR OG1  1 1 
        1   512 1 1 37 ARG C    C    9.428   8.560  -0.642 1.00 . A A .  37 ARG C    1 1 
        1   513 1 1 37 ARG CA   C    8.101   9.303  -0.514 1.00 . A A .  37 ARG CA   1 1 
        1   514 1 1 37 ARG CB   C    7.499   9.057   0.871 1.00 . A A .  37 ARG CB   1 1 
        1   515 1 1 37 ARG CD   C    6.488   7.368   2.435 1.00 . A A .  37 ARG CD   1 1 
        1   516 1 1 37 ARG CG   C    7.408   7.586   1.243 1.00 . A A .  37 ARG CG   1 1 
        1   517 1 1 37 ARG CZ   C    7.464   8.576   4.341 1.00 . A A .  37 ARG CZ   1 1 
        1   518 1 1 37 ARG H    H    6.399   8.328  -1.309 1.00 . A A .  37 ARG H    1 1 
        1   519 1 1 37 ARG HA   H    8.281  10.360  -0.636 1.00 . A A .  37 ARG HA   1 1 
        1   520 1 1 37 ARG HB2  H    8.109   9.555   1.610 1.00 . A A .  37 ARG HB2  1 1 
        1   521 1 1 37 ARG HB3  H    6.504   9.474   0.897 1.00 . A A .  37 ARG HB3  1 1 
        1   522 1 1 37 ARG HD2  H    5.722   8.129   2.424 1.00 . A A .  37 ARG HD2  1 1 
        1   523 1 1 37 ARG HD3  H    6.030   6.395   2.345 1.00 . A A .  37 ARG HD3  1 1 
        1   524 1 1 37 ARG HE   H    7.518   6.597   4.097 1.00 . A A .  37 ARG HE   1 1 
        1   525 1 1 37 ARG HG2  H    7.022   7.034   0.399 1.00 . A A .  37 ARG HG2  1 1 
        1   526 1 1 37 ARG HG3  H    8.395   7.225   1.491 1.00 . A A .  37 ARG HG3  1 1 
        1   527 1 1 37 ARG HH11 H    6.559   9.747   2.966 1.00 . A A .  37 ARG HH11 1 1 
        1   528 1 1 37 ARG HH12 H    7.251  10.586   4.314 1.00 . A A .  37 ARG HH12 1 1 
        1   529 1 1 37 ARG HH21 H    8.433   7.690   5.878 1.00 . A A .  37 ARG HH21 1 1 
        1   530 1 1 37 ARG HH22 H    8.317   9.415   5.970 1.00 . A A .  37 ARG HH22 1 1 
        1   531 1 1 37 ARG N    N    7.169   8.883  -1.553 1.00 . A A .  37 ARG N    1 1 
        1   532 1 1 37 ARG NE   N    7.209   7.439   3.703 1.00 . A A .  37 ARG NE   1 1 
        1   533 1 1 37 ARG NH1  N    7.059   9.731   3.832 1.00 . A A .  37 ARG NH1  1 1 
        1   534 1 1 37 ARG NH2  N    8.126   8.559   5.491 1.00 . A A .  37 ARG NH2  1 1 
        1   535 1 1 37 ARG O    O   10.498   9.158  -0.526 1.00 . A A .  37 ARG O    1 1 
        1   536 1 1 38 GLU C    C   11.581   7.125  -1.903 1.00 . A A .  38 GLU C    1 1 
        1   537 1 1 38 GLU CA   C   10.545   6.432  -1.023 1.00 . A A .  38 GLU CA   1 1 
        1   538 1 1 38 GLU CB   C   10.184   5.069  -1.619 1.00 . A A .  38 GLU CB   1 1 
        1   539 1 1 38 GLU CD   C   10.130   3.386   0.264 1.00 . A A .  38 GLU CD   1 1 
        1   540 1 1 38 GLU CG   C    9.316   4.218  -0.708 1.00 . A A .  38 GLU CG   1 1 
        1   541 1 1 38 GLU H    H    8.468   6.836  -0.963 1.00 . A A .  38 GLU H    1 1 
        1   542 1 1 38 GLU HA   H   10.965   6.285  -0.040 1.00 . A A .  38 GLU HA   1 1 
        1   543 1 1 38 GLU HB2  H    9.654   5.224  -2.547 1.00 . A A .  38 GLU HB2  1 1 
        1   544 1 1 38 GLU HB3  H   11.096   4.527  -1.822 1.00 . A A .  38 GLU HB3  1 1 
        1   545 1 1 38 GLU HG2  H    8.663   4.867  -0.144 1.00 . A A .  38 GLU HG2  1 1 
        1   546 1 1 38 GLU HG3  H    8.721   3.553  -1.317 1.00 . A A .  38 GLU HG3  1 1 
        1   547 1 1 38 GLU N    N    9.350   7.255  -0.881 1.00 . A A .  38 GLU N    1 1 
        1   548 1 1 38 GLU O    O   11.323   7.425  -3.069 1.00 . A A .  38 GLU O    1 1 
        1   549 1 1 38 GLU OE1  O   11.286   3.050  -0.065 1.00 . A A .  38 GLU OE1  1 1 
        1   550 1 1 38 GLU OE2  O    9.609   3.071   1.355 1.00 . A A .  38 GLU OE2  1 1 
        1   551 1 1 39 LYS C    C   15.063   7.137  -2.146 1.00 . A A .  39 LYS C    1 1 
        1   552 1 1 39 LYS CA   C   13.833   8.035  -2.066 1.00 . A A .  39 LYS CA   1 1 
        1   553 1 1 39 LYS CB   C   14.199   9.360  -1.393 1.00 . A A .  39 LYS CB   1 1 
        1   554 1 1 39 LYS CD   C   15.058  10.926  -3.160 1.00 . A A .  39 LYS CD   1 1 
        1   555 1 1 39 LYS CE   C   16.208  11.847  -3.537 1.00 . A A .  39 LYS CE   1 1 
        1   556 1 1 39 LYS CG   C   15.426  10.027  -1.990 1.00 . A A .  39 LYS CG   1 1 
        1   557 1 1 39 LYS H    H   12.902   7.115  -0.402 1.00 . A A .  39 LYS H    1 1 
        1   558 1 1 39 LYS HA   H   13.482   8.234  -3.067 1.00 . A A .  39 LYS HA   1 1 
        1   559 1 1 39 LYS HB2  H   13.364  10.039  -1.485 1.00 . A A .  39 LYS HB2  1 1 
        1   560 1 1 39 LYS HB3  H   14.389   9.177  -0.345 1.00 . A A .  39 LYS HB3  1 1 
        1   561 1 1 39 LYS HD2  H   14.811  10.310  -4.012 1.00 . A A .  39 LYS HD2  1 1 
        1   562 1 1 39 LYS HD3  H   14.202  11.526  -2.886 1.00 . A A .  39 LYS HD3  1 1 
        1   563 1 1 39 LYS HE2  H   17.068  11.245  -3.785 1.00 . A A .  39 LYS HE2  1 1 
        1   564 1 1 39 LYS HE3  H   15.916  12.431  -4.398 1.00 . A A .  39 LYS HE3  1 1 
        1   565 1 1 39 LYS HG2  H   15.906  10.624  -1.230 1.00 . A A .  39 LYS HG2  1 1 
        1   566 1 1 39 LYS HG3  H   16.108   9.263  -2.336 1.00 . A A .  39 LYS HG3  1 1 
        1   567 1 1 39 LYS HZ1  H   17.182  13.531  -2.776 1.00 . A A .  39 LYS HZ1  1 1 
        1   568 1 1 39 LYS HZ2  H   17.068  12.250  -1.677 1.00 . A A .  39 LYS HZ2  1 1 
        1   569 1 1 39 LYS HZ3  H   15.707  13.194  -2.021 1.00 . A A .  39 LYS HZ3  1 1 
        1   570 1 1 39 LYS N    N   12.756   7.378  -1.336 1.00 . A A .  39 LYS N    1 1 
        1   571 1 1 39 LYS NZ   N   16.566  12.771  -2.425 1.00 . A A .  39 LYS NZ   1 1 
        1   572 1 1 39 LYS O    O   16.017   7.280  -1.380 1.00 . A A .  39 LYS O    1 1 
        1   573 1 1 40 PRO C    C   17.392   5.931  -3.866 1.00 . A A .  40 PRO C    1 1 
        1   574 1 1 40 PRO CA   C   16.152   5.250  -3.298 1.00 . A A .  40 PRO CA   1 1 
        1   575 1 1 40 PRO CB   C   15.585   4.246  -4.305 1.00 . A A .  40 PRO CB   1 1 
        1   576 1 1 40 PRO CD   C   13.941   5.961  -4.042 1.00 . A A .  40 PRO CD   1 1 
        1   577 1 1 40 PRO CG   C   14.529   4.999  -5.037 1.00 . A A .  40 PRO CG   1 1 
        1   578 1 1 40 PRO HA   H   16.411   4.738  -2.383 1.00 . A A .  40 PRO HA   1 1 
        1   579 1 1 40 PRO HB2  H   16.371   3.918  -4.971 1.00 . A A .  40 PRO HB2  1 1 
        1   580 1 1 40 PRO HB3  H   15.173   3.398  -3.780 1.00 . A A .  40 PRO HB3  1 1 
        1   581 1 1 40 PRO HD2  H   13.655   6.881  -4.530 1.00 . A A .  40 PRO HD2  1 1 
        1   582 1 1 40 PRO HD3  H   13.092   5.516  -3.544 1.00 . A A .  40 PRO HD3  1 1 
        1   583 1 1 40 PRO HG2  H   14.967   5.536  -5.864 1.00 . A A .  40 PRO HG2  1 1 
        1   584 1 1 40 PRO HG3  H   13.771   4.316  -5.391 1.00 . A A .  40 PRO HG3  1 1 
        1   585 1 1 40 PRO N    N   15.044   6.189  -3.095 1.00 . A A .  40 PRO N    1 1 
        1   586 1 1 40 PRO O    O   17.292   6.919  -4.593 1.00 . A A .  40 PRO O    1 1 
        1   587 1 1 41 SER C    C   19.849   6.021  -5.527 1.00 . A A .  41 SER C    1 1 
        1   588 1 1 41 SER CA   C   19.823   5.956  -4.003 1.00 . A A .  41 SER CA   1 1 
        1   589 1 1 41 SER CB   C   20.999   5.119  -3.496 1.00 . A A .  41 SER CB   1 1 
        1   590 1 1 41 SER H    H   18.577   4.610  -2.945 1.00 . A A .  41 SER H    1 1 
        1   591 1 1 41 SER HA   H   19.909   6.958  -3.610 1.00 . A A .  41 SER HA   1 1 
        1   592 1 1 41 SER HB2  H   21.921   5.531  -3.876 1.00 . A A .  41 SER HB2  1 1 
        1   593 1 1 41 SER HB3  H   21.013   5.140  -2.415 1.00 . A A .  41 SER HB3  1 1 
        1   594 1 1 41 SER HG   H   21.642   3.272  -3.603 1.00 . A A .  41 SER HG   1 1 
        1   595 1 1 41 SER N    N   18.562   5.397  -3.529 1.00 . A A .  41 SER N    1 1 
        1   596 1 1 41 SER O    O   20.044   7.086  -6.110 1.00 . A A .  41 SER O    1 1 
        1   597 1 1 41 SER OG   O   20.889   3.773  -3.925 1.00 . A A .  41 SER OG   1 1 
        1   598 1 1 42 GLY C    C   19.302   3.444  -8.147 1.00 . A A .  42 GLY C    1 1 
        1   599 1 1 42 GLY CA   C   19.657   4.819  -7.616 1.00 . A A .  42 GLY CA   1 1 
        1   600 1 1 42 GLY H    H   19.502   4.053  -5.647 1.00 . A A .  42 GLY H    1 1 
        1   601 1 1 42 GLY HA2  H   18.944   5.535  -7.994 1.00 . A A .  42 GLY HA2  1 1 
        1   602 1 1 42 GLY HA3  H   20.642   5.085  -7.970 1.00 . A A .  42 GLY HA3  1 1 
        1   603 1 1 42 GLY N    N   19.652   4.872  -6.165 1.00 . A A .  42 GLY N    1 1 
        1   604 1 1 42 GLY O    O   18.141   3.144  -8.426 1.00 . A A .  42 GLY O    1 1 
        1   605 1 1 43 PRO C    C   19.394   0.328  -7.804 1.00 . A A .  43 PRO C    1 1 
        1   606 1 1 43 PRO CA   C   20.132   1.218  -8.798 1.00 . A A .  43 PRO CA   1 1 
        1   607 1 1 43 PRO CB   C   21.564   0.717  -9.003 1.00 . A A .  43 PRO CB   1 1 
        1   608 1 1 43 PRO CD   C   21.728   2.872  -7.982 1.00 . A A .  43 PRO CD   1 1 
        1   609 1 1 43 PRO CG   C   22.387   1.522  -8.057 1.00 . A A .  43 PRO CG   1 1 
        1   610 1 1 43 PRO HA   H   19.608   1.211  -9.743 1.00 . A A .  43 PRO HA   1 1 
        1   611 1 1 43 PRO HB2  H   21.616  -0.338  -8.774 1.00 . A A .  43 PRO HB2  1 1 
        1   612 1 1 43 PRO HB3  H   21.865   0.883 -10.027 1.00 . A A .  43 PRO HB3  1 1 
        1   613 1 1 43 PRO HD2  H   21.825   3.284  -6.989 1.00 . A A .  43 PRO HD2  1 1 
        1   614 1 1 43 PRO HD3  H   22.155   3.541  -8.714 1.00 . A A .  43 PRO HD3  1 1 
        1   615 1 1 43 PRO HG2  H   22.393   1.053  -7.085 1.00 . A A .  43 PRO HG2  1 1 
        1   616 1 1 43 PRO HG3  H   23.393   1.617  -8.436 1.00 . A A .  43 PRO HG3  1 1 
        1   617 1 1 43 PRO N    N   20.319   2.582  -8.295 1.00 . A A .  43 PRO N    1 1 
        1   618 1 1 43 PRO O    O   20.008  -0.282  -6.928 1.00 . A A .  43 PRO O    1 1 
        1   619 1 1 44 SER C    C   16.474  -1.603  -7.844 1.00 . A A .  44 SER C    1 1 
        1   620 1 1 44 SER CA   C   17.252  -0.554  -7.056 1.00 . A A .  44 SER CA   1 1 
        1   621 1 1 44 SER CB   C   16.284   0.333  -6.270 1.00 . A A .  44 SER CB   1 1 
        1   622 1 1 44 SER H    H   17.643   0.769  -8.662 1.00 . A A .  44 SER H    1 1 
        1   623 1 1 44 SER HA   H   17.910  -1.056  -6.363 1.00 . A A .  44 SER HA   1 1 
        1   624 1 1 44 SER HB2  H   15.800   1.020  -6.947 1.00 . A A .  44 SER HB2  1 1 
        1   625 1 1 44 SER HB3  H   15.539  -0.288  -5.793 1.00 . A A .  44 SER HB3  1 1 
        1   626 1 1 44 SER HG   H   16.406   1.162  -4.500 1.00 . A A .  44 SER HG   1 1 
        1   627 1 1 44 SER N    N   18.075   0.259  -7.945 1.00 . A A .  44 SER N    1 1 
        1   628 1 1 44 SER O    O   16.564  -2.798  -7.565 1.00 . A A .  44 SER O    1 1 
        1   629 1 1 44 SER OG   O   16.966   1.076  -5.275 1.00 . A A .  44 SER OG   1 1 
        1   630 1 1 45 SER C    C   15.803  -3.032 -10.403 1.00 . A A .  45 SER C    1 1 
        1   631 1 1 45 SER CA   C   14.912  -2.043  -9.658 1.00 . A A .  45 SER CA   1 1 
        1   632 1 1 45 SER CB   C   14.074  -1.242 -10.657 1.00 . A A .  45 SER CB   1 1 
        1   633 1 1 45 SER H    H   15.680  -0.181  -9.005 1.00 . A A .  45 SER H    1 1 
        1   634 1 1 45 SER HA   H   14.250  -2.594  -9.006 1.00 . A A .  45 SER HA   1 1 
        1   635 1 1 45 SER HB2  H   14.644  -0.390 -10.998 1.00 . A A .  45 SER HB2  1 1 
        1   636 1 1 45 SER HB3  H   13.825  -1.870 -11.499 1.00 . A A .  45 SER HB3  1 1 
        1   637 1 1 45 SER HG   H   13.063  -0.013  -9.514 1.00 . A A .  45 SER HG   1 1 
        1   638 1 1 45 SER N    N   15.710  -1.146  -8.831 1.00 . A A .  45 SER N    1 1 
        1   639 1 1 45 SER O    O   17.029  -2.968 -10.316 1.00 . A A .  45 SER O    1 1 
        1   640 1 1 45 SER OG   O   12.875  -0.779 -10.061 1.00 . A A .  45 SER OG   1 1 
        1   641 1 1 46 GLY C    C   15.888  -6.308 -11.240 1.00 . A A .  46 GLY C    1 1 
        1   642 1 1 46 GLY CA   C   15.928  -4.937 -11.887 1.00 . A A .  46 GLY CA   1 1 
        1   643 1 1 46 GLY H    H   14.198  -3.951 -11.169 1.00 . A A .  46 GLY H    1 1 
        1   644 1 1 46 GLY HA2  H   15.516  -5.008 -12.882 1.00 . A A .  46 GLY HA2  1 1 
        1   645 1 1 46 GLY HA3  H   16.957  -4.615 -11.956 1.00 . A A .  46 GLY HA3  1 1 
        1   646 1 1 46 GLY N    N   15.177  -3.947 -11.137 1.00 . A A .  46 GLY N    1 1 
        1   647 1 1 46 GLY O    O   14.806  -6.766 -10.875 1.00 . A A .  46 GLY O    1 1 
        1   648 2 2  1 ZN  ZN   ZN   3.048  -0.835  -5.072 1.00 . B A . 181 ZN  ZN   1 1 
        2   649 1 1  1 GLY C    C    5.679 -27.526 -11.838 1.00 . A A .   1 GLY C    1 1 
        2   650 1 1  1 GLY CA   C    5.857 -28.124 -10.456 1.00 . A A .   1 GLY CA   1 1 
        2   651 1 1  1 GLY H1   H    7.434 -29.077  -9.413 1.00 . A A .   1 GLY H1   1 1 
        2   652 1 1  1 GLY HA2  H    5.061 -28.832 -10.276 1.00 . A A .   1 GLY HA2  1 1 
        2   653 1 1  1 GLY HA3  H    5.793 -27.332  -9.724 1.00 . A A .   1 GLY HA3  1 1 
        2   654 1 1  1 GLY N    N    7.131 -28.801 -10.304 1.00 . A A .   1 GLY N    1 1 
        2   655 1 1  1 GLY O    O    6.643 -27.074 -12.455 1.00 . A A .   1 GLY O    1 1 
        2   656 1 1  2 SER C    C    3.371 -25.673 -13.534 1.00 . A A .   2 SER C    1 1 
        2   657 1 1  2 SER CA   C    4.143 -26.985 -13.647 1.00 . A A .   2 SER CA   1 1 
        2   658 1 1  2 SER CB   C    3.335 -27.995 -14.464 1.00 . A A .   2 SER CB   1 1 
        2   659 1 1  2 SER H    H    3.716 -27.901 -11.786 1.00 . A A .   2 SER H    1 1 
        2   660 1 1  2 SER HA   H    5.080 -26.796 -14.148 1.00 . A A .   2 SER HA   1 1 
        2   661 1 1  2 SER HB2  H    3.154 -27.595 -15.449 1.00 . A A .   2 SER HB2  1 1 
        2   662 1 1  2 SER HB3  H    3.895 -28.916 -14.547 1.00 . A A .   2 SER HB3  1 1 
        2   663 1 1  2 SER HG   H    1.774 -27.486 -13.396 1.00 . A A .   2 SER HG   1 1 
        2   664 1 1  2 SER N    N    4.443 -27.526 -12.326 1.00 . A A .   2 SER N    1 1 
        2   665 1 1  2 SER O    O    2.337 -25.604 -12.870 1.00 . A A .   2 SER O    1 1 
        2   666 1 1  2 SER OG   O    2.090 -28.272 -13.846 1.00 . A A .   2 SER OG   1 1 
        2   667 1 1  3 SER C    C    2.015 -23.298 -15.057 1.00 . A A .   3 SER C    1 1 
        2   668 1 1  3 SER CA   C    3.246 -23.324 -14.157 1.00 . A A .   3 SER CA   1 1 
        2   669 1 1  3 SER CB   C    4.236 -22.243 -14.597 1.00 . A A .   3 SER CB   1 1 
        2   670 1 1  3 SER H    H    4.712 -24.753 -14.698 1.00 . A A .   3 SER H    1 1 
        2   671 1 1  3 SER HA   H    2.939 -23.127 -13.141 1.00 . A A .   3 SER HA   1 1 
        2   672 1 1  3 SER HB2  H    4.997 -22.127 -13.841 1.00 . A A .   3 SER HB2  1 1 
        2   673 1 1  3 SER HB3  H    4.696 -22.537 -15.529 1.00 . A A .   3 SER HB3  1 1 
        2   674 1 1  3 SER HG   H    4.122 -20.434 -15.341 1.00 . A A .   3 SER HG   1 1 
        2   675 1 1  3 SER N    N    3.884 -24.635 -14.187 1.00 . A A .   3 SER N    1 1 
        2   676 1 1  3 SER O    O    2.125 -23.169 -16.276 1.00 . A A .   3 SER O    1 1 
        2   677 1 1  3 SER OG   O    3.583 -20.999 -14.782 1.00 . A A .   3 SER OG   1 1 
        2   678 1 1  4 GLY C    C   -1.414 -22.440 -14.643 1.00 . A A .   4 GLY C    1 1 
        2   679 1 1  4 GLY CA   C   -0.396 -23.411 -15.207 1.00 . A A .   4 GLY CA   1 1 
        2   680 1 1  4 GLY H    H    0.813 -23.522 -13.472 1.00 . A A .   4 GLY H    1 1 
        2   681 1 1  4 GLY HA2  H   -0.176 -23.134 -16.227 1.00 . A A .   4 GLY HA2  1 1 
        2   682 1 1  4 GLY HA3  H   -0.820 -24.404 -15.197 1.00 . A A .   4 GLY HA3  1 1 
        2   683 1 1  4 GLY N    N    0.840 -23.422 -14.447 1.00 . A A .   4 GLY N    1 1 
        2   684 1 1  4 GLY O    O   -1.367 -21.244 -14.930 1.00 . A A .   4 GLY O    1 1 
        2   685 1 1  5 SER C    C   -2.799 -20.802 -12.748 1.00 . A A .   5 SER C    1 1 
        2   686 1 1  5 SER CA   C   -3.377 -22.126 -13.238 1.00 . A A .   5 SER CA   1 1 
        2   687 1 1  5 SER CB   C   -4.042 -22.866 -12.076 1.00 . A A .   5 SER CB   1 1 
        2   688 1 1  5 SER H    H   -2.324 -23.916 -13.648 1.00 . A A .   5 SER H    1 1 
        2   689 1 1  5 SER HA   H   -4.119 -21.923 -13.996 1.00 . A A .   5 SER HA   1 1 
        2   690 1 1  5 SER HB2  H   -4.538 -23.749 -12.451 1.00 . A A .   5 SER HB2  1 1 
        2   691 1 1  5 SER HB3  H   -3.287 -23.155 -11.358 1.00 . A A .   5 SER HB3  1 1 
        2   692 1 1  5 SER HG   H   -5.654 -21.754 -12.066 1.00 . A A .   5 SER HG   1 1 
        2   693 1 1  5 SER N    N   -2.339 -22.955 -13.839 1.00 . A A .   5 SER N    1 1 
        2   694 1 1  5 SER O    O   -1.798 -20.776 -12.032 1.00 . A A .   5 SER O    1 1 
        2   695 1 1  5 SER OG   O   -4.998 -22.045 -11.428 1.00 . A A .   5 SER OG   1 1 
        2   696 1 1  6 SER C    C   -3.657 -17.937 -11.446 1.00 . A A .   6 SER C    1 1 
        2   697 1 1  6 SER CA   C   -2.986 -18.375 -12.744 1.00 . A A .   6 SER CA   1 1 
        2   698 1 1  6 SER CB   C   -3.282 -17.362 -13.851 1.00 . A A .   6 SER CB   1 1 
        2   699 1 1  6 SER H    H   -4.230 -19.789 -13.710 1.00 . A A .   6 SER H    1 1 
        2   700 1 1  6 SER HA   H   -1.919 -18.421 -12.586 1.00 . A A .   6 SER HA   1 1 
        2   701 1 1  6 SER HB2  H   -2.951 -16.383 -13.538 1.00 . A A .   6 SER HB2  1 1 
        2   702 1 1  6 SER HB3  H   -2.754 -17.650 -14.749 1.00 . A A .   6 SER HB3  1 1 
        2   703 1 1  6 SER HG   H   -4.814 -17.485 -15.066 1.00 . A A .   6 SER HG   1 1 
        2   704 1 1  6 SER N    N   -3.438 -19.704 -13.139 1.00 . A A .   6 SER N    1 1 
        2   705 1 1  6 SER O    O   -4.767 -17.406 -11.456 1.00 . A A .   6 SER O    1 1 
        2   706 1 1  6 SER OG   O   -4.669 -17.306 -14.134 1.00 . A A .   6 SER OG   1 1 
        2   707 1 1  7 GLY C    C   -4.991 -18.122  -8.908 1.00 . A A .   7 GLY C    1 1 
        2   708 1 1  7 GLY CA   C   -3.518 -17.786  -9.036 1.00 . A A .   7 GLY CA   1 1 
        2   709 1 1  7 GLY H    H   -2.092 -18.589 -10.380 1.00 . A A .   7 GLY H    1 1 
        2   710 1 1  7 GLY HA2  H   -2.972 -18.305  -8.262 1.00 . A A .   7 GLY HA2  1 1 
        2   711 1 1  7 GLY HA3  H   -3.390 -16.722  -8.901 1.00 . A A .   7 GLY HA3  1 1 
        2   712 1 1  7 GLY N    N   -2.973 -18.163 -10.328 1.00 . A A .   7 GLY N    1 1 
        2   713 1 1  7 GLY O    O   -5.464 -19.096  -9.491 1.00 . A A .   7 GLY O    1 1 
        2   714 1 1  8 GLU C    C   -7.964 -16.448  -8.627 1.00 . A A .   8 GLU C    1 1 
        2   715 1 1  8 GLU CA   C   -7.143 -17.533  -7.936 1.00 . A A .   8 GLU CA   1 1 
        2   716 1 1  8 GLU CB   C   -7.468 -17.559  -6.441 1.00 . A A .   8 GLU CB   1 1 
        2   717 1 1  8 GLU CD   C   -9.962 -17.195  -6.600 1.00 . A A .   8 GLU CD   1 1 
        2   718 1 1  8 GLU CG   C   -8.849 -18.110  -6.128 1.00 . A A .   8 GLU CG   1 1 
        2   719 1 1  8 GLU H    H   -5.280 -16.553  -7.701 1.00 . A A .   8 GLU H    1 1 
        2   720 1 1  8 GLU HA   H   -7.396 -18.489  -8.367 1.00 . A A .   8 GLU HA   1 1 
        2   721 1 1  8 GLU HB2  H   -6.735 -18.171  -5.936 1.00 . A A .   8 GLU HB2  1 1 
        2   722 1 1  8 GLU HB3  H   -7.409 -16.552  -6.055 1.00 . A A .   8 GLU HB3  1 1 
        2   723 1 1  8 GLU HG2  H   -8.960 -19.067  -6.615 1.00 . A A .   8 GLU HG2  1 1 
        2   724 1 1  8 GLU HG3  H   -8.937 -18.239  -5.059 1.00 . A A .   8 GLU HG3  1 1 
        2   725 1 1  8 GLU N    N   -5.715 -17.314  -8.140 1.00 . A A .   8 GLU N    1 1 
        2   726 1 1  8 GLU O    O   -8.842 -16.741  -9.438 1.00 . A A .   8 GLU O    1 1 
        2   727 1 1  8 GLU OE1  O   -9.811 -15.962  -6.471 1.00 . A A .   8 GLU OE1  1 1 
        2   728 1 1  8 GLU OE2  O  -10.984 -17.712  -7.098 1.00 . A A .   8 GLU OE2  1 1 
        2   729 1 1  9 GLY C    C   -7.617 -12.783  -8.824 1.00 . A A .   9 GLY C    1 1 
        2   730 1 1  9 GLY CA   C   -8.392 -14.084  -8.897 1.00 . A A .   9 GLY CA   1 1 
        2   731 1 1  9 GLY H    H   -6.961 -15.019  -7.647 1.00 . A A .   9 GLY H    1 1 
        2   732 1 1  9 GLY HA2  H   -8.592 -14.314  -9.932 1.00 . A A .   9 GLY HA2  1 1 
        2   733 1 1  9 GLY HA3  H   -9.331 -13.958  -8.378 1.00 . A A .   9 GLY HA3  1 1 
        2   734 1 1  9 GLY N    N   -7.672 -15.193  -8.299 1.00 . A A .   9 GLY N    1 1 
        2   735 1 1  9 GLY O    O   -7.406 -12.238  -7.741 1.00 . A A .   9 GLY O    1 1 
        2   736 1 1 10 GLU C    C   -7.352  -9.855 -10.307 1.00 . A A .  10 GLU C    1 1 
        2   737 1 1 10 GLU CA   C   -6.430 -11.042 -10.042 1.00 . A A .  10 GLU CA   1 1 
        2   738 1 1 10 GLU CB   C   -5.361 -11.125 -11.134 1.00 . A A .  10 GLU CB   1 1 
        2   739 1 1 10 GLU CD   C   -4.838 -11.571 -13.565 1.00 . A A .  10 GLU CD   1 1 
        2   740 1 1 10 GLU CG   C   -5.920 -11.445 -12.510 1.00 . A A .  10 GLU CG   1 1 
        2   741 1 1 10 GLU H    H   -7.388 -12.766 -10.811 1.00 . A A .  10 GLU H    1 1 
        2   742 1 1 10 GLU HA   H   -5.946 -10.901  -9.088 1.00 . A A .  10 GLU HA   1 1 
        2   743 1 1 10 GLU HB2  H   -4.845 -10.177 -11.189 1.00 . A A .  10 GLU HB2  1 1 
        2   744 1 1 10 GLU HB3  H   -4.652 -11.895 -10.869 1.00 . A A .  10 GLU HB3  1 1 
        2   745 1 1 10 GLU HG2  H   -6.460 -12.378 -12.457 1.00 . A A .  10 GLU HG2  1 1 
        2   746 1 1 10 GLU HG3  H   -6.597 -10.655 -12.803 1.00 . A A .  10 GLU HG3  1 1 
        2   747 1 1 10 GLU N    N   -7.189 -12.286  -9.981 1.00 . A A .  10 GLU N    1 1 
        2   748 1 1 10 GLU O    O   -8.022  -9.792 -11.337 1.00 . A A .  10 GLU O    1 1 
        2   749 1 1 10 GLU OE1  O   -4.399 -10.528 -14.093 1.00 . A A .  10 GLU OE1  1 1 
        2   750 1 1 10 GLU OE2  O   -4.430 -12.713 -13.862 1.00 . A A .  10 GLU OE2  1 1 
        2   751 1 1 11 LYS C    C   -7.714  -6.826 -10.618 1.00 . A A .  11 LYS C    1 1 
        2   752 1 1 11 LYS CA   C   -8.218  -7.729  -9.497 1.00 . A A .  11 LYS CA   1 1 
        2   753 1 1 11 LYS CB   C   -8.246  -6.953  -8.178 1.00 . A A .  11 LYS CB   1 1 
        2   754 1 1 11 LYS CD   C   -9.128  -8.787  -6.704 1.00 . A A .  11 LYS CD   1 1 
        2   755 1 1 11 LYS CE   C   -8.215  -8.772  -5.488 1.00 . A A .  11 LYS CE   1 1 
        2   756 1 1 11 LYS CG   C   -9.362  -7.385  -7.242 1.00 . A A .  11 LYS CG   1 1 
        2   757 1 1 11 LYS H    H   -6.823  -9.022  -8.568 1.00 . A A .  11 LYS H    1 1 
        2   758 1 1 11 LYS HA   H   -9.219  -8.054  -9.735 1.00 . A A .  11 LYS HA   1 1 
        2   759 1 1 11 LYS HB2  H   -7.304  -7.096  -7.670 1.00 . A A .  11 LYS HB2  1 1 
        2   760 1 1 11 LYS HB3  H   -8.373  -5.902  -8.395 1.00 . A A .  11 LYS HB3  1 1 
        2   761 1 1 11 LYS HD2  H  -10.077  -9.218  -6.422 1.00 . A A .  11 LYS HD2  1 1 
        2   762 1 1 11 LYS HD3  H   -8.673  -9.389  -7.478 1.00 . A A .  11 LYS HD3  1 1 
        2   763 1 1 11 LYS HE2  H   -7.339  -8.186  -5.720 1.00 . A A .  11 LYS HE2  1 1 
        2   764 1 1 11 LYS HE3  H   -8.743  -8.317  -4.663 1.00 . A A .  11 LYS HE3  1 1 
        2   765 1 1 11 LYS HG2  H   -9.411  -6.696  -6.412 1.00 . A A .  11 LYS HG2  1 1 
        2   766 1 1 11 LYS HG3  H  -10.299  -7.368  -7.782 1.00 . A A .  11 LYS HG3  1 1 
        2   767 1 1 11 LYS HZ1  H   -8.624 -10.756  -4.978 1.00 . A A .  11 LYS HZ1  1 1 
        2   768 1 1 11 LYS HZ2  H   -7.268 -10.113  -4.198 1.00 . A A .  11 LYS HZ2  1 1 
        2   769 1 1 11 LYS HZ3  H   -7.176 -10.551  -5.829 1.00 . A A .  11 LYS HZ3  1 1 
        2   770 1 1 11 LYS N    N   -7.380  -8.915  -9.368 1.00 . A A .  11 LYS N    1 1 
        2   771 1 1 11 LYS NZ   N   -7.791 -10.144  -5.096 1.00 . A A .  11 LYS NZ   1 1 
        2   772 1 1 11 LYS O    O   -6.562  -6.910 -11.045 1.00 . A A .  11 LYS O    1 1 
        2   773 1 1 12 PRO C    C   -7.281  -3.927 -11.733 1.00 . A A .  12 PRO C    1 1 
        2   774 1 1 12 PRO CA   C   -8.260  -5.005 -12.185 1.00 . A A .  12 PRO CA   1 1 
        2   775 1 1 12 PRO CB   C   -9.611  -4.382 -12.546 1.00 . A A .  12 PRO CB   1 1 
        2   776 1 1 12 PRO CD   C   -9.985  -5.786 -10.648 1.00 . A A .  12 PRO CD   1 1 
        2   777 1 1 12 PRO CG   C  -10.430  -4.511 -11.308 1.00 . A A .  12 PRO CG   1 1 
        2   778 1 1 12 PRO HA   H   -7.857  -5.518 -13.046 1.00 . A A .  12 PRO HA   1 1 
        2   779 1 1 12 PRO HB2  H   -9.471  -3.346 -12.821 1.00 . A A .  12 PRO HB2  1 1 
        2   780 1 1 12 PRO HB3  H  -10.053  -4.923 -13.369 1.00 . A A .  12 PRO HB3  1 1 
        2   781 1 1 12 PRO HD2  H  -10.026  -5.690  -9.573 1.00 . A A .  12 PRO HD2  1 1 
        2   782 1 1 12 PRO HD3  H  -10.594  -6.615 -10.978 1.00 . A A .  12 PRO HD3  1 1 
        2   783 1 1 12 PRO HG2  H  -10.248  -3.669 -10.658 1.00 . A A .  12 PRO HG2  1 1 
        2   784 1 1 12 PRO HG3  H  -11.477  -4.569 -11.566 1.00 . A A .  12 PRO HG3  1 1 
        2   785 1 1 12 PRO N    N   -8.595  -5.941 -11.108 1.00 . A A .  12 PRO N    1 1 
        2   786 1 1 12 PRO O    O   -6.698  -3.220 -12.556 1.00 . A A .  12 PRO O    1 1 
        2   787 1 1 13 TYR C    C   -5.035  -3.488  -9.133 1.00 . A A .  13 TYR C    1 1 
        2   788 1 1 13 TYR CA   C   -6.194  -2.815  -9.861 1.00 . A A .  13 TYR CA   1 1 
        2   789 1 1 13 TYR CB   C   -6.946  -1.891  -8.902 1.00 . A A .  13 TYR CB   1 1 
        2   790 1 1 13 TYR CD1  C   -8.008  -0.423 -10.661 1.00 . A A .  13 TYR CD1  1 1 
        2   791 1 1 13 TYR CD2  C   -9.415  -1.368  -8.985 1.00 . A A .  13 TYR CD2  1 1 
        2   792 1 1 13 TYR CE1  C   -9.101   0.197 -11.235 1.00 . A A .  13 TYR CE1  1 1 
        2   793 1 1 13 TYR CE2  C  -10.514  -0.753  -9.553 1.00 . A A .  13 TYR CE2  1 1 
        2   794 1 1 13 TYR CG   C   -8.145  -1.215  -9.527 1.00 . A A .  13 TYR CG   1 1 
        2   795 1 1 13 TYR CZ   C  -10.352   0.029 -10.678 1.00 . A A .  13 TYR CZ   1 1 
        2   796 1 1 13 TYR H    H   -7.595  -4.401  -9.817 1.00 . A A .  13 TYR H    1 1 
        2   797 1 1 13 TYR HA   H   -5.800  -2.228 -10.677 1.00 . A A .  13 TYR HA   1 1 
        2   798 1 1 13 TYR HB2  H   -7.293  -2.465  -8.057 1.00 . A A .  13 TYR HB2  1 1 
        2   799 1 1 13 TYR HB3  H   -6.273  -1.120  -8.555 1.00 . A A .  13 TYR HB3  1 1 
        2   800 1 1 13 TYR HD1  H   -7.027  -0.294 -11.095 1.00 . A A .  13 TYR HD1  1 1 
        2   801 1 1 13 TYR HD2  H   -9.539  -1.981  -8.104 1.00 . A A .  13 TYR HD2  1 1 
        2   802 1 1 13 TYR HE1  H   -8.975   0.809 -12.116 1.00 . A A .  13 TYR HE1  1 1 
        2   803 1 1 13 TYR HE2  H  -11.493  -0.884  -9.117 1.00 . A A .  13 TYR HE2  1 1 
        2   804 1 1 13 TYR HH   H  -12.232   0.424 -10.746 1.00 . A A .  13 TYR HH   1 1 
        2   805 1 1 13 TYR N    N   -7.103  -3.808 -10.422 1.00 . A A .  13 TYR N    1 1 
        2   806 1 1 13 TYR O    O   -5.095  -3.716  -7.925 1.00 . A A .  13 TYR O    1 1 
        2   807 1 1 13 TYR OH   O  -11.443   0.644 -11.247 1.00 . A A .  13 TYR OH   1 1 
        2   808 1 1 14 GLN C    C   -1.599  -3.515  -9.338 1.00 . A A .  14 GLN C    1 1 
        2   809 1 1 14 GLN CA   C   -2.805  -4.448  -9.304 1.00 . A A .  14 GLN CA   1 1 
        2   810 1 1 14 GLN CB   C   -2.487  -5.739 -10.060 1.00 . A A .  14 GLN CB   1 1 
        2   811 1 1 14 GLN CD   C   -0.865  -7.643 -10.421 1.00 . A A .  14 GLN CD   1 1 
        2   812 1 1 14 GLN CG   C   -1.200  -6.409  -9.606 1.00 . A A .  14 GLN CG   1 1 
        2   813 1 1 14 GLN H    H   -3.991  -3.594 -10.835 1.00 . A A .  14 GLN H    1 1 
        2   814 1 1 14 GLN HA   H   -3.029  -4.690  -8.276 1.00 . A A .  14 GLN HA   1 1 
        2   815 1 1 14 GLN HB2  H   -3.300  -6.435  -9.918 1.00 . A A .  14 GLN HB2  1 1 
        2   816 1 1 14 GLN HB3  H   -2.397  -5.513 -11.113 1.00 . A A .  14 GLN HB3  1 1 
        2   817 1 1 14 GLN HE21 H    0.251  -6.555 -11.655 1.00 . A A .  14 GLN HE21 1 1 
        2   818 1 1 14 GLN HE22 H    0.162  -8.243 -12.013 1.00 . A A .  14 GLN HE22 1 1 
        2   819 1 1 14 GLN HG2  H   -0.388  -5.703  -9.702 1.00 . A A .  14 GLN HG2  1 1 
        2   820 1 1 14 GLN HG3  H   -1.305  -6.696  -8.571 1.00 . A A .  14 GLN HG3  1 1 
        2   821 1 1 14 GLN N    N   -3.979  -3.802  -9.878 1.00 . A A .  14 GLN N    1 1 
        2   822 1 1 14 GLN NE2  N   -0.071  -7.463 -11.470 1.00 . A A .  14 GLN NE2  1 1 
        2   823 1 1 14 GLN O    O   -1.053  -3.227 -10.403 1.00 . A A .  14 GLN O    1 1 
        2   824 1 1 14 GLN OE1  O   -1.316  -8.746 -10.111 1.00 . A A .  14 GLN OE1  1 1 
        2   825 1 1 15 CYS C    C    1.184  -2.742  -8.731 1.00 . A A .  15 CYS C    1 1 
        2   826 1 1 15 CYS CA   C   -0.048  -2.142  -8.059 1.00 . A A .  15 CYS CA   1 1 
        2   827 1 1 15 CYS CB   C    0.255  -1.840  -6.590 1.00 . A A .  15 CYS CB   1 1 
        2   828 1 1 15 CYS H    H   -1.665  -3.309  -7.350 1.00 . A A .  15 CYS H    1 1 
        2   829 1 1 15 CYS HA   H   -0.305  -1.222  -8.562 1.00 . A A .  15 CYS HA   1 1 
        2   830 1 1 15 CYS HB2  H   -0.642  -1.471  -6.114 1.00 . A A .  15 CYS HB2  1 1 
        2   831 1 1 15 CYS HB3  H    0.568  -2.750  -6.100 1.00 . A A .  15 CYS HB3  1 1 
        2   832 1 1 15 CYS N    N   -1.189  -3.044  -8.165 1.00 . A A .  15 CYS N    1 1 
        2   833 1 1 15 CYS O    O    1.838  -3.626  -8.176 1.00 . A A .  15 CYS O    1 1 
        2   834 1 1 15 CYS SG   S    1.563  -0.596  -6.342 1.00 . A A .  15 CYS SG   1 1 
        2   835 1 1 16 SER C    C    3.949  -2.340  -9.998 1.00 . A A .  16 SER C    1 1 
        2   836 1 1 16 SER CA   C    2.645  -2.746 -10.677 1.00 . A A .  16 SER CA   1 1 
        2   837 1 1 16 SER CB   C    2.614  -2.209 -12.110 1.00 . A A .  16 SER CB   1 1 
        2   838 1 1 16 SER H    H    0.934  -1.552 -10.318 1.00 . A A .  16 SER H    1 1 
        2   839 1 1 16 SER HA   H    2.588  -3.824 -10.705 1.00 . A A .  16 SER HA   1 1 
        2   840 1 1 16 SER HB2  H    1.601  -2.242 -12.482 1.00 . A A .  16 SER HB2  1 1 
        2   841 1 1 16 SER HB3  H    2.968  -1.188 -12.116 1.00 . A A .  16 SER HB3  1 1 
        2   842 1 1 16 SER HG   H    4.261  -3.190 -12.512 1.00 . A A .  16 SER HG   1 1 
        2   843 1 1 16 SER N    N    1.494  -2.256  -9.928 1.00 . A A .  16 SER N    1 1 
        2   844 1 1 16 SER O    O    4.894  -3.124  -9.926 1.00 . A A .  16 SER O    1 1 
        2   845 1 1 16 SER OG   O    3.439  -2.984 -12.963 1.00 . A A .  16 SER OG   1 1 
        2   846 1 1 17 GLU C    C    5.865  -1.697  -8.024 1.00 . A A .  17 GLU C    1 1 
        2   847 1 1 17 GLU CA   C    5.179  -0.596  -8.827 1.00 . A A .  17 GLU CA   1 1 
        2   848 1 1 17 GLU CB   C    4.808   0.568  -7.905 1.00 . A A .  17 GLU CB   1 1 
        2   849 1 1 17 GLU CD   C    5.163   2.738  -9.149 1.00 . A A .  17 GLU CD   1 1 
        2   850 1 1 17 GLU CG   C    4.154   1.733  -8.629 1.00 . A A .  17 GLU CG   1 1 
        2   851 1 1 17 GLU H    H    3.204  -0.529  -9.589 1.00 . A A .  17 GLU H    1 1 
        2   852 1 1 17 GLU HA   H    5.861  -0.240  -9.584 1.00 . A A .  17 GLU HA   1 1 
        2   853 1 1 17 GLU HB2  H    4.125   0.210  -7.150 1.00 . A A .  17 GLU HB2  1 1 
        2   854 1 1 17 GLU HB3  H    5.705   0.929  -7.424 1.00 . A A .  17 GLU HB3  1 1 
        2   855 1 1 17 GLU HG2  H    3.588   1.349  -9.465 1.00 . A A .  17 GLU HG2  1 1 
        2   856 1 1 17 GLU HG3  H    3.486   2.236  -7.945 1.00 . A A .  17 GLU HG3  1 1 
        2   857 1 1 17 GLU N    N    3.991  -1.107  -9.500 1.00 . A A .  17 GLU N    1 1 
        2   858 1 1 17 GLU O    O    7.032  -2.015  -8.256 1.00 . A A .  17 GLU O    1 1 
        2   859 1 1 17 GLU OE1  O    6.307   2.332  -9.443 1.00 . A A .  17 GLU OE1  1 1 
        2   860 1 1 17 GLU OE2  O    4.810   3.930  -9.261 1.00 . A A .  17 GLU OE2  1 1 
        2   861 1 1 18 CYS C    C    5.014  -4.676  -6.570 1.00 . A A .  18 CYS C    1 1 
        2   862 1 1 18 CYS CA   C    5.670  -3.339  -6.238 1.00 . A A .  18 CYS CA   1 1 
        2   863 1 1 18 CYS CB   C    5.457  -3.007  -4.760 1.00 . A A .  18 CYS CB   1 1 
        2   864 1 1 18 CYS H    H    4.208  -1.978  -6.940 1.00 . A A .  18 CYS H    1 1 
        2   865 1 1 18 CYS HA   H    6.729  -3.413  -6.433 1.00 . A A .  18 CYS HA   1 1 
        2   866 1 1 18 CYS HB2  H    5.880  -3.798  -4.157 1.00 . A A .  18 CYS HB2  1 1 
        2   867 1 1 18 CYS HB3  H    5.959  -2.079  -4.531 1.00 . A A .  18 CYS HB3  1 1 
        2   868 1 1 18 CYS N    N    5.133  -2.275  -7.078 1.00 . A A .  18 CYS N    1 1 
        2   869 1 1 18 CYS O    O    5.693  -5.689  -6.733 1.00 . A A .  18 CYS O    1 1 
        2   870 1 1 18 CYS SG   S    3.708  -2.826  -4.283 1.00 . A A .  18 CYS SG   1 1 
        2   871 1 1 19 GLY C    C    1.942  -6.244  -5.918 1.00 . A A .  19 GLY C    1 1 
        2   872 1 1 19 GLY CA   C    2.963  -5.889  -6.981 1.00 . A A .  19 GLY CA   1 1 
        2   873 1 1 19 GLY H    H    3.199  -3.834  -6.529 1.00 . A A .  19 GLY H    1 1 
        2   874 1 1 19 GLY HA2  H    2.454  -5.760  -7.925 1.00 . A A .  19 GLY HA2  1 1 
        2   875 1 1 19 GLY HA3  H    3.668  -6.701  -7.072 1.00 . A A .  19 GLY HA3  1 1 
        2   876 1 1 19 GLY N    N    3.688  -4.671  -6.669 1.00 . A A .  19 GLY N    1 1 
        2   877 1 1 19 GLY O    O    2.093  -7.241  -5.211 1.00 . A A .  19 GLY O    1 1 
        2   878 1 1 20 LYS C    C   -1.504  -5.826  -5.496 1.00 . A A .  20 LYS C    1 1 
        2   879 1 1 20 LYS CA   C   -0.148  -5.659  -4.817 1.00 . A A .  20 LYS CA   1 1 
        2   880 1 1 20 LYS CB   C   -0.205  -4.500  -3.819 1.00 . A A .  20 LYS CB   1 1 
        2   881 1 1 20 LYS CD   C    0.763  -5.301  -1.643 1.00 . A A .  20 LYS CD   1 1 
        2   882 1 1 20 LYS CE   C    1.902  -5.150  -0.646 1.00 . A A .  20 LYS CE   1 1 
        2   883 1 1 20 LYS CG   C    0.988  -4.448  -2.880 1.00 . A A .  20 LYS CG   1 1 
        2   884 1 1 20 LYS H    H    0.837  -4.648  -6.394 1.00 . A A .  20 LYS H    1 1 
        2   885 1 1 20 LYS HA   H    0.090  -6.569  -4.287 1.00 . A A .  20 LYS HA   1 1 
        2   886 1 1 20 LYS HB2  H   -0.247  -3.571  -4.366 1.00 . A A .  20 LYS HB2  1 1 
        2   887 1 1 20 LYS HB3  H   -1.101  -4.598  -3.223 1.00 . A A .  20 LYS HB3  1 1 
        2   888 1 1 20 LYS HD2  H   -0.158  -4.995  -1.168 1.00 . A A .  20 LYS HD2  1 1 
        2   889 1 1 20 LYS HD3  H    0.690  -6.337  -1.939 1.00 . A A .  20 LYS HD3  1 1 
        2   890 1 1 20 LYS HE2  H    2.001  -6.069  -0.091 1.00 . A A .  20 LYS HE2  1 1 
        2   891 1 1 20 LYS HE3  H    2.815  -4.957  -1.190 1.00 . A A .  20 LYS HE3  1 1 
        2   892 1 1 20 LYS HG2  H    1.861  -4.812  -3.401 1.00 . A A .  20 LYS HG2  1 1 
        2   893 1 1 20 LYS HG3  H    1.150  -3.423  -2.575 1.00 . A A .  20 LYS HG3  1 1 
        2   894 1 1 20 LYS HZ1  H    1.559  -3.135  -0.211 1.00 . A A .  20 LYS HZ1  1 1 
        2   895 1 1 20 LYS HZ2  H    2.459  -3.948   0.969 1.00 . A A .  20 LYS HZ2  1 1 
        2   896 1 1 20 LYS HZ3  H    0.791  -4.206   0.850 1.00 . A A .  20 LYS HZ3  1 1 
        2   897 1 1 20 LYS N    N    0.902  -5.427  -5.802 1.00 . A A .  20 LYS N    1 1 
        2   898 1 1 20 LYS NZ   N    1.661  -4.031   0.307 1.00 . A A .  20 LYS NZ   1 1 
        2   899 1 1 20 LYS O    O   -1.654  -5.538  -6.683 1.00 . A A .  20 LYS O    1 1 
        2   900 1 1 21 SER C    C   -4.873  -5.806  -4.387 1.00 . A A .  21 SER C    1 1 
        2   901 1 1 21 SER CA   C   -3.832  -6.496  -5.263 1.00 . A A .  21 SER CA   1 1 
        2   902 1 1 21 SER CB   C   -4.141  -7.992  -5.359 1.00 . A A .  21 SER CB   1 1 
        2   903 1 1 21 SER H    H   -2.307  -6.501  -3.794 1.00 . A A .  21 SER H    1 1 
        2   904 1 1 21 SER HA   H   -3.869  -6.066  -6.252 1.00 . A A .  21 SER HA   1 1 
        2   905 1 1 21 SER HB2  H   -5.036  -8.135  -5.944 1.00 . A A .  21 SER HB2  1 1 
        2   906 1 1 21 SER HB3  H   -3.314  -8.497  -5.836 1.00 . A A .  21 SER HB3  1 1 
        2   907 1 1 21 SER HG   H   -4.759  -9.414  -4.162 1.00 . A A .  21 SER HG   1 1 
        2   908 1 1 21 SER N    N   -2.489  -6.290  -4.734 1.00 . A A .  21 SER N    1 1 
        2   909 1 1 21 SER O    O   -4.939  -6.039  -3.180 1.00 . A A .  21 SER O    1 1 
        2   910 1 1 21 SER OG   O   -4.340  -8.555  -4.074 1.00 . A A .  21 SER OG   1 1 
        2   911 1 1 22 PHE C    C   -8.054  -4.296  -5.027 1.00 . A A .  22 PHE C    1 1 
        2   912 1 1 22 PHE CA   C   -6.724  -4.228  -4.282 1.00 . A A .  22 PHE CA   1 1 
        2   913 1 1 22 PHE CB   C   -6.311  -2.768  -4.085 1.00 . A A .  22 PHE CB   1 1 
        2   914 1 1 22 PHE CD1  C   -5.069  -2.575  -1.913 1.00 . A A .  22 PHE CD1  1 1 
        2   915 1 1 22 PHE CD2  C   -3.822  -2.482  -3.943 1.00 . A A .  22 PHE CD2  1 1 
        2   916 1 1 22 PHE CE1  C   -3.903  -2.424  -1.187 1.00 . A A .  22 PHE CE1  1 1 
        2   917 1 1 22 PHE CE2  C   -2.653  -2.331  -3.222 1.00 . A A .  22 PHE CE2  1 1 
        2   918 1 1 22 PHE CG   C   -5.042  -2.605  -3.298 1.00 . A A .  22 PHE CG   1 1 
        2   919 1 1 22 PHE CZ   C   -2.693  -2.303  -1.842 1.00 . A A .  22 PHE CZ   1 1 
        2   920 1 1 22 PHE H    H   -5.584  -4.811  -5.969 1.00 . A A .  22 PHE H    1 1 
        2   921 1 1 22 PHE HA   H   -6.842  -4.694  -3.316 1.00 . A A .  22 PHE HA   1 1 
        2   922 1 1 22 PHE HB2  H   -6.163  -2.310  -5.051 1.00 . A A .  22 PHE HB2  1 1 
        2   923 1 1 22 PHE HB3  H   -7.098  -2.247  -3.561 1.00 . A A .  22 PHE HB3  1 1 
        2   924 1 1 22 PHE HD1  H   -6.015  -2.670  -1.399 1.00 . A A .  22 PHE HD1  1 1 
        2   925 1 1 22 PHE HD2  H   -3.789  -2.504  -5.024 1.00 . A A .  22 PHE HD2  1 1 
        2   926 1 1 22 PHE HE1  H   -3.938  -2.402  -0.108 1.00 . A A .  22 PHE HE1  1 1 
        2   927 1 1 22 PHE HE2  H   -1.708  -2.237  -3.738 1.00 . A A .  22 PHE HE2  1 1 
        2   928 1 1 22 PHE HZ   H   -1.781  -2.185  -1.277 1.00 . A A .  22 PHE HZ   1 1 
        2   929 1 1 22 PHE N    N   -5.686  -4.954  -5.004 1.00 . A A .  22 PHE N    1 1 
        2   930 1 1 22 PHE O    O   -8.086  -4.411  -6.252 1.00 . A A .  22 PHE O    1 1 
        2   931 1 1 23 SER C    C  -10.924  -2.906  -5.349 1.00 . A A .  23 SER C    1 1 
        2   932 1 1 23 SER CA   C  -10.482  -4.284  -4.865 1.00 . A A .  23 SER CA   1 1 
        2   933 1 1 23 SER CB   C  -11.488  -4.826  -3.848 1.00 . A A .  23 SER CB   1 1 
        2   934 1 1 23 SER H    H   -9.058  -4.135  -3.306 1.00 . A A .  23 SER H    1 1 
        2   935 1 1 23 SER HA   H  -10.443  -4.954  -5.712 1.00 . A A .  23 SER HA   1 1 
        2   936 1 1 23 SER HB2  H  -11.375  -4.295  -2.915 1.00 . A A .  23 SER HB2  1 1 
        2   937 1 1 23 SER HB3  H  -12.490  -4.682  -4.225 1.00 . A A .  23 SER HB3  1 1 
        2   938 1 1 23 SER HG   H  -11.552  -6.708  -4.388 1.00 . A A .  23 SER HG   1 1 
        2   939 1 1 23 SER N    N   -9.149  -4.226  -4.278 1.00 . A A .  23 SER N    1 1 
        2   940 1 1 23 SER O    O  -11.451  -2.762  -6.451 1.00 . A A .  23 SER O    1 1 
        2   941 1 1 23 SER OG   O  -11.282  -6.209  -3.614 1.00 . A A .  23 SER OG   1 1 
        2   942 1 1 24 GLY C    C   -9.942   0.236  -5.497 1.00 . A A .  24 GLY C    1 1 
        2   943 1 1 24 GLY CA   C  -11.084  -0.541  -4.873 1.00 . A A .  24 GLY CA   1 1 
        2   944 1 1 24 GLY H    H  -10.280  -2.069  -3.648 1.00 . A A .  24 GLY H    1 1 
        2   945 1 1 24 GLY HA2  H  -11.904  -0.583  -5.575 1.00 . A A .  24 GLY HA2  1 1 
        2   946 1 1 24 GLY HA3  H  -11.412  -0.023  -3.983 1.00 . A A .  24 GLY HA3  1 1 
        2   947 1 1 24 GLY N    N  -10.704  -1.894  -4.514 1.00 . A A .  24 GLY N    1 1 
        2   948 1 1 24 GLY O    O   -8.780   0.032  -5.148 1.00 . A A .  24 GLY O    1 1 
        2   949 1 1 25 SER C    C   -8.672   2.974  -6.156 1.00 . A A .  25 SER C    1 1 
        2   950 1 1 25 SER CA   C   -9.266   1.936  -7.103 1.00 . A A .  25 SER CA   1 1 
        2   951 1 1 25 SER CB   C   -9.875   2.631  -8.322 1.00 . A A .  25 SER CB   1 1 
        2   952 1 1 25 SER H    H  -11.218   1.246  -6.659 1.00 . A A .  25 SER H    1 1 
        2   953 1 1 25 SER HA   H   -8.479   1.274  -7.433 1.00 . A A .  25 SER HA   1 1 
        2   954 1 1 25 SER HB2  H  -10.257   1.887  -9.004 1.00 . A A .  25 SER HB2  1 1 
        2   955 1 1 25 SER HB3  H  -10.682   3.274  -8.001 1.00 . A A .  25 SER HB3  1 1 
        2   956 1 1 25 SER HG   H   -8.234   3.700  -8.376 1.00 . A A .  25 SER HG   1 1 
        2   957 1 1 25 SER N    N  -10.273   1.129  -6.425 1.00 . A A .  25 SER N    1 1 
        2   958 1 1 25 SER O    O   -7.455   3.050  -5.984 1.00 . A A .  25 SER O    1 1 
        2   959 1 1 25 SER OG   O   -8.908   3.416  -8.998 1.00 . A A .  25 SER OG   1 1 
        2   960 1 1 26 TYR C    C   -7.993   4.290  -3.705 1.00 . A A .  26 TYR C    1 1 
        2   961 1 1 26 TYR CA   C   -9.103   4.807  -4.615 1.00 . A A .  26 TYR CA   1 1 
        2   962 1 1 26 TYR CB   C  -10.282   5.296  -3.772 1.00 . A A .  26 TYR CB   1 1 
        2   963 1 1 26 TYR CD1  C   -9.057   6.554  -1.957 1.00 . A A .  26 TYR CD1  1 1 
        2   964 1 1 26 TYR CD2  C  -10.635   7.748  -3.285 1.00 . A A .  26 TYR CD2  1 1 
        2   965 1 1 26 TYR CE1  C   -8.784   7.703  -1.240 1.00 . A A .  26 TYR CE1  1 1 
        2   966 1 1 26 TYR CE2  C  -10.368   8.902  -2.574 1.00 . A A .  26 TYR CE2  1 1 
        2   967 1 1 26 TYR CG   C   -9.986   6.556  -2.990 1.00 . A A .  26 TYR CG   1 1 
        2   968 1 1 26 TYR CZ   C   -9.442   8.874  -1.552 1.00 . A A .  26 TYR CZ   1 1 
        2   969 1 1 26 TYR H    H  -10.498   3.662  -5.721 1.00 . A A .  26 TYR H    1 1 
        2   970 1 1 26 TYR HA   H   -8.721   5.634  -5.196 1.00 . A A .  26 TYR HA   1 1 
        2   971 1 1 26 TYR HB2  H  -11.120   5.498  -4.420 1.00 . A A .  26 TYR HB2  1 1 
        2   972 1 1 26 TYR HB3  H  -10.556   4.525  -3.067 1.00 . A A .  26 TYR HB3  1 1 
        2   973 1 1 26 TYR HD1  H   -8.544   5.635  -1.715 1.00 . A A .  26 TYR HD1  1 1 
        2   974 1 1 26 TYR HD2  H  -11.360   7.767  -4.087 1.00 . A A .  26 TYR HD2  1 1 
        2   975 1 1 26 TYR HE1  H   -8.059   7.681  -0.439 1.00 . A A .  26 TYR HE1  1 1 
        2   976 1 1 26 TYR HE2  H  -10.882   9.820  -2.819 1.00 . A A .  26 TYR HE2  1 1 
        2   977 1 1 26 TYR HH   H   -8.283   9.972  -0.481 1.00 . A A .  26 TYR HH   1 1 
        2   978 1 1 26 TYR N    N   -9.540   3.771  -5.543 1.00 . A A .  26 TYR N    1 1 
        2   979 1 1 26 TYR O    O   -6.939   4.913  -3.578 1.00 . A A .  26 TYR O    1 1 
        2   980 1 1 26 TYR OH   O   -9.172  10.021  -0.841 1.00 . A A .  26 TYR OH   1 1 
        2   981 1 1 27 ARG C    C   -5.900   2.419  -2.858 1.00 . A A .  27 ARG C    1 1 
        2   982 1 1 27 ARG CA   C   -7.260   2.544  -2.177 1.00 . A A .  27 ARG CA   1 1 
        2   983 1 1 27 ARG CB   C   -7.740   1.166  -1.715 1.00 . A A .  27 ARG CB   1 1 
        2   984 1 1 27 ARG CD   C   -7.222   1.053   0.742 1.00 . A A .  27 ARG CD   1 1 
        2   985 1 1 27 ARG CG   C   -6.860   0.542  -0.644 1.00 . A A .  27 ARG CG   1 1 
        2   986 1 1 27 ARG CZ   C   -6.184   1.043   2.970 1.00 . A A .  27 ARG CZ   1 1 
        2   987 1 1 27 ARG H    H   -9.097   2.696  -3.217 1.00 . A A .  27 ARG H    1 1 
        2   988 1 1 27 ARG HA   H   -7.160   3.188  -1.316 1.00 . A A .  27 ARG HA   1 1 
        2   989 1 1 27 ARG HB2  H   -8.740   1.261  -1.318 1.00 . A A .  27 ARG HB2  1 1 
        2   990 1 1 27 ARG HB3  H   -7.760   0.502  -2.566 1.00 . A A .  27 ARG HB3  1 1 
        2   991 1 1 27 ARG HD2  H   -7.588   2.065   0.653 1.00 . A A .  27 ARG HD2  1 1 
        2   992 1 1 27 ARG HD3  H   -7.999   0.424   1.151 1.00 . A A .  27 ARG HD3  1 1 
        2   993 1 1 27 ARG HE   H   -5.182   1.031   1.246 1.00 . A A .  27 ARG HE   1 1 
        2   994 1 1 27 ARG HG2  H   -6.989  -0.530  -0.665 1.00 . A A .  27 ARG HG2  1 1 
        2   995 1 1 27 ARG HG3  H   -5.829   0.787  -0.851 1.00 . A A .  27 ARG HG3  1 1 
        2   996 1 1 27 ARG HH11 H   -8.204   1.063   2.973 1.00 . A A .  27 ARG HH11 1 1 
        2   997 1 1 27 ARG HH12 H   -7.460   1.055   4.538 1.00 . A A .  27 ARG HH12 1 1 
        2   998 1 1 27 ARG HH21 H   -4.190   1.021   3.300 1.00 . A A .  27 ARG HH21 1 1 
        2   999 1 1 27 ARG HH22 H   -5.177   1.032   4.722 1.00 . A A .  27 ARG HH22 1 1 
        2  1000 1 1 27 ARG N    N   -8.238   3.146  -3.075 1.00 . A A .  27 ARG N    1 1 
        2  1001 1 1 27 ARG NE   N   -6.076   1.041   1.646 1.00 . A A .  27 ARG NE   1 1 
        2  1002 1 1 27 ARG NH1  N   -7.381   1.055   3.541 1.00 . A A .  27 ARG NH1  1 1 
        2  1003 1 1 27 ARG NH2  N   -5.094   1.031   3.726 1.00 . A A .  27 ARG NH2  1 1 
        2  1004 1 1 27 ARG O    O   -4.867   2.737  -2.268 1.00 . A A .  27 ARG O    1 1 
        2  1005 1 1 28 LEU C    C   -3.836   3.057  -4.828 1.00 . A A .  28 LEU C    1 1 
        2  1006 1 1 28 LEU CA   C   -4.676   1.784  -4.864 1.00 . A A .  28 LEU CA   1 1 
        2  1007 1 1 28 LEU CB   C   -4.996   1.411  -6.312 1.00 . A A .  28 LEU CB   1 1 
        2  1008 1 1 28 LEU CD1  C   -3.598  -0.530  -7.062 1.00 . A A .  28 LEU CD1  1 1 
        2  1009 1 1 28 LEU CD2  C   -4.020   1.380  -8.621 1.00 . A A .  28 LEU CD2  1 1 
        2  1010 1 1 28 LEU CG   C   -3.809   0.973  -7.170 1.00 . A A .  28 LEU CG   1 1 
        2  1011 1 1 28 LEU H    H   -6.763   1.715  -4.518 1.00 . A A .  28 LEU H    1 1 
        2  1012 1 1 28 LEU HA   H   -4.113   0.982  -4.410 1.00 . A A .  28 LEU HA   1 1 
        2  1013 1 1 28 LEU HB2  H   -5.709   0.601  -6.296 1.00 . A A .  28 LEU HB2  1 1 
        2  1014 1 1 28 LEU HB3  H   -5.445   2.274  -6.784 1.00 . A A .  28 LEU HB3  1 1 
        2  1015 1 1 28 LEU HD11 H   -4.229  -0.926  -6.282 1.00 . A A .  28 LEU HD11 1 1 
        2  1016 1 1 28 LEU HD12 H   -2.564  -0.732  -6.827 1.00 . A A .  28 LEU HD12 1 1 
        2  1017 1 1 28 LEU HD13 H   -3.851  -0.997  -8.003 1.00 . A A .  28 LEU HD13 1 1 
        2  1018 1 1 28 LEU HD21 H   -3.619   2.371  -8.779 1.00 . A A .  28 LEU HD21 1 1 
        2  1019 1 1 28 LEU HD22 H   -5.076   1.379  -8.845 1.00 . A A .  28 LEU HD22 1 1 
        2  1020 1 1 28 LEU HD23 H   -3.514   0.679  -9.269 1.00 . A A .  28 LEU HD23 1 1 
        2  1021 1 1 28 LEU HG   H   -2.913   1.461  -6.812 1.00 . A A .  28 LEU HG   1 1 
        2  1022 1 1 28 LEU N    N   -5.909   1.952  -4.102 1.00 . A A .  28 LEU N    1 1 
        2  1023 1 1 28 LEU O    O   -2.695   3.048  -4.364 1.00 . A A .  28 LEU O    1 1 
        2  1024 1 1 29 THR C    C   -3.035   5.714  -4.007 1.00 . A A .  29 THR C    1 1 
        2  1025 1 1 29 THR CA   C   -3.713   5.432  -5.343 1.00 . A A .  29 THR CA   1 1 
        2  1026 1 1 29 THR CB   C   -4.676   6.588  -5.671 1.00 . A A .  29 THR CB   1 1 
        2  1027 1 1 29 THR CG2  C   -3.911   7.885  -5.887 1.00 . A A .  29 THR CG2  1 1 
        2  1028 1 1 29 THR H    H   -5.319   4.095  -5.675 1.00 . A A .  29 THR H    1 1 
        2  1029 1 1 29 THR HA   H   -2.959   5.389  -6.116 1.00 . A A .  29 THR HA   1 1 
        2  1030 1 1 29 THR HB   H   -5.352   6.721  -4.838 1.00 . A A .  29 THR HB   1 1 
        2  1031 1 1 29 THR HG1  H   -5.691   7.088  -7.286 1.00 . A A .  29 THR HG1  1 1 
        2  1032 1 1 29 THR HG21 H   -3.152   7.986  -5.126 1.00 . A A .  29 THR HG21 1 1 
        2  1033 1 1 29 THR HG22 H   -4.593   8.720  -5.828 1.00 . A A .  29 THR HG22 1 1 
        2  1034 1 1 29 THR HG23 H   -3.445   7.870  -6.861 1.00 . A A .  29 THR HG23 1 1 
        2  1035 1 1 29 THR N    N   -4.408   4.152  -5.319 1.00 . A A .  29 THR N    1 1 
        2  1036 1 1 29 THR O    O   -1.820   5.899  -3.944 1.00 . A A .  29 THR O    1 1 
        2  1037 1 1 29 THR OG1  O   -5.436   6.275  -6.844 1.00 . A A .  29 THR OG1  1 1 
        2  1038 1 1 30 GLN C    C   -2.059   5.165  -1.337 1.00 . A A .  30 GLN C    1 1 
        2  1039 1 1 30 GLN CA   C   -3.303   6.005  -1.606 1.00 . A A .  30 GLN CA   1 1 
        2  1040 1 1 30 GLN CB   C   -4.369   5.711  -0.549 1.00 . A A .  30 GLN CB   1 1 
        2  1041 1 1 30 GLN CD   C   -5.139   8.118  -0.568 1.00 . A A .  30 GLN CD   1 1 
        2  1042 1 1 30 GLN CG   C   -5.556   6.661  -0.601 1.00 . A A .  30 GLN CG   1 1 
        2  1043 1 1 30 GLN H    H   -4.788   5.591  -3.055 1.00 . A A .  30 GLN H    1 1 
        2  1044 1 1 30 GLN HA   H   -3.035   7.050  -1.552 1.00 . A A .  30 GLN HA   1 1 
        2  1045 1 1 30 GLN HB2  H   -4.734   4.705  -0.693 1.00 . A A .  30 GLN HB2  1 1 
        2  1046 1 1 30 GLN HB3  H   -3.919   5.786   0.430 1.00 . A A .  30 GLN HB3  1 1 
        2  1047 1 1 30 GLN HE21 H   -4.536   7.927   1.317 1.00 . A A .  30 GLN HE21 1 1 
        2  1048 1 1 30 GLN HE22 H   -4.342   9.496   0.622 1.00 . A A .  30 GLN HE22 1 1 
        2  1049 1 1 30 GLN HG2  H   -6.105   6.481  -1.514 1.00 . A A .  30 GLN HG2  1 1 
        2  1050 1 1 30 GLN HG3  H   -6.195   6.464   0.247 1.00 . A A .  30 GLN HG3  1 1 
        2  1051 1 1 30 GLN N    N   -3.828   5.746  -2.941 1.00 . A A .  30 GLN N    1 1 
        2  1052 1 1 30 GLN NE2  N   -4.620   8.559   0.572 1.00 . A A .  30 GLN NE2  1 1 
        2  1053 1 1 30 GLN O    O   -1.007   5.693  -0.976 1.00 . A A .  30 GLN O    1 1 
        2  1054 1 1 30 GLN OE1  O   -5.282   8.839  -1.555 1.00 . A A .  30 GLN OE1  1 1 
        2  1055 1 1 31 HIS C    C    0.130   3.329  -2.149 1.00 . A A .  31 HIS C    1 1 
        2  1056 1 1 31 HIS CA   C   -1.072   2.940  -1.292 1.00 . A A .  31 HIS CA   1 1 
        2  1057 1 1 31 HIS CB   C   -1.492   1.504  -1.605 1.00 . A A .  31 HIS CB   1 1 
        2  1058 1 1 31 HIS CD2  C    0.218   0.292  -3.133 1.00 . A A .  31 HIS CD2  1 1 
        2  1059 1 1 31 HIS CE1  C    1.314  -0.804  -1.581 1.00 . A A .  31 HIS CE1  1 1 
        2  1060 1 1 31 HIS CG   C   -0.343   0.603  -1.941 1.00 . A A .  31 HIS CG   1 1 
        2  1061 1 1 31 HIS H    H   -3.050   3.493  -1.804 1.00 . A A .  31 HIS H    1 1 
        2  1062 1 1 31 HIS HA   H   -0.792   3.006  -0.252 1.00 . A A .  31 HIS HA   1 1 
        2  1063 1 1 31 HIS HB2  H   -1.998   1.088  -0.746 1.00 . A A .  31 HIS HB2  1 1 
        2  1064 1 1 31 HIS HB3  H   -2.169   1.508  -2.447 1.00 . A A .  31 HIS HB3  1 1 
        2  1065 1 1 31 HIS HD1  H    0.199  -0.084  -0.025 1.00 . A A .  31 HIS HD1  1 1 
        2  1066 1 1 31 HIS HD2  H   -0.085   0.663  -4.102 1.00 . A A .  31 HIS HD2  1 1 
        2  1067 1 1 31 HIS HE1  H    2.024  -1.449  -1.087 1.00 . A A .  31 HIS HE1  1 1 
        2  1068 1 1 31 HIS N    N   -2.186   3.854  -1.515 1.00 . A A .  31 HIS N    1 1 
        2  1069 1 1 31 HIS ND1  N    0.365  -0.100  -0.990 1.00 . A A .  31 HIS ND1  1 1 
        2  1070 1 1 31 HIS NE2  N    1.246  -0.584  -2.882 1.00 . A A .  31 HIS NE2  1 1 
        2  1071 1 1 31 HIS O    O    1.252   3.426  -1.653 1.00 . A A .  31 HIS O    1 1 
        2  1072 1 1 32 TRP C    C    1.834   5.012  -3.758 1.00 . A A .  32 TRP C    1 1 
        2  1073 1 1 32 TRP CA   C    0.948   3.928  -4.361 1.00 . A A .  32 TRP CA   1 1 
        2  1074 1 1 32 TRP CB   C    0.352   4.414  -5.682 1.00 . A A .  32 TRP CB   1 1 
        2  1075 1 1 32 TRP CD1  C   -0.654   2.157  -6.362 1.00 . A A .  32 TRP CD1  1 1 
        2  1076 1 1 32 TRP CD2  C    0.402   3.231  -8.019 1.00 . A A .  32 TRP CD2  1 1 
        2  1077 1 1 32 TRP CE2  C   -0.101   2.014  -8.520 1.00 . A A .  32 TRP CE2  1 1 
        2  1078 1 1 32 TRP CE3  C    1.104   4.076  -8.883 1.00 . A A .  32 TRP CE3  1 1 
        2  1079 1 1 32 TRP CG   C    0.037   3.303  -6.637 1.00 . A A .  32 TRP CG   1 1 
        2  1080 1 1 32 TRP CH2  C    0.769   2.471 -10.669 1.00 . A A .  32 TRP CH2  1 1 
        2  1081 1 1 32 TRP CZ2  C    0.078   1.624  -9.845 1.00 . A A .  32 TRP CZ2  1 1 
        2  1082 1 1 32 TRP CZ3  C    1.280   3.688 -10.197 1.00 . A A .  32 TRP CZ3  1 1 
        2  1083 1 1 32 TRP H    H   -1.031   3.457  -3.771 1.00 . A A .  32 TRP H    1 1 
        2  1084 1 1 32 TRP HA   H    1.549   3.051  -4.549 1.00 . A A .  32 TRP HA   1 1 
        2  1085 1 1 32 TRP HB2  H   -0.563   4.951  -5.482 1.00 . A A .  32 TRP HB2  1 1 
        2  1086 1 1 32 TRP HB3  H    1.056   5.078  -6.163 1.00 . A A .  32 TRP HB3  1 1 
        2  1087 1 1 32 TRP HD1  H   -1.065   1.913  -5.394 1.00 . A A .  32 TRP HD1  1 1 
        2  1088 1 1 32 TRP HE1  H   -1.188   0.507  -7.547 1.00 . A A .  32 TRP HE1  1 1 
        2  1089 1 1 32 TRP HE3  H    1.506   5.018  -8.539 1.00 . A A .  32 TRP HE3  1 1 
        2  1090 1 1 32 TRP HH2  H    0.931   2.209 -11.702 1.00 . A A .  32 TRP HH2  1 1 
        2  1091 1 1 32 TRP HZ2  H   -0.311   0.690 -10.224 1.00 . A A .  32 TRP HZ2  1 1 
        2  1092 1 1 32 TRP HZ3  H    1.820   4.328 -10.880 1.00 . A A .  32 TRP HZ3  1 1 
        2  1093 1 1 32 TRP N    N   -0.115   3.550  -3.435 1.00 . A A .  32 TRP N    1 1 
        2  1094 1 1 32 TRP NE1  N   -0.740   1.378  -7.490 1.00 . A A .  32 TRP NE1  1 1 
        2  1095 1 1 32 TRP O    O    3.061   4.915  -3.796 1.00 . A A .  32 TRP O    1 1 
        2  1096 1 1 33 ILE C    C    3.131   6.634  -1.790 1.00 . A A .  33 ILE C    1 1 
        2  1097 1 1 33 ILE CA   C    1.939   7.145  -2.593 1.00 . A A .  33 ILE CA   1 1 
        2  1098 1 1 33 ILE CB   C    1.033   7.981  -1.669 1.00 . A A .  33 ILE CB   1 1 
        2  1099 1 1 33 ILE CD1  C   -1.244   9.115  -1.594 1.00 . A A .  33 ILE CD1  1 1 
        2  1100 1 1 33 ILE CG1  C   -0.130   8.577  -2.464 1.00 . A A .  33 ILE CG1  1 1 
        2  1101 1 1 33 ILE CG2  C    1.838   9.080  -0.991 1.00 . A A .  33 ILE CG2  1 1 
        2  1102 1 1 33 ILE H    H    0.227   6.063  -3.205 1.00 . A A .  33 ILE H    1 1 
        2  1103 1 1 33 ILE HA   H    2.300   7.785  -3.385 1.00 . A A .  33 ILE HA   1 1 
        2  1104 1 1 33 ILE HB   H    0.640   7.330  -0.903 1.00 . A A .  33 ILE HB   1 1 
        2  1105 1 1 33 ILE HD11 H   -2.187   9.013  -2.112 1.00 . A A .  33 ILE HD11 1 1 
        2  1106 1 1 33 ILE HD12 H   -1.280   8.558  -0.669 1.00 . A A .  33 ILE HD12 1 1 
        2  1107 1 1 33 ILE HD13 H   -1.063  10.158  -1.379 1.00 . A A .  33 ILE HD13 1 1 
        2  1108 1 1 33 ILE HG12 H    0.237   9.390  -3.072 1.00 . A A .  33 ILE HG12 1 1 
        2  1109 1 1 33 ILE HG13 H   -0.548   7.814  -3.105 1.00 . A A .  33 ILE HG13 1 1 
        2  1110 1 1 33 ILE HG21 H    1.669   9.044   0.075 1.00 . A A .  33 ILE HG21 1 1 
        2  1111 1 1 33 ILE HG22 H    2.888   8.933  -1.193 1.00 . A A .  33 ILE HG22 1 1 
        2  1112 1 1 33 ILE HG23 H    1.528  10.041  -1.373 1.00 . A A .  33 ILE HG23 1 1 
        2  1113 1 1 33 ILE N    N    1.206   6.043  -3.204 1.00 . A A .  33 ILE N    1 1 
        2  1114 1 1 33 ILE O    O    4.201   7.243  -1.790 1.00 . A A .  33 ILE O    1 1 
        2  1115 1 1 34 THR C    C    5.321   4.898  -1.057 1.00 . A A .  34 THR C    1 1 
        2  1116 1 1 34 THR CA   C    3.997   4.915  -0.301 1.00 . A A .  34 THR CA   1 1 
        2  1117 1 1 34 THR CB   C    3.642   3.477   0.122 1.00 . A A .  34 THR CB   1 1 
        2  1118 1 1 34 THR CG2  C    2.350   3.452   0.924 1.00 . A A .  34 THR CG2  1 1 
        2  1119 1 1 34 THR H    H    2.064   5.070  -1.147 1.00 . A A .  34 THR H    1 1 
        2  1120 1 1 34 THR HA   H    4.112   5.512   0.592 1.00 . A A .  34 THR HA   1 1 
        2  1121 1 1 34 THR HB   H    4.440   3.092   0.740 1.00 . A A .  34 THR HB   1 1 
        2  1122 1 1 34 THR HG1  H    3.366   1.736  -0.763 1.00 . A A .  34 THR HG1  1 1 
        2  1123 1 1 34 THR HG21 H    1.803   4.368   0.754 1.00 . A A .  34 THR HG21 1 1 
        2  1124 1 1 34 THR HG22 H    2.580   3.361   1.975 1.00 . A A .  34 THR HG22 1 1 
        2  1125 1 1 34 THR HG23 H    1.748   2.611   0.612 1.00 . A A .  34 THR HG23 1 1 
        2  1126 1 1 34 THR N    N    2.939   5.509  -1.107 1.00 . A A .  34 THR N    1 1 
        2  1127 1 1 34 THR O    O    6.364   5.262  -0.512 1.00 . A A .  34 THR O    1 1 
        2  1128 1 1 34 THR OG1  O    3.506   2.646  -1.037 1.00 . A A .  34 THR OG1  1 1 
        2  1129 1 1 35 HIS C    C    7.014   5.808  -3.423 1.00 . A A .  35 HIS C    1 1 
        2  1130 1 1 35 HIS CA   C    6.470   4.409  -3.147 1.00 . A A .  35 HIS CA   1 1 
        2  1131 1 1 35 HIS CB   C    6.163   3.699  -4.466 1.00 . A A .  35 HIS CB   1 1 
        2  1132 1 1 35 HIS CD2  C    4.316   1.897  -4.730 1.00 . A A .  35 HIS CD2  1 1 
        2  1133 1 1 35 HIS CE1  C    5.277   0.285  -3.597 1.00 . A A .  35 HIS CE1  1 1 
        2  1134 1 1 35 HIS CG   C    5.507   2.364  -4.288 1.00 . A A .  35 HIS CG   1 1 
        2  1135 1 1 35 HIS H    H    4.413   4.195  -2.693 1.00 . A A .  35 HIS H    1 1 
        2  1136 1 1 35 HIS HA   H    7.217   3.846  -2.610 1.00 . A A .  35 HIS HA   1 1 
        2  1137 1 1 35 HIS HB2  H    5.501   4.317  -5.054 1.00 . A A .  35 HIS HB2  1 1 
        2  1138 1 1 35 HIS HB3  H    7.085   3.547  -5.009 1.00 . A A .  35 HIS HB3  1 1 
        2  1139 1 1 35 HIS HD1  H    6.956   1.358  -3.136 1.00 . A A .  35 HIS HD1  1 1 
        2  1140 1 1 35 HIS HD2  H    3.593   2.441  -5.321 1.00 . A A .  35 HIS HD2  1 1 
        2  1141 1 1 35 HIS HE1  H    5.467  -0.668  -3.126 1.00 . A A .  35 HIS HE1  1 1 
        2  1142 1 1 35 HIS N    N    5.273   4.472  -2.315 1.00 . A A .  35 HIS N    1 1 
        2  1143 1 1 35 HIS ND1  N    6.084   1.330  -3.581 1.00 . A A .  35 HIS ND1  1 1 
        2  1144 1 1 35 HIS NE2  N    4.196   0.603  -4.287 1.00 . A A .  35 HIS NE2  1 1 
        2  1145 1 1 35 HIS O    O    8.226   6.021  -3.447 1.00 . A A .  35 HIS O    1 1 
        2  1146 1 1 36 THR C    C    5.589   9.120  -3.182 1.00 . A A .  36 THR C    1 1 
        2  1147 1 1 36 THR CA   C    6.497   8.136  -3.910 1.00 . A A .  36 THR CA   1 1 
        2  1148 1 1 36 THR CB   C    6.458   8.438  -5.420 1.00 . A A .  36 THR CB   1 1 
        2  1149 1 1 36 THR CG2  C    7.572   7.702  -6.148 1.00 . A A .  36 THR CG2  1 1 
        2  1150 1 1 36 THR H    H    5.157   6.527  -3.601 1.00 . A A .  36 THR H    1 1 
        2  1151 1 1 36 THR HA   H    7.511   8.273  -3.563 1.00 . A A .  36 THR HA   1 1 
        2  1152 1 1 36 THR HB   H    6.596   9.500  -5.562 1.00 . A A .  36 THR HB   1 1 
        2  1153 1 1 36 THR HG1  H    5.134   7.096  -5.997 1.00 . A A .  36 THR HG1  1 1 
        2  1154 1 1 36 THR HG21 H    7.459   7.841  -7.212 1.00 . A A .  36 THR HG21 1 1 
        2  1155 1 1 36 THR HG22 H    7.520   6.648  -5.916 1.00 . A A .  36 THR HG22 1 1 
        2  1156 1 1 36 THR HG23 H    8.528   8.093  -5.833 1.00 . A A .  36 THR HG23 1 1 
        2  1157 1 1 36 THR N    N    6.109   6.759  -3.633 1.00 . A A .  36 THR N    1 1 
        2  1158 1 1 36 THR O    O    4.375   9.126  -3.385 1.00 . A A .  36 THR O    1 1 
        2  1159 1 1 36 THR OG1  O    5.190   8.054  -5.963 1.00 . A A .  36 THR OG1  1 1 
        2  1160 1 1 37 ARG C    C    5.852  12.358  -1.955 1.00 . A A .  37 ARG C    1 1 
        2  1161 1 1 37 ARG CA   C    5.428  10.942  -1.576 1.00 . A A .  37 ARG CA   1 1 
        2  1162 1 1 37 ARG CB   C    5.624  10.724  -0.075 1.00 . A A .  37 ARG CB   1 1 
        2  1163 1 1 37 ARG CD   C    5.692   8.898   1.650 1.00 . A A .  37 ARG CD   1 1 
        2  1164 1 1 37 ARG CG   C    4.951   9.467   0.451 1.00 . A A .  37 ARG CG   1 1 
        2  1165 1 1 37 ARG CZ   C    4.063   8.743   3.485 1.00 . A A .  37 ARG CZ   1 1 
        2  1166 1 1 37 ARG H    H    7.156   9.900  -2.215 1.00 . A A .  37 ARG H    1 1 
        2  1167 1 1 37 ARG HA   H    4.383  10.815  -1.816 1.00 . A A .  37 ARG HA   1 1 
        2  1168 1 1 37 ARG HB2  H    6.682  10.653   0.132 1.00 . A A .  37 ARG HB2  1 1 
        2  1169 1 1 37 ARG HB3  H    5.218  11.572   0.455 1.00 . A A .  37 ARG HB3  1 1 
        2  1170 1 1 37 ARG HD2  H    6.463   8.229   1.296 1.00 . A A .  37 ARG HD2  1 1 
        2  1171 1 1 37 ARG HD3  H    6.146   9.712   2.195 1.00 . A A .  37 ARG HD3  1 1 
        2  1172 1 1 37 ARG HE   H    4.756   7.191   2.442 1.00 . A A .  37 ARG HE   1 1 
        2  1173 1 1 37 ARG HG2  H    3.940   9.708   0.748 1.00 . A A .  37 ARG HG2  1 1 
        2  1174 1 1 37 ARG HG3  H    4.930   8.726  -0.334 1.00 . A A .  37 ARG HG3  1 1 
        2  1175 1 1 37 ARG HH11 H    4.696  10.615   3.065 1.00 . A A .  37 ARG HH11 1 1 
        2  1176 1 1 37 ARG HH12 H    3.548  10.492   4.357 1.00 . A A .  37 ARG HH12 1 1 
        2  1177 1 1 37 ARG HH21 H    3.243   7.016   4.140 1.00 . A A .  37 ARG HH21 1 1 
        2  1178 1 1 37 ARG HH22 H    2.722   8.444   4.968 1.00 . A A .  37 ARG HH22 1 1 
        2  1179 1 1 37 ARG N    N    6.184   9.953  -2.335 1.00 . A A .  37 ARG N    1 1 
        2  1180 1 1 37 ARG NE   N    4.803   8.163   2.546 1.00 . A A .  37 ARG NE   1 1 
        2  1181 1 1 37 ARG NH1  N    4.106  10.058   3.650 1.00 . A A .  37 ARG NH1  1 1 
        2  1182 1 1 37 ARG NH2  N    3.278   8.007   4.261 1.00 . A A .  37 ARG NH2  1 1 
        2  1183 1 1 37 ARG O    O    5.036  13.158  -2.412 1.00 . A A .  37 ARG O    1 1 
        2  1184 1 1 38 GLU C    C    8.658  13.899  -3.237 1.00 . A A .  38 GLU C    1 1 
        2  1185 1 1 38 GLU CA   C    7.663  13.978  -2.082 1.00 . A A .  38 GLU CA   1 1 
        2  1186 1 1 38 GLU CB   C    8.338  14.593  -0.854 1.00 . A A .  38 GLU CB   1 1 
        2  1187 1 1 38 GLU CD   C    8.131  16.883  -1.901 1.00 . A A .  38 GLU CD   1 1 
        2  1188 1 1 38 GLU CG   C    9.020  15.921  -1.136 1.00 . A A .  38 GLU CG   1 1 
        2  1189 1 1 38 GLU H    H    7.733  11.977  -1.395 1.00 . A A .  38 GLU H    1 1 
        2  1190 1 1 38 GLU HA   H    6.836  14.606  -2.379 1.00 . A A .  38 GLU HA   1 1 
        2  1191 1 1 38 GLU HB2  H    7.592  14.749  -0.089 1.00 . A A .  38 GLU HB2  1 1 
        2  1192 1 1 38 GLU HB3  H    9.081  13.902  -0.484 1.00 . A A .  38 GLU HB3  1 1 
        2  1193 1 1 38 GLU HG2  H    9.293  16.378  -0.196 1.00 . A A .  38 GLU HG2  1 1 
        2  1194 1 1 38 GLU HG3  H    9.911  15.738  -1.717 1.00 . A A .  38 GLU HG3  1 1 
        2  1195 1 1 38 GLU N    N    7.132  12.659  -1.762 1.00 . A A .  38 GLU N    1 1 
        2  1196 1 1 38 GLU O    O    8.542  14.627  -4.223 1.00 . A A .  38 GLU O    1 1 
        2  1197 1 1 38 GLU OE1  O    6.897  16.815  -1.726 1.00 . A A .  38 GLU OE1  1 1 
        2  1198 1 1 38 GLU OE2  O    8.670  17.702  -2.673 1.00 . A A .  38 GLU OE2  1 1 
        2  1199 1 1 39 LYS C    C   10.261  11.718  -5.102 1.00 . A A .  39 LYS C    1 1 
        2  1200 1 1 39 LYS CA   C   10.653  12.833  -4.137 1.00 . A A .  39 LYS CA   1 1 
        2  1201 1 1 39 LYS CB   C   12.007  12.518  -3.499 1.00 . A A .  39 LYS CB   1 1 
        2  1202 1 1 39 LYS CD   C   13.827  13.304  -1.956 1.00 . A A .  39 LYS CD   1 1 
        2  1203 1 1 39 LYS CE   C   15.045  12.912  -2.779 1.00 . A A .  39 LYS CE   1 1 
        2  1204 1 1 39 LYS CG   C   12.665  13.719  -2.843 1.00 . A A .  39 LYS CG   1 1 
        2  1205 1 1 39 LYS H    H    9.676  12.459  -2.297 1.00 . A A .  39 LYS H    1 1 
        2  1206 1 1 39 LYS HA   H   10.731  13.759  -4.688 1.00 . A A .  39 LYS HA   1 1 
        2  1207 1 1 39 LYS HB2  H   11.868  11.755  -2.747 1.00 . A A .  39 LYS HB2  1 1 
        2  1208 1 1 39 LYS HB3  H   12.673  12.141  -4.262 1.00 . A A .  39 LYS HB3  1 1 
        2  1209 1 1 39 LYS HD2  H   14.092  14.130  -1.313 1.00 . A A .  39 LYS HD2  1 1 
        2  1210 1 1 39 LYS HD3  H   13.524  12.459  -1.353 1.00 . A A .  39 LYS HD3  1 1 
        2  1211 1 1 39 LYS HE2  H   14.834  11.987  -3.292 1.00 . A A .  39 LYS HE2  1 1 
        2  1212 1 1 39 LYS HE3  H   15.238  13.689  -3.503 1.00 . A A .  39 LYS HE3  1 1 
        2  1213 1 1 39 LYS HG2  H   13.033  14.381  -3.613 1.00 . A A .  39 LYS HG2  1 1 
        2  1214 1 1 39 LYS HG3  H   11.932  14.236  -2.241 1.00 . A A .  39 LYS HG3  1 1 
        2  1215 1 1 39 LYS HZ1  H   17.079  12.512  -2.522 1.00 . A A .  39 LYS HZ1  1 1 
        2  1216 1 1 39 LYS HZ2  H   16.105  11.949  -1.259 1.00 . A A .  39 LYS HZ2  1 1 
        2  1217 1 1 39 LYS HZ3  H   16.447  13.600  -1.391 1.00 . A A .  39 LYS HZ3  1 1 
        2  1218 1 1 39 LYS N    N    9.637  13.010  -3.106 1.00 . A A .  39 LYS N    1 1 
        2  1219 1 1 39 LYS NZ   N   16.254  12.731  -1.928 1.00 . A A .  39 LYS NZ   1 1 
        2  1220 1 1 39 LYS O    O    9.595  10.751  -4.732 1.00 . A A .  39 LYS O    1 1 
        2  1221 1 1 40 PRO C    C   11.142   9.556  -7.195 1.00 . A A .  40 PRO C    1 1 
        2  1222 1 1 40 PRO CA   C   10.391  10.866  -7.410 1.00 . A A .  40 PRO CA   1 1 
        2  1223 1 1 40 PRO CB   C   10.868  11.551  -8.692 1.00 . A A .  40 PRO CB   1 1 
        2  1224 1 1 40 PRO CD   C   11.483  12.981  -6.878 1.00 . A A .  40 PRO CD   1 1 
        2  1225 1 1 40 PRO CG   C   11.911  12.515  -8.241 1.00 . A A .  40 PRO CG   1 1 
        2  1226 1 1 40 PRO HA   H    9.332  10.665  -7.479 1.00 . A A .  40 PRO HA   1 1 
        2  1227 1 1 40 PRO HB2  H   11.277  10.813  -9.368 1.00 . A A .  40 PRO HB2  1 1 
        2  1228 1 1 40 PRO HB3  H   10.040  12.059  -9.163 1.00 . A A .  40 PRO HB3  1 1 
        2  1229 1 1 40 PRO HD2  H   12.344  13.158  -6.251 1.00 . A A .  40 PRO HD2  1 1 
        2  1230 1 1 40 PRO HD3  H   10.881  13.874  -6.956 1.00 . A A .  40 PRO HD3  1 1 
        2  1231 1 1 40 PRO HG2  H   12.869  12.020  -8.185 1.00 . A A .  40 PRO HG2  1 1 
        2  1232 1 1 40 PRO HG3  H   11.959  13.350  -8.925 1.00 . A A .  40 PRO HG3  1 1 
        2  1233 1 1 40 PRO N    N   10.684  11.854  -6.367 1.00 . A A .  40 PRO N    1 1 
        2  1234 1 1 40 PRO O    O   11.809   9.372  -6.177 1.00 . A A .  40 PRO O    1 1 
        2  1235 1 1 41 SER C    C   13.159   7.522  -7.680 1.00 . A A .  41 SER C    1 1 
        2  1236 1 1 41 SER CA   C   11.695   7.355  -8.075 1.00 . A A .  41 SER CA   1 1 
        2  1237 1 1 41 SER CB   C   11.596   6.617  -9.411 1.00 . A A .  41 SER CB   1 1 
        2  1238 1 1 41 SER H    H   10.482   8.855  -8.947 1.00 . A A .  41 SER H    1 1 
        2  1239 1 1 41 SER HA   H   11.193   6.774  -7.315 1.00 . A A .  41 SER HA   1 1 
        2  1240 1 1 41 SER HB2  H   11.866   5.582  -9.269 1.00 . A A .  41 SER HB2  1 1 
        2  1241 1 1 41 SER HB3  H   10.581   6.678  -9.779 1.00 . A A .  41 SER HB3  1 1 
        2  1242 1 1 41 SER HG   H   12.386   8.144 -10.350 1.00 . A A .  41 SER HG   1 1 
        2  1243 1 1 41 SER N    N   11.029   8.649  -8.160 1.00 . A A .  41 SER N    1 1 
        2  1244 1 1 41 SER O    O   13.774   8.551  -7.956 1.00 . A A .  41 SER O    1 1 
        2  1245 1 1 41 SER OG   O   12.465   7.188 -10.374 1.00 . A A .  41 SER OG   1 1 
        2  1246 1 1 42 GLY C    C   15.948   5.488  -7.273 1.00 . A A .  42 GLY C    1 1 
        2  1247 1 1 42 GLY CA   C   15.098   6.554  -6.609 1.00 . A A .  42 GLY CA   1 1 
        2  1248 1 1 42 GLY H    H   13.172   5.705  -6.838 1.00 . A A .  42 GLY H    1 1 
        2  1249 1 1 42 GLY HA2  H   15.501   7.525  -6.853 1.00 . A A .  42 GLY HA2  1 1 
        2  1250 1 1 42 GLY HA3  H   15.142   6.416  -5.538 1.00 . A A .  42 GLY HA3  1 1 
        2  1251 1 1 42 GLY N    N   13.711   6.501  -7.031 1.00 . A A .  42 GLY N    1 1 
        2  1252 1 1 42 GLY O    O   16.646   5.744  -8.255 1.00 . A A .  42 GLY O    1 1 
        2  1253 1 1 43 PRO C    C   16.141   2.662  -8.618 1.00 . A A .  43 PRO C    1 1 
        2  1254 1 1 43 PRO CA   C   16.662   3.130  -7.263 1.00 . A A .  43 PRO CA   1 1 
        2  1255 1 1 43 PRO CB   C   16.461   2.040  -6.207 1.00 . A A .  43 PRO CB   1 1 
        2  1256 1 1 43 PRO CD   C   15.086   3.886  -5.562 1.00 . A A .  43 PRO CD   1 1 
        2  1257 1 1 43 PRO CG   C   15.170   2.385  -5.548 1.00 . A A .  43 PRO CG   1 1 
        2  1258 1 1 43 PRO HA   H   17.713   3.366  -7.345 1.00 . A A .  43 PRO HA   1 1 
        2  1259 1 1 43 PRO HB2  H   16.414   1.073  -6.689 1.00 . A A .  43 PRO HB2  1 1 
        2  1260 1 1 43 PRO HB3  H   17.281   2.059  -5.505 1.00 . A A .  43 PRO HB3  1 1 
        2  1261 1 1 43 PRO HD2  H   14.061   4.205  -5.684 1.00 . A A .  43 PRO HD2  1 1 
        2  1262 1 1 43 PRO HD3  H   15.505   4.296  -4.656 1.00 . A A .  43 PRO HD3  1 1 
        2  1263 1 1 43 PRO HG2  H   14.349   1.957  -6.103 1.00 . A A .  43 PRO HG2  1 1 
        2  1264 1 1 43 PRO HG3  H   15.169   2.019  -4.532 1.00 . A A .  43 PRO HG3  1 1 
        2  1265 1 1 43 PRO N    N   15.896   4.262  -6.733 1.00 . A A .  43 PRO N    1 1 
        2  1266 1 1 43 PRO O    O   16.919   2.318  -9.507 1.00 . A A .  43 PRO O    1 1 
        2  1267 1 1 44 SER C    C   14.320   3.302 -11.084 1.00 . A A .  44 SER C    1 1 
        2  1268 1 1 44 SER CA   C   14.195   2.222 -10.013 1.00 . A A .  44 SER CA   1 1 
        2  1269 1 1 44 SER CB   C   12.721   1.888  -9.780 1.00 . A A .  44 SER CB   1 1 
        2  1270 1 1 44 SER H    H   14.252   2.938  -8.021 1.00 . A A .  44 SER H    1 1 
        2  1271 1 1 44 SER HA   H   14.708   1.334 -10.352 1.00 . A A .  44 SER HA   1 1 
        2  1272 1 1 44 SER HB2  H   12.603   1.458  -8.796 1.00 . A A .  44 SER HB2  1 1 
        2  1273 1 1 44 SER HB3  H   12.134   2.792  -9.850 1.00 . A A .  44 SER HB3  1 1 
        2  1274 1 1 44 SER HG   H   12.779   1.030 -11.540 1.00 . A A .  44 SER HG   1 1 
        2  1275 1 1 44 SER N    N   14.820   2.652  -8.767 1.00 . A A .  44 SER N    1 1 
        2  1276 1 1 44 SER O    O   13.561   4.271 -11.095 1.00 . A A .  44 SER O    1 1 
        2  1277 1 1 44 SER OG   O   12.250   0.960 -10.742 1.00 . A A .  44 SER OG   1 1 
        2  1278 1 1 45 SER C    C   14.306   4.155 -13.989 1.00 . A A .  45 SER C    1 1 
        2  1279 1 1 45 SER CA   C   15.511   4.087 -13.056 1.00 . A A .  45 SER CA   1 1 
        2  1280 1 1 45 SER CB   C   16.764   3.709 -13.849 1.00 . A A .  45 SER CB   1 1 
        2  1281 1 1 45 SER H    H   15.856   2.333 -11.921 1.00 . A A .  45 SER H    1 1 
        2  1282 1 1 45 SER HA   H   15.659   5.057 -12.607 1.00 . A A .  45 SER HA   1 1 
        2  1283 1 1 45 SER HB2  H   16.819   2.635 -13.941 1.00 . A A .  45 SER HB2  1 1 
        2  1284 1 1 45 SER HB3  H   16.710   4.152 -14.833 1.00 . A A .  45 SER HB3  1 1 
        2  1285 1 1 45 SER HG   H   18.540   3.438 -13.069 1.00 . A A .  45 SER HG   1 1 
        2  1286 1 1 45 SER N    N   15.283   3.126 -11.983 1.00 . A A .  45 SER N    1 1 
        2  1287 1 1 45 SER O    O   13.690   3.137 -14.301 1.00 . A A .  45 SER O    1 1 
        2  1288 1 1 45 SER OG   O   17.936   4.173 -13.203 1.00 . A A .  45 SER OG   1 1 
        2  1289 1 1 46 GLY C    C   11.806   6.493 -14.759 1.00 . A A .  46 GLY C    1 1 
        2  1290 1 1 46 GLY CA   C   12.845   5.545 -15.323 1.00 . A A .  46 GLY CA   1 1 
        2  1291 1 1 46 GLY H    H   14.503   6.141 -14.148 1.00 . A A .  46 GLY H    1 1 
        2  1292 1 1 46 GLY HA2  H   13.202   5.938 -16.264 1.00 . A A .  46 GLY HA2  1 1 
        2  1293 1 1 46 GLY HA3  H   12.382   4.585 -15.498 1.00 . A A .  46 GLY HA3  1 1 
        2  1294 1 1 46 GLY N    N   13.975   5.365 -14.431 1.00 . A A .  46 GLY N    1 1 
        2  1295 1 1 46 GLY O    O   10.941   6.053 -14.003 1.00 . A A .  46 GLY O    1 1 
        2  1296 2 2  1 ZN  ZN   ZN   2.721  -0.847  -4.352 1.00 . B A . 181 ZN  ZN   1 1 
        3  1297 1 1  1 GLY C    C    5.067 -27.825  -1.457 1.00 . A A .   1 GLY C    1 1 
        3  1298 1 1  1 GLY CA   C    4.926 -28.807  -0.311 1.00 . A A .   1 GLY CA   1 1 
        3  1299 1 1  1 GLY H1   H    5.764 -30.752  -0.278 1.00 . A A .   1 GLY H1   1 1 
        3  1300 1 1  1 GLY HA2  H    3.977 -29.315  -0.399 1.00 . A A .   1 GLY HA2  1 1 
        3  1301 1 1  1 GLY HA3  H    4.945 -28.261   0.621 1.00 . A A .   1 GLY HA3  1 1 
        3  1302 1 1  1 GLY N    N    5.987 -29.797  -0.294 1.00 . A A .   1 GLY N    1 1 
        3  1303 1 1  1 GLY O    O    5.560 -26.713  -1.273 1.00 . A A .   1 GLY O    1 1 
        3  1304 1 1  2 SER C    C    3.406 -26.646  -4.057 1.00 . A A .   2 SER C    1 1 
        3  1305 1 1  2 SER CA   C    4.719 -27.388  -3.826 1.00 . A A .   2 SER CA   1 1 
        3  1306 1 1  2 SER CB   C    5.069 -28.225  -5.058 1.00 . A A .   2 SER CB   1 1 
        3  1307 1 1  2 SER H    H    4.250 -29.136  -2.727 1.00 . A A .   2 SER H    1 1 
        3  1308 1 1  2 SER HA   H    5.503 -26.665  -3.658 1.00 . A A .   2 SER HA   1 1 
        3  1309 1 1  2 SER HB2  H    5.941 -28.824  -4.847 1.00 . A A .   2 SER HB2  1 1 
        3  1310 1 1  2 SER HB3  H    4.237 -28.872  -5.298 1.00 . A A .   2 SER HB3  1 1 
        3  1311 1 1  2 SER HG   H    4.615 -27.455  -6.801 1.00 . A A .   2 SER HG   1 1 
        3  1312 1 1  2 SER N    N    4.634 -28.238  -2.644 1.00 . A A .   2 SER N    1 1 
        3  1313 1 1  2 SER O    O    2.519 -27.134  -4.758 1.00 . A A .   2 SER O    1 1 
        3  1314 1 1  2 SER OG   O    5.342 -27.398  -6.176 1.00 . A A .   2 SER OG   1 1 
        3  1315 1 1  3 SER C    C    2.423 -23.165  -3.569 1.00 . A A .   3 SER C    1 1 
        3  1316 1 1  3 SER CA   C    2.085 -24.653  -3.601 1.00 . A A .   3 SER CA   1 1 
        3  1317 1 1  3 SER CB   C    1.092 -24.986  -2.486 1.00 . A A .   3 SER CB   1 1 
        3  1318 1 1  3 SER H    H    4.032 -25.127  -2.918 1.00 . A A .   3 SER H    1 1 
        3  1319 1 1  3 SER HA   H    1.635 -24.887  -4.554 1.00 . A A .   3 SER HA   1 1 
        3  1320 1 1  3 SER HB2  H    1.631 -25.151  -1.565 1.00 . A A .   3 SER HB2  1 1 
        3  1321 1 1  3 SER HB3  H    0.407 -24.160  -2.359 1.00 . A A .   3 SER HB3  1 1 
        3  1322 1 1  3 SER HG   H    0.855 -26.704  -3.397 1.00 . A A .   3 SER HG   1 1 
        3  1323 1 1  3 SER N    N    3.290 -25.462  -3.463 1.00 . A A .   3 SER N    1 1 
        3  1324 1 1  3 SER O    O    3.370 -22.746  -2.904 1.00 . A A .   3 SER O    1 1 
        3  1325 1 1  3 SER OG   O    0.349 -26.152  -2.796 1.00 . A A .   3 SER OG   1 1 
        3  1326 1 1  4 GLY C    C    0.743 -20.189  -5.015 1.00 . A A .   4 GLY C    1 1 
        3  1327 1 1  4 GLY CA   C    1.872 -20.939  -4.336 1.00 . A A .   4 GLY CA   1 1 
        3  1328 1 1  4 GLY H    H    0.900 -22.761  -4.804 1.00 . A A .   4 GLY H    1 1 
        3  1329 1 1  4 GLY HA2  H    1.978 -20.573  -3.326 1.00 . A A .   4 GLY HA2  1 1 
        3  1330 1 1  4 GLY HA3  H    2.789 -20.750  -4.874 1.00 . A A .   4 GLY HA3  1 1 
        3  1331 1 1  4 GLY N    N    1.641 -22.371  -4.294 1.00 . A A .   4 GLY N    1 1 
        3  1332 1 1  4 GLY O    O    0.134 -19.300  -4.420 1.00 . A A .   4 GLY O    1 1 
        3  1333 1 1  5 SER C    C   -1.961 -20.172  -6.402 1.00 . A A .   5 SER C    1 1 
        3  1334 1 1  5 SER CA   C   -0.596 -19.898  -7.026 1.00 . A A .   5 SER CA   1 1 
        3  1335 1 1  5 SER CB   C   -0.579 -20.382  -8.477 1.00 . A A .   5 SER CB   1 1 
        3  1336 1 1  5 SER H    H    0.985 -21.264  -6.683 1.00 . A A .   5 SER H    1 1 
        3  1337 1 1  5 SER HA   H   -0.413 -18.834  -7.009 1.00 . A A .   5 SER HA   1 1 
        3  1338 1 1  5 SER HB2  H   -0.582 -21.461  -8.494 1.00 . A A .   5 SER HB2  1 1 
        3  1339 1 1  5 SER HB3  H   -1.457 -20.012  -8.988 1.00 . A A .   5 SER HB3  1 1 
        3  1340 1 1  5 SER HG   H    0.880 -19.103  -8.750 1.00 . A A .   5 SER HG   1 1 
        3  1341 1 1  5 SER N    N    0.464 -20.547  -6.264 1.00 . A A .   5 SER N    1 1 
        3  1342 1 1  5 SER O    O   -2.588 -21.195  -6.679 1.00 . A A .   5 SER O    1 1 
        3  1343 1 1  5 SER OG   O    0.574 -19.917  -9.157 1.00 . A A .   5 SER OG   1 1 
        3  1344 1 1  6 SER C    C   -4.622 -18.224  -5.226 1.00 . A A .   6 SER C    1 1 
        3  1345 1 1  6 SER CA   C   -3.703 -19.395  -4.891 1.00 . A A .   6 SER CA   1 1 
        3  1346 1 1  6 SER CB   C   -3.509 -19.488  -3.376 1.00 . A A .   6 SER CB   1 1 
        3  1347 1 1  6 SER H    H   -1.868 -18.458  -5.378 1.00 . A A .   6 SER H    1 1 
        3  1348 1 1  6 SER HA   H   -4.159 -20.308  -5.243 1.00 . A A .   6 SER HA   1 1 
        3  1349 1 1  6 SER HB2  H   -2.795 -20.266  -3.154 1.00 . A A .   6 SER HB2  1 1 
        3  1350 1 1  6 SER HB3  H   -3.140 -18.543  -3.005 1.00 . A A .   6 SER HB3  1 1 
        3  1351 1 1  6 SER HG   H   -5.465 -19.492  -3.265 1.00 . A A .   6 SER HG   1 1 
        3  1352 1 1  6 SER N    N   -2.415 -19.251  -5.558 1.00 . A A .   6 SER N    1 1 
        3  1353 1 1  6 SER O    O   -4.220 -17.064  -5.153 1.00 . A A .   6 SER O    1 1 
        3  1354 1 1  6 SER OG   O   -4.730 -19.789  -2.723 1.00 . A A .   6 SER OG   1 1 
        3  1355 1 1  7 GLY C    C   -7.058 -17.406  -7.432 1.00 . A A .   7 GLY C    1 1 
        3  1356 1 1  7 GLY CA   C   -6.817 -17.503  -5.938 1.00 . A A .   7 GLY CA   1 1 
        3  1357 1 1  7 GLY H    H   -6.125 -19.481  -5.637 1.00 . A A .   7 GLY H    1 1 
        3  1358 1 1  7 GLY HA2  H   -7.754 -17.717  -5.446 1.00 . A A .   7 GLY HA2  1 1 
        3  1359 1 1  7 GLY HA3  H   -6.445 -16.553  -5.583 1.00 . A A .   7 GLY HA3  1 1 
        3  1360 1 1  7 GLY N    N   -5.860 -18.538  -5.596 1.00 . A A .   7 GLY N    1 1 
        3  1361 1 1  7 GLY O    O   -6.238 -16.853  -8.164 1.00 . A A .   7 GLY O    1 1 
        3  1362 1 1  8 GLU C    C   -9.222 -16.612  -9.669 1.00 . A A .   8 GLU C    1 1 
        3  1363 1 1  8 GLU CA   C   -8.529 -17.921  -9.301 1.00 . A A .   8 GLU CA   1 1 
        3  1364 1 1  8 GLU CB   C   -9.432 -19.105  -9.651 1.00 . A A .   8 GLU CB   1 1 
        3  1365 1 1  8 GLU CD   C   -9.789 -21.602  -9.517 1.00 . A A .   8 GLU CD   1 1 
        3  1366 1 1  8 GLU CG   C   -8.810 -20.457  -9.345 1.00 . A A .   8 GLU CG   1 1 
        3  1367 1 1  8 GLU H    H   -8.798 -18.375  -7.251 1.00 . A A .   8 GLU H    1 1 
        3  1368 1 1  8 GLU HA   H   -7.612 -18.000  -9.866 1.00 . A A .   8 GLU HA   1 1 
        3  1369 1 1  8 GLU HB2  H  -10.352 -19.019  -9.091 1.00 . A A .   8 GLU HB2  1 1 
        3  1370 1 1  8 GLU HB3  H   -9.660 -19.068 -10.706 1.00 . A A .   8 GLU HB3  1 1 
        3  1371 1 1  8 GLU HG2  H   -7.976 -20.615 -10.012 1.00 . A A .   8 GLU HG2  1 1 
        3  1372 1 1  8 GLU HG3  H   -8.457 -20.454  -8.324 1.00 . A A .   8 GLU HG3  1 1 
        3  1373 1 1  8 GLU N    N   -8.185 -17.947  -7.884 1.00 . A A .   8 GLU N    1 1 
        3  1374 1 1  8 GLU O    O  -10.427 -16.460  -9.475 1.00 . A A .   8 GLU O    1 1 
        3  1375 1 1  8 GLU OE1  O  -10.690 -21.490 -10.374 1.00 . A A .   8 GLU OE1  1 1 
        3  1376 1 1  8 GLU OE2  O   -9.653 -22.611  -8.793 1.00 . A A .   8 GLU OE2  1 1 
        3  1377 1 1  9 GLY C    C   -8.053 -13.237 -10.316 1.00 . A A .   9 GLY C    1 1 
        3  1378 1 1  9 GLY CA   C   -9.005 -14.385 -10.586 1.00 . A A .   9 GLY CA   1 1 
        3  1379 1 1  9 GLY H    H   -7.494 -15.847 -10.331 1.00 . A A .   9 GLY H    1 1 
        3  1380 1 1  9 GLY HA2  H   -9.237 -14.408 -11.640 1.00 . A A .   9 GLY HA2  1 1 
        3  1381 1 1  9 GLY HA3  H   -9.917 -14.220 -10.031 1.00 . A A .   9 GLY HA3  1 1 
        3  1382 1 1  9 GLY N    N   -8.449 -15.669 -10.200 1.00 . A A .   9 GLY N    1 1 
        3  1383 1 1  9 GLY O    O   -7.605 -13.047  -9.186 1.00 . A A .   9 GLY O    1 1 
        3  1384 1 1 10 GLU C    C   -7.606 -10.020 -11.231 1.00 . A A .  10 GLU C    1 1 
        3  1385 1 1 10 GLU CA   C   -6.835 -11.337 -11.227 1.00 . A A .  10 GLU CA   1 1 
        3  1386 1 1 10 GLU CB   C   -5.809 -11.344 -12.362 1.00 . A A .  10 GLU CB   1 1 
        3  1387 1 1 10 GLU CD   C   -5.696 -13.767 -13.066 1.00 . A A .  10 GLU CD   1 1 
        3  1388 1 1 10 GLU CG   C   -4.967 -12.608 -12.415 1.00 . A A .  10 GLU CG   1 1 
        3  1389 1 1 10 GLU H    H   -8.132 -12.674 -12.234 1.00 . A A .  10 GLU H    1 1 
        3  1390 1 1 10 GLU HA   H   -6.316 -11.434 -10.285 1.00 . A A .  10 GLU HA   1 1 
        3  1391 1 1 10 GLU HB2  H   -6.330 -11.242 -13.303 1.00 . A A .  10 GLU HB2  1 1 
        3  1392 1 1 10 GLU HB3  H   -5.146 -10.500 -12.236 1.00 . A A .  10 GLU HB3  1 1 
        3  1393 1 1 10 GLU HG2  H   -4.070 -12.404 -12.980 1.00 . A A .  10 GLU HG2  1 1 
        3  1394 1 1 10 GLU HG3  H   -4.700 -12.890 -11.407 1.00 . A A .  10 GLU HG3  1 1 
        3  1395 1 1 10 GLU N    N   -7.742 -12.471 -11.358 1.00 . A A .  10 GLU N    1 1 
        3  1396 1 1 10 GLU O    O   -8.389  -9.749 -12.141 1.00 . A A .  10 GLU O    1 1 
        3  1397 1 1 10 GLU OE1  O   -5.901 -13.722 -14.297 1.00 . A A .  10 GLU OE1  1 1 
        3  1398 1 1 10 GLU OE2  O   -6.063 -14.718 -12.345 1.00 . A A .  10 GLU OE2  1 1 
        3  1399 1 1 11 LYS C    C   -7.481  -6.914 -11.090 1.00 . A A .  11 LYS C    1 1 
        3  1400 1 1 11 LYS CA   C   -8.049  -7.916 -10.090 1.00 . A A .  11 LYS CA   1 1 
        3  1401 1 1 11 LYS CB   C   -7.906  -7.370  -8.667 1.00 . A A .  11 LYS CB   1 1 
        3  1402 1 1 11 LYS CD   C   -8.939  -7.252  -6.380 1.00 . A A .  11 LYS CD   1 1 
        3  1403 1 1 11 LYS CE   C   -9.850  -7.939  -5.376 1.00 . A A .  11 LYS CE   1 1 
        3  1404 1 1 11 LYS CG   C   -8.801  -8.066  -7.656 1.00 . A A .  11 LYS CG   1 1 
        3  1405 1 1 11 LYS H    H   -6.742  -9.478  -9.512 1.00 . A A .  11 LYS H    1 1 
        3  1406 1 1 11 LYS HA   H   -9.096  -8.067 -10.305 1.00 . A A .  11 LYS HA   1 1 
        3  1407 1 1 11 LYS HB2  H   -6.881  -7.489  -8.351 1.00 . A A .  11 LYS HB2  1 1 
        3  1408 1 1 11 LYS HB3  H   -8.153  -6.318  -8.672 1.00 . A A .  11 LYS HB3  1 1 
        3  1409 1 1 11 LYS HD2  H   -7.962  -7.127  -5.936 1.00 . A A .  11 LYS HD2  1 1 
        3  1410 1 1 11 LYS HD3  H   -9.352  -6.283  -6.624 1.00 . A A .  11 LYS HD3  1 1 
        3  1411 1 1 11 LYS HE2  H  -10.156  -7.218  -4.634 1.00 . A A .  11 LYS HE2  1 1 
        3  1412 1 1 11 LYS HE3  H  -10.720  -8.312  -5.895 1.00 . A A .  11 LYS HE3  1 1 
        3  1413 1 1 11 LYS HG2  H   -9.781  -8.202  -8.090 1.00 . A A .  11 LYS HG2  1 1 
        3  1414 1 1 11 LYS HG3  H   -8.375  -9.029  -7.414 1.00 . A A .  11 LYS HG3  1 1 
        3  1415 1 1 11 LYS HZ1  H   -8.920  -9.810  -5.388 1.00 . A A .  11 LYS HZ1  1 1 
        3  1416 1 1 11 LYS HZ2  H   -9.796  -9.490  -3.977 1.00 . A A .  11 LYS HZ2  1 1 
        3  1417 1 1 11 LYS HZ3  H   -8.300  -8.744  -4.230 1.00 . A A .  11 LYS HZ3  1 1 
        3  1418 1 1 11 LYS N    N   -7.378  -9.206 -10.206 1.00 . A A .  11 LYS N    1 1 
        3  1419 1 1 11 LYS NZ   N   -9.169  -9.075  -4.695 1.00 . A A .  11 LYS NZ   1 1 
        3  1420 1 1 11 LYS O    O   -6.285  -6.903 -11.381 1.00 . A A .  11 LYS O    1 1 
        3  1421 1 1 12 PRO C    C   -7.114  -3.928 -11.975 1.00 . A A .  12 PRO C    1 1 
        3  1422 1 1 12 PRO CA   C   -7.963  -5.030 -12.602 1.00 . A A .  12 PRO CA   1 1 
        3  1423 1 1 12 PRO CB   C   -9.302  -4.464 -13.082 1.00 . A A .  12 PRO CB   1 1 
        3  1424 1 1 12 PRO CD   C   -9.797  -6.009 -11.327 1.00 . A A .  12 PRO CD   1 1 
        3  1425 1 1 12 PRO CG   C  -10.247  -4.722 -11.959 1.00 . A A .  12 PRO CG   1 1 
        3  1426 1 1 12 PRO HA   H   -7.432  -5.461 -13.437 1.00 . A A .  12 PRO HA   1 1 
        3  1427 1 1 12 PRO HB2  H   -9.199  -3.406 -13.279 1.00 . A A .  12 PRO HB2  1 1 
        3  1428 1 1 12 PRO HB3  H   -9.610  -4.975 -13.982 1.00 . A A .  12 PRO HB3  1 1 
        3  1429 1 1 12 PRO HD2  H   -9.968  -5.986 -10.260 1.00 . A A .  12 PRO HD2  1 1 
        3  1430 1 1 12 PRO HD3  H  -10.309  -6.849 -11.774 1.00 . A A .  12 PRO HD3  1 1 
        3  1431 1 1 12 PRO HG2  H  -10.196  -3.915 -11.245 1.00 . A A .  12 PRO HG2  1 1 
        3  1432 1 1 12 PRO HG3  H  -11.252  -4.824 -12.342 1.00 . A A .  12 PRO HG3  1 1 
        3  1433 1 1 12 PRO N    N   -8.356  -6.052 -11.628 1.00 . A A .  12 PRO N    1 1 
        3  1434 1 1 12 PRO O    O   -6.635  -3.031 -12.668 1.00 . A A .  12 PRO O    1 1 
        3  1435 1 1 13 TYR C    C   -5.008  -3.677  -9.167 1.00 . A A .  13 TYR C    1 1 
        3  1436 1 1 13 TYR CA   C   -6.142  -3.012  -9.942 1.00 . A A .  13 TYR CA   1 1 
        3  1437 1 1 13 TYR CB   C   -7.032  -2.218  -8.984 1.00 . A A .  13 TYR CB   1 1 
        3  1438 1 1 13 TYR CD1  C   -8.035  -0.455 -10.487 1.00 . A A .  13 TYR CD1  1 1 
        3  1439 1 1 13 TYR CD2  C   -9.502  -2.037  -9.474 1.00 . A A .  13 TYR CD2  1 1 
        3  1440 1 1 13 TYR CE1  C   -9.110   0.153 -11.106 1.00 . A A .  13 TYR CE1  1 1 
        3  1441 1 1 13 TYR CE2  C  -10.583  -1.437 -10.090 1.00 . A A .  13 TYR CE2  1 1 
        3  1442 1 1 13 TYR CG   C   -8.211  -1.557  -9.660 1.00 . A A .  13 TYR CG   1 1 
        3  1443 1 1 13 TYR CZ   C  -10.382  -0.342 -10.905 1.00 . A A .  13 TYR CZ   1 1 
        3  1444 1 1 13 TYR H    H   -7.339  -4.743 -10.164 1.00 . A A .  13 TYR H    1 1 
        3  1445 1 1 13 TYR HA   H   -5.718  -2.335 -10.668 1.00 . A A .  13 TYR HA   1 1 
        3  1446 1 1 13 TYR HB2  H   -7.415  -2.883  -8.225 1.00 . A A .  13 TYR HB2  1 1 
        3  1447 1 1 13 TYR HB3  H   -6.442  -1.445  -8.513 1.00 . A A .  13 TYR HB3  1 1 
        3  1448 1 1 13 TYR HD1  H   -7.038  -0.070 -10.643 1.00 . A A .  13 TYR HD1  1 1 
        3  1449 1 1 13 TYR HD2  H   -9.657  -2.894  -8.835 1.00 . A A .  13 TYR HD2  1 1 
        3  1450 1 1 13 TYR HE1  H   -8.953   1.009 -11.745 1.00 . A A .  13 TYR HE1  1 1 
        3  1451 1 1 13 TYR HE2  H  -11.579  -1.823  -9.933 1.00 . A A .  13 TYR HE2  1 1 
        3  1452 1 1 13 TYR HH   H  -11.515  -0.047 -12.430 1.00 . A A .  13 TYR HH   1 1 
        3  1453 1 1 13 TYR N    N   -6.932  -4.004 -10.662 1.00 . A A .  13 TYR N    1 1 
        3  1454 1 1 13 TYR O    O   -5.155  -4.006  -7.991 1.00 . A A .  13 TYR O    1 1 
        3  1455 1 1 13 TYR OH   O  -11.455   0.259 -11.522 1.00 . A A .  13 TYR OH   1 1 
        3  1456 1 1 14 GLN C    C   -1.480  -3.613  -9.354 1.00 . A A .  14 GLN C    1 1 
        3  1457 1 1 14 GLN CA   C   -2.716  -4.495  -9.213 1.00 . A A .  14 GLN CA   1 1 
        3  1458 1 1 14 GLN CB   C   -2.452  -5.867  -9.836 1.00 . A A .  14 GLN CB   1 1 
        3  1459 1 1 14 GLN CD   C    0.035  -6.138 -10.186 1.00 . A A .  14 GLN CD   1 1 
        3  1460 1 1 14 GLN CG   C   -1.169  -6.520  -9.348 1.00 . A A .  14 GLN CG   1 1 
        3  1461 1 1 14 GLN H    H   -3.820  -3.586 -10.773 1.00 . A A .  14 GLN H    1 1 
        3  1462 1 1 14 GLN HA   H   -2.934  -4.622  -8.163 1.00 . A A .  14 GLN HA   1 1 
        3  1463 1 1 14 GLN HB2  H   -3.277  -6.521  -9.599 1.00 . A A .  14 GLN HB2  1 1 
        3  1464 1 1 14 GLN HB3  H   -2.388  -5.755 -10.908 1.00 . A A .  14 GLN HB3  1 1 
        3  1465 1 1 14 GLN HE21 H   -0.481  -7.463 -11.576 1.00 . A A .  14 GLN HE21 1 1 
        3  1466 1 1 14 GLN HE22 H    0.955  -6.557 -11.897 1.00 . A A .  14 GLN HE22 1 1 
        3  1467 1 1 14 GLN HG2  H   -0.990  -6.214  -8.328 1.00 . A A .  14 GLN HG2  1 1 
        3  1468 1 1 14 GLN HG3  H   -1.290  -7.592  -9.385 1.00 . A A .  14 GLN HG3  1 1 
        3  1469 1 1 14 GLN N    N   -3.876  -3.870  -9.837 1.00 . A A .  14 GLN N    1 1 
        3  1470 1 1 14 GLN NE2  N    0.186  -6.785 -11.336 1.00 . A A .  14 GLN NE2  1 1 
        3  1471 1 1 14 GLN O    O   -0.960  -3.427 -10.454 1.00 . A A .  14 GLN O    1 1 
        3  1472 1 1 14 GLN OE1  O    0.822  -5.270  -9.804 1.00 . A A .  14 GLN OE1  1 1 
        3  1473 1 1 15 CYS C    C    1.390  -2.961  -8.725 1.00 . A A .  15 CYS C    1 1 
        3  1474 1 1 15 CYS CA   C    0.159  -2.206  -8.231 1.00 . A A .  15 CYS CA   1 1 
        3  1475 1 1 15 CYS CB   C    0.413  -1.658  -6.826 1.00 . A A .  15 CYS CB   1 1 
        3  1476 1 1 15 CYS H    H   -1.474  -3.255  -7.386 1.00 . A A .  15 CYS H    1 1 
        3  1477 1 1 15 CYS HA   H   -0.034  -1.382  -8.900 1.00 . A A .  15 CYS HA   1 1 
        3  1478 1 1 15 CYS HB2  H   -0.494  -1.199  -6.458 1.00 . A A .  15 CYS HB2  1 1 
        3  1479 1 1 15 CYS HB3  H    0.687  -2.474  -6.173 1.00 . A A .  15 CYS HB3  1 1 
        3  1480 1 1 15 CYS N    N   -1.015  -3.070  -8.233 1.00 . A A .  15 CYS N    1 1 
        3  1481 1 1 15 CYS O    O    1.920  -3.828  -8.029 1.00 . A A .  15 CYS O    1 1 
        3  1482 1 1 15 CYS SG   S    1.737  -0.411  -6.741 1.00 . A A .  15 CYS SG   1 1 
        3  1483 1 1 16 SER C    C    4.277  -2.894  -9.762 1.00 . A A .  16 SER C    1 1 
        3  1484 1 1 16 SER CA   C    3.007  -3.272 -10.518 1.00 . A A .  16 SER CA   1 1 
        3  1485 1 1 16 SER CB   C    3.142  -2.885 -11.991 1.00 . A A .  16 SER CB   1 1 
        3  1486 1 1 16 SER H    H    1.375  -1.926 -10.435 1.00 . A A .  16 SER H    1 1 
        3  1487 1 1 16 SER HA   H    2.864  -4.340 -10.446 1.00 . A A .  16 SER HA   1 1 
        3  1488 1 1 16 SER HB2  H    2.160  -2.758 -12.419 1.00 . A A .  16 SER HB2  1 1 
        3  1489 1 1 16 SER HB3  H    3.691  -1.957 -12.068 1.00 . A A .  16 SER HB3  1 1 
        3  1490 1 1 16 SER HG   H    4.507  -4.280 -12.163 1.00 . A A .  16 SER HG   1 1 
        3  1491 1 1 16 SER N    N    1.841  -2.625  -9.929 1.00 . A A .  16 SER N    1 1 
        3  1492 1 1 16 SER O    O    5.133  -3.740  -9.504 1.00 . A A .  16 SER O    1 1 
        3  1493 1 1 16 SER OG   O    3.832  -3.885 -12.720 1.00 . A A .  16 SER OG   1 1 
        3  1494 1 1 17 GLU C    C    6.042  -2.159  -7.672 1.00 . A A .  17 GLU C    1 1 
        3  1495 1 1 17 GLU CA   C    5.557  -1.126  -8.685 1.00 . A A .  17 GLU CA   1 1 
        3  1496 1 1 17 GLU CB   C    5.227   0.187  -7.973 1.00 . A A .  17 GLU CB   1 1 
        3  1497 1 1 17 GLU CD   C    5.583   1.374 -10.175 1.00 . A A .  17 GLU CD   1 1 
        3  1498 1 1 17 GLU CG   C    4.751   1.284  -8.911 1.00 . A A .  17 GLU CG   1 1 
        3  1499 1 1 17 GLU H    H    3.675  -0.990  -9.645 1.00 . A A .  17 GLU H    1 1 
        3  1500 1 1 17 GLU HA   H    6.344  -0.948  -9.403 1.00 . A A .  17 GLU HA   1 1 
        3  1501 1 1 17 GLU HB2  H    4.452   0.003  -7.244 1.00 . A A .  17 GLU HB2  1 1 
        3  1502 1 1 17 GLU HB3  H    6.112   0.538  -7.464 1.00 . A A .  17 GLU HB3  1 1 
        3  1503 1 1 17 GLU HG2  H    3.726   1.085  -9.186 1.00 . A A .  17 GLU HG2  1 1 
        3  1504 1 1 17 GLU HG3  H    4.805   2.231  -8.393 1.00 . A A .  17 GLU HG3  1 1 
        3  1505 1 1 17 GLU N    N    4.391  -1.617  -9.411 1.00 . A A .  17 GLU N    1 1 
        3  1506 1 1 17 GLU O    O    7.206  -2.560  -7.685 1.00 . A A .  17 GLU O    1 1 
        3  1507 1 1 17 GLU OE1  O    5.372   0.544 -11.084 1.00 . A A .  17 GLU OE1  1 1 
        3  1508 1 1 17 GLU OE2  O    6.445   2.274 -10.255 1.00 . A A .  17 GLU OE2  1 1 
        3  1509 1 1 18 CYS C    C    4.823  -4.914  -6.078 1.00 . A A .  18 CYS C    1 1 
        3  1510 1 1 18 CYS CA   C    5.474  -3.569  -5.771 1.00 . A A .  18 CYS CA   1 1 
        3  1511 1 1 18 CYS CB   C    5.028  -3.077  -4.393 1.00 . A A .  18 CYS CB   1 1 
        3  1512 1 1 18 CYS H    H    4.228  -2.227  -6.832 1.00 . A A .  18 CYS H    1 1 
        3  1513 1 1 18 CYS HA   H    6.546  -3.695  -5.768 1.00 . A A .  18 CYS HA   1 1 
        3  1514 1 1 18 CYS HB2  H    5.152  -3.875  -3.676 1.00 . A A .  18 CYS HB2  1 1 
        3  1515 1 1 18 CYS HB3  H    5.644  -2.239  -4.101 1.00 . A A .  18 CYS HB3  1 1 
        3  1516 1 1 18 CYS N    N    5.141  -2.585  -6.793 1.00 . A A .  18 CYS N    1 1 
        3  1517 1 1 18 CYS O    O    5.485  -5.951  -6.080 1.00 . A A .  18 CYS O    1 1 
        3  1518 1 1 18 CYS SG   S    3.289  -2.537  -4.324 1.00 . A A .  18 CYS SG   1 1 
        3  1519 1 1 19 GLY C    C    1.670  -6.378  -5.668 1.00 . A A .  19 GLY C    1 1 
        3  1520 1 1 19 GLY CA   C    2.799  -6.111  -6.644 1.00 . A A .  19 GLY CA   1 1 
        3  1521 1 1 19 GLY H    H    3.042  -4.032  -6.323 1.00 . A A .  19 GLY H    1 1 
        3  1522 1 1 19 GLY HA2  H    2.390  -6.036  -7.640 1.00 . A A .  19 GLY HA2  1 1 
        3  1523 1 1 19 GLY HA3  H    3.491  -6.940  -6.611 1.00 . A A .  19 GLY HA3  1 1 
        3  1524 1 1 19 GLY N    N    3.519  -4.889  -6.339 1.00 . A A .  19 GLY N    1 1 
        3  1525 1 1 19 GLY O    O    1.437  -7.521  -5.273 1.00 . A A .  19 GLY O    1 1 
        3  1526 1 1 20 LYS C    C   -1.460  -5.050  -5.002 1.00 . A A .  20 LYS C    1 1 
        3  1527 1 1 20 LYS CA   C   -0.144  -5.445  -4.340 1.00 . A A .  20 LYS CA   1 1 
        3  1528 1 1 20 LYS CB   C    0.101  -4.572  -3.107 1.00 . A A .  20 LYS CB   1 1 
        3  1529 1 1 20 LYS CD   C    2.316  -5.484  -2.349 1.00 . A A .  20 LYS CD   1 1 
        3  1530 1 1 20 LYS CE   C    3.186  -5.553  -1.103 1.00 . A A .  20 LYS CE   1 1 
        3  1531 1 1 20 LYS CG   C    0.851  -5.286  -1.996 1.00 . A A .  20 LYS CG   1 1 
        3  1532 1 1 20 LYS H    H    1.200  -4.435  -5.626 1.00 . A A .  20 LYS H    1 1 
        3  1533 1 1 20 LYS HA   H   -0.205  -6.478  -4.032 1.00 . A A .  20 LYS HA   1 1 
        3  1534 1 1 20 LYS HB2  H    0.675  -3.707  -3.402 1.00 . A A .  20 LYS HB2  1 1 
        3  1535 1 1 20 LYS HB3  H   -0.852  -4.246  -2.717 1.00 . A A .  20 LYS HB3  1 1 
        3  1536 1 1 20 LYS HD2  H    2.423  -6.406  -2.900 1.00 . A A .  20 LYS HD2  1 1 
        3  1537 1 1 20 LYS HD3  H    2.644  -4.656  -2.962 1.00 . A A .  20 LYS HD3  1 1 
        3  1538 1 1 20 LYS HE2  H    4.179  -5.215  -1.355 1.00 . A A .  20 LYS HE2  1 1 
        3  1539 1 1 20 LYS HE3  H    2.765  -4.903  -0.350 1.00 . A A .  20 LYS HE3  1 1 
        3  1540 1 1 20 LYS HG2  H    0.787  -4.697  -1.093 1.00 . A A .  20 LYS HG2  1 1 
        3  1541 1 1 20 LYS HG3  H    0.397  -6.253  -1.830 1.00 . A A .  20 LYS HG3  1 1 
        3  1542 1 1 20 LYS HZ1  H    2.316  -7.350  -0.489 1.00 . A A .  20 LYS HZ1  1 1 
        3  1543 1 1 20 LYS HZ2  H    3.699  -6.923   0.387 1.00 . A A .  20 LYS HZ2  1 1 
        3  1544 1 1 20 LYS HZ3  H    3.848  -7.532  -1.184 1.00 . A A .  20 LYS HZ3  1 1 
        3  1545 1 1 20 LYS N    N    0.967  -5.321  -5.276 1.00 . A A .  20 LYS N    1 1 
        3  1546 1 1 20 LYS NZ   N    3.268  -6.936  -0.560 1.00 . A A .  20 LYS NZ   1 1 
        3  1547 1 1 20 LYS O    O   -1.569  -3.979  -5.599 1.00 . A A .  20 LYS O    1 1 
        3  1548 1 1 21 SER C    C   -4.777  -5.264  -4.408 1.00 . A A .  21 SER C    1 1 
        3  1549 1 1 21 SER CA   C   -3.767  -5.664  -5.480 1.00 . A A .  21 SER CA   1 1 
        3  1550 1 1 21 SER CB   C   -4.264  -6.901  -6.230 1.00 . A A .  21 SER CB   1 1 
        3  1551 1 1 21 SER H    H   -2.310  -6.758  -4.401 1.00 . A A .  21 SER H    1 1 
        3  1552 1 1 21 SER HA   H   -3.660  -4.848  -6.179 1.00 . A A .  21 SER HA   1 1 
        3  1553 1 1 21 SER HB2  H   -5.274  -6.730  -6.571 1.00 . A A .  21 SER HB2  1 1 
        3  1554 1 1 21 SER HB3  H   -3.623  -7.085  -7.080 1.00 . A A .  21 SER HB3  1 1 
        3  1555 1 1 21 SER HG   H   -4.836  -8.714  -5.755 1.00 . A A .  21 SER HG   1 1 
        3  1556 1 1 21 SER N    N   -2.458  -5.921  -4.890 1.00 . A A .  21 SER N    1 1 
        3  1557 1 1 21 SER O    O   -4.557  -5.488  -3.218 1.00 . A A .  21 SER O    1 1 
        3  1558 1 1 21 SER OG   O   -4.252  -8.044  -5.392 1.00 . A A .  21 SER OG   1 1 
        3  1559 1 1 22 PHE C    C   -8.294  -4.248  -4.601 1.00 . A A .  22 PHE C    1 1 
        3  1560 1 1 22 PHE CA   C   -6.929  -4.239  -3.919 1.00 . A A .  22 PHE CA   1 1 
        3  1561 1 1 22 PHE CB   C   -6.622  -2.838  -3.387 1.00 . A A .  22 PHE CB   1 1 
        3  1562 1 1 22 PHE CD1  C   -4.976  -3.207  -1.529 1.00 . A A .  22 PHE CD1  1 1 
        3  1563 1 1 22 PHE CD2  C   -4.228  -2.093  -3.500 1.00 . A A .  22 PHE CD2  1 1 
        3  1564 1 1 22 PHE CE1  C   -3.713  -3.090  -0.980 1.00 . A A .  22 PHE CE1  1 1 
        3  1565 1 1 22 PHE CE2  C   -2.963  -1.974  -2.957 1.00 . A A .  22 PHE CE2  1 1 
        3  1566 1 1 22 PHE CG   C   -5.248  -2.710  -2.793 1.00 . A A .  22 PHE CG   1 1 
        3  1567 1 1 22 PHE CZ   C   -2.705  -2.474  -1.695 1.00 . A A .  22 PHE CZ   1 1 
        3  1568 1 1 22 PHE H    H   -6.002  -4.520  -5.802 1.00 . A A .  22 PHE H    1 1 
        3  1569 1 1 22 PHE HA   H   -6.949  -4.932  -3.092 1.00 . A A .  22 PHE HA   1 1 
        3  1570 1 1 22 PHE HB2  H   -6.700  -2.128  -4.196 1.00 . A A .  22 PHE HB2  1 1 
        3  1571 1 1 22 PHE HB3  H   -7.340  -2.586  -2.622 1.00 . A A .  22 PHE HB3  1 1 
        3  1572 1 1 22 PHE HD1  H   -5.763  -3.691  -0.969 1.00 . A A .  22 PHE HD1  1 1 
        3  1573 1 1 22 PHE HD2  H   -4.429  -1.702  -4.487 1.00 . A A .  22 PHE HD2  1 1 
        3  1574 1 1 22 PHE HE1  H   -3.514  -3.483   0.006 1.00 . A A .  22 PHE HE1  1 1 
        3  1575 1 1 22 PHE HE2  H   -2.177  -1.491  -3.519 1.00 . A A .  22 PHE HE2  1 1 
        3  1576 1 1 22 PHE HZ   H   -1.718  -2.381  -1.269 1.00 . A A .  22 PHE HZ   1 1 
        3  1577 1 1 22 PHE N    N   -5.885  -4.671  -4.840 1.00 . A A .  22 PHE N    1 1 
        3  1578 1 1 22 PHE O    O   -8.387  -4.324  -5.826 1.00 . A A .  22 PHE O    1 1 
        3  1579 1 1 23 SER C    C  -11.288  -2.763  -4.347 1.00 . A A .  23 SER C    1 1 
        3  1580 1 1 23 SER CA   C  -10.711  -4.175  -4.324 1.00 . A A .  23 SER CA   1 1 
        3  1581 1 1 23 SER CB   C  -11.603  -5.088  -3.481 1.00 . A A .  23 SER CB   1 1 
        3  1582 1 1 23 SER H    H   -9.212  -4.113  -2.830 1.00 . A A .  23 SER H    1 1 
        3  1583 1 1 23 SER HA   H  -10.676  -4.553  -5.334 1.00 . A A .  23 SER HA   1 1 
        3  1584 1 1 23 SER HB2  H  -11.054  -5.979  -3.216 1.00 . A A .  23 SER HB2  1 1 
        3  1585 1 1 23 SER HB3  H  -11.900  -4.568  -2.582 1.00 . A A .  23 SER HB3  1 1 
        3  1586 1 1 23 SER HG   H  -12.721  -6.400  -4.414 1.00 . A A .  23 SER HG   1 1 
        3  1587 1 1 23 SER N    N   -9.351  -4.171  -3.799 1.00 . A A .  23 SER N    1 1 
        3  1588 1 1 23 SER O    O  -12.423  -2.536  -3.928 1.00 . A A .  23 SER O    1 1 
        3  1589 1 1 23 SER OG   O  -12.767  -5.466  -4.196 1.00 . A A .  23 SER OG   1 1 
        3  1590 1 1 24 GLY C    C   -9.879   0.494  -5.453 1.00 . A A .  24 GLY C    1 1 
        3  1591 1 1 24 GLY CA   C  -10.946  -0.436  -4.910 1.00 . A A .  24 GLY CA   1 1 
        3  1592 1 1 24 GLY H    H   -9.602  -2.053  -5.161 1.00 . A A .  24 GLY H    1 1 
        3  1593 1 1 24 GLY HA2  H  -11.814  -0.383  -5.549 1.00 . A A .  24 GLY HA2  1 1 
        3  1594 1 1 24 GLY HA3  H  -11.221  -0.109  -3.918 1.00 . A A .  24 GLY HA3  1 1 
        3  1595 1 1 24 GLY N    N  -10.497  -1.815  -4.841 1.00 . A A .  24 GLY N    1 1 
        3  1596 1 1 24 GLY O    O   -8.736   0.472  -4.997 1.00 . A A .  24 GLY O    1 1 
        3  1597 1 1 25 SER C    C   -8.606   3.080  -5.976 1.00 . A A .  25 SER C    1 1 
        3  1598 1 1 25 SER CA   C   -9.317   2.250  -7.042 1.00 . A A .  25 SER CA   1 1 
        3  1599 1 1 25 SER CB   C  -10.050   3.173  -8.017 1.00 . A A .  25 SER CB   1 1 
        3  1600 1 1 25 SER H    H  -11.177   1.282  -6.753 1.00 . A A .  25 SER H    1 1 
        3  1601 1 1 25 SER HA   H   -8.580   1.678  -7.586 1.00 . A A .  25 SER HA   1 1 
        3  1602 1 1 25 SER HB2  H   -9.365   3.922  -8.385 1.00 . A A .  25 SER HB2  1 1 
        3  1603 1 1 25 SER HB3  H  -10.426   2.590  -8.846 1.00 . A A .  25 SER HB3  1 1 
        3  1604 1 1 25 SER HG   H  -11.915   3.258  -7.424 1.00 . A A .  25 SER HG   1 1 
        3  1605 1 1 25 SER N    N  -10.252   1.312  -6.432 1.00 . A A .  25 SER N    1 1 
        3  1606 1 1 25 SER O    O   -7.380   3.055  -5.869 1.00 . A A .  25 SER O    1 1 
        3  1607 1 1 25 SER OG   O  -11.140   3.822  -7.384 1.00 . A A .  25 SER OG   1 1 
        3  1608 1 1 26 TYR C    C   -7.753   3.909  -3.356 1.00 . A A .  26 TYR C    1 1 
        3  1609 1 1 26 TYR CA   C   -8.833   4.653  -4.134 1.00 . A A .  26 TYR CA   1 1 
        3  1610 1 1 26 TYR CB   C   -9.941   5.109  -3.183 1.00 . A A .  26 TYR CB   1 1 
        3  1611 1 1 26 TYR CD1  C   -8.887   5.569  -0.935 1.00 . A A .  26 TYR CD1  1 1 
        3  1612 1 1 26 TYR CD2  C   -9.584   7.429  -2.252 1.00 . A A .  26 TYR CD2  1 1 
        3  1613 1 1 26 TYR CE1  C   -8.449   6.428   0.054 1.00 . A A .  26 TYR CE1  1 1 
        3  1614 1 1 26 TYR CE2  C   -9.148   8.295  -1.269 1.00 . A A .  26 TYR CE2  1 1 
        3  1615 1 1 26 TYR CG   C   -9.462   6.053  -2.103 1.00 . A A .  26 TYR CG   1 1 
        3  1616 1 1 26 TYR CZ   C   -8.581   7.790  -0.117 1.00 . A A .  26 TYR CZ   1 1 
        3  1617 1 1 26 TYR H    H  -10.357   3.792  -5.324 1.00 . A A .  26 TYR H    1 1 
        3  1618 1 1 26 TYR HA   H   -8.391   5.523  -4.599 1.00 . A A .  26 TYR HA   1 1 
        3  1619 1 1 26 TYR HB2  H  -10.707   5.615  -3.750 1.00 . A A .  26 TYR HB2  1 1 
        3  1620 1 1 26 TYR HB3  H  -10.370   4.243  -2.701 1.00 . A A .  26 TYR HB3  1 1 
        3  1621 1 1 26 TYR HD1  H   -8.785   4.501  -0.804 1.00 . A A .  26 TYR HD1  1 1 
        3  1622 1 1 26 TYR HD2  H  -10.028   7.822  -3.156 1.00 . A A .  26 TYR HD2  1 1 
        3  1623 1 1 26 TYR HE1  H   -8.005   6.032   0.956 1.00 . A A .  26 TYR HE1  1 1 
        3  1624 1 1 26 TYR HE2  H   -9.251   9.362  -1.403 1.00 . A A .  26 TYR HE2  1 1 
        3  1625 1 1 26 TYR HH   H   -8.453   8.339   1.720 1.00 . A A .  26 TYR HH   1 1 
        3  1626 1 1 26 TYR N    N   -9.386   3.814  -5.190 1.00 . A A .  26 TYR N    1 1 
        3  1627 1 1 26 TYR O    O   -6.611   4.361  -3.269 1.00 . A A .  26 TYR O    1 1 
        3  1628 1 1 26 TYR OH   O   -8.145   8.649   0.865 1.00 . A A .  26 TYR OH   1 1 
        3  1629 1 1 27 ARG C    C   -5.818   1.917  -2.692 1.00 . A A .  27 ARG C    1 1 
        3  1630 1 1 27 ARG CA   C   -7.187   1.955  -2.019 1.00 . A A .  27 ARG CA   1 1 
        3  1631 1 1 27 ARG CB   C   -7.725   0.533  -1.853 1.00 . A A .  27 ARG CB   1 1 
        3  1632 1 1 27 ARG CD   C   -7.914   0.432   0.651 1.00 . A A .  27 ARG CD   1 1 
        3  1633 1 1 27 ARG CG   C   -8.665   0.371  -0.670 1.00 . A A .  27 ARG CG   1 1 
        3  1634 1 1 27 ARG CZ   C   -6.446  -1.035   1.968 1.00 . A A .  27 ARG CZ   1 1 
        3  1635 1 1 27 ARG H    H   -9.047   2.455  -2.896 1.00 . A A .  27 ARG H    1 1 
        3  1636 1 1 27 ARG HA   H   -7.084   2.407  -1.044 1.00 . A A .  27 ARG HA   1 1 
        3  1637 1 1 27 ARG HB2  H   -8.260   0.256  -2.750 1.00 . A A .  27 ARG HB2  1 1 
        3  1638 1 1 27 ARG HB3  H   -6.892  -0.141  -1.719 1.00 . A A .  27 ARG HB3  1 1 
        3  1639 1 1 27 ARG HD2  H   -7.353   1.354   0.688 1.00 . A A .  27 ARG HD2  1 1 
        3  1640 1 1 27 ARG HD3  H   -8.630   0.413   1.458 1.00 . A A .  27 ARG HD3  1 1 
        3  1641 1 1 27 ARG HE   H   -6.769  -1.210   0.008 1.00 . A A .  27 ARG HE   1 1 
        3  1642 1 1 27 ARG HG2  H   -9.397   1.165  -0.692 1.00 . A A .  27 ARG HG2  1 1 
        3  1643 1 1 27 ARG HG3  H   -9.165  -0.583  -0.747 1.00 . A A .  27 ARG HG3  1 1 
        3  1644 1 1 27 ARG HH11 H   -7.354   0.429   3.024 1.00 . A A .  27 ARG HH11 1 1 
        3  1645 1 1 27 ARG HH12 H   -6.316  -0.613   3.941 1.00 . A A .  27 ARG HH12 1 1 
        3  1646 1 1 27 ARG HH21 H   -5.400  -2.587   1.204 1.00 . A A .  27 ARG HH21 1 1 
        3  1647 1 1 27 ARG HH22 H   -5.205  -2.327   2.905 1.00 . A A .  27 ARG HH22 1 1 
        3  1648 1 1 27 ARG N    N   -8.123   2.764  -2.791 1.00 . A A .  27 ARG N    1 1 
        3  1649 1 1 27 ARG NE   N   -6.992  -0.690   0.808 1.00 . A A .  27 ARG NE   1 1 
        3  1650 1 1 27 ARG NH1  N   -6.728  -0.350   3.068 1.00 . A A .  27 ARG NH1  1 1 
        3  1651 1 1 27 ARG NH2  N   -5.615  -2.068   2.031 1.00 . A A .  27 ARG NH2  1 1 
        3  1652 1 1 27 ARG O    O   -4.786   2.047  -2.031 1.00 . A A .  27 ARG O    1 1 
        3  1653 1 1 28 LEU C    C   -3.831   3.013  -4.699 1.00 . A A .  28 LEU C    1 1 
        3  1654 1 1 28 LEU CA   C   -4.574   1.683  -4.770 1.00 . A A .  28 LEU CA   1 1 
        3  1655 1 1 28 LEU CB   C   -4.863   1.326  -6.229 1.00 . A A .  28 LEU CB   1 1 
        3  1656 1 1 28 LEU CD1  C   -3.276  -0.427  -7.061 1.00 . A A .  28 LEU CD1  1 1 
        3  1657 1 1 28 LEU CD2  C   -3.904   1.489  -8.540 1.00 . A A .  28 LEU CD2  1 1 
        3  1658 1 1 28 LEU CG   C   -3.642   1.048  -7.107 1.00 . A A .  28 LEU CG   1 1 
        3  1659 1 1 28 LEU H    H   -6.669   1.642  -4.479 1.00 . A A .  28 LEU H    1 1 
        3  1660 1 1 28 LEU HA   H   -3.952   0.914  -4.336 1.00 . A A .  28 LEU HA   1 1 
        3  1661 1 1 28 LEU HB2  H   -5.483   0.443  -6.237 1.00 . A A .  28 LEU HB2  1 1 
        3  1662 1 1 28 LEU HB3  H   -5.408   2.149  -6.669 1.00 . A A .  28 LEU HB3  1 1 
        3  1663 1 1 28 LEU HD11 H   -3.861  -0.966  -7.791 1.00 . A A .  28 LEU HD11 1 1 
        3  1664 1 1 28 LEU HD12 H   -3.481  -0.818  -6.075 1.00 . A A .  28 LEU HD12 1 1 
        3  1665 1 1 28 LEU HD13 H   -2.225  -0.544  -7.283 1.00 . A A .  28 LEU HD13 1 1 
        3  1666 1 1 28 LEU HD21 H   -3.224   2.286  -8.801 1.00 . A A .  28 LEU HD21 1 1 
        3  1667 1 1 28 LEU HD22 H   -4.922   1.841  -8.627 1.00 . A A .  28 LEU HD22 1 1 
        3  1668 1 1 28 LEU HD23 H   -3.754   0.653  -9.207 1.00 . A A .  28 LEU HD23 1 1 
        3  1669 1 1 28 LEU HG   H   -2.800   1.613  -6.731 1.00 . A A .  28 LEU HG   1 1 
        3  1670 1 1 28 LEU N    N   -5.816   1.739  -4.008 1.00 . A A .  28 LEU N    1 1 
        3  1671 1 1 28 LEU O    O   -2.641   3.057  -4.384 1.00 . A A .  28 LEU O    1 1 
        3  1672 1 1 29 THR C    C   -3.321   5.720  -3.600 1.00 . A A .  29 THR C    1 1 
        3  1673 1 1 29 THR CA   C   -3.950   5.430  -4.958 1.00 . A A .  29 THR CA   1 1 
        3  1674 1 1 29 THR CB   C   -4.997   6.517  -5.269 1.00 . A A .  29 THR CB   1 1 
        3  1675 1 1 29 THR CG2  C   -4.327   7.865  -5.493 1.00 . A A .  29 THR CG2  1 1 
        3  1676 1 1 29 THR H    H   -5.485   3.999  -5.234 1.00 . A A .  29 THR H    1 1 
        3  1677 1 1 29 THR HA   H   -3.182   5.473  -5.716 1.00 . A A .  29 THR HA   1 1 
        3  1678 1 1 29 THR HB   H   -5.667   6.601  -4.425 1.00 . A A .  29 THR HB   1 1 
        3  1679 1 1 29 THR HG1  H   -5.182   5.688  -7.048 1.00 . A A .  29 THR HG1  1 1 
        3  1680 1 1 29 THR HG21 H   -4.492   8.183  -6.512 1.00 . A A .  29 THR HG21 1 1 
        3  1681 1 1 29 THR HG22 H   -3.266   7.775  -5.311 1.00 . A A .  29 THR HG22 1 1 
        3  1682 1 1 29 THR HG23 H   -4.748   8.593  -4.816 1.00 . A A .  29 THR HG23 1 1 
        3  1683 1 1 29 THR N    N   -4.541   4.099  -4.991 1.00 . A A .  29 THR N    1 1 
        3  1684 1 1 29 THR O    O   -2.109   5.905  -3.495 1.00 . A A .  29 THR O    1 1 
        3  1685 1 1 29 THR OG1  O   -5.750   6.154  -6.431 1.00 . A A .  29 THR OG1  1 1 
        3  1686 1 1 30 GLN C    C   -2.422   5.212  -0.906 1.00 . A A .  30 GLN C    1 1 
        3  1687 1 1 30 GLN CA   C   -3.676   6.024  -1.212 1.00 . A A .  30 GLN CA   1 1 
        3  1688 1 1 30 GLN CB   C   -4.768   5.703  -0.191 1.00 . A A .  30 GLN CB   1 1 
        3  1689 1 1 30 GLN CD   C   -5.691   3.772   1.152 1.00 . A A .  30 GLN CD   1 1 
        3  1690 1 1 30 GLN CG   C   -5.202   4.246  -0.202 1.00 . A A .  30 GLN CG   1 1 
        3  1691 1 1 30 GLN H    H   -5.108   5.602  -2.712 1.00 . A A .  30 GLN H    1 1 
        3  1692 1 1 30 GLN HA   H   -3.433   7.074  -1.148 1.00 . A A .  30 GLN HA   1 1 
        3  1693 1 1 30 GLN HB2  H   -4.402   5.940   0.797 1.00 . A A .  30 GLN HB2  1 1 
        3  1694 1 1 30 GLN HB3  H   -5.633   6.315  -0.401 1.00 . A A .  30 GLN HB3  1 1 
        3  1695 1 1 30 GLN HE21 H   -7.566   3.738   0.492 1.00 . A A .  30 GLN HE21 1 1 
        3  1696 1 1 30 GLN HE22 H   -7.341   3.264   2.138 1.00 . A A .  30 GLN HE22 1 1 
        3  1697 1 1 30 GLN HG2  H   -6.002   4.128  -0.917 1.00 . A A .  30 GLN HG2  1 1 
        3  1698 1 1 30 GLN HG3  H   -4.362   3.636  -0.499 1.00 . A A .  30 GLN HG3  1 1 
        3  1699 1 1 30 GLN N    N   -4.152   5.757  -2.564 1.00 . A A .  30 GLN N    1 1 
        3  1700 1 1 30 GLN NE2  N   -6.998   3.572   1.274 1.00 . A A .  30 GLN NE2  1 1 
        3  1701 1 1 30 GLN O    O   -1.616   5.591  -0.056 1.00 . A A .  30 GLN O    1 1 
        3  1702 1 1 30 GLN OE1  O   -4.902   3.588   2.080 1.00 . A A .  30 GLN OE1  1 1 
        3  1703 1 1 31 HIS C    C    0.050   3.650  -2.305 1.00 . A A .  31 HIS C    1 1 
        3  1704 1 1 31 HIS CA   C   -1.108   3.225  -1.407 1.00 . A A .  31 HIS CA   1 1 
        3  1705 1 1 31 HIS CB   C   -1.480   1.769  -1.691 1.00 . A A .  31 HIS CB   1 1 
        3  1706 1 1 31 HIS CD2  C    0.208   0.672  -3.326 1.00 . A A .  31 HIS CD2  1 1 
        3  1707 1 1 31 HIS CE1  C    1.401  -0.436  -1.859 1.00 . A A .  31 HIS CE1  1 1 
        3  1708 1 1 31 HIS CG   C   -0.316   0.922  -2.104 1.00 . A A .  31 HIS CG   1 1 
        3  1709 1 1 31 HIS H    H   -2.941   3.842  -2.267 1.00 . A A .  31 HIS H    1 1 
        3  1710 1 1 31 HIS HA   H   -0.799   3.313  -0.377 1.00 . A A .  31 HIS HA   1 1 
        3  1711 1 1 31 HIS HB2  H   -1.908   1.333  -0.801 1.00 . A A .  31 HIS HB2  1 1 
        3  1712 1 1 31 HIS HB3  H   -2.211   1.740  -2.487 1.00 . A A .  31 HIS HB3  1 1 
        3  1713 1 1 31 HIS HD1  H    0.325   0.189  -0.235 1.00 . A A .  31 HIS HD1  1 1 
        3  1714 1 1 31 HIS HD2  H   -0.146   1.065  -4.269 1.00 . A A .  31 HIS HD2  1 1 
        3  1715 1 1 31 HIS HE1  H    2.152  -1.073  -1.415 1.00 . A A .  31 HIS HE1  1 1 
        3  1716 1 1 31 HIS N    N   -2.264   4.091  -1.604 1.00 . A A .  31 HIS N    1 1 
        3  1717 1 1 31 HIS ND1  N    0.454   0.213  -1.206 1.00 . A A .  31 HIS ND1  1 1 
        3  1718 1 1 31 HIS NE2  N    1.274  -0.175  -3.147 1.00 . A A .  31 HIS NE2  1 1 
        3  1719 1 1 31 HIS O    O    1.208   3.644  -1.887 1.00 . A A .  31 HIS O    1 1 
        3  1720 1 1 32 TRP C    C    1.623   5.542  -3.905 1.00 . A A .  32 TRP C    1 1 
        3  1721 1 1 32 TRP CA   C    0.743   4.447  -4.497 1.00 . A A .  32 TRP CA   1 1 
        3  1722 1 1 32 TRP CB   C    0.082   4.947  -5.783 1.00 . A A .  32 TRP CB   1 1 
        3  1723 1 1 32 TRP CD1  C   -0.656   2.627  -6.584 1.00 . A A .  32 TRP CD1  1 1 
        3  1724 1 1 32 TRP CD2  C    0.187   3.933  -8.196 1.00 . A A .  32 TRP CD2  1 1 
        3  1725 1 1 32 TRP CE2  C   -0.177   2.697  -8.764 1.00 . A A .  32 TRP CE2  1 1 
        3  1726 1 1 32 TRP CE3  C    0.740   4.917  -9.021 1.00 . A A .  32 TRP CE3  1 1 
        3  1727 1 1 32 TRP CG   C   -0.128   3.868  -6.801 1.00 . A A .  32 TRP CG   1 1 
        3  1728 1 1 32 TRP CH2  C    0.539   3.401 -10.902 1.00 . A A .  32 TRP CH2  1 1 
        3  1729 1 1 32 TRP CZ2  C   -0.004   2.420 -10.118 1.00 . A A .  32 TRP CZ2  1 1 
        3  1730 1 1 32 TRP CZ3  C    0.911   4.640 -10.364 1.00 . A A .  32 TRP CZ3  1 1 
        3  1731 1 1 32 TRP H    H   -1.212   4.003  -3.815 1.00 . A A .  32 TRP H    1 1 
        3  1732 1 1 32 TRP HA   H    1.360   3.591  -4.730 1.00 . A A .  32 TRP HA   1 1 
        3  1733 1 1 32 TRP HB2  H   -0.882   5.371  -5.543 1.00 . A A .  32 TRP HB2  1 1 
        3  1734 1 1 32 TRP HB3  H    0.706   5.709  -6.227 1.00 . A A .  32 TRP HB3  1 1 
        3  1735 1 1 32 TRP HD1  H   -0.993   2.270  -5.623 1.00 . A A .  32 TRP HD1  1 1 
        3  1736 1 1 32 TRP HE1  H   -1.024   1.002  -7.863 1.00 . A A .  32 TRP HE1  1 1 
        3  1737 1 1 32 TRP HE3  H    1.032   5.878  -8.625 1.00 . A A .  32 TRP HE3  1 1 
        3  1738 1 1 32 TRP HH2  H    0.691   3.229 -11.956 1.00 . A A .  32 TRP HH2  1 1 
        3  1739 1 1 32 TRP HZ2  H   -0.286   1.470 -10.547 1.00 . A A .  32 TRP HZ2  1 1 
        3  1740 1 1 32 TRP HZ3  H    1.337   5.388 -11.017 1.00 . A A .  32 TRP HZ3  1 1 
        3  1741 1 1 32 TRP N    N   -0.271   4.019  -3.540 1.00 . A A .  32 TRP N    1 1 
        3  1742 1 1 32 TRP NE1  N   -0.688   1.918  -7.760 1.00 . A A .  32 TRP NE1  1 1 
        3  1743 1 1 32 TRP O    O    2.747   5.761  -4.359 1.00 . A A .  32 TRP O    1 1 
        3  1744 1 1 33 ILE C    C    3.176   6.787  -1.681 1.00 . A A .  33 ILE C    1 1 
        3  1745 1 1 33 ILE CA   C    1.848   7.296  -2.234 1.00 . A A .  33 ILE CA   1 1 
        3  1746 1 1 33 ILE CB   C    1.035   7.924  -1.087 1.00 . A A .  33 ILE CB   1 1 
        3  1747 1 1 33 ILE CD1  C   -0.338   9.315  -2.718 1.00 . A A .  33 ILE CD1  1 1 
        3  1748 1 1 33 ILE CG1  C   -0.359   8.320  -1.579 1.00 . A A .  33 ILE CG1  1 1 
        3  1749 1 1 33 ILE CG2  C    1.765   9.132  -0.520 1.00 . A A .  33 ILE CG2  1 1 
        3  1750 1 1 33 ILE H    H    0.207   6.003  -2.571 1.00 . A A .  33 ILE H    1 1 
        3  1751 1 1 33 ILE HA   H    2.047   8.062  -2.970 1.00 . A A .  33 ILE HA   1 1 
        3  1752 1 1 33 ILE HB   H    0.936   7.191  -0.301 1.00 . A A .  33 ILE HB   1 1 
        3  1753 1 1 33 ILE HD11 H    0.077  10.251  -2.371 1.00 . A A .  33 ILE HD11 1 1 
        3  1754 1 1 33 ILE HD12 H    0.271   8.930  -3.523 1.00 . A A .  33 ILE HD12 1 1 
        3  1755 1 1 33 ILE HD13 H   -1.344   9.478  -3.073 1.00 . A A .  33 ILE HD13 1 1 
        3  1756 1 1 33 ILE HG12 H   -0.878   7.438  -1.920 1.00 . A A .  33 ILE HG12 1 1 
        3  1757 1 1 33 ILE HG13 H   -0.909   8.762  -0.761 1.00 . A A .  33 ILE HG13 1 1 
        3  1758 1 1 33 ILE HG21 H    2.712   9.250  -1.025 1.00 . A A .  33 ILE HG21 1 1 
        3  1759 1 1 33 ILE HG22 H    1.165  10.017  -0.669 1.00 . A A .  33 ILE HG22 1 1 
        3  1760 1 1 33 ILE HG23 H    1.936   8.987   0.536 1.00 . A A .  33 ILE HG23 1 1 
        3  1761 1 1 33 ILE N    N    1.107   6.225  -2.889 1.00 . A A .  33 ILE N    1 1 
        3  1762 1 1 33 ILE O    O    4.138   7.545  -1.551 1.00 . A A .  33 ILE O    1 1 
        3  1763 1 1 34 THR C    C    5.576   4.959  -1.824 1.00 . A A .  34 THR C    1 1 
        3  1764 1 1 34 THR CA   C    4.431   4.888  -0.820 1.00 . A A .  34 THR CA   1 1 
        3  1765 1 1 34 THR CB   C    4.193   3.416  -0.434 1.00 . A A .  34 THR CB   1 1 
        3  1766 1 1 34 THR CG2  C    3.157   3.308   0.675 1.00 . A A .  34 THR CG2  1 1 
        3  1767 1 1 34 THR H    H    2.422   4.946  -1.485 1.00 . A A .  34 THR H    1 1 
        3  1768 1 1 34 THR HA   H    4.711   5.431   0.070 1.00 . A A .  34 THR HA   1 1 
        3  1769 1 1 34 THR HB   H    5.124   2.997  -0.079 1.00 . A A .  34 THR HB   1 1 
        3  1770 1 1 34 THR HG1  H    2.794   2.691  -1.621 1.00 . A A .  34 THR HG1  1 1 
        3  1771 1 1 34 THR HG21 H    2.232   3.759   0.348 1.00 . A A .  34 THR HG21 1 1 
        3  1772 1 1 34 THR HG22 H    3.516   3.821   1.554 1.00 . A A .  34 THR HG22 1 1 
        3  1773 1 1 34 THR HG23 H    2.988   2.267   0.909 1.00 . A A .  34 THR HG23 1 1 
        3  1774 1 1 34 THR N    N    3.222   5.499  -1.358 1.00 . A A .  34 THR N    1 1 
        3  1775 1 1 34 THR O    O    6.744   5.040  -1.443 1.00 . A A .  34 THR O    1 1 
        3  1776 1 1 34 THR OG1  O    3.753   2.674  -1.578 1.00 . A A .  34 THR OG1  1 1 
        3  1777 1 1 35 HIS C    C    6.449   6.432  -4.628 1.00 . A A .  35 HIS C    1 1 
        3  1778 1 1 35 HIS CA   C    6.235   4.994  -4.167 1.00 . A A .  35 HIS CA   1 1 
        3  1779 1 1 35 HIS CB   C    5.811   4.124  -5.351 1.00 . A A .  35 HIS CB   1 1 
        3  1780 1 1 35 HIS CD2  C    3.913   2.369  -5.146 1.00 . A A .  35 HIS CD2  1 1 
        3  1781 1 1 35 HIS CE1  C    5.015   0.834  -4.034 1.00 . A A .  35 HIS CE1  1 1 
        3  1782 1 1 35 HIS CG   C    5.169   2.833  -4.946 1.00 . A A .  35 HIS CG   1 1 
        3  1783 1 1 35 HIS H    H    4.287   4.866  -3.349 1.00 . A A .  35 HIS H    1 1 
        3  1784 1 1 35 HIS HA   H    7.164   4.615  -3.768 1.00 . A A .  35 HIS HA   1 1 
        3  1785 1 1 35 HIS HB2  H    5.103   4.672  -5.956 1.00 . A A .  35 HIS HB2  1 1 
        3  1786 1 1 35 HIS HB3  H    6.682   3.890  -5.947 1.00 . A A .  35 HIS HB3  1 1 
        3  1787 1 1 35 HIS HD1  H    6.766   1.888  -3.950 1.00 . A A .  35 HIS HD1  1 1 
        3  1788 1 1 35 HIS HD2  H    3.114   2.881  -5.663 1.00 . A A .  35 HIS HD2  1 1 
        3  1789 1 1 35 HIS HE1  H    5.261  -0.079  -3.512 1.00 . A A .  35 HIS HE1  1 1 
        3  1790 1 1 35 HIS N    N    5.234   4.931  -3.108 1.00 . A A .  35 HIS N    1 1 
        3  1791 1 1 35 HIS ND1  N    5.833   1.849  -4.246 1.00 . A A .  35 HIS ND1  1 1 
        3  1792 1 1 35 HIS NE2  N    3.843   1.124  -4.570 1.00 . A A .  35 HIS NE2  1 1 
        3  1793 1 1 35 HIS O    O    6.955   6.676  -5.724 1.00 . A A .  35 HIS O    1 1 
        3  1794 1 1 36 THR C    C    7.028   9.519  -3.044 1.00 . A A .  36 THR C    1 1 
        3  1795 1 1 36 THR CA   C    6.206   8.797  -4.105 1.00 . A A .  36 THR CA   1 1 
        3  1796 1 1 36 THR CB   C    4.836   9.489  -4.236 1.00 . A A .  36 THR CB   1 1 
        3  1797 1 1 36 THR CG2  C    4.994  10.908  -4.760 1.00 . A A .  36 THR CG2  1 1 
        3  1798 1 1 36 THR H    H    5.663   7.126  -2.926 1.00 . A A .  36 THR H    1 1 
        3  1799 1 1 36 THR HA   H    6.716   8.872  -5.055 1.00 . A A .  36 THR HA   1 1 
        3  1800 1 1 36 THR HB   H    4.376   9.530  -3.259 1.00 . A A .  36 THR HB   1 1 
        3  1801 1 1 36 THR HG1  H    3.170   9.219  -5.257 1.00 . A A .  36 THR HG1  1 1 
        3  1802 1 1 36 THR HG21 H    4.435  11.587  -4.134 1.00 . A A .  36 THR HG21 1 1 
        3  1803 1 1 36 THR HG22 H    4.620  10.962  -5.772 1.00 . A A .  36 THR HG22 1 1 
        3  1804 1 1 36 THR HG23 H    6.038  11.182  -4.746 1.00 . A A .  36 THR HG23 1 1 
        3  1805 1 1 36 THR N    N    6.059   7.383  -3.784 1.00 . A A .  36 THR N    1 1 
        3  1806 1 1 36 THR O    O    8.082  10.083  -3.339 1.00 . A A .  36 THR O    1 1 
        3  1807 1 1 36 THR OG1  O    3.991   8.740  -5.118 1.00 . A A .  36 THR OG1  1 1 
        3  1808 1 1 37 ARG C    C    8.710   9.781  -0.690 1.00 . A A .  37 ARG C    1 1 
        3  1809 1 1 37 ARG CA   C    7.230  10.153  -0.703 1.00 . A A .  37 ARG CA   1 1 
        3  1810 1 1 37 ARG CB   C    6.584   9.766   0.629 1.00 . A A .  37 ARG CB   1 1 
        3  1811 1 1 37 ARG CD   C    5.872   7.934   2.195 1.00 . A A .  37 ARG CD   1 1 
        3  1812 1 1 37 ARG CG   C    6.592   8.270   0.899 1.00 . A A .  37 ARG CG   1 1 
        3  1813 1 1 37 ARG CZ   C    5.749   6.088   3.814 1.00 . A A .  37 ARG CZ   1 1 
        3  1814 1 1 37 ARG H    H    5.694   9.033  -1.636 1.00 . A A .  37 ARG H    1 1 
        3  1815 1 1 37 ARG HA   H    7.139  11.220  -0.840 1.00 . A A .  37 ARG HA   1 1 
        3  1816 1 1 37 ARG HB2  H    7.118  10.257   1.430 1.00 . A A .  37 ARG HB2  1 1 
        3  1817 1 1 37 ARG HB3  H    5.559  10.105   0.630 1.00 . A A .  37 ARG HB3  1 1 
        3  1818 1 1 37 ARG HD2  H    6.158   8.654   2.947 1.00 . A A .  37 ARG HD2  1 1 
        3  1819 1 1 37 ARG HD3  H    4.808   7.994   2.026 1.00 . A A .  37 ARG HD3  1 1 
        3  1820 1 1 37 ARG HE   H    6.792   6.046   2.115 1.00 . A A .  37 ARG HE   1 1 
        3  1821 1 1 37 ARG HG2  H    6.097   7.764   0.083 1.00 . A A .  37 ARG HG2  1 1 
        3  1822 1 1 37 ARG HG3  H    7.616   7.932   0.967 1.00 . A A .  37 ARG HG3  1 1 
        3  1823 1 1 37 ARG HH11 H    4.687   7.732   4.316 1.00 . A A .  37 ARG HH11 1 1 
        3  1824 1 1 37 ARG HH12 H    4.608   6.423   5.449 1.00 . A A .  37 ARG HH12 1 1 
        3  1825 1 1 37 ARG HH21 H    6.697   4.316   3.598 1.00 . A A .  37 ARG HH21 1 1 
        3  1826 1 1 37 ARG HH22 H    5.753   4.481   5.040 1.00 . A A .  37 ARG HH22 1 1 
        3  1827 1 1 37 ARG N    N    6.539   9.499  -1.808 1.00 . A A .  37 ARG N    1 1 
        3  1828 1 1 37 ARG NE   N    6.203   6.594   2.673 1.00 . A A .  37 ARG NE   1 1 
        3  1829 1 1 37 ARG NH1  N    4.950   6.807   4.590 1.00 . A A .  37 ARG NH1  1 1 
        3  1830 1 1 37 ARG NH2  N    6.094   4.861   4.181 1.00 . A A .  37 ARG NH2  1 1 
        3  1831 1 1 37 ARG O    O    9.573  10.641  -0.514 1.00 . A A .  37 ARG O    1 1 
        3  1832 1 1 38 GLU C    C   10.508   6.783  -1.779 1.00 . A A .  38 GLU C    1 1 
        3  1833 1 1 38 GLU CA   C   10.369   8.012  -0.885 1.00 . A A .  38 GLU CA   1 1 
        3  1834 1 1 38 GLU CB   C   10.824   7.677   0.537 1.00 . A A .  38 GLU CB   1 1 
        3  1835 1 1 38 GLU CD   C   12.716   9.347   0.635 1.00 . A A .  38 GLU CD   1 1 
        3  1836 1 1 38 GLU CG   C   11.432   8.857   1.275 1.00 . A A .  38 GLU CG   1 1 
        3  1837 1 1 38 GLU H    H    8.262   7.859  -1.012 1.00 . A A .  38 GLU H    1 1 
        3  1838 1 1 38 GLU HA   H   10.995   8.799  -1.277 1.00 . A A .  38 GLU HA   1 1 
        3  1839 1 1 38 GLU HB2  H    9.973   7.325   1.100 1.00 . A A .  38 GLU HB2  1 1 
        3  1840 1 1 38 GLU HB3  H   11.562   6.890   0.489 1.00 . A A .  38 GLU HB3  1 1 
        3  1841 1 1 38 GLU HG2  H   10.719   9.668   1.281 1.00 . A A .  38 GLU HG2  1 1 
        3  1842 1 1 38 GLU HG3  H   11.644   8.559   2.292 1.00 . A A .  38 GLU HG3  1 1 
        3  1843 1 1 38 GLU N    N    8.994   8.496  -0.877 1.00 . A A .  38 GLU N    1 1 
        3  1844 1 1 38 GLU O    O    9.909   5.739  -1.516 1.00 . A A .  38 GLU O    1 1 
        3  1845 1 1 38 GLU OE1  O   13.708   8.588   0.636 1.00 . A A .  38 GLU OE1  1 1 
        3  1846 1 1 38 GLU OE2  O   12.729  10.491   0.133 1.00 . A A .  38 GLU OE2  1 1 
        3  1847 1 1 39 LYS C    C   11.548   4.477  -3.038 1.00 . A A .  39 LYS C    1 1 
        3  1848 1 1 39 LYS CA   C   11.521   5.815  -3.770 1.00 . A A .  39 LYS CA   1 1 
        3  1849 1 1 39 LYS CB   C   12.833   6.019  -4.530 1.00 . A A .  39 LYS CB   1 1 
        3  1850 1 1 39 LYS CD   C   14.177   7.730  -5.786 1.00 . A A .  39 LYS CD   1 1 
        3  1851 1 1 39 LYS CE   C   14.588   8.728  -4.716 1.00 . A A .  39 LYS CE   1 1 
        3  1852 1 1 39 LYS CG   C   12.789   7.169  -5.521 1.00 . A A .  39 LYS CG   1 1 
        3  1853 1 1 39 LYS H    H   11.751   7.771  -2.993 1.00 . A A .  39 LYS H    1 1 
        3  1854 1 1 39 LYS HA   H   10.703   5.810  -4.474 1.00 . A A .  39 LYS HA   1 1 
        3  1855 1 1 39 LYS HB2  H   13.621   6.215  -3.818 1.00 . A A .  39 LYS HB2  1 1 
        3  1856 1 1 39 LYS HB3  H   13.066   5.114  -5.072 1.00 . A A .  39 LYS HB3  1 1 
        3  1857 1 1 39 LYS HD2  H   14.888   6.917  -5.797 1.00 . A A .  39 LYS HD2  1 1 
        3  1858 1 1 39 LYS HD3  H   14.178   8.225  -6.747 1.00 . A A .  39 LYS HD3  1 1 
        3  1859 1 1 39 LYS HE2  H   15.301   9.419  -5.141 1.00 . A A .  39 LYS HE2  1 1 
        3  1860 1 1 39 LYS HE3  H   13.712   9.270  -4.391 1.00 . A A .  39 LYS HE3  1 1 
        3  1861 1 1 39 LYS HG2  H   12.372   6.815  -6.452 1.00 . A A .  39 LYS HG2  1 1 
        3  1862 1 1 39 LYS HG3  H   12.164   7.955  -5.120 1.00 . A A .  39 LYS HG3  1 1 
        3  1863 1 1 39 LYS HZ1  H   16.072   8.558  -3.255 1.00 . A A .  39 LYS HZ1  1 1 
        3  1864 1 1 39 LYS HZ2  H   15.450   7.073  -3.776 1.00 . A A .  39 LYS HZ2  1 1 
        3  1865 1 1 39 LYS HZ3  H   14.542   8.054  -2.739 1.00 . A A .  39 LYS HZ3  1 1 
        3  1866 1 1 39 LYS N    N   11.301   6.914  -2.836 1.00 . A A .  39 LYS N    1 1 
        3  1867 1 1 39 LYS NZ   N   15.207   8.057  -3.539 1.00 . A A .  39 LYS NZ   1 1 
        3  1868 1 1 39 LYS O    O   12.037   4.367  -1.914 1.00 . A A .  39 LYS O    1 1 
        3  1869 1 1 40 PRO C    C   12.344   1.444  -3.032 1.00 . A A .  40 PRO C    1 1 
        3  1870 1 1 40 PRO CA   C   10.963   2.085  -3.120 1.00 . A A .  40 PRO CA   1 1 
        3  1871 1 1 40 PRO CB   C   10.079   1.316  -4.105 1.00 . A A .  40 PRO CB   1 1 
        3  1872 1 1 40 PRO CD   C   10.409   3.494  -5.032 1.00 . A A .  40 PRO CD   1 1 
        3  1873 1 1 40 PRO CG   C   10.224   2.046  -5.395 1.00 . A A .  40 PRO CG   1 1 
        3  1874 1 1 40 PRO HA   H   10.503   2.082  -2.143 1.00 . A A .  40 PRO HA   1 1 
        3  1875 1 1 40 PRO HB2  H   10.428   0.296  -4.185 1.00 . A A .  40 PRO HB2  1 1 
        3  1876 1 1 40 PRO HB3  H    9.056   1.325  -3.759 1.00 . A A .  40 PRO HB3  1 1 
        3  1877 1 1 40 PRO HD2  H   11.075   3.976  -5.733 1.00 . A A .  40 PRO HD2  1 1 
        3  1878 1 1 40 PRO HD3  H    9.456   4.001  -5.005 1.00 . A A .  40 PRO HD3  1 1 
        3  1879 1 1 40 PRO HG2  H   11.087   1.680  -5.929 1.00 . A A .  40 PRO HG2  1 1 
        3  1880 1 1 40 PRO HG3  H    9.331   1.921  -5.990 1.00 . A A .  40 PRO HG3  1 1 
        3  1881 1 1 40 PRO N    N   11.011   3.435  -3.689 1.00 . A A .  40 PRO N    1 1 
        3  1882 1 1 40 PRO O    O   13.326   1.992  -3.532 1.00 . A A .  40 PRO O    1 1 
        3  1883 1 1 41 SER C    C   13.455  -1.943  -2.298 1.00 . A A .  41 SER C    1 1 
        3  1884 1 1 41 SER CA   C   13.673  -0.434  -2.236 1.00 . A A .  41 SER CA   1 1 
        3  1885 1 1 41 SER CB   C   14.335  -0.057  -0.909 1.00 . A A .  41 SER CB   1 1 
        3  1886 1 1 41 SER H    H   11.593  -0.106  -2.016 1.00 . A A .  41 SER H    1 1 
        3  1887 1 1 41 SER HA   H   14.322  -0.142  -3.048 1.00 . A A .  41 SER HA   1 1 
        3  1888 1 1 41 SER HB2  H   14.589   0.992  -0.922 1.00 . A A .  41 SER HB2  1 1 
        3  1889 1 1 41 SER HB3  H   13.648  -0.252  -0.099 1.00 . A A .  41 SER HB3  1 1 
        3  1890 1 1 41 SER HG   H   15.986  -0.912  -1.529 1.00 . A A .  41 SER HG   1 1 
        3  1891 1 1 41 SER N    N   12.411   0.280  -2.393 1.00 . A A .  41 SER N    1 1 
        3  1892 1 1 41 SER O    O   12.385  -2.441  -1.951 1.00 . A A .  41 SER O    1 1 
        3  1893 1 1 41 SER OG   O   15.517  -0.810  -0.697 1.00 . A A .  41 SER OG   1 1 
        3  1894 1 1 42 GLY C    C   15.658  -4.743  -3.356 1.00 . A A .  42 GLY C    1 1 
        3  1895 1 1 42 GLY CA   C   14.380  -4.109  -2.845 1.00 . A A .  42 GLY CA   1 1 
        3  1896 1 1 42 GLY H    H   15.307  -2.212  -3.008 1.00 . A A .  42 GLY H    1 1 
        3  1897 1 1 42 GLY HA2  H   14.155  -4.512  -1.869 1.00 . A A .  42 GLY HA2  1 1 
        3  1898 1 1 42 GLY HA3  H   13.574  -4.357  -3.521 1.00 . A A .  42 GLY HA3  1 1 
        3  1899 1 1 42 GLY N    N   14.478  -2.664  -2.745 1.00 . A A .  42 GLY N    1 1 
        3  1900 1 1 42 GLY O    O   16.742  -4.165  -3.267 1.00 . A A .  42 GLY O    1 1 
        3  1901 1 1 43 PRO C    C   17.237  -6.074  -5.716 1.00 . A A .  43 PRO C    1 1 
        3  1902 1 1 43 PRO CA   C   16.687  -6.702  -4.440 1.00 . A A .  43 PRO CA   1 1 
        3  1903 1 1 43 PRO CB   C   16.107  -8.088  -4.733 1.00 . A A .  43 PRO CB   1 1 
        3  1904 1 1 43 PRO CD   C   14.280  -6.710  -4.043 1.00 . A A .  43 PRO CD   1 1 
        3  1905 1 1 43 PRO CG   C   14.652  -7.853  -4.946 1.00 . A A .  43 PRO CG   1 1 
        3  1906 1 1 43 PRO HA   H   17.479  -6.788  -3.711 1.00 . A A .  43 PRO HA   1 1 
        3  1907 1 1 43 PRO HB2  H   16.576  -8.497  -5.618 1.00 . A A .  43 PRO HB2  1 1 
        3  1908 1 1 43 PRO HB3  H   16.282  -8.741  -3.892 1.00 . A A .  43 PRO HB3  1 1 
        3  1909 1 1 43 PRO HD2  H   13.517  -6.099  -4.501 1.00 . A A .  43 PRO HD2  1 1 
        3  1910 1 1 43 PRO HD3  H   13.945  -7.080  -3.085 1.00 . A A .  43 PRO HD3  1 1 
        3  1911 1 1 43 PRO HG2  H   14.469  -7.591  -5.977 1.00 . A A .  43 PRO HG2  1 1 
        3  1912 1 1 43 PRO HG3  H   14.094  -8.739  -4.678 1.00 . A A .  43 PRO HG3  1 1 
        3  1913 1 1 43 PRO N    N   15.541  -5.962  -3.904 1.00 . A A .  43 PRO N    1 1 
        3  1914 1 1 43 PRO O    O   18.449  -5.921  -5.871 1.00 . A A .  43 PRO O    1 1 
        3  1915 1 1 44 SER C    C   17.671  -6.024  -8.668 1.00 . A A .  44 SER C    1 1 
        3  1916 1 1 44 SER CA   C   16.736  -5.103  -7.891 1.00 . A A .  44 SER CA   1 1 
        3  1917 1 1 44 SER CB   C   17.419  -3.757  -7.641 1.00 . A A .  44 SER CB   1 1 
        3  1918 1 1 44 SER H    H   15.387  -5.860  -6.445 1.00 . A A .  44 SER H    1 1 
        3  1919 1 1 44 SER HA   H   15.842  -4.940  -8.475 1.00 . A A .  44 SER HA   1 1 
        3  1920 1 1 44 SER HB2  H   16.756  -3.119  -7.078 1.00 . A A .  44 SER HB2  1 1 
        3  1921 1 1 44 SER HB3  H   18.328  -3.917  -7.079 1.00 . A A .  44 SER HB3  1 1 
        3  1922 1 1 44 SER HG   H   18.226  -2.305  -8.680 1.00 . A A .  44 SER HG   1 1 
        3  1923 1 1 44 SER N    N   16.339  -5.712  -6.627 1.00 . A A .  44 SER N    1 1 
        3  1924 1 1 44 SER O    O   18.670  -5.580  -9.234 1.00 . A A .  44 SER O    1 1 
        3  1925 1 1 44 SER OG   O   17.743  -3.115  -8.862 1.00 . A A .  44 SER OG   1 1 
        3  1926 1 1 45 SER C    C   17.269  -9.316 -10.110 1.00 . A A .  45 SER C    1 1 
        3  1927 1 1 45 SER CA   C   18.151  -8.298  -9.394 1.00 . A A .  45 SER CA   1 1 
        3  1928 1 1 45 SER CB   C   19.084  -9.014  -8.415 1.00 . A A .  45 SER CB   1 1 
        3  1929 1 1 45 SER H    H   16.531  -7.605  -8.219 1.00 . A A .  45 SER H    1 1 
        3  1930 1 1 45 SER HA   H   18.746  -7.775 -10.127 1.00 . A A .  45 SER HA   1 1 
        3  1931 1 1 45 SER HB2  H   18.495  -9.517  -7.663 1.00 . A A .  45 SER HB2  1 1 
        3  1932 1 1 45 SER HB3  H   19.677  -9.739  -8.953 1.00 . A A .  45 SER HB3  1 1 
        3  1933 1 1 45 SER HG   H   20.071  -7.324  -8.333 1.00 . A A .  45 SER HG   1 1 
        3  1934 1 1 45 SER N    N   17.340  -7.311  -8.690 1.00 . A A .  45 SER N    1 1 
        3  1935 1 1 45 SER O    O   16.094  -9.475  -9.783 1.00 . A A .  45 SER O    1 1 
        3  1936 1 1 45 SER OG   O   19.954  -8.096  -7.775 1.00 . A A .  45 SER OG   1 1 
        3  1937 1 1 46 GLY C    C   17.972 -11.772 -12.807 1.00 . A A .  46 GLY C    1 1 
        3  1938 1 1 46 GLY CA   C   17.099 -10.997 -11.839 1.00 . A A .  46 GLY CA   1 1 
        3  1939 1 1 46 GLY H    H   18.787  -9.834 -11.308 1.00 . A A .  46 GLY H    1 1 
        3  1940 1 1 46 GLY HA2  H   16.646 -11.689 -11.145 1.00 . A A .  46 GLY HA2  1 1 
        3  1941 1 1 46 GLY HA3  H   16.319 -10.500 -12.396 1.00 . A A .  46 GLY HA3  1 1 
        3  1942 1 1 46 GLY N    N   17.846 -10.003 -11.091 1.00 . A A .  46 GLY N    1 1 
        3  1943 1 1 46 GLY O    O   18.692 -11.154 -13.590 1.00 . A A .  46 GLY O    1 1 
        3  1944 2 2  1 ZN  ZN   ZN   2.729  -0.435  -4.597 1.00 . B A . 181 ZN  ZN   1 1 
        4  1945 1 1  1 GLY C    C   10.115 -15.630  -9.666 1.00 . A A .   1 GLY C    1 1 
        4  1946 1 1  1 GLY CA   C   11.341 -14.740  -9.683 1.00 . A A .   1 GLY CA   1 1 
        4  1947 1 1  1 GLY H1   H   12.866 -14.311 -11.088 1.00 . A A .   1 GLY H1   1 1 
        4  1948 1 1  1 GLY HA2  H   12.062 -15.122  -8.976 1.00 . A A .   1 GLY HA2  1 1 
        4  1949 1 1  1 GLY HA3  H   11.052 -13.743  -9.384 1.00 . A A .   1 GLY HA3  1 1 
        4  1950 1 1  1 GLY N    N   11.960 -14.674 -10.994 1.00 . A A .   1 GLY N    1 1 
        4  1951 1 1  1 GLY O    O    9.609 -16.023 -10.717 1.00 . A A .   1 GLY O    1 1 
        4  1952 1 1  2 SER C    C    7.204 -16.091  -8.796 1.00 . A A .   2 SER C    1 1 
        4  1953 1 1  2 SER CA   C    8.464 -16.807  -8.318 1.00 . A A .   2 SER CA   1 1 
        4  1954 1 1  2 SER CB   C    8.300 -17.231  -6.857 1.00 . A A .   2 SER CB   1 1 
        4  1955 1 1  2 SER H    H   10.083 -15.607  -7.667 1.00 . A A .   2 SER H    1 1 
        4  1956 1 1  2 SER HA   H    8.616 -17.687  -8.924 1.00 . A A .   2 SER HA   1 1 
        4  1957 1 1  2 SER HB2  H    8.168 -16.353  -6.243 1.00 . A A .   2 SER HB2  1 1 
        4  1958 1 1  2 SER HB3  H    7.432 -17.868  -6.765 1.00 . A A .   2 SER HB3  1 1 
        4  1959 1 1  2 SER HG   H    9.288 -18.244  -5.503 1.00 . A A .   2 SER HG   1 1 
        4  1960 1 1  2 SER N    N    9.636 -15.952  -8.468 1.00 . A A .   2 SER N    1 1 
        4  1961 1 1  2 SER O    O    7.154 -14.862  -8.840 1.00 . A A .   2 SER O    1 1 
        4  1962 1 1  2 SER OG   O    9.439 -17.940  -6.401 1.00 . A A .   2 SER OG   1 1 
        4  1963 1 1  3 SER C    C    4.046 -15.884  -8.465 1.00 . A A .   3 SER C    1 1 
        4  1964 1 1  3 SER CA   C    4.929 -16.312  -9.633 1.00 . A A .   3 SER CA   1 1 
        4  1965 1 1  3 SER CB   C    4.191 -17.334 -10.498 1.00 . A A .   3 SER CB   1 1 
        4  1966 1 1  3 SER H    H    6.290 -17.843  -9.096 1.00 . A A .   3 SER H    1 1 
        4  1967 1 1  3 SER HA   H    5.158 -15.444 -10.233 1.00 . A A .   3 SER HA   1 1 
        4  1968 1 1  3 SER HB2  H    3.331 -16.865 -10.952 1.00 . A A .   3 SER HB2  1 1 
        4  1969 1 1  3 SER HB3  H    4.854 -17.694 -11.271 1.00 . A A .   3 SER HB3  1 1 
        4  1970 1 1  3 SER HG   H    4.397 -19.146  -9.782 1.00 . A A .   3 SER HG   1 1 
        4  1971 1 1  3 SER N    N    6.189 -16.870  -9.154 1.00 . A A .   3 SER N    1 1 
        4  1972 1 1  3 SER O    O    4.183 -16.387  -7.351 1.00 . A A .   3 SER O    1 1 
        4  1973 1 1  3 SER OG   O    3.752 -18.437  -9.723 1.00 . A A .   3 SER OG   1 1 
        4  1974 1 1  4 GLY C    C    0.804 -14.384  -8.160 1.00 . A A .   4 GLY C    1 1 
        4  1975 1 1  4 GLY CA   C    2.243 -14.469  -7.692 1.00 . A A .   4 GLY CA   1 1 
        4  1976 1 1  4 GLY H    H    3.072 -14.585  -9.637 1.00 . A A .   4 GLY H    1 1 
        4  1977 1 1  4 GLY HA2  H    2.297 -15.139  -6.847 1.00 . A A .   4 GLY HA2  1 1 
        4  1978 1 1  4 GLY HA3  H    2.567 -13.487  -7.381 1.00 . A A .   4 GLY HA3  1 1 
        4  1979 1 1  4 GLY N    N    3.137 -14.950  -8.730 1.00 . A A .   4 GLY N    1 1 
        4  1980 1 1  4 GLY O    O    0.396 -13.386  -8.755 1.00 . A A .   4 GLY O    1 1 
        4  1981 1 1  5 SER C    C   -2.278 -15.620  -7.081 1.00 . A A .   5 SER C    1 1 
        4  1982 1 1  5 SER CA   C   -1.368 -15.475  -8.296 1.00 . A A .   5 SER CA   1 1 
        4  1983 1 1  5 SER CB   C   -1.607 -16.631  -9.269 1.00 . A A .   5 SER CB   1 1 
        4  1984 1 1  5 SER H    H    0.417 -16.199  -7.416 1.00 . A A .   5 SER H    1 1 
        4  1985 1 1  5 SER HA   H   -1.597 -14.544  -8.794 1.00 . A A .   5 SER HA   1 1 
        4  1986 1 1  5 SER HB2  H   -1.457 -17.568  -8.754 1.00 . A A .   5 SER HB2  1 1 
        4  1987 1 1  5 SER HB3  H   -2.620 -16.583  -9.640 1.00 . A A .   5 SER HB3  1 1 
        4  1988 1 1  5 SER HG   H    0.162 -16.327 -10.055 1.00 . A A .   5 SER HG   1 1 
        4  1989 1 1  5 SER N    N    0.033 -15.433  -7.894 1.00 . A A .   5 SER N    1 1 
        4  1990 1 1  5 SER O    O   -2.705 -16.724  -6.740 1.00 . A A .   5 SER O    1 1 
        4  1991 1 1  5 SER OG   O   -0.714 -16.567 -10.368 1.00 . A A .   5 SER OG   1 1 
        4  1992 1 1  6 SER C    C   -4.809 -13.942  -5.582 1.00 . A A .   6 SER C    1 1 
        4  1993 1 1  6 SER CA   C   -3.428 -14.500  -5.251 1.00 . A A .   6 SER CA   1 1 
        4  1994 1 1  6 SER CB   C   -2.789 -13.680  -4.129 1.00 . A A .   6 SER CB   1 1 
        4  1995 1 1  6 SER H    H   -2.200 -13.650  -6.752 1.00 . A A .   6 SER H    1 1 
        4  1996 1 1  6 SER HA   H   -3.536 -15.523  -4.921 1.00 . A A .   6 SER HA   1 1 
        4  1997 1 1  6 SER HB2  H   -1.715 -13.757  -4.197 1.00 . A A .   6 SER HB2  1 1 
        4  1998 1 1  6 SER HB3  H   -3.083 -12.645  -4.232 1.00 . A A .   6 SER HB3  1 1 
        4  1999 1 1  6 SER HG   H   -3.682 -13.453  -2.400 1.00 . A A .   6 SER HG   1 1 
        4  2000 1 1  6 SER N    N   -2.572 -14.499  -6.431 1.00 . A A .   6 SER N    1 1 
        4  2001 1 1  6 SER O    O   -4.976 -13.201  -6.549 1.00 . A A .   6 SER O    1 1 
        4  2002 1 1  6 SER OG   O   -3.201 -14.148  -2.857 1.00 . A A .   6 SER OG   1 1 
        4  2003 1 1  7 GLY C    C   -7.979 -14.805  -5.806 1.00 . A A .   7 GLY C    1 1 
        4  2004 1 1  7 GLY CA   C   -7.151 -13.832  -4.991 1.00 . A A .   7 GLY CA   1 1 
        4  2005 1 1  7 GLY H    H   -5.605 -14.898  -4.013 1.00 . A A .   7 GLY H    1 1 
        4  2006 1 1  7 GLY HA2  H   -7.630 -13.682  -4.034 1.00 . A A .   7 GLY HA2  1 1 
        4  2007 1 1  7 GLY HA3  H   -7.109 -12.887  -5.513 1.00 . A A .   7 GLY HA3  1 1 
        4  2008 1 1  7 GLY N    N   -5.797 -14.305  -4.769 1.00 . A A .   7 GLY N    1 1 
        4  2009 1 1  7 GLY O    O   -7.768 -16.016  -5.740 1.00 . A A .   7 GLY O    1 1 
        4  2010 1 1  8 GLU C    C   -9.227 -15.232  -8.820 1.00 . A A .   8 GLU C    1 1 
        4  2011 1 1  8 GLU CA   C   -9.788 -15.107  -7.406 1.00 . A A .   8 GLU CA   1 1 
        4  2012 1 1  8 GLU CB   C  -11.201 -14.523  -7.456 1.00 . A A .   8 GLU CB   1 1 
        4  2013 1 1  8 GLU CD   C  -13.673 -14.969  -7.726 1.00 . A A .   8 GLU CD   1 1 
        4  2014 1 1  8 GLU CG   C  -12.273 -15.549  -7.782 1.00 . A A .   8 GLU CG   1 1 
        4  2015 1 1  8 GLU H    H   -9.043 -13.303  -6.587 1.00 . A A .   8 GLU H    1 1 
        4  2016 1 1  8 GLU HA   H   -9.830 -16.089  -6.960 1.00 . A A .   8 GLU HA   1 1 
        4  2017 1 1  8 GLU HB2  H  -11.431 -14.085  -6.496 1.00 . A A .   8 GLU HB2  1 1 
        4  2018 1 1  8 GLU HB3  H  -11.231 -13.750  -8.210 1.00 . A A .   8 GLU HB3  1 1 
        4  2019 1 1  8 GLU HG2  H  -12.098 -15.930  -8.777 1.00 . A A .   8 GLU HG2  1 1 
        4  2020 1 1  8 GLU HG3  H  -12.206 -16.359  -7.071 1.00 . A A .   8 GLU HG3  1 1 
        4  2021 1 1  8 GLU N    N   -8.924 -14.275  -6.577 1.00 . A A .   8 GLU N    1 1 
        4  2022 1 1  8 GLU O    O   -9.207 -16.318  -9.398 1.00 . A A .   8 GLU O    1 1 
        4  2023 1 1  8 GLU OE1  O  -13.812 -13.738  -7.883 1.00 . A A .   8 GLU OE1  1 1 
        4  2024 1 1  8 GLU OE2  O  -14.629 -15.747  -7.525 1.00 . A A .   8 GLU OE2  1 1 
        4  2025 1 1  9 GLY C    C   -7.690 -12.758 -11.127 1.00 . A A .   9 GLY C    1 1 
        4  2026 1 1  9 GLY CA   C   -8.219 -14.116 -10.714 1.00 . A A .   9 GLY CA   1 1 
        4  2027 1 1  9 GLY H    H   -8.814 -13.274  -8.864 1.00 . A A .   9 GLY H    1 1 
        4  2028 1 1  9 GLY HA2  H   -7.413 -14.834 -10.756 1.00 . A A .   9 GLY HA2  1 1 
        4  2029 1 1  9 GLY HA3  H   -8.991 -14.415 -11.408 1.00 . A A .   9 GLY HA3  1 1 
        4  2030 1 1  9 GLY N    N   -8.773 -14.111  -9.372 1.00 . A A .   9 GLY N    1 1 
        4  2031 1 1  9 GLY O    O   -6.820 -12.196 -10.463 1.00 . A A .   9 GLY O    1 1 
        4  2032 1 1 10 GLU C    C   -8.302  -9.805 -11.838 1.00 . A A .  10 GLU C    1 1 
        4  2033 1 1 10 GLU CA   C   -7.786 -10.930 -12.731 1.00 . A A .  10 GLU CA   1 1 
        4  2034 1 1 10 GLU CB   C   -8.279 -10.724 -14.165 1.00 . A A .  10 GLU CB   1 1 
        4  2035 1 1 10 GLU CD   C   -7.862  -8.321 -14.822 1.00 . A A .  10 GLU CD   1 1 
        4  2036 1 1 10 GLU CG   C   -7.421  -9.764 -14.971 1.00 . A A .  10 GLU CG   1 1 
        4  2037 1 1 10 GLU H    H   -8.905 -12.727 -12.715 1.00 . A A .  10 GLU H    1 1 
        4  2038 1 1 10 GLU HA   H   -6.706 -10.911 -12.725 1.00 . A A .  10 GLU HA   1 1 
        4  2039 1 1 10 GLU HB2  H   -8.287 -11.679 -14.670 1.00 . A A .  10 GLU HB2  1 1 
        4  2040 1 1 10 GLU HB3  H   -9.285 -10.335 -14.134 1.00 . A A .  10 GLU HB3  1 1 
        4  2041 1 1 10 GLU HG2  H   -6.398  -9.847 -14.637 1.00 . A A .  10 GLU HG2  1 1 
        4  2042 1 1 10 GLU HG3  H   -7.481 -10.037 -16.015 1.00 . A A .  10 GLU HG3  1 1 
        4  2043 1 1 10 GLU N    N   -8.214 -12.230 -12.229 1.00 . A A .  10 GLU N    1 1 
        4  2044 1 1 10 GLU O    O   -9.508  -9.653 -11.645 1.00 . A A .  10 GLU O    1 1 
        4  2045 1 1 10 GLU OE1  O   -9.002  -8.004 -15.222 1.00 . A A .  10 GLU OE1  1 1 
        4  2046 1 1 10 GLU OE2  O   -7.067  -7.509 -14.304 1.00 . A A .  10 GLU OE2  1 1 
        4  2047 1 1 11 LYS C    C   -7.893  -6.616 -11.221 1.00 . A A .  11 LYS C    1 1 
        4  2048 1 1 11 LYS CA   C   -7.738  -7.906 -10.422 1.00 . A A .  11 LYS CA   1 1 
        4  2049 1 1 11 LYS CB   C   -6.678  -7.721  -9.335 1.00 . A A .  11 LYS CB   1 1 
        4  2050 1 1 11 LYS CD   C   -5.879 -10.004  -8.654 1.00 . A A .  11 LYS CD   1 1 
        4  2051 1 1 11 LYS CE   C   -4.390  -9.717  -8.530 1.00 . A A .  11 LYS CE   1 1 
        4  2052 1 1 11 LYS CG   C   -6.713  -8.796  -8.262 1.00 . A A .  11 LYS CG   1 1 
        4  2053 1 1 11 LYS H    H   -6.433  -9.190 -11.486 1.00 . A A .  11 LYS H    1 1 
        4  2054 1 1 11 LYS HA   H   -8.683  -8.142  -9.956 1.00 . A A .  11 LYS HA   1 1 
        4  2055 1 1 11 LYS HB2  H   -5.701  -7.734  -9.795 1.00 . A A .  11 LYS HB2  1 1 
        4  2056 1 1 11 LYS HB3  H   -6.830  -6.763  -8.860 1.00 . A A .  11 LYS HB3  1 1 
        4  2057 1 1 11 LYS HD2  H   -6.130 -10.830  -8.006 1.00 . A A .  11 LYS HD2  1 1 
        4  2058 1 1 11 LYS HD3  H   -6.102 -10.267  -9.679 1.00 . A A .  11 LYS HD3  1 1 
        4  2059 1 1 11 LYS HE2  H   -4.213  -8.684  -8.787 1.00 . A A .  11 LYS HE2  1 1 
        4  2060 1 1 11 LYS HE3  H   -4.088  -9.891  -7.507 1.00 . A A .  11 LYS HE3  1 1 
        4  2061 1 1 11 LYS HG2  H   -6.323  -8.386  -7.342 1.00 . A A .  11 LYS HG2  1 1 
        4  2062 1 1 11 LYS HG3  H   -7.737  -9.109  -8.113 1.00 . A A .  11 LYS HG3  1 1 
        4  2063 1 1 11 LYS HZ1  H   -3.699 -11.585  -9.162 1.00 . A A .  11 LYS HZ1  1 1 
        4  2064 1 1 11 LYS HZ2  H   -2.574 -10.336  -9.356 1.00 . A A .  11 LYS HZ2  1 1 
        4  2065 1 1 11 LYS HZ3  H   -3.887 -10.464 -10.415 1.00 . A A .  11 LYS HZ3  1 1 
        4  2066 1 1 11 LYS N    N   -7.379  -9.018 -11.295 1.00 . A A .  11 LYS N    1 1 
        4  2067 1 1 11 LYS NZ   N   -3.581 -10.586  -9.429 1.00 . A A .  11 LYS NZ   1 1 
        4  2068 1 1 11 LYS O    O   -7.172  -6.366 -12.188 1.00 . A A .  11 LYS O    1 1 
        4  2069 1 1 12 PRO C    C   -8.004  -3.482 -11.252 1.00 . A A .  12 PRO C    1 1 
        4  2070 1 1 12 PRO CA   C   -9.122  -4.496 -11.471 1.00 . A A .  12 PRO CA   1 1 
        4  2071 1 1 12 PRO CB   C  -10.415  -4.017 -10.806 1.00 . A A .  12 PRO CB   1 1 
        4  2072 1 1 12 PRO CD   C   -9.749  -6.008  -9.664 1.00 . A A .  12 PRO CD   1 1 
        4  2073 1 1 12 PRO CG   C  -10.421  -4.677  -9.471 1.00 . A A .  12 PRO CG   1 1 
        4  2074 1 1 12 PRO HA   H   -9.287  -4.624 -12.531 1.00 . A A .  12 PRO HA   1 1 
        4  2075 1 1 12 PRO HB2  H  -10.399  -2.940 -10.716 1.00 . A A .  12 PRO HB2  1 1 
        4  2076 1 1 12 PRO HB3  H  -11.264  -4.322 -11.401 1.00 . A A .  12 PRO HB3  1 1 
        4  2077 1 1 12 PRO HD2  H   -9.186  -6.278  -8.783 1.00 . A A .  12 PRO HD2  1 1 
        4  2078 1 1 12 PRO HD3  H  -10.479  -6.770  -9.895 1.00 . A A .  12 PRO HD3  1 1 
        4  2079 1 1 12 PRO HG2  H   -9.869  -4.078  -8.763 1.00 . A A .  12 PRO HG2  1 1 
        4  2080 1 1 12 PRO HG3  H  -11.438  -4.817  -9.135 1.00 . A A .  12 PRO HG3  1 1 
        4  2081 1 1 12 PRO N    N   -8.853  -5.775 -10.809 1.00 . A A .  12 PRO N    1 1 
        4  2082 1 1 12 PRO O    O   -7.883  -2.506 -11.993 1.00 . A A .  12 PRO O    1 1 
        4  2083 1 1 13 TYR C    C   -5.006  -3.555  -9.113 1.00 . A A .  13 TYR C    1 1 
        4  2084 1 1 13 TYR CA   C   -6.081  -2.827  -9.913 1.00 . A A .  13 TYR CA   1 1 
        4  2085 1 1 13 TYR CB   C   -6.585  -1.616  -9.126 1.00 . A A .  13 TYR CB   1 1 
        4  2086 1 1 13 TYR CD1  C   -9.060  -1.320  -9.527 1.00 . A A .  13 TYR CD1  1 1 
        4  2087 1 1 13 TYR CD2  C   -7.556   0.153 -10.644 1.00 . A A .  13 TYR CD2  1 1 
        4  2088 1 1 13 TYR CE1  C  -10.133  -0.682 -10.121 1.00 . A A .  13 TYR CE1  1 1 
        4  2089 1 1 13 TYR CE2  C   -8.622   0.798 -11.241 1.00 . A A .  13 TYR CE2  1 1 
        4  2090 1 1 13 TYR CG   C   -7.755  -0.914  -9.778 1.00 . A A .  13 TYR CG   1 1 
        4  2091 1 1 13 TYR CZ   C   -9.908   0.376 -10.977 1.00 . A A .  13 TYR CZ   1 1 
        4  2092 1 1 13 TYR H    H   -7.336  -4.514  -9.676 1.00 . A A .  13 TYR H    1 1 
        4  2093 1 1 13 TYR HA   H   -5.652  -2.486 -10.844 1.00 . A A .  13 TYR HA   1 1 
        4  2094 1 1 13 TYR HB2  H   -6.897  -1.937  -8.144 1.00 . A A .  13 TYR HB2  1 1 
        4  2095 1 1 13 TYR HB3  H   -5.782  -0.900  -9.027 1.00 . A A .  13 TYR HB3  1 1 
        4  2096 1 1 13 TYR HD1  H   -9.233  -2.149  -8.857 1.00 . A A .  13 TYR HD1  1 1 
        4  2097 1 1 13 TYR HD2  H   -6.547   0.481 -10.849 1.00 . A A .  13 TYR HD2  1 1 
        4  2098 1 1 13 TYR HE1  H  -11.140  -1.012  -9.914 1.00 . A A .  13 TYR HE1  1 1 
        4  2099 1 1 13 TYR HE2  H   -8.447   1.626 -11.911 1.00 . A A .  13 TYR HE2  1 1 
        4  2100 1 1 13 TYR HH   H  -11.616   0.362 -11.859 1.00 . A A .  13 TYR HH   1 1 
        4  2101 1 1 13 TYR N    N   -7.189  -3.720 -10.231 1.00 . A A .  13 TYR N    1 1 
        4  2102 1 1 13 TYR O    O   -5.238  -3.976  -7.980 1.00 . A A .  13 TYR O    1 1 
        4  2103 1 1 13 TYR OH   O  -10.973   1.014 -11.570 1.00 . A A .  13 TYR OH   1 1 
        4  2104 1 1 14 GLN C    C   -1.451  -3.527  -9.111 1.00 . A A .  14 GLN C    1 1 
        4  2105 1 1 14 GLN CA   C   -2.716  -4.378  -9.056 1.00 . A A .  14 GLN CA   1 1 
        4  2106 1 1 14 GLN CB   C   -2.460  -5.735  -9.712 1.00 . A A .  14 GLN CB   1 1 
        4  2107 1 1 14 GLN CD   C   -1.028  -7.815  -9.795 1.00 . A A .  14 GLN CD   1 1 
        4  2108 1 1 14 GLN CG   C   -1.323  -6.516  -9.072 1.00 . A A .  14 GLN CG   1 1 
        4  2109 1 1 14 GLN H    H   -3.704  -3.343 -10.616 1.00 . A A .  14 GLN H    1 1 
        4  2110 1 1 14 GLN HA   H   -2.986  -4.533  -8.022 1.00 . A A .  14 GLN HA   1 1 
        4  2111 1 1 14 GLN HB2  H   -3.359  -6.330  -9.645 1.00 . A A .  14 GLN HB2  1 1 
        4  2112 1 1 14 GLN HB3  H   -2.219  -5.579 -10.753 1.00 . A A .  14 GLN HB3  1 1 
        4  2113 1 1 14 GLN HE21 H    0.091  -6.850 -11.125 1.00 . A A .  14 GLN HE21 1 1 
        4  2114 1 1 14 GLN HE22 H   -0.040  -8.558 -11.352 1.00 . A A .  14 GLN HE22 1 1 
        4  2115 1 1 14 GLN HG2  H   -0.433  -5.905  -9.085 1.00 . A A .  14 GLN HG2  1 1 
        4  2116 1 1 14 GLN HG3  H   -1.590  -6.742  -8.050 1.00 . A A .  14 GLN HG3  1 1 
        4  2117 1 1 14 GLN N    N   -3.828  -3.700  -9.712 1.00 . A A .  14 GLN N    1 1 
        4  2118 1 1 14 GLN NE2  N   -0.247  -7.734 -10.866 1.00 . A A .  14 GLN NE2  1 1 
        4  2119 1 1 14 GLN O    O   -0.837  -3.376 -10.168 1.00 . A A .  14 GLN O    1 1 
        4  2120 1 1 14 GLN OE1  O   -1.497  -8.882  -9.396 1.00 . A A .  14 GLN OE1  1 1 
        4  2121 1 1 15 CYS C    C    1.345  -2.872  -8.427 1.00 . A A .  15 CYS C    1 1 
        4  2122 1 1 15 CYS CA   C    0.124  -2.136  -7.883 1.00 . A A .  15 CYS CA   1 1 
        4  2123 1 1 15 CYS CB   C    0.374  -1.711  -6.434 1.00 . A A .  15 CYS CB   1 1 
        4  2124 1 1 15 CYS H    H   -1.598  -3.129  -7.156 1.00 . A A .  15 CYS H    1 1 
        4  2125 1 1 15 CYS HA   H   -0.047  -1.255  -8.483 1.00 . A A .  15 CYS HA   1 1 
        4  2126 1 1 15 CYS HB2  H   -0.477  -1.149  -6.080 1.00 . A A .  15 CYS HB2  1 1 
        4  2127 1 1 15 CYS HB3  H    0.495  -2.594  -5.825 1.00 . A A .  15 CYS HB3  1 1 
        4  2128 1 1 15 CYS N    N   -1.067  -2.972  -7.966 1.00 . A A .  15 CYS N    1 1 
        4  2129 1 1 15 CYS O    O    1.669  -3.972  -7.981 1.00 . A A .  15 CYS O    1 1 
        4  2130 1 1 15 CYS SG   S    1.854  -0.673  -6.209 1.00 . A A .  15 CYS SG   1 1 
        4  2131 1 1 16 SER C    C    4.458  -2.483  -9.222 1.00 . A A .  16 SER C    1 1 
        4  2132 1 1 16 SER CA   C    3.201  -2.853 -10.002 1.00 . A A .  16 SER CA   1 1 
        4  2133 1 1 16 SER CB   C    3.337  -2.399 -11.457 1.00 . A A .  16 SER CB   1 1 
        4  2134 1 1 16 SER H    H    1.709  -1.380  -9.707 1.00 . A A .  16 SER H    1 1 
        4  2135 1 1 16 SER HA   H    3.079  -3.926  -9.979 1.00 . A A .  16 SER HA   1 1 
        4  2136 1 1 16 SER HB2  H    2.355  -2.262 -11.882 1.00 . A A .  16 SER HB2  1 1 
        4  2137 1 1 16 SER HB3  H    3.877  -1.463 -11.489 1.00 . A A .  16 SER HB3  1 1 
        4  2138 1 1 16 SER HG   H    3.844  -3.228 -13.158 1.00 . A A .  16 SER HG   1 1 
        4  2139 1 1 16 SER N    N    2.018  -2.256  -9.394 1.00 . A A .  16 SER N    1 1 
        4  2140 1 1 16 SER O    O    5.374  -3.293  -9.081 1.00 . A A .  16 SER O    1 1 
        4  2141 1 1 16 SER OG   O    4.040  -3.358 -12.227 1.00 . A A .  16 SER OG   1 1 
        4  2142 1 1 17 GLU C    C    6.204  -1.885  -7.067 1.00 . A A .  17 GLU C    1 1 
        4  2143 1 1 17 GLU CA   C    5.639  -0.776  -7.951 1.00 . A A .  17 GLU CA   1 1 
        4  2144 1 1 17 GLU CB   C    5.240   0.424  -7.090 1.00 . A A .  17 GLU CB   1 1 
        4  2145 1 1 17 GLU CD   C    6.149   1.931  -8.902 1.00 . A A .  17 GLU CD   1 1 
        4  2146 1 1 17 GLU CG   C    5.048   1.705  -7.883 1.00 . A A .  17 GLU CG   1 1 
        4  2147 1 1 17 GLU H    H    3.732  -0.655  -8.862 1.00 . A A .  17 GLU H    1 1 
        4  2148 1 1 17 GLU HA   H    6.401  -0.468  -8.651 1.00 . A A .  17 GLU HA   1 1 
        4  2149 1 1 17 GLU HB2  H    4.314   0.196  -6.583 1.00 . A A .  17 GLU HB2  1 1 
        4  2150 1 1 17 GLU HB3  H    6.011   0.594  -6.353 1.00 . A A .  17 GLU HB3  1 1 
        4  2151 1 1 17 GLU HG2  H    4.103   1.654  -8.403 1.00 . A A .  17 GLU HG2  1 1 
        4  2152 1 1 17 GLU HG3  H    5.036   2.540  -7.198 1.00 . A A .  17 GLU HG3  1 1 
        4  2153 1 1 17 GLU N    N    4.494  -1.254  -8.716 1.00 . A A .  17 GLU N    1 1 
        4  2154 1 1 17 GLU O    O    7.411  -2.124  -7.047 1.00 . A A .  17 GLU O    1 1 
        4  2155 1 1 17 GLU OE1  O    7.247   2.370  -8.503 1.00 . A A .  17 GLU OE1  1 1 
        4  2156 1 1 17 GLU OE2  O    5.911   1.667 -10.099 1.00 . A A .  17 GLU OE2  1 1 
        4  2157 1 1 18 CYS C    C    5.056  -4.952  -5.846 1.00 . A A .  18 CYS C    1 1 
        4  2158 1 1 18 CYS CA   C    5.729  -3.641  -5.450 1.00 . A A .  18 CYS CA   1 1 
        4  2159 1 1 18 CYS CB   C    5.386  -3.297  -3.999 1.00 . A A .  18 CYS CB   1 1 
        4  2160 1 1 18 CYS H    H    4.371  -2.322  -6.396 1.00 . A A .  18 CYS H    1 1 
        4  2161 1 1 18 CYS HA   H    6.798  -3.759  -5.540 1.00 . A A .  18 CYS HA   1 1 
        4  2162 1 1 18 CYS HB2  H    5.622  -4.144  -3.371 1.00 . A A .  18 CYS HB2  1 1 
        4  2163 1 1 18 CYS HB3  H    5.978  -2.449  -3.689 1.00 . A A .  18 CYS HB3  1 1 
        4  2164 1 1 18 CYS N    N    5.321  -2.559  -6.337 1.00 . A A .  18 CYS N    1 1 
        4  2165 1 1 18 CYS O    O    5.709  -5.988  -5.963 1.00 . A A .  18 CYS O    1 1 
        4  2166 1 1 18 CYS SG   S    3.634  -2.880  -3.729 1.00 . A A .  18 CYS SG   1 1 
        4  2167 1 1 19 GLY C    C    1.897  -6.421  -5.451 1.00 . A A .  19 GLY C    1 1 
        4  2168 1 1 19 GLY CA   C    3.003  -6.087  -6.433 1.00 . A A .  19 GLY CA   1 1 
        4  2169 1 1 19 GLY H    H    3.274  -4.044  -5.945 1.00 . A A .  19 GLY H    1 1 
        4  2170 1 1 19 GLY HA2  H    2.568  -5.930  -7.409 1.00 . A A .  19 GLY HA2  1 1 
        4  2171 1 1 19 GLY HA3  H    3.686  -6.922  -6.485 1.00 . A A .  19 GLY HA3  1 1 
        4  2172 1 1 19 GLY N    N    3.743  -4.898  -6.052 1.00 . A A .  19 GLY N    1 1 
        4  2173 1 1 19 GLY O    O    1.841  -7.530  -4.921 1.00 . A A .  19 GLY O    1 1 
        4  2174 1 1 20 LYS C    C   -1.408  -5.185  -4.900 1.00 . A A .  20 LYS C    1 1 
        4  2175 1 1 20 LYS CA   C   -0.095  -5.653  -4.281 1.00 . A A .  20 LYS CA   1 1 
        4  2176 1 1 20 LYS CB   C    0.163  -4.898  -2.975 1.00 . A A .  20 LYS CB   1 1 
        4  2177 1 1 20 LYS CD   C    2.409  -5.715  -2.200 1.00 . A A .  20 LYS CD   1 1 
        4  2178 1 1 20 LYS CE   C    3.118  -6.786  -1.386 1.00 . A A .  20 LYS CE   1 1 
        4  2179 1 1 20 LYS CG   C    0.912  -5.716  -1.938 1.00 . A A .  20 LYS CG   1 1 
        4  2180 1 1 20 LYS H    H    1.112  -4.594  -5.660 1.00 . A A .  20 LYS H    1 1 
        4  2181 1 1 20 LYS HA   H   -0.167  -6.709  -4.068 1.00 . A A .  20 LYS HA   1 1 
        4  2182 1 1 20 LYS HB2  H    0.744  -4.014  -3.194 1.00 . A A .  20 LYS HB2  1 1 
        4  2183 1 1 20 LYS HB3  H   -0.785  -4.600  -2.552 1.00 . A A .  20 LYS HB3  1 1 
        4  2184 1 1 20 LYS HD2  H    2.582  -5.902  -3.249 1.00 . A A .  20 LYS HD2  1 1 
        4  2185 1 1 20 LYS HD3  H    2.811  -4.747  -1.933 1.00 . A A .  20 LYS HD3  1 1 
        4  2186 1 1 20 LYS HE2  H    2.993  -6.565  -0.337 1.00 . A A .  20 LYS HE2  1 1 
        4  2187 1 1 20 LYS HE3  H    2.671  -7.744  -1.609 1.00 . A A .  20 LYS HE3  1 1 
        4  2188 1 1 20 LYS HG2  H    0.728  -5.296  -0.960 1.00 . A A .  20 LYS HG2  1 1 
        4  2189 1 1 20 LYS HG3  H    0.552  -6.735  -1.967 1.00 . A A .  20 LYS HG3  1 1 
        4  2190 1 1 20 LYS HZ1  H    5.081  -6.099  -1.183 1.00 . A A .  20 LYS HZ1  1 1 
        4  2191 1 1 20 LYS HZ2  H    4.726  -6.715  -2.718 1.00 . A A .  20 LYS HZ2  1 1 
        4  2192 1 1 20 LYS HZ3  H    4.961  -7.770  -1.417 1.00 . A A .  20 LYS HZ3  1 1 
        4  2193 1 1 20 LYS N    N    1.015  -5.458  -5.206 1.00 . A A .  20 LYS N    1 1 
        4  2194 1 1 20 LYS NZ   N    4.573  -6.846  -1.698 1.00 . A A .  20 LYS NZ   1 1 
        4  2195 1 1 20 LYS O    O   -1.520  -4.047  -5.354 1.00 . A A .  20 LYS O    1 1 
        4  2196 1 1 21 SER C    C   -4.716  -5.454  -4.376 1.00 . A A .  21 SER C    1 1 
        4  2197 1 1 21 SER CA   C   -3.704  -5.749  -5.479 1.00 . A A .  21 SER CA   1 1 
        4  2198 1 1 21 SER CB   C   -4.205  -6.902  -6.351 1.00 . A A .  21 SER CB   1 1 
        4  2199 1 1 21 SER H    H   -2.248  -6.963  -4.537 1.00 . A A .  21 SER H    1 1 
        4  2200 1 1 21 SER HA   H   -3.591  -4.867  -6.093 1.00 . A A .  21 SER HA   1 1 
        4  2201 1 1 21 SER HB2  H   -5.033  -6.561  -6.953 1.00 . A A .  21 SER HB2  1 1 
        4  2202 1 1 21 SER HB3  H   -3.405  -7.236  -6.995 1.00 . A A .  21 SER HB3  1 1 
        4  2203 1 1 21 SER HG   H   -4.010  -8.137  -4.843 1.00 . A A .  21 SER HG   1 1 
        4  2204 1 1 21 SER N    N   -2.399  -6.071  -4.914 1.00 . A A .  21 SER N    1 1 
        4  2205 1 1 21 SER O    O   -4.606  -5.967  -3.262 1.00 . A A .  21 SER O    1 1 
        4  2206 1 1 21 SER OG   O   -4.636  -7.992  -5.556 1.00 . A A .  21 SER OG   1 1 
        4  2207 1 1 22 PHE C    C   -8.124  -4.357  -4.357 1.00 . A A .  22 PHE C    1 1 
        4  2208 1 1 22 PHE CA   C   -6.736  -4.258  -3.731 1.00 . A A .  22 PHE CA   1 1 
        4  2209 1 1 22 PHE CB   C   -6.499  -2.838  -3.211 1.00 . A A .  22 PHE CB   1 1 
        4  2210 1 1 22 PHE CD1  C   -4.076  -2.226  -3.442 1.00 . A A .  22 PHE CD1  1 1 
        4  2211 1 1 22 PHE CD2  C   -4.889  -2.844  -1.287 1.00 . A A .  22 PHE CD2  1 1 
        4  2212 1 1 22 PHE CE1  C   -2.813  -2.035  -2.915 1.00 . A A .  22 PHE CE1  1 1 
        4  2213 1 1 22 PHE CE2  C   -3.628  -2.653  -0.754 1.00 . A A .  22 PHE CE2  1 1 
        4  2214 1 1 22 PHE CG   C   -5.127  -2.632  -2.635 1.00 . A A .  22 PHE CG   1 1 
        4  2215 1 1 22 PHE CZ   C   -2.588  -2.250  -1.569 1.00 . A A .  22 PHE CZ   1 1 
        4  2216 1 1 22 PHE H    H   -5.738  -4.246  -5.598 1.00 . A A .  22 PHE H    1 1 
        4  2217 1 1 22 PHE HA   H   -6.676  -4.949  -2.905 1.00 . A A .  22 PHE HA   1 1 
        4  2218 1 1 22 PHE HB2  H   -6.625  -2.139  -4.024 1.00 . A A .  22 PHE HB2  1 1 
        4  2219 1 1 22 PHE HB3  H   -7.221  -2.620  -2.439 1.00 . A A .  22 PHE HB3  1 1 
        4  2220 1 1 22 PHE HD1  H   -4.251  -2.058  -4.496 1.00 . A A .  22 PHE HD1  1 1 
        4  2221 1 1 22 PHE HD2  H   -5.700  -3.160  -0.648 1.00 . A A .  22 PHE HD2  1 1 
        4  2222 1 1 22 PHE HE1  H   -2.003  -1.719  -3.555 1.00 . A A .  22 PHE HE1  1 1 
        4  2223 1 1 22 PHE HE2  H   -3.454  -2.823   0.298 1.00 . A A .  22 PHE HE2  1 1 
        4  2224 1 1 22 PHE HZ   H   -1.602  -2.100  -1.155 1.00 . A A .  22 PHE HZ   1 1 
        4  2225 1 1 22 PHE N    N   -5.703  -4.623  -4.694 1.00 . A A .  22 PHE N    1 1 
        4  2226 1 1 22 PHE O    O   -8.262  -4.431  -5.578 1.00 . A A .  22 PHE O    1 1 
        4  2227 1 1 23 SER C    C  -11.122  -3.067  -4.202 1.00 . A A .  23 SER C    1 1 
        4  2228 1 1 23 SER CA   C  -10.527  -4.454  -3.980 1.00 . A A .  23 SER CA   1 1 
        4  2229 1 1 23 SER CB   C  -11.377  -5.233  -2.975 1.00 . A A .  23 SER CB   1 1 
        4  2230 1 1 23 SER H    H   -8.974  -4.298  -2.549 1.00 . A A .  23 SER H    1 1 
        4  2231 1 1 23 SER HA   H  -10.521  -4.985  -4.921 1.00 . A A .  23 SER HA   1 1 
        4  2232 1 1 23 SER HB2  H  -12.356  -5.408  -3.395 1.00 . A A .  23 SER HB2  1 1 
        4  2233 1 1 23 SER HB3  H  -10.902  -6.179  -2.762 1.00 . A A .  23 SER HB3  1 1 
        4  2234 1 1 23 SER HG   H  -12.419  -4.175  -1.697 1.00 . A A .  23 SER HG   1 1 
        4  2235 1 1 23 SER N    N   -9.149  -4.359  -3.511 1.00 . A A .  23 SER N    1 1 
        4  2236 1 1 23 SER O    O  -12.272  -2.810  -3.849 1.00 . A A .  23 SER O    1 1 
        4  2237 1 1 23 SER OG   O  -11.523  -4.512  -1.764 1.00 . A A .  23 SER OG   1 1 
        4  2238 1 1 24 GLY C    C   -9.673   0.101  -5.475 1.00 . A A .  24 GLY C    1 1 
        4  2239 1 1 24 GLY CA   C  -10.794  -0.826  -5.048 1.00 . A A .  24 GLY CA   1 1 
        4  2240 1 1 24 GLY H    H   -9.421  -2.438  -5.049 1.00 . A A .  24 GLY H    1 1 
        4  2241 1 1 24 GLY HA2  H  -11.539  -0.857  -5.828 1.00 . A A .  24 GLY HA2  1 1 
        4  2242 1 1 24 GLY HA3  H  -11.245  -0.435  -4.148 1.00 . A A .  24 GLY HA3  1 1 
        4  2243 1 1 24 GLY N    N  -10.329  -2.176  -4.789 1.00 . A A .  24 GLY N    1 1 
        4  2244 1 1 24 GLY O    O   -8.590   0.087  -4.891 1.00 . A A .  24 GLY O    1 1 
        4  2245 1 1 25 SER C    C   -8.605   2.906  -5.964 1.00 . A A .  25 SER C    1 1 
        4  2246 1 1 25 SER CA   C   -8.936   1.843  -7.007 1.00 . A A .  25 SER CA   1 1 
        4  2247 1 1 25 SER CB   C   -9.438   2.509  -8.290 1.00 . A A .  25 SER CB   1 1 
        4  2248 1 1 25 SER H    H  -10.816   0.873  -6.923 1.00 . A A .  25 SER H    1 1 
        4  2249 1 1 25 SER HA   H   -8.040   1.282  -7.230 1.00 . A A .  25 SER HA   1 1 
        4  2250 1 1 25 SER HB2  H   -8.608   2.972  -8.801 1.00 . A A .  25 SER HB2  1 1 
        4  2251 1 1 25 SER HB3  H   -9.883   1.761  -8.930 1.00 . A A .  25 SER HB3  1 1 
        4  2252 1 1 25 SER HG   H   -9.968   4.325  -7.781 1.00 . A A .  25 SER HG   1 1 
        4  2253 1 1 25 SER N    N   -9.933   0.909  -6.498 1.00 . A A .  25 SER N    1 1 
        4  2254 1 1 25 SER O    O   -7.438   3.231  -5.742 1.00 . A A .  25 SER O    1 1 
        4  2255 1 1 25 SER OG   O  -10.408   3.501  -8.003 1.00 . A A .  25 SER OG   1 1 
        4  2256 1 1 26 TYR C    C   -8.348   4.089  -3.339 1.00 . A A .  26 TYR C    1 1 
        4  2257 1 1 26 TYR CA   C   -9.461   4.472  -4.310 1.00 . A A .  26 TYR CA   1 1 
        4  2258 1 1 26 TYR CB   C  -10.766   4.695  -3.546 1.00 . A A .  26 TYR CB   1 1 
        4  2259 1 1 26 TYR CD1  C  -10.308   6.309  -1.658 1.00 . A A .  26 TYR CD1  1 1 
        4  2260 1 1 26 TYR CD2  C  -11.521   7.105  -3.549 1.00 . A A .  26 TYR CD2  1 1 
        4  2261 1 1 26 TYR CE1  C  -10.399   7.555  -1.069 1.00 . A A .  26 TYR CE1  1 1 
        4  2262 1 1 26 TYR CE2  C  -11.615   8.355  -2.968 1.00 . A A .  26 TYR CE2  1 1 
        4  2263 1 1 26 TYR CG   C  -10.867   6.061  -2.906 1.00 . A A .  26 TYR CG   1 1 
        4  2264 1 1 26 TYR CZ   C  -11.053   8.575  -1.728 1.00 . A A .  26 TYR CZ   1 1 
        4  2265 1 1 26 TYR H    H  -10.546   3.143  -5.550 1.00 . A A .  26 TYR H    1 1 
        4  2266 1 1 26 TYR HA   H   -9.186   5.389  -4.810 1.00 . A A .  26 TYR HA   1 1 
        4  2267 1 1 26 TYR HB2  H  -11.597   4.586  -4.226 1.00 . A A .  26 TYR HB2  1 1 
        4  2268 1 1 26 TYR HB3  H  -10.849   3.955  -2.763 1.00 . A A .  26 TYR HB3  1 1 
        4  2269 1 1 26 TYR HD1  H   -9.796   5.507  -1.145 1.00 . A A .  26 TYR HD1  1 1 
        4  2270 1 1 26 TYR HD2  H  -11.961   6.929  -4.520 1.00 . A A .  26 TYR HD2  1 1 
        4  2271 1 1 26 TYR HE1  H   -9.958   7.727  -0.098 1.00 . A A .  26 TYR HE1  1 1 
        4  2272 1 1 26 TYR HE2  H  -12.128   9.154  -3.484 1.00 . A A .  26 TYR HE2  1 1 
        4  2273 1 1 26 TYR HH   H  -11.138   9.725  -0.190 1.00 . A A .  26 TYR HH   1 1 
        4  2274 1 1 26 TYR N    N   -9.640   3.444  -5.328 1.00 . A A .  26 TYR N    1 1 
        4  2275 1 1 26 TYR O    O   -7.580   4.940  -2.890 1.00 . A A .  26 TYR O    1 1 
        4  2276 1 1 26 TYR OH   O  -11.145   9.818  -1.146 1.00 . A A .  26 TYR OH   1 1 
        4  2277 1 1 27 ARG C    C   -5.896   2.202  -2.793 1.00 . A A .  27 ARG C    1 1 
        4  2278 1 1 27 ARG CA   C   -7.252   2.304  -2.100 1.00 . A A .  27 ARG CA   1 1 
        4  2279 1 1 27 ARG CB   C   -7.658   0.936  -1.548 1.00 . A A .  27 ARG CB   1 1 
        4  2280 1 1 27 ARG CD   C   -6.926   0.820   0.854 1.00 . A A .  27 ARG CD   1 1 
        4  2281 1 1 27 ARG CG   C   -6.654   0.353  -0.568 1.00 . A A .  27 ARG CG   1 1 
        4  2282 1 1 27 ARG CZ   C   -8.877   0.965   2.342 1.00 . A A .  27 ARG CZ   1 1 
        4  2283 1 1 27 ARG H    H   -8.910   2.171  -3.409 1.00 . A A .  27 ARG H    1 1 
        4  2284 1 1 27 ARG HA   H   -7.173   3.004  -1.282 1.00 . A A .  27 ARG HA   1 1 
        4  2285 1 1 27 ARG HB2  H   -8.607   1.033  -1.041 1.00 . A A .  27 ARG HB2  1 1 
        4  2286 1 1 27 ARG HB3  H   -7.767   0.247  -2.371 1.00 . A A .  27 ARG HB3  1 1 
        4  2287 1 1 27 ARG HD2  H   -6.167   0.412   1.504 1.00 . A A .  27 ARG HD2  1 1 
        4  2288 1 1 27 ARG HD3  H   -6.879   1.898   0.879 1.00 . A A .  27 ARG HD3  1 1 
        4  2289 1 1 27 ARG HE   H   -8.663  -0.364   0.870 1.00 . A A .  27 ARG HE   1 1 
        4  2290 1 1 27 ARG HG2  H   -6.719  -0.725  -0.599 1.00 . A A .  27 ARG HG2  1 1 
        4  2291 1 1 27 ARG HG3  H   -5.661   0.664  -0.856 1.00 . A A .  27 ARG HG3  1 1 
        4  2292 1 1 27 ARG HH11 H   -7.429   2.327   2.702 1.00 . A A .  27 ARG HH11 1 1 
        4  2293 1 1 27 ARG HH12 H   -8.810   2.419   3.745 1.00 . A A .  27 ARG HH12 1 1 
        4  2294 1 1 27 ARG HH21 H  -10.486  -0.253   2.236 1.00 . A A .  27 ARG HH21 1 1 
        4  2295 1 1 27 ARG HH22 H  -10.548   0.950   3.479 1.00 . A A .  27 ARG HH22 1 1 
        4  2296 1 1 27 ARG N    N   -8.269   2.801  -3.018 1.00 . A A .  27 ARG N    1 1 
        4  2297 1 1 27 ARG NE   N   -8.238   0.390   1.329 1.00 . A A .  27 ARG NE   1 1 
        4  2298 1 1 27 ARG NH1  N   -8.327   1.987   2.983 1.00 . A A .  27 ARG NH1  1 1 
        4  2299 1 1 27 ARG NH2  N  -10.068   0.517   2.717 1.00 . A A .  27 ARG NH2  1 1 
        4  2300 1 1 27 ARG O    O   -4.868   2.574  -2.227 1.00 . A A .  27 ARG O    1 1 
        4  2301 1 1 28 LEU C    C   -3.839   2.820  -4.744 1.00 . A A .  28 LEU C    1 1 
        4  2302 1 1 28 LEU CA   C   -4.673   1.544  -4.792 1.00 . A A .  28 LEU CA   1 1 
        4  2303 1 1 28 LEU CB   C   -4.999   1.189  -6.244 1.00 . A A .  28 LEU CB   1 1 
        4  2304 1 1 28 LEU CD1  C   -3.667  -0.830  -6.902 1.00 . A A .  28 LEU CD1  1 1 
        4  2305 1 1 28 LEU CD2  C   -4.044   1.010  -8.555 1.00 . A A .  28 LEU CD2  1 1 
        4  2306 1 1 28 LEU CG   C   -3.833   0.670  -7.086 1.00 . A A .  28 LEU CG   1 1 
        4  2307 1 1 28 LEU H    H   -6.752   1.416  -4.419 1.00 . A A .  28 LEU H    1 1 
        4  2308 1 1 28 LEU HA   H   -4.103   0.739  -4.352 1.00 . A A .  28 LEU HA   1 1 
        4  2309 1 1 28 LEU HB2  H   -5.764   0.428  -6.234 1.00 . A A .  28 LEU HB2  1 1 
        4  2310 1 1 28 LEU HB3  H   -5.385   2.078  -6.722 1.00 . A A .  28 LEU HB3  1 1 
        4  2311 1 1 28 LEU HD11 H   -3.104  -1.234  -7.730 1.00 . A A .  28 LEU HD11 1 1 
        4  2312 1 1 28 LEU HD12 H   -4.640  -1.298  -6.866 1.00 . A A .  28 LEU HD12 1 1 
        4  2313 1 1 28 LEU HD13 H   -3.141  -1.023  -5.979 1.00 . A A .  28 LEU HD13 1 1 
        4  2314 1 1 28 LEU HD21 H   -3.248   1.656  -8.892 1.00 . A A .  28 LEU HD21 1 1 
        4  2315 1 1 28 LEU HD22 H   -4.992   1.512  -8.675 1.00 . A A .  28 LEU HD22 1 1 
        4  2316 1 1 28 LEU HD23 H   -4.042   0.100  -9.138 1.00 . A A .  28 LEU HD23 1 1 
        4  2317 1 1 28 LEU HG   H   -2.920   1.149  -6.759 1.00 . A A .  28 LEU HG   1 1 
        4  2318 1 1 28 LEU N    N   -5.902   1.695  -4.021 1.00 . A A .  28 LEU N    1 1 
        4  2319 1 1 28 LEU O    O   -2.768   2.852  -4.137 1.00 . A A .  28 LEU O    1 1 
        4  2320 1 1 29 THR C    C   -3.075   5.501  -4.043 1.00 . A A .  29 THR C    1 1 
        4  2321 1 1 29 THR CA   C   -3.640   5.151  -5.415 1.00 . A A .  29 THR CA   1 1 
        4  2322 1 1 29 THR CB   C   -4.570   6.288  -5.879 1.00 . A A .  29 THR CB   1 1 
        4  2323 1 1 29 THR CG2  C   -5.910   6.218  -5.163 1.00 . A A .  29 THR CG2  1 1 
        4  2324 1 1 29 THR H    H   -5.196   3.784  -5.851 1.00 . A A .  29 THR H    1 1 
        4  2325 1 1 29 THR HA   H   -2.825   5.070  -6.119 1.00 . A A .  29 THR HA   1 1 
        4  2326 1 1 29 THR HB   H   -4.740   6.182  -6.941 1.00 . A A .  29 THR HB   1 1 
        4  2327 1 1 29 THR HG1  H   -4.189   8.169  -6.331 1.00 . A A .  29 THR HG1  1 1 
        4  2328 1 1 29 THR HG21 H   -6.685   6.596  -5.812 1.00 . A A .  29 THR HG21 1 1 
        4  2329 1 1 29 THR HG22 H   -5.870   6.816  -4.265 1.00 . A A .  29 THR HG22 1 1 
        4  2330 1 1 29 THR HG23 H   -6.126   5.192  -4.903 1.00 . A A .  29 THR HG23 1 1 
        4  2331 1 1 29 THR N    N   -4.338   3.872  -5.385 1.00 . A A .  29 THR N    1 1 
        4  2332 1 1 29 THR O    O   -1.867   5.681  -3.887 1.00 . A A .  29 THR O    1 1 
        4  2333 1 1 29 THR OG1  O   -3.955   7.557  -5.629 1.00 . A A .  29 THR OG1  1 1 
        4  2334 1 1 30 GLN C    C   -2.252   5.198  -1.326 1.00 . A A .  30 GLN C    1 1 
        4  2335 1 1 30 GLN CA   C   -3.542   5.923  -1.692 1.00 . A A .  30 GLN CA   1 1 
        4  2336 1 1 30 GLN CB   C   -4.647   5.557  -0.699 1.00 . A A .  30 GLN CB   1 1 
        4  2337 1 1 30 GLN CD   C   -5.573   7.786   0.046 1.00 . A A .  30 GLN CD   1 1 
        4  2338 1 1 30 GLN CG   C   -5.831   6.509  -0.728 1.00 . A A .  30 GLN CG   1 1 
        4  2339 1 1 30 GLN H    H   -4.904   5.440  -3.239 1.00 . A A .  30 GLN H    1 1 
        4  2340 1 1 30 GLN HA   H   -3.368   6.987  -1.647 1.00 . A A .  30 GLN HA   1 1 
        4  2341 1 1 30 GLN HB2  H   -5.004   4.564  -0.926 1.00 . A A .  30 GLN HB2  1 1 
        4  2342 1 1 30 GLN HB3  H   -4.233   5.562   0.299 1.00 . A A .  30 GLN HB3  1 1 
        4  2343 1 1 30 GLN HE21 H   -5.726   6.803   1.767 1.00 . A A .  30 GLN HE21 1 1 
        4  2344 1 1 30 GLN HE22 H   -5.401   8.495   1.895 1.00 . A A .  30 GLN HE22 1 1 
        4  2345 1 1 30 GLN HG2  H   -6.045   6.766  -1.755 1.00 . A A .  30 GLN HG2  1 1 
        4  2346 1 1 30 GLN HG3  H   -6.687   6.011  -0.297 1.00 . A A .  30 GLN HG3  1 1 
        4  2347 1 1 30 GLN N    N   -3.955   5.594  -3.052 1.00 . A A .  30 GLN N    1 1 
        4  2348 1 1 30 GLN NE2  N   -5.566   7.685   1.370 1.00 . A A .  30 GLN NE2  1 1 
        4  2349 1 1 30 GLN O    O   -1.387   5.754  -0.647 1.00 . A A .  30 GLN O    1 1 
        4  2350 1 1 30 GLN OE1  O   -5.380   8.852  -0.539 1.00 . A A .  30 GLN OE1  1 1 
        4  2351 1 1 31 HIS C    C    0.209   3.545  -2.419 1.00 . A A .  31 HIS C    1 1 
        4  2352 1 1 31 HIS CA   C   -0.942   3.153  -1.497 1.00 . A A .  31 HIS CA   1 1 
        4  2353 1 1 31 HIS CB   C   -1.255   1.665  -1.658 1.00 . A A .  31 HIS CB   1 1 
        4  2354 1 1 31 HIS CD2  C    0.407   0.311  -3.119 1.00 . A A .  31 HIS CD2  1 1 
        4  2355 1 1 31 HIS CE1  C    1.801  -0.295  -1.539 1.00 . A A .  31 HIS CE1  1 1 
        4  2356 1 1 31 HIS CG   C   -0.049   0.827  -1.953 1.00 . A A .  31 HIS CG   1 1 
        4  2357 1 1 31 HIS H    H   -2.851   3.566  -2.313 1.00 . A A .  31 HIS H    1 1 
        4  2358 1 1 31 HIS HA   H   -0.648   3.341  -0.475 1.00 . A A .  31 HIS HA   1 1 
        4  2359 1 1 31 HIS HB2  H   -1.699   1.297  -0.745 1.00 . A A .  31 HIS HB2  1 1 
        4  2360 1 1 31 HIS HB3  H   -1.956   1.538  -2.471 1.00 . A A .  31 HIS HB3  1 1 
        4  2361 1 1 31 HIS HD1  H    0.790   0.645  -0.029 1.00 . A A .  31 HIS HD1  1 1 
        4  2362 1 1 31 HIS HD2  H   -0.049   0.424  -4.092 1.00 . A A .  31 HIS HD2  1 1 
        4  2363 1 1 31 HIS HE1  H    2.638  -0.741  -1.023 1.00 . A A .  31 HIS HE1  1 1 
        4  2364 1 1 31 HIS N    N   -2.128   3.954  -1.778 1.00 . A A .  31 HIS N    1 1 
        4  2365 1 1 31 HIS ND1  N    0.845   0.428  -0.983 1.00 . A A .  31 HIS ND1  1 1 
        4  2366 1 1 31 HIS NE2  N    1.557  -0.382  -2.834 1.00 . A A .  31 HIS NE2  1 1 
        4  2367 1 1 31 HIS O    O    1.330   3.775  -1.964 1.00 . A A .  31 HIS O    1 1 
        4  2368 1 1 32 TRP C    C    1.788   5.145  -4.202 1.00 . A A .  32 TRP C    1 1 
        4  2369 1 1 32 TRP CA   C    0.937   3.982  -4.699 1.00 . A A .  32 TRP CA   1 1 
        4  2370 1 1 32 TRP CB   C    0.275   4.349  -6.028 1.00 . A A .  32 TRP CB   1 1 
        4  2371 1 1 32 TRP CD1  C   -0.671   2.027  -6.558 1.00 . A A .  32 TRP CD1  1 1 
        4  2372 1 1 32 TRP CD2  C    0.401   2.997  -8.269 1.00 . A A .  32 TRP CD2  1 1 
        4  2373 1 1 32 TRP CE2  C   -0.067   1.736  -8.689 1.00 . A A .  32 TRP CE2  1 1 
        4  2374 1 1 32 TRP CE3  C    1.104   3.791  -9.179 1.00 . A A .  32 TRP CE3  1 1 
        4  2375 1 1 32 TRP CG   C    0.003   3.163  -6.904 1.00 . A A .  32 TRP CG   1 1 
        4  2376 1 1 32 TRP CH2  C    0.840   2.052 -10.847 1.00 . A A .  32 TRP CH2  1 1 
        4  2377 1 1 32 TRP CZ2  C    0.149   1.254  -9.977 1.00 . A A .  32 TRP CZ2  1 1 
        4  2378 1 1 32 TRP CZ3  C    1.317   3.311 -10.457 1.00 . A A .  32 TRP CZ3  1 1 
        4  2379 1 1 32 TRP H    H   -0.987   3.423  -4.015 1.00 . A A .  32 TRP H    1 1 
        4  2380 1 1 32 TRP HA   H    1.575   3.123  -4.850 1.00 . A A .  32 TRP HA   1 1 
        4  2381 1 1 32 TRP HB2  H   -0.665   4.841  -5.831 1.00 . A A .  32 TRP HB2  1 1 
        4  2382 1 1 32 TRP HB3  H    0.923   5.023  -6.570 1.00 . A A .  32 TRP HB3  1 1 
        4  2383 1 1 32 TRP HD1  H   -1.098   1.846  -5.584 1.00 . A A .  32 TRP HD1  1 1 
        4  2384 1 1 32 TRP HE1  H   -1.146   0.283  -7.628 1.00 . A A .  32 TRP HE1  1 1 
        4  2385 1 1 32 TRP HE3  H    1.480   4.764  -8.897 1.00 . A A .  32 TRP HE3  1 1 
        4  2386 1 1 32 TRP HH2  H    1.030   1.717 -11.855 1.00 . A A .  32 TRP HH2  1 1 
        4  2387 1 1 32 TRP HZ2  H   -0.213   0.286 -10.293 1.00 . A A .  32 TRP HZ2  1 1 
        4  2388 1 1 32 TRP HZ3  H    1.859   3.910 -11.173 1.00 . A A .  32 TRP HZ3  1 1 
        4  2389 1 1 32 TRP N    N   -0.075   3.618  -3.714 1.00 . A A .  32 TRP N    1 1 
        4  2390 1 1 32 TRP NE1  N   -0.716   1.164  -7.627 1.00 . A A .  32 TRP NE1  1 1 
        4  2391 1 1 32 TRP O    O    3.015   5.109  -4.288 1.00 . A A .  32 TRP O    1 1 
        4  2392 1 1 33 ILE C    C    3.099   6.952  -2.431 1.00 . A A .  33 ILE C    1 1 
        4  2393 1 1 33 ILE CA   C    1.825   7.348  -3.170 1.00 . A A .  33 ILE CA   1 1 
        4  2394 1 1 33 ILE CB   C    0.929   8.166  -2.222 1.00 . A A .  33 ILE CB   1 1 
        4  2395 1 1 33 ILE CD1  C   -1.348   9.291  -2.044 1.00 . A A .  33 ILE CD1  1 1 
        4  2396 1 1 33 ILE CG1  C   -0.333   8.630  -2.952 1.00 . A A .  33 ILE CG1  1 1 
        4  2397 1 1 33 ILE CG2  C    1.694   9.358  -1.666 1.00 . A A .  33 ILE CG2  1 1 
        4  2398 1 1 33 ILE H    H    0.150   6.145  -3.641 1.00 . A A .  33 ILE H    1 1 
        4  2399 1 1 33 ILE HA   H    2.089   7.972  -4.012 1.00 . A A .  33 ILE HA   1 1 
        4  2400 1 1 33 ILE HB   H    0.646   7.534  -1.394 1.00 . A A .  33 ILE HB   1 1 
        4  2401 1 1 33 ILE HD11 H   -2.345   9.060  -2.391 1.00 . A A .  33 ILE HD11 1 1 
        4  2402 1 1 33 ILE HD12 H   -1.224   8.922  -1.037 1.00 . A A .  33 ILE HD12 1 1 
        4  2403 1 1 33 ILE HD13 H   -1.201  10.360  -2.058 1.00 . A A .  33 ILE HD13 1 1 
        4  2404 1 1 33 ILE HG12 H   -0.060   9.341  -3.715 1.00 . A A .  33 ILE HG12 1 1 
        4  2405 1 1 33 ILE HG13 H   -0.807   7.776  -3.414 1.00 . A A .  33 ILE HG13 1 1 
        4  2406 1 1 33 ILE HG21 H    2.756   9.177  -1.754 1.00 . A A .  33 ILE HG21 1 1 
        4  2407 1 1 33 ILE HG22 H    1.435  10.244  -2.226 1.00 . A A .  33 ILE HG22 1 1 
        4  2408 1 1 33 ILE HG23 H    1.437   9.499  -0.628 1.00 . A A .  33 ILE HG23 1 1 
        4  2409 1 1 33 ILE N    N    1.128   6.175  -3.682 1.00 . A A .  33 ILE N    1 1 
        4  2410 1 1 33 ILE O    O    4.129   7.618  -2.544 1.00 . A A .  33 ILE O    1 1 
        4  2411 1 1 34 THR C    C    5.422   5.326  -1.788 1.00 . A A .  34 THR C    1 1 
        4  2412 1 1 34 THR CA   C    4.170   5.374  -0.919 1.00 . A A .  34 THR CA   1 1 
        4  2413 1 1 34 THR CB   C    3.907   3.971  -0.340 1.00 . A A .  34 THR CB   1 1 
        4  2414 1 1 34 THR CG2  C    2.732   3.996   0.626 1.00 . A A .  34 THR CG2  1 1 
        4  2415 1 1 34 THR H    H    2.175   5.372  -1.627 1.00 . A A .  34 THR H    1 1 
        4  2416 1 1 34 THR HA   H    4.340   6.054  -0.097 1.00 . A A .  34 THR HA   1 1 
        4  2417 1 1 34 THR HB   H    4.788   3.648   0.196 1.00 . A A .  34 THR HB   1 1 
        4  2418 1 1 34 THR HG1  H    4.341   2.391  -1.438 1.00 . A A .  34 THR HG1  1 1 
        4  2419 1 1 34 THR HG21 H    2.393   2.987   0.806 1.00 . A A .  34 THR HG21 1 1 
        4  2420 1 1 34 THR HG22 H    1.927   4.576   0.200 1.00 . A A .  34 THR HG22 1 1 
        4  2421 1 1 34 THR HG23 H    3.043   4.443   1.559 1.00 . A A .  34 THR HG23 1 1 
        4  2422 1 1 34 THR N    N    3.024   5.860  -1.676 1.00 . A A .  34 THR N    1 1 
        4  2423 1 1 34 THR O    O    6.499   5.747  -1.365 1.00 . A A .  34 THR O    1 1 
        4  2424 1 1 34 THR OG1  O    3.639   3.046  -1.400 1.00 . A A .  34 THR OG1  1 1 
        4  2425 1 1 35 HIS C    C    6.764   6.082  -4.489 1.00 . A A .  35 HIS C    1 1 
        4  2426 1 1 35 HIS CA   C    6.393   4.710  -3.933 1.00 . A A .  35 HIS CA   1 1 
        4  2427 1 1 35 HIS CB   C    6.047   3.759  -5.080 1.00 . A A .  35 HIS CB   1 1 
        4  2428 1 1 35 HIS CD2  C    4.237   1.909  -4.916 1.00 . A A .  35 HIS CD2  1 1 
        4  2429 1 1 35 HIS CE1  C    5.284   0.556  -3.544 1.00 . A A .  35 HIS CE1  1 1 
        4  2430 1 1 35 HIS CG   C    5.433   2.471  -4.625 1.00 . A A .  35 HIS CG   1 1 
        4  2431 1 1 35 HIS H    H    4.390   4.493  -3.284 1.00 . A A .  35 HIS H    1 1 
        4  2432 1 1 35 HIS HA   H    7.239   4.315  -3.392 1.00 . A A .  35 HIS HA   1 1 
        4  2433 1 1 35 HIS HB2  H    5.346   4.244  -5.742 1.00 . A A .  35 HIS HB2  1 1 
        4  2434 1 1 35 HIS HB3  H    6.949   3.523  -5.627 1.00 . A A .  35 HIS HB3  1 1 
        4  2435 1 1 35 HIS HD1  H    6.954   1.726  -3.371 1.00 . A A .  35 HIS HD1  1 1 
        4  2436 1 1 35 HIS HD2  H    3.476   2.320  -5.565 1.00 . A A .  35 HIS HD2  1 1 
        4  2437 1 1 35 HIS HE1  H    5.517  -0.287  -2.911 1.00 . A A .  35 HIS HE1  1 1 
        4  2438 1 1 35 HIS N    N    5.273   4.812  -3.004 1.00 . A A .  35 HIS N    1 1 
        4  2439 1 1 35 HIS ND1  N    6.065   1.599  -3.763 1.00 . A A .  35 HIS ND1  1 1 
        4  2440 1 1 35 HIS NE2  N    4.168   0.720  -4.232 1.00 . A A .  35 HIS NE2  1 1 
        4  2441 1 1 35 HIS O    O    7.933   6.361  -4.756 1.00 . A A .  35 HIS O    1 1 
        4  2442 1 1 36 THR C    C    6.846   9.103  -4.243 1.00 . A A .  36 THR C    1 1 
        4  2443 1 1 36 THR CA   C    5.980   8.277  -5.188 1.00 . A A .  36 THR CA   1 1 
        4  2444 1 1 36 THR CB   C    4.648   9.015  -5.422 1.00 . A A .  36 THR CB   1 1 
        4  2445 1 1 36 THR CG2  C    4.890  10.398  -6.006 1.00 . A A .  36 THR CG2  1 1 
        4  2446 1 1 36 THR H    H    4.850   6.655  -4.432 1.00 . A A .  36 THR H    1 1 
        4  2447 1 1 36 THR HA   H    6.487   8.185  -6.138 1.00 . A A .  36 THR HA   1 1 
        4  2448 1 1 36 THR HB   H    4.143   9.124  -4.473 1.00 . A A .  36 THR HB   1 1 
        4  2449 1 1 36 THR HG1  H    2.978   8.709  -6.426 1.00 . A A .  36 THR HG1  1 1 
        4  2450 1 1 36 THR HG21 H    4.337  11.130  -5.438 1.00 . A A .  36 THR HG21 1 1 
        4  2451 1 1 36 THR HG22 H    4.560  10.418  -7.035 1.00 . A A .  36 THR HG22 1 1 
        4  2452 1 1 36 THR HG23 H    5.944  10.628  -5.961 1.00 . A A .  36 THR HG23 1 1 
        4  2453 1 1 36 THR N    N    5.760   6.936  -4.663 1.00 . A A .  36 THR N    1 1 
        4  2454 1 1 36 THR O    O    7.936   9.541  -4.609 1.00 . A A .  36 THR O    1 1 
        4  2455 1 1 36 THR OG1  O    3.817   8.256  -6.308 1.00 . A A .  36 THR OG1  1 1 
        4  2456 1 1 37 ARG C    C    8.555   9.687  -2.002 1.00 . A A .  37 ARG C    1 1 
        4  2457 1 1 37 ARG CA   C    7.082  10.085  -2.029 1.00 . A A .  37 ARG CA   1 1 
        4  2458 1 1 37 ARG CB   C    6.463   9.885  -0.645 1.00 . A A .  37 ARG CB   1 1 
        4  2459 1 1 37 ARG CD   C    5.230  12.050  -0.313 1.00 . A A .  37 ARG CD   1 1 
        4  2460 1 1 37 ARG CG   C    5.103  10.545  -0.485 1.00 . A A .  37 ARG CG   1 1 
        4  2461 1 1 37 ARG CZ   C    3.828  14.057  -0.537 1.00 . A A .  37 ARG CZ   1 1 
        4  2462 1 1 37 ARG H    H    5.478   8.936  -2.794 1.00 . A A .  37 ARG H    1 1 
        4  2463 1 1 37 ARG HA   H    7.008  11.128  -2.300 1.00 . A A .  37 ARG HA   1 1 
        4  2464 1 1 37 ARG HB2  H    6.348   8.827  -0.464 1.00 . A A .  37 ARG HB2  1 1 
        4  2465 1 1 37 ARG HB3  H    7.129  10.299   0.097 1.00 . A A .  37 ARG HB3  1 1 
        4  2466 1 1 37 ARG HD2  H    5.576  12.257   0.689 1.00 . A A .  37 ARG HD2  1 1 
        4  2467 1 1 37 ARG HD3  H    5.951  12.420  -1.026 1.00 . A A .  37 ARG HD3  1 1 
        4  2468 1 1 37 ARG HE   H    3.162  12.181  -0.666 1.00 . A A .  37 ARG HE   1 1 
        4  2469 1 1 37 ARG HG2  H    4.509  10.343  -1.365 1.00 . A A .  37 ARG HG2  1 1 
        4  2470 1 1 37 ARG HG3  H    4.613  10.132   0.384 1.00 . A A .  37 ARG HG3  1 1 
        4  2471 1 1 37 ARG HH11 H    5.786  14.421  -0.200 1.00 . A A .  37 ARG HH11 1 1 
        4  2472 1 1 37 ARG HH12 H    4.786  15.828  -0.360 1.00 . A A .  37 ARG HH12 1 1 
        4  2473 1 1 37 ARG HH21 H    1.836  14.025  -0.878 1.00 . A A .  37 ARG HH21 1 1 
        4  2474 1 1 37 ARG HH22 H    2.539  15.601  -0.745 1.00 . A A .  37 ARG HH22 1 1 
        4  2475 1 1 37 ARG N    N    6.353   9.311  -3.027 1.00 . A A .  37 ARG N    1 1 
        4  2476 1 1 37 ARG NE   N    3.958  12.735  -0.526 1.00 . A A .  37 ARG NE   1 1 
        4  2477 1 1 37 ARG NH1  N    4.887  14.832  -0.350 1.00 . A A .  37 ARG NH1  1 1 
        4  2478 1 1 37 ARG NH2  N    2.636  14.606  -0.737 1.00 . A A .  37 ARG NH2  1 1 
        4  2479 1 1 37 ARG O    O    8.916   8.648  -1.451 1.00 . A A .  37 ARG O    1 1 
        4  2480 1 1 38 GLU C    C   11.312   9.638  -1.335 1.00 . A A .  38 GLU C    1 1 
        4  2481 1 1 38 GLU CA   C   10.832  10.254  -2.646 1.00 . A A .  38 GLU CA   1 1 
        4  2482 1 1 38 GLU CB   C   11.605  11.544  -2.929 1.00 . A A .  38 GLU CB   1 1 
        4  2483 1 1 38 GLU CD   C   13.867  10.428  -2.785 1.00 . A A .  38 GLU CD   1 1 
        4  2484 1 1 38 GLU CG   C   12.947  11.314  -3.603 1.00 . A A .  38 GLU CG   1 1 
        4  2485 1 1 38 GLU H    H    9.051  11.334  -3.023 1.00 . A A .  38 GLU H    1 1 
        4  2486 1 1 38 GLU HA   H   11.014   9.554  -3.447 1.00 . A A .  38 GLU HA   1 1 
        4  2487 1 1 38 GLU HB2  H   11.007  12.175  -3.569 1.00 . A A .  38 GLU HB2  1 1 
        4  2488 1 1 38 GLU HB3  H   11.779  12.057  -1.994 1.00 . A A .  38 GLU HB3  1 1 
        4  2489 1 1 38 GLU HG2  H   12.778  10.844  -4.561 1.00 . A A .  38 GLU HG2  1 1 
        4  2490 1 1 38 GLU HG3  H   13.429  12.269  -3.752 1.00 . A A .  38 GLU HG3  1 1 
        4  2491 1 1 38 GLU N    N    9.399  10.521  -2.601 1.00 . A A .  38 GLU N    1 1 
        4  2492 1 1 38 GLU O    O   11.311  10.291  -0.291 1.00 . A A .  38 GLU O    1 1 
        4  2493 1 1 38 GLU OE1  O   14.422  10.917  -1.780 1.00 . A A .  38 GLU OE1  1 1 
        4  2494 1 1 38 GLU OE2  O   14.031   9.245  -3.152 1.00 . A A .  38 GLU OE2  1 1 
        4  2495 1 1 39 LYS C    C   13.033   6.450  -0.614 1.00 . A A .  39 LYS C    1 1 
        4  2496 1 1 39 LYS CA   C   12.205   7.668  -0.217 1.00 . A A .  39 LYS CA   1 1 
        4  2497 1 1 39 LYS CB   C   11.029   7.234   0.661 1.00 . A A .  39 LYS CB   1 1 
        4  2498 1 1 39 LYS CD   C    9.884   7.678   2.852 1.00 . A A .  39 LYS CD   1 1 
        4  2499 1 1 39 LYS CE   C   10.865   7.337   3.963 1.00 . A A .  39 LYS CE   1 1 
        4  2500 1 1 39 LYS CG   C   10.589   8.294   1.656 1.00 . A A .  39 LYS CG   1 1 
        4  2501 1 1 39 LYS H    H   11.698   7.907  -2.258 1.00 . A A .  39 LYS H    1 1 
        4  2502 1 1 39 LYS HA   H   12.830   8.347   0.343 1.00 . A A .  39 LYS HA   1 1 
        4  2503 1 1 39 LYS HB2  H   10.189   6.997   0.025 1.00 . A A .  39 LYS HB2  1 1 
        4  2504 1 1 39 LYS HB3  H   11.313   6.349   1.212 1.00 . A A .  39 LYS HB3  1 1 
        4  2505 1 1 39 LYS HD2  H    9.157   8.380   3.232 1.00 . A A .  39 LYS HD2  1 1 
        4  2506 1 1 39 LYS HD3  H    9.382   6.773   2.537 1.00 . A A .  39 LYS HD3  1 1 
        4  2507 1 1 39 LYS HE2  H   11.685   8.039   3.929 1.00 . A A .  39 LYS HE2  1 1 
        4  2508 1 1 39 LYS HE3  H   10.358   7.423   4.912 1.00 . A A .  39 LYS HE3  1 1 
        4  2509 1 1 39 LYS HG2  H   11.458   8.833   2.002 1.00 . A A .  39 LYS HG2  1 1 
        4  2510 1 1 39 LYS HG3  H    9.912   8.978   1.163 1.00 . A A .  39 LYS HG3  1 1 
        4  2511 1 1 39 LYS HZ1  H   12.030   5.734   4.623 1.00 . A A .  39 LYS HZ1  1 1 
        4  2512 1 1 39 LYS HZ2  H   11.944   5.871   2.939 1.00 . A A .  39 LYS HZ2  1 1 
        4  2513 1 1 39 LYS HZ3  H   10.623   5.268   3.807 1.00 . A A .  39 LYS HZ3  1 1 
        4  2514 1 1 39 LYS N    N   11.721   8.375  -1.397 1.00 . A A .  39 LYS N    1 1 
        4  2515 1 1 39 LYS NZ   N   11.404   5.956   3.824 1.00 . A A .  39 LYS NZ   1 1 
        4  2516 1 1 39 LYS O    O   12.843   5.860  -1.677 1.00 . A A .  39 LYS O    1 1 
        4  2517 1 1 40 PRO C    C   14.096   3.587   0.098 1.00 . A A .  40 PRO C    1 1 
        4  2518 1 1 40 PRO CA   C   14.849   4.911   0.024 1.00 . A A .  40 PRO CA   1 1 
        4  2519 1 1 40 PRO CB   C   15.875   5.007   1.155 1.00 . A A .  40 PRO CB   1 1 
        4  2520 1 1 40 PRO CD   C   14.256   6.721   1.548 1.00 . A A .  40 PRO CD   1 1 
        4  2521 1 1 40 PRO CG   C   15.177   5.753   2.238 1.00 . A A .  40 PRO CG   1 1 
        4  2522 1 1 40 PRO HA   H   15.352   4.984  -0.929 1.00 . A A .  40 PRO HA   1 1 
        4  2523 1 1 40 PRO HB2  H   16.155   4.013   1.475 1.00 . A A .  40 PRO HB2  1 1 
        4  2524 1 1 40 PRO HB3  H   16.749   5.539   0.809 1.00 . A A .  40 PRO HB3  1 1 
        4  2525 1 1 40 PRO HD2  H   13.350   6.853   2.120 1.00 . A A .  40 PRO HD2  1 1 
        4  2526 1 1 40 PRO HD3  H   14.751   7.669   1.395 1.00 . A A .  40 PRO HD3  1 1 
        4  2527 1 1 40 PRO HG2  H   14.610   5.068   2.850 1.00 . A A .  40 PRO HG2  1 1 
        4  2528 1 1 40 PRO HG3  H   15.898   6.287   2.840 1.00 . A A .  40 PRO HG3  1 1 
        4  2529 1 1 40 PRO N    N   13.974   6.063   0.261 1.00 . A A .  40 PRO N    1 1 
        4  2530 1 1 40 PRO O    O   13.426   3.298   1.089 1.00 . A A .  40 PRO O    1 1 
        4  2531 1 1 41 SER C    C   14.552   0.357  -1.117 1.00 . A A .  41 SER C    1 1 
        4  2532 1 1 41 SER CA   C   13.538   1.493  -1.011 1.00 . A A .  41 SER CA   1 1 
        4  2533 1 1 41 SER CB   C   12.576   1.445  -2.199 1.00 . A A .  41 SER CB   1 1 
        4  2534 1 1 41 SER H    H   14.760   3.072  -1.716 1.00 . A A .  41 SER H    1 1 
        4  2535 1 1 41 SER HA   H   12.975   1.374  -0.098 1.00 . A A .  41 SER HA   1 1 
        4  2536 1 1 41 SER HB2  H   12.008   0.528  -2.163 1.00 . A A .  41 SER HB2  1 1 
        4  2537 1 1 41 SER HB3  H   11.902   2.289  -2.147 1.00 . A A .  41 SER HB3  1 1 
        4  2538 1 1 41 SER HG   H   14.010   2.117  -3.353 1.00 . A A .  41 SER HG   1 1 
        4  2539 1 1 41 SER N    N   14.211   2.786  -0.956 1.00 . A A .  41 SER N    1 1 
        4  2540 1 1 41 SER O    O   15.493   0.421  -1.907 1.00 . A A .  41 SER O    1 1 
        4  2541 1 1 41 SER OG   O   13.280   1.499  -3.428 1.00 . A A .  41 SER OG   1 1 
        4  2542 1 1 42 GLY C    C   15.424  -2.403  -1.719 1.00 . A A .  42 GLY C    1 1 
        4  2543 1 1 42 GLY CA   C   15.254  -1.819  -0.331 1.00 . A A .  42 GLY CA   1 1 
        4  2544 1 1 42 GLY H    H   13.584  -0.679   0.296 1.00 . A A .  42 GLY H    1 1 
        4  2545 1 1 42 GLY HA2  H   16.220  -1.503   0.036 1.00 . A A .  42 GLY HA2  1 1 
        4  2546 1 1 42 GLY HA3  H   14.864  -2.584   0.324 1.00 . A A .  42 GLY HA3  1 1 
        4  2547 1 1 42 GLY N    N   14.351  -0.683  -0.313 1.00 . A A .  42 GLY N    1 1 
        4  2548 1 1 42 GLY O    O   14.716  -2.041  -2.659 1.00 . A A .  42 GLY O    1 1 
        4  2549 1 1 43 PRO C    C   15.553  -4.932  -3.569 1.00 . A A .  43 PRO C    1 1 
        4  2550 1 1 43 PRO CA   C   16.668  -3.983  -3.144 1.00 . A A .  43 PRO CA   1 1 
        4  2551 1 1 43 PRO CB   C   17.957  -4.761  -2.866 1.00 . A A .  43 PRO CB   1 1 
        4  2552 1 1 43 PRO CD   C   17.266  -3.808  -0.786 1.00 . A A .  43 PRO CD   1 1 
        4  2553 1 1 43 PRO CG   C   17.944  -5.003  -1.396 1.00 . A A .  43 PRO CG   1 1 
        4  2554 1 1 43 PRO HA   H   16.844  -3.261  -3.928 1.00 . A A .  43 PRO HA   1 1 
        4  2555 1 1 43 PRO HB2  H   17.946  -5.689  -3.420 1.00 . A A .  43 PRO HB2  1 1 
        4  2556 1 1 43 PRO HB3  H   18.810  -4.169  -3.161 1.00 . A A .  43 PRO HB3  1 1 
        4  2557 1 1 43 PRO HD2  H   16.693  -4.101   0.081 1.00 . A A .  43 PRO HD2  1 1 
        4  2558 1 1 43 PRO HD3  H   17.995  -3.055  -0.521 1.00 . A A .  43 PRO HD3  1 1 
        4  2559 1 1 43 PRO HG2  H   17.388  -5.902  -1.177 1.00 . A A .  43 PRO HG2  1 1 
        4  2560 1 1 43 PRO HG3  H   18.957  -5.087  -1.030 1.00 . A A .  43 PRO HG3  1 1 
        4  2561 1 1 43 PRO N    N   16.384  -3.328  -1.863 1.00 . A A .  43 PRO N    1 1 
        4  2562 1 1 43 PRO O    O   15.369  -5.994  -2.976 1.00 . A A .  43 PRO O    1 1 
        4  2563 1 1 44 SER C    C   13.280  -4.890  -6.491 1.00 . A A .  44 SER C    1 1 
        4  2564 1 1 44 SER CA   C   13.713  -5.357  -5.105 1.00 . A A .  44 SER CA   1 1 
        4  2565 1 1 44 SER CB   C   12.526  -5.301  -4.141 1.00 . A A .  44 SER CB   1 1 
        4  2566 1 1 44 SER H    H   15.008  -3.684  -5.033 1.00 . A A .  44 SER H    1 1 
        4  2567 1 1 44 SER HA   H   14.061  -6.377  -5.174 1.00 . A A .  44 SER HA   1 1 
        4  2568 1 1 44 SER HB2  H   12.891  -5.218  -3.129 1.00 . A A .  44 SER HB2  1 1 
        4  2569 1 1 44 SER HB3  H   11.916  -4.440  -4.376 1.00 . A A .  44 SER HB3  1 1 
        4  2570 1 1 44 SER HG   H   11.734  -6.935  -3.407 1.00 . A A .  44 SER HG   1 1 
        4  2571 1 1 44 SER N    N   14.812  -4.542  -4.602 1.00 . A A .  44 SER N    1 1 
        4  2572 1 1 44 SER O    O   12.980  -3.714  -6.696 1.00 . A A .  44 SER O    1 1 
        4  2573 1 1 44 SER OG   O   11.728  -6.467  -4.246 1.00 . A A .  44 SER OG   1 1 
        4  2574 1 1 45 SER C    C   12.188  -6.703  -9.472 1.00 . A A .  45 SER C    1 1 
        4  2575 1 1 45 SER CA   C   12.860  -5.505  -8.809 1.00 . A A .  45 SER CA   1 1 
        4  2576 1 1 45 SER CB   C   14.080  -5.074  -9.624 1.00 . A A .  45 SER CB   1 1 
        4  2577 1 1 45 SER H    H   13.503  -6.741  -7.214 1.00 . A A .  45 SER H    1 1 
        4  2578 1 1 45 SER HA   H   12.156  -4.687  -8.771 1.00 . A A .  45 SER HA   1 1 
        4  2579 1 1 45 SER HB2  H   14.908  -5.731  -9.404 1.00 . A A .  45 SER HB2  1 1 
        4  2580 1 1 45 SER HB3  H   13.845  -5.132 -10.677 1.00 . A A .  45 SER HB3  1 1 
        4  2581 1 1 45 SER HG   H   14.331  -3.186 -10.084 1.00 . A A .  45 SER HG   1 1 
        4  2582 1 1 45 SER N    N   13.252  -5.820  -7.440 1.00 . A A .  45 SER N    1 1 
        4  2583 1 1 45 SER O    O   12.331  -7.838  -9.019 1.00 . A A .  45 SER O    1 1 
        4  2584 1 1 45 SER OG   O   14.458  -3.744  -9.313 1.00 . A A .  45 SER OG   1 1 
        4  2585 1 1 46 GLY C    C    9.358  -7.727 -10.753 1.00 . A A .  46 GLY C    1 1 
        4  2586 1 1 46 GLY CA   C   10.770  -7.507 -11.258 1.00 . A A .  46 GLY CA   1 1 
        4  2587 1 1 46 GLY H    H   11.376  -5.517 -10.865 1.00 . A A .  46 GLY H    1 1 
        4  2588 1 1 46 GLY HA2  H   10.732  -7.259 -12.308 1.00 . A A .  46 GLY HA2  1 1 
        4  2589 1 1 46 GLY HA3  H   11.331  -8.423 -11.135 1.00 . A A .  46 GLY HA3  1 1 
        4  2590 1 1 46 GLY N    N   11.454  -6.441 -10.549 1.00 . A A .  46 GLY N    1 1 
        4  2591 1 1 46 GLY O    O    9.108  -8.734 -10.092 1.00 . A A .  46 GLY O    1 1 
        4  2592 2 2  1 ZN  ZN   ZN   2.921  -0.831  -4.214 1.00 . B A . 181 ZN  ZN   1 1 
        5  2593 1 1  1 GLY C    C   -6.390 -35.613 -17.355 1.00 . A A .   1 GLY C    1 1 
        5  2594 1 1  1 GLY CA   C   -5.911 -36.635 -18.367 1.00 . A A .   1 GLY CA   1 1 
        5  2595 1 1  1 GLY H1   H   -7.916 -37.226 -18.705 1.00 . A A .   1 GLY H1   1 1 
        5  2596 1 1  1 GLY HA2  H   -5.334 -37.390 -17.855 1.00 . A A .   1 GLY HA2  1 1 
        5  2597 1 1  1 GLY HA3  H   -5.278 -36.140 -19.088 1.00 . A A .   1 GLY HA3  1 1 
        5  2598 1 1  1 GLY N    N   -7.007 -37.277 -19.068 1.00 . A A .   1 GLY N    1 1 
        5  2599 1 1  1 GLY O    O   -7.593 -35.400 -17.199 1.00 . A A .   1 GLY O    1 1 
        5  2600 1 1  2 SER C    C   -6.019 -32.617 -16.304 1.00 . A A .   2 SER C    1 1 
        5  2601 1 1  2 SER CA   C   -5.780 -33.978 -15.657 1.00 . A A .   2 SER CA   1 1 
        5  2602 1 1  2 SER CB   C   -4.659 -33.874 -14.622 1.00 . A A .   2 SER CB   1 1 
        5  2603 1 1  2 SER H    H   -4.506 -35.193 -16.834 1.00 . A A .   2 SER H    1 1 
        5  2604 1 1  2 SER HA   H   -6.687 -34.293 -15.163 1.00 . A A .   2 SER HA   1 1 
        5  2605 1 1  2 SER HB2  H   -3.704 -33.928 -15.122 1.00 . A A .   2 SER HB2  1 1 
        5  2606 1 1  2 SER HB3  H   -4.740 -32.930 -14.101 1.00 . A A .   2 SER HB3  1 1 
        5  2607 1 1  2 SER HG   H   -4.684 -34.563 -12.788 1.00 . A A .   2 SER HG   1 1 
        5  2608 1 1  2 SER N    N   -5.448 -34.979 -16.664 1.00 . A A .   2 SER N    1 1 
        5  2609 1 1  2 SER O    O   -5.297 -32.215 -17.216 1.00 . A A .   2 SER O    1 1 
        5  2610 1 1  2 SER OG   O   -4.739 -34.926 -13.676 1.00 . A A .   2 SER OG   1 1 
        5  2611 1 1  3 SER C    C   -8.227 -29.811 -15.362 1.00 . A A .   3 SER C    1 1 
        5  2612 1 1  3 SER CA   C   -7.377 -30.597 -16.356 1.00 . A A .   3 SER CA   1 1 
        5  2613 1 1  3 SER CB   C   -8.124 -30.738 -17.683 1.00 . A A .   3 SER CB   1 1 
        5  2614 1 1  3 SER H    H   -7.578 -32.287 -15.095 1.00 . A A .   3 SER H    1 1 
        5  2615 1 1  3 SER HA   H   -6.455 -30.062 -16.526 1.00 . A A .   3 SER HA   1 1 
        5  2616 1 1  3 SER HB2  H   -8.886 -31.497 -17.586 1.00 . A A .   3 SER HB2  1 1 
        5  2617 1 1  3 SER HB3  H   -8.586 -29.794 -17.935 1.00 . A A .   3 SER HB3  1 1 
        5  2618 1 1  3 SER HG   H   -6.374 -30.732 -18.563 1.00 . A A .   3 SER HG   1 1 
        5  2619 1 1  3 SER N    N   -7.039 -31.912 -15.823 1.00 . A A .   3 SER N    1 1 
        5  2620 1 1  3 SER O    O   -8.761 -30.371 -14.405 1.00 . A A .   3 SER O    1 1 
        5  2621 1 1  3 SER OG   O   -7.242 -31.108 -18.729 1.00 . A A .   3 SER OG   1 1 
        5  2622 1 1  4 GLY C    C   -8.433 -26.360 -14.386 1.00 . A A .   4 GLY C    1 1 
        5  2623 1 1  4 GLY CA   C   -9.132 -27.664 -14.714 1.00 . A A .   4 GLY CA   1 1 
        5  2624 1 1  4 GLY H    H   -7.898 -28.116 -16.375 1.00 . A A .   4 GLY H    1 1 
        5  2625 1 1  4 GLY HA2  H  -10.076 -27.445 -15.190 1.00 . A A .   4 GLY HA2  1 1 
        5  2626 1 1  4 GLY HA3  H   -9.319 -28.200 -13.796 1.00 . A A .   4 GLY HA3  1 1 
        5  2627 1 1  4 GLY N    N   -8.347 -28.508 -15.597 1.00 . A A .   4 GLY N    1 1 
        5  2628 1 1  4 GLY O    O   -7.251 -26.351 -14.041 1.00 . A A .   4 GLY O    1 1 
        5  2629 1 1  5 SER C    C   -8.301 -23.785 -12.723 1.00 . A A .   5 SER C    1 1 
        5  2630 1 1  5 SER CA   C   -8.605 -23.938 -14.211 1.00 . A A .   5 SER CA   1 1 
        5  2631 1 1  5 SER CB   C   -9.573 -22.842 -14.660 1.00 . A A .   5 SER CB   1 1 
        5  2632 1 1  5 SER H    H  -10.100 -25.327 -14.773 1.00 . A A .   5 SER H    1 1 
        5  2633 1 1  5 SER HA   H   -7.684 -23.843 -14.766 1.00 . A A .   5 SER HA   1 1 
        5  2634 1 1  5 SER HB2  H   -9.583 -22.795 -15.738 1.00 . A A .   5 SER HB2  1 1 
        5  2635 1 1  5 SER HB3  H  -10.565 -23.073 -14.300 1.00 . A A .   5 SER HB3  1 1 
        5  2636 1 1  5 SER HG   H   -9.823 -20.914 -14.421 1.00 . A A .   5 SER HG   1 1 
        5  2637 1 1  5 SER N    N   -9.164 -25.255 -14.494 1.00 . A A .   5 SER N    1 1 
        5  2638 1 1  5 SER O    O   -9.051 -24.265 -11.873 1.00 . A A .   5 SER O    1 1 
        5  2639 1 1  5 SER OG   O   -9.185 -21.578 -14.151 1.00 . A A .   5 SER OG   1 1 
        5  2640 1 1  6 SER C    C   -7.946 -22.344 -10.207 1.00 . A A .   6 SER C    1 1 
        5  2641 1 1  6 SER CA   C   -6.790 -22.900 -11.033 1.00 . A A .   6 SER CA   1 1 
        5  2642 1 1  6 SER CB   C   -5.597 -21.943 -10.971 1.00 . A A .   6 SER CB   1 1 
        5  2643 1 1  6 SER H    H   -6.639 -22.755 -13.140 1.00 . A A .   6 SER H    1 1 
        5  2644 1 1  6 SER HA   H   -6.496 -23.855 -10.623 1.00 . A A .   6 SER HA   1 1 
        5  2645 1 1  6 SER HB2  H   -4.940 -22.136 -11.806 1.00 . A A .   6 SER HB2  1 1 
        5  2646 1 1  6 SER HB3  H   -5.954 -20.925 -11.022 1.00 . A A .   6 SER HB3  1 1 
        5  2647 1 1  6 SER HG   H   -4.185 -22.776  -9.898 1.00 . A A .   6 SER HG   1 1 
        5  2648 1 1  6 SER N    N   -7.196 -23.114 -12.417 1.00 . A A .   6 SER N    1 1 
        5  2649 1 1  6 SER O    O   -8.282 -22.878  -9.152 1.00 . A A .   6 SER O    1 1 
        5  2650 1 1  6 SER OG   O   -4.869 -22.114  -9.768 1.00 . A A .   6 SER OG   1 1 
        5  2651 1 1  7 GLY C    C   -9.626 -19.140 -10.058 1.00 . A A .   7 GLY C    1 1 
        5  2652 1 1  7 GLY CA   C   -9.661 -20.654  -9.993 1.00 . A A .   7 GLY CA   1 1 
        5  2653 1 1  7 GLY H    H   -8.238 -20.882 -11.544 1.00 . A A .   7 GLY H    1 1 
        5  2654 1 1  7 GLY HA2  H  -10.586 -21.001 -10.430 1.00 . A A .   7 GLY HA2  1 1 
        5  2655 1 1  7 GLY HA3  H   -9.628 -20.959  -8.957 1.00 . A A .   7 GLY HA3  1 1 
        5  2656 1 1  7 GLY N    N   -8.550 -21.265 -10.697 1.00 . A A .   7 GLY N    1 1 
        5  2657 1 1  7 GLY O    O  -10.644 -18.500 -10.321 1.00 . A A .   7 GLY O    1 1 
        5  2658 1 1  8 GLU C    C   -7.086 -16.721 -10.696 1.00 . A A .   8 GLU C    1 1 
        5  2659 1 1  8 GLU CA   C   -8.290 -17.117  -9.845 1.00 . A A .   8 GLU CA   1 1 
        5  2660 1 1  8 GLU CB   C   -8.126 -16.570  -8.426 1.00 . A A .   8 GLU CB   1 1 
        5  2661 1 1  8 GLU CD   C   -6.678 -16.418  -6.361 1.00 . A A .   8 GLU CD   1 1 
        5  2662 1 1  8 GLU CG   C   -6.811 -16.958  -7.772 1.00 . A A .   8 GLU CG   1 1 
        5  2663 1 1  8 GLU H    H   -7.677 -19.129  -9.611 1.00 . A A .   8 GLU H    1 1 
        5  2664 1 1  8 GLU HA   H   -9.180 -16.692 -10.284 1.00 . A A .   8 GLU HA   1 1 
        5  2665 1 1  8 GLU HB2  H   -8.184 -15.492  -8.459 1.00 . A A .   8 GLU HB2  1 1 
        5  2666 1 1  8 GLU HB3  H   -8.933 -16.946  -7.813 1.00 . A A .   8 GLU HB3  1 1 
        5  2667 1 1  8 GLU HG2  H   -6.746 -18.035  -7.735 1.00 . A A .   8 GLU HG2  1 1 
        5  2668 1 1  8 GLU HG3  H   -5.998 -16.570  -8.368 1.00 . A A .   8 GLU HG3  1 1 
        5  2669 1 1  8 GLU N    N   -8.452 -18.566  -9.815 1.00 . A A .   8 GLU N    1 1 
        5  2670 1 1  8 GLU O    O   -6.040 -17.367 -10.649 1.00 . A A .   8 GLU O    1 1 
        5  2671 1 1  8 GLU OE1  O   -7.641 -16.559  -5.578 1.00 . A A .   8 GLU OE1  1 1 
        5  2672 1 1  8 GLU OE2  O   -5.611 -15.853  -6.041 1.00 . A A .   8 GLU OE2  1 1 
        5  2673 1 1  9 GLY C    C   -5.627 -13.840 -11.897 1.00 . A A .   9 GLY C    1 1 
        5  2674 1 1  9 GLY CA   C   -6.164 -15.192 -12.326 1.00 . A A .   9 GLY CA   1 1 
        5  2675 1 1  9 GLY H    H   -8.101 -15.179 -11.471 1.00 . A A .   9 GLY H    1 1 
        5  2676 1 1  9 GLY HA2  H   -5.361 -15.913 -12.295 1.00 . A A .   9 GLY HA2  1 1 
        5  2677 1 1  9 GLY HA3  H   -6.527 -15.116 -13.340 1.00 . A A .   9 GLY HA3  1 1 
        5  2678 1 1  9 GLY N    N   -7.244 -15.655 -11.475 1.00 . A A .   9 GLY N    1 1 
        5  2679 1 1  9 GLY O    O   -5.185 -13.674 -10.761 1.00 . A A .   9 GLY O    1 1 
        5  2680 1 1 10 GLU C    C   -6.318 -10.617 -12.091 1.00 . A A .  10 GLU C    1 1 
        5  2681 1 1 10 GLU CA   C   -5.174 -11.532 -12.520 1.00 . A A .  10 GLU CA   1 1 
        5  2682 1 1 10 GLU CB   C   -4.470 -10.946 -13.745 1.00 . A A .  10 GLU CB   1 1 
        5  2683 1 1 10 GLU CD   C   -4.779  -9.954 -16.048 1.00 . A A .  10 GLU CD   1 1 
        5  2684 1 1 10 GLU CG   C   -5.362 -10.849 -14.971 1.00 . A A .  10 GLU CG   1 1 
        5  2685 1 1 10 GLU H    H   -6.028 -13.069 -13.698 1.00 . A A .  10 GLU H    1 1 
        5  2686 1 1 10 GLU HA   H   -4.465 -11.605 -11.709 1.00 . A A .  10 GLU HA   1 1 
        5  2687 1 1 10 GLU HB2  H   -4.116  -9.954 -13.503 1.00 . A A .  10 GLU HB2  1 1 
        5  2688 1 1 10 GLU HB3  H   -3.623 -11.570 -13.991 1.00 . A A .  10 GLU HB3  1 1 
        5  2689 1 1 10 GLU HG2  H   -5.497 -11.838 -15.382 1.00 . A A .  10 GLU HG2  1 1 
        5  2690 1 1 10 GLU HG3  H   -6.320 -10.450 -14.673 1.00 . A A .  10 GLU HG3  1 1 
        5  2691 1 1 10 GLU N    N   -5.664 -12.874 -12.810 1.00 . A A .  10 GLU N    1 1 
        5  2692 1 1 10 GLU O    O   -7.486 -10.895 -12.362 1.00 . A A .  10 GLU O    1 1 
        5  2693 1 1 10 GLU OE1  O   -4.268  -8.867 -15.704 1.00 . A A .  10 GLU OE1  1 1 
        5  2694 1 1 10 GLU OE2  O   -4.833 -10.341 -17.234 1.00 . A A .  10 GLU OE2  1 1 
        5  2695 1 1 11 LYS C    C   -6.858  -7.251 -11.717 1.00 . A A .  11 LYS C    1 1 
        5  2696 1 1 11 LYS CA   C   -6.967  -8.566 -10.952 1.00 . A A .  11 LYS CA   1 1 
        5  2697 1 1 11 LYS CB   C   -6.796  -8.311  -9.452 1.00 . A A .  11 LYS CB   1 1 
        5  2698 1 1 11 LYS CD   C   -5.883 -10.459  -8.523 1.00 . A A .  11 LYS CD   1 1 
        5  2699 1 1 11 LYS CE   C   -6.174 -11.682  -7.668 1.00 . A A .  11 LYS CE   1 1 
        5  2700 1 1 11 LYS CG   C   -7.083  -9.529  -8.592 1.00 . A A .  11 LYS CG   1 1 
        5  2701 1 1 11 LYS H    H   -5.024  -9.356 -11.233 1.00 . A A .  11 LYS H    1 1 
        5  2702 1 1 11 LYS HA   H   -7.944  -8.990 -11.127 1.00 . A A .  11 LYS HA   1 1 
        5  2703 1 1 11 LYS HB2  H   -5.780  -7.996  -9.267 1.00 . A A .  11 LYS HB2  1 1 
        5  2704 1 1 11 LYS HB3  H   -7.469  -7.519  -9.155 1.00 . A A .  11 LYS HB3  1 1 
        5  2705 1 1 11 LYS HD2  H   -5.633 -10.784  -9.522 1.00 . A A .  11 LYS HD2  1 1 
        5  2706 1 1 11 LYS HD3  H   -5.047  -9.923  -8.097 1.00 . A A .  11 LYS HD3  1 1 
        5  2707 1 1 11 LYS HE2  H   -5.239 -12.097  -7.326 1.00 . A A .  11 LYS HE2  1 1 
        5  2708 1 1 11 LYS HE3  H   -6.765 -11.378  -6.817 1.00 . A A .  11 LYS HE3  1 1 
        5  2709 1 1 11 LYS HG2  H   -7.329  -9.203  -7.592 1.00 . A A .  11 LYS HG2  1 1 
        5  2710 1 1 11 LYS HG3  H   -7.920 -10.067  -9.013 1.00 . A A .  11 LYS HG3  1 1 
        5  2711 1 1 11 LYS HZ1  H   -6.873 -13.635  -7.924 1.00 . A A .  11 LYS HZ1  1 1 
        5  2712 1 1 11 LYS HZ2  H   -6.504 -12.843  -9.373 1.00 . A A .  11 LYS HZ2  1 1 
        5  2713 1 1 11 LYS HZ3  H   -7.916 -12.448  -8.530 1.00 . A A .  11 LYS HZ3  1 1 
        5  2714 1 1 11 LYS N    N   -5.972  -9.524 -11.419 1.00 . A A .  11 LYS N    1 1 
        5  2715 1 1 11 LYS NZ   N   -6.919 -12.725  -8.426 1.00 . A A .  11 LYS NZ   1 1 
        5  2716 1 1 11 LYS O    O   -5.769  -6.801 -12.074 1.00 . A A .  11 LYS O    1 1 
        5  2717 1 1 12 PRO C    C   -7.506  -4.187 -11.883 1.00 . A A .  12 PRO C    1 1 
        5  2718 1 1 12 PRO CA   C   -8.072  -5.344 -12.699 1.00 . A A .  12 PRO CA   1 1 
        5  2719 1 1 12 PRO CB   C   -9.570  -5.144 -12.942 1.00 . A A .  12 PRO CB   1 1 
        5  2720 1 1 12 PRO CD   C   -9.348  -7.096 -11.579 1.00 . A A .  12 PRO CD   1 1 
        5  2721 1 1 12 PRO CG   C  -10.236  -5.914 -11.855 1.00 . A A .  12 PRO CG   1 1 
        5  2722 1 1 12 PRO HA   H   -7.556  -5.402 -13.646 1.00 . A A .  12 PRO HA   1 1 
        5  2723 1 1 12 PRO HB2  H   -9.809  -4.092 -12.886 1.00 . A A .  12 PRO HB2  1 1 
        5  2724 1 1 12 PRO HB3  H   -9.834  -5.527 -13.916 1.00 . A A .  12 PRO HB3  1 1 
        5  2725 1 1 12 PRO HD2  H   -9.371  -7.349 -10.530 1.00 . A A .  12 PRO HD2  1 1 
        5  2726 1 1 12 PRO HD3  H   -9.647  -7.942 -12.181 1.00 . A A .  12 PRO HD3  1 1 
        5  2727 1 1 12 PRO HG2  H  -10.327  -5.300 -10.972 1.00 . A A .  12 PRO HG2  1 1 
        5  2728 1 1 12 PRO HG3  H  -11.210  -6.247 -12.184 1.00 . A A .  12 PRO HG3  1 1 
        5  2729 1 1 12 PRO N    N   -8.012  -6.618 -11.975 1.00 . A A .  12 PRO N    1 1 
        5  2730 1 1 12 PRO O    O   -7.154  -3.142 -12.431 1.00 . A A .  12 PRO O    1 1 
        5  2731 1 1 13 TYR C    C   -5.756  -3.896  -8.828 1.00 . A A .  13 TYR C    1 1 
        5  2732 1 1 13 TYR CA   C   -6.898  -3.351  -9.680 1.00 . A A .  13 TYR CA   1 1 
        5  2733 1 1 13 TYR CB   C   -8.011  -2.815  -8.778 1.00 . A A .  13 TYR CB   1 1 
        5  2734 1 1 13 TYR CD1  C   -9.719  -2.455 -10.603 1.00 . A A .  13 TYR CD1  1 1 
        5  2735 1 1 13 TYR CD2  C   -9.280  -0.656  -9.102 1.00 . A A .  13 TYR CD2  1 1 
        5  2736 1 1 13 TYR CE1  C  -10.643  -1.677 -11.273 1.00 . A A .  13 TYR CE1  1 1 
        5  2737 1 1 13 TYR CE2  C  -10.203   0.129  -9.765 1.00 . A A .  13 TYR CE2  1 1 
        5  2738 1 1 13 TYR CG   C   -9.022  -1.960  -9.508 1.00 . A A .  13 TYR CG   1 1 
        5  2739 1 1 13 TYR CZ   C  -10.882  -0.386 -10.850 1.00 . A A .  13 TYR CZ   1 1 
        5  2740 1 1 13 TYR H    H   -7.716  -5.234 -10.193 1.00 . A A .  13 TYR H    1 1 
        5  2741 1 1 13 TYR HA   H   -6.522  -2.543 -10.291 1.00 . A A .  13 TYR HA   1 1 
        5  2742 1 1 13 TYR HB2  H   -8.538  -3.646  -8.336 1.00 . A A .  13 TYR HB2  1 1 
        5  2743 1 1 13 TYR HB3  H   -7.572  -2.215  -7.994 1.00 . A A .  13 TYR HB3  1 1 
        5  2744 1 1 13 TYR HD1  H   -9.530  -3.467 -10.932 1.00 . A A .  13 TYR HD1  1 1 
        5  2745 1 1 13 TYR HD2  H   -8.746  -0.256  -8.253 1.00 . A A .  13 TYR HD2  1 1 
        5  2746 1 1 13 TYR HE1  H  -11.176  -2.080 -12.122 1.00 . A A .  13 TYR HE1  1 1 
        5  2747 1 1 13 TYR HE2  H  -10.390   1.140  -9.435 1.00 . A A .  13 TYR HE2  1 1 
        5  2748 1 1 13 TYR HH   H  -11.655   0.325 -12.460 1.00 . A A .  13 TYR HH   1 1 
        5  2749 1 1 13 TYR N    N   -7.420  -4.380 -10.572 1.00 . A A .  13 TYR N    1 1 
        5  2750 1 1 13 TYR O    O   -5.941  -4.216  -7.655 1.00 . A A .  13 TYR O    1 1 
        5  2751 1 1 13 TYR OH   O  -11.802   0.393 -11.514 1.00 . A A .  13 TYR OH   1 1 
        5  2752 1 1 14 GLN C    C   -2.161  -3.694  -9.082 1.00 . A A .  14 GLN C    1 1 
        5  2753 1 1 14 GLN CA   C   -3.402  -4.505  -8.726 1.00 . A A .  14 GLN CA   1 1 
        5  2754 1 1 14 GLN CB   C   -3.176  -5.980  -9.065 1.00 . A A .  14 GLN CB   1 1 
        5  2755 1 1 14 GLN CD   C   -1.610  -7.961  -8.972 1.00 . A A .  14 GLN CD   1 1 
        5  2756 1 1 14 GLN CG   C   -1.862  -6.531  -8.534 1.00 . A A .  14 GLN CG   1 1 
        5  2757 1 1 14 GLN H    H   -4.490  -3.728 -10.367 1.00 . A A .  14 GLN H    1 1 
        5  2758 1 1 14 GLN HA   H   -3.585  -4.413  -7.667 1.00 . A A .  14 GLN HA   1 1 
        5  2759 1 1 14 GLN HB2  H   -3.982  -6.562  -8.643 1.00 . A A .  14 GLN HB2  1 1 
        5  2760 1 1 14 GLN HB3  H   -3.182  -6.096 -10.139 1.00 . A A .  14 GLN HB3  1 1 
        5  2761 1 1 14 GLN HE21 H   -0.410  -7.330 -10.427 1.00 . A A .  14 GLN HE21 1 1 
        5  2762 1 1 14 GLN HE22 H   -0.616  -9.041 -10.313 1.00 . A A .  14 GLN HE22 1 1 
        5  2763 1 1 14 GLN HG2  H   -1.054  -5.913  -8.897 1.00 . A A .  14 GLN HG2  1 1 
        5  2764 1 1 14 GLN HG3  H   -1.883  -6.499  -7.455 1.00 . A A .  14 GLN HG3  1 1 
        5  2765 1 1 14 GLN N    N   -4.575  -3.999  -9.429 1.00 . A A .  14 GLN N    1 1 
        5  2766 1 1 14 GLN NE2  N   -0.797  -8.128 -10.009 1.00 . A A .  14 GLN NE2  1 1 
        5  2767 1 1 14 GLN O    O   -1.837  -3.519 -10.258 1.00 . A A .  14 GLN O    1 1 
        5  2768 1 1 14 GLN OE1  O   -2.140  -8.905  -8.385 1.00 . A A .  14 GLN OE1  1 1 
        5  2769 1 1 15 CYS C    C    0.778  -3.191  -9.055 1.00 . A A .  15 CYS C    1 1 
        5  2770 1 1 15 CYS CA   C   -0.265  -2.405  -8.265 1.00 . A A .  15 CYS CA   1 1 
        5  2771 1 1 15 CYS CB   C    0.320  -1.971  -6.919 1.00 . A A .  15 CYS CB   1 1 
        5  2772 1 1 15 CYS H    H   -1.778  -3.373  -7.146 1.00 . A A .  15 CYS H    1 1 
        5  2773 1 1 15 CYS HA   H   -0.538  -1.526  -8.829 1.00 . A A .  15 CYS HA   1 1 
        5  2774 1 1 15 CYS HB2  H   -0.433  -1.428  -6.367 1.00 . A A .  15 CYS HB2  1 1 
        5  2775 1 1 15 CYS HB3  H    0.605  -2.850  -6.359 1.00 . A A .  15 CYS HB3  1 1 
        5  2776 1 1 15 CYS N    N   -1.470  -3.199  -8.061 1.00 . A A .  15 CYS N    1 1 
        5  2777 1 1 15 CYS O    O    0.752  -4.422  -9.083 1.00 . A A .  15 CYS O    1 1 
        5  2778 1 1 15 CYS SG   S    1.786  -0.899  -7.056 1.00 . A A .  15 CYS SG   1 1 
        5  2779 1 1 16 SER C    C    4.112  -2.878  -9.853 1.00 . A A .  16 SER C    1 1 
        5  2780 1 1 16 SER CA   C    2.743  -3.101 -10.488 1.00 . A A .  16 SER CA   1 1 
        5  2781 1 1 16 SER CB   C    2.734  -2.549 -11.915 1.00 . A A .  16 SER CB   1 1 
        5  2782 1 1 16 SER H    H    1.662  -1.494  -9.634 1.00 . A A .  16 SER H    1 1 
        5  2783 1 1 16 SER HA   H    2.543  -4.162 -10.520 1.00 . A A .  16 SER HA   1 1 
        5  2784 1 1 16 SER HB2  H    1.743  -2.647 -12.329 1.00 . A A .  16 SER HB2  1 1 
        5  2785 1 1 16 SER HB3  H    3.015  -1.506 -11.896 1.00 . A A .  16 SER HB3  1 1 
        5  2786 1 1 16 SER HG   H    3.249  -4.079 -13.024 1.00 . A A .  16 SER HG   1 1 
        5  2787 1 1 16 SER N    N    1.694  -2.472  -9.695 1.00 . A A .  16 SER N    1 1 
        5  2788 1 1 16 SER O    O    4.943  -3.785  -9.809 1.00 . A A .  16 SER O    1 1 
        5  2789 1 1 16 SER OG   O    3.646  -3.253 -12.740 1.00 . A A .  16 SER OG   1 1 
        5  2790 1 1 17 GLU C    C    6.059  -2.426  -7.781 1.00 . A A .  17 GLU C    1 1 
        5  2791 1 1 17 GLU CA   C    5.607  -1.320  -8.730 1.00 . A A .  17 GLU CA   1 1 
        5  2792 1 1 17 GLU CB   C    5.482   0.001  -7.968 1.00 . A A .  17 GLU CB   1 1 
        5  2793 1 1 17 GLU CD   C    6.131   1.516  -9.882 1.00 . A A .  17 GLU CD   1 1 
        5  2794 1 1 17 GLU CG   C    5.078   1.174  -8.845 1.00 . A A .  17 GLU CG   1 1 
        5  2795 1 1 17 GLU H    H    3.637  -0.982  -9.427 1.00 . A A .  17 GLU H    1 1 
        5  2796 1 1 17 GLU HA   H    6.346  -1.207  -9.509 1.00 . A A .  17 GLU HA   1 1 
        5  2797 1 1 17 GLU HB2  H    4.740  -0.114  -7.192 1.00 . A A .  17 GLU HB2  1 1 
        5  2798 1 1 17 GLU HB3  H    6.434   0.231  -7.512 1.00 . A A .  17 GLU HB3  1 1 
        5  2799 1 1 17 GLU HG2  H    4.160   0.926  -9.356 1.00 . A A .  17 GLU HG2  1 1 
        5  2800 1 1 17 GLU HG3  H    4.918   2.038  -8.218 1.00 . A A .  17 GLU HG3  1 1 
        5  2801 1 1 17 GLU N    N    4.339  -1.663  -9.362 1.00 . A A .  17 GLU N    1 1 
        5  2802 1 1 17 GLU O    O    7.152  -2.975  -7.925 1.00 . A A .  17 GLU O    1 1 
        5  2803 1 1 17 GLU OE1  O    7.272   1.832  -9.488 1.00 . A A .  17 GLU OE1  1 1 
        5  2804 1 1 17 GLU OE2  O    5.811   1.468 -11.089 1.00 . A A .  17 GLU OE2  1 1 
        5  2805 1 1 18 CYS C    C    4.699  -5.045  -6.102 1.00 . A A .  18 CYS C    1 1 
        5  2806 1 1 18 CYS CA   C    5.521  -3.787  -5.836 1.00 . A A .  18 CYS CA   1 1 
        5  2807 1 1 18 CYS CB   C    5.255  -3.281  -4.417 1.00 . A A .  18 CYS CB   1 1 
        5  2808 1 1 18 CYS H    H    4.354  -2.275  -6.747 1.00 . A A .  18 CYS H    1 1 
        5  2809 1 1 18 CYS HA   H    6.569  -4.030  -5.932 1.00 . A A .  18 CYS HA   1 1 
        5  2810 1 1 18 CYS HB2  H    5.525  -4.053  -3.711 1.00 . A A .  18 CYS HB2  1 1 
        5  2811 1 1 18 CYS HB3  H    5.861  -2.406  -4.235 1.00 . A A .  18 CYS HB3  1 1 
        5  2812 1 1 18 CYS N    N    5.211  -2.748  -6.810 1.00 . A A .  18 CYS N    1 1 
        5  2813 1 1 18 CYS O    O    5.228  -6.156  -6.102 1.00 . A A .  18 CYS O    1 1 
        5  2814 1 1 18 CYS SG   S    3.518  -2.829  -4.103 1.00 . A A .  18 CYS SG   1 1 
        5  2815 1 1 19 GLY C    C    1.563  -6.254  -5.455 1.00 . A A .  19 GLY C    1 1 
        5  2816 1 1 19 GLY CA   C    2.528  -5.989  -6.593 1.00 . A A .  19 GLY CA   1 1 
        5  2817 1 1 19 GLY H    H    3.036  -3.952  -6.317 1.00 . A A .  19 GLY H    1 1 
        5  2818 1 1 19 GLY HA2  H    1.963  -5.790  -7.492 1.00 . A A .  19 GLY HA2  1 1 
        5  2819 1 1 19 GLY HA3  H    3.133  -6.870  -6.749 1.00 . A A .  19 GLY HA3  1 1 
        5  2820 1 1 19 GLY N    N    3.402  -4.861  -6.329 1.00 . A A .  19 GLY N    1 1 
        5  2821 1 1 19 GLY O    O    1.755  -7.184  -4.672 1.00 . A A .  19 GLY O    1 1 
        5  2822 1 1 20 LYS C    C   -1.864  -5.201  -4.819 1.00 . A A .  20 LYS C    1 1 
        5  2823 1 1 20 LYS CA   C   -0.477  -5.582  -4.310 1.00 . A A .  20 LYS CA   1 1 
        5  2824 1 1 20 LYS CB   C   -0.110  -4.717  -3.102 1.00 . A A .  20 LYS CB   1 1 
        5  2825 1 1 20 LYS CD   C    1.631  -4.280  -1.345 1.00 . A A .  20 LYS CD   1 1 
        5  2826 1 1 20 LYS CE   C    2.760  -4.878  -0.520 1.00 . A A .  20 LYS CE   1 1 
        5  2827 1 1 20 LYS CG   C    0.964  -5.328  -2.220 1.00 . A A .  20 LYS CG   1 1 
        5  2828 1 1 20 LYS H    H    0.423  -4.710  -6.016 1.00 . A A .  20 LYS H    1 1 
        5  2829 1 1 20 LYS HA   H   -0.490  -6.619  -4.008 1.00 . A A .  20 LYS HA   1 1 
        5  2830 1 1 20 LYS HB2  H    0.245  -3.760  -3.455 1.00 . A A .  20 LYS HB2  1 1 
        5  2831 1 1 20 LYS HB3  H   -0.996  -4.564  -2.502 1.00 . A A .  20 LYS HB3  1 1 
        5  2832 1 1 20 LYS HD2  H    2.034  -3.501  -1.975 1.00 . A A .  20 LYS HD2  1 1 
        5  2833 1 1 20 LYS HD3  H    0.893  -3.858  -0.677 1.00 . A A .  20 LYS HD3  1 1 
        5  2834 1 1 20 LYS HE2  H    2.357  -5.662   0.102 1.00 . A A .  20 LYS HE2  1 1 
        5  2835 1 1 20 LYS HE3  H    3.497  -5.294  -1.192 1.00 . A A .  20 LYS HE3  1 1 
        5  2836 1 1 20 LYS HG2  H    0.513  -6.077  -1.585 1.00 . A A .  20 LYS HG2  1 1 
        5  2837 1 1 20 LYS HG3  H    1.713  -5.790  -2.847 1.00 . A A .  20 LYS HG3  1 1 
        5  2838 1 1 20 LYS HZ1  H    4.189  -4.293   0.887 1.00 . A A .  20 LYS HZ1  1 1 
        5  2839 1 1 20 LYS HZ2  H    2.723  -3.458   1.011 1.00 . A A .  20 LYS HZ2  1 1 
        5  2840 1 1 20 LYS HZ3  H    3.803  -3.090  -0.238 1.00 . A A .  20 LYS HZ3  1 1 
        5  2841 1 1 20 LYS N    N    0.522  -5.434  -5.361 1.00 . A A .  20 LYS N    1 1 
        5  2842 1 1 20 LYS NZ   N    3.415  -3.859   0.346 1.00 . A A .  20 LYS NZ   1 1 
        5  2843 1 1 20 LYS O    O   -2.042  -4.149  -5.433 1.00 . A A .  20 LYS O    1 1 
        5  2844 1 1 21 SER C    C   -5.003  -5.089  -3.911 1.00 . A A .  21 SER C    1 1 
        5  2845 1 1 21 SER CA   C   -4.212  -5.816  -4.994 1.00 . A A .  21 SER CA   1 1 
        5  2846 1 1 21 SER CB   C   -4.902  -7.136  -5.347 1.00 . A A .  21 SER CB   1 1 
        5  2847 1 1 21 SER H    H   -2.637  -6.884  -4.066 1.00 . A A .  21 SER H    1 1 
        5  2848 1 1 21 SER HA   H   -4.174  -5.193  -5.875 1.00 . A A .  21 SER HA   1 1 
        5  2849 1 1 21 SER HB2  H   -4.928  -7.770  -4.474 1.00 . A A .  21 SER HB2  1 1 
        5  2850 1 1 21 SER HB3  H   -5.911  -6.934  -5.676 1.00 . A A .  21 SER HB3  1 1 
        5  2851 1 1 21 SER HG   H   -4.830  -8.343  -6.888 1.00 . A A .  21 SER HG   1 1 
        5  2852 1 1 21 SER N    N   -2.842  -6.062  -4.559 1.00 . A A .  21 SER N    1 1 
        5  2853 1 1 21 SER O    O   -4.898  -5.411  -2.727 1.00 . A A .  21 SER O    1 1 
        5  2854 1 1 21 SER OG   O   -4.211  -7.812  -6.382 1.00 . A A .  21 SER OG   1 1 
        5  2855 1 1 22 PHE C    C   -8.075  -3.351  -3.800 1.00 . A A .  22 PHE C    1 1 
        5  2856 1 1 22 PHE CA   C   -6.605  -3.332  -3.391 1.00 . A A .  22 PHE CA   1 1 
        5  2857 1 1 22 PHE CB   C   -6.102  -1.889  -3.323 1.00 . A A .  22 PHE CB   1 1 
        5  2858 1 1 22 PHE CD1  C   -3.635  -2.349  -3.352 1.00 . A A .  22 PHE CD1  1 1 
        5  2859 1 1 22 PHE CD2  C   -4.525  -1.054  -1.558 1.00 . A A .  22 PHE CD2  1 1 
        5  2860 1 1 22 PHE CE1  C   -2.368  -2.233  -2.812 1.00 . A A .  22 PHE CE1  1 1 
        5  2861 1 1 22 PHE CE2  C   -3.261  -0.934  -1.014 1.00 . A A .  22 PHE CE2  1 1 
        5  2862 1 1 22 PHE CG   C   -4.726  -1.761  -2.733 1.00 . A A .  22 PHE CG   1 1 
        5  2863 1 1 22 PHE CZ   C   -2.181  -1.525  -1.640 1.00 . A A .  22 PHE CZ   1 1 
        5  2864 1 1 22 PHE H    H   -5.837  -3.897  -5.282 1.00 . A A .  22 PHE H    1 1 
        5  2865 1 1 22 PHE HA   H   -6.509  -3.784  -2.416 1.00 . A A .  22 PHE HA   1 1 
        5  2866 1 1 22 PHE HB2  H   -6.073  -1.477  -4.320 1.00 . A A .  22 PHE HB2  1 1 
        5  2867 1 1 22 PHE HB3  H   -6.780  -1.307  -2.717 1.00 . A A .  22 PHE HB3  1 1 
        5  2868 1 1 22 PHE HD1  H   -3.781  -2.903  -4.269 1.00 . A A .  22 PHE HD1  1 1 
        5  2869 1 1 22 PHE HD2  H   -5.369  -0.592  -1.066 1.00 . A A .  22 PHE HD2  1 1 
        5  2870 1 1 22 PHE HE1  H   -1.526  -2.696  -3.304 1.00 . A A .  22 PHE HE1  1 1 
        5  2871 1 1 22 PHE HE2  H   -3.117  -0.381  -0.098 1.00 . A A .  22 PHE HE2  1 1 
        5  2872 1 1 22 PHE HZ   H   -1.192  -1.433  -1.217 1.00 . A A .  22 PHE HZ   1 1 
        5  2873 1 1 22 PHE N    N   -5.796  -4.107  -4.325 1.00 . A A .  22 PHE N    1 1 
        5  2874 1 1 22 PHE O    O   -8.404  -3.579  -4.964 1.00 . A A .  22 PHE O    1 1 
        5  2875 1 1 23 SER C    C  -10.703  -2.408  -4.412 1.00 . A A .  23 SER C    1 1 
        5  2876 1 1 23 SER CA   C  -10.390  -3.104  -3.091 1.00 . A A .  23 SER CA   1 1 
        5  2877 1 1 23 SER CB   C  -11.132  -2.408  -1.947 1.00 . A A .  23 SER CB   1 1 
        5  2878 1 1 23 SER H    H   -8.631  -2.935  -1.925 1.00 . A A .  23 SER H    1 1 
        5  2879 1 1 23 SER HA   H  -10.721  -4.130  -3.151 1.00 . A A .  23 SER HA   1 1 
        5  2880 1 1 23 SER HB2  H  -10.521  -1.606  -1.561 1.00 . A A .  23 SER HB2  1 1 
        5  2881 1 1 23 SER HB3  H  -12.063  -2.004  -2.319 1.00 . A A .  23 SER HB3  1 1 
        5  2882 1 1 23 SER HG   H  -10.591  -3.648  -0.531 1.00 . A A .  23 SER HG   1 1 
        5  2883 1 1 23 SER N    N   -8.955  -3.110  -2.833 1.00 . A A .  23 SER N    1 1 
        5  2884 1 1 23 SER O    O  -11.321  -2.990  -5.302 1.00 . A A .  23 SER O    1 1 
        5  2885 1 1 23 SER OG   O  -11.414  -3.315  -0.896 1.00 . A A .  23 SER OG   1 1 
        5  2886 1 1 24 GLY C    C   -9.428   0.625  -6.017 1.00 . A A .  24 GLY C    1 1 
        5  2887 1 1 24 GLY CA   C  -10.511  -0.401  -5.747 1.00 . A A .  24 GLY CA   1 1 
        5  2888 1 1 24 GLY H    H   -9.781  -0.743  -3.789 1.00 . A A .  24 GLY H    1 1 
        5  2889 1 1 24 GLY HA2  H  -10.560  -1.085  -6.580 1.00 . A A .  24 GLY HA2  1 1 
        5  2890 1 1 24 GLY HA3  H  -11.459   0.109  -5.657 1.00 . A A .  24 GLY HA3  1 1 
        5  2891 1 1 24 GLY N    N  -10.269  -1.156  -4.532 1.00 . A A .  24 GLY N    1 1 
        5  2892 1 1 24 GLY O    O   -8.281   0.450  -5.605 1.00 . A A .  24 GLY O    1 1 
        5  2893 1 1 25 SER C    C   -8.522   3.601  -5.813 1.00 . A A .  25 SER C    1 1 
        5  2894 1 1 25 SER CA   C   -8.841   2.754  -7.041 1.00 . A A .  25 SER CA   1 1 
        5  2895 1 1 25 SER CB   C   -9.398   3.641  -8.156 1.00 . A A .  25 SER CB   1 1 
        5  2896 1 1 25 SER H    H  -10.721   1.781  -7.012 1.00 . A A .  25 SER H    1 1 
        5  2897 1 1 25 SER HA   H   -7.931   2.285  -7.387 1.00 . A A .  25 SER HA   1 1 
        5  2898 1 1 25 SER HB2  H   -9.622   3.033  -9.019 1.00 . A A .  25 SER HB2  1 1 
        5  2899 1 1 25 SER HB3  H  -10.300   4.124  -7.811 1.00 . A A .  25 SER HB3  1 1 
        5  2900 1 1 25 SER HG   H   -7.822   4.262  -9.140 1.00 . A A .  25 SER HG   1 1 
        5  2901 1 1 25 SER N    N   -9.791   1.698  -6.712 1.00 . A A .  25 SER N    1 1 
        5  2902 1 1 25 SER O    O   -7.368   3.699  -5.395 1.00 . A A .  25 SER O    1 1 
        5  2903 1 1 25 SER OG   O   -8.462   4.637  -8.531 1.00 . A A .  25 SER OG   1 1 
        5  2904 1 1 26 TYR C    C   -8.322   4.476  -3.128 1.00 . A A .  26 TYR C    1 1 
        5  2905 1 1 26 TYR CA   C   -9.384   5.052  -4.060 1.00 . A A .  26 TYR CA   1 1 
        5  2906 1 1 26 TYR CB   C  -10.711   5.192  -3.313 1.00 . A A .  26 TYR CB   1 1 
        5  2907 1 1 26 TYR CD1  C  -10.349   6.405  -1.128 1.00 . A A .  26 TYR CD1  1 1 
        5  2908 1 1 26 TYR CD2  C  -11.305   7.618  -2.943 1.00 . A A .  26 TYR CD2  1 1 
        5  2909 1 1 26 TYR CE1  C  -10.420   7.531  -0.331 1.00 . A A .  26 TYR CE1  1 1 
        5  2910 1 1 26 TYR CE2  C  -11.379   8.750  -2.154 1.00 . A A .  26 TYR CE2  1 1 
        5  2911 1 1 26 TYR CG   C  -10.790   6.427  -2.445 1.00 . A A .  26 TYR CG   1 1 
        5  2912 1 1 26 TYR CZ   C  -10.935   8.701  -0.849 1.00 . A A .  26 TYR CZ   1 1 
        5  2913 1 1 26 TYR H    H  -10.449   4.094  -5.618 1.00 . A A .  26 TYR H    1 1 
        5  2914 1 1 26 TYR HA   H   -9.064   6.028  -4.392 1.00 . A A .  26 TYR HA   1 1 
        5  2915 1 1 26 TYR HB2  H  -11.517   5.239  -4.030 1.00 . A A .  26 TYR HB2  1 1 
        5  2916 1 1 26 TYR HB3  H  -10.852   4.330  -2.678 1.00 . A A .  26 TYR HB3  1 1 
        5  2917 1 1 26 TYR HD1  H   -9.945   5.486  -0.726 1.00 . A A .  26 TYR HD1  1 1 
        5  2918 1 1 26 TYR HD2  H  -11.652   7.653  -3.966 1.00 . A A .  26 TYR HD2  1 1 
        5  2919 1 1 26 TYR HE1  H  -10.072   7.493   0.690 1.00 . A A .  26 TYR HE1  1 1 
        5  2920 1 1 26 TYR HE2  H  -11.783   9.666  -2.558 1.00 . A A .  26 TYR HE2  1 1 
        5  2921 1 1 26 TYR HH   H  -11.823   9.811   0.445 1.00 . A A .  26 TYR HH   1 1 
        5  2922 1 1 26 TYR N    N   -9.553   4.211  -5.239 1.00 . A A .  26 TYR N    1 1 
        5  2923 1 1 26 TYR O    O   -7.398   5.177  -2.714 1.00 . A A .  26 TYR O    1 1 
        5  2924 1 1 26 TYR OH   O  -11.006   9.825  -0.059 1.00 . A A .  26 TYR OH   1 1 
        5  2925 1 1 27 ARG C    C   -6.147   2.396  -2.586 1.00 . A A .  27 ARG C    1 1 
        5  2926 1 1 27 ARG CA   C   -7.514   2.524  -1.920 1.00 . A A .  27 ARG CA   1 1 
        5  2927 1 1 27 ARG CB   C   -8.037   1.140  -1.534 1.00 . A A .  27 ARG CB   1 1 
        5  2928 1 1 27 ARG CD   C   -8.617   1.239   0.909 1.00 . A A .  27 ARG CD   1 1 
        5  2929 1 1 27 ARG CG   C   -9.160   1.177  -0.510 1.00 . A A .  27 ARG CG   1 1 
        5  2930 1 1 27 ARG CZ   C   -6.961  -0.004   2.234 1.00 . A A .  27 ARG CZ   1 1 
        5  2931 1 1 27 ARG H    H   -9.217   2.689  -3.165 1.00 . A A .  27 ARG H    1 1 
        5  2932 1 1 27 ARG HA   H   -7.412   3.123  -1.027 1.00 . A A .  27 ARG HA   1 1 
        5  2933 1 1 27 ARG HB2  H   -8.406   0.646  -2.421 1.00 . A A .  27 ARG HB2  1 1 
        5  2934 1 1 27 ARG HB3  H   -7.223   0.562  -1.123 1.00 . A A .  27 ARG HB3  1 1 
        5  2935 1 1 27 ARG HD2  H   -7.968   2.098   0.995 1.00 . A A .  27 ARG HD2  1 1 
        5  2936 1 1 27 ARG HD3  H   -9.446   1.346   1.593 1.00 . A A .  27 ARG HD3  1 1 
        5  2937 1 1 27 ARG HE   H   -8.040  -0.775   0.745 1.00 . A A .  27 ARG HE   1 1 
        5  2938 1 1 27 ARG HG2  H   -9.769   2.050  -0.689 1.00 . A A .  27 ARG HG2  1 1 
        5  2939 1 1 27 ARG HG3  H   -9.762   0.287  -0.617 1.00 . A A .  27 ARG HG3  1 1 
        5  2940 1 1 27 ARG HH11 H   -7.186   1.934   2.757 1.00 . A A .  27 ARG HH11 1 1 
        5  2941 1 1 27 ARG HH12 H   -6.022   1.046   3.683 1.00 . A A .  27 ARG HH12 1 1 
        5  2942 1 1 27 ARG HH21 H   -6.511  -1.955   1.957 1.00 . A A .  27 ARG HH21 1 1 
        5  2943 1 1 27 ARG HH22 H   -5.638  -1.166   3.227 1.00 . A A .  27 ARG HH22 1 1 
        5  2944 1 1 27 ARG N    N   -8.460   3.195  -2.803 1.00 . A A .  27 ARG N    1 1 
        5  2945 1 1 27 ARG NE   N   -7.864   0.039   1.261 1.00 . A A .  27 ARG NE   1 1 
        5  2946 1 1 27 ARG NH1  N   -6.701   1.081   2.950 1.00 . A A .  27 ARG NH1  1 1 
        5  2947 1 1 27 ARG NH2  N   -6.317  -1.135   2.494 1.00 . A A .  27 ARG NH2  1 1 
        5  2948 1 1 27 ARG O    O   -5.120   2.716  -1.986 1.00 . A A .  27 ARG O    1 1 
        5  2949 1 1 28 LEU C    C   -4.053   3.019  -4.523 1.00 . A A .  28 LEU C    1 1 
        5  2950 1 1 28 LEU CA   C   -4.900   1.752  -4.575 1.00 . A A .  28 LEU CA   1 1 
        5  2951 1 1 28 LEU CB   C   -5.204   1.388  -6.029 1.00 . A A .  28 LEU CB   1 1 
        5  2952 1 1 28 LEU CD1  C   -4.062  -0.810  -6.416 1.00 . A A .  28 LEU CD1  1 1 
        5  2953 1 1 28 LEU CD2  C   -4.269   0.835  -8.289 1.00 . A A .  28 LEU CD2  1 1 
        5  2954 1 1 28 LEU CG   C   -4.090   0.665  -6.787 1.00 . A A .  28 LEU CG   1 1 
        5  2955 1 1 28 LEU H    H   -6.991   1.685  -4.253 1.00 . A A .  28 LEU H    1 1 
        5  2956 1 1 28 LEU HA   H   -4.348   0.945  -4.118 1.00 . A A .  28 LEU HA   1 1 
        5  2957 1 1 28 LEU HB2  H   -6.075   0.751  -6.035 1.00 . A A .  28 LEU HB2  1 1 
        5  2958 1 1 28 LEU HB3  H   -5.426   2.303  -6.559 1.00 . A A .  28 LEU HB3  1 1 
        5  2959 1 1 28 LEU HD11 H   -3.261  -0.989  -5.715 1.00 . A A .  28 LEU HD11 1 1 
        5  2960 1 1 28 LEU HD12 H   -3.902  -1.402  -7.305 1.00 . A A .  28 LEU HD12 1 1 
        5  2961 1 1 28 LEU HD13 H   -5.005  -1.086  -5.966 1.00 . A A .  28 LEU HD13 1 1 
        5  2962 1 1 28 LEU HD21 H   -4.471  -0.125  -8.738 1.00 . A A .  28 LEU HD21 1 1 
        5  2963 1 1 28 LEU HD22 H   -3.366   1.249  -8.713 1.00 . A A .  28 LEU HD22 1 1 
        5  2964 1 1 28 LEU HD23 H   -5.095   1.504  -8.479 1.00 . A A .  28 LEU HD23 1 1 
        5  2965 1 1 28 LEU HG   H   -3.137   1.096  -6.511 1.00 . A A .  28 LEU HG   1 1 
        5  2966 1 1 28 LEU N    N   -6.141   1.924  -3.827 1.00 . A A .  28 LEU N    1 1 
        5  2967 1 1 28 LEU O    O   -2.834   2.958  -4.354 1.00 . A A .  28 LEU O    1 1 
        5  2968 1 1 29 THR C    C   -3.287   5.650  -3.309 1.00 . A A .  29 THR C    1 1 
        5  2969 1 1 29 THR CA   C   -4.014   5.450  -4.634 1.00 . A A .  29 THR CA   1 1 
        5  2970 1 1 29 THR CB   C   -4.990   6.621  -4.853 1.00 . A A .  29 THR CB   1 1 
        5  2971 1 1 29 THR CG2  C   -4.242   7.945  -4.912 1.00 . A A .  29 THR CG2  1 1 
        5  2972 1 1 29 THR H    H   -5.677   4.151  -4.798 1.00 . A A .  29 THR H    1 1 
        5  2973 1 1 29 THR HA   H   -3.289   5.458  -5.436 1.00 . A A .  29 THR HA   1 1 
        5  2974 1 1 29 THR HB   H   -5.682   6.653  -4.024 1.00 . A A .  29 THR HB   1 1 
        5  2975 1 1 29 THR HG1  H   -6.596   6.082  -5.863 1.00 . A A .  29 THR HG1  1 1 
        5  2976 1 1 29 THR HG21 H   -3.876   8.107  -5.915 1.00 . A A .  29 THR HG21 1 1 
        5  2977 1 1 29 THR HG22 H   -3.410   7.919  -4.225 1.00 . A A .  29 THR HG22 1 1 
        5  2978 1 1 29 THR HG23 H   -4.910   8.748  -4.639 1.00 . A A .  29 THR HG23 1 1 
        5  2979 1 1 29 THR N    N   -4.706   4.168  -4.666 1.00 . A A .  29 THR N    1 1 
        5  2980 1 1 29 THR O    O   -2.087   5.921  -3.284 1.00 . A A .  29 THR O    1 1 
        5  2981 1 1 29 THR OG1  O   -5.723   6.428  -6.068 1.00 . A A .  29 THR OG1  1 1 
        5  2982 1 1 30 GLN C    C   -2.126   4.924  -0.762 1.00 . A A .  30 GLN C    1 1 
        5  2983 1 1 30 GLN CA   C   -3.446   5.678  -0.881 1.00 . A A .  30 GLN CA   1 1 
        5  2984 1 1 30 GLN CB   C   -4.425   5.188   0.187 1.00 . A A .  30 GLN CB   1 1 
        5  2985 1 1 30 GLN CD   C   -6.561   5.667   1.449 1.00 . A A .  30 GLN CD   1 1 
        5  2986 1 1 30 GLN CG   C   -5.734   5.961   0.213 1.00 . A A .  30 GLN CG   1 1 
        5  2987 1 1 30 GLN H    H   -4.973   5.296  -2.295 1.00 . A A .  30 GLN H    1 1 
        5  2988 1 1 30 GLN HA   H   -3.260   6.731  -0.730 1.00 . A A .  30 GLN HA   1 1 
        5  2989 1 1 30 GLN HB2  H   -4.650   4.148   0.003 1.00 . A A .  30 GLN HB2  1 1 
        5  2990 1 1 30 GLN HB3  H   -3.958   5.281   1.156 1.00 . A A .  30 GLN HB3  1 1 
        5  2991 1 1 30 GLN HE21 H   -7.973   4.821   0.333 1.00 . A A .  30 GLN HE21 1 1 
        5  2992 1 1 30 GLN HE22 H   -8.275   4.847   2.034 1.00 . A A .  30 GLN HE22 1 1 
        5  2993 1 1 30 GLN HG2  H   -5.514   7.018   0.191 1.00 . A A .  30 GLN HG2  1 1 
        5  2994 1 1 30 GLN HG3  H   -6.311   5.696  -0.660 1.00 . A A .  30 GLN HG3  1 1 
        5  2995 1 1 30 GLN N    N   -4.022   5.513  -2.210 1.00 . A A .  30 GLN N    1 1 
        5  2996 1 1 30 GLN NE2  N   -7.720   5.050   1.253 1.00 . A A .  30 GLN NE2  1 1 
        5  2997 1 1 30 GLN O    O   -1.154   5.436  -0.206 1.00 . A A .  30 GLN O    1 1 
        5  2998 1 1 30 GLN OE1  O   -6.163   5.991   2.569 1.00 . A A .  30 GLN OE1  1 1 
        5  2999 1 1 31 HIS C    C    0.151   3.386  -2.226 1.00 . A A .  31 HIS C    1 1 
        5  3000 1 1 31 HIS CA   C   -0.896   2.878  -1.240 1.00 . A A .  31 HIS CA   1 1 
        5  3001 1 1 31 HIS CB   C   -1.240   1.421  -1.550 1.00 . A A .  31 HIS CB   1 1 
        5  3002 1 1 31 HIS CD2  C    0.120   0.230  -3.410 1.00 . A A .  31 HIS CD2  1 1 
        5  3003 1 1 31 HIS CE1  C    1.818  -0.431  -2.191 1.00 . A A .  31 HIS CE1  1 1 
        5  3004 1 1 31 HIS CG   C   -0.101   0.649  -2.142 1.00 . A A .  31 HIS CG   1 1 
        5  3005 1 1 31 HIS H    H   -2.904   3.350  -1.718 1.00 . A A .  31 HIS H    1 1 
        5  3006 1 1 31 HIS HA   H   -0.492   2.939  -0.241 1.00 . A A .  31 HIS HA   1 1 
        5  3007 1 1 31 HIS HB2  H   -1.537   0.926  -0.637 1.00 . A A .  31 HIS HB2  1 1 
        5  3008 1 1 31 HIS HB3  H   -2.061   1.393  -2.252 1.00 . A A .  31 HIS HB3  1 1 
        5  3009 1 1 31 HIS HD1  H    1.114   0.368  -0.444 1.00 . A A .  31 HIS HD1  1 1 
        5  3010 1 1 31 HIS HD2  H   -0.526   0.391  -4.261 1.00 . A A .  31 HIS HD2  1 1 
        5  3011 1 1 31 HIS HE1  H    2.752  -0.880  -1.887 1.00 . A A .  31 HIS HE1  1 1 
        5  3012 1 1 31 HIS N    N   -2.098   3.703  -1.288 1.00 . A A .  31 HIS N    1 1 
        5  3013 1 1 31 HIS ND1  N    0.980   0.218  -1.403 1.00 . A A .  31 HIS ND1  1 1 
        5  3014 1 1 31 HIS NE2  N    1.320  -0.439  -3.414 1.00 . A A .  31 HIS NE2  1 1 
        5  3015 1 1 31 HIS O    O    1.293   3.653  -1.851 1.00 . A A .  31 HIS O    1 1 
        5  3016 1 1 32 TRP C    C    1.543   5.122  -4.006 1.00 . A A .  32 TRP C    1 1 
        5  3017 1 1 32 TRP CA   C    0.661   3.993  -4.527 1.00 . A A .  32 TRP CA   1 1 
        5  3018 1 1 32 TRP CB   C   -0.133   4.469  -5.744 1.00 . A A .  32 TRP CB   1 1 
        5  3019 1 1 32 TRP CD1  C   -0.939   2.154  -6.492 1.00 . A A .  32 TRP CD1  1 1 
        5  3020 1 1 32 TRP CD2  C   -0.133   3.428  -8.149 1.00 . A A .  32 TRP CD2  1 1 
        5  3021 1 1 32 TRP CE2  C   -0.539   2.191  -8.689 1.00 . A A .  32 TRP CE2  1 1 
        5  3022 1 1 32 TRP CE3  C    0.405   4.392  -9.004 1.00 . A A .  32 TRP CE3  1 1 
        5  3023 1 1 32 TRP CG   C   -0.399   3.383  -6.742 1.00 . A A .  32 TRP CG   1 1 
        5  3024 1 1 32 TRP CH2  C    0.110   2.860 -10.859 1.00 . A A .  32 TRP CH2  1 1 
        5  3025 1 1 32 TRP CZ2  C   -0.421   1.897 -10.044 1.00 . A A .  32 TRP CZ2  1 1 
        5  3026 1 1 32 TRP CZ3  C    0.522   4.098 -10.350 1.00 . A A .  32 TRP CZ3  1 1 
        5  3027 1 1 32 TRP H    H   -1.168   3.288  -3.725 1.00 . A A .  32 TRP H    1 1 
        5  3028 1 1 32 TRP HA   H    1.291   3.166  -4.820 1.00 . A A .  32 TRP HA   1 1 
        5  3029 1 1 32 TRP HB2  H   -1.085   4.860  -5.416 1.00 . A A .  32 TRP HB2  1 1 
        5  3030 1 1 32 TRP HB3  H    0.421   5.252  -6.242 1.00 . A A .  32 TRP HB3  1 1 
        5  3031 1 1 32 TRP HD1  H   -1.247   1.813  -5.515 1.00 . A A .  32 TRP HD1  1 1 
        5  3032 1 1 32 TRP HE1  H   -1.381   0.522  -7.738 1.00 . A A .  32 TRP HE1  1 1 
        5  3033 1 1 32 TRP HE3  H    0.729   5.352  -8.631 1.00 . A A .  32 TRP HE3  1 1 
        5  3034 1 1 32 TRP HH2  H    0.221   2.673 -11.916 1.00 . A A .  32 TRP HH2  1 1 
        5  3035 1 1 32 TRP HZ2  H   -0.734   0.947 -10.452 1.00 . A A .  32 TRP HZ2  1 1 
        5  3036 1 1 32 TRP HZ3  H    0.937   4.831 -11.026 1.00 . A A .  32 TRP HZ3  1 1 
        5  3037 1 1 32 TRP N    N   -0.245   3.517  -3.487 1.00 . A A .  32 TRP N    1 1 
        5  3038 1 1 32 TRP NE1  N   -1.026   1.432  -7.658 1.00 . A A .  32 TRP NE1  1 1 
        5  3039 1 1 32 TRP O    O    2.746   5.153  -4.266 1.00 . A A .  32 TRP O    1 1 
        5  3040 1 1 33 ILE C    C    3.052   6.754  -2.229 1.00 . A A .  33 ILE C    1 1 
        5  3041 1 1 33 ILE CA   C    1.669   7.178  -2.711 1.00 . A A .  33 ILE CA   1 1 
        5  3042 1 1 33 ILE CB   C    0.904   7.821  -1.539 1.00 . A A .  33 ILE CB   1 1 
        5  3043 1 1 33 ILE CD1  C   -1.401   8.705  -0.920 1.00 . A A .  33 ILE CD1  1 1 
        5  3044 1 1 33 ILE CG1  C   -0.414   8.424  -2.031 1.00 . A A .  33 ILE CG1  1 1 
        5  3045 1 1 33 ILE CG2  C    1.761   8.883  -0.867 1.00 . A A .  33 ILE CG2  1 1 
        5  3046 1 1 33 ILE H    H   -0.024   5.969  -3.097 1.00 . A A .  33 ILE H    1 1 
        5  3047 1 1 33 ILE HA   H    1.783   7.919  -3.490 1.00 . A A .  33 ILE HA   1 1 
        5  3048 1 1 33 ILE HB   H    0.691   7.052  -0.813 1.00 . A A .  33 ILE HB   1 1 
        5  3049 1 1 33 ILE HD11 H   -2.403   8.494  -1.267 1.00 . A A .  33 ILE HD11 1 1 
        5  3050 1 1 33 ILE HD12 H   -1.176   8.077  -0.070 1.00 . A A .  33 ILE HD12 1 1 
        5  3051 1 1 33 ILE HD13 H   -1.332   9.743  -0.631 1.00 . A A .  33 ILE HD13 1 1 
        5  3052 1 1 33 ILE HG12 H   -0.210   9.354  -2.537 1.00 . A A .  33 ILE HG12 1 1 
        5  3053 1 1 33 ILE HG13 H   -0.879   7.737  -2.723 1.00 . A A .  33 ILE HG13 1 1 
        5  3054 1 1 33 ILE HG21 H    1.208   9.329  -0.053 1.00 . A A .  33 ILE HG21 1 1 
        5  3055 1 1 33 ILE HG22 H    2.661   8.429  -0.482 1.00 . A A .  33 ILE HG22 1 1 
        5  3056 1 1 33 ILE HG23 H    2.020   9.645  -1.586 1.00 . A A .  33 ILE HG23 1 1 
        5  3057 1 1 33 ILE N    N    0.937   6.048  -3.270 1.00 . A A .  33 ILE N    1 1 
        5  3058 1 1 33 ILE O    O    4.043   7.448  -2.459 1.00 . A A .  33 ILE O    1 1 
        5  3059 1 1 34 THR C    C    5.477   5.186  -2.094 1.00 . A A .  34 THR C    1 1 
        5  3060 1 1 34 THR CA   C    4.375   5.088  -1.046 1.00 . A A .  34 THR CA   1 1 
        5  3061 1 1 34 THR CB   C    4.237   3.621  -0.596 1.00 . A A .  34 THR CB   1 1 
        5  3062 1 1 34 THR CG2  C    3.169   3.482   0.477 1.00 . A A .  34 THR CG2  1 1 
        5  3063 1 1 34 THR H    H    2.289   5.099  -1.409 1.00 . A A .  34 THR H    1 1 
        5  3064 1 1 34 THR HA   H    4.654   5.681  -0.187 1.00 . A A .  34 THR HA   1 1 
        5  3065 1 1 34 THR HB   H    5.183   3.296  -0.187 1.00 . A A .  34 THR HB   1 1 
        5  3066 1 1 34 THR HG1  H    2.964   2.860  -1.896 1.00 . A A .  34 THR HG1  1 1 
        5  3067 1 1 34 THR HG21 H    2.598   2.583   0.302 1.00 . A A .  34 THR HG21 1 1 
        5  3068 1 1 34 THR HG22 H    2.511   4.338   0.444 1.00 . A A .  34 THR HG22 1 1 
        5  3069 1 1 34 THR HG23 H    3.639   3.426   1.448 1.00 . A A .  34 THR HG23 1 1 
        5  3070 1 1 34 THR N    N    3.113   5.607  -1.560 1.00 . A A .  34 THR N    1 1 
        5  3071 1 1 34 THR O    O    6.551   5.728  -1.831 1.00 . A A .  34 THR O    1 1 
        5  3072 1 1 34 THR OG1  O    3.905   2.795  -1.718 1.00 . A A .  34 THR OG1  1 1 
        5  3073 1 1 35 HIS C    C    6.417   6.118  -4.846 1.00 . A A .  35 HIS C    1 1 
        5  3074 1 1 35 HIS CA   C    6.175   4.688  -4.372 1.00 . A A .  35 HIS CA   1 1 
        5  3075 1 1 35 HIS CB   C    5.690   3.827  -5.539 1.00 . A A .  35 HIS CB   1 1 
        5  3076 1 1 35 HIS CD2  C    3.831   2.044  -5.236 1.00 . A A .  35 HIS CD2  1 1 
        5  3077 1 1 35 HIS CE1  C    5.022   0.509  -4.220 1.00 . A A .  35 HIS CE1  1 1 
        5  3078 1 1 35 HIS CG   C    5.091   2.522  -5.112 1.00 . A A .  35 HIS CG   1 1 
        5  3079 1 1 35 HIS H    H    4.332   4.240  -3.432 1.00 . A A .  35 HIS H    1 1 
        5  3080 1 1 35 HIS HA   H    7.104   4.283  -4.000 1.00 . A A .  35 HIS HA   1 1 
        5  3081 1 1 35 HIS HB2  H    4.938   4.371  -6.091 1.00 . A A .  35 HIS HB2  1 1 
        5  3082 1 1 35 HIS HB3  H    6.524   3.612  -6.191 1.00 . A A .  35 HIS HB3  1 1 
        5  3083 1 1 35 HIS HD1  H    6.762   1.584  -4.236 1.00 . A A .  35 HIS HD1  1 1 
        5  3084 1 1 35 HIS HD2  H    2.993   2.552  -5.693 1.00 . A A .  35 HIS HD2  1 1 
        5  3085 1 1 35 HIS HE1  H    5.313  -0.407  -3.728 1.00 . A A .  35 HIS HE1  1 1 
        5  3086 1 1 35 HIS N    N    5.205   4.659  -3.283 1.00 . A A .  35 HIS N    1 1 
        5  3087 1 1 35 HIS ND1  N    5.812   1.537  -4.471 1.00 . A A .  35 HIS ND1  1 1 
        5  3088 1 1 35 HIS NE2  N    3.814   0.791  -4.675 1.00 . A A .  35 HIS NE2  1 1 
        5  3089 1 1 35 HIS O    O    7.540   6.488  -5.189 1.00 . A A .  35 HIS O    1 1 
        5  3090 1 1 36 THR C    C    6.586   9.029  -4.578 1.00 . A A .  36 THR C    1 1 
        5  3091 1 1 36 THR CA   C    5.452   8.306  -5.297 1.00 . A A .  36 THR CA   1 1 
        5  3092 1 1 36 THR CB   C    4.135   9.065  -5.047 1.00 . A A .  36 THR CB   1 1 
        5  3093 1 1 36 THR CG2  C    4.216  10.483  -5.592 1.00 . A A .  36 THR CG2  1 1 
        5  3094 1 1 36 THR H    H    4.487   6.565  -4.578 1.00 . A A .  36 THR H    1 1 
        5  3095 1 1 36 THR HA   H    5.650   8.311  -6.359 1.00 . A A .  36 THR HA   1 1 
        5  3096 1 1 36 THR HB   H    3.962   9.114  -3.981 1.00 . A A .  36 THR HB   1 1 
        5  3097 1 1 36 THR HG1  H    3.258   7.439  -5.736 1.00 . A A .  36 THR HG1  1 1 
        5  3098 1 1 36 THR HG21 H    4.544  11.151  -4.809 1.00 . A A .  36 THR HG21 1 1 
        5  3099 1 1 36 THR HG22 H    3.242  10.791  -5.942 1.00 . A A .  36 THR HG22 1 1 
        5  3100 1 1 36 THR HG23 H    4.920  10.515  -6.410 1.00 . A A .  36 THR HG23 1 1 
        5  3101 1 1 36 THR N    N    5.356   6.918  -4.863 1.00 . A A .  36 THR N    1 1 
        5  3102 1 1 36 THR O    O    7.388   9.722  -5.205 1.00 . A A .  36 THR O    1 1 
        5  3103 1 1 36 THR OG1  O    3.045   8.373  -5.666 1.00 . A A .  36 THR OG1  1 1 
        5  3104 1 1 37 ARG C    C    8.539   8.457  -1.748 1.00 . A A .  37 ARG C    1 1 
        5  3105 1 1 37 ARG CA   C    7.683   9.501  -2.458 1.00 . A A .  37 ARG CA   1 1 
        5  3106 1 1 37 ARG CB   C    7.053  10.444  -1.431 1.00 . A A .  37 ARG CB   1 1 
        5  3107 1 1 37 ARG CD   C    5.718  10.702   0.683 1.00 . A A .  37 ARG CD   1 1 
        5  3108 1 1 37 ARG CG   C    6.266   9.726  -0.347 1.00 . A A .  37 ARG CG   1 1 
        5  3109 1 1 37 ARG CZ   C    6.664  12.263   2.331 1.00 . A A .  37 ARG CZ   1 1 
        5  3110 1 1 37 ARG H    H    5.978   8.299  -2.819 1.00 . A A .  37 ARG H    1 1 
        5  3111 1 1 37 ARG HA   H    8.312  10.074  -3.122 1.00 . A A .  37 ARG HA   1 1 
        5  3112 1 1 37 ARG HB2  H    7.837  11.016  -0.957 1.00 . A A .  37 ARG HB2  1 1 
        5  3113 1 1 37 ARG HB3  H    6.385  11.120  -1.943 1.00 . A A .  37 ARG HB3  1 1 
        5  3114 1 1 37 ARG HD2  H    5.323  11.565   0.167 1.00 . A A .  37 ARG HD2  1 1 
        5  3115 1 1 37 ARG HD3  H    4.925  10.217   1.232 1.00 . A A .  37 ARG HD3  1 1 
        5  3116 1 1 37 ARG HE   H    7.537  10.573   1.728 1.00 . A A .  37 ARG HE   1 1 
        5  3117 1 1 37 ARG HG2  H    5.441   9.200  -0.802 1.00 . A A .  37 ARG HG2  1 1 
        5  3118 1 1 37 ARG HG3  H    6.916   9.020   0.149 1.00 . A A .  37 ARG HG3  1 1 
        5  3119 1 1 37 ARG HH11 H    4.868  12.804   1.580 1.00 . A A .  37 ARG HH11 1 1 
        5  3120 1 1 37 ARG HH12 H    5.546  13.895   2.743 1.00 . A A .  37 ARG HH12 1 1 
        5  3121 1 1 37 ARG HH21 H    8.440  12.002   3.260 1.00 . A A .  37 ARG HH21 1 1 
        5  3122 1 1 37 ARG HH22 H    7.578  13.438   3.697 1.00 . A A .  37 ARG HH22 1 1 
        5  3123 1 1 37 ARG N    N    6.646   8.863  -3.261 1.00 . A A .  37 ARG N    1 1 
        5  3124 1 1 37 ARG NE   N    6.747  11.142   1.622 1.00 . A A .  37 ARG NE   1 1 
        5  3125 1 1 37 ARG NH1  N    5.606  13.052   2.208 1.00 . A A .  37 ARG NH1  1 1 
        5  3126 1 1 37 ARG NH2  N    7.641  12.595   3.165 1.00 . A A .  37 ARG NH2  1 1 
        5  3127 1 1 37 ARG O    O    8.018   7.543  -1.109 1.00 . A A .  37 ARG O    1 1 
        5  3128 1 1 38 GLU C    C   11.781   8.409  -0.349 1.00 . A A .  38 GLU C    1 1 
        5  3129 1 1 38 GLU CA   C   10.784   7.668  -1.235 1.00 . A A .  38 GLU CA   1 1 
        5  3130 1 1 38 GLU CB   C   11.531   6.861  -2.299 1.00 . A A .  38 GLU CB   1 1 
        5  3131 1 1 38 GLU CD   C   10.351   4.627  -2.291 1.00 . A A .  38 GLU CD   1 1 
        5  3132 1 1 38 GLU CG   C   10.643   5.897  -3.067 1.00 . A A .  38 GLU CG   1 1 
        5  3133 1 1 38 GLU H    H   10.211   9.349  -2.388 1.00 . A A .  38 GLU H    1 1 
        5  3134 1 1 38 GLU HA   H   10.209   6.991  -0.622 1.00 . A A .  38 GLU HA   1 1 
        5  3135 1 1 38 GLU HB2  H   11.980   7.545  -3.004 1.00 . A A .  38 GLU HB2  1 1 
        5  3136 1 1 38 GLU HB3  H   12.313   6.292  -1.818 1.00 . A A .  38 GLU HB3  1 1 
        5  3137 1 1 38 GLU HG2  H    9.708   6.388  -3.289 1.00 . A A .  38 GLU HG2  1 1 
        5  3138 1 1 38 GLU HG3  H   11.136   5.631  -3.991 1.00 . A A .  38 GLU HG3  1 1 
        5  3139 1 1 38 GLU N    N    9.856   8.600  -1.865 1.00 . A A .  38 GLU N    1 1 
        5  3140 1 1 38 GLU O    O   12.272   9.479  -0.708 1.00 . A A .  38 GLU O    1 1 
        5  3141 1 1 38 GLU OE1  O   11.270   3.793  -2.149 1.00 . A A .  38 GLU OE1  1 1 
        5  3142 1 1 38 GLU OE2  O    9.204   4.469  -1.824 1.00 . A A .  38 GLU OE2  1 1 
        5  3143 1 1 39 LYS C    C   13.763   7.362   2.534 1.00 . A A .  39 LYS C    1 1 
        5  3144 1 1 39 LYS CA   C   13.014   8.434   1.750 1.00 . A A .  39 LYS CA   1 1 
        5  3145 1 1 39 LYS CB   C   12.276   9.365   2.714 1.00 . A A .  39 LYS CB   1 1 
        5  3146 1 1 39 LYS CD   C   10.372   9.601   4.336 1.00 . A A .  39 LYS CD   1 1 
        5  3147 1 1 39 LYS CE   C    9.067   8.916   4.713 1.00 . A A .  39 LYS CE   1 1 
        5  3148 1 1 39 LYS CG   C   11.331   8.638   3.656 1.00 . A A .  39 LYS CG   1 1 
        5  3149 1 1 39 LYS H    H   11.651   6.978   1.041 1.00 . A A .  39 LYS H    1 1 
        5  3150 1 1 39 LYS HA   H   13.727   9.012   1.181 1.00 . A A .  39 LYS HA   1 1 
        5  3151 1 1 39 LYS HB2  H   13.003   9.899   3.308 1.00 . A A .  39 LYS HB2  1 1 
        5  3152 1 1 39 LYS HB3  H   11.700  10.076   2.140 1.00 . A A .  39 LYS HB3  1 1 
        5  3153 1 1 39 LYS HD2  H   10.836   9.985   5.233 1.00 . A A .  39 LYS HD2  1 1 
        5  3154 1 1 39 LYS HD3  H   10.158  10.418   3.662 1.00 . A A .  39 LYS HD3  1 1 
        5  3155 1 1 39 LYS HE2  H    8.382   9.658   5.091 1.00 . A A .  39 LYS HE2  1 1 
        5  3156 1 1 39 LYS HE3  H    8.649   8.457   3.829 1.00 . A A .  39 LYS HE3  1 1 
        5  3157 1 1 39 LYS HG2  H   10.759   7.916   3.093 1.00 . A A .  39 LYS HG2  1 1 
        5  3158 1 1 39 LYS HG3  H   11.912   8.129   4.412 1.00 . A A .  39 LYS HG3  1 1 
        5  3159 1 1 39 LYS HZ1  H   10.273   7.828   6.027 1.00 . A A .  39 LYS HZ1  1 1 
        5  3160 1 1 39 LYS HZ2  H    8.984   6.940   5.385 1.00 . A A .  39 LYS HZ2  1 1 
        5  3161 1 1 39 LYS HZ3  H    8.700   8.087   6.595 1.00 . A A .  39 LYS HZ3  1 1 
        5  3162 1 1 39 LYS N    N   12.076   7.832   0.811 1.00 . A A .  39 LYS N    1 1 
        5  3163 1 1 39 LYS NZ   N    9.271   7.869   5.753 1.00 . A A .  39 LYS NZ   1 1 
        5  3164 1 1 39 LYS O    O   13.215   6.316   2.882 1.00 . A A .  39 LYS O    1 1 
        5  3165 1 1 40 PRO C    C   15.490   6.589   5.035 1.00 . A A .  40 PRO C    1 1 
        5  3166 1 1 40 PRO CA   C   15.898   6.696   3.570 1.00 . A A .  40 PRO CA   1 1 
        5  3167 1 1 40 PRO CB   C   17.293   7.315   3.447 1.00 . A A .  40 PRO CB   1 1 
        5  3168 1 1 40 PRO CD   C   15.766   8.852   2.438 1.00 . A A .  40 PRO CD   1 1 
        5  3169 1 1 40 PRO CG   C   17.045   8.767   3.224 1.00 . A A .  40 PRO CG   1 1 
        5  3170 1 1 40 PRO HA   H   15.898   5.712   3.124 1.00 . A A .  40 PRO HA   1 1 
        5  3171 1 1 40 PRO HB2  H   17.847   7.143   4.359 1.00 . A A .  40 PRO HB2  1 1 
        5  3172 1 1 40 PRO HB3  H   17.815   6.871   2.613 1.00 . A A .  40 PRO HB3  1 1 
        5  3173 1 1 40 PRO HD2  H   15.207   9.732   2.722 1.00 . A A .  40 PRO HD2  1 1 
        5  3174 1 1 40 PRO HD3  H   15.974   8.861   1.378 1.00 . A A .  40 PRO HD3  1 1 
        5  3175 1 1 40 PRO HG2  H   16.937   9.271   4.172 1.00 . A A .  40 PRO HG2  1 1 
        5  3176 1 1 40 PRO HG3  H   17.860   9.195   2.660 1.00 . A A .  40 PRO HG3  1 1 
        5  3177 1 1 40 PRO N    N   15.047   7.626   2.821 1.00 . A A .  40 PRO N    1 1 
        5  3178 1 1 40 PRO O    O   15.498   7.579   5.766 1.00 . A A .  40 PRO O    1 1 
        5  3179 1 1 41 SER C    C   15.145   3.754   7.301 1.00 . A A .  41 SER C    1 1 
        5  3180 1 1 41 SER CA   C   14.720   5.144   6.837 1.00 . A A .  41 SER CA   1 1 
        5  3181 1 1 41 SER CB   C   13.204   5.297   6.969 1.00 . A A .  41 SER CB   1 1 
        5  3182 1 1 41 SER H    H   15.149   4.629   4.828 1.00 . A A .  41 SER H    1 1 
        5  3183 1 1 41 SER HA   H   15.204   5.882   7.459 1.00 . A A .  41 SER HA   1 1 
        5  3184 1 1 41 SER HB2  H   12.891   6.202   6.471 1.00 . A A .  41 SER HB2  1 1 
        5  3185 1 1 41 SER HB3  H   12.718   4.448   6.511 1.00 . A A .  41 SER HB3  1 1 
        5  3186 1 1 41 SER HG   H   12.970   6.254   8.662 1.00 . A A .  41 SER HG   1 1 
        5  3187 1 1 41 SER N    N   15.134   5.380   5.459 1.00 . A A .  41 SER N    1 1 
        5  3188 1 1 41 SER O    O   15.615   2.939   6.508 1.00 . A A .  41 SER O    1 1 
        5  3189 1 1 41 SER OG   O   12.815   5.367   8.330 1.00 . A A .  41 SER OG   1 1 
        5  3190 1 1 42 GLY C    C   16.807   2.136   9.541 1.00 . A A .  42 GLY C    1 1 
        5  3191 1 1 42 GLY CA   C   15.345   2.200   9.143 1.00 . A A .  42 GLY CA   1 1 
        5  3192 1 1 42 GLY H    H   14.596   4.180   9.179 1.00 . A A .  42 GLY H    1 1 
        5  3193 1 1 42 GLY HA2  H   14.737   2.003  10.013 1.00 . A A .  42 GLY HA2  1 1 
        5  3194 1 1 42 GLY HA3  H   15.153   1.438   8.402 1.00 . A A .  42 GLY HA3  1 1 
        5  3195 1 1 42 GLY N    N   14.975   3.491   8.594 1.00 . A A .  42 GLY N    1 1 
        5  3196 1 1 42 GLY O    O   17.670   2.749   8.912 1.00 . A A .  42 GLY O    1 1 
        5  3197 1 1 43 PRO C    C   19.343   0.404  10.173 1.00 . A A .  43 PRO C    1 1 
        5  3198 1 1 43 PRO CA   C   18.467   1.223  11.115 1.00 . A A .  43 PRO CA   1 1 
        5  3199 1 1 43 PRO CB   C   18.272   0.484  12.441 1.00 . A A .  43 PRO CB   1 1 
        5  3200 1 1 43 PRO CD   C   16.121   0.623  11.406 1.00 . A A .  43 PRO CD   1 1 
        5  3201 1 1 43 PRO CG   C   16.982  -0.245  12.282 1.00 . A A .  43 PRO CG   1 1 
        5  3202 1 1 43 PRO HA   H   18.935   2.179  11.300 1.00 . A A .  43 PRO HA   1 1 
        5  3203 1 1 43 PRO HB2  H   19.095  -0.198  12.601 1.00 . A A .  43 PRO HB2  1 1 
        5  3204 1 1 43 PRO HB3  H   18.225   1.197  13.251 1.00 . A A .  43 PRO HB3  1 1 
        5  3205 1 1 43 PRO HD2  H   15.495   0.015  10.771 1.00 . A A .  43 PRO HD2  1 1 
        5  3206 1 1 43 PRO HD3  H   15.519   1.287  12.009 1.00 . A A .  43 PRO HD3  1 1 
        5  3207 1 1 43 PRO HG2  H   17.156  -1.199  11.810 1.00 . A A .  43 PRO HG2  1 1 
        5  3208 1 1 43 PRO HG3  H   16.517  -0.381  13.247 1.00 . A A .  43 PRO HG3  1 1 
        5  3209 1 1 43 PRO N    N   17.101   1.381  10.609 1.00 . A A .  43 PRO N    1 1 
        5  3210 1 1 43 PRO O    O   18.891  -0.582   9.591 1.00 . A A .  43 PRO O    1 1 
        5  3211 1 1 44 SER C    C   22.328  -0.923   9.930 1.00 . A A .  44 SER C    1 1 
        5  3212 1 1 44 SER CA   C   21.536   0.124   9.154 1.00 . A A .  44 SER CA   1 1 
        5  3213 1 1 44 SER CB   C   22.492   1.124   8.501 1.00 . A A .  44 SER CB   1 1 
        5  3214 1 1 44 SER H    H   20.898   1.612  10.519 1.00 . A A .  44 SER H    1 1 
        5  3215 1 1 44 SER HA   H   20.965  -0.371   8.382 1.00 . A A .  44 SER HA   1 1 
        5  3216 1 1 44 SER HB2  H   21.926   1.947   8.093 1.00 . A A .  44 SER HB2  1 1 
        5  3217 1 1 44 SER HB3  H   23.183   1.495   9.245 1.00 . A A .  44 SER HB3  1 1 
        5  3218 1 1 44 SER HG   H   22.737  -0.230   7.107 1.00 . A A .  44 SER HG   1 1 
        5  3219 1 1 44 SER N    N   20.597   0.819  10.028 1.00 . A A .  44 SER N    1 1 
        5  3220 1 1 44 SER O    O   23.472  -0.689  10.319 1.00 . A A .  44 SER O    1 1 
        5  3221 1 1 44 SER OG   O   23.230   0.516   7.456 1.00 . A A .  44 SER OG   1 1 
        5  3222 1 1 45 SER C    C   23.721  -3.486  10.284 1.00 . A A .  45 SER C    1 1 
        5  3223 1 1 45 SER CA   C   22.356  -3.163  10.883 1.00 . A A .  45 SER CA   1 1 
        5  3224 1 1 45 SER CB   C   21.472  -4.412  10.872 1.00 . A A .  45 SER CB   1 1 
        5  3225 1 1 45 SER H    H   20.798  -2.205   9.815 1.00 . A A .  45 SER H    1 1 
        5  3226 1 1 45 SER HA   H   22.492  -2.838  11.904 1.00 . A A .  45 SER HA   1 1 
        5  3227 1 1 45 SER HB2  H   20.437  -4.118  10.959 1.00 . A A .  45 SER HB2  1 1 
        5  3228 1 1 45 SER HB3  H   21.618  -4.944   9.943 1.00 . A A .  45 SER HB3  1 1 
        5  3229 1 1 45 SER HG   H   21.008  -5.751  12.224 1.00 . A A .  45 SER HG   1 1 
        5  3230 1 1 45 SER N    N   21.711  -2.079  10.151 1.00 . A A .  45 SER N    1 1 
        5  3231 1 1 45 SER O    O   23.902  -3.450   9.068 1.00 . A A .  45 SER O    1 1 
        5  3232 1 1 45 SER OG   O   21.794  -5.274  11.949 1.00 . A A .  45 SER OG   1 1 
        5  3233 1 1 46 GLY C    C   27.033  -4.131  11.812 1.00 . A A .  46 GLY C    1 1 
        5  3234 1 1 46 GLY CA   C   26.017  -4.128  10.688 1.00 . A A .  46 GLY CA   1 1 
        5  3235 1 1 46 GLY H    H   24.478  -3.816  12.108 1.00 . A A .  46 GLY H    1 1 
        5  3236 1 1 46 GLY HA2  H   26.000  -5.106  10.229 1.00 . A A .  46 GLY HA2  1 1 
        5  3237 1 1 46 GLY HA3  H   26.317  -3.400   9.948 1.00 . A A .  46 GLY HA3  1 1 
        5  3238 1 1 46 GLY N    N   24.680  -3.803  11.149 1.00 . A A .  46 GLY N    1 1 
        5  3239 1 1 46 GLY O    O   27.762  -3.152  11.963 1.00 . A A .  46 GLY O    1 1 
        5  3240 2 2  1 ZN  ZN   ZN   2.715  -0.918  -4.877 1.00 . B A . 181 ZN  ZN   1 1 
        6  3241 1 1  1 GLY C    C    9.856 -28.096  -5.436 1.00 . A A .   1 GLY C    1 1 
        6  3242 1 1  1 GLY CA   C   10.188 -29.521  -5.039 1.00 . A A .   1 GLY CA   1 1 
        6  3243 1 1  1 GLY H1   H   12.099 -30.405  -4.822 1.00 . A A .   1 GLY H1   1 1 
        6  3244 1 1  1 GLY HA2  H    9.473 -30.188  -5.498 1.00 . A A .   1 GLY HA2  1 1 
        6  3245 1 1  1 GLY HA3  H   10.110 -29.610  -3.965 1.00 . A A .   1 GLY HA3  1 1 
        6  3246 1 1  1 GLY N    N   11.524 -29.915  -5.446 1.00 . A A .   1 GLY N    1 1 
        6  3247 1 1  1 GLY O    O   10.740 -27.331  -5.821 1.00 . A A .   1 GLY O    1 1 
        6  3248 1 1  2 SER C    C    6.760 -26.106  -5.105 1.00 . A A .   2 SER C    1 1 
        6  3249 1 1  2 SER CA   C    8.132 -26.399  -5.703 1.00 . A A .   2 SER CA   1 1 
        6  3250 1 1  2 SER CB   C    8.082 -26.245  -7.225 1.00 . A A .   2 SER CB   1 1 
        6  3251 1 1  2 SER H    H    7.922 -28.395  -5.031 1.00 . A A .   2 SER H    1 1 
        6  3252 1 1  2 SER HA   H    8.845 -25.694  -5.302 1.00 . A A .   2 SER HA   1 1 
        6  3253 1 1  2 SER HB2  H    8.039 -25.196  -7.477 1.00 . A A .   2 SER HB2  1 1 
        6  3254 1 1  2 SER HB3  H    8.969 -26.684  -7.658 1.00 . A A .   2 SER HB3  1 1 
        6  3255 1 1  2 SER HG   H    7.146 -27.814  -7.932 1.00 . A A .   2 SER HG   1 1 
        6  3256 1 1  2 SER N    N    8.579 -27.740  -5.345 1.00 . A A .   2 SER N    1 1 
        6  3257 1 1  2 SER O    O    6.101 -26.996  -4.568 1.00 . A A .   2 SER O    1 1 
        6  3258 1 1  2 SER OG   O    6.942 -26.891  -7.765 1.00 . A A .   2 SER OG   1 1 
        6  3259 1 1  3 SER C    C    4.130 -23.934  -5.781 1.00 . A A .   3 SER C    1 1 
        6  3260 1 1  3 SER CA   C    5.043 -24.436  -4.667 1.00 . A A .   3 SER CA   1 1 
        6  3261 1 1  3 SER CB   C    5.230 -23.343  -3.613 1.00 . A A .   3 SER CB   1 1 
        6  3262 1 1  3 SER H    H    6.907 -24.185  -5.641 1.00 . A A .   3 SER H    1 1 
        6  3263 1 1  3 SER HA   H    4.586 -25.297  -4.203 1.00 . A A .   3 SER HA   1 1 
        6  3264 1 1  3 SER HB2  H    4.329 -23.257  -3.024 1.00 . A A .   3 SER HB2  1 1 
        6  3265 1 1  3 SER HB3  H    6.057 -23.605  -2.969 1.00 . A A .   3 SER HB3  1 1 
        6  3266 1 1  3 SER HG   H    5.899 -22.232  -5.081 1.00 . A A .   3 SER HG   1 1 
        6  3267 1 1  3 SER N    N    6.336 -24.850  -5.201 1.00 . A A .   3 SER N    1 1 
        6  3268 1 1  3 SER O    O    4.573 -23.244  -6.698 1.00 . A A .   3 SER O    1 1 
        6  3269 1 1  3 SER OG   O    5.501 -22.091  -4.219 1.00 . A A .   3 SER OG   1 1 
        6  3270 1 1  4 GLY C    C    0.978 -22.762  -6.202 1.00 . A A .   4 GLY C    1 1 
        6  3271 1 1  4 GLY CA   C    1.894 -23.862  -6.699 1.00 . A A .   4 GLY CA   1 1 
        6  3272 1 1  4 GLY H    H    2.554 -24.837  -4.939 1.00 . A A .   4 GLY H    1 1 
        6  3273 1 1  4 GLY HA2  H    2.433 -23.505  -7.564 1.00 . A A .   4 GLY HA2  1 1 
        6  3274 1 1  4 GLY HA3  H    1.293 -24.712  -6.987 1.00 . A A .   4 GLY HA3  1 1 
        6  3275 1 1  4 GLY N    N    2.851 -24.286  -5.693 1.00 . A A .   4 GLY N    1 1 
        6  3276 1 1  4 GLY O    O    1.183 -22.218  -5.117 1.00 . A A .   4 GLY O    1 1 
        6  3277 1 1  5 SER C    C   -2.135 -21.327  -7.631 1.00 . A A .   5 SER C    1 1 
        6  3278 1 1  5 SER CA   C   -0.982 -21.385  -6.634 1.00 . A A .   5 SER CA   1 1 
        6  3279 1 1  5 SER CB   C   -0.277 -20.028  -6.573 1.00 . A A .   5 SER CB   1 1 
        6  3280 1 1  5 SER H    H   -0.144 -22.902  -7.850 1.00 . A A .   5 SER H    1 1 
        6  3281 1 1  5 SER HA   H   -1.377 -21.620  -5.657 1.00 . A A .   5 SER HA   1 1 
        6  3282 1 1  5 SER HB2  H    0.735 -20.167  -6.224 1.00 . A A .   5 SER HB2  1 1 
        6  3283 1 1  5 SER HB3  H   -0.260 -19.590  -7.561 1.00 . A A .   5 SER HB3  1 1 
        6  3284 1 1  5 SER HG   H   -1.624 -18.663  -6.174 1.00 . A A .   5 SER HG   1 1 
        6  3285 1 1  5 SER N    N   -0.034 -22.432  -6.997 1.00 . A A .   5 SER N    1 1 
        6  3286 1 1  5 SER O    O   -2.022 -21.809  -8.758 1.00 . A A .   5 SER O    1 1 
        6  3287 1 1  5 SER OG   O   -0.947 -19.144  -5.692 1.00 . A A .   5 SER OG   1 1 
        6  3288 1 1  6 SER C    C   -4.599 -19.178  -8.545 1.00 . A A .   6 SER C    1 1 
        6  3289 1 1  6 SER CA   C   -4.423 -20.614  -8.060 1.00 . A A .   6 SER CA   1 1 
        6  3290 1 1  6 SER CB   C   -5.674 -21.066  -7.305 1.00 . A A .   6 SER CB   1 1 
        6  3291 1 1  6 SER H    H   -3.275 -20.367  -6.298 1.00 . A A .   6 SER H    1 1 
        6  3292 1 1  6 SER HA   H   -4.278 -21.256  -8.916 1.00 . A A .   6 SER HA   1 1 
        6  3293 1 1  6 SER HB2  H   -5.796 -20.460  -6.420 1.00 . A A .   6 SER HB2  1 1 
        6  3294 1 1  6 SER HB3  H   -6.538 -20.951  -7.943 1.00 . A A .   6 SER HB3  1 1 
        6  3295 1 1  6 SER HG   H   -4.984 -22.887  -7.519 1.00 . A A .   6 SER HG   1 1 
        6  3296 1 1  6 SER N    N   -3.246 -20.732  -7.207 1.00 . A A .   6 SER N    1 1 
        6  3297 1 1  6 SER O    O   -4.106 -18.236  -7.927 1.00 . A A .   6 SER O    1 1 
        6  3298 1 1  6 SER OG   O   -5.571 -22.425  -6.916 1.00 . A A .   6 SER OG   1 1 
        6  3299 1 1  7 GLY C    C   -5.478 -17.681 -11.724 1.00 . A A .   7 GLY C    1 1 
        6  3300 1 1  7 GLY CA   C   -5.539 -17.697 -10.210 1.00 . A A .   7 GLY CA   1 1 
        6  3301 1 1  7 GLY H    H   -5.679 -19.807 -10.110 1.00 . A A .   7 GLY H    1 1 
        6  3302 1 1  7 GLY HA2  H   -6.512 -17.352  -9.895 1.00 . A A .   7 GLY HA2  1 1 
        6  3303 1 1  7 GLY HA3  H   -4.787 -17.023  -9.824 1.00 . A A .   7 GLY HA3  1 1 
        6  3304 1 1  7 GLY N    N   -5.309 -19.019  -9.659 1.00 . A A .   7 GLY N    1 1 
        6  3305 1 1  7 GLY O    O   -4.395 -17.659 -12.308 1.00 . A A .   7 GLY O    1 1 
        6  3306 1 1  8 GLU C    C   -6.045 -16.437 -14.388 1.00 . A A .   8 GLU C    1 1 
        6  3307 1 1  8 GLU CA   C   -6.718 -17.683 -13.818 1.00 . A A .   8 GLU CA   1 1 
        6  3308 1 1  8 GLU CB   C   -8.176 -17.743 -14.278 1.00 . A A .   8 GLU CB   1 1 
        6  3309 1 1  8 GLU CD   C   -8.826 -19.839 -13.027 1.00 . A A .   8 GLU CD   1 1 
        6  3310 1 1  8 GLU CG   C   -8.725 -19.156 -14.377 1.00 . A A .   8 GLU CG   1 1 
        6  3311 1 1  8 GLU H    H   -7.474 -17.710 -11.841 1.00 . A A .   8 GLU H    1 1 
        6  3312 1 1  8 GLU HA   H   -6.199 -18.556 -14.183 1.00 . A A .   8 GLU HA   1 1 
        6  3313 1 1  8 GLU HB2  H   -8.785 -17.190 -13.577 1.00 . A A .   8 GLU HB2  1 1 
        6  3314 1 1  8 GLU HB3  H   -8.254 -17.280 -15.250 1.00 . A A .   8 GLU HB3  1 1 
        6  3315 1 1  8 GLU HG2  H   -9.711 -19.116 -14.817 1.00 . A A .   8 GLU HG2  1 1 
        6  3316 1 1  8 GLU HG3  H   -8.073 -19.738 -15.011 1.00 . A A .   8 GLU HG3  1 1 
        6  3317 1 1  8 GLU N    N   -6.644 -17.693 -12.362 1.00 . A A .   8 GLU N    1 1 
        6  3318 1 1  8 GLU O    O   -5.217 -16.525 -15.294 1.00 . A A .   8 GLU O    1 1 
        6  3319 1 1  8 GLU OE1  O   -9.176 -19.158 -12.041 1.00 . A A .   8 GLU OE1  1 1 
        6  3320 1 1  8 GLU OE2  O   -8.556 -21.057 -12.958 1.00 . A A .   8 GLU OE2  1 1 
        6  3321 1 1  9 GLY C    C   -5.449 -13.105 -13.179 1.00 . A A .   9 GLY C    1 1 
        6  3322 1 1  9 GLY CA   C   -5.831 -14.030 -14.318 1.00 . A A .   9 GLY CA   1 1 
        6  3323 1 1  9 GLY H    H   -7.073 -15.267 -13.131 1.00 . A A .   9 GLY H    1 1 
        6  3324 1 1  9 GLY HA2  H   -4.949 -14.250 -14.900 1.00 . A A .   9 GLY HA2  1 1 
        6  3325 1 1  9 GLY HA3  H   -6.550 -13.527 -14.948 1.00 . A A .   9 GLY HA3  1 1 
        6  3326 1 1  9 GLY N    N   -6.408 -15.277 -13.850 1.00 . A A .   9 GLY N    1 1 
        6  3327 1 1  9 GLY O    O   -5.532 -13.483 -12.011 1.00 . A A .   9 GLY O    1 1 
        6  3328 1 1 10 GLU C    C   -5.714  -9.856 -12.325 1.00 . A A .  10 GLU C    1 1 
        6  3329 1 1 10 GLU CA   C   -4.629 -10.912 -12.516 1.00 . A A .  10 GLU CA   1 1 
        6  3330 1 1 10 GLU CB   C   -3.315 -10.240 -12.920 1.00 . A A .  10 GLU CB   1 1 
        6  3331 1 1 10 GLU CD   C   -3.522  -9.848 -15.407 1.00 . A A .  10 GLU CD   1 1 
        6  3332 1 1 10 GLU CG   C   -3.471  -9.215 -14.030 1.00 . A A .  10 GLU CG   1 1 
        6  3333 1 1 10 GLU H    H   -4.984 -11.649 -14.469 1.00 . A A .  10 GLU H    1 1 
        6  3334 1 1 10 GLU HA   H   -4.484 -11.434 -11.583 1.00 . A A .  10 GLU HA   1 1 
        6  3335 1 1 10 GLU HB2  H   -2.897  -9.745 -12.056 1.00 . A A .  10 GLU HB2  1 1 
        6  3336 1 1 10 GLU HB3  H   -2.625 -11.001 -13.256 1.00 . A A .  10 GLU HB3  1 1 
        6  3337 1 1 10 GLU HG2  H   -4.387  -8.666 -13.869 1.00 . A A .  10 GLU HG2  1 1 
        6  3338 1 1 10 GLU HG3  H   -2.633  -8.534 -13.994 1.00 . A A .  10 GLU HG3  1 1 
        6  3339 1 1 10 GLU N    N   -5.028 -11.891 -13.520 1.00 . A A .  10 GLU N    1 1 
        6  3340 1 1 10 GLU O    O   -6.392  -9.466 -13.277 1.00 . A A .  10 GLU O    1 1 
        6  3341 1 1 10 GLU OE1  O   -2.871 -10.896 -15.603 1.00 . A A .  10 GLU OE1  1 1 
        6  3342 1 1 10 GLU OE2  O   -4.214  -9.297 -16.288 1.00 . A A .  10 GLU OE2  1 1 
        6  3343 1 1 11 LYS C    C   -6.580  -7.079 -11.499 1.00 . A A .  11 LYS C    1 1 
        6  3344 1 1 11 LYS CA   C   -6.876  -8.386 -10.771 1.00 . A A .  11 LYS CA   1 1 
        6  3345 1 1 11 LYS CB   C   -6.922  -8.142  -9.261 1.00 . A A .  11 LYS CB   1 1 
        6  3346 1 1 11 LYS CD   C   -7.098 -10.440  -8.261 1.00 . A A .  11 LYS CD   1 1 
        6  3347 1 1 11 LYS CE   C   -7.915 -11.351  -7.358 1.00 . A A .  11 LYS CE   1 1 
        6  3348 1 1 11 LYS CG   C   -7.810  -9.121  -8.513 1.00 . A A .  11 LYS CG   1 1 
        6  3349 1 1 11 LYS H    H   -5.304  -9.747 -10.372 1.00 . A A .  11 LYS H    1 1 
        6  3350 1 1 11 LYS HA   H   -7.836  -8.756 -11.096 1.00 . A A .  11 LYS HA   1 1 
        6  3351 1 1 11 LYS HB2  H   -5.921  -8.221  -8.864 1.00 . A A .  11 LYS HB2  1 1 
        6  3352 1 1 11 LYS HB3  H   -7.293  -7.143  -9.081 1.00 . A A .  11 LYS HB3  1 1 
        6  3353 1 1 11 LYS HD2  H   -6.937 -10.938  -9.205 1.00 . A A .  11 LYS HD2  1 1 
        6  3354 1 1 11 LYS HD3  H   -6.145 -10.240  -7.790 1.00 . A A .  11 LYS HD3  1 1 
        6  3355 1 1 11 LYS HE2  H   -8.958 -11.246  -7.611 1.00 . A A .  11 LYS HE2  1 1 
        6  3356 1 1 11 LYS HE3  H   -7.605 -12.372  -7.525 1.00 . A A .  11 LYS HE3  1 1 
        6  3357 1 1 11 LYS HG2  H   -8.089  -8.688  -7.564 1.00 . A A .  11 LYS HG2  1 1 
        6  3358 1 1 11 LYS HG3  H   -8.698  -9.309  -9.100 1.00 . A A .  11 LYS HG3  1 1 
        6  3359 1 1 11 LYS HZ1  H   -7.787 -11.880  -5.341 1.00 . A A .  11 LYS HZ1  1 1 
        6  3360 1 1 11 LYS HZ2  H   -8.468 -10.354  -5.608 1.00 . A A .  11 LYS HZ2  1 1 
        6  3361 1 1 11 LYS HZ3  H   -6.799 -10.576  -5.772 1.00 . A A .  11 LYS HZ3  1 1 
        6  3362 1 1 11 LYS N    N   -5.874  -9.397 -11.089 1.00 . A A .  11 LYS N    1 1 
        6  3363 1 1 11 LYS NZ   N   -7.729 -11.017  -5.919 1.00 . A A .  11 LYS NZ   1 1 
        6  3364 1 1 11 LYS O    O   -5.426  -6.710 -11.718 1.00 . A A .  11 LYS O    1 1 
        6  3365 1 1 12 PRO C    C   -6.975  -3.974 -11.696 1.00 . A A .  12 PRO C    1 1 
        6  3366 1 1 12 PRO CA   C   -7.524  -5.082 -12.590 1.00 . A A .  12 PRO CA   1 1 
        6  3367 1 1 12 PRO CB   C   -8.964  -4.769 -13.006 1.00 . A A .  12 PRO CB   1 1 
        6  3368 1 1 12 PRO CD   C   -9.050  -6.739 -11.655 1.00 . A A .  12 PRO CD   1 1 
        6  3369 1 1 12 PRO CG   C   -9.810  -5.493 -12.016 1.00 . A A .  12 PRO CG   1 1 
        6  3370 1 1 12 PRO HA   H   -6.905  -5.172 -13.470 1.00 . A A .  12 PRO HA   1 1 
        6  3371 1 1 12 PRO HB2  H   -9.130  -3.702 -12.963 1.00 . A A .  12 PRO HB2  1 1 
        6  3372 1 1 12 PRO HB3  H   -9.138  -5.126 -14.010 1.00 . A A .  12 PRO HB3  1 1 
        6  3373 1 1 12 PRO HD2  H   -9.217  -6.996 -10.619 1.00 . A A .  12 PRO HD2  1 1 
        6  3374 1 1 12 PRO HD3  H   -9.337  -7.557 -12.299 1.00 . A A .  12 PRO HD3  1 1 
        6  3375 1 1 12 PRO HG2  H   -9.960  -4.878 -11.142 1.00 . A A .  12 PRO HG2  1 1 
        6  3376 1 1 12 PRO HG3  H  -10.759  -5.750 -12.464 1.00 . A A .  12 PRO HG3  1 1 
        6  3377 1 1 12 PRO N    N   -7.645  -6.360 -11.882 1.00 . A A .  12 PRO N    1 1 
        6  3378 1 1 12 PRO O    O   -6.482  -2.957 -12.184 1.00 . A A .  12 PRO O    1 1 
        6  3379 1 1 13 TYR C    C   -5.368  -3.731  -8.665 1.00 . A A .  13 TYR C    1 1 
        6  3380 1 1 13 TYR CA   C   -6.578  -3.196  -9.425 1.00 . A A .  13 TYR CA   1 1 
        6  3381 1 1 13 TYR CB   C   -7.688  -2.822  -8.442 1.00 . A A .  13 TYR CB   1 1 
        6  3382 1 1 13 TYR CD1  C   -9.836  -2.346  -9.680 1.00 . A A .  13 TYR CD1  1 1 
        6  3383 1 1 13 TYR CD2  C   -8.554  -0.495  -8.900 1.00 . A A .  13 TYR CD2  1 1 
        6  3384 1 1 13 TYR CE1  C  -10.774  -1.481 -10.209 1.00 . A A .  13 TYR CE1  1 1 
        6  3385 1 1 13 TYR CE2  C   -9.488   0.378  -9.425 1.00 . A A .  13 TYR CE2  1 1 
        6  3386 1 1 13 TYR CG   C   -8.712  -1.870  -9.018 1.00 . A A .  13 TYR CG   1 1 
        6  3387 1 1 13 TYR CZ   C  -10.596  -0.119 -10.078 1.00 . A A .  13 TYR CZ   1 1 
        6  3388 1 1 13 TYR H    H   -7.467  -5.009 -10.059 1.00 . A A .  13 TYR H    1 1 
        6  3389 1 1 13 TYR HA   H   -6.283  -2.313  -9.974 1.00 . A A .  13 TYR HA   1 1 
        6  3390 1 1 13 TYR HB2  H   -8.205  -3.718  -8.135 1.00 . A A .  13 TYR HB2  1 1 
        6  3391 1 1 13 TYR HB3  H   -7.248  -2.351  -7.575 1.00 . A A .  13 TYR HB3  1 1 
        6  3392 1 1 13 TYR HD1  H   -9.974  -3.413  -9.781 1.00 . A A .  13 TYR HD1  1 1 
        6  3393 1 1 13 TYR HD2  H   -7.685  -0.108  -8.388 1.00 . A A .  13 TYR HD2  1 1 
        6  3394 1 1 13 TYR HE1  H  -11.642  -1.870 -10.721 1.00 . A A .  13 TYR HE1  1 1 
        6  3395 1 1 13 TYR HE2  H   -9.348   1.444  -9.322 1.00 . A A .  13 TYR HE2  1 1 
        6  3396 1 1 13 TYR HH   H  -11.571   0.631 -11.555 1.00 . A A .  13 TYR HH   1 1 
        6  3397 1 1 13 TYR N    N   -7.064  -4.179 -10.387 1.00 . A A .  13 TYR N    1 1 
        6  3398 1 1 13 TYR O    O   -5.361  -3.765  -7.435 1.00 . A A .  13 TYR O    1 1 
        6  3399 1 1 13 TYR OH   O  -11.527   0.747 -10.603 1.00 . A A .  13 TYR OH   1 1 
        6  3400 1 1 14 GLN C    C   -1.973  -3.697  -8.956 1.00 . A A .  14 GLN C    1 1 
        6  3401 1 1 14 GLN CA   C   -3.131  -4.678  -8.804 1.00 . A A .  14 GLN CA   1 1 
        6  3402 1 1 14 GLN CB   C   -2.765  -6.020  -9.442 1.00 . A A .  14 GLN CB   1 1 
        6  3403 1 1 14 GLN CD   C   -0.932  -7.750  -9.610 1.00 . A A .  14 GLN CD   1 1 
        6  3404 1 1 14 GLN CG   C   -1.645  -6.751  -8.720 1.00 . A A .  14 GLN CG   1 1 
        6  3405 1 1 14 GLN H    H   -4.412  -4.092 -10.383 1.00 . A A .  14 GLN H    1 1 
        6  3406 1 1 14 GLN HA   H   -3.322  -4.830  -7.753 1.00 . A A .  14 GLN HA   1 1 
        6  3407 1 1 14 GLN HB2  H   -3.639  -6.654  -9.443 1.00 . A A .  14 GLN HB2  1 1 
        6  3408 1 1 14 GLN HB3  H   -2.454  -5.847 -10.462 1.00 . A A .  14 GLN HB3  1 1 
        6  3409 1 1 14 GLN HE21 H   -0.284  -8.745  -8.016 1.00 . A A .  14 GLN HE21 1 1 
        6  3410 1 1 14 GLN HE22 H    0.196  -9.385  -9.547 1.00 . A A .  14 GLN HE22 1 1 
        6  3411 1 1 14 GLN HG2  H   -0.925  -6.026  -8.371 1.00 . A A .  14 GLN HG2  1 1 
        6  3412 1 1 14 GLN HG3  H   -2.063  -7.278  -7.875 1.00 . A A .  14 GLN HG3  1 1 
        6  3413 1 1 14 GLN N    N   -4.347  -4.145  -9.408 1.00 . A A .  14 GLN N    1 1 
        6  3414 1 1 14 GLN NE2  N   -0.273  -8.725  -8.996 1.00 . A A .  14 GLN NE2  1 1 
        6  3415 1 1 14 GLN O    O   -1.560  -3.375 -10.070 1.00 . A A .  14 GLN O    1 1 
        6  3416 1 1 14 GLN OE1  O   -0.974  -7.647 -10.837 1.00 . A A .  14 GLN OE1  1 1 
        6  3417 1 1 15 CYS C    C    0.816  -2.808  -8.675 1.00 . A A .  15 CYS C    1 1 
        6  3418 1 1 15 CYS CA   C   -0.343  -2.280  -7.834 1.00 . A A .  15 CYS CA   1 1 
        6  3419 1 1 15 CYS CB   C    0.132  -2.008  -6.405 1.00 . A A .  15 CYS CB   1 1 
        6  3420 1 1 15 CYS H    H   -1.825  -3.519  -6.969 1.00 . A A .  15 CYS H    1 1 
        6  3421 1 1 15 CYS HA   H   -0.695  -1.357  -8.269 1.00 . A A .  15 CYS HA   1 1 
        6  3422 1 1 15 CYS HB2  H   -0.730  -1.878  -5.767 1.00 . A A .  15 CYS HB2  1 1 
        6  3423 1 1 15 CYS HB3  H    0.705  -2.854  -6.058 1.00 . A A .  15 CYS HB3  1 1 
        6  3424 1 1 15 CYS N    N   -1.453  -3.225  -7.828 1.00 . A A .  15 CYS N    1 1 
        6  3425 1 1 15 CYS O    O    1.478  -3.776  -8.300 1.00 . A A .  15 CYS O    1 1 
        6  3426 1 1 15 CYS SG   S    1.173  -0.524  -6.237 1.00 . A A .  15 CYS SG   1 1 
        6  3427 1 1 16 SER C    C    3.465  -1.976 -10.261 1.00 . A A .  16 SER C    1 1 
        6  3428 1 1 16 SER CA   C    2.133  -2.570 -10.709 1.00 . A A .  16 SER CA   1 1 
        6  3429 1 1 16 SER CB   C    1.824  -2.135 -12.142 1.00 . A A .  16 SER CB   1 1 
        6  3430 1 1 16 SER H    H    0.494  -1.399 -10.057 1.00 . A A .  16 SER H    1 1 
        6  3431 1 1 16 SER HA   H    2.203  -3.647 -10.675 1.00 . A A .  16 SER HA   1 1 
        6  3432 1 1 16 SER HB2  H    2.627  -2.447 -12.792 1.00 . A A .  16 SER HB2  1 1 
        6  3433 1 1 16 SER HB3  H    0.901  -2.597 -12.464 1.00 . A A .  16 SER HB3  1 1 
        6  3434 1 1 16 SER HG   H    2.274  -0.308 -11.598 1.00 . A A .  16 SER HG   1 1 
        6  3435 1 1 16 SER N    N    1.056  -2.164  -9.813 1.00 . A A .  16 SER N    1 1 
        6  3436 1 1 16 SER O    O    4.293  -1.592 -11.086 1.00 . A A .  16 SER O    1 1 
        6  3437 1 1 16 SER OG   O    1.685  -0.728 -12.229 1.00 . A A .  16 SER OG   1 1 
        6  3438 1 1 17 GLU C    C    5.554  -2.355  -7.443 1.00 . A A .  17 GLU C    1 1 
        6  3439 1 1 17 GLU CA   C    4.894  -1.357  -8.391 1.00 . A A .  17 GLU CA   1 1 
        6  3440 1 1 17 GLU CB   C    4.607  -0.049  -7.652 1.00 . A A .  17 GLU CB   1 1 
        6  3441 1 1 17 GLU CD   C    5.687   1.368  -9.443 1.00 . A A .  17 GLU CD   1 1 
        6  3442 1 1 17 GLU CG   C    4.465   1.152  -8.573 1.00 . A A .  17 GLU CG   1 1 
        6  3443 1 1 17 GLU H    H    2.965  -2.228  -8.341 1.00 . A A .  17 GLU H    1 1 
        6  3444 1 1 17 GLU HA   H    5.569  -1.157  -9.210 1.00 . A A .  17 GLU HA   1 1 
        6  3445 1 1 17 GLU HB2  H    3.690  -0.159  -7.092 1.00 . A A .  17 GLU HB2  1 1 
        6  3446 1 1 17 GLU HB3  H    5.417   0.147  -6.964 1.00 . A A .  17 GLU HB3  1 1 
        6  3447 1 1 17 GLU HG2  H    3.609   0.999  -9.213 1.00 . A A .  17 GLU HG2  1 1 
        6  3448 1 1 17 GLU HG3  H    4.309   2.035  -7.971 1.00 . A A .  17 GLU HG3  1 1 
        6  3449 1 1 17 GLU N    N    3.663  -1.905  -8.948 1.00 . A A .  17 GLU N    1 1 
        6  3450 1 1 17 GLU O    O    6.762  -2.583  -7.506 1.00 . A A .  17 GLU O    1 1 
        6  3451 1 1 17 GLU OE1  O    6.813   1.332  -8.905 1.00 . A A .  17 GLU OE1  1 1 
        6  3452 1 1 17 GLU OE2  O    5.517   1.573 -10.663 1.00 . A A .  17 GLU OE2  1 1 
        6  3453 1 1 18 CYS C    C    4.716  -5.315  -5.907 1.00 . A A .  18 CYS C    1 1 
        6  3454 1 1 18 CYS CA   C    5.255  -3.920  -5.603 1.00 . A A .  18 CYS CA   1 1 
        6  3455 1 1 18 CYS CB   C    4.866  -3.510  -4.181 1.00 . A A .  18 CYS CB   1 1 
        6  3456 1 1 18 CYS H    H    3.796  -2.724  -6.563 1.00 . A A .  18 CYS H    1 1 
        6  3457 1 1 18 CYS HA   H    6.331  -3.938  -5.681 1.00 . A A .  18 CYS HA   1 1 
        6  3458 1 1 18 CYS HB2  H    4.996  -4.356  -3.522 1.00 . A A .  18 CYS HB2  1 1 
        6  3459 1 1 18 CYS HB3  H    5.510  -2.706  -3.857 1.00 . A A .  18 CYS HB3  1 1 
        6  3460 1 1 18 CYS N    N    4.751  -2.947  -6.565 1.00 . A A .  18 CYS N    1 1 
        6  3461 1 1 18 CYS O    O    5.481  -6.266  -6.066 1.00 . A A .  18 CYS O    1 1 
        6  3462 1 1 18 CYS SG   S    3.142  -2.942  -4.016 1.00 . A A .  18 CYS SG   1 1 
        6  3463 1 1 19 GLY C    C    1.652  -7.039  -5.310 1.00 . A A .  19 GLY C    1 1 
        6  3464 1 1 19 GLY CA   C    2.776  -6.710  -6.272 1.00 . A A .  19 GLY CA   1 1 
        6  3465 1 1 19 GLY H    H    2.834  -4.636  -5.851 1.00 . A A .  19 GLY H    1 1 
        6  3466 1 1 19 GLY HA2  H    2.381  -6.692  -7.277 1.00 . A A .  19 GLY HA2  1 1 
        6  3467 1 1 19 GLY HA3  H    3.528  -7.483  -6.206 1.00 . A A .  19 GLY HA3  1 1 
        6  3468 1 1 19 GLY N    N    3.394  -5.429  -5.987 1.00 . A A .  19 GLY N    1 1 
        6  3469 1 1 19 GLY O    O    1.684  -8.067  -4.633 1.00 . A A .  19 GLY O    1 1 
        6  3470 1 1 20 LYS C    C   -1.756  -5.776  -4.965 1.00 . A A .  20 LYS C    1 1 
        6  3471 1 1 20 LYS CA   C   -0.485  -6.363  -4.359 1.00 . A A .  20 LYS CA   1 1 
        6  3472 1 1 20 LYS CB   C   -0.215  -5.724  -2.995 1.00 . A A .  20 LYS CB   1 1 
        6  3473 1 1 20 LYS CD   C    1.109  -3.891  -1.902 1.00 . A A .  20 LYS CD   1 1 
        6  3474 1 1 20 LYS CE   C    0.352  -3.988  -0.586 1.00 . A A .  20 LYS CE   1 1 
        6  3475 1 1 20 LYS CG   C    0.230  -4.274  -3.080 1.00 . A A .  20 LYS CG   1 1 
        6  3476 1 1 20 LYS H    H    0.686  -5.361  -5.811 1.00 . A A .  20 LYS H    1 1 
        6  3477 1 1 20 LYS HA   H   -0.621  -7.426  -4.229 1.00 . A A .  20 LYS HA   1 1 
        6  3478 1 1 20 LYS HB2  H   -1.118  -5.768  -2.405 1.00 . A A .  20 LYS HB2  1 1 
        6  3479 1 1 20 LYS HB3  H    0.560  -6.288  -2.494 1.00 . A A .  20 LYS HB3  1 1 
        6  3480 1 1 20 LYS HD2  H    1.958  -4.557  -1.865 1.00 . A A .  20 LYS HD2  1 1 
        6  3481 1 1 20 LYS HD3  H    1.452  -2.875  -2.036 1.00 . A A .  20 LYS HD3  1 1 
        6  3482 1 1 20 LYS HE2  H    0.785  -3.292   0.116 1.00 . A A .  20 LYS HE2  1 1 
        6  3483 1 1 20 LYS HE3  H   -0.681  -3.727  -0.761 1.00 . A A .  20 LYS HE3  1 1 
        6  3484 1 1 20 LYS HG2  H    0.788  -4.131  -3.993 1.00 . A A .  20 LYS HG2  1 1 
        6  3485 1 1 20 LYS HG3  H   -0.645  -3.639  -3.087 1.00 . A A .  20 LYS HG3  1 1 
        6  3486 1 1 20 LYS HZ1  H   -0.138  -5.404   0.870 1.00 . A A .  20 LYS HZ1  1 1 
        6  3487 1 1 20 LYS HZ2  H    1.402  -5.613   0.200 1.00 . A A .  20 LYS HZ2  1 1 
        6  3488 1 1 20 LYS HZ3  H    0.029  -6.049  -0.685 1.00 . A A .  20 LYS HZ3  1 1 
        6  3489 1 1 20 LYS N    N    0.655  -6.163  -5.246 1.00 . A A .  20 LYS N    1 1 
        6  3490 1 1 20 LYS NZ   N    0.415  -5.360  -0.010 1.00 . A A .  20 LYS NZ   1 1 
        6  3491 1 1 20 LYS O    O   -1.711  -4.764  -5.665 1.00 . A A .  20 LYS O    1 1 
        6  3492 1 1 21 SER C    C   -5.067  -5.456  -4.080 1.00 . A A .  21 SER C    1 1 
        6  3493 1 1 21 SER CA   C   -4.171  -5.957  -5.209 1.00 . A A .  21 SER CA   1 1 
        6  3494 1 1 21 SER CB   C   -4.870  -7.086  -5.969 1.00 . A A .  21 SER CB   1 1 
        6  3495 1 1 21 SER H    H   -2.859  -7.216  -4.125 1.00 . A A .  21 SER H    1 1 
        6  3496 1 1 21 SER HA   H   -3.980  -5.140  -5.890 1.00 . A A .  21 SER HA   1 1 
        6  3497 1 1 21 SER HB2  H   -4.264  -7.378  -6.813 1.00 . A A .  21 SER HB2  1 1 
        6  3498 1 1 21 SER HB3  H   -5.002  -7.932  -5.310 1.00 . A A .  21 SER HB3  1 1 
        6  3499 1 1 21 SER HG   H   -6.657  -6.324  -5.709 1.00 . A A .  21 SER HG   1 1 
        6  3500 1 1 21 SER N    N   -2.888  -6.415  -4.689 1.00 . A A .  21 SER N    1 1 
        6  3501 1 1 21 SER O    O   -4.940  -5.887  -2.934 1.00 . A A .  21 SER O    1 1 
        6  3502 1 1 21 SER OG   O   -6.141  -6.672  -6.440 1.00 . A A .  21 SER OG   1 1 
        6  3503 1 1 22 PHE C    C   -8.320  -3.965  -3.965 1.00 . A A .  22 PHE C    1 1 
        6  3504 1 1 22 PHE CA   C   -6.892  -3.983  -3.428 1.00 . A A .  22 PHE CA   1 1 
        6  3505 1 1 22 PHE CB   C   -6.460  -2.566  -3.046 1.00 . A A .  22 PHE CB   1 1 
        6  3506 1 1 22 PHE CD1  C   -4.443  -3.210  -1.699 1.00 . A A .  22 PHE CD1  1 1 
        6  3507 1 1 22 PHE CD2  C   -4.180  -1.589  -3.428 1.00 . A A .  22 PHE CD2  1 1 
        6  3508 1 1 22 PHE CE1  C   -3.099  -3.107  -1.394 1.00 . A A .  22 PHE CE1  1 1 
        6  3509 1 1 22 PHE CE2  C   -2.835  -1.482  -3.128 1.00 . A A .  22 PHE CE2  1 1 
        6  3510 1 1 22 PHE CG   C   -4.999  -2.453  -2.718 1.00 . A A .  22 PHE CG   1 1 
        6  3511 1 1 22 PHE CZ   C   -2.294  -2.243  -2.110 1.00 . A A .  22 PHE CZ   1 1 
        6  3512 1 1 22 PHE H    H   -6.027  -4.240  -5.344 1.00 . A A .  22 PHE H    1 1 
        6  3513 1 1 22 PHE HA   H   -6.858  -4.610  -2.550 1.00 . A A .  22 PHE HA   1 1 
        6  3514 1 1 22 PHE HB2  H   -6.666  -1.900  -3.870 1.00 . A A .  22 PHE HB2  1 1 
        6  3515 1 1 22 PHE HB3  H   -7.022  -2.247  -2.181 1.00 . A A .  22 PHE HB3  1 1 
        6  3516 1 1 22 PHE HD1  H   -5.072  -3.887  -1.139 1.00 . A A .  22 PHE HD1  1 1 
        6  3517 1 1 22 PHE HD2  H   -4.603  -0.993  -4.224 1.00 . A A .  22 PHE HD2  1 1 
        6  3518 1 1 22 PHE HE1  H   -2.678  -3.704  -0.598 1.00 . A A .  22 PHE HE1  1 1 
        6  3519 1 1 22 PHE HE2  H   -2.208  -0.806  -3.689 1.00 . A A .  22 PHE HE2  1 1 
        6  3520 1 1 22 PHE HZ   H   -1.244  -2.161  -1.873 1.00 . A A .  22 PHE HZ   1 1 
        6  3521 1 1 22 PHE N    N   -5.974  -4.544  -4.413 1.00 . A A .  22 PHE N    1 1 
        6  3522 1 1 22 PHE O    O   -8.557  -4.243  -5.140 1.00 . A A .  22 PHE O    1 1 
        6  3523 1 1 23 SER C    C  -11.147  -2.141  -3.619 1.00 . A A .  23 SER C    1 1 
        6  3524 1 1 23 SER CA   C  -10.674  -3.584  -3.477 1.00 . A A .  23 SER CA   1 1 
        6  3525 1 1 23 SER CB   C  -11.534  -4.315  -2.444 1.00 . A A .  23 SER CB   1 1 
        6  3526 1 1 23 SER H    H   -9.017  -3.424  -2.170 1.00 . A A .  23 SER H    1 1 
        6  3527 1 1 23 SER HA   H  -10.776  -4.080  -4.432 1.00 . A A .  23 SER HA   1 1 
        6  3528 1 1 23 SER HB2  H  -11.183  -4.073  -1.452 1.00 . A A .  23 SER HB2  1 1 
        6  3529 1 1 23 SER HB3  H  -12.562  -4.000  -2.548 1.00 . A A .  23 SER HB3  1 1 
        6  3530 1 1 23 SER HG   H  -10.578  -6.025  -2.419 1.00 . A A .  23 SER HG   1 1 
        6  3531 1 1 23 SER N    N   -9.269  -3.635  -3.094 1.00 . A A .  23 SER N    1 1 
        6  3532 1 1 23 SER O    O  -11.856  -1.620  -2.759 1.00 . A A .  23 SER O    1 1 
        6  3533 1 1 23 SER OG   O  -11.465  -5.719  -2.624 1.00 . A A .  23 SER OG   1 1 
        6  3534 1 1 24 GLY C    C  -10.006   0.715  -5.512 1.00 . A A .  24 GLY C    1 1 
        6  3535 1 1 24 GLY CA   C  -11.139  -0.121  -4.949 1.00 . A A .  24 GLY CA   1 1 
        6  3536 1 1 24 GLY H    H  -10.183  -1.964  -5.365 1.00 . A A .  24 GLY H    1 1 
        6  3537 1 1 24 GLY HA2  H  -11.964  -0.107  -5.646 1.00 . A A .  24 GLY HA2  1 1 
        6  3538 1 1 24 GLY HA3  H  -11.462   0.314  -4.015 1.00 . A A .  24 GLY HA3  1 1 
        6  3539 1 1 24 GLY N    N  -10.748  -1.499  -4.713 1.00 . A A .  24 GLY N    1 1 
        6  3540 1 1 24 GLY O    O   -8.836   0.353  -5.386 1.00 . A A .  24 GLY O    1 1 
        6  3541 1 1 25 SER C    C   -8.691   3.579  -5.655 1.00 . A A .  25 SER C    1 1 
        6  3542 1 1 25 SER CA   C   -9.358   2.722  -6.727 1.00 . A A .  25 SER CA   1 1 
        6  3543 1 1 25 SER CB   C  -10.005   3.619  -7.783 1.00 . A A .  25 SER CB   1 1 
        6  3544 1 1 25 SER H    H  -11.303   2.069  -6.205 1.00 . A A .  25 SER H    1 1 
        6  3545 1 1 25 SER HA   H   -8.606   2.108  -7.200 1.00 . A A .  25 SER HA   1 1 
        6  3546 1 1 25 SER HB2  H   -9.248   4.241  -8.237 1.00 . A A .  25 SER HB2  1 1 
        6  3547 1 1 25 SER HB3  H  -10.466   3.003  -8.541 1.00 . A A .  25 SER HB3  1 1 
        6  3548 1 1 25 SER HG   H  -11.799   4.405  -7.730 1.00 . A A .  25 SER HG   1 1 
        6  3549 1 1 25 SER N    N  -10.354   1.835  -6.137 1.00 . A A .  25 SER N    1 1 
        6  3550 1 1 25 SER O    O   -7.465   3.605  -5.539 1.00 . A A .  25 SER O    1 1 
        6  3551 1 1 25 SER OG   O  -10.995   4.453  -7.207 1.00 . A A .  25 SER OG   1 1 
        6  3552 1 1 26 TYR C    C   -7.893   4.436  -3.025 1.00 . A A .  26 TYR C    1 1 
        6  3553 1 1 26 TYR CA   C   -8.997   5.138  -3.812 1.00 . A A .  26 TYR CA   1 1 
        6  3554 1 1 26 TYR CB   C  -10.130   5.546  -2.869 1.00 . A A .  26 TYR CB   1 1 
        6  3555 1 1 26 TYR CD1  C   -9.371   7.870  -2.238 1.00 . A A .  26 TYR CD1  1 1 
        6  3556 1 1 26 TYR CD2  C   -9.692   6.279  -0.493 1.00 . A A .  26 TYR CD2  1 1 
        6  3557 1 1 26 TYR CE1  C   -8.998   8.822  -1.309 1.00 . A A .  26 TYR CE1  1 1 
        6  3558 1 1 26 TYR CE2  C   -9.322   7.225   0.444 1.00 . A A .  26 TYR CE2  1 1 
        6  3559 1 1 26 TYR CG   C   -9.724   6.584  -1.848 1.00 . A A .  26 TYR CG   1 1 
        6  3560 1 1 26 TYR CZ   C   -8.976   8.495   0.031 1.00 . A A .  26 TYR CZ   1 1 
        6  3561 1 1 26 TYR H    H  -10.474   4.215  -5.014 1.00 . A A .  26 TYR H    1 1 
        6  3562 1 1 26 TYR HA   H   -8.587   6.025  -4.272 1.00 . A A .  26 TYR HA   1 1 
        6  3563 1 1 26 TYR HB2  H  -10.943   5.953  -3.450 1.00 . A A .  26 TYR HB2  1 1 
        6  3564 1 1 26 TYR HB3  H  -10.477   4.673  -2.335 1.00 . A A .  26 TYR HB3  1 1 
        6  3565 1 1 26 TYR HD1  H   -9.389   8.123  -3.288 1.00 . A A .  26 TYR HD1  1 1 
        6  3566 1 1 26 TYR HD2  H   -9.963   5.284  -0.173 1.00 . A A .  26 TYR HD2  1 1 
        6  3567 1 1 26 TYR HE1  H   -8.727   9.817  -1.632 1.00 . A A .  26 TYR HE1  1 1 
        6  3568 1 1 26 TYR HE2  H   -9.304   6.969   1.493 1.00 . A A .  26 TYR HE2  1 1 
        6  3569 1 1 26 TYR HH   H   -8.101  10.133   0.529 1.00 . A A .  26 TYR HH   1 1 
        6  3570 1 1 26 TYR N    N   -9.506   4.277  -4.873 1.00 . A A .  26 TYR N    1 1 
        6  3571 1 1 26 TYR O    O   -6.834   5.011  -2.773 1.00 . A A .  26 TYR O    1 1 
        6  3572 1 1 26 TYR OH   O   -8.606   9.439   0.961 1.00 . A A .  26 TYR OH   1 1 
        6  3573 1 1 27 ARG C    C   -5.859   2.303  -2.635 1.00 . A A .  27 ARG C    1 1 
        6  3574 1 1 27 ARG CA   C   -7.181   2.410  -1.881 1.00 . A A .  27 ARG CA   1 1 
        6  3575 1 1 27 ARG CB   C   -7.732   1.012  -1.595 1.00 . A A .  27 ARG CB   1 1 
        6  3576 1 1 27 ARG CD   C   -7.135   0.841   0.840 1.00 . A A .  27 ARG CD   1 1 
        6  3577 1 1 27 ARG CG   C   -6.939   0.248  -0.546 1.00 . A A .  27 ARG CG   1 1 
        6  3578 1 1 27 ARG CZ   C   -8.944   1.162   2.473 1.00 . A A .  27 ARG CZ   1 1 
        6  3579 1 1 27 ARG H    H   -9.013   2.787  -2.870 1.00 . A A .  27 ARG H    1 1 
        6  3580 1 1 27 ARG HA   H   -7.007   2.917  -0.944 1.00 . A A .  27 ARG HA   1 1 
        6  3581 1 1 27 ARG HB2  H   -8.751   1.103  -1.248 1.00 . A A .  27 ARG HB2  1 1 
        6  3582 1 1 27 ARG HB3  H   -7.721   0.440  -2.510 1.00 . A A .  27 ARG HB3  1 1 
        6  3583 1 1 27 ARG HD2  H   -6.458   0.351   1.525 1.00 . A A .  27 ARG HD2  1 1 
        6  3584 1 1 27 ARG HD3  H   -6.907   1.895   0.802 1.00 . A A .  27 ARG HD3  1 1 
        6  3585 1 1 27 ARG HE   H   -9.121   0.157   0.759 1.00 . A A .  27 ARG HE   1 1 
        6  3586 1 1 27 ARG HG2  H   -7.271  -0.780  -0.536 1.00 . A A .  27 ARG HG2  1 1 
        6  3587 1 1 27 ARG HG3  H   -5.891   0.288  -0.802 1.00 . A A .  27 ARG HG3  1 1 
        6  3588 1 1 27 ARG HH11 H   -7.182   2.010   2.979 1.00 . A A .  27 ARG HH11 1 1 
        6  3589 1 1 27 ARG HH12 H   -8.466   2.230   4.121 1.00 . A A .  27 ARG HH12 1 1 
        6  3590 1 1 27 ARG HH21 H  -10.819   0.439   2.255 1.00 . A A .  27 ARG HH21 1 1 
        6  3591 1 1 27 ARG HH22 H  -10.534   1.335   3.709 1.00 . A A .  27 ARG HH22 1 1 
        6  3592 1 1 27 ARG N    N   -8.151   3.191  -2.639 1.00 . A A .  27 ARG N    1 1 
        6  3593 1 1 27 ARG NE   N   -8.502   0.668   1.322 1.00 . A A .  27 ARG NE   1 1 
        6  3594 1 1 27 ARG NH1  N   -8.130   1.857   3.256 1.00 . A A .  27 ARG NH1  1 1 
        6  3595 1 1 27 ARG NH2  N  -10.203   0.963   2.843 1.00 . A A .  27 ARG NH2  1 1 
        6  3596 1 1 27 ARG O    O   -4.793   2.585  -2.086 1.00 . A A .  27 ARG O    1 1 
        6  3597 1 1 28 LEU C    C   -3.947   3.049  -4.766 1.00 . A A .  28 LEU C    1 1 
        6  3598 1 1 28 LEU CA   C   -4.745   1.750  -4.728 1.00 . A A .  28 LEU CA   1 1 
        6  3599 1 1 28 LEU CB   C   -5.138   1.337  -6.148 1.00 . A A .  28 LEU CB   1 1 
        6  3600 1 1 28 LEU CD1  C   -3.611  -0.549  -6.775 1.00 . A A .  28 LEU CD1  1 1 
        6  3601 1 1 28 LEU CD2  C   -4.376   1.070  -8.521 1.00 . A A .  28 LEU CD2  1 1 
        6  3602 1 1 28 LEU CG   C   -3.992   0.895  -7.059 1.00 . A A .  28 LEU CG   1 1 
        6  3603 1 1 28 LEU H    H   -6.813   1.686  -4.280 1.00 . A A .  28 LEU H    1 1 
        6  3604 1 1 28 LEU HA   H   -4.130   0.976  -4.294 1.00 . A A .  28 LEU HA   1 1 
        6  3605 1 1 28 LEU HB2  H   -5.835   0.518  -6.073 1.00 . A A .  28 LEU HB2  1 1 
        6  3606 1 1 28 LEU HB3  H   -5.626   2.182  -6.614 1.00 . A A .  28 LEU HB3  1 1 
        6  3607 1 1 28 LEU HD11 H   -2.795  -0.574  -6.069 1.00 . A A .  28 LEU HD11 1 1 
        6  3608 1 1 28 LEU HD12 H   -3.308  -1.029  -7.694 1.00 . A A .  28 LEU HD12 1 1 
        6  3609 1 1 28 LEU HD13 H   -4.462  -1.071  -6.361 1.00 . A A .  28 LEU HD13 1 1 
        6  3610 1 1 28 LEU HD21 H   -4.673   0.116  -8.932 1.00 . A A .  28 LEU HD21 1 1 
        6  3611 1 1 28 LEU HD22 H   -3.528   1.451  -9.072 1.00 . A A .  28 LEU HD22 1 1 
        6  3612 1 1 28 LEU HD23 H   -5.197   1.768  -8.597 1.00 . A A .  28 LEU HD23 1 1 
        6  3613 1 1 28 LEU HG   H   -3.126   1.513  -6.863 1.00 . A A .  28 LEU HG   1 1 
        6  3614 1 1 28 LEU N    N   -5.936   1.895  -3.897 1.00 . A A .  28 LEU N    1 1 
        6  3615 1 1 28 LEU O    O   -2.791   3.094  -4.342 1.00 . A A .  28 LEU O    1 1 
        6  3616 1 1 29 THR C    C   -3.229   5.771  -4.059 1.00 . A A .  29 THR C    1 1 
        6  3617 1 1 29 THR CA   C   -3.919   5.407  -5.369 1.00 . A A .  29 THR CA   1 1 
        6  3618 1 1 29 THR CB   C   -4.926   6.516  -5.730 1.00 . A A .  29 THR CB   1 1 
        6  3619 1 1 29 THR CG2  C   -5.533   6.270  -7.103 1.00 . A A .  29 THR CG2  1 1 
        6  3620 1 1 29 THR H    H   -5.491   4.008  -5.598 1.00 . A A .  29 THR H    1 1 
        6  3621 1 1 29 THR HA   H   -3.178   5.354  -6.153 1.00 . A A .  29 THR HA   1 1 
        6  3622 1 1 29 THR HB   H   -4.406   7.463  -5.747 1.00 . A A .  29 THR HB   1 1 
        6  3623 1 1 29 THR HG1  H   -6.402   5.718  -4.692 1.00 . A A .  29 THR HG1  1 1 
        6  3624 1 1 29 THR HG21 H   -4.892   6.696  -7.860 1.00 . A A .  29 THR HG21 1 1 
        6  3625 1 1 29 THR HG22 H   -6.507   6.732  -7.154 1.00 . A A .  29 THR HG22 1 1 
        6  3626 1 1 29 THR HG23 H   -5.629   5.207  -7.269 1.00 . A A .  29 THR HG23 1 1 
        6  3627 1 1 29 THR N    N   -4.571   4.107  -5.276 1.00 . A A .  29 THR N    1 1 
        6  3628 1 1 29 THR O    O   -2.030   6.049  -4.037 1.00 . A A .  29 THR O    1 1 
        6  3629 1 1 29 THR OG1  O   -5.966   6.572  -4.747 1.00 . A A .  29 THR OG1  1 1 
        6  3630 1 1 30 GLN C    C   -2.130   5.373  -1.416 1.00 . A A .  30 GLN C    1 1 
        6  3631 1 1 30 GLN CA   C   -3.452   6.095  -1.658 1.00 . A A .  30 GLN CA   1 1 
        6  3632 1 1 30 GLN CB   C   -4.455   5.728  -0.564 1.00 . A A .  30 GLN CB   1 1 
        6  3633 1 1 30 GLN CD   C   -5.415   7.983   0.052 1.00 . A A .  30 GLN CD   1 1 
        6  3634 1 1 30 GLN CG   C   -5.688   6.617  -0.546 1.00 . A A .  30 GLN CG   1 1 
        6  3635 1 1 30 GLN H    H   -4.940   5.535  -3.054 1.00 . A A .  30 GLN H    1 1 
        6  3636 1 1 30 GLN HA   H   -3.276   7.160  -1.630 1.00 . A A .  30 GLN HA   1 1 
        6  3637 1 1 30 GLN HB2  H   -4.775   4.708  -0.713 1.00 . A A .  30 GLN HB2  1 1 
        6  3638 1 1 30 GLN HB3  H   -3.967   5.807   0.397 1.00 . A A .  30 GLN HB3  1 1 
        6  3639 1 1 30 GLN HE21 H   -5.856   8.856  -1.679 1.00 . A A .  30 GLN HE21 1 1 
        6  3640 1 1 30 GLN HE22 H   -5.404   9.920  -0.395 1.00 . A A .  30 GLN HE22 1 1 
        6  3641 1 1 30 GLN HG2  H   -6.037   6.748  -1.559 1.00 . A A .  30 GLN HG2  1 1 
        6  3642 1 1 30 GLN HG3  H   -6.457   6.132   0.038 1.00 . A A .  30 GLN HG3  1 1 
        6  3643 1 1 30 GLN N    N   -3.992   5.766  -2.972 1.00 . A A .  30 GLN N    1 1 
        6  3644 1 1 30 GLN NE2  N   -5.573   9.025  -0.756 1.00 . A A .  30 GLN NE2  1 1 
        6  3645 1 1 30 GLN O    O   -1.124   5.995  -1.076 1.00 . A A .  30 GLN O    1 1 
        6  3646 1 1 30 GLN OE1  O   -5.064   8.101   1.226 1.00 . A A .  30 GLN OE1  1 1 
        6  3647 1 1 31 HIS C    C    0.159   3.661  -2.367 1.00 . A A .  31 HIS C    1 1 
        6  3648 1 1 31 HIS CA   C   -0.942   3.248  -1.395 1.00 . A A .  31 HIS CA   1 1 
        6  3649 1 1 31 HIS CB   C   -1.266   1.764  -1.573 1.00 . A A .  31 HIS CB   1 1 
        6  3650 1 1 31 HIS CD2  C    0.383   0.414  -3.051 1.00 . A A .  31 HIS CD2  1 1 
        6  3651 1 1 31 HIS CE1  C    1.778  -0.216  -1.482 1.00 . A A .  31 HIS CE1  1 1 
        6  3652 1 1 31 HIS CG   C   -0.066   0.922  -1.880 1.00 . A A .  31 HIS CG   1 1 
        6  3653 1 1 31 HIS H    H   -2.973   3.617  -1.865 1.00 . A A .  31 HIS H    1 1 
        6  3654 1 1 31 HIS HA   H   -0.595   3.413  -0.386 1.00 . A A .  31 HIS HA   1 1 
        6  3655 1 1 31 HIS HB2  H   -1.711   1.388  -0.664 1.00 . A A .  31 HIS HB2  1 1 
        6  3656 1 1 31 HIS HB3  H   -1.969   1.651  -2.386 1.00 . A A .  31 HIS HB3  1 1 
        6  3657 1 1 31 HIS HD1  H    0.778   0.717   0.040 1.00 . A A .  31 HIS HD1  1 1 
        6  3658 1 1 31 HIS HD2  H   -0.076   0.538  -4.022 1.00 . A A .  31 HIS HD2  1 1 
        6  3659 1 1 31 HIS HE1  H    2.614  -0.671  -0.973 1.00 . A A .  31 HIS HE1  1 1 
        6  3660 1 1 31 HIS N    N   -2.141   4.056  -1.594 1.00 . A A .  31 HIS N    1 1 
        6  3661 1 1 31 HIS ND1  N    0.829   0.509  -0.916 1.00 . A A .  31 HIS ND1  1 1 
        6  3662 1 1 31 HIS NE2  N    1.530  -0.289  -2.777 1.00 . A A .  31 HIS NE2  1 1 
        6  3663 1 1 31 HIS O    O    1.267   4.002  -1.955 1.00 . A A .  31 HIS O    1 1 
        6  3664 1 1 32 TRP C    C    1.645   5.193  -4.246 1.00 . A A .  32 TRP C    1 1 
        6  3665 1 1 32 TRP CA   C    0.809   3.997  -4.687 1.00 . A A .  32 TRP CA   1 1 
        6  3666 1 1 32 TRP CB   C    0.087   4.319  -5.997 1.00 . A A .  32 TRP CB   1 1 
        6  3667 1 1 32 TRP CD1  C   -0.860   1.970  -6.385 1.00 . A A .  32 TRP CD1  1 1 
        6  3668 1 1 32 TRP CD2  C    0.064   2.901  -8.200 1.00 . A A .  32 TRP CD2  1 1 
        6  3669 1 1 32 TRP CE2  C   -0.414   1.621  -8.545 1.00 . A A .  32 TRP CE2  1 1 
        6  3670 1 1 32 TRP CE3  C    0.685   3.675  -9.183 1.00 . A A .  32 TRP CE3  1 1 
        6  3671 1 1 32 TRP CG   C   -0.232   3.104  -6.814 1.00 . A A .  32 TRP CG   1 1 
        6  3672 1 1 32 TRP CH2  C    0.323   1.882 -10.774 1.00 . A A .  32 TRP CH2  1 1 
        6  3673 1 1 32 TRP CZ2  C   -0.289   1.102  -9.831 1.00 . A A .  32 TRP CZ2  1 1 
        6  3674 1 1 32 TRP CZ3  C    0.809   3.158 -10.459 1.00 . A A .  32 TRP CZ3  1 1 
        6  3675 1 1 32 TRP H    H   -1.056   3.346  -3.923 1.00 . A A .  32 TRP H    1 1 
        6  3676 1 1 32 TRP HA   H    1.464   3.153  -4.846 1.00 . A A .  32 TRP HA   1 1 
        6  3677 1 1 32 TRP HB2  H   -0.841   4.824  -5.775 1.00 . A A .  32 TRP HB2  1 1 
        6  3678 1 1 32 TRP HB3  H    0.712   4.968  -6.594 1.00 . A A .  32 TRP HB3  1 1 
        6  3679 1 1 32 TRP HD1  H   -1.210   1.813  -5.376 1.00 . A A .  32 TRP HD1  1 1 
        6  3680 1 1 32 TRP HE1  H   -1.387   0.187  -7.363 1.00 . A A .  32 TRP HE1  1 1 
        6  3681 1 1 32 TRP HE3  H    1.066   4.661  -8.960 1.00 . A A .  32 TRP HE3  1 1 
        6  3682 1 1 32 TRP HH2  H    0.442   1.519 -11.783 1.00 . A A .  32 TRP HH2  1 1 
        6  3683 1 1 32 TRP HZ2  H   -0.658   0.121 -10.090 1.00 . A A .  32 TRP HZ2  1 1 
        6  3684 1 1 32 TRP HZ3  H    1.286   3.743 -11.232 1.00 . A A .  32 TRP HZ3  1 1 
        6  3685 1 1 32 TRP N    N   -0.155   3.627  -3.657 1.00 . A A .  32 TRP N    1 1 
        6  3686 1 1 32 TRP NE1  N   -0.973   1.074  -7.421 1.00 . A A .  32 TRP NE1  1 1 
        6  3687 1 1 32 TRP O    O    2.775   5.372  -4.701 1.00 . A A .  32 TRP O    1 1 
        6  3688 1 1 33 ILE C    C    3.161   6.821  -2.321 1.00 . A A .  33 ILE C    1 1 
        6  3689 1 1 33 ILE CA   C    1.780   7.185  -2.856 1.00 . A A .  33 ILE CA   1 1 
        6  3690 1 1 33 ILE CB   C    0.977   7.881  -1.742 1.00 . A A .  33 ILE CB   1 1 
        6  3691 1 1 33 ILE CD1  C   -0.323   9.455  -3.262 1.00 . A A .  33 ILE CD1  1 1 
        6  3692 1 1 33 ILE CG1  C   -0.393   8.318  -2.267 1.00 . A A .  33 ILE CG1  1 1 
        6  3693 1 1 33 ILE CG2  C    1.748   9.075  -1.199 1.00 . A A .  33 ILE CG2  1 1 
        6  3694 1 1 33 ILE H    H    0.181   5.811  -3.034 1.00 . A A .  33 ILE H    1 1 
        6  3695 1 1 33 ILE HA   H    1.895   7.879  -3.676 1.00 . A A .  33 ILE HA   1 1 
        6  3696 1 1 33 ILE HB   H    0.837   7.176  -0.936 1.00 . A A .  33 ILE HB   1 1 
        6  3697 1 1 33 ILE HD11 H    0.185  10.296  -2.812 1.00 . A A .  33 ILE HD11 1 1 
        6  3698 1 1 33 ILE HD12 H    0.222   9.134  -4.138 1.00 . A A .  33 ILE HD12 1 1 
        6  3699 1 1 33 ILE HD13 H   -1.322   9.748  -3.545 1.00 . A A .  33 ILE HD13 1 1 
        6  3700 1 1 33 ILE HG12 H   -0.869   7.481  -2.753 1.00 . A A .  33 ILE HG12 1 1 
        6  3701 1 1 33 ILE HG13 H   -1.002   8.641  -1.435 1.00 . A A .  33 ILE HG13 1 1 
        6  3702 1 1 33 ILE HG21 H    2.089   9.687  -2.021 1.00 . A A .  33 ILE HG21 1 1 
        6  3703 1 1 33 ILE HG22 H    1.103   9.659  -0.560 1.00 . A A .  33 ILE HG22 1 1 
        6  3704 1 1 33 ILE HG23 H    2.598   8.727  -0.632 1.00 . A A .  33 ILE HG23 1 1 
        6  3705 1 1 33 ILE N    N    1.084   6.007  -3.359 1.00 . A A .  33 ILE N    1 1 
        6  3706 1 1 33 ILE O    O    4.152   7.487  -2.622 1.00 . A A .  33 ILE O    1 1 
        6  3707 1 1 34 THR C    C    5.537   5.103  -2.026 1.00 . A A .  34 THR C    1 1 
        6  3708 1 1 34 THR CA   C    4.478   5.303  -0.948 1.00 . A A .  34 THR CA   1 1 
        6  3709 1 1 34 THR CB   C    4.297   3.985  -0.172 1.00 . A A .  34 THR CB   1 1 
        6  3710 1 1 34 THR CG2  C    3.996   2.835  -1.121 1.00 . A A .  34 THR CG2  1 1 
        6  3711 1 1 34 THR H    H    2.395   5.268  -1.322 1.00 . A A .  34 THR H    1 1 
        6  3712 1 1 34 THR HA   H    4.820   6.060  -0.257 1.00 . A A .  34 THR HA   1 1 
        6  3713 1 1 34 THR HB   H    3.465   4.097   0.509 1.00 . A A .  34 THR HB   1 1 
        6  3714 1 1 34 THR HG1  H    5.494   2.759   0.805 1.00 . A A .  34 THR HG1  1 1 
        6  3715 1 1 34 THR HG21 H    3.338   3.178  -1.905 1.00 . A A .  34 THR HG21 1 1 
        6  3716 1 1 34 THR HG22 H    3.519   2.034  -0.576 1.00 . A A .  34 THR HG22 1 1 
        6  3717 1 1 34 THR HG23 H    4.918   2.476  -1.555 1.00 . A A .  34 THR HG23 1 1 
        6  3718 1 1 34 THR N    N    3.219   5.757  -1.525 1.00 . A A .  34 THR N    1 1 
        6  3719 1 1 34 THR O    O    6.730   5.277  -1.778 1.00 . A A .  34 THR O    1 1 
        6  3720 1 1 34 THR OG1  O    5.480   3.693   0.581 1.00 . A A .  34 THR OG1  1 1 
        6  3721 1 1 35 HIS C    C    6.510   5.840  -4.902 1.00 . A A .  35 HIS C    1 1 
        6  3722 1 1 35 HIS CA   C    6.003   4.514  -4.342 1.00 . A A .  35 HIS CA   1 1 
        6  3723 1 1 35 HIS CB   C    5.307   3.715  -5.444 1.00 . A A .  35 HIS CB   1 1 
        6  3724 1 1 35 HIS CD2  C    3.829   1.595  -5.225 1.00 . A A .  35 HIS CD2  1 1 
        6  3725 1 1 35 HIS CE1  C    5.248   0.325  -4.140 1.00 . A A .  35 HIS CE1  1 1 
        6  3726 1 1 35 HIS CG   C    4.959   2.315  -5.040 1.00 . A A .  35 HIS CG   1 1 
        6  3727 1 1 35 HIS H    H    4.130   4.614  -3.360 1.00 . A A .  35 HIS H    1 1 
        6  3728 1 1 35 HIS HA   H    6.846   3.947  -3.976 1.00 . A A .  35 HIS HA   1 1 
        6  3729 1 1 35 HIS HB2  H    4.391   4.217  -5.720 1.00 . A A .  35 HIS HB2  1 1 
        6  3730 1 1 35 HIS HB3  H    5.956   3.661  -6.306 1.00 . A A .  35 HIS HB3  1 1 
        6  3731 1 1 35 HIS HD1  H    6.737   1.727  -4.073 1.00 . A A .  35 HIS HD1  1 1 
        6  3732 1 1 35 HIS HD2  H    2.931   1.928  -5.727 1.00 . A A .  35 HIS HD2  1 1 
        6  3733 1 1 35 HIS HE1  H    5.690  -0.516  -3.628 1.00 . A A .  35 HIS HE1  1 1 
        6  3734 1 1 35 HIS N    N    5.093   4.737  -3.225 1.00 . A A .  35 HIS N    1 1 
        6  3735 1 1 35 HIS ND1  N    5.829   1.492  -4.356 1.00 . A A .  35 HIS ND1  1 1 
        6  3736 1 1 35 HIS NE2  N    4.033   0.362  -4.657 1.00 . A A .  35 HIS NE2  1 1 
        6  3737 1 1 35 HIS O    O    7.665   5.951  -5.315 1.00 . A A .  35 HIS O    1 1 
        6  3738 1 1 36 THR C    C    6.495   9.068  -4.306 1.00 . A A .  36 THR C    1 1 
        6  3739 1 1 36 THR CA   C    5.997   8.161  -5.425 1.00 . A A .  36 THR CA   1 1 
        6  3740 1 1 36 THR CB   C    4.802   8.836  -6.124 1.00 . A A .  36 THR CB   1 1 
        6  3741 1 1 36 THR CG2  C    3.907   9.535  -5.112 1.00 . A A .  36 THR CG2  1 1 
        6  3742 1 1 36 THR H    H    4.733   6.693  -4.571 1.00 . A A .  36 THR H    1 1 
        6  3743 1 1 36 THR HA   H    6.787   8.034  -6.151 1.00 . A A .  36 THR HA   1 1 
        6  3744 1 1 36 THR HB   H    4.224   8.076  -6.630 1.00 . A A .  36 THR HB   1 1 
        6  3745 1 1 36 THR HG1  H    5.940  10.345  -6.688 1.00 . A A .  36 THR HG1  1 1 
        6  3746 1 1 36 THR HG21 H    4.029   9.072  -4.145 1.00 . A A .  36 THR HG21 1 1 
        6  3747 1 1 36 THR HG22 H    2.877   9.451  -5.424 1.00 . A A .  36 THR HG22 1 1 
        6  3748 1 1 36 THR HG23 H    4.181  10.578  -5.050 1.00 . A A .  36 THR HG23 1 1 
        6  3749 1 1 36 THR N    N    5.639   6.844  -4.914 1.00 . A A .  36 THR N    1 1 
        6  3750 1 1 36 THR O    O    6.640  10.276  -4.491 1.00 . A A .  36 THR O    1 1 
        6  3751 1 1 36 THR OG1  O    5.272   9.785  -7.089 1.00 . A A .  36 THR OG1  1 1 
        6  3752 1 1 37 ARG C    C    8.643   8.790  -1.601 1.00 . A A .  37 ARG C    1 1 
        6  3753 1 1 37 ARG CA   C    7.237   9.234  -1.994 1.00 . A A .  37 ARG CA   1 1 
        6  3754 1 1 37 ARG CB   C    6.286   9.061  -0.808 1.00 . A A .  37 ARG CB   1 1 
        6  3755 1 1 37 ARG CD   C    4.605  10.329   0.563 1.00 . A A .  37 ARG CD   1 1 
        6  3756 1 1 37 ARG CG   C    5.095  10.005  -0.839 1.00 . A A .  37 ARG CG   1 1 
        6  3757 1 1 37 ARG CZ   C    5.388  11.660   2.476 1.00 . A A .  37 ARG CZ   1 1 
        6  3758 1 1 37 ARG H    H    6.620   7.511  -3.057 1.00 . A A .  37 ARG H    1 1 
        6  3759 1 1 37 ARG HA   H    7.266  10.277  -2.271 1.00 . A A .  37 ARG HA   1 1 
        6  3760 1 1 37 ARG HB2  H    5.913   8.047  -0.805 1.00 . A A .  37 ARG HB2  1 1 
        6  3761 1 1 37 ARG HB3  H    6.834   9.237   0.105 1.00 . A A .  37 ARG HB3  1 1 
        6  3762 1 1 37 ARG HD2  H    3.565  10.614   0.509 1.00 . A A .  37 ARG HD2  1 1 
        6  3763 1 1 37 ARG HD3  H    4.705   9.448   1.178 1.00 . A A .  37 ARG HD3  1 1 
        6  3764 1 1 37 ARG HE   H    5.880  12.001   0.573 1.00 . A A .  37 ARG HE   1 1 
        6  3765 1 1 37 ARG HG2  H    5.388  10.923  -1.328 1.00 . A A .  37 ARG HG2  1 1 
        6  3766 1 1 37 ARG HG3  H    4.294   9.540  -1.394 1.00 . A A .  37 ARG HG3  1 1 
        6  3767 1 1 37 ARG HH11 H    4.161  10.128   2.952 1.00 . A A .  37 ARG HH11 1 1 
        6  3768 1 1 37 ARG HH12 H    4.720  11.074   4.291 1.00 . A A .  37 ARG HH12 1 1 
        6  3769 1 1 37 ARG HH21 H    6.623  13.254   2.328 1.00 . A A .  37 ARG HH21 1 1 
        6  3770 1 1 37 ARG HH22 H    6.120  12.852   3.935 1.00 . A A .  37 ARG HH22 1 1 
        6  3771 1 1 37 ARG N    N    6.756   8.478  -3.144 1.00 . A A .  37 ARG N    1 1 
        6  3772 1 1 37 ARG NE   N    5.363  11.420   1.170 1.00 . A A .  37 ARG NE   1 1 
        6  3773 1 1 37 ARG NH1  N    4.699  10.891   3.308 1.00 . A A .  37 ARG NH1  1 1 
        6  3774 1 1 37 ARG NH2  N    6.102  12.672   2.952 1.00 . A A .  37 ARG NH2  1 1 
        6  3775 1 1 37 ARG O    O    8.844   7.664  -1.147 1.00 . A A .  37 ARG O    1 1 
        6  3776 1 1 38 GLU C    C   11.079   8.501  -0.201 1.00 . A A .  38 GLU C    1 1 
        6  3777 1 1 38 GLU CA   C   10.999   9.380  -1.445 1.00 . A A .  38 GLU CA   1 1 
        6  3778 1 1 38 GLU CB   C   11.786  10.673  -1.221 1.00 . A A .  38 GLU CB   1 1 
        6  3779 1 1 38 GLU CD   C   13.559  10.265  -2.973 1.00 . A A .  38 GLU CD   1 1 
        6  3780 1 1 38 GLU CG   C   13.271  10.539  -1.510 1.00 . A A .  38 GLU CG   1 1 
        6  3781 1 1 38 GLU H    H    9.389  10.563  -2.146 1.00 . A A .  38 GLU H    1 1 
        6  3782 1 1 38 GLU HA   H   11.432   8.846  -2.277 1.00 . A A .  38 GLU HA   1 1 
        6  3783 1 1 38 GLU HB2  H   11.383  11.442  -1.864 1.00 . A A .  38 GLU HB2  1 1 
        6  3784 1 1 38 GLU HB3  H   11.666  10.979  -0.192 1.00 . A A .  38 GLU HB3  1 1 
        6  3785 1 1 38 GLU HG2  H   13.764  11.458  -1.228 1.00 . A A .  38 GLU HG2  1 1 
        6  3786 1 1 38 GLU HG3  H   13.667   9.725  -0.921 1.00 . A A .  38 GLU HG3  1 1 
        6  3787 1 1 38 GLU N    N    9.612   9.682  -1.780 1.00 . A A .  38 GLU N    1 1 
        6  3788 1 1 38 GLU O    O   10.244   8.599   0.698 1.00 . A A .  38 GLU O    1 1 
        6  3789 1 1 38 GLU OE1  O   13.700  11.239  -3.742 1.00 . A A .  38 GLU OE1  1 1 
        6  3790 1 1 38 GLU OE2  O   13.644   9.078  -3.349 1.00 . A A .  38 GLU OE2  1 1 
        6  3791 1 1 39 LYS C    C   13.766   6.472   1.211 1.00 . A A .  39 LYS C    1 1 
        6  3792 1 1 39 LYS CA   C   12.283   6.743   0.977 1.00 . A A .  39 LYS CA   1 1 
        6  3793 1 1 39 LYS CB   C   11.543   5.425   0.741 1.00 . A A .  39 LYS CB   1 1 
        6  3794 1 1 39 LYS CD   C   11.464   3.215  -0.451 1.00 . A A .  39 LYS CD   1 1 
        6  3795 1 1 39 LYS CE   C   12.312   2.147  -1.125 1.00 . A A .  39 LYS CE   1 1 
        6  3796 1 1 39 LYS CG   C   12.254   4.494  -0.226 1.00 . A A .  39 LYS CG   1 1 
        6  3797 1 1 39 LYS H    H   12.725   7.609  -0.904 1.00 . A A .  39 LYS H    1 1 
        6  3798 1 1 39 LYS HA   H   11.875   7.223   1.854 1.00 . A A .  39 LYS HA   1 1 
        6  3799 1 1 39 LYS HB2  H   11.434   4.913   1.686 1.00 . A A .  39 LYS HB2  1 1 
        6  3800 1 1 39 LYS HB3  H   10.562   5.642   0.344 1.00 . A A .  39 LYS HB3  1 1 
        6  3801 1 1 39 LYS HD2  H   11.124   2.840   0.502 1.00 . A A .  39 LYS HD2  1 1 
        6  3802 1 1 39 LYS HD3  H   10.611   3.435  -1.079 1.00 . A A .  39 LYS HD3  1 1 
        6  3803 1 1 39 LYS HE2  H   12.745   2.563  -2.022 1.00 . A A .  39 LYS HE2  1 1 
        6  3804 1 1 39 LYS HE3  H   13.101   1.853  -0.448 1.00 . A A .  39 LYS HE3  1 1 
        6  3805 1 1 39 LYS HG2  H   12.377   4.999  -1.173 1.00 . A A .  39 LYS HG2  1 1 
        6  3806 1 1 39 LYS HG3  H   13.223   4.241   0.178 1.00 . A A .  39 LYS HG3  1 1 
        6  3807 1 1 39 LYS HZ1  H   10.496   1.137  -1.343 1.00 . A A .  39 LYS HZ1  1 1 
        6  3808 1 1 39 LYS HZ2  H   11.786   0.140  -0.889 1.00 . A A .  39 LYS HZ2  1 1 
        6  3809 1 1 39 LYS HZ3  H   11.667   0.696  -2.482 1.00 . A A .  39 LYS HZ3  1 1 
        6  3810 1 1 39 LYS N    N   12.091   7.641  -0.156 1.00 . A A .  39 LYS N    1 1 
        6  3811 1 1 39 LYS NZ   N   11.509   0.946  -1.485 1.00 . A A .  39 LYS NZ   1 1 
        6  3812 1 1 39 LYS O    O   14.567   6.425   0.278 1.00 . A A .  39 LYS O    1 1 
        6  3813 1 1 40 PRO C    C   15.992   4.630   2.431 1.00 . A A .  40 PRO C    1 1 
        6  3814 1 1 40 PRO CA   C   15.529   6.015   2.871 1.00 . A A .  40 PRO CA   1 1 
        6  3815 1 1 40 PRO CB   C   15.498   6.109   4.398 1.00 . A A .  40 PRO CB   1 1 
        6  3816 1 1 40 PRO CD   C   13.238   6.329   3.648 1.00 . A A .  40 PRO CD   1 1 
        6  3817 1 1 40 PRO CG   C   14.089   5.796   4.768 1.00 . A A .  40 PRO CG   1 1 
        6  3818 1 1 40 PRO HA   H   16.203   6.761   2.476 1.00 . A A .  40 PRO HA   1 1 
        6  3819 1 1 40 PRO HB2  H   16.186   5.390   4.819 1.00 . A A .  40 PRO HB2  1 1 
        6  3820 1 1 40 PRO HB3  H   15.775   7.105   4.707 1.00 . A A .  40 PRO HB3  1 1 
        6  3821 1 1 40 PRO HD2  H   12.379   5.695   3.493 1.00 . A A .  40 PRO HD2  1 1 
        6  3822 1 1 40 PRO HD3  H   12.929   7.342   3.859 1.00 . A A .  40 PRO HD3  1 1 
        6  3823 1 1 40 PRO HG2  H   13.962   4.728   4.860 1.00 . A A .  40 PRO HG2  1 1 
        6  3824 1 1 40 PRO HG3  H   13.836   6.287   5.697 1.00 . A A .  40 PRO HG3  1 1 
        6  3825 1 1 40 PRO N    N   14.141   6.287   2.485 1.00 . A A .  40 PRO N    1 1 
        6  3826 1 1 40 PRO O    O   15.220   3.671   2.454 1.00 . A A .  40 PRO O    1 1 
        6  3827 1 1 41 SER C    C   17.817   2.240   2.713 1.00 . A A .  41 SER C    1 1 
        6  3828 1 1 41 SER CA   C   17.820   3.266   1.583 1.00 . A A .  41 SER CA   1 1 
        6  3829 1 1 41 SER CB   C   19.247   3.472   1.070 1.00 . A A .  41 SER CB   1 1 
        6  3830 1 1 41 SER H    H   17.821   5.334   2.036 1.00 . A A .  41 SER H    1 1 
        6  3831 1 1 41 SER HA   H   17.206   2.896   0.776 1.00 . A A .  41 SER HA   1 1 
        6  3832 1 1 41 SER HB2  H   19.626   2.538   0.685 1.00 . A A .  41 SER HB2  1 1 
        6  3833 1 1 41 SER HB3  H   19.239   4.210   0.281 1.00 . A A .  41 SER HB3  1 1 
        6  3834 1 1 41 SER HG   H   19.767   3.614   2.953 1.00 . A A .  41 SER HG   1 1 
        6  3835 1 1 41 SER N    N   17.256   4.533   2.032 1.00 . A A .  41 SER N    1 1 
        6  3836 1 1 41 SER O    O   18.231   2.533   3.834 1.00 . A A .  41 SER O    1 1 
        6  3837 1 1 41 SER OG   O   20.102   3.919   2.107 1.00 . A A .  41 SER OG   1 1 
        6  3838 1 1 42 GLY C    C   17.120  -1.392   2.793 1.00 . A A .  42 GLY C    1 1 
        6  3839 1 1 42 GLY CA   C   17.297  -0.017   3.407 1.00 . A A .  42 GLY CA   1 1 
        6  3840 1 1 42 GLY H    H   17.029   0.858   1.497 1.00 . A A .  42 GLY H    1 1 
        6  3841 1 1 42 GLY HA2  H   18.216  -0.003   3.974 1.00 . A A .  42 GLY HA2  1 1 
        6  3842 1 1 42 GLY HA3  H   16.471   0.175   4.075 1.00 . A A .  42 GLY HA3  1 1 
        6  3843 1 1 42 GLY N    N   17.346   1.034   2.408 1.00 . A A .  42 GLY N    1 1 
        6  3844 1 1 42 GLY O    O   18.067  -2.170   2.676 1.00 . A A .  42 GLY O    1 1 
        6  3845 1 1 43 PRO C    C   16.150  -3.151   0.385 1.00 . A A .  43 PRO C    1 1 
        6  3846 1 1 43 PRO CA   C   15.552  -3.000   1.779 1.00 . A A .  43 PRO CA   1 1 
        6  3847 1 1 43 PRO CB   C   14.024  -2.980   1.706 1.00 . A A .  43 PRO CB   1 1 
        6  3848 1 1 43 PRO CD   C   14.704  -0.830   2.498 1.00 . A A .  43 PRO CD   1 1 
        6  3849 1 1 43 PRO CG   C   13.665  -1.535   1.671 1.00 . A A .  43 PRO CG   1 1 
        6  3850 1 1 43 PRO HA   H   15.874  -3.825   2.399 1.00 . A A .  43 PRO HA   1 1 
        6  3851 1 1 43 PRO HB2  H   13.697  -3.492   0.812 1.00 . A A .  43 PRO HB2  1 1 
        6  3852 1 1 43 PRO HB3  H   13.612  -3.467   2.577 1.00 . A A .  43 PRO HB3  1 1 
        6  3853 1 1 43 PRO HD2  H   14.913   0.147   2.089 1.00 . A A .  43 PRO HD2  1 1 
        6  3854 1 1 43 PRO HD3  H   14.377  -0.749   3.525 1.00 . A A .  43 PRO HD3  1 1 
        6  3855 1 1 43 PRO HG2  H   13.689  -1.175   0.653 1.00 . A A .  43 PRO HG2  1 1 
        6  3856 1 1 43 PRO HG3  H   12.684  -1.390   2.098 1.00 . A A .  43 PRO HG3  1 1 
        6  3857 1 1 43 PRO N    N   15.880  -1.709   2.390 1.00 . A A .  43 PRO N    1 1 
        6  3858 1 1 43 PRO O    O   15.930  -2.312  -0.489 1.00 . A A .  43 PRO O    1 1 
        6  3859 1 1 44 SER C    C   16.544  -4.298  -2.246 1.00 . A A .  44 SER C    1 1 
        6  3860 1 1 44 SER CA   C   17.540  -4.483  -1.105 1.00 . A A .  44 SER CA   1 1 
        6  3861 1 1 44 SER CB   C   18.115  -5.900  -1.140 1.00 . A A .  44 SER CB   1 1 
        6  3862 1 1 44 SER H    H   17.046  -4.857   0.919 1.00 . A A .  44 SER H    1 1 
        6  3863 1 1 44 SER HA   H   18.345  -3.774  -1.227 1.00 . A A .  44 SER HA   1 1 
        6  3864 1 1 44 SER HB2  H   18.691  -6.074  -0.243 1.00 . A A .  44 SER HB2  1 1 
        6  3865 1 1 44 SER HB3  H   17.305  -6.613  -1.191 1.00 . A A .  44 SER HB3  1 1 
        6  3866 1 1 44 SER HG   H   19.584  -6.786  -2.086 1.00 . A A .  44 SER HG   1 1 
        6  3867 1 1 44 SER N    N   16.907  -4.224   0.183 1.00 . A A .  44 SER N    1 1 
        6  3868 1 1 44 SER O    O   16.805  -3.565  -3.200 1.00 . A A .  44 SER O    1 1 
        6  3869 1 1 44 SER OG   O   18.957  -6.082  -2.265 1.00 . A A .  44 SER OG   1 1 
        6  3870 1 1 45 SER C    C   13.822  -3.463  -3.268 1.00 . A A .  45 SER C    1 1 
        6  3871 1 1 45 SER CA   C   14.367  -4.884  -3.164 1.00 . A A .  45 SER CA   1 1 
        6  3872 1 1 45 SER CB   C   13.229  -5.858  -2.853 1.00 . A A .  45 SER CB   1 1 
        6  3873 1 1 45 SER H    H   15.253  -5.539  -1.356 1.00 . A A .  45 SER H    1 1 
        6  3874 1 1 45 SER HA   H   14.813  -5.155  -4.110 1.00 . A A .  45 SER HA   1 1 
        6  3875 1 1 45 SER HB2  H   12.477  -5.787  -3.624 1.00 . A A .  45 SER HB2  1 1 
        6  3876 1 1 45 SER HB3  H   13.619  -6.865  -2.821 1.00 . A A .  45 SER HB3  1 1 
        6  3877 1 1 45 SER HG   H   12.541  -4.608  -1.509 1.00 . A A .  45 SER HG   1 1 
        6  3878 1 1 45 SER N    N   15.402  -4.970  -2.140 1.00 . A A .  45 SER N    1 1 
        6  3879 1 1 45 SER O    O   13.740  -2.743  -2.273 1.00 . A A .  45 SER O    1 1 
        6  3880 1 1 45 SER OG   O   12.631  -5.560  -1.603 1.00 . A A .  45 SER OG   1 1 
        6  3881 1 1 46 GLY C    C   11.788  -1.713  -5.706 1.00 . A A .  46 GLY C    1 1 
        6  3882 1 1 46 GLY CA   C   12.916  -1.732  -4.693 1.00 . A A .  46 GLY CA   1 1 
        6  3883 1 1 46 GLY H    H   13.536  -3.682  -5.237 1.00 . A A .  46 GLY H    1 1 
        6  3884 1 1 46 GLY HA2  H   12.548  -1.349  -3.753 1.00 . A A .  46 GLY HA2  1 1 
        6  3885 1 1 46 GLY HA3  H   13.711  -1.091  -5.045 1.00 . A A .  46 GLY HA3  1 1 
        6  3886 1 1 46 GLY N    N   13.449  -3.065  -4.481 1.00 . A A .  46 GLY N    1 1 
        6  3887 1 1 46 GLY O    O   11.182  -2.756  -5.947 1.00 . A A .  46 GLY O    1 1 
        6  3888 2 2  1 ZN  ZN   ZN   2.592  -0.863  -4.436 1.00 . B A . 181 ZN  ZN   1 1 
        7  3889 1 1  1 GLY C    C  -15.276 -22.987 -33.747 1.00 . A A .   1 GLY C    1 1 
        7  3890 1 1  1 GLY CA   C  -15.200 -24.265 -34.559 1.00 . A A .   1 GLY CA   1 1 
        7  3891 1 1  1 GLY H1   H  -17.057 -25.191 -34.979 1.00 . A A .   1 GLY H1   1 1 
        7  3892 1 1  1 GLY HA2  H  -15.018 -25.093 -33.891 1.00 . A A .   1 GLY HA2  1 1 
        7  3893 1 1  1 GLY HA3  H  -14.377 -24.187 -35.254 1.00 . A A .   1 GLY HA3  1 1 
        7  3894 1 1  1 GLY N    N  -16.419 -24.522 -35.303 1.00 . A A .   1 GLY N    1 1 
        7  3895 1 1  1 GLY O    O  -15.393 -21.896 -34.304 1.00 . A A .   1 GLY O    1 1 
        7  3896 1 1  2 SER C    C  -14.293 -22.118 -30.380 1.00 . A A .   2 SER C    1 1 
        7  3897 1 1  2 SER CA   C  -15.278 -21.970 -31.535 1.00 . A A .   2 SER CA   1 1 
        7  3898 1 1  2 SER CB   C  -16.698 -21.801 -30.992 1.00 . A A .   2 SER CB   1 1 
        7  3899 1 1  2 SER H    H  -15.117 -24.019 -32.042 1.00 . A A .   2 SER H    1 1 
        7  3900 1 1  2 SER HA   H  -15.014 -21.093 -32.108 1.00 . A A .   2 SER HA   1 1 
        7  3901 1 1  2 SER HB2  H  -16.783 -20.841 -30.505 1.00 . A A .   2 SER HB2  1 1 
        7  3902 1 1  2 SER HB3  H  -17.402 -21.854 -31.809 1.00 . A A .   2 SER HB3  1 1 
        7  3903 1 1  2 SER HG   H  -16.658 -23.656 -30.362 1.00 . A A .   2 SER HG   1 1 
        7  3904 1 1  2 SER N    N  -15.210 -23.122 -32.426 1.00 . A A .   2 SER N    1 1 
        7  3905 1 1  2 SER O    O  -14.107 -23.211 -29.844 1.00 . A A .   2 SER O    1 1 
        7  3906 1 1  2 SER OG   O  -17.009 -22.817 -30.054 1.00 . A A .   2 SER OG   1 1 
        7  3907 1 1  3 SER C    C  -13.222 -20.235 -27.711 1.00 . A A .   3 SER C    1 1 
        7  3908 1 1  3 SER CA   C  -12.695 -21.015 -28.911 1.00 . A A .   3 SER CA   1 1 
        7  3909 1 1  3 SER CB   C  -11.367 -20.418 -29.379 1.00 . A A .   3 SER CB   1 1 
        7  3910 1 1  3 SER H    H  -13.856 -20.169 -30.466 1.00 . A A .   3 SER H    1 1 
        7  3911 1 1  3 SER HA   H  -12.535 -22.042 -28.616 1.00 . A A .   3 SER HA   1 1 
        7  3912 1 1  3 SER HB2  H  -10.656 -20.448 -28.567 1.00 . A A .   3 SER HB2  1 1 
        7  3913 1 1  3 SER HB3  H  -10.989 -20.995 -30.210 1.00 . A A .   3 SER HB3  1 1 
        7  3914 1 1  3 SER HG   H  -11.688 -18.518 -29.025 1.00 . A A .   3 SER HG   1 1 
        7  3915 1 1  3 SER N    N  -13.665 -21.010 -30.000 1.00 . A A .   3 SER N    1 1 
        7  3916 1 1  3 SER O    O  -14.306 -19.654 -27.761 1.00 . A A .   3 SER O    1 1 
        7  3917 1 1  3 SER OG   O  -11.530 -19.073 -29.793 1.00 . A A .   3 SER OG   1 1 
        7  3918 1 1  4 GLY C    C  -11.697 -19.287 -24.476 1.00 . A A .   4 GLY C    1 1 
        7  3919 1 1  4 GLY CA   C  -12.851 -19.516 -25.432 1.00 . A A .   4 GLY CA   1 1 
        7  3920 1 1  4 GLY H    H  -11.593 -20.708 -26.648 1.00 . A A .   4 GLY H    1 1 
        7  3921 1 1  4 GLY HA2  H  -13.264 -18.559 -25.716 1.00 . A A .   4 GLY HA2  1 1 
        7  3922 1 1  4 GLY HA3  H  -13.614 -20.090 -24.927 1.00 . A A .   4 GLY HA3  1 1 
        7  3923 1 1  4 GLY N    N  -12.447 -20.227 -26.631 1.00 . A A .   4 GLY N    1 1 
        7  3924 1 1  4 GLY O    O  -10.707 -20.018 -24.502 1.00 . A A .   4 GLY O    1 1 
        7  3925 1 1  5 SER C    C  -11.387 -17.485 -21.344 1.00 . A A .   5 SER C    1 1 
        7  3926 1 1  5 SER CA   C  -10.780 -17.943 -22.666 1.00 . A A .   5 SER CA   1 1 
        7  3927 1 1  5 SER CB   C   -9.863 -16.852 -23.224 1.00 . A A .   5 SER CB   1 1 
        7  3928 1 1  5 SER H    H  -12.637 -17.722 -23.660 1.00 . A A .   5 SER H    1 1 
        7  3929 1 1  5 SER HA   H  -10.198 -18.836 -22.492 1.00 . A A .   5 SER HA   1 1 
        7  3930 1 1  5 SER HB2  H  -10.460 -16.011 -23.542 1.00 . A A .   5 SER HB2  1 1 
        7  3931 1 1  5 SER HB3  H   -9.176 -16.535 -22.453 1.00 . A A .   5 SER HB3  1 1 
        7  3932 1 1  5 SER HG   H   -9.713 -17.741 -24.963 1.00 . A A .   5 SER HG   1 1 
        7  3933 1 1  5 SER N    N  -11.823 -18.269 -23.631 1.00 . A A .   5 SER N    1 1 
        7  3934 1 1  5 SER O    O  -12.545 -17.071 -21.290 1.00 . A A .   5 SER O    1 1 
        7  3935 1 1  5 SER OG   O   -9.119 -17.328 -24.332 1.00 . A A .   5 SER OG   1 1 
        7  3936 1 1  6 SER C    C   -9.882 -17.032 -17.988 1.00 . A A .   6 SER C    1 1 
        7  3937 1 1  6 SER CA   C  -11.056 -17.163 -18.954 1.00 . A A .   6 SER CA   1 1 
        7  3938 1 1  6 SER CB   C  -12.066 -18.176 -18.412 1.00 . A A .   6 SER CB   1 1 
        7  3939 1 1  6 SER H    H   -9.683 -17.903 -20.385 1.00 . A A .   6 SER H    1 1 
        7  3940 1 1  6 SER HA   H  -11.538 -16.201 -19.048 1.00 . A A .   6 SER HA   1 1 
        7  3941 1 1  6 SER HB2  H  -11.792 -19.166 -18.744 1.00 . A A .   6 SER HB2  1 1 
        7  3942 1 1  6 SER HB3  H  -12.061 -18.143 -17.332 1.00 . A A .   6 SER HB3  1 1 
        7  3943 1 1  6 SER HG   H  -13.324 -17.405 -19.701 1.00 . A A .   6 SER HG   1 1 
        7  3944 1 1  6 SER N    N  -10.596 -17.564 -20.278 1.00 . A A .   6 SER N    1 1 
        7  3945 1 1  6 SER O    O   -9.003 -17.892 -17.941 1.00 . A A .   6 SER O    1 1 
        7  3946 1 1  6 SER OG   O  -13.375 -17.886 -18.871 1.00 . A A .   6 SER OG   1 1 
        7  3947 1 1  7 GLY C    C   -9.299 -15.092 -14.976 1.00 . A A .   7 GLY C    1 1 
        7  3948 1 1  7 GLY CA   C   -8.805 -15.724 -16.263 1.00 . A A .   7 GLY CA   1 1 
        7  3949 1 1  7 GLY H    H  -10.603 -15.296 -17.298 1.00 . A A .   7 GLY H    1 1 
        7  3950 1 1  7 GLY HA2  H   -8.340 -16.670 -16.031 1.00 . A A .   7 GLY HA2  1 1 
        7  3951 1 1  7 GLY HA3  H   -8.070 -15.072 -16.711 1.00 . A A .   7 GLY HA3  1 1 
        7  3952 1 1  7 GLY N    N   -9.875 -15.948 -17.217 1.00 . A A .   7 GLY N    1 1 
        7  3953 1 1  7 GLY O    O   -8.811 -14.039 -14.568 1.00 . A A .   7 GLY O    1 1 
        7  3954 1 1  8 GLU C    C   -9.942 -15.586 -11.907 1.00 . A A .   8 GLU C    1 1 
        7  3955 1 1  8 GLU CA   C  -10.834 -15.227 -13.092 1.00 . A A .   8 GLU CA   1 1 
        7  3956 1 1  8 GLU CB   C  -12.241 -15.788 -12.875 1.00 . A A .   8 GLU CB   1 1 
        7  3957 1 1  8 GLU CD   C  -14.648 -15.824 -13.639 1.00 . A A .   8 GLU CD   1 1 
        7  3958 1 1  8 GLU CG   C  -13.232 -15.380 -13.952 1.00 . A A .   8 GLU CG   1 1 
        7  3959 1 1  8 GLU H    H  -10.621 -16.570 -14.715 1.00 . A A .   8 GLU H    1 1 
        7  3960 1 1  8 GLU HA   H  -10.893 -14.152 -13.170 1.00 . A A .   8 GLU HA   1 1 
        7  3961 1 1  8 GLU HB2  H  -12.186 -16.867 -12.854 1.00 . A A .   8 GLU HB2  1 1 
        7  3962 1 1  8 GLU HB3  H  -12.611 -15.437 -11.923 1.00 . A A .   8 GLU HB3  1 1 
        7  3963 1 1  8 GLU HG2  H  -13.221 -14.305 -14.045 1.00 . A A .   8 GLU HG2  1 1 
        7  3964 1 1  8 GLU HG3  H  -12.929 -15.825 -14.889 1.00 . A A .   8 GLU HG3  1 1 
        7  3965 1 1  8 GLU N    N  -10.272 -15.735 -14.339 1.00 . A A .   8 GLU N    1 1 
        7  3966 1 1  8 GLU O    O  -10.143 -16.608 -11.252 1.00 . A A .   8 GLU O    1 1 
        7  3967 1 1  8 GLU OE1  O  -14.984 -15.939 -12.442 1.00 . A A .   8 GLU OE1  1 1 
        7  3968 1 1  8 GLU OE2  O  -15.420 -16.056 -14.593 1.00 . A A .   8 GLU OE2  1 1 
        7  3969 1 1  9 GLY C    C   -7.427 -13.706  -9.998 1.00 . A A .   9 GLY C    1 1 
        7  3970 1 1  9 GLY CA   C   -8.046 -14.982 -10.533 1.00 . A A .   9 GLY CA   1 1 
        7  3971 1 1  9 GLY H    H   -8.842 -13.938 -12.195 1.00 . A A .   9 GLY H    1 1 
        7  3972 1 1  9 GLY HA2  H   -8.589 -15.469  -9.737 1.00 . A A .   9 GLY HA2  1 1 
        7  3973 1 1  9 GLY HA3  H   -7.256 -15.637 -10.871 1.00 . A A .   9 GLY HA3  1 1 
        7  3974 1 1  9 GLY N    N   -8.955 -14.737 -11.638 1.00 . A A .   9 GLY N    1 1 
        7  3975 1 1  9 GLY O    O   -7.352 -13.507  -8.786 1.00 . A A .   9 GLY O    1 1 
        7  3976 1 1 10 GLU C    C   -7.292 -10.405 -10.809 1.00 . A A .  10 GLU C    1 1 
        7  3977 1 1 10 GLU CA   C   -6.364 -11.579 -10.514 1.00 . A A .  10 GLU CA   1 1 
        7  3978 1 1 10 GLU CB   C   -5.034 -11.389 -11.246 1.00 . A A .  10 GLU CB   1 1 
        7  3979 1 1 10 GLU CD   C   -3.440 -12.425  -9.583 1.00 . A A .  10 GLU CD   1 1 
        7  3980 1 1 10 GLU CG   C   -4.028 -12.496 -10.979 1.00 . A A .  10 GLU CG   1 1 
        7  3981 1 1 10 GLU H    H   -7.070 -13.057 -11.855 1.00 . A A .  10 GLU H    1 1 
        7  3982 1 1 10 GLU HA   H   -6.176 -11.616  -9.451 1.00 . A A .  10 GLU HA   1 1 
        7  3983 1 1 10 GLU HB2  H   -5.225 -11.352 -12.309 1.00 . A A .  10 GLU HB2  1 1 
        7  3984 1 1 10 GLU HB3  H   -4.597 -10.451 -10.936 1.00 . A A .  10 GLU HB3  1 1 
        7  3985 1 1 10 GLU HG2  H   -4.521 -13.449 -11.098 1.00 . A A .  10 GLU HG2  1 1 
        7  3986 1 1 10 GLU HG3  H   -3.225 -12.415 -11.697 1.00 . A A .  10 GLU HG3  1 1 
        7  3987 1 1 10 GLU N    N   -6.982 -12.841 -10.903 1.00 . A A .  10 GLU N    1 1 
        7  3988 1 1 10 GLU O    O   -7.896 -10.329 -11.879 1.00 . A A .  10 GLU O    1 1 
        7  3989 1 1 10 GLU OE1  O   -2.676 -11.477  -9.308 1.00 . A A .  10 GLU OE1  1 1 
        7  3990 1 1 10 GLU OE2  O   -3.746 -13.319  -8.766 1.00 . A A .  10 GLU OE2  1 1 
        7  3991 1 1 11 LYS C    C   -7.626  -7.308 -10.958 1.00 . A A .  11 LYS C    1 1 
        7  3992 1 1 11 LYS CA   C   -8.257  -8.319 -10.006 1.00 . A A .  11 LYS CA   1 1 
        7  3993 1 1 11 LYS CB   C   -8.511  -7.664  -8.646 1.00 . A A .  11 LYS CB   1 1 
        7  3994 1 1 11 LYS CD   C   -9.936  -7.623  -6.578 1.00 . A A .  11 LYS CD   1 1 
        7  3995 1 1 11 LYS CE   C  -11.009  -8.350  -5.782 1.00 . A A .  11 LYS CE   1 1 
        7  3996 1 1 11 LYS CG   C   -9.464  -8.450  -7.762 1.00 . A A .  11 LYS CG   1 1 
        7  3997 1 1 11 LYS H    H   -6.897  -9.606  -9.019 1.00 . A A .  11 LYS H    1 1 
        7  3998 1 1 11 LYS HA   H   -9.198  -8.646 -10.420 1.00 . A A .  11 LYS HA   1 1 
        7  3999 1 1 11 LYS HB2  H   -7.570  -7.564  -8.126 1.00 . A A .  11 LYS HB2  1 1 
        7  4000 1 1 11 LYS HB3  H   -8.930  -6.681  -8.806 1.00 . A A .  11 LYS HB3  1 1 
        7  4001 1 1 11 LYS HD2  H   -9.095  -7.425  -5.929 1.00 . A A .  11 LYS HD2  1 1 
        7  4002 1 1 11 LYS HD3  H  -10.340  -6.688  -6.941 1.00 . A A .  11 LYS HD3  1 1 
        7  4003 1 1 11 LYS HE2  H  -11.636  -7.619  -5.295 1.00 . A A .  11 LYS HE2  1 1 
        7  4004 1 1 11 LYS HE3  H  -11.606  -8.939  -6.463 1.00 . A A .  11 LYS HE3  1 1 
        7  4005 1 1 11 LYS HG2  H  -10.323  -8.745  -8.346 1.00 . A A .  11 LYS HG2  1 1 
        7  4006 1 1 11 LYS HG3  H   -8.956  -9.330  -7.394 1.00 . A A .  11 LYS HG3  1 1 
        7  4007 1 1 11 LYS HZ1  H  -10.817 -10.207  -4.844 1.00 . A A .  11 LYS HZ1  1 1 
        7  4008 1 1 11 LYS HZ2  H  -10.636  -8.888  -3.799 1.00 . A A .  11 LYS HZ2  1 1 
        7  4009 1 1 11 LYS HZ3  H   -9.389  -9.299  -4.866 1.00 . A A .  11 LYS HZ3  1 1 
        7  4010 1 1 11 LYS N    N   -7.403  -9.490  -9.851 1.00 . A A .  11 LYS N    1 1 
        7  4011 1 1 11 LYS NZ   N  -10.422  -9.249  -4.751 1.00 . A A .  11 LYS NZ   1 1 
        7  4012 1 1 11 LYS O    O   -6.408  -7.260 -11.133 1.00 . A A .  11 LYS O    1 1 
        7  4013 1 1 12 PRO C    C   -7.269  -4.320 -11.840 1.00 . A A .  12 PRO C    1 1 
        7  4014 1 1 12 PRO CA   C   -8.018  -5.453 -12.532 1.00 . A A .  12 PRO CA   1 1 
        7  4015 1 1 12 PRO CB   C   -9.322  -4.936 -13.146 1.00 . A A .  12 PRO CB   1 1 
        7  4016 1 1 12 PRO CD   C   -9.935  -6.480 -11.428 1.00 . A A .  12 PRO CD   1 1 
        7  4017 1 1 12 PRO CG   C  -10.362  -5.213 -12.117 1.00 . A A .  12 PRO CG   1 1 
        7  4018 1 1 12 PRO HA   H   -7.395  -5.874 -13.307 1.00 . A A .  12 PRO HA   1 1 
        7  4019 1 1 12 PRO HB2  H   -9.234  -3.877 -13.344 1.00 . A A .  12 PRO HB2  1 1 
        7  4020 1 1 12 PRO HB3  H   -9.525  -5.464 -14.065 1.00 . A A .  12 PRO HB3  1 1 
        7  4021 1 1 12 PRO HD2  H  -10.209  -6.452 -10.384 1.00 . A A .  12 PRO HD2  1 1 
        7  4022 1 1 12 PRO HD3  H  -10.375  -7.340 -11.912 1.00 . A A .  12 PRO HD3  1 1 
        7  4023 1 1 12 PRO HG2  H  -10.406  -4.399 -11.410 1.00 . A A .  12 PRO HG2  1 1 
        7  4024 1 1 12 PRO HG3  H  -11.322  -5.351 -12.593 1.00 . A A .  12 PRO HG3  1 1 
        7  4025 1 1 12 PRO N    N   -8.472  -6.479 -11.588 1.00 . A A .  12 PRO N    1 1 
        7  4026 1 1 12 PRO O    O   -6.835  -3.364 -12.485 1.00 . A A .  12 PRO O    1 1 
        7  4027 1 1 13 TYR C    C   -5.168  -3.989  -9.098 1.00 . A A .  13 TYR C    1 1 
        7  4028 1 1 13 TYR CA   C   -6.424  -3.415  -9.745 1.00 . A A .  13 TYR CA   1 1 
        7  4029 1 1 13 TYR CB   C   -7.351  -2.845  -8.669 1.00 . A A .  13 TYR CB   1 1 
        7  4030 1 1 13 TYR CD1  C   -9.720  -2.771  -9.538 1.00 . A A .  13 TYR CD1  1 1 
        7  4031 1 1 13 TYR CD2  C   -8.491  -0.731  -9.448 1.00 . A A .  13 TYR CD2  1 1 
        7  4032 1 1 13 TYR CE1  C  -10.812  -2.096 -10.050 1.00 . A A .  13 TYR CE1  1 1 
        7  4033 1 1 13 TYR CE2  C   -9.578  -0.048  -9.959 1.00 . A A .  13 TYR CE2  1 1 
        7  4034 1 1 13 TYR CG   C   -8.543  -2.102  -9.229 1.00 . A A .  13 TYR CG   1 1 
        7  4035 1 1 13 TYR CZ   C  -10.736  -0.735 -10.258 1.00 . A A .  13 TYR CZ   1 1 
        7  4036 1 1 13 TYR H    H   -7.488  -5.216 -10.067 1.00 . A A .  13 TYR H    1 1 
        7  4037 1 1 13 TYR HA   H   -6.138  -2.620 -10.417 1.00 . A A .  13 TYR HA   1 1 
        7  4038 1 1 13 TYR HB2  H   -7.721  -3.653  -8.058 1.00 . A A .  13 TYR HB2  1 1 
        7  4039 1 1 13 TYR HB3  H   -6.792  -2.158  -8.050 1.00 . A A .  13 TYR HB3  1 1 
        7  4040 1 1 13 TYR HD1  H   -9.777  -3.837  -9.374 1.00 . A A .  13 TYR HD1  1 1 
        7  4041 1 1 13 TYR HD2  H   -7.582  -0.196  -9.213 1.00 . A A .  13 TYR HD2  1 1 
        7  4042 1 1 13 TYR HE1  H  -11.719  -2.634 -10.284 1.00 . A A .  13 TYR HE1  1 1 
        7  4043 1 1 13 TYR HE2  H   -9.519   1.018 -10.122 1.00 . A A .  13 TYR HE2  1 1 
        7  4044 1 1 13 TYR HH   H  -11.994   0.719 -10.231 1.00 . A A .  13 TYR HH   1 1 
        7  4045 1 1 13 TYR N    N   -7.120  -4.432 -10.525 1.00 . A A .  13 TYR N    1 1 
        7  4046 1 1 13 TYR O    O   -5.170  -4.338  -7.917 1.00 . A A .  13 TYR O    1 1 
        7  4047 1 1 13 TYR OH   O  -11.821  -0.058 -10.767 1.00 . A A .  13 TYR OH   1 1 
        7  4048 1 1 14 GLN C    C   -1.741  -3.553  -9.428 1.00 . A A .  14 GLN C    1 1 
        7  4049 1 1 14 GLN CA   C   -2.834  -4.616  -9.384 1.00 . A A .  14 GLN CA   1 1 
        7  4050 1 1 14 GLN CB   C   -2.411  -5.834 -10.206 1.00 . A A .  14 GLN CB   1 1 
        7  4051 1 1 14 GLN CD   C   -0.495  -7.377 -10.782 1.00 . A A .  14 GLN CD   1 1 
        7  4052 1 1 14 GLN CG   C   -1.106  -6.459  -9.741 1.00 . A A .  14 GLN CG   1 1 
        7  4053 1 1 14 GLN H    H   -4.159  -3.789 -10.812 1.00 . A A .  14 GLN H    1 1 
        7  4054 1 1 14 GLN HA   H   -2.982  -4.919  -8.358 1.00 . A A .  14 GLN HA   1 1 
        7  4055 1 1 14 GLN HB2  H   -3.187  -6.583 -10.143 1.00 . A A .  14 GLN HB2  1 1 
        7  4056 1 1 14 GLN HB3  H   -2.295  -5.535 -11.237 1.00 . A A .  14 GLN HB3  1 1 
        7  4057 1 1 14 GLN HE21 H    1.283  -7.231  -9.903 1.00 . A A .  14 GLN HE21 1 1 
        7  4058 1 1 14 GLN HE22 H    1.221  -8.229 -11.311 1.00 . A A .  14 GLN HE22 1 1 
        7  4059 1 1 14 GLN HG2  H   -0.402  -5.670  -9.523 1.00 . A A .  14 GLN HG2  1 1 
        7  4060 1 1 14 GLN HG3  H   -1.294  -7.030  -8.844 1.00 . A A .  14 GLN HG3  1 1 
        7  4061 1 1 14 GLN N    N   -4.098  -4.084  -9.880 1.00 . A A .  14 GLN N    1 1 
        7  4062 1 1 14 GLN NE2  N    0.801  -7.638 -10.653 1.00 . A A .  14 GLN NE2  1 1 
        7  4063 1 1 14 GLN O    O   -1.292  -3.154 -10.503 1.00 . A A .  14 GLN O    1 1 
        7  4064 1 1 14 GLN OE1  O   -1.180  -7.846 -11.692 1.00 . A A .  14 GLN OE1  1 1 
        7  4065 1 1 15 CYS C    C    0.942  -2.468  -8.992 1.00 . A A .  15 CYS C    1 1 
        7  4066 1 1 15 CYS CA   C   -0.276  -2.082  -8.158 1.00 . A A .  15 CYS CA   1 1 
        7  4067 1 1 15 CYS CB   C    0.135  -1.879  -6.699 1.00 . A A .  15 CYS CB   1 1 
        7  4068 1 1 15 CYS H    H   -1.712  -3.456  -7.431 1.00 . A A .  15 CYS H    1 1 
        7  4069 1 1 15 CYS HA   H   -0.680  -1.157  -8.541 1.00 . A A .  15 CYS HA   1 1 
        7  4070 1 1 15 CYS HB2  H   -0.749  -1.693  -6.106 1.00 . A A .  15 CYS HB2  1 1 
        7  4071 1 1 15 CYS HB3  H    0.619  -2.776  -6.341 1.00 . A A .  15 CYS HB3  1 1 
        7  4072 1 1 15 CYS N    N   -1.316  -3.099  -8.254 1.00 . A A .  15 CYS N    1 1 
        7  4073 1 1 15 CYS O    O    1.693  -3.374  -8.630 1.00 . A A .  15 CYS O    1 1 
        7  4074 1 1 15 CYS SG   S    1.281  -0.488  -6.435 1.00 . A A .  15 CYS SG   1 1 
        7  4075 1 1 16 SER C    C    3.503  -1.301 -10.540 1.00 . A A .  16 SER C    1 1 
        7  4076 1 1 16 SER CA   C    2.255  -2.048 -10.999 1.00 . A A .  16 SER CA   1 1 
        7  4077 1 1 16 SER CB   C    1.906  -1.650 -12.434 1.00 . A A .  16 SER CB   1 1 
        7  4078 1 1 16 SER H    H    0.497  -1.065 -10.345 1.00 . A A .  16 SER H    1 1 
        7  4079 1 1 16 SER HA   H    2.452  -3.109 -10.966 1.00 . A A .  16 SER HA   1 1 
        7  4080 1 1 16 SER HB2  H    0.948  -2.070 -12.699 1.00 . A A .  16 SER HB2  1 1 
        7  4081 1 1 16 SER HB3  H    1.860  -0.573 -12.505 1.00 . A A .  16 SER HB3  1 1 
        7  4082 1 1 16 SER HG   H    2.764  -1.693 -14.195 1.00 . A A .  16 SER HG   1 1 
        7  4083 1 1 16 SER N    N    1.130  -1.776 -10.111 1.00 . A A .  16 SER N    1 1 
        7  4084 1 1 16 SER O    O    4.206  -0.693 -11.347 1.00 . A A .  16 SER O    1 1 
        7  4085 1 1 16 SER OG   O    2.881  -2.126 -13.346 1.00 . A A .  16 SER OG   1 1 
        7  4086 1 1 17 GLU C    C    5.675  -1.594  -7.704 1.00 . A A .  17 GLU C    1 1 
        7  4087 1 1 17 GLU CA   C    4.933  -0.678  -8.672 1.00 . A A .  17 GLU CA   1 1 
        7  4088 1 1 17 GLU CB   C    4.508   0.605  -7.954 1.00 . A A .  17 GLU CB   1 1 
        7  4089 1 1 17 GLU CD   C    4.413   3.126  -8.076 1.00 . A A .  17 GLU CD   1 1 
        7  4090 1 1 17 GLU CG   C    4.482   1.827  -8.856 1.00 . A A .  17 GLU CG   1 1 
        7  4091 1 1 17 GLU H    H    3.172  -1.852  -8.646 1.00 . A A .  17 GLU H    1 1 
        7  4092 1 1 17 GLU HA   H    5.596  -0.421  -9.485 1.00 . A A .  17 GLU HA   1 1 
        7  4093 1 1 17 GLU HB2  H    3.519   0.463  -7.545 1.00 . A A .  17 GLU HB2  1 1 
        7  4094 1 1 17 GLU HB3  H    5.198   0.795  -7.146 1.00 . A A .  17 GLU HB3  1 1 
        7  4095 1 1 17 GLU HG2  H    5.378   1.834  -9.458 1.00 . A A .  17 GLU HG2  1 1 
        7  4096 1 1 17 GLU HG3  H    3.618   1.765  -9.501 1.00 . A A .  17 GLU HG3  1 1 
        7  4097 1 1 17 GLU N    N    3.771  -1.351  -9.239 1.00 . A A .  17 GLU N    1 1 
        7  4098 1 1 17 GLU O    O    6.901  -1.548  -7.602 1.00 . A A .  17 GLU O    1 1 
        7  4099 1 1 17 GLU OE1  O    3.296   3.528  -7.690 1.00 . A A .  17 GLU OE1  1 1 
        7  4100 1 1 17 GLU OE2  O    5.477   3.740  -7.852 1.00 . A A .  17 GLU OE2  1 1 
        7  4101 1 1 18 CYS C    C    4.936  -4.758  -6.216 1.00 . A A .  18 CYS C    1 1 
        7  4102 1 1 18 CYS CA   C    5.504  -3.354  -6.031 1.00 . A A .  18 CYS CA   1 1 
        7  4103 1 1 18 CYS CB   C    5.244  -2.871  -4.603 1.00 . A A .  18 CYS CB   1 1 
        7  4104 1 1 18 CYS H    H    3.948  -2.417  -7.118 1.00 . A A .  18 CYS H    1 1 
        7  4105 1 1 18 CYS HA   H    6.569  -3.385  -6.203 1.00 . A A .  18 CYS HA   1 1 
        7  4106 1 1 18 CYS HB2  H    5.735  -3.539  -3.910 1.00 . A A .  18 CYS HB2  1 1 
        7  4107 1 1 18 CYS HB3  H    5.653  -1.878  -4.487 1.00 . A A .  18 CYS HB3  1 1 
        7  4108 1 1 18 CYS N    N    4.921  -2.427  -6.993 1.00 . A A .  18 CYS N    1 1 
        7  4109 1 1 18 CYS O    O    5.676  -5.741  -6.241 1.00 . A A .  18 CYS O    1 1 
        7  4110 1 1 18 CYS SG   S    3.481  -2.802  -4.150 1.00 . A A .  18 CYS SG   1 1 
        7  4111 1 1 19 GLY C    C    1.904  -6.397  -5.480 1.00 . A A .  19 GLY C    1 1 
        7  4112 1 1 19 GLY CA   C    2.969  -6.131  -6.525 1.00 . A A .  19 GLY CA   1 1 
        7  4113 1 1 19 GLY H    H    3.075  -4.027  -6.316 1.00 . A A .  19 GLY H    1 1 
        7  4114 1 1 19 GLY HA2  H    2.514  -6.158  -7.504 1.00 . A A .  19 GLY HA2  1 1 
        7  4115 1 1 19 GLY HA3  H    3.717  -6.908  -6.466 1.00 . A A .  19 GLY HA3  1 1 
        7  4116 1 1 19 GLY N    N    3.615  -4.844  -6.344 1.00 . A A .  19 GLY N    1 1 
        7  4117 1 1 19 GLY O    O    1.961  -7.397  -4.765 1.00 . A A .  19 GLY O    1 1 
        7  4118 1 1 20 LYS C    C   -1.502  -5.330  -5.069 1.00 . A A .  20 LYS C    1 1 
        7  4119 1 1 20 LYS CA   C   -0.155  -5.640  -4.424 1.00 . A A .  20 LYS CA   1 1 
        7  4120 1 1 20 LYS CB   C    0.076  -4.713  -3.229 1.00 . A A .  20 LYS CB   1 1 
        7  4121 1 1 20 LYS CD   C    1.172  -4.491  -0.980 1.00 . A A .  20 LYS CD   1 1 
        7  4122 1 1 20 LYS CE   C    0.401  -5.372  -0.008 1.00 . A A .  20 LYS CE   1 1 
        7  4123 1 1 20 LYS CG   C    1.252  -5.123  -2.360 1.00 . A A .  20 LYS CG   1 1 
        7  4124 1 1 20 LYS H    H    0.938  -4.722  -5.988 1.00 . A A .  20 LYS H    1 1 
        7  4125 1 1 20 LYS HA   H   -0.161  -6.663  -4.080 1.00 . A A .  20 LYS HA   1 1 
        7  4126 1 1 20 LYS HB2  H    0.256  -3.713  -3.594 1.00 . A A .  20 LYS HB2  1 1 
        7  4127 1 1 20 LYS HB3  H   -0.814  -4.709  -2.615 1.00 . A A .  20 LYS HB3  1 1 
        7  4128 1 1 20 LYS HD2  H    2.173  -4.348  -0.600 1.00 . A A .  20 LYS HD2  1 1 
        7  4129 1 1 20 LYS HD3  H    0.674  -3.535  -1.059 1.00 . A A .  20 LYS HD3  1 1 
        7  4130 1 1 20 LYS HE2  H   -0.655  -5.195  -0.143 1.00 . A A .  20 LYS HE2  1 1 
        7  4131 1 1 20 LYS HE3  H    0.623  -6.406  -0.226 1.00 . A A .  20 LYS HE3  1 1 
        7  4132 1 1 20 LYS HG2  H    1.252  -6.197  -2.252 1.00 . A A .  20 LYS HG2  1 1 
        7  4133 1 1 20 LYS HG3  H    2.168  -4.806  -2.838 1.00 . A A .  20 LYS HG3  1 1 
        7  4134 1 1 20 LYS HZ1  H    0.728  -4.061   1.586 1.00 . A A .  20 LYS HZ1  1 1 
        7  4135 1 1 20 LYS HZ2  H    1.725  -5.428   1.606 1.00 . A A .  20 LYS HZ2  1 1 
        7  4136 1 1 20 LYS HZ3  H    0.099  -5.561   2.050 1.00 . A A .  20 LYS HZ3  1 1 
        7  4137 1 1 20 LYS N    N    0.929  -5.499  -5.390 1.00 . A A .  20 LYS N    1 1 
        7  4138 1 1 20 LYS NZ   N    0.763  -5.085   1.408 1.00 . A A .  20 LYS NZ   1 1 
        7  4139 1 1 20 LYS O    O   -1.659  -4.311  -5.741 1.00 . A A .  20 LYS O    1 1 
        7  4140 1 1 21 SER C    C   -4.728  -5.348  -4.424 1.00 . A A .  21 SER C    1 1 
        7  4141 1 1 21 SER CA   C   -3.804  -6.037  -5.423 1.00 . A A .  21 SER CA   1 1 
        7  4142 1 1 21 SER CB   C   -4.393  -7.389  -5.831 1.00 . A A .  21 SER CB   1 1 
        7  4143 1 1 21 SER H    H   -2.284  -7.009  -4.315 1.00 . A A .  21 SER H    1 1 
        7  4144 1 1 21 SER HA   H   -3.713  -5.414  -6.300 1.00 . A A .  21 SER HA   1 1 
        7  4145 1 1 21 SER HB2  H   -3.865  -7.763  -6.695 1.00 . A A .  21 SER HB2  1 1 
        7  4146 1 1 21 SER HB3  H   -4.287  -8.087  -5.013 1.00 . A A .  21 SER HB3  1 1 
        7  4147 1 1 21 SER HG   H   -6.278  -7.875  -5.610 1.00 . A A .  21 SER HG   1 1 
        7  4148 1 1 21 SER N    N   -2.471  -6.216  -4.860 1.00 . A A .  21 SER N    1 1 
        7  4149 1 1 21 SER O    O   -4.635  -5.573  -3.217 1.00 . A A .  21 SER O    1 1 
        7  4150 1 1 21 SER OG   O   -5.768  -7.269  -6.153 1.00 . A A .  21 SER OG   1 1 
        7  4151 1 1 22 PHE C    C   -7.950  -3.755  -4.719 1.00 . A A .  22 PHE C    1 1 
        7  4152 1 1 22 PHE CA   C   -6.561  -3.781  -4.089 1.00 . A A .  22 PHE CA   1 1 
        7  4153 1 1 22 PHE CB   C   -6.069  -2.352  -3.851 1.00 . A A .  22 PHE CB   1 1 
        7  4154 1 1 22 PHE CD1  C   -3.577  -2.534  -3.622 1.00 . A A .  22 PHE CD1  1 1 
        7  4155 1 1 22 PHE CD2  C   -4.853  -1.957  -1.692 1.00 . A A .  22 PHE CD2  1 1 
        7  4156 1 1 22 PHE CE1  C   -2.414  -2.468  -2.878 1.00 . A A .  22 PHE CE1  1 1 
        7  4157 1 1 22 PHE CE2  C   -3.693  -1.889  -0.943 1.00 . A A .  22 PHE CE2  1 1 
        7  4158 1 1 22 PHE CG   C   -4.808  -2.279  -3.039 1.00 . A A .  22 PHE CG   1 1 
        7  4159 1 1 22 PHE CZ   C   -2.473  -2.146  -1.536 1.00 . A A .  22 PHE CZ   1 1 
        7  4160 1 1 22 PHE H    H   -5.645  -4.367  -5.906 1.00 . A A .  22 PHE H    1 1 
        7  4161 1 1 22 PHE HA   H   -6.618  -4.296  -3.142 1.00 . A A .  22 PHE HA   1 1 
        7  4162 1 1 22 PHE HB2  H   -5.878  -1.881  -4.803 1.00 . A A .  22 PHE HB2  1 1 
        7  4163 1 1 22 PHE HB3  H   -6.835  -1.799  -3.327 1.00 . A A .  22 PHE HB3  1 1 
        7  4164 1 1 22 PHE HD1  H   -3.530  -2.786  -4.672 1.00 . A A .  22 PHE HD1  1 1 
        7  4165 1 1 22 PHE HD2  H   -5.806  -1.757  -1.226 1.00 . A A .  22 PHE HD2  1 1 
        7  4166 1 1 22 PHE HE1  H   -1.462  -2.669  -3.345 1.00 . A A .  22 PHE HE1  1 1 
        7  4167 1 1 22 PHE HE2  H   -3.742  -1.637   0.106 1.00 . A A .  22 PHE HE2  1 1 
        7  4168 1 1 22 PHE HZ   H   -1.565  -2.093  -0.953 1.00 . A A .  22 PHE HZ   1 1 
        7  4169 1 1 22 PHE N    N   -5.620  -4.505  -4.935 1.00 . A A .  22 PHE N    1 1 
        7  4170 1 1 22 PHE O    O   -8.105  -3.418  -5.893 1.00 . A A .  22 PHE O    1 1 
        7  4171 1 1 23 SER C    C  -10.911  -2.724  -4.473 1.00 . A A .  23 SER C    1 1 
        7  4172 1 1 23 SER CA   C  -10.334  -4.135  -4.412 1.00 . A A .  23 SER CA   1 1 
        7  4173 1 1 23 SER CB   C  -11.200  -5.013  -3.505 1.00 . A A .  23 SER CB   1 1 
        7  4174 1 1 23 SER H    H   -8.771  -4.371  -3.004 1.00 . A A .  23 SER H    1 1 
        7  4175 1 1 23 SER HA   H  -10.331  -4.554  -5.407 1.00 . A A .  23 SER HA   1 1 
        7  4176 1 1 23 SER HB2  H  -12.227  -4.963  -3.834 1.00 . A A .  23 SER HB2  1 1 
        7  4177 1 1 23 SER HB3  H  -10.853  -6.035  -3.561 1.00 . A A .  23 SER HB3  1 1 
        7  4178 1 1 23 SER HG   H  -11.832  -3.947  -1.988 1.00 . A A .  23 SER HG   1 1 
        7  4179 1 1 23 SER N    N   -8.958  -4.113  -3.931 1.00 . A A .  23 SER N    1 1 
        7  4180 1 1 23 SER O    O  -11.979  -2.453  -3.926 1.00 . A A .  23 SER O    1 1 
        7  4181 1 1 23 SER OG   O  -11.130  -4.579  -2.158 1.00 . A A .  23 SER OG   1 1 
        7  4182 1 1 24 GLY C    C   -9.645   0.428  -5.980 1.00 . A A .  24 GLY C    1 1 
        7  4183 1 1 24 GLY CA   C  -10.650  -0.455  -5.267 1.00 . A A .  24 GLY CA   1 1 
        7  4184 1 1 24 GLY H    H   -9.350  -2.101  -5.561 1.00 . A A .  24 GLY H    1 1 
        7  4185 1 1 24 GLY HA2  H  -11.579  -0.443  -5.817 1.00 . A A .  24 GLY HA2  1 1 
        7  4186 1 1 24 GLY HA3  H  -10.824  -0.056  -4.278 1.00 . A A .  24 GLY HA3  1 1 
        7  4187 1 1 24 GLY N    N  -10.195  -1.828  -5.145 1.00 . A A .  24 GLY N    1 1 
        7  4188 1 1 24 GLY O    O   -8.452   0.124  -6.009 1.00 . A A .  24 GLY O    1 1 
        7  4189 1 1 25 SER C    C   -8.610   3.442  -6.320 1.00 . A A .  25 SER C    1 1 
        7  4190 1 1 25 SER CA   C   -9.263   2.451  -7.278 1.00 . A A .  25 SER CA   1 1 
        7  4191 1 1 25 SER CB   C  -10.063   3.205  -8.342 1.00 . A A .  25 SER CB   1 1 
        7  4192 1 1 25 SER H    H  -11.087   1.712  -6.498 1.00 . A A .  25 SER H    1 1 
        7  4193 1 1 25 SER HA   H   -8.489   1.874  -7.763 1.00 . A A .  25 SER HA   1 1 
        7  4194 1 1 25 SER HB2  H   -9.405   3.869  -8.881 1.00 . A A .  25 SER HB2  1 1 
        7  4195 1 1 25 SER HB3  H  -10.501   2.495  -9.029 1.00 . A A .  25 SER HB3  1 1 
        7  4196 1 1 25 SER HG   H  -11.846   3.398  -7.554 1.00 . A A .  25 SER HG   1 1 
        7  4197 1 1 25 SER N    N  -10.127   1.524  -6.557 1.00 . A A .  25 SER N    1 1 
        7  4198 1 1 25 SER O    O   -7.409   3.703  -6.401 1.00 . A A .  25 SER O    1 1 
        7  4199 1 1 25 SER OG   O  -11.101   3.969  -7.753 1.00 . A A .  25 SER OG   1 1 
        7  4200 1 1 26 TYR C    C   -7.823   4.338  -3.566 1.00 . A A .  26 TYR C    1 1 
        7  4201 1 1 26 TYR CA   C   -8.911   4.956  -4.439 1.00 . A A .  26 TYR CA   1 1 
        7  4202 1 1 26 TYR CB   C  -10.056   5.465  -3.562 1.00 . A A .  26 TYR CB   1 1 
        7  4203 1 1 26 TYR CD1  C   -9.791   7.973  -3.705 1.00 . A A .  26 TYR CD1  1 1 
        7  4204 1 1 26 TYR CD2  C   -9.523   6.933  -1.577 1.00 . A A .  26 TYR CD2  1 1 
        7  4205 1 1 26 TYR CE1  C   -9.544   9.208  -3.137 1.00 . A A .  26 TYR CE1  1 1 
        7  4206 1 1 26 TYR CE2  C   -9.276   8.164  -1.001 1.00 . A A .  26 TYR CE2  1 1 
        7  4207 1 1 26 TYR CG   C   -9.785   6.815  -2.936 1.00 . A A .  26 TYR CG   1 1 
        7  4208 1 1 26 TYR CZ   C   -9.287   9.298  -1.785 1.00 . A A .  26 TYR CZ   1 1 
        7  4209 1 1 26 TYR H    H  -10.357   3.744  -5.397 1.00 . A A .  26 TYR H    1 1 
        7  4210 1 1 26 TYR HA   H   -8.489   5.789  -4.983 1.00 . A A .  26 TYR HA   1 1 
        7  4211 1 1 26 TYR HB2  H  -10.949   5.552  -4.162 1.00 . A A .  26 TYR HB2  1 1 
        7  4212 1 1 26 TYR HB3  H  -10.231   4.759  -2.764 1.00 . A A .  26 TYR HB3  1 1 
        7  4213 1 1 26 TYR HD1  H   -9.993   7.899  -4.764 1.00 . A A .  26 TYR HD1  1 1 
        7  4214 1 1 26 TYR HD2  H   -9.514   6.042  -0.965 1.00 . A A .  26 TYR HD2  1 1 
        7  4215 1 1 26 TYR HE1  H   -9.553  10.097  -3.751 1.00 . A A .  26 TYR HE1  1 1 
        7  4216 1 1 26 TYR HE2  H   -9.074   8.235   0.058 1.00 . A A .  26 TYR HE2  1 1 
        7  4217 1 1 26 TYR HH   H   -8.097  10.703  -1.233 1.00 . A A .  26 TYR HH   1 1 
        7  4218 1 1 26 TYR N    N   -9.409   3.992  -5.412 1.00 . A A .  26 TYR N    1 1 
        7  4219 1 1 26 TYR O    O   -6.699   4.837  -3.508 1.00 . A A .  26 TYR O    1 1 
        7  4220 1 1 26 TYR OH   O   -9.041  10.526  -1.216 1.00 . A A .  26 TYR OH   1 1 
        7  4221 1 1 27 ARG C    C   -5.865   2.404  -2.703 1.00 . A A .  27 ARG C    1 1 
        7  4222 1 1 27 ARG CA   C   -7.220   2.558  -2.019 1.00 . A A .  27 ARG CA   1 1 
        7  4223 1 1 27 ARG CB   C   -7.764   1.184  -1.625 1.00 . A A .  27 ARG CB   1 1 
        7  4224 1 1 27 ARG CD   C   -7.610   1.383   0.875 1.00 . A A .  27 ARG CD   1 1 
        7  4225 1 1 27 ARG CG   C   -7.142   0.623  -0.357 1.00 . A A .  27 ARG CG   1 1 
        7  4226 1 1 27 ARG CZ   C   -8.407  -0.309   2.471 1.00 . A A .  27 ARG CZ   1 1 
        7  4227 1 1 27 ARG H    H   -9.077   2.896  -2.978 1.00 . A A .  27 ARG H    1 1 
        7  4228 1 1 27 ARG HA   H   -7.095   3.155  -1.128 1.00 . A A .  27 ARG HA   1 1 
        7  4229 1 1 27 ARG HB2  H   -8.830   1.261  -1.473 1.00 . A A .  27 ARG HB2  1 1 
        7  4230 1 1 27 ARG HB3  H   -7.573   0.490  -2.431 1.00 . A A .  27 ARG HB3  1 1 
        7  4231 1 1 27 ARG HD2  H   -7.005   2.271   0.985 1.00 . A A .  27 ARG HD2  1 1 
        7  4232 1 1 27 ARG HD3  H   -8.643   1.665   0.736 1.00 . A A .  27 ARG HD3  1 1 
        7  4233 1 1 27 ARG HE   H   -6.701   0.709   2.647 1.00 . A A .  27 ARG HE   1 1 
        7  4234 1 1 27 ARG HG2  H   -7.425  -0.414  -0.255 1.00 . A A .  27 ARG HG2  1 1 
        7  4235 1 1 27 ARG HG3  H   -6.067   0.700  -0.430 1.00 . A A .  27 ARG HG3  1 1 
        7  4236 1 1 27 ARG HH11 H   -9.627   0.014   0.894 1.00 . A A .  27 ARG HH11 1 1 
        7  4237 1 1 27 ARG HH12 H  -10.178  -1.176   2.026 1.00 . A A .  27 ARG HH12 1 1 
        7  4238 1 1 27 ARG HH21 H   -7.415  -0.856   4.145 1.00 . A A .  27 ARG HH21 1 1 
        7  4239 1 1 27 ARG HH22 H   -8.919  -1.669   3.876 1.00 . A A .  27 ARG HH22 1 1 
        7  4240 1 1 27 ARG N    N   -8.166   3.246  -2.890 1.00 . A A .  27 ARG N    1 1 
        7  4241 1 1 27 ARG NE   N   -7.496   0.579   2.089 1.00 . A A .  27 ARG NE   1 1 
        7  4242 1 1 27 ARG NH1  N   -9.494  -0.506   1.737 1.00 . A A .  27 ARG NH1  1 1 
        7  4243 1 1 27 ARG NH2  N   -8.233  -1.002   3.589 1.00 . A A .  27 ARG NH2  1 1 
        7  4244 1 1 27 ARG O    O   -4.820   2.629  -2.091 1.00 . A A .  27 ARG O    1 1 
        7  4245 1 1 28 LEU C    C   -3.822   3.107  -4.739 1.00 . A A .  28 LEU C    1 1 
        7  4246 1 1 28 LEU CA   C   -4.663   1.834  -4.742 1.00 . A A .  28 LEU CA   1 1 
        7  4247 1 1 28 LEU CB   C   -4.994   1.432  -6.180 1.00 . A A .  28 LEU CB   1 1 
        7  4248 1 1 28 LEU CD1  C   -3.715  -0.625  -6.826 1.00 . A A .  28 LEU CD1  1 1 
        7  4249 1 1 28 LEU CD2  C   -4.010   1.231  -8.477 1.00 . A A .  28 LEU CD2  1 1 
        7  4250 1 1 28 LEU CG   C   -3.832   0.881  -7.007 1.00 . A A .  28 LEU CG   1 1 
        7  4251 1 1 28 LEU H    H   -6.753   1.855  -4.408 1.00 . A A .  28 LEU H    1 1 
        7  4252 1 1 28 LEU HA   H   -4.097   1.042  -4.276 1.00 . A A .  28 LEU HA   1 1 
        7  4253 1 1 28 LEU HB2  H   -5.761   0.674  -6.143 1.00 . A A .  28 LEU HB2  1 1 
        7  4254 1 1 28 LEU HB3  H   -5.377   2.305  -6.687 1.00 . A A .  28 LEU HB3  1 1 
        7  4255 1 1 28 LEU HD11 H   -4.456  -0.961  -6.118 1.00 . A A .  28 LEU HD11 1 1 
        7  4256 1 1 28 LEU HD12 H   -2.729  -0.868  -6.458 1.00 . A A .  28 LEU HD12 1 1 
        7  4257 1 1 28 LEU HD13 H   -3.874  -1.115  -7.776 1.00 . A A .  28 LEU HD13 1 1 
        7  4258 1 1 28 LEU HD21 H   -3.749   2.267  -8.634 1.00 . A A .  28 LEU HD21 1 1 
        7  4259 1 1 28 LEU HD22 H   -5.039   1.071  -8.762 1.00 . A A .  28 LEU HD22 1 1 
        7  4260 1 1 28 LEU HD23 H   -3.368   0.602  -9.077 1.00 . A A .  28 LEU HD23 1 1 
        7  4261 1 1 28 LEU HG   H   -2.909   1.330  -6.664 1.00 . A A .  28 LEU HG   1 1 
        7  4262 1 1 28 LEU N    N   -5.890   2.019  -3.974 1.00 . A A .  28 LEU N    1 1 
        7  4263 1 1 28 LEU O    O   -2.636   3.080  -4.407 1.00 . A A .  28 LEU O    1 1 
        7  4264 1 1 29 THR C    C   -3.184   5.865  -3.780 1.00 . A A .  29 THR C    1 1 
        7  4265 1 1 29 THR CA   C   -3.753   5.505  -5.147 1.00 . A A .  29 THR CA   1 1 
        7  4266 1 1 29 THR CB   C   -4.691   6.634  -5.613 1.00 . A A .  29 THR CB   1 1 
        7  4267 1 1 29 THR CG2  C   -3.952   7.962  -5.673 1.00 . A A .  29 THR CG2  1 1 
        7  4268 1 1 29 THR H    H   -5.389   4.179  -5.362 1.00 . A A .  29 THR H    1 1 
        7  4269 1 1 29 THR HA   H   -2.941   5.425  -5.855 1.00 . A A .  29 THR HA   1 1 
        7  4270 1 1 29 THR HB   H   -5.503   6.722  -4.905 1.00 . A A .  29 THR HB   1 1 
        7  4271 1 1 29 THR HG1  H   -5.437   7.137  -7.368 1.00 . A A .  29 THR HG1  1 1 
        7  4272 1 1 29 THR HG21 H   -3.357   8.083  -4.781 1.00 . A A .  29 THR HG21 1 1 
        7  4273 1 1 29 THR HG22 H   -4.666   8.769  -5.742 1.00 . A A .  29 THR HG22 1 1 
        7  4274 1 1 29 THR HG23 H   -3.308   7.977  -6.540 1.00 . A A .  29 THR HG23 1 1 
        7  4275 1 1 29 THR N    N   -4.443   4.222  -5.109 1.00 . A A .  29 THR N    1 1 
        7  4276 1 1 29 THR O    O   -2.088   6.416  -3.680 1.00 . A A .  29 THR O    1 1 
        7  4277 1 1 29 THR OG1  O   -5.229   6.323  -6.904 1.00 . A A .  29 THR OG1  1 1 
        7  4278 1 1 30 GLN C    C   -2.217   5.090  -1.032 1.00 . A A .  30 GLN C    1 1 
        7  4279 1 1 30 GLN CA   C   -3.503   5.839  -1.368 1.00 . A A .  30 GLN CA   1 1 
        7  4280 1 1 30 GLN CB   C   -4.601   5.463  -0.371 1.00 . A A .  30 GLN CB   1 1 
        7  4281 1 1 30 GLN CD   C   -5.007   7.627   0.868 1.00 . A A .  30 GLN CD   1 1 
        7  4282 1 1 30 GLN CG   C   -5.576   6.594  -0.085 1.00 . A A .  30 GLN CG   1 1 
        7  4283 1 1 30 GLN H    H   -4.798   5.110  -2.874 1.00 . A A .  30 GLN H    1 1 
        7  4284 1 1 30 GLN HA   H   -3.315   6.900  -1.299 1.00 . A A .  30 GLN HA   1 1 
        7  4285 1 1 30 GLN HB2  H   -5.158   4.627  -0.766 1.00 . A A .  30 GLN HB2  1 1 
        7  4286 1 1 30 GLN HB3  H   -4.140   5.170   0.560 1.00 . A A .  30 GLN HB3  1 1 
        7  4287 1 1 30 GLN HE21 H   -6.648   8.734   0.685 1.00 . A A .  30 GLN HE21 1 1 
        7  4288 1 1 30 GLN HE22 H   -5.429   9.366   1.734 1.00 . A A .  30 GLN HE22 1 1 
        7  4289 1 1 30 GLN HG2  H   -5.823   7.083  -1.015 1.00 . A A .  30 GLN HG2  1 1 
        7  4290 1 1 30 GLN HG3  H   -6.472   6.177   0.352 1.00 . A A .  30 GLN HG3  1 1 
        7  4291 1 1 30 GLN N    N   -3.934   5.548  -2.730 1.00 . A A .  30 GLN N    1 1 
        7  4292 1 1 30 GLN NE2  N   -5.771   8.683   1.121 1.00 . A A .  30 GLN NE2  1 1 
        7  4293 1 1 30 GLN O    O   -1.316   5.637  -0.396 1.00 . A A .  30 GLN O    1 1 
        7  4294 1 1 30 GLN OE1  O   -3.893   7.478   1.371 1.00 . A A .  30 GLN OE1  1 1 
        7  4295 1 1 31 HIS C    C    0.193   3.419  -2.116 1.00 . A A .  31 HIS C    1 1 
        7  4296 1 1 31 HIS CA   C   -0.964   3.011  -1.209 1.00 . A A .  31 HIS CA   1 1 
        7  4297 1 1 31 HIS CB   C   -1.295   1.533  -1.420 1.00 . A A .  31 HIS CB   1 1 
        7  4298 1 1 31 HIS CD2  C    0.205   0.082  -2.959 1.00 . A A .  31 HIS CD2  1 1 
        7  4299 1 1 31 HIS CE1  C    1.823  -0.327  -1.536 1.00 . A A .  31 HIS CE1  1 1 
        7  4300 1 1 31 HIS CG   C   -0.109   0.701  -1.797 1.00 . A A .  31 HIS CG   1 1 
        7  4301 1 1 31 HIS H    H   -2.891   3.455  -1.965 1.00 . A A .  31 HIS H    1 1 
        7  4302 1 1 31 HIS HA   H   -0.669   3.162  -0.182 1.00 . A A .  31 HIS HA   1 1 
        7  4303 1 1 31 HIS HB2  H   -1.706   1.129  -0.506 1.00 . A A .  31 HIS HB2  1 1 
        7  4304 1 1 31 HIS HB3  H   -2.028   1.444  -2.209 1.00 . A A .  31 HIS HB3  1 1 
        7  4305 1 1 31 HIS HD1  H    0.989   0.734   0.001 1.00 . A A .  31 HIS HD1  1 1 
        7  4306 1 1 31 HIS HD2  H   -0.382   0.084  -3.866 1.00 . A A .  31 HIS HD2  1 1 
        7  4307 1 1 31 HIS HE1  H    2.739  -0.698  -1.101 1.00 . A A .  31 HIS HE1  1 1 
        7  4308 1 1 31 HIS N    N   -2.140   3.835  -1.464 1.00 . A A .  31 HIS N    1 1 
        7  4309 1 1 31 HIS ND1  N    0.924   0.424  -0.926 1.00 . A A .  31 HIS ND1  1 1 
        7  4310 1 1 31 HIS NE2  N    1.410  -0.550  -2.771 1.00 . A A .  31 HIS NE2  1 1 
        7  4311 1 1 31 HIS O    O    1.335   3.528  -1.671 1.00 . A A .  31 HIS O    1 1 
        7  4312 1 1 32 TRP C    C    1.825   5.105  -3.779 1.00 . A A .  32 TRP C    1 1 
        7  4313 1 1 32 TRP CA   C    0.903   4.038  -4.360 1.00 . A A .  32 TRP CA   1 1 
        7  4314 1 1 32 TRP CB   C    0.242   4.558  -5.637 1.00 . A A .  32 TRP CB   1 1 
        7  4315 1 1 32 TRP CD1  C   -0.669   2.288  -6.402 1.00 . A A .  32 TRP CD1  1 1 
        7  4316 1 1 32 TRP CD2  C    0.279   3.496  -8.032 1.00 . A A .  32 TRP CD2  1 1 
        7  4317 1 1 32 TRP CE2  C   -0.177   2.281  -8.580 1.00 . A A .  32 TRP CE2  1 1 
        7  4318 1 1 32 TRP CE3  C    0.908   4.419  -8.871 1.00 . A A .  32 TRP CE3  1 1 
        7  4319 1 1 32 TRP CG   C   -0.046   3.480  -6.638 1.00 . A A .  32 TRP CG   1 1 
        7  4320 1 1 32 TRP CH2  C    0.599   2.890 -10.726 1.00 . A A .  32 TRP CH2  1 1 
        7  4321 1 1 32 TRP CZ2  C   -0.021   1.968  -9.928 1.00 . A A .  32 TRP CZ2  1 1 
        7  4322 1 1 32 TRP CZ3  C    1.063   4.107 -10.209 1.00 . A A .  32 TRP CZ3  1 1 
        7  4323 1 1 32 TRP H    H   -1.040   3.539  -3.685 1.00 . A A .  32 TRP H    1 1 
        7  4324 1 1 32 TRP HA   H    1.490   3.163  -4.599 1.00 . A A .  32 TRP HA   1 1 
        7  4325 1 1 32 TRP HB2  H   -0.692   5.035  -5.383 1.00 . A A .  32 TRP HB2  1 1 
        7  4326 1 1 32 TRP HB3  H    0.896   5.281  -6.104 1.00 . A A .  32 TRP HB3  1 1 
        7  4327 1 1 32 TRP HD1  H   -1.036   1.974  -5.437 1.00 . A A .  32 TRP HD1  1 1 
        7  4328 1 1 32 TRP HE1  H   -1.155   0.673  -7.654 1.00 . A A .  32 TRP HE1  1 1 
        7  4329 1 1 32 TRP HE3  H    1.273   5.362  -8.491 1.00 . A A .  32 TRP HE3  1 1 
        7  4330 1 1 32 TRP HH2  H    0.742   2.688 -11.777 1.00 . A A .  32 TRP HH2  1 1 
        7  4331 1 1 32 TRP HZ2  H   -0.373   1.034 -10.342 1.00 . A A .  32 TRP HZ2  1 1 
        7  4332 1 1 32 TRP HZ3  H    1.548   4.807 -10.872 1.00 . A A .  32 TRP HZ3  1 1 
        7  4333 1 1 32 TRP N    N   -0.111   3.642  -3.390 1.00 . A A .  32 TRP N    1 1 
        7  4334 1 1 32 TRP NE1  N   -0.750   1.562  -7.565 1.00 . A A .  32 TRP NE1  1 1 
        7  4335 1 1 32 TRP O    O    3.041   5.056  -3.966 1.00 . A A .  32 TRP O    1 1 
        7  4336 1 1 33 ILE C    C    3.241   6.602  -1.748 1.00 . A A .  33 ILE C    1 1 
        7  4337 1 1 33 ILE CA   C    2.009   7.144  -2.466 1.00 . A A .  33 ILE CA   1 1 
        7  4338 1 1 33 ILE CB   C    1.158   7.949  -1.466 1.00 . A A .  33 ILE CB   1 1 
        7  4339 1 1 33 ILE CD1  C   -1.142   9.007  -1.207 1.00 . A A .  33 ILE CD1  1 1 
        7  4340 1 1 33 ILE CG1  C   -0.070   8.536  -2.164 1.00 . A A .  33 ILE CG1  1 1 
        7  4341 1 1 33 ILE CG2  C    1.991   9.053  -0.830 1.00 . A A .  33 ILE CG2  1 1 
        7  4342 1 1 33 ILE H    H    0.266   6.051  -2.961 1.00 . A A .  33 ILE H    1 1 
        7  4343 1 1 33 ILE HA   H    2.330   7.811  -3.254 1.00 . A A .  33 ILE HA   1 1 
        7  4344 1 1 33 ILE HB   H    0.834   7.280  -0.684 1.00 . A A .  33 ILE HB   1 1 
        7  4345 1 1 33 ILE HD11 H   -1.807   8.187  -0.979 1.00 . A A .  33 ILE HD11 1 1 
        7  4346 1 1 33 ILE HD12 H   -0.682   9.359  -0.295 1.00 . A A .  33 ILE HD12 1 1 
        7  4347 1 1 33 ILE HD13 H   -1.703   9.810  -1.661 1.00 . A A .  33 ILE HD13 1 1 
        7  4348 1 1 33 ILE HG12 H    0.233   9.380  -2.763 1.00 . A A .  33 ILE HG12 1 1 
        7  4349 1 1 33 ILE HG13 H   -0.504   7.782  -2.805 1.00 . A A .  33 ILE HG13 1 1 
        7  4350 1 1 33 ILE HG21 H    1.927   9.945  -1.435 1.00 . A A .  33 ILE HG21 1 1 
        7  4351 1 1 33 ILE HG22 H    1.614   9.262   0.160 1.00 . A A .  33 ILE HG22 1 1 
        7  4352 1 1 33 ILE HG23 H    3.020   8.735  -0.764 1.00 . A A .  33 ILE HG23 1 1 
        7  4353 1 1 33 ILE N    N    1.239   6.067  -3.074 1.00 . A A .  33 ILE N    1 1 
        7  4354 1 1 33 ILE O    O    4.309   7.214  -1.775 1.00 . A A .  33 ILE O    1 1 
        7  4355 1 1 34 THR C    C    5.433   4.730  -1.249 1.00 . A A .  34 THR C    1 1 
        7  4356 1 1 34 THR CA   C    4.183   4.823  -0.381 1.00 . A A .  34 THR CA   1 1 
        7  4357 1 1 34 THR CB   C    3.804   3.411   0.105 1.00 . A A .  34 THR CB   1 1 
        7  4358 1 1 34 THR CG2  C    2.571   3.458   0.995 1.00 . A A .  34 THR CG2  1 1 
        7  4359 1 1 34 THR H    H    2.209   5.009  -1.121 1.00 . A A .  34 THR H    1 1 
        7  4360 1 1 34 THR HA   H    4.402   5.432   0.484 1.00 . A A .  34 THR HA   1 1 
        7  4361 1 1 34 THR HB   H    4.628   3.010   0.677 1.00 . A A .  34 THR HB   1 1 
        7  4362 1 1 34 THR HG1  H    4.338   2.521  -1.572 1.00 . A A .  34 THR HG1  1 1 
        7  4363 1 1 34 THR HG21 H    1.791   2.851   0.562 1.00 . A A .  34 THR HG21 1 1 
        7  4364 1 1 34 THR HG22 H    2.228   4.479   1.081 1.00 . A A .  34 THR HG22 1 1 
        7  4365 1 1 34 THR HG23 H    2.821   3.079   1.975 1.00 . A A .  34 THR HG23 1 1 
        7  4366 1 1 34 THR N    N    3.085   5.448  -1.106 1.00 . A A .  34 THR N    1 1 
        7  4367 1 1 34 THR O    O    6.550   4.927  -0.770 1.00 . A A .  34 THR O    1 1 
        7  4368 1 1 34 THR OG1  O    3.555   2.557  -1.017 1.00 . A A .  34 THR OG1  1 1 
        7  4369 1 1 35 HIS C    C    6.945   5.682  -3.777 1.00 . A A .  35 HIS C    1 1 
        7  4370 1 1 35 HIS CA   C    6.350   4.312  -3.465 1.00 . A A .  35 HIS CA   1 1 
        7  4371 1 1 35 HIS CB   C    5.888   3.638  -4.757 1.00 . A A .  35 HIS CB   1 1 
        7  4372 1 1 35 HIS CD2  C    3.945   1.939  -5.004 1.00 . A A .  35 HIS CD2  1 1 
        7  4373 1 1 35 HIS CE1  C    4.746   0.348  -3.726 1.00 . A A .  35 HIS CE1  1 1 
        7  4374 1 1 35 HIS CG   C    5.141   2.360  -4.532 1.00 . A A .  35 HIS CG   1 1 
        7  4375 1 1 35 HIS H    H    4.324   4.284  -2.852 1.00 . A A .  35 HIS H    1 1 
        7  4376 1 1 35 HIS HA   H    7.110   3.701  -3.002 1.00 . A A .  35 HIS HA   1 1 
        7  4377 1 1 35 HIS HB2  H    5.237   4.312  -5.294 1.00 . A A .  35 HIS HB2  1 1 
        7  4378 1 1 35 HIS HB3  H    6.752   3.416  -5.368 1.00 . A A .  35 HIS HB3  1 1 
        7  4379 1 1 35 HIS HD1  H    6.467   1.345  -3.246 1.00 . A A .  35 HIS HD1  1 1 
        7  4380 1 1 35 HIS HD2  H    3.287   2.486  -5.665 1.00 . A A .  35 HIS HD2  1 1 
        7  4381 1 1 35 HIS HE1  H    4.852  -0.582  -3.188 1.00 . A A .  35 HIS HE1  1 1 
        7  4382 1 1 35 HIS N    N    5.238   4.430  -2.529 1.00 . A A .  35 HIS N    1 1 
        7  4383 1 1 35 HIS ND1  N    5.617   1.341  -3.734 1.00 . A A .  35 HIS ND1  1 1 
        7  4384 1 1 35 HIS NE2  N    3.722   0.685  -4.489 1.00 . A A .  35 HIS NE2  1 1 
        7  4385 1 1 35 HIS O    O    8.162   5.831  -3.898 1.00 . A A .  35 HIS O    1 1 
        7  4386 1 1 36 THR C    C    7.352   8.612  -3.065 1.00 . A A .  36 THR C    1 1 
        7  4387 1 1 36 THR CA   C    6.518   8.040  -4.206 1.00 . A A .  36 THR CA   1 1 
        7  4388 1 1 36 THR CB   C    5.320   8.972  -4.468 1.00 . A A .  36 THR CB   1 1 
        7  4389 1 1 36 THR CG2  C    5.789  10.322  -4.991 1.00 . A A .  36 THR CG2  1 1 
        7  4390 1 1 36 THR H    H    5.122   6.502  -3.798 1.00 . A A .  36 THR H    1 1 
        7  4391 1 1 36 THR HA   H    7.123   8.005  -5.100 1.00 . A A .  36 THR HA   1 1 
        7  4392 1 1 36 THR HB   H    4.793   9.127  -3.537 1.00 . A A .  36 THR HB   1 1 
        7  4393 1 1 36 THR HG1  H    3.936   9.058  -5.870 1.00 . A A .  36 THR HG1  1 1 
        7  4394 1 1 36 THR HG21 H    6.350  10.178  -5.903 1.00 . A A .  36 THR HG21 1 1 
        7  4395 1 1 36 THR HG22 H    6.419  10.795  -4.253 1.00 . A A .  36 THR HG22 1 1 
        7  4396 1 1 36 THR HG23 H    4.933  10.948  -5.190 1.00 . A A .  36 THR HG23 1 1 
        7  4397 1 1 36 THR N    N    6.079   6.683  -3.906 1.00 . A A .  36 THR N    1 1 
        7  4398 1 1 36 THR O    O    8.411   9.197  -3.292 1.00 . A A .  36 THR O    1 1 
        7  4399 1 1 36 THR OG1  O    4.430   8.371  -5.415 1.00 . A A .  36 THR OG1  1 1 
        7  4400 1 1 37 ARG C    C    8.819   8.109  -0.382 1.00 . A A .  37 ARG C    1 1 
        7  4401 1 1 37 ARG CA   C    7.570   8.939  -0.664 1.00 . A A .  37 ARG CA   1 1 
        7  4402 1 1 37 ARG CB   C    6.646   8.919   0.555 1.00 . A A .  37 ARG CB   1 1 
        7  4403 1 1 37 ARG CD   C    6.236  11.282   1.304 1.00 . A A .  37 ARG CD   1 1 
        7  4404 1 1 37 ARG CG   C    5.657  10.072   0.588 1.00 . A A .  37 ARG CG   1 1 
        7  4405 1 1 37 ARG CZ   C    5.397  13.244   0.082 1.00 . A A .  37 ARG CZ   1 1 
        7  4406 1 1 37 ARG H    H    6.019   7.964  -1.723 1.00 . A A .  37 ARG H    1 1 
        7  4407 1 1 37 ARG HA   H    7.867   9.958  -0.862 1.00 . A A .  37 ARG HA   1 1 
        7  4408 1 1 37 ARG HB2  H    6.088   7.994   0.554 1.00 . A A .  37 ARG HB2  1 1 
        7  4409 1 1 37 ARG HB3  H    7.249   8.964   1.450 1.00 . A A .  37 ARG HB3  1 1 
        7  4410 1 1 37 ARG HD2  H    6.334  11.050   2.354 1.00 . A A .  37 ARG HD2  1 1 
        7  4411 1 1 37 ARG HD3  H    7.210  11.496   0.890 1.00 . A A .  37 ARG HD3  1 1 
        7  4412 1 1 37 ARG HE   H    4.783  12.682   1.895 1.00 . A A .  37 ARG HE   1 1 
        7  4413 1 1 37 ARG HG2  H    5.409  10.351  -0.425 1.00 . A A .  37 ARG HG2  1 1 
        7  4414 1 1 37 ARG HG3  H    4.763   9.752   1.104 1.00 . A A .  37 ARG HG3  1 1 
        7  4415 1 1 37 ARG HH11 H    6.808  12.176  -0.891 1.00 . A A .  37 ARG HH11 1 1 
        7  4416 1 1 37 ARG HH12 H    6.208  13.561  -1.742 1.00 . A A .  37 ARG HH12 1 1 
        7  4417 1 1 37 ARG HH21 H    3.985  14.509   0.786 1.00 . A A .  37 ARG HH21 1 1 
        7  4418 1 1 37 ARG HH22 H    4.603  14.888  -0.786 1.00 . A A .  37 ARG HH22 1 1 
        7  4419 1 1 37 ARG N    N    6.868   8.439  -1.840 1.00 . A A .  37 ARG N    1 1 
        7  4420 1 1 37 ARG NE   N    5.388  12.462   1.156 1.00 . A A .  37 ARG NE   1 1 
        7  4421 1 1 37 ARG NH1  N    6.204  12.971  -0.933 1.00 . A A .  37 ARG NH1  1 1 
        7  4422 1 1 37 ARG NH2  N    4.596  14.300   0.022 1.00 . A A .  37 ARG NH2  1 1 
        7  4423 1 1 37 ARG O    O    9.063   7.095  -1.037 1.00 . A A .  37 ARG O    1 1 
        7  4424 1 1 38 GLU C    C   10.983   7.770   2.478 1.00 . A A .  38 GLU C    1 1 
        7  4425 1 1 38 GLU CA   C   10.831   7.844   0.962 1.00 . A A .  38 GLU CA   1 1 
        7  4426 1 1 38 GLU CB   C   12.048   8.540   0.350 1.00 . A A .  38 GLU CB   1 1 
        7  4427 1 1 38 GLU CD   C   11.451   9.029  -2.056 1.00 . A A .  38 GLU CD   1 1 
        7  4428 1 1 38 GLU CG   C   12.283   8.186  -1.109 1.00 . A A .  38 GLU CG   1 1 
        7  4429 1 1 38 GLU H    H    9.359   9.360   1.081 1.00 . A A .  38 GLU H    1 1 
        7  4430 1 1 38 GLU HA   H   10.768   6.840   0.569 1.00 . A A .  38 GLU HA   1 1 
        7  4431 1 1 38 GLU HB2  H   11.910   9.609   0.421 1.00 . A A .  38 GLU HB2  1 1 
        7  4432 1 1 38 GLU HB3  H   12.927   8.262   0.912 1.00 . A A .  38 GLU HB3  1 1 
        7  4433 1 1 38 GLU HG2  H   13.327   8.337  -1.339 1.00 . A A .  38 GLU HG2  1 1 
        7  4434 1 1 38 GLU HG3  H   12.029   7.146  -1.259 1.00 . A A .  38 GLU HG3  1 1 
        7  4435 1 1 38 GLU N    N    9.607   8.546   0.595 1.00 . A A .  38 GLU N    1 1 
        7  4436 1 1 38 GLU O    O   10.526   8.653   3.204 1.00 . A A .  38 GLU O    1 1 
        7  4437 1 1 38 GLU OE1  O   11.290  10.238  -1.787 1.00 . A A .  38 GLU OE1  1 1 
        7  4438 1 1 38 GLU OE2  O   10.961   8.481  -3.065 1.00 . A A .  38 GLU OE2  1 1 
        7  4439 1 1 39 LYS C    C   13.044   7.323   4.864 1.00 . A A .  39 LYS C    1 1 
        7  4440 1 1 39 LYS CA   C   11.842   6.518   4.381 1.00 . A A .  39 LYS CA   1 1 
        7  4441 1 1 39 LYS CB   C   12.050   5.034   4.692 1.00 . A A .  39 LYS CB   1 1 
        7  4442 1 1 39 LYS CD   C   11.026   2.753   4.941 1.00 . A A .  39 LYS CD   1 1 
        7  4443 1 1 39 LYS CE   C   11.074   2.384   6.415 1.00 . A A .  39 LYS CE   1 1 
        7  4444 1 1 39 LYS CG   C   10.758   4.237   4.747 1.00 . A A .  39 LYS CG   1 1 
        7  4445 1 1 39 LYS H    H   11.969   6.038   2.323 1.00 . A A .  39 LYS H    1 1 
        7  4446 1 1 39 LYS HA   H   10.960   6.865   4.898 1.00 . A A .  39 LYS HA   1 1 
        7  4447 1 1 39 LYS HB2  H   12.683   4.604   3.930 1.00 . A A .  39 LYS HB2  1 1 
        7  4448 1 1 39 LYS HB3  H   12.544   4.945   5.650 1.00 . A A .  39 LYS HB3  1 1 
        7  4449 1 1 39 LYS HD2  H   10.238   2.189   4.465 1.00 . A A .  39 LYS HD2  1 1 
        7  4450 1 1 39 LYS HD3  H   11.975   2.505   4.485 1.00 . A A .  39 LYS HD3  1 1 
        7  4451 1 1 39 LYS HE2  H   10.419   3.047   6.960 1.00 . A A .  39 LYS HE2  1 1 
        7  4452 1 1 39 LYS HE3  H   10.731   1.366   6.529 1.00 . A A .  39 LYS HE3  1 1 
        7  4453 1 1 39 LYS HG2  H   10.160   4.594   5.571 1.00 . A A .  39 LYS HG2  1 1 
        7  4454 1 1 39 LYS HG3  H   10.220   4.378   3.820 1.00 . A A .  39 LYS HG3  1 1 
        7  4455 1 1 39 LYS HZ1  H   12.841   3.439   6.770 1.00 . A A .  39 LYS HZ1  1 1 
        7  4456 1 1 39 LYS HZ2  H   13.068   1.778   6.543 1.00 . A A .  39 LYS HZ2  1 1 
        7  4457 1 1 39 LYS HZ3  H   12.433   2.352   8.001 1.00 . A A .  39 LYS HZ3  1 1 
        7  4458 1 1 39 LYS N    N   11.628   6.709   2.951 1.00 . A A .  39 LYS N    1 1 
        7  4459 1 1 39 LYS NZ   N   12.450   2.496   6.971 1.00 . A A .  39 LYS NZ   1 1 
        7  4460 1 1 39 LYS O    O   14.015   7.530   4.136 1.00 . A A .  39 LYS O    1 1 
        7  4461 1 1 40 PRO C    C   15.306   7.741   6.995 1.00 . A A .  40 PRO C    1 1 
        7  4462 1 1 40 PRO CA   C   14.057   8.574   6.729 1.00 . A A .  40 PRO CA   1 1 
        7  4463 1 1 40 PRO CB   C   13.444   9.054   8.047 1.00 . A A .  40 PRO CB   1 1 
        7  4464 1 1 40 PRO CD   C   11.854   7.577   7.045 1.00 . A A .  40 PRO CD   1 1 
        7  4465 1 1 40 PRO CG   C   12.397   8.044   8.367 1.00 . A A .  40 PRO CG   1 1 
        7  4466 1 1 40 PRO HA   H   14.318   9.427   6.119 1.00 . A A .  40 PRO HA   1 1 
        7  4467 1 1 40 PRO HB2  H   14.208   9.088   8.811 1.00 . A A .  40 PRO HB2  1 1 
        7  4468 1 1 40 PRO HB3  H   13.017  10.037   7.913 1.00 . A A .  40 PRO HB3  1 1 
        7  4469 1 1 40 PRO HD2  H   11.586   6.532   7.096 1.00 . A A .  40 PRO HD2  1 1 
        7  4470 1 1 40 PRO HD3  H   11.002   8.173   6.755 1.00 . A A .  40 PRO HD3  1 1 
        7  4471 1 1 40 PRO HG2  H   12.835   7.219   8.906 1.00 . A A .  40 PRO HG2  1 1 
        7  4472 1 1 40 PRO HG3  H   11.613   8.502   8.953 1.00 . A A .  40 PRO HG3  1 1 
        7  4473 1 1 40 PRO N    N   12.981   7.786   6.121 1.00 . A A .  40 PRO N    1 1 
        7  4474 1 1 40 PRO O    O   15.238   6.686   7.626 1.00 . A A .  40 PRO O    1 1 
        7  4475 1 1 41 SER C    C   18.772   8.449   7.272 1.00 . A A .  41 SER C    1 1 
        7  4476 1 1 41 SER CA   C   17.711   7.518   6.692 1.00 . A A .  41 SER CA   1 1 
        7  4477 1 1 41 SER CB   C   18.196   6.942   5.360 1.00 . A A .  41 SER CB   1 1 
        7  4478 1 1 41 SER H    H   16.437   9.067   6.014 1.00 . A A .  41 SER H    1 1 
        7  4479 1 1 41 SER HA   H   17.543   6.707   7.385 1.00 . A A .  41 SER HA   1 1 
        7  4480 1 1 41 SER HB2  H   18.278   7.737   4.635 1.00 . A A .  41 SER HB2  1 1 
        7  4481 1 1 41 SER HB3  H   19.163   6.481   5.501 1.00 . A A .  41 SER HB3  1 1 
        7  4482 1 1 41 SER HG   H   17.130   5.309   5.548 1.00 . A A .  41 SER HG   1 1 
        7  4483 1 1 41 SER N    N   16.447   8.221   6.509 1.00 . A A .  41 SER N    1 1 
        7  4484 1 1 41 SER O    O   19.414   8.131   8.272 1.00 . A A .  41 SER O    1 1 
        7  4485 1 1 41 SER OG   O   17.293   5.966   4.868 1.00 . A A .  41 SER OG   1 1 
        7  4486 1 1 42 GLY C    C   19.450  11.350   8.303 1.00 . A A .  42 GLY C    1 1 
        7  4487 1 1 42 GLY CA   C   19.932  10.564   7.100 1.00 . A A .  42 GLY CA   1 1 
        7  4488 1 1 42 GLY H    H   18.409   9.803   5.842 1.00 . A A .  42 GLY H    1 1 
        7  4489 1 1 42 GLY HA2  H   20.837  10.037   7.366 1.00 . A A .  42 GLY HA2  1 1 
        7  4490 1 1 42 GLY HA3  H   20.152  11.253   6.299 1.00 . A A .  42 GLY HA3  1 1 
        7  4491 1 1 42 GLY N    N   18.949   9.603   6.635 1.00 . A A .  42 GLY N    1 1 
        7  4492 1 1 42 GLY O    O   19.799  11.052   9.446 1.00 . A A .  42 GLY O    1 1 
        7  4493 1 1 43 PRO C    C   17.060  12.503   9.973 1.00 . A A .  43 PRO C    1 1 
        7  4494 1 1 43 PRO CA   C   18.083  13.234   9.110 1.00 . A A .  43 PRO CA   1 1 
        7  4495 1 1 43 PRO CB   C   17.414  14.373   8.338 1.00 . A A .  43 PRO CB   1 1 
        7  4496 1 1 43 PRO CD   C   18.173  12.792   6.714 1.00 . A A .  43 PRO CD   1 1 
        7  4497 1 1 43 PRO CG   C   17.085  13.788   7.008 1.00 . A A .  43 PRO CG   1 1 
        7  4498 1 1 43 PRO HA   H   18.864  13.633   9.741 1.00 . A A .  43 PRO HA   1 1 
        7  4499 1 1 43 PRO HB2  H   16.524  14.693   8.861 1.00 . A A .  43 PRO HB2  1 1 
        7  4500 1 1 43 PRO HB3  H   18.101  15.202   8.245 1.00 . A A .  43 PRO HB3  1 1 
        7  4501 1 1 43 PRO HD2  H   17.776  11.950   6.166 1.00 . A A .  43 PRO HD2  1 1 
        7  4502 1 1 43 PRO HD3  H   18.974  13.260   6.161 1.00 . A A .  43 PRO HD3  1 1 
        7  4503 1 1 43 PRO HG2  H   16.127  13.294   7.051 1.00 . A A .  43 PRO HG2  1 1 
        7  4504 1 1 43 PRO HG3  H   17.076  14.564   6.258 1.00 . A A .  43 PRO HG3  1 1 
        7  4505 1 1 43 PRO N    N   18.630  12.380   8.051 1.00 . A A .  43 PRO N    1 1 
        7  4506 1 1 43 PRO O    O   16.704  11.358   9.695 1.00 . A A .  43 PRO O    1 1 
        7  4507 1 1 44 SER C    C   14.259  13.283  11.792 1.00 . A A .  44 SER C    1 1 
        7  4508 1 1 44 SER CA   C   15.609  12.585  11.926 1.00 . A A .  44 SER CA   1 1 
        7  4509 1 1 44 SER CB   C   16.101  12.674  13.372 1.00 . A A .  44 SER CB   1 1 
        7  4510 1 1 44 SER H    H   16.912  14.082  11.190 1.00 . A A .  44 SER H    1 1 
        7  4511 1 1 44 SER HA   H   15.491  11.545  11.658 1.00 . A A .  44 SER HA   1 1 
        7  4512 1 1 44 SER HB2  H   16.606  13.616  13.521 1.00 . A A .  44 SER HB2  1 1 
        7  4513 1 1 44 SER HB3  H   15.256  12.608  14.041 1.00 . A A .  44 SER HB3  1 1 
        7  4514 1 1 44 SER HG   H   17.844  11.789  13.240 1.00 . A A .  44 SER HG   1 1 
        7  4515 1 1 44 SER N    N   16.590  13.172  11.021 1.00 . A A .  44 SER N    1 1 
        7  4516 1 1 44 SER O    O   13.225  12.635  11.634 1.00 . A A .  44 SER O    1 1 
        7  4517 1 1 44 SER OG   O   17.002  11.621  13.669 1.00 . A A .  44 SER OG   1 1 
        7  4518 1 1 45 SER C    C   13.373  16.845  11.381 1.00 . A A .  45 SER C    1 1 
        7  4519 1 1 45 SER CA   C   13.056  15.399  11.749 1.00 . A A .  45 SER CA   1 1 
        7  4520 1 1 45 SER CB   C   12.276  15.355  13.064 1.00 . A A .  45 SER CB   1 1 
        7  4521 1 1 45 SER H    H   15.134  15.071  11.986 1.00 . A A .  45 SER H    1 1 
        7  4522 1 1 45 SER HA   H   12.451  14.965  10.966 1.00 . A A .  45 SER HA   1 1 
        7  4523 1 1 45 SER HB2  H   11.261  15.677  12.889 1.00 . A A .  45 SER HB2  1 1 
        7  4524 1 1 45 SER HB3  H   12.272  14.343  13.443 1.00 . A A .  45 SER HB3  1 1 
        7  4525 1 1 45 SER HG   H   13.796  16.318  13.837 1.00 . A A .  45 SER HG   1 1 
        7  4526 1 1 45 SER N    N   14.278  14.611  11.858 1.00 . A A .  45 SER N    1 1 
        7  4527 1 1 45 SER O    O   14.475  17.333  11.629 1.00 . A A .  45 SER O    1 1 
        7  4528 1 1 45 SER OG   O   12.864  16.204  14.034 1.00 . A A .  45 SER OG   1 1 
        7  4529 1 1 46 GLY C    C   11.292  19.592  10.016 1.00 . A A .  46 GLY C    1 1 
        7  4530 1 1 46 GLY CA   C   12.591  18.909  10.393 1.00 . A A .  46 GLY CA   1 1 
        7  4531 1 1 46 GLY H    H   11.539  17.085  10.614 1.00 . A A .  46 GLY H    1 1 
        7  4532 1 1 46 GLY HA2  H   13.043  19.445  11.214 1.00 . A A .  46 GLY HA2  1 1 
        7  4533 1 1 46 GLY HA3  H   13.260  18.940   9.545 1.00 . A A .  46 GLY HA3  1 1 
        7  4534 1 1 46 GLY N    N   12.398  17.526  10.786 1.00 . A A .  46 GLY N    1 1 
        7  4535 1 1 46 GLY O    O   10.833  19.425   8.887 1.00 . A A .  46 GLY O    1 1 
        7  4536 2 2  1 ZN  ZN   ZN   2.487  -0.807  -4.407 1.00 . B A . 181 ZN  ZN   1 1 
        8  4537 1 1  1 GLY C    C   -1.040 -26.951 -18.457 1.00 . A A .   1 GLY C    1 1 
        8  4538 1 1  1 GLY CA   C   -0.837 -27.309 -19.916 1.00 . A A .   1 GLY CA   1 1 
        8  4539 1 1  1 GLY H1   H   -2.170 -28.944 -19.734 1.00 . A A .   1 GLY H1   1 1 
        8  4540 1 1  1 GLY HA2  H    0.222 -27.340 -20.125 1.00 . A A .   1 GLY HA2  1 1 
        8  4541 1 1  1 GLY HA3  H   -1.292 -26.544 -20.528 1.00 . A A .   1 GLY HA3  1 1 
        8  4542 1 1  1 GLY N    N   -1.421 -28.593 -20.259 1.00 . A A .   1 GLY N    1 1 
        8  4543 1 1  1 GLY O    O   -1.195 -27.832 -17.611 1.00 . A A .   1 GLY O    1 1 
        8  4544 1 1  2 SER C    C   -2.628 -24.642 -16.586 1.00 . A A .   2 SER C    1 1 
        8  4545 1 1  2 SER CA   C   -1.217 -25.183 -16.793 1.00 . A A .   2 SER CA   1 1 
        8  4546 1 1  2 SER CB   C   -0.189 -24.098 -16.467 1.00 . A A .   2 SER CB   1 1 
        8  4547 1 1  2 SER H    H   -0.909 -25.001 -18.880 1.00 . A A .   2 SER H    1 1 
        8  4548 1 1  2 SER HA   H   -1.065 -26.022 -16.130 1.00 . A A .   2 SER HA   1 1 
        8  4549 1 1  2 SER HB2  H   -0.334 -23.258 -17.128 1.00 . A A .   2 SER HB2  1 1 
        8  4550 1 1  2 SER HB3  H   -0.320 -23.778 -15.443 1.00 . A A .   2 SER HB3  1 1 
        8  4551 1 1  2 SER HG   H    1.547 -24.142 -17.373 1.00 . A A .   2 SER HG   1 1 
        8  4552 1 1  2 SER N    N   -1.037 -25.655 -18.161 1.00 . A A .   2 SER N    1 1 
        8  4553 1 1  2 SER O    O   -3.360 -24.402 -17.546 1.00 . A A .   2 SER O    1 1 
        8  4554 1 1  2 SER OG   O    1.133 -24.583 -16.628 1.00 . A A .   2 SER OG   1 1 
        8  4555 1 1  3 SER C    C   -4.418 -22.444 -15.260 1.00 . A A .   3 SER C    1 1 
        8  4556 1 1  3 SER CA   C   -4.328 -23.943 -14.990 1.00 . A A .   3 SER CA   1 1 
        8  4557 1 1  3 SER CB   C   -4.651 -24.229 -13.522 1.00 . A A .   3 SER CB   1 1 
        8  4558 1 1  3 SER H    H   -2.374 -24.663 -14.603 1.00 . A A .   3 SER H    1 1 
        8  4559 1 1  3 SER HA   H   -5.046 -24.453 -15.614 1.00 . A A .   3 SER HA   1 1 
        8  4560 1 1  3 SER HB2  H   -5.570 -23.730 -13.255 1.00 . A A .   3 SER HB2  1 1 
        8  4561 1 1  3 SER HB3  H   -4.765 -25.294 -13.383 1.00 . A A .   3 SER HB3  1 1 
        8  4562 1 1  3 SER HG   H   -3.927 -23.755 -11.764 1.00 . A A .   3 SER HG   1 1 
        8  4563 1 1  3 SER N    N   -3.003 -24.452 -15.325 1.00 . A A .   3 SER N    1 1 
        8  4564 1 1  3 SER O    O   -5.251 -21.992 -16.043 1.00 . A A .   3 SER O    1 1 
        8  4565 1 1  3 SER OG   O   -3.616 -23.766 -12.672 1.00 . A A .   3 SER OG   1 1 
        8  4566 1 1  4 GLY C    C   -3.923 -19.494 -13.519 1.00 . A A .   4 GLY C    1 1 
        8  4567 1 1  4 GLY CA   C   -3.548 -20.238 -14.785 1.00 . A A .   4 GLY CA   1 1 
        8  4568 1 1  4 GLY H    H   -2.908 -22.094 -13.991 1.00 . A A .   4 GLY H    1 1 
        8  4569 1 1  4 GLY HA2  H   -2.562 -19.927 -15.095 1.00 . A A .   4 GLY HA2  1 1 
        8  4570 1 1  4 GLY HA3  H   -4.255 -19.983 -15.561 1.00 . A A .   4 GLY HA3  1 1 
        8  4571 1 1  4 GLY N    N   -3.551 -21.678 -14.604 1.00 . A A .   4 GLY N    1 1 
        8  4572 1 1  4 GLY O    O   -3.572 -19.914 -12.416 1.00 . A A .   4 GLY O    1 1 
        8  4573 1 1  5 SER C    C   -6.265 -18.194 -11.846 1.00 . A A .   5 SER C    1 1 
        8  4574 1 1  5 SER CA   C   -5.054 -17.575 -12.536 1.00 . A A .   5 SER CA   1 1 
        8  4575 1 1  5 SER CB   C   -5.383 -16.150 -12.987 1.00 . A A .   5 SER CB   1 1 
        8  4576 1 1  5 SER H    H   -4.885 -18.099 -14.581 1.00 . A A .   5 SER H    1 1 
        8  4577 1 1  5 SER HA   H   -4.233 -17.541 -11.836 1.00 . A A .   5 SER HA   1 1 
        8  4578 1 1  5 SER HB2  H   -6.018 -16.189 -13.859 1.00 . A A .   5 SER HB2  1 1 
        8  4579 1 1  5 SER HB3  H   -5.897 -15.633 -12.190 1.00 . A A .   5 SER HB3  1 1 
        8  4580 1 1  5 SER HG   H   -3.948 -15.630 -14.216 1.00 . A A .   5 SER HG   1 1 
        8  4581 1 1  5 SER N    N   -4.636 -18.383 -13.676 1.00 . A A .   5 SER N    1 1 
        8  4582 1 1  5 SER O    O   -7.400 -17.771 -12.062 1.00 . A A .   5 SER O    1 1 
        8  4583 1 1  5 SER OG   O   -4.204 -15.433 -13.312 1.00 . A A .   5 SER OG   1 1 
        8  4584 1 1  6 SER C    C   -7.222 -19.329  -8.878 1.00 . A A .   6 SER C    1 1 
        8  4585 1 1  6 SER CA   C   -7.083 -19.882 -10.294 1.00 . A A .   6 SER CA   1 1 
        8  4586 1 1  6 SER CB   C   -6.813 -21.387 -10.242 1.00 . A A .   6 SER CB   1 1 
        8  4587 1 1  6 SER H    H   -5.087 -19.492 -10.884 1.00 . A A .   6 SER H    1 1 
        8  4588 1 1  6 SER HA   H   -8.005 -19.708 -10.828 1.00 . A A .   6 SER HA   1 1 
        8  4589 1 1  6 SER HB2  H   -5.864 -21.563  -9.757 1.00 . A A .   6 SER HB2  1 1 
        8  4590 1 1  6 SER HB3  H   -7.599 -21.872  -9.681 1.00 . A A .   6 SER HB3  1 1 
        8  4591 1 1  6 SER HG   H   -6.043 -22.566 -11.603 1.00 . A A .   6 SER HG   1 1 
        8  4592 1 1  6 SER N    N   -6.014 -19.200 -11.014 1.00 . A A .   6 SER N    1 1 
        8  4593 1 1  6 SER O    O   -8.279 -18.827  -8.497 1.00 . A A .   6 SER O    1 1 
        8  4594 1 1  6 SER OG   O   -6.770 -21.943 -11.544 1.00 . A A .   6 SER OG   1 1 
        8  4595 1 1  7 GLY C    C   -6.355 -17.431  -6.668 1.00 . A A .   7 GLY C    1 1 
        8  4596 1 1  7 GLY CA   C   -6.169 -18.934  -6.738 1.00 . A A .   7 GLY CA   1 1 
        8  4597 1 1  7 GLY H    H   -5.332 -19.838  -8.460 1.00 . A A .   7 GLY H    1 1 
        8  4598 1 1  7 GLY HA2  H   -6.979 -19.412  -6.207 1.00 . A A .   7 GLY HA2  1 1 
        8  4599 1 1  7 GLY HA3  H   -5.236 -19.192  -6.259 1.00 . A A .   7 GLY HA3  1 1 
        8  4600 1 1  7 GLY N    N   -6.147 -19.427  -8.103 1.00 . A A .   7 GLY N    1 1 
        8  4601 1 1  7 GLY O    O   -7.473 -16.932  -6.792 1.00 . A A .   7 GLY O    1 1 
        8  4602 1 1  8 GLU C    C   -6.307 -14.682  -7.375 1.00 . A A .   8 GLU C    1 1 
        8  4603 1 1  8 GLU CA   C   -5.306 -15.255  -6.376 1.00 . A A .   8 GLU CA   1 1 
        8  4604 1 1  8 GLU CB   C   -3.919 -14.659  -6.629 1.00 . A A .   8 GLU CB   1 1 
        8  4605 1 1  8 GLU CD   C   -1.537 -14.406  -5.827 1.00 . A A .   8 GLU CD   1 1 
        8  4606 1 1  8 GLU CG   C   -2.907 -14.992  -5.546 1.00 . A A .   8 GLU CG   1 1 
        8  4607 1 1  8 GLU H    H   -4.395 -17.166  -6.374 1.00 . A A .   8 GLU H    1 1 
        8  4608 1 1  8 GLU HA   H   -5.622 -14.994  -5.378 1.00 . A A .   8 GLU HA   1 1 
        8  4609 1 1  8 GLU HB2  H   -3.545 -15.035  -7.570 1.00 . A A .   8 GLU HB2  1 1 
        8  4610 1 1  8 GLU HB3  H   -4.008 -13.585  -6.691 1.00 . A A .   8 GLU HB3  1 1 
        8  4611 1 1  8 GLU HG2  H   -3.263 -14.598  -4.605 1.00 . A A .   8 GLU HG2  1 1 
        8  4612 1 1  8 GLU HG3  H   -2.815 -16.066  -5.474 1.00 . A A .   8 GLU HG3  1 1 
        8  4613 1 1  8 GLU N    N   -5.257 -16.709  -6.466 1.00 . A A .   8 GLU N    1 1 
        8  4614 1 1  8 GLU O    O   -6.440 -15.178  -8.493 1.00 . A A .   8 GLU O    1 1 
        8  4615 1 1  8 GLU OE1  O   -1.407 -13.164  -5.808 1.00 . A A .   8 GLU OE1  1 1 
        8  4616 1 1  8 GLU OE2  O   -0.595 -15.190  -6.067 1.00 . A A .   8 GLU OE2  1 1 
        8  4617 1 1  9 GLY C    C   -7.396 -11.903  -8.679 1.00 . A A .   9 GLY C    1 1 
        8  4618 1 1  9 GLY CA   C   -7.992 -13.008  -7.831 1.00 . A A .   9 GLY CA   1 1 
        8  4619 1 1  9 GLY H    H   -6.863 -13.278  -6.060 1.00 . A A .   9 GLY H    1 1 
        8  4620 1 1  9 GLY HA2  H   -8.411 -13.761  -8.482 1.00 . A A .   9 GLY HA2  1 1 
        8  4621 1 1  9 GLY HA3  H   -8.782 -12.593  -7.222 1.00 . A A .   9 GLY HA3  1 1 
        8  4622 1 1  9 GLY N    N   -7.011 -13.632  -6.962 1.00 . A A .   9 GLY N    1 1 
        8  4623 1 1  9 GLY O    O   -6.809 -10.957  -8.153 1.00 . A A .   9 GLY O    1 1 
        8  4624 1 1 10 GLU C    C   -7.903  -9.784 -10.947 1.00 . A A .  10 GLU C    1 1 
        8  4625 1 1 10 GLU CA   C   -7.014 -11.025 -10.916 1.00 . A A .  10 GLU CA   1 1 
        8  4626 1 1 10 GLU CB   C   -6.891 -11.613 -12.324 1.00 . A A .  10 GLU CB   1 1 
        8  4627 1 1 10 GLU CD   C   -4.841 -10.154 -12.543 1.00 . A A .  10 GLU CD   1 1 
        8  4628 1 1 10 GLU CG   C   -6.021 -10.786 -13.255 1.00 . A A .  10 GLU CG   1 1 
        8  4629 1 1 10 GLU H    H   -8.023 -12.798 -10.353 1.00 . A A .  10 GLU H    1 1 
        8  4630 1 1 10 GLU HA   H   -6.033 -10.741 -10.568 1.00 . A A .  10 GLU HA   1 1 
        8  4631 1 1 10 GLU HB2  H   -6.466 -12.603 -12.251 1.00 . A A .  10 GLU HB2  1 1 
        8  4632 1 1 10 GLU HB3  H   -7.878 -11.686 -12.757 1.00 . A A .  10 GLU HB3  1 1 
        8  4633 1 1 10 GLU HG2  H   -5.647 -11.426 -14.040 1.00 . A A .  10 GLU HG2  1 1 
        8  4634 1 1 10 GLU HG3  H   -6.624 -10.002 -13.688 1.00 . A A .  10 GLU HG3  1 1 
        8  4635 1 1 10 GLU N    N   -7.545 -12.022  -9.994 1.00 . A A .  10 GLU N    1 1 
        8  4636 1 1 10 GLU O    O   -9.037  -9.831 -11.424 1.00 . A A .  10 GLU O    1 1 
        8  4637 1 1 10 GLU OE1  O   -4.175 -10.860 -11.758 1.00 . A A .  10 GLU OE1  1 1 
        8  4638 1 1 10 GLU OE2  O   -4.584  -8.953 -12.770 1.00 . A A .  10 GLU OE2  1 1 
        8  4639 1 1 11 LYS C    C   -7.488  -6.390 -11.332 1.00 . A A .  11 LYS C    1 1 
        8  4640 1 1 11 LYS CA   C   -8.122  -7.422 -10.404 1.00 . A A .  11 LYS CA   1 1 
        8  4641 1 1 11 LYS CB   C   -8.177  -6.873  -8.977 1.00 . A A .  11 LYS CB   1 1 
        8  4642 1 1 11 LYS CD   C   -9.286  -6.953  -6.724 1.00 . A A .  11 LYS CD   1 1 
        8  4643 1 1 11 LYS CE   C   -8.089  -7.169  -5.812 1.00 . A A .  11 LYS CE   1 1 
        8  4644 1 1 11 LYS CG   C   -9.103  -7.654  -8.060 1.00 . A A .  11 LYS CG   1 1 
        8  4645 1 1 11 LYS H    H   -6.469  -8.702 -10.070 1.00 . A A .  11 LYS H    1 1 
        8  4646 1 1 11 LYS HA   H   -9.127  -7.623 -10.742 1.00 . A A .  11 LYS HA   1 1 
        8  4647 1 1 11 LYS HB2  H   -7.182  -6.898  -8.556 1.00 . A A .  11 LYS HB2  1 1 
        8  4648 1 1 11 LYS HB3  H   -8.518  -5.848  -9.010 1.00 . A A .  11 LYS HB3  1 1 
        8  4649 1 1 11 LYS HD2  H   -9.406  -5.894  -6.897 1.00 . A A .  11 LYS HD2  1 1 
        8  4650 1 1 11 LYS HD3  H  -10.171  -7.344  -6.242 1.00 . A A .  11 LYS HD3  1 1 
        8  4651 1 1 11 LYS HE2  H   -7.188  -6.939  -6.361 1.00 . A A .  11 LYS HE2  1 1 
        8  4652 1 1 11 LYS HE3  H   -8.174  -6.505  -4.965 1.00 . A A .  11 LYS HE3  1 1 
        8  4653 1 1 11 LYS HG2  H  -10.066  -7.754  -8.537 1.00 . A A .  11 LYS HG2  1 1 
        8  4654 1 1 11 LYS HG3  H   -8.681  -8.634  -7.887 1.00 . A A .  11 LYS HG3  1 1 
        8  4655 1 1 11 LYS HZ1  H   -8.903  -9.070  -5.518 1.00 . A A .  11 LYS HZ1  1 1 
        8  4656 1 1 11 LYS HZ2  H   -7.840  -8.584  -4.295 1.00 . A A .  11 LYS HZ2  1 1 
        8  4657 1 1 11 LYS HZ3  H   -7.235  -9.075  -5.796 1.00 . A A .  11 LYS HZ3  1 1 
        8  4658 1 1 11 LYS N    N   -7.379  -8.676 -10.436 1.00 . A A .  11 LYS N    1 1 
        8  4659 1 1 11 LYS NZ   N   -8.012  -8.573  -5.321 1.00 . A A .  11 LYS NZ   1 1 
        8  4660 1 1 11 LYS O    O   -6.270  -6.338 -11.502 1.00 . A A .  11 LYS O    1 1 
        8  4661 1 1 12 PRO C    C   -7.130  -3.384 -12.148 1.00 . A A .  12 PRO C    1 1 
        8  4662 1 1 12 PRO CA   C   -7.876  -4.502 -12.867 1.00 . A A .  12 PRO CA   1 1 
        8  4663 1 1 12 PRO CB   C   -9.177  -3.972 -13.475 1.00 . A A .  12 PRO CB   1 1 
        8  4664 1 1 12 PRO CD   C   -9.796  -5.554 -11.792 1.00 . A A .  12 PRO CD   1 1 
        8  4665 1 1 12 PRO CG   C  -10.221  -4.273 -12.455 1.00 . A A .  12 PRO CG   1 1 
        8  4666 1 1 12 PRO HA   H   -7.250  -4.906 -13.649 1.00 . A A .  12 PRO HA   1 1 
        8  4667 1 1 12 PRO HB2  H   -9.089  -2.909 -13.650 1.00 . A A .  12 PRO HB2  1 1 
        8  4668 1 1 12 PRO HB3  H   -9.377  -4.481 -14.406 1.00 . A A .  12 PRO HB3  1 1 
        8  4669 1 1 12 PRO HD2  H  -10.074  -5.549 -10.749 1.00 . A A .  12 PRO HD2  1 1 
        8  4670 1 1 12 PRO HD3  H  -10.234  -6.403 -12.297 1.00 . A A .  12 PRO HD3  1 1 
        8  4671 1 1 12 PRO HG2  H  -10.268  -3.473 -11.731 1.00 . A A .  12 PRO HG2  1 1 
        8  4672 1 1 12 PRO HG3  H  -11.179  -4.400 -12.938 1.00 . A A .  12 PRO HG3  1 1 
        8  4673 1 1 12 PRO N    N   -8.332  -5.549 -11.948 1.00 . A A .  12 PRO N    1 1 
        8  4674 1 1 12 PRO O    O   -6.676  -2.425 -12.773 1.00 . A A .  12 PRO O    1 1 
        8  4675 1 1 13 TYR C    C   -5.235  -3.156  -9.165 1.00 . A A .  13 TYR C    1 1 
        8  4676 1 1 13 TYR CA   C   -6.315  -2.511 -10.028 1.00 . A A .  13 TYR CA   1 1 
        8  4677 1 1 13 TYR CB   C   -7.312  -1.763  -9.141 1.00 . A A .  13 TYR CB   1 1 
        8  4678 1 1 13 TYR CD1  C   -8.215  -0.224 -10.929 1.00 . A A .  13 TYR CD1  1 1 
        8  4679 1 1 13 TYR CD2  C   -9.774  -1.462  -9.617 1.00 . A A .  13 TYR CD2  1 1 
        8  4680 1 1 13 TYR CE1  C   -9.256   0.350 -11.632 1.00 . A A .  13 TYR CE1  1 1 
        8  4681 1 1 13 TYR CE2  C  -10.821  -0.894 -10.317 1.00 . A A .  13 TYR CE2  1 1 
        8  4682 1 1 13 TYR CG   C   -8.455  -1.138  -9.910 1.00 . A A .  13 TYR CG   1 1 
        8  4683 1 1 13 TYR CZ   C  -10.557   0.011 -11.323 1.00 . A A .  13 TYR CZ   1 1 
        8  4684 1 1 13 TYR H    H   -7.388  -4.299 -10.390 1.00 . A A .  13 TYR H    1 1 
        8  4685 1 1 13 TYR HA   H   -5.849  -1.808 -10.702 1.00 . A A .  13 TYR HA   1 1 
        8  4686 1 1 13 TYR HB2  H   -7.733  -2.451  -8.424 1.00 . A A .  13 TYR HB2  1 1 
        8  4687 1 1 13 TYR HB3  H   -6.794  -0.974  -8.616 1.00 . A A .  13 TYR HB3  1 1 
        8  4688 1 1 13 TYR HD1  H   -7.195   0.038 -11.169 1.00 . A A .  13 TYR HD1  1 1 
        8  4689 1 1 13 TYR HD2  H   -9.977  -2.172  -8.828 1.00 . A A .  13 TYR HD2  1 1 
        8  4690 1 1 13 TYR HE1  H   -9.050   1.058 -12.421 1.00 . A A .  13 TYR HE1  1 1 
        8  4691 1 1 13 TYR HE2  H  -11.840  -1.159 -10.074 1.00 . A A .  13 TYR HE2  1 1 
        8  4692 1 1 13 TYR HH   H  -11.938  -0.053 -12.659 1.00 . A A .  13 TYR HH   1 1 
        8  4693 1 1 13 TYR N    N   -7.005  -3.513 -10.832 1.00 . A A .  13 TYR N    1 1 
        8  4694 1 1 13 TYR O    O   -5.330  -3.166  -7.938 1.00 . A A .  13 TYR O    1 1 
        8  4695 1 1 13 TYR OH   O  -11.597   0.580 -12.023 1.00 . A A .  13 TYR OH   1 1 
        8  4696 1 1 14 GLN C    C   -1.824  -3.528  -9.243 1.00 . A A .  14 GLN C    1 1 
        8  4697 1 1 14 GLN CA   C   -3.109  -4.339  -9.109 1.00 . A A .  14 GLN CA   1 1 
        8  4698 1 1 14 GLN CB   C   -2.891  -5.754  -9.647 1.00 . A A .  14 GLN CB   1 1 
        8  4699 1 1 14 GLN CD   C   -1.670  -7.943  -9.329 1.00 . A A .  14 GLN CD   1 1 
        8  4700 1 1 14 GLN CG   C   -1.681  -6.453  -9.048 1.00 . A A .  14 GLN CG   1 1 
        8  4701 1 1 14 GLN H    H   -4.189  -3.652 -10.795 1.00 . A A .  14 GLN H    1 1 
        8  4702 1 1 14 GLN HA   H   -3.376  -4.398  -8.065 1.00 . A A .  14 GLN HA   1 1 
        8  4703 1 1 14 GLN HB2  H   -3.767  -6.348  -9.431 1.00 . A A .  14 GLN HB2  1 1 
        8  4704 1 1 14 GLN HB3  H   -2.757  -5.703 -10.718 1.00 . A A .  14 GLN HB3  1 1 
        8  4705 1 1 14 GLN HE21 H   -1.307  -8.327  -7.412 1.00 . A A .  14 GLN HE21 1 1 
        8  4706 1 1 14 GLN HE22 H   -1.436  -9.707  -8.443 1.00 . A A .  14 GLN HE22 1 1 
        8  4707 1 1 14 GLN HG2  H   -0.786  -6.017  -9.466 1.00 . A A .  14 GLN HG2  1 1 
        8  4708 1 1 14 GLN HG3  H   -1.688  -6.303  -7.979 1.00 . A A .  14 GLN HG3  1 1 
        8  4709 1 1 14 GLN N    N   -4.208  -3.692  -9.816 1.00 . A A .  14 GLN N    1 1 
        8  4710 1 1 14 GLN NE2  N   -1.448  -8.740  -8.291 1.00 . A A .  14 GLN NE2  1 1 
        8  4711 1 1 14 GLN O    O   -1.240  -3.444 -10.324 1.00 . A A .  14 GLN O    1 1 
        8  4712 1 1 14 GLN OE1  O   -1.858  -8.373 -10.468 1.00 . A A .  14 GLN OE1  1 1 
        8  4713 1 1 15 CYS C    C    0.992  -2.896  -8.749 1.00 . A A .  15 CYS C    1 1 
        8  4714 1 1 15 CYS CA   C   -0.173  -2.128  -8.130 1.00 . A A .  15 CYS CA   1 1 
        8  4715 1 1 15 CYS CB   C    0.179  -1.710  -6.701 1.00 . A A .  15 CYS CB   1 1 
        8  4716 1 1 15 CYS H    H   -1.897  -3.037  -7.306 1.00 . A A .  15 CYS H    1 1 
        8  4717 1 1 15 CYS HA   H   -0.357  -1.242  -8.719 1.00 . A A .  15 CYS HA   1 1 
        8  4718 1 1 15 CYS HB2  H   -0.661  -1.184  -6.271 1.00 . A A .  15 CYS HB2  1 1 
        8  4719 1 1 15 CYS HB3  H    0.381  -2.595  -6.115 1.00 . A A .  15 CYS HB3  1 1 
        8  4720 1 1 15 CYS N    N   -1.388  -2.933  -8.138 1.00 . A A .  15 CYS N    1 1 
        8  4721 1 1 15 CYS O    O    1.166  -4.088  -8.497 1.00 . A A .  15 CYS O    1 1 
        8  4722 1 1 15 CYS SG   S    1.634  -0.620  -6.581 1.00 . A A .  15 CYS SG   1 1 
        8  4723 1 1 16 SER C    C    4.225  -2.493  -9.474 1.00 . A A .  16 SER C    1 1 
        8  4724 1 1 16 SER CA   C    2.933  -2.820 -10.216 1.00 . A A .  16 SER CA   1 1 
        8  4725 1 1 16 SER CB   C    3.030  -2.347 -11.667 1.00 . A A .  16 SER CB   1 1 
        8  4726 1 1 16 SER H    H    1.595  -1.255  -9.720 1.00 . A A .  16 SER H    1 1 
        8  4727 1 1 16 SER HA   H    2.785  -3.890 -10.204 1.00 . A A .  16 SER HA   1 1 
        8  4728 1 1 16 SER HB2  H    2.158  -2.676 -12.210 1.00 . A A .  16 SER HB2  1 1 
        8  4729 1 1 16 SER HB3  H    3.082  -1.268 -11.689 1.00 . A A .  16 SER HB3  1 1 
        8  4730 1 1 16 SER HG   H    4.928  -2.282 -12.149 1.00 . A A .  16 SER HG   1 1 
        8  4731 1 1 16 SER N    N    1.786  -2.203  -9.559 1.00 . A A .  16 SER N    1 1 
        8  4732 1 1 16 SER O    O    5.074  -3.361  -9.274 1.00 . A A .  16 SER O    1 1 
        8  4733 1 1 16 SER OG   O    4.185  -2.872 -12.298 1.00 . A A .  16 SER OG   1 1 
        8  4734 1 1 17 GLU C    C    6.067  -1.889  -7.421 1.00 . A A .  17 GLU C    1 1 
        8  4735 1 1 17 GLU CA   C    5.555  -0.792  -8.351 1.00 . A A .  17 GLU CA   1 1 
        8  4736 1 1 17 GLU CB   C    5.250   0.473  -7.546 1.00 . A A .  17 GLU CB   1 1 
        8  4737 1 1 17 GLU CD   C    6.970   2.105  -8.417 1.00 . A A .  17 GLU CD   1 1 
        8  4738 1 1 17 GLU CG   C    5.497   1.759  -8.317 1.00 . A A .  17 GLU CG   1 1 
        8  4739 1 1 17 GLU H    H    3.653  -0.589  -9.259 1.00 . A A .  17 GLU H    1 1 
        8  4740 1 1 17 GLU HA   H    6.319  -0.569  -9.079 1.00 . A A .  17 GLU HA   1 1 
        8  4741 1 1 17 GLU HB2  H    4.214   0.452  -7.243 1.00 . A A .  17 GLU HB2  1 1 
        8  4742 1 1 17 GLU HB3  H    5.873   0.482  -6.664 1.00 . A A .  17 GLU HB3  1 1 
        8  4743 1 1 17 GLU HG2  H    5.101   1.647  -9.315 1.00 . A A .  17 GLU HG2  1 1 
        8  4744 1 1 17 GLU HG3  H    4.986   2.567  -7.817 1.00 . A A .  17 GLU HG3  1 1 
        8  4745 1 1 17 GLU N    N    4.366  -1.235  -9.069 1.00 . A A .  17 GLU N    1 1 
        8  4746 1 1 17 GLU O    O    7.267  -2.164  -7.369 1.00 . A A .  17 GLU O    1 1 
        8  4747 1 1 17 GLU OE1  O    7.744   1.669  -7.539 1.00 . A A .  17 GLU OE1  1 1 
        8  4748 1 1 17 GLU OE2  O    7.349   2.812  -9.375 1.00 . A A .  17 GLU OE2  1 1 
        8  4749 1 1 18 CYS C    C    4.879  -4.900  -6.180 1.00 . A A .  18 CYS C    1 1 
        8  4750 1 1 18 CYS CA   C    5.508  -3.575  -5.758 1.00 . A A .  18 CYS CA   1 1 
        8  4751 1 1 18 CYS CB   C    5.060  -3.215  -4.340 1.00 . A A .  18 CYS CB   1 1 
        8  4752 1 1 18 CYS H    H    4.210  -2.246  -6.772 1.00 . A A .  18 CYS H    1 1 
        8  4753 1 1 18 CYS HA   H    6.582  -3.681  -5.771 1.00 . A A .  18 CYS HA   1 1 
        8  4754 1 1 18 CYS HB2  H    5.262  -4.049  -3.684 1.00 . A A .  18 CYS HB2  1 1 
        8  4755 1 1 18 CYS HB3  H    5.619  -2.355  -4.002 1.00 . A A .  18 CYS HB3  1 1 
        8  4756 1 1 18 CYS N    N    5.151  -2.510  -6.687 1.00 . A A .  18 CYS N    1 1 
        8  4757 1 1 18 CYS O    O    5.537  -5.939  -6.182 1.00 . A A .  18 CYS O    1 1 
        8  4758 1 1 18 CYS SG   S    3.288  -2.818  -4.198 1.00 . A A .  18 CYS SG   1 1 
        8  4759 1 1 19 GLY C    C    1.827  -6.475  -5.976 1.00 . A A .  19 GLY C    1 1 
        8  4760 1 1 19 GLY CA   C    2.902  -6.055  -6.959 1.00 . A A .  19 GLY CA   1 1 
        8  4761 1 1 19 GLY H    H    3.124  -3.996  -6.518 1.00 . A A .  19 GLY H    1 1 
        8  4762 1 1 19 GLY HA2  H    2.446  -5.875  -7.921 1.00 . A A .  19 GLY HA2  1 1 
        8  4763 1 1 19 GLY HA3  H    3.618  -6.857  -7.055 1.00 . A A .  19 GLY HA3  1 1 
        8  4764 1 1 19 GLY N    N    3.599  -4.853  -6.539 1.00 . A A .  19 GLY N    1 1 
        8  4765 1 1 19 GLY O    O    1.612  -7.666  -5.751 1.00 . A A .  19 GLY O    1 1 
        8  4766 1 1 20 LYS C    C   -1.279  -5.466  -5.019 1.00 . A A .  20 LYS C    1 1 
        8  4767 1 1 20 LYS CA   C    0.092  -5.767  -4.422 1.00 . A A .  20 LYS CA   1 1 
        8  4768 1 1 20 LYS CB   C    0.302  -4.936  -3.155 1.00 . A A .  20 LYS CB   1 1 
        8  4769 1 1 20 LYS CD   C    1.877  -4.290  -1.307 1.00 . A A .  20 LYS CD   1 1 
        8  4770 1 1 20 LYS CE   C    3.239  -4.551  -0.682 1.00 . A A .  20 LYS CE   1 1 
        8  4771 1 1 20 LYS CG   C    1.548  -5.320  -2.375 1.00 . A A .  20 LYS CG   1 1 
        8  4772 1 1 20 LYS H    H    1.368  -4.564  -5.608 1.00 . A A .  20 LYS H    1 1 
        8  4773 1 1 20 LYS HA   H    0.137  -6.815  -4.167 1.00 . A A .  20 LYS HA   1 1 
        8  4774 1 1 20 LYS HB2  H    0.382  -3.895  -3.431 1.00 . A A .  20 LYS HB2  1 1 
        8  4775 1 1 20 LYS HB3  H   -0.555  -5.064  -2.509 1.00 . A A .  20 LYS HB3  1 1 
        8  4776 1 1 20 LYS HD2  H    1.882  -3.308  -1.756 1.00 . A A .  20 LYS HD2  1 1 
        8  4777 1 1 20 LYS HD3  H    1.122  -4.332  -0.535 1.00 . A A .  20 LYS HD3  1 1 
        8  4778 1 1 20 LYS HE2  H    3.920  -4.870  -1.456 1.00 . A A .  20 LYS HE2  1 1 
        8  4779 1 1 20 LYS HE3  H    3.599  -3.634  -0.241 1.00 . A A .  20 LYS HE3  1 1 
        8  4780 1 1 20 LYS HG2  H    1.384  -6.276  -1.900 1.00 . A A .  20 LYS HG2  1 1 
        8  4781 1 1 20 LYS HG3  H    2.381  -5.394  -3.060 1.00 . A A .  20 LYS HG3  1 1 
        8  4782 1 1 20 LYS HZ1  H    3.516  -5.224   1.276 1.00 . A A .  20 LYS HZ1  1 1 
        8  4783 1 1 20 LYS HZ2  H    3.764  -6.415   0.100 1.00 . A A .  20 LYS HZ2  1 1 
        8  4784 1 1 20 LYS HZ3  H    2.193  -5.927   0.491 1.00 . A A .  20 LYS HZ3  1 1 
        8  4785 1 1 20 LYS N    N    1.150  -5.495  -5.387 1.00 . A A .  20 LYS N    1 1 
        8  4786 1 1 20 LYS NZ   N    3.174  -5.603   0.370 1.00 . A A .  20 LYS NZ   1 1 
        8  4787 1 1 20 LYS O    O   -1.416  -4.591  -5.874 1.00 . A A .  20 LYS O    1 1 
        8  4788 1 1 21 SER C    C   -4.541  -5.399  -3.971 1.00 . A A .  21 SER C    1 1 
        8  4789 1 1 21 SER CA   C   -3.652  -6.007  -5.052 1.00 . A A .  21 SER CA   1 1 
        8  4790 1 1 21 SER CB   C   -4.238  -7.341  -5.519 1.00 . A A .  21 SER CB   1 1 
        8  4791 1 1 21 SER H    H   -2.120  -6.877  -3.879 1.00 . A A .  21 SER H    1 1 
        8  4792 1 1 21 SER HA   H   -3.611  -5.328  -5.891 1.00 . A A .  21 SER HA   1 1 
        8  4793 1 1 21 SER HB2  H   -4.044  -8.097  -4.773 1.00 . A A .  21 SER HB2  1 1 
        8  4794 1 1 21 SER HB3  H   -5.305  -7.234  -5.655 1.00 . A A .  21 SER HB3  1 1 
        8  4795 1 1 21 SER HG   H   -3.771  -7.057  -7.400 1.00 . A A .  21 SER HG   1 1 
        8  4796 1 1 21 SER N    N   -2.292  -6.195  -4.561 1.00 . A A .  21 SER N    1 1 
        8  4797 1 1 21 SER O    O   -4.256  -5.517  -2.778 1.00 . A A .  21 SER O    1 1 
        8  4798 1 1 21 SER OG   O   -3.659  -7.750  -6.745 1.00 . A A .  21 SER OG   1 1 
        8  4799 1 1 22 PHE C    C   -7.971  -4.142  -4.019 1.00 . A A .  22 PHE C    1 1 
        8  4800 1 1 22 PHE CA   C   -6.549  -4.120  -3.465 1.00 . A A .  22 PHE CA   1 1 
        8  4801 1 1 22 PHE CB   C   -6.123  -2.678  -3.180 1.00 . A A .  22 PHE CB   1 1 
        8  4802 1 1 22 PHE CD1  C   -4.320  -2.865  -1.445 1.00 . A A .  22 PHE CD1  1 1 
        8  4803 1 1 22 PHE CD2  C   -3.718  -2.120  -3.629 1.00 . A A .  22 PHE CD2  1 1 
        8  4804 1 1 22 PHE CE1  C   -3.004  -2.748  -1.040 1.00 . A A .  22 PHE CE1  1 1 
        8  4805 1 1 22 PHE CE2  C   -2.400  -2.002  -3.229 1.00 . A A .  22 PHE CE2  1 1 
        8  4806 1 1 22 PHE CG   C   -4.692  -2.552  -2.742 1.00 . A A .  22 PHE CG   1 1 
        8  4807 1 1 22 PHE CZ   C   -2.043  -2.317  -1.933 1.00 . A A .  22 PHE CZ   1 1 
        8  4808 1 1 22 PHE H    H   -5.792  -4.688  -5.359 1.00 . A A .  22 PHE H    1 1 
        8  4809 1 1 22 PHE HA   H   -6.526  -4.682  -2.544 1.00 . A A .  22 PHE HA   1 1 
        8  4810 1 1 22 PHE HB2  H   -6.249  -2.089  -4.076 1.00 . A A .  22 PHE HB2  1 1 
        8  4811 1 1 22 PHE HB3  H   -6.748  -2.275  -2.397 1.00 . A A .  22 PHE HB3  1 1 
        8  4812 1 1 22 PHE HD1  H   -5.070  -3.203  -0.745 1.00 . A A .  22 PHE HD1  1 1 
        8  4813 1 1 22 PHE HD2  H   -3.998  -1.873  -4.643 1.00 . A A .  22 PHE HD2  1 1 
        8  4814 1 1 22 PHE HE1  H   -2.727  -2.996  -0.026 1.00 . A A .  22 PHE HE1  1 1 
        8  4815 1 1 22 PHE HE2  H   -1.652  -1.665  -3.931 1.00 . A A .  22 PHE HE2  1 1 
        8  4816 1 1 22 PHE HZ   H   -1.014  -2.225  -1.619 1.00 . A A .  22 PHE HZ   1 1 
        8  4817 1 1 22 PHE N    N   -5.618  -4.748  -4.396 1.00 . A A .  22 PHE N    1 1 
        8  4818 1 1 22 PHE O    O   -8.175  -4.203  -5.232 1.00 . A A .  22 PHE O    1 1 
        8  4819 1 1 23 SER C    C  -10.893  -2.693  -3.672 1.00 . A A .  23 SER C    1 1 
        8  4820 1 1 23 SER CA   C  -10.353  -4.112  -3.520 1.00 . A A .  23 SER CA   1 1 
        8  4821 1 1 23 SER CB   C  -11.186  -4.880  -2.492 1.00 . A A .  23 SER CB   1 1 
        8  4822 1 1 23 SER H    H   -8.723  -4.046  -2.170 1.00 . A A .  23 SER H    1 1 
        8  4823 1 1 23 SER HA   H  -10.420  -4.614  -4.473 1.00 . A A .  23 SER HA   1 1 
        8  4824 1 1 23 SER HB2  H  -11.184  -4.342  -1.557 1.00 . A A .  23 SER HB2  1 1 
        8  4825 1 1 23 SER HB3  H  -12.201  -4.972  -2.852 1.00 . A A .  23 SER HB3  1 1 
        8  4826 1 1 23 SER HG   H  -10.242  -6.492  -3.079 1.00 . A A .  23 SER HG   1 1 
        8  4827 1 1 23 SER N    N   -8.950  -4.093  -3.122 1.00 . A A .  23 SER N    1 1 
        8  4828 1 1 23 SER O    O  -11.618  -2.197  -2.811 1.00 . A A .  23 SER O    1 1 
        8  4829 1 1 23 SER OG   O  -10.659  -6.177  -2.274 1.00 . A A .  23 SER OG   1 1 
        8  4830 1 1 24 GLY C    C   -9.905   0.191  -5.608 1.00 . A A .  24 GLY C    1 1 
        8  4831 1 1 24 GLY CA   C  -10.991  -0.690  -5.023 1.00 . A A .  24 GLY CA   1 1 
        8  4832 1 1 24 GLY H    H   -9.954  -2.491  -5.429 1.00 . A A .  24 GLY H    1 1 
        8  4833 1 1 24 GLY HA2  H  -11.824  -0.722  -5.710 1.00 . A A .  24 GLY HA2  1 1 
        8  4834 1 1 24 GLY HA3  H  -11.324  -0.259  -4.090 1.00 . A A .  24 GLY HA3  1 1 
        8  4835 1 1 24 GLY N    N  -10.534  -2.045  -4.777 1.00 . A A .  24 GLY N    1 1 
        8  4836 1 1 24 GLY O    O   -8.757   0.149  -5.166 1.00 . A A .  24 GLY O    1 1 
        8  4837 1 1 25 SER C    C   -8.628   2.783  -6.236 1.00 . A A .  25 SER C    1 1 
        8  4838 1 1 25 SER CA   C   -9.313   1.880  -7.258 1.00 . A A .  25 SER CA   1 1 
        8  4839 1 1 25 SER CB   C  -10.018   2.731  -8.316 1.00 . A A .  25 SER CB   1 1 
        8  4840 1 1 25 SER H    H  -11.198   0.977  -6.915 1.00 . A A .  25 SER H    1 1 
        8  4841 1 1 25 SER HA   H   -8.565   1.269  -7.740 1.00 . A A .  25 SER HA   1 1 
        8  4842 1 1 25 SER HB2  H  -11.035   2.918  -8.005 1.00 . A A .  25 SER HB2  1 1 
        8  4843 1 1 25 SER HB3  H   -9.496   3.671  -8.424 1.00 . A A .  25 SER HB3  1 1 
        8  4844 1 1 25 SER HG   H   -9.775   2.688 -10.259 1.00 . A A .  25 SER HG   1 1 
        8  4845 1 1 25 SER N    N  -10.267   0.989  -6.607 1.00 . A A .  25 SER N    1 1 
        8  4846 1 1 25 SER O    O   -7.409   2.741  -6.074 1.00 . A A .  25 SER O    1 1 
        8  4847 1 1 25 SER OG   O  -10.038   2.073  -9.570 1.00 . A A .  25 SER OG   1 1 
        8  4848 1 1 26 TYR C    C   -7.809   3.838  -3.711 1.00 . A A .  26 TYR C    1 1 
        8  4849 1 1 26 TYR CA   C   -8.894   4.512  -4.545 1.00 . A A .  26 TYR CA   1 1 
        8  4850 1 1 26 TYR CB   C  -10.018   5.008  -3.635 1.00 . A A .  26 TYR CB   1 1 
        8  4851 1 1 26 TYR CD1  C   -8.736   5.552  -1.529 1.00 . A A .  26 TYR CD1  1 1 
        8  4852 1 1 26 TYR CD2  C   -9.931   7.312  -2.605 1.00 . A A .  26 TYR CD2  1 1 
        8  4853 1 1 26 TYR CE1  C   -8.309   6.432  -0.553 1.00 . A A .  26 TYR CE1  1 1 
        8  4854 1 1 26 TYR CE2  C   -9.508   8.199  -1.634 1.00 . A A .  26 TYR CE2  1 1 
        8  4855 1 1 26 TYR CG   C   -9.553   5.975  -2.570 1.00 . A A .  26 TYR CG   1 1 
        8  4856 1 1 26 TYR CZ   C   -8.697   7.754  -0.610 1.00 . A A .  26 TYR CZ   1 1 
        8  4857 1 1 26 TYR H    H  -10.387   3.584  -5.724 1.00 . A A .  26 TYR H    1 1 
        8  4858 1 1 26 TYR HA   H   -8.462   5.358  -5.061 1.00 . A A .  26 TYR HA   1 1 
        8  4859 1 1 26 TYR HB2  H  -10.763   5.509  -4.234 1.00 . A A .  26 TYR HB2  1 1 
        8  4860 1 1 26 TYR HB3  H  -10.471   4.162  -3.140 1.00 . A A .  26 TYR HB3  1 1 
        8  4861 1 1 26 TYR HD1  H   -8.433   4.516  -1.487 1.00 . A A .  26 TYR HD1  1 1 
        8  4862 1 1 26 TYR HD2  H  -10.565   7.657  -3.408 1.00 . A A .  26 TYR HD2  1 1 
        8  4863 1 1 26 TYR HE1  H   -7.674   6.084   0.249 1.00 . A A .  26 TYR HE1  1 1 
        8  4864 1 1 26 TYR HE2  H   -9.812   9.235  -1.678 1.00 . A A .  26 TYR HE2  1 1 
        8  4865 1 1 26 TYR HH   H   -8.273   8.194   1.213 1.00 . A A .  26 TYR HH   1 1 
        8  4866 1 1 26 TYR N    N   -9.422   3.597  -5.550 1.00 . A A .  26 TYR N    1 1 
        8  4867 1 1 26 TYR O    O   -6.701   4.358  -3.576 1.00 . A A .  26 TYR O    1 1 
        8  4868 1 1 26 TYR OH   O   -8.273   8.634   0.359 1.00 . A A .  26 TYR OH   1 1 
        8  4869 1 1 27 ARG C    C   -5.830   1.838  -3.017 1.00 . A A .  27 ARG C    1 1 
        8  4870 1 1 27 ARG CA   C   -7.191   1.930  -2.333 1.00 . A A .  27 ARG CA   1 1 
        8  4871 1 1 27 ARG CB   C   -7.727   0.526  -2.050 1.00 . A A .  27 ARG CB   1 1 
        8  4872 1 1 27 ARG CD   C   -7.197   0.619   0.405 1.00 . A A .  27 ARG CD   1 1 
        8  4873 1 1 27 ARG CG   C   -7.036  -0.167  -0.886 1.00 . A A .  27 ARG CG   1 1 
        8  4874 1 1 27 ARG CZ   C   -7.169   0.200   2.828 1.00 . A A .  27 ARG CZ   1 1 
        8  4875 1 1 27 ARG H    H   -9.035   2.313  -3.299 1.00 . A A .  27 ARG H    1 1 
        8  4876 1 1 27 ARG HA   H   -7.076   2.457  -1.397 1.00 . A A .  27 ARG HA   1 1 
        8  4877 1 1 27 ARG HB2  H   -8.781   0.594  -1.824 1.00 . A A .  27 ARG HB2  1 1 
        8  4878 1 1 27 ARG HB3  H   -7.595  -0.082  -2.932 1.00 . A A .  27 ARG HB3  1 1 
        8  4879 1 1 27 ARG HD2  H   -6.378   1.317   0.491 1.00 . A A .  27 ARG HD2  1 1 
        8  4880 1 1 27 ARG HD3  H   -8.130   1.162   0.367 1.00 . A A .  27 ARG HD3  1 1 
        8  4881 1 1 27 ARG HE   H   -7.231  -1.218   1.426 1.00 . A A .  27 ARG HE   1 1 
        8  4882 1 1 27 ARG HG2  H   -7.470  -1.148  -0.754 1.00 . A A .  27 ARG HG2  1 1 
        8  4883 1 1 27 ARG HG3  H   -5.984  -0.264  -1.111 1.00 . A A .  27 ARG HG3  1 1 
        8  4884 1 1 27 ARG HH11 H   -7.125   2.150   2.302 1.00 . A A .  27 ARG HH11 1 1 
        8  4885 1 1 27 ARG HH12 H   -7.106   1.840   4.006 1.00 . A A .  27 ARG HH12 1 1 
        8  4886 1 1 27 ARG HH21 H   -7.207  -1.638   3.668 1.00 . A A .  27 ARG HH21 1 1 
        8  4887 1 1 27 ARG HH22 H   -7.152  -0.315   4.782 1.00 . A A .  27 ARG HH22 1 1 
        8  4888 1 1 27 ARG N    N   -8.136   2.677  -3.154 1.00 . A A .  27 ARG N    1 1 
        8  4889 1 1 27 ARG NE   N   -7.202  -0.251   1.578 1.00 . A A .  27 ARG NE   1 1 
        8  4890 1 1 27 ARG NH1  N   -7.129   1.504   3.065 1.00 . A A .  27 ARG NH1  1 1 
        8  4891 1 1 27 ARG NH2  N   -7.177  -0.655   3.843 1.00 . A A .  27 ARG NH2  1 1 
        8  4892 1 1 27 ARG O    O   -4.789   1.984  -2.374 1.00 . A A .  27 ARG O    1 1 
        8  4893 1 1 28 LEU C    C   -3.828   2.791  -5.060 1.00 . A A .  28 LEU C    1 1 
        8  4894 1 1 28 LEU CA   C   -4.613   1.483  -5.094 1.00 . A A .  28 LEU CA   1 1 
        8  4895 1 1 28 LEU CB   C   -4.927   1.102  -6.542 1.00 . A A .  28 LEU CB   1 1 
        8  4896 1 1 28 LEU CD1  C   -3.318  -0.623  -7.390 1.00 . A A .  28 LEU CD1  1 1 
        8  4897 1 1 28 LEU CD2  C   -4.025   1.260  -8.876 1.00 . A A .  28 LEU CD2  1 1 
        8  4898 1 1 28 LEU CG   C   -3.720   0.842  -7.445 1.00 . A A .  28 LEU CG   1 1 
        8  4899 1 1 28 LEU H    H   -6.705   1.488  -4.779 1.00 . A A .  28 LEU H    1 1 
        8  4900 1 1 28 LEU HA   H   -4.012   0.705  -4.648 1.00 . A A .  28 LEU HA   1 1 
        8  4901 1 1 28 LEU HB2  H   -5.526   0.204  -6.525 1.00 . A A .  28 LEU HB2  1 1 
        8  4902 1 1 28 LEU HB3  H   -5.501   1.907  -6.978 1.00 . A A .  28 LEU HB3  1 1 
        8  4903 1 1 28 LEU HD11 H   -2.658  -0.784  -6.551 1.00 . A A .  28 LEU HD11 1 1 
        8  4904 1 1 28 LEU HD12 H   -2.811  -0.892  -8.304 1.00 . A A .  28 LEU HD12 1 1 
        8  4905 1 1 28 LEU HD13 H   -4.201  -1.235  -7.275 1.00 . A A .  28 LEU HD13 1 1 
        8  4906 1 1 28 LEU HD21 H   -3.103   1.485  -9.390 1.00 . A A .  28 LEU HD21 1 1 
        8  4907 1 1 28 LEU HD22 H   -4.656   2.137  -8.868 1.00 . A A .  28 LEU HD22 1 1 
        8  4908 1 1 28 LEU HD23 H   -4.535   0.455  -9.385 1.00 . A A .  28 LEU HD23 1 1 
        8  4909 1 1 28 LEU HG   H   -2.884   1.431  -7.095 1.00 . A A .  28 LEU HG   1 1 
        8  4910 1 1 28 LEU N    N   -5.845   1.595  -4.322 1.00 . A A .  28 LEU N    1 1 
        8  4911 1 1 28 LEU O    O   -2.629   2.802  -4.781 1.00 . A A .  28 LEU O    1 1 
        8  4912 1 1 29 THR C    C   -3.266   5.522  -3.986 1.00 . A A .  29 THR C    1 1 
        8  4913 1 1 29 THR CA   C   -3.882   5.208  -5.344 1.00 . A A .  29 THR CA   1 1 
        8  4914 1 1 29 THR CB   C   -4.890   6.315  -5.707 1.00 . A A .  29 THR CB   1 1 
        8  4915 1 1 29 THR CG2  C   -4.214   7.678  -5.720 1.00 . A A .  29 THR CG2  1 1 
        8  4916 1 1 29 THR H    H   -5.467   3.821  -5.558 1.00 . A A .  29 THR H    1 1 
        8  4917 1 1 29 THR HA   H   -3.101   5.202  -6.090 1.00 . A A .  29 THR HA   1 1 
        8  4918 1 1 29 THR HB   H   -5.674   6.326  -4.963 1.00 . A A .  29 THR HB   1 1 
        8  4919 1 1 29 THR HG1  H   -5.995   5.250  -6.945 1.00 . A A .  29 THR HG1  1 1 
        8  4920 1 1 29 THR HG21 H   -3.748   7.839  -6.680 1.00 . A A .  29 THR HG21 1 1 
        8  4921 1 1 29 THR HG22 H   -3.463   7.715  -4.945 1.00 . A A .  29 THR HG22 1 1 
        8  4922 1 1 29 THR HG23 H   -4.951   8.447  -5.544 1.00 . A A .  29 THR HG23 1 1 
        8  4923 1 1 29 THR N    N   -4.514   3.894  -5.343 1.00 . A A .  29 THR N    1 1 
        8  4924 1 1 29 THR O    O   -2.050   5.668  -3.865 1.00 . A A .  29 THR O    1 1 
        8  4925 1 1 29 THR OG1  O   -5.467   6.051  -6.991 1.00 . A A .  29 THR OG1  1 1 
        8  4926 1 1 30 GLN C    C   -2.393   5.124  -1.284 1.00 . A A .  30 GLN C    1 1 
        8  4927 1 1 30 GLN CA   C   -3.650   5.922  -1.616 1.00 . A A .  30 GLN CA   1 1 
        8  4928 1 1 30 GLN CB   C   -4.749   5.612  -0.598 1.00 . A A .  30 GLN CB   1 1 
        8  4929 1 1 30 GLN CD   C   -6.008   3.824   0.667 1.00 . A A .  30 GLN CD   1 1 
        8  4930 1 1 30 GLN CG   C   -5.082   4.133  -0.493 1.00 . A A .  30 GLN CG   1 1 
        8  4931 1 1 30 GLN H    H   -5.071   5.497  -3.126 1.00 . A A .  30 GLN H    1 1 
        8  4932 1 1 30 GLN HA   H   -3.416   6.974  -1.571 1.00 . A A .  30 GLN HA   1 1 
        8  4933 1 1 30 GLN HB2  H   -4.429   5.957   0.374 1.00 . A A .  30 GLN HB2  1 1 
        8  4934 1 1 30 GLN HB3  H   -5.646   6.142  -0.882 1.00 . A A .  30 GLN HB3  1 1 
        8  4935 1 1 30 GLN HE21 H   -4.487   3.933   1.942 1.00 . A A .  30 GLN HE21 1 1 
        8  4936 1 1 30 GLN HE22 H   -6.027   3.573   2.638 1.00 . A A .  30 GLN HE22 1 1 
        8  4937 1 1 30 GLN HG2  H   -5.561   3.819  -1.409 1.00 . A A .  30 GLN HG2  1 1 
        8  4938 1 1 30 GLN HG3  H   -4.165   3.579  -0.360 1.00 . A A .  30 GLN HG3  1 1 
        8  4939 1 1 30 GLN N    N   -4.113   5.624  -2.966 1.00 . A A .  30 GLN N    1 1 
        8  4940 1 1 30 GLN NE2  N   -5.451   3.770   1.871 1.00 . A A .  30 GLN NE2  1 1 
        8  4941 1 1 30 GLN O    O   -1.503   5.611  -0.585 1.00 . A A .  30 GLN O    1 1 
        8  4942 1 1 30 GLN OE1  O   -7.211   3.635   0.482 1.00 . A A .  30 GLN OE1  1 1 
        8  4943 1 1 31 HIS C    C    0.013   3.455  -2.402 1.00 . A A .  31 HIS C    1 1 
        8  4944 1 1 31 HIS CA   C   -1.177   3.031  -1.546 1.00 . A A .  31 HIS CA   1 1 
        8  4945 1 1 31 HIS CB   C   -1.538   1.575  -1.838 1.00 . A A .  31 HIS CB   1 1 
        8  4946 1 1 31 HIS CD2  C    0.239   0.293  -3.226 1.00 . A A .  31 HIS CD2  1 1 
        8  4947 1 1 31 HIS CE1  C    1.369  -0.586  -1.566 1.00 . A A .  31 HIS CE1  1 1 
        8  4948 1 1 31 HIS CG   C   -0.347   0.698  -2.075 1.00 . A A .  31 HIS CG   1 1 
        8  4949 1 1 31 HIS H    H   -3.066   3.565  -2.338 1.00 . A A .  31 HIS H    1 1 
        8  4950 1 1 31 HIS HA   H   -0.907   3.124  -0.505 1.00 . A A .  31 HIS HA   1 1 
        8  4951 1 1 31 HIS HB2  H   -2.085   1.171  -0.999 1.00 . A A .  31 HIS HB2  1 1 
        8  4952 1 1 31 HIS HB3  H   -2.161   1.535  -2.720 1.00 . A A .  31 HIS HB3  1 1 
        8  4953 1 1 31 HIS HD1  H    0.208   0.236  -0.096 1.00 . A A .  31 HIS HD1  1 1 
        8  4954 1 1 31 HIS HD2  H   -0.072   0.549  -4.229 1.00 . A A .  31 HIS HD2  1 1 
        8  4955 1 1 31 HIS HE1  H    2.103  -1.145  -1.005 1.00 . A A .  31 HIS HE1  1 1 
        8  4956 1 1 31 HIS N    N   -2.326   3.897  -1.789 1.00 . A A .  31 HIS N    1 1 
        8  4957 1 1 31 HIS ND1  N    0.384   0.130  -1.054 1.00 . A A .  31 HIS ND1  1 1 
        8  4958 1 1 31 HIS NE2  N    1.303  -0.504  -2.883 1.00 . A A .  31 HIS NE2  1 1 
        8  4959 1 1 31 HIS O    O    1.123   3.622  -1.898 1.00 . A A .  31 HIS O    1 1 
        8  4960 1 1 32 TRP C    C    1.661   5.161  -4.036 1.00 . A A .  32 TRP C    1 1 
        8  4961 1 1 32 TRP CA   C    0.825   4.028  -4.622 1.00 . A A .  32 TRP CA   1 1 
        8  4962 1 1 32 TRP CB   C    0.219   4.463  -5.958 1.00 . A A .  32 TRP CB   1 1 
        8  4963 1 1 32 TRP CD1  C   -0.518   2.107  -6.648 1.00 . A A .  32 TRP CD1  1 1 
        8  4964 1 1 32 TRP CD2  C    0.379   3.315  -8.307 1.00 . A A .  32 TRP CD2  1 1 
        8  4965 1 1 32 TRP CE2  C    0.020   2.051  -8.815 1.00 . A A .  32 TRP CE2  1 1 
        8  4966 1 1 32 TRP CE3  C    0.962   4.246  -9.171 1.00 . A A .  32 TRP CE3  1 1 
        8  4967 1 1 32 TRP CG   C    0.027   3.330  -6.920 1.00 . A A .  32 TRP CG   1 1 
        8  4968 1 1 32 TRP CH2  C    0.798   2.628 -10.969 1.00 . A A .  32 TRP CH2  1 1 
        8  4969 1 1 32 TRP CZ2  C    0.225   1.697 -10.145 1.00 . A A .  32 TRP CZ2  1 1 
        8  4970 1 1 32 TRP CZ3  C    1.166   3.893 -10.491 1.00 . A A .  32 TRP CZ3  1 1 
        8  4971 1 1 32 TRP H    H   -1.134   3.476  -4.039 1.00 . A A .  32 TRP H    1 1 
        8  4972 1 1 32 TRP HA   H    1.464   3.173  -4.789 1.00 . A A .  32 TRP HA   1 1 
        8  4973 1 1 32 TRP HB2  H   -0.745   4.915  -5.778 1.00 . A A .  32 TRP HB2  1 1 
        8  4974 1 1 32 TRP HB3  H    0.872   5.188  -6.422 1.00 . A A .  32 TRP HB3  1 1 
        8  4975 1 1 32 TRP HD1  H   -0.883   1.807  -5.678 1.00 . A A .  32 TRP HD1  1 1 
        8  4976 1 1 32 TRP HE1  H   -0.866   0.416  -7.843 1.00 . A A .  32 TRP HE1  1 1 
        8  4977 1 1 32 TRP HE3  H    1.253   5.226  -8.822 1.00 . A A .  32 TRP HE3  1 1 
        8  4978 1 1 32 TRP HH2  H    0.976   2.396 -12.007 1.00 . A A .  32 TRP HH2  1 1 
        8  4979 1 1 32 TRP HZ2  H   -0.054   0.726 -10.529 1.00 . A A .  32 TRP HZ2  1 1 
        8  4980 1 1 32 TRP HZ3  H    1.616   4.600 -11.174 1.00 . A A .  32 TRP HZ3  1 1 
        8  4981 1 1 32 TRP N    N   -0.227   3.625  -3.697 1.00 . A A .  32 TRP N    1 1 
        8  4982 1 1 32 TRP NE1  N   -0.525   1.333  -7.783 1.00 . A A .  32 TRP NE1  1 1 
        8  4983 1 1 32 TRP O    O    2.806   5.371  -4.439 1.00 . A A .  32 TRP O    1 1 
        8  4984 1 1 33 ILE C    C    3.117   6.549  -1.870 1.00 . A A .  33 ILE C    1 1 
        8  4985 1 1 33 ILE CA   C    1.777   6.996  -2.444 1.00 . A A .  33 ILE CA   1 1 
        8  4986 1 1 33 ILE CB   C    0.928   7.614  -1.317 1.00 . A A .  33 ILE CB   1 1 
        8  4987 1 1 33 ILE CD1  C   -0.382   9.233  -2.779 1.00 . A A .  33 ILE CD1  1 1 
        8  4988 1 1 33 ILE CG1  C   -0.440   8.039  -1.853 1.00 . A A .  33 ILE CG1  1 1 
        8  4989 1 1 33 ILE CG2  C    1.653   8.800  -0.698 1.00 . A A .  33 ILE CG2  1 1 
        8  4990 1 1 33 ILE H    H    0.169   5.669  -2.808 1.00 . A A .  33 ILE H    1 1 
        8  4991 1 1 33 ILE HA   H    1.953   7.755  -3.192 1.00 . A A .  33 ILE HA   1 1 
        8  4992 1 1 33 ILE HB   H    0.791   6.867  -0.550 1.00 . A A .  33 ILE HB   1 1 
        8  4993 1 1 33 ILE HD11 H   -0.380  10.142  -2.195 1.00 . A A .  33 ILE HD11 1 1 
        8  4994 1 1 33 ILE HD12 H    0.520   9.186  -3.372 1.00 . A A .  33 ILE HD12 1 1 
        8  4995 1 1 33 ILE HD13 H   -1.243   9.227  -3.430 1.00 . A A .  33 ILE HD13 1 1 
        8  4996 1 1 33 ILE HG12 H   -0.877   7.218  -2.398 1.00 . A A .  33 ILE HG12 1 1 
        8  4997 1 1 33 ILE HG13 H   -1.081   8.294  -1.021 1.00 . A A .  33 ILE HG13 1 1 
        8  4998 1 1 33 ILE HG21 H    1.743   8.651   0.368 1.00 . A A .  33 ILE HG21 1 1 
        8  4999 1 1 33 ILE HG22 H    2.637   8.887  -1.133 1.00 . A A .  33 ILE HG22 1 1 
        8  5000 1 1 33 ILE HG23 H    1.094   9.704  -0.889 1.00 . A A .  33 ILE HG23 1 1 
        8  5001 1 1 33 ILE N    N    1.083   5.886  -3.085 1.00 . A A .  33 ILE N    1 1 
        8  5002 1 1 33 ILE O    O    4.133   7.225  -2.034 1.00 . A A .  33 ILE O    1 1 
        8  5003 1 1 34 THR C    C    5.496   4.924  -1.576 1.00 . A A .  34 THR C    1 1 
        8  5004 1 1 34 THR CA   C    4.328   4.864  -0.598 1.00 . A A .  34 THR CA   1 1 
        8  5005 1 1 34 THR CB   C    4.130   3.406  -0.141 1.00 . A A .  34 THR CB   1 1 
        8  5006 1 1 34 THR CG2  C    3.937   2.486  -1.336 1.00 . A A .  34 THR CG2  1 1 
        8  5007 1 1 34 THR H    H    2.272   4.909  -1.099 1.00 . A A .  34 THR H    1 1 
        8  5008 1 1 34 THR HA   H    4.566   5.462   0.270 1.00 . A A .  34 THR HA   1 1 
        8  5009 1 1 34 THR HB   H    3.247   3.356   0.479 1.00 . A A .  34 THR HB   1 1 
        8  5010 1 1 34 THR HG1  H    5.354   2.021   0.548 1.00 . A A .  34 THR HG1  1 1 
        8  5011 1 1 34 THR HG21 H    3.268   2.951  -2.044 1.00 . A A .  34 THR HG21 1 1 
        8  5012 1 1 34 THR HG22 H    3.515   1.548  -1.005 1.00 . A A .  34 THR HG22 1 1 
        8  5013 1 1 34 THR HG23 H    4.891   2.304  -1.809 1.00 . A A .  34 THR HG23 1 1 
        8  5014 1 1 34 THR N    N    3.113   5.403  -1.196 1.00 . A A .  34 THR N    1 1 
        8  5015 1 1 34 THR O    O    6.641   5.137  -1.178 1.00 . A A .  34 THR O    1 1 
        8  5016 1 1 34 THR OG1  O    5.262   2.974   0.623 1.00 . A A .  34 THR OG1  1 1 
        8  5017 1 1 35 HIS C    C    6.508   6.203  -4.331 1.00 . A A .  35 HIS C    1 1 
        8  5018 1 1 35 HIS CA   C    6.225   4.769  -3.894 1.00 . A A .  35 HIS CA   1 1 
        8  5019 1 1 35 HIS CB   C    5.791   3.932  -5.098 1.00 . A A .  35 HIS CB   1 1 
        8  5020 1 1 35 HIS CD2  C    4.007   2.050  -5.060 1.00 . A A .  35 HIS CD2  1 1 
        8  5021 1 1 35 HIS CE1  C    5.062   0.634  -3.761 1.00 . A A .  35 HIS CE1  1 1 
        8  5022 1 1 35 HIS CG   C    5.193   2.611  -4.725 1.00 . A A .  35 HIS CG   1 1 
        8  5023 1 1 35 HIS H    H    4.267   4.569  -3.113 1.00 . A A .  35 HIS H    1 1 
        8  5024 1 1 35 HIS HA   H    7.128   4.347  -3.480 1.00 . A A .  35 HIS HA   1 1 
        8  5025 1 1 35 HIS HB2  H    5.054   4.483  -5.663 1.00 . A A .  35 HIS HB2  1 1 
        8  5026 1 1 35 HIS HB3  H    6.651   3.743  -5.725 1.00 . A A .  35 HIS HB3  1 1 
        8  5027 1 1 35 HIS HD1  H    6.713   1.815  -3.503 1.00 . A A .  35 HIS HD1  1 1 
        8  5028 1 1 35 HIS HD2  H    3.246   2.487  -5.692 1.00 . A A .  35 HIS HD2  1 1 
        8  5029 1 1 35 HIS HE1  H    5.303  -0.241  -3.176 1.00 . A A .  35 HIS HE1  1 1 
        8  5030 1 1 35 HIS N    N    5.198   4.735  -2.858 1.00 . A A .  35 HIS N    1 1 
        8  5031 1 1 35 HIS ND1  N    5.830   1.700  -3.910 1.00 . A A .  35 HIS ND1  1 1 
        8  5032 1 1 35 HIS NE2  N    3.951   0.822  -4.449 1.00 . A A .  35 HIS NE2  1 1 
        8  5033 1 1 35 HIS O    O    7.656   6.573  -4.581 1.00 . A A .  35 HIS O    1 1 
        8  5034 1 1 36 THR C    C    6.489   9.170  -3.872 1.00 . A A .  36 THR C    1 1 
        8  5035 1 1 36 THR CA   C    5.589   8.400  -4.831 1.00 . A A .  36 THR CA   1 1 
        8  5036 1 1 36 THR CB   C    4.218   9.100  -4.904 1.00 . A A .  36 THR CB   1 1 
        8  5037 1 1 36 THR CG2  C    4.360  10.513  -5.448 1.00 . A A .  36 THR CG2  1 1 
        8  5038 1 1 36 THR H    H    4.564   6.655  -4.210 1.00 . A A .  36 THR H    1 1 
        8  5039 1 1 36 THR HA   H    6.031   8.417  -5.817 1.00 . A A .  36 THR HA   1 1 
        8  5040 1 1 36 THR HB   H    3.805   9.154  -3.906 1.00 . A A .  36 THR HB   1 1 
        8  5041 1 1 36 THR HG1  H    2.944   7.630  -5.230 1.00 . A A .  36 THR HG1  1 1 
        8  5042 1 1 36 THR HG21 H    3.643  11.159  -4.964 1.00 . A A .  36 THR HG21 1 1 
        8  5043 1 1 36 THR HG22 H    4.179  10.509  -6.513 1.00 . A A .  36 THR HG22 1 1 
        8  5044 1 1 36 THR HG23 H    5.359  10.875  -5.254 1.00 . A A .  36 THR HG23 1 1 
        8  5045 1 1 36 THR N    N    5.454   7.008  -4.422 1.00 . A A .  36 THR N    1 1 
        8  5046 1 1 36 THR O    O    7.389   9.895  -4.297 1.00 . A A .  36 THR O    1 1 
        8  5047 1 1 36 THR OG1  O    3.328   8.349  -5.737 1.00 . A A .  36 THR OG1  1 1 
        8  5048 1 1 37 ARG C    C    7.451   8.719  -0.457 1.00 . A A .  37 ARG C    1 1 
        8  5049 1 1 37 ARG CA   C    7.030   9.689  -1.557 1.00 . A A .  37 ARG CA   1 1 
        8  5050 1 1 37 ARG CB   C    6.233  10.847  -0.953 1.00 . A A .  37 ARG CB   1 1 
        8  5051 1 1 37 ARG CD   C    3.900  11.499  -0.283 1.00 . A A .  37 ARG CD   1 1 
        8  5052 1 1 37 ARG CG   C    4.958  10.407  -0.251 1.00 . A A .  37 ARG CG   1 1 
        8  5053 1 1 37 ARG CZ   C    2.441  12.566  -1.950 1.00 . A A .  37 ARG CZ   1 1 
        8  5054 1 1 37 ARG H    H    5.510   8.418  -2.299 1.00 . A A .  37 ARG H    1 1 
        8  5055 1 1 37 ARG HA   H    7.916  10.083  -2.031 1.00 . A A .  37 ARG HA   1 1 
        8  5056 1 1 37 ARG HB2  H    6.854  11.361  -0.234 1.00 . A A .  37 ARG HB2  1 1 
        8  5057 1 1 37 ARG HB3  H    5.965  11.533  -1.742 1.00 . A A .  37 ARG HB3  1 1 
        8  5058 1 1 37 ARG HD2  H    3.024  11.148   0.243 1.00 . A A .  37 ARG HD2  1 1 
        8  5059 1 1 37 ARG HD3  H    4.290  12.375   0.213 1.00 . A A .  37 ARG HD3  1 1 
        8  5060 1 1 37 ARG HE   H    4.103  11.548  -2.374 1.00 . A A .  37 ARG HE   1 1 
        8  5061 1 1 37 ARG HG2  H    4.569   9.530  -0.746 1.00 . A A .  37 ARG HG2  1 1 
        8  5062 1 1 37 ARG HG3  H    5.188  10.171   0.778 1.00 . A A .  37 ARG HG3  1 1 
        8  5063 1 1 37 ARG HH11 H    1.842  12.783  -0.033 1.00 . A A .  37 ARG HH11 1 1 
        8  5064 1 1 37 ARG HH12 H    0.823  13.530  -1.218 1.00 . A A .  37 ARG HH12 1 1 
        8  5065 1 1 37 ARG HH21 H    2.770  12.528  -3.944 1.00 . A A .  37 ARG HH21 1 1 
        8  5066 1 1 37 ARG HH22 H    1.351  13.384  -3.442 1.00 . A A .  37 ARG HH22 1 1 
        8  5067 1 1 37 ARG N    N    6.241   9.009  -2.576 1.00 . A A .  37 ARG N    1 1 
        8  5068 1 1 37 ARG NE   N    3.522  11.855  -1.648 1.00 . A A .  37 ARG NE   1 1 
        8  5069 1 1 37 ARG NH1  N    1.636  12.994  -0.988 1.00 . A A .  37 ARG NH1  1 1 
        8  5070 1 1 37 ARG NH2  N    2.165  12.849  -3.216 1.00 . A A .  37 ARG NH2  1 1 
        8  5071 1 1 37 ARG O    O    6.633   7.955   0.056 1.00 . A A .  37 ARG O    1 1 
        8  5072 1 1 38 GLU C    C   10.471   8.508   1.618 1.00 . A A .  38 GLU C    1 1 
        8  5073 1 1 38 GLU CA   C    9.259   7.878   0.938 1.00 . A A .  38 GLU CA   1 1 
        8  5074 1 1 38 GLU CB   C    9.643   6.521   0.343 1.00 . A A .  38 GLU CB   1 1 
        8  5075 1 1 38 GLU CD   C   10.821   5.391  -1.585 1.00 . A A .  38 GLU CD   1 1 
        8  5076 1 1 38 GLU CG   C   10.774   6.599  -0.670 1.00 . A A .  38 GLU CG   1 1 
        8  5077 1 1 38 GLU H    H    9.334   9.386  -0.546 1.00 . A A .  38 GLU H    1 1 
        8  5078 1 1 38 GLU HA   H    8.484   7.731   1.674 1.00 . A A .  38 GLU HA   1 1 
        8  5079 1 1 38 GLU HB2  H    9.949   5.864   1.144 1.00 . A A .  38 GLU HB2  1 1 
        8  5080 1 1 38 GLU HB3  H    8.778   6.099  -0.147 1.00 . A A .  38 GLU HB3  1 1 
        8  5081 1 1 38 GLU HG2  H   10.639   7.483  -1.273 1.00 . A A .  38 GLU HG2  1 1 
        8  5082 1 1 38 GLU HG3  H   11.712   6.666  -0.138 1.00 . A A .  38 GLU HG3  1 1 
        8  5083 1 1 38 GLU N    N    8.731   8.755  -0.100 1.00 . A A .  38 GLU N    1 1 
        8  5084 1 1 38 GLU O    O   10.957   9.559   1.198 1.00 . A A .  38 GLU O    1 1 
        8  5085 1 1 38 GLU OE1  O    9.805   5.117  -2.258 1.00 . A A .  38 GLU OE1  1 1 
        8  5086 1 1 38 GLU OE2  O   11.872   4.719  -1.628 1.00 . A A .  38 GLU OE2  1 1 
        8  5087 1 1 39 LYS C    C   13.242   7.334   3.399 1.00 . A A .  39 LYS C    1 1 
        8  5088 1 1 39 LYS CA   C   12.108   8.355   3.413 1.00 . A A .  39 LYS CA   1 1 
        8  5089 1 1 39 LYS CB   C   11.715   8.675   4.857 1.00 . A A .  39 LYS CB   1 1 
        8  5090 1 1 39 LYS CD   C   10.773   7.845   7.033 1.00 . A A .  39 LYS CD   1 1 
        8  5091 1 1 39 LYS CE   C   11.911   7.968   8.033 1.00 . A A .  39 LYS CE   1 1 
        8  5092 1 1 39 LYS CG   C   11.282   7.457   5.655 1.00 . A A .  39 LYS CG   1 1 
        8  5093 1 1 39 LYS H    H   10.522   7.027   2.960 1.00 . A A .  39 LYS H    1 1 
        8  5094 1 1 39 LYS HA   H   12.448   9.259   2.932 1.00 . A A .  39 LYS HA   1 1 
        8  5095 1 1 39 LYS HB2  H   12.560   9.125   5.357 1.00 . A A .  39 LYS HB2  1 1 
        8  5096 1 1 39 LYS HB3  H   10.897   9.381   4.847 1.00 . A A .  39 LYS HB3  1 1 
        8  5097 1 1 39 LYS HD2  H   10.263   8.794   6.965 1.00 . A A .  39 LYS HD2  1 1 
        8  5098 1 1 39 LYS HD3  H   10.082   7.088   7.378 1.00 . A A .  39 LYS HD3  1 1 
        8  5099 1 1 39 LYS HE2  H   12.165   6.984   8.395 1.00 . A A .  39 LYS HE2  1 1 
        8  5100 1 1 39 LYS HE3  H   12.767   8.399   7.534 1.00 . A A .  39 LYS HE3  1 1 
        8  5101 1 1 39 LYS HG2  H   10.492   6.950   5.120 1.00 . A A .  39 LYS HG2  1 1 
        8  5102 1 1 39 LYS HG3  H   12.127   6.793   5.767 1.00 . A A .  39 LYS HG3  1 1 
        8  5103 1 1 39 LYS HZ1  H   11.866   9.804   9.030 1.00 . A A .  39 LYS HZ1  1 1 
        8  5104 1 1 39 LYS HZ2  H   11.983   8.467  10.060 1.00 . A A .  39 LYS HZ2  1 1 
        8  5105 1 1 39 LYS HZ3  H   10.509   8.835   9.316 1.00 . A A .  39 LYS HZ3  1 1 
        8  5106 1 1 39 LYS N    N   10.953   7.860   2.673 1.00 . A A .  39 LYS N    1 1 
        8  5107 1 1 39 LYS NZ   N   11.542   8.829   9.191 1.00 . A A .  39 LYS NZ   1 1 
        8  5108 1 1 39 LYS O    O   13.021   6.127   3.294 1.00 . A A .  39 LYS O    1 1 
        8  5109 1 1 40 PRO C    C   15.791   6.143   4.783 1.00 . A A .  40 PRO C    1 1 
        8  5110 1 1 40 PRO CA   C   15.677   6.975   3.511 1.00 . A A .  40 PRO CA   1 1 
        8  5111 1 1 40 PRO CB   C   16.830   7.977   3.422 1.00 . A A .  40 PRO CB   1 1 
        8  5112 1 1 40 PRO CD   C   14.821   9.255   3.635 1.00 . A A .  40 PRO CD   1 1 
        8  5113 1 1 40 PRO CG   C   16.281   9.238   3.995 1.00 . A A .  40 PRO CG   1 1 
        8  5114 1 1 40 PRO HA   H   15.699   6.321   2.651 1.00 . A A .  40 PRO HA   1 1 
        8  5115 1 1 40 PRO HB2  H   17.671   7.615   3.997 1.00 . A A .  40 PRO HB2  1 1 
        8  5116 1 1 40 PRO HB3  H   17.121   8.107   2.390 1.00 . A A .  40 PRO HB3  1 1 
        8  5117 1 1 40 PRO HD2  H   14.243   9.719   4.421 1.00 . A A .  40 PRO HD2  1 1 
        8  5118 1 1 40 PRO HD3  H   14.669   9.772   2.698 1.00 . A A .  40 PRO HD3  1 1 
        8  5119 1 1 40 PRO HG2  H   16.402   9.238   5.067 1.00 . A A .  40 PRO HG2  1 1 
        8  5120 1 1 40 PRO HG3  H   16.784  10.089   3.559 1.00 . A A .  40 PRO HG3  1 1 
        8  5121 1 1 40 PRO N    N   14.484   7.827   3.507 1.00 . A A .  40 PRO N    1 1 
        8  5122 1 1 40 PRO O    O   16.235   6.635   5.820 1.00 . A A .  40 PRO O    1 1 
        8  5123 1 1 41 SER C    C   16.085   2.651   5.462 1.00 . A A .  41 SER C    1 1 
        8  5124 1 1 41 SER CA   C   15.440   3.980   5.844 1.00 . A A .  41 SER CA   1 1 
        8  5125 1 1 41 SER CB   C   14.034   3.737   6.395 1.00 . A A .  41 SER CB   1 1 
        8  5126 1 1 41 SER H    H   15.041   4.545   3.843 1.00 . A A .  41 SER H    1 1 
        8  5127 1 1 41 SER HA   H   16.040   4.452   6.608 1.00 . A A .  41 SER HA   1 1 
        8  5128 1 1 41 SER HB2  H   13.501   4.675   6.439 1.00 . A A .  41 SER HB2  1 1 
        8  5129 1 1 41 SER HB3  H   13.508   3.054   5.744 1.00 . A A .  41 SER HB3  1 1 
        8  5130 1 1 41 SER HG   H   14.361   3.853   8.323 1.00 . A A .  41 SER HG   1 1 
        8  5131 1 1 41 SER N    N   15.386   4.880   4.697 1.00 . A A .  41 SER N    1 1 
        8  5132 1 1 41 SER O    O   17.022   2.193   6.115 1.00 . A A .  41 SER O    1 1 
        8  5133 1 1 41 SER OG   O   14.085   3.179   7.697 1.00 . A A .  41 SER OG   1 1 
        8  5134 1 1 42 GLY C    C   15.042  -0.155   3.401 1.00 . A A .  42 GLY C    1 1 
        8  5135 1 1 42 GLY CA   C   16.114   0.767   3.946 1.00 . A A .  42 GLY CA   1 1 
        8  5136 1 1 42 GLY H    H   14.830   2.450   3.916 1.00 . A A .  42 GLY H    1 1 
        8  5137 1 1 42 GLY HA2  H   16.843   0.953   3.172 1.00 . A A .  42 GLY HA2  1 1 
        8  5138 1 1 42 GLY HA3  H   16.602   0.280   4.778 1.00 . A A .  42 GLY HA3  1 1 
        8  5139 1 1 42 GLY N    N   15.576   2.037   4.398 1.00 . A A .  42 GLY N    1 1 
        8  5140 1 1 42 GLY O    O   14.540  -1.038   4.096 1.00 . A A .  42 GLY O    1 1 
        8  5141 1 1 43 PRO C    C   14.119  -2.191   1.202 1.00 . A A .  43 PRO C    1 1 
        8  5142 1 1 43 PRO CA   C   13.651  -0.763   1.460 1.00 . A A .  43 PRO CA   1 1 
        8  5143 1 1 43 PRO CB   C   13.422  -0.028   0.137 1.00 . A A .  43 PRO CB   1 1 
        8  5144 1 1 43 PRO CD   C   15.231   1.081   1.238 1.00 . A A .  43 PRO CD   1 1 
        8  5145 1 1 43 PRO CG   C   14.696   0.703  -0.115 1.00 . A A .  43 PRO CG   1 1 
        8  5146 1 1 43 PRO HA   H   12.731  -0.784   2.026 1.00 . A A .  43 PRO HA   1 1 
        8  5147 1 1 43 PRO HB2  H   13.215  -0.745  -0.645 1.00 . A A .  43 PRO HB2  1 1 
        8  5148 1 1 43 PRO HB3  H   12.590   0.653   0.239 1.00 . A A .  43 PRO HB3  1 1 
        8  5149 1 1 43 PRO HD2  H   16.311   1.050   1.239 1.00 . A A .  43 PRO HD2  1 1 
        8  5150 1 1 43 PRO HD3  H   14.880   2.062   1.522 1.00 . A A .  43 PRO HD3  1 1 
        8  5151 1 1 43 PRO HG2  H   15.393   0.058  -0.628 1.00 . A A .  43 PRO HG2  1 1 
        8  5152 1 1 43 PRO HG3  H   14.501   1.588  -0.701 1.00 . A A .  43 PRO HG3  1 1 
        8  5153 1 1 43 PRO N    N   14.675   0.047   2.127 1.00 . A A .  43 PRO N    1 1 
        8  5154 1 1 43 PRO O    O   13.373  -3.147   1.415 1.00 . A A .  43 PRO O    1 1 
        8  5155 1 1 44 SER C    C   16.123  -4.443   1.734 1.00 . A A .  44 SER C    1 1 
        8  5156 1 1 44 SER CA   C   15.924  -3.641   0.451 1.00 . A A .  44 SER CA   1 1 
        8  5157 1 1 44 SER CB   C   17.258  -3.493  -0.283 1.00 . A A .  44 SER CB   1 1 
        8  5158 1 1 44 SER H    H   15.904  -1.528   0.592 1.00 . A A .  44 SER H    1 1 
        8  5159 1 1 44 SER HA   H   15.229  -4.168  -0.185 1.00 . A A .  44 SER HA   1 1 
        8  5160 1 1 44 SER HB2  H   17.532  -4.441  -0.721 1.00 . A A .  44 SER HB2  1 1 
        8  5161 1 1 44 SER HB3  H   17.156  -2.752  -1.063 1.00 . A A .  44 SER HB3  1 1 
        8  5162 1 1 44 SER HG   H   18.783  -3.854   0.893 1.00 . A A .  44 SER HG   1 1 
        8  5163 1 1 44 SER N    N   15.358  -2.329   0.742 1.00 . A A .  44 SER N    1 1 
        8  5164 1 1 44 SER O    O   16.473  -3.890   2.777 1.00 . A A .  44 SER O    1 1 
        8  5165 1 1 44 SER OG   O   18.286  -3.085   0.603 1.00 . A A .  44 SER OG   1 1 
        8  5166 1 1 45 SER C    C   16.276  -8.071   2.360 1.00 . A A .  45 SER C    1 1 
        8  5167 1 1 45 SER CA   C   16.047  -6.629   2.802 1.00 . A A .  45 SER CA   1 1 
        8  5168 1 1 45 SER CB   C   14.808  -6.548   3.696 1.00 . A A .  45 SER CB   1 1 
        8  5169 1 1 45 SER H    H   15.620  -6.131   0.789 1.00 . A A .  45 SER H    1 1 
        8  5170 1 1 45 SER HA   H   16.908  -6.296   3.363 1.00 . A A .  45 SER HA   1 1 
        8  5171 1 1 45 SER HB2  H   14.913  -7.242   4.516 1.00 . A A .  45 SER HB2  1 1 
        8  5172 1 1 45 SER HB3  H   14.713  -5.544   4.084 1.00 . A A .  45 SER HB3  1 1 
        8  5173 1 1 45 SER HG   H   13.862  -7.432   2.227 1.00 . A A .  45 SER HG   1 1 
        8  5174 1 1 45 SER N    N   15.897  -5.750   1.648 1.00 . A A .  45 SER N    1 1 
        8  5175 1 1 45 SER O    O   16.271  -8.375   1.168 1.00 . A A .  45 SER O    1 1 
        8  5176 1 1 45 SER OG   O   13.634  -6.871   2.972 1.00 . A A .  45 SER OG   1 1 
        8  5177 1 1 46 GLY C    C   16.033 -11.285   4.017 1.00 . A A .  46 GLY C    1 1 
        8  5178 1 1 46 GLY CA   C   16.704 -10.357   3.024 1.00 . A A .  46 GLY CA   1 1 
        8  5179 1 1 46 GLY H    H   16.468  -8.657   4.265 1.00 . A A .  46 GLY H    1 1 
        8  5180 1 1 46 GLY HA2  H   16.320 -10.564   2.036 1.00 . A A .  46 GLY HA2  1 1 
        8  5181 1 1 46 GLY HA3  H   17.767 -10.547   3.033 1.00 . A A .  46 GLY HA3  1 1 
        8  5182 1 1 46 GLY N    N   16.476  -8.957   3.332 1.00 . A A .  46 GLY N    1 1 
        8  5183 1 1 46 GLY O    O   14.812 -11.429   3.972 1.00 . A A .  46 GLY O    1 1 
        8  5184 2 2  1 ZN  ZN   ZN   2.628  -0.737  -4.434 1.00 . B A . 181 ZN  ZN   1 1 
        9  5185 1 1  1 GLY C    C    9.581 -18.080  -8.868 1.00 . A A .   1 GLY C    1 1 
        9  5186 1 1  1 GLY CA   C   10.493 -18.207 -10.071 1.00 . A A .   1 GLY CA   1 1 
        9  5187 1 1  1 GLY H1   H   11.415 -16.311 -10.264 1.00 . A A .   1 GLY H1   1 1 
        9  5188 1 1  1 GLY HA2  H   10.022 -18.848 -10.802 1.00 . A A .   1 GLY HA2  1 1 
        9  5189 1 1  1 GLY HA3  H   11.423 -18.659  -9.757 1.00 . A A .   1 GLY HA3  1 1 
        9  5190 1 1  1 GLY N    N   10.781 -16.926 -10.688 1.00 . A A .   1 GLY N    1 1 
        9  5191 1 1  1 GLY O    O    8.517 -18.697  -8.820 1.00 . A A .   1 GLY O    1 1 
        9  5192 1 1  2 SER C    C    7.799 -16.614  -7.020 1.00 . A A .   2 SER C    1 1 
        9  5193 1 1  2 SER CA   C    9.212 -17.077  -6.681 1.00 . A A .   2 SER CA   1 1 
        9  5194 1 1  2 SER CB   C    9.892 -16.051  -5.772 1.00 . A A .   2 SER CB   1 1 
        9  5195 1 1  2 SER H    H   10.855 -16.814  -7.990 1.00 . A A .   2 SER H    1 1 
        9  5196 1 1  2 SER HA   H    9.154 -18.022  -6.162 1.00 . A A .   2 SER HA   1 1 
        9  5197 1 1  2 SER HB2  H   10.962 -16.195  -5.809 1.00 . A A .   2 SER HB2  1 1 
        9  5198 1 1  2 SER HB3  H    9.651 -15.055  -6.114 1.00 . A A .   2 SER HB3  1 1 
        9  5199 1 1  2 SER HG   H   10.156 -15.904  -3.837 1.00 . A A .   2 SER HG   1 1 
        9  5200 1 1  2 SER N    N    9.998 -17.279  -7.893 1.00 . A A .   2 SER N    1 1 
        9  5201 1 1  2 SER O    O    7.609 -15.581  -7.662 1.00 . A A .   2 SER O    1 1 
        9  5202 1 1  2 SER OG   O    9.458 -16.191  -4.430 1.00 . A A .   2 SER OG   1 1 
        9  5203 1 1  3 SER C    C    4.517 -17.563  -5.716 1.00 . A A .   3 SER C    1 1 
        9  5204 1 1  3 SER CA   C    5.412 -17.061  -6.845 1.00 . A A .   3 SER CA   1 1 
        9  5205 1 1  3 SER CB   C    4.964 -17.668  -8.176 1.00 . A A .   3 SER CB   1 1 
        9  5206 1 1  3 SER H    H    7.025 -18.199  -6.079 1.00 . A A .   3 SER H    1 1 
        9  5207 1 1  3 SER HA   H    5.329 -15.986  -6.903 1.00 . A A .   3 SER HA   1 1 
        9  5208 1 1  3 SER HB2  H    5.776 -17.616  -8.884 1.00 . A A .   3 SER HB2  1 1 
        9  5209 1 1  3 SER HB3  H    4.685 -18.700  -8.021 1.00 . A A .   3 SER HB3  1 1 
        9  5210 1 1  3 SER HG   H    3.072 -17.530  -8.668 1.00 . A A .   3 SER HG   1 1 
        9  5211 1 1  3 SER N    N    6.809 -17.388  -6.585 1.00 . A A .   3 SER N    1 1 
        9  5212 1 1  3 SER O    O    4.669 -18.689  -5.243 1.00 . A A .   3 SER O    1 1 
        9  5213 1 1  3 SER OG   O    3.851 -16.969  -8.706 1.00 . A A .   3 SER OG   1 1 
        9  5214 1 1  4 GLY C    C    1.271 -16.573  -4.441 1.00 . A A .   4 GLY C    1 1 
        9  5215 1 1  4 GLY CA   C    2.677 -17.094  -4.220 1.00 . A A .   4 GLY CA   1 1 
        9  5216 1 1  4 GLY H    H    3.508 -15.834  -5.705 1.00 . A A .   4 GLY H    1 1 
        9  5217 1 1  4 GLY HA2  H    2.643 -18.172  -4.152 1.00 . A A .   4 GLY HA2  1 1 
        9  5218 1 1  4 GLY HA3  H    3.053 -16.697  -3.289 1.00 . A A .   4 GLY HA3  1 1 
        9  5219 1 1  4 GLY N    N    3.583 -16.719  -5.289 1.00 . A A .   4 GLY N    1 1 
        9  5220 1 1  4 GLY O    O    0.899 -15.527  -3.910 1.00 . A A .   4 GLY O    1 1 
        9  5221 1 1  5 SER C    C   -1.666 -18.062  -6.136 1.00 . A A .   5 SER C    1 1 
        9  5222 1 1  5 SER CA   C   -0.884 -16.904  -5.524 1.00 . A A .   5 SER CA   1 1 
        9  5223 1 1  5 SER CB   C   -0.896 -15.706  -6.476 1.00 . A A .   5 SER CB   1 1 
        9  5224 1 1  5 SER H    H    0.842 -18.127  -5.624 1.00 . A A .   5 SER H    1 1 
        9  5225 1 1  5 SER HA   H   -1.354 -16.619  -4.595 1.00 . A A .   5 SER HA   1 1 
        9  5226 1 1  5 SER HB2  H   -0.134 -15.004  -6.176 1.00 . A A .   5 SER HB2  1 1 
        9  5227 1 1  5 SER HB3  H   -0.695 -16.047  -7.482 1.00 . A A .   5 SER HB3  1 1 
        9  5228 1 1  5 SER HG   H   -2.059 -14.189  -6.049 1.00 . A A .   5 SER HG   1 1 
        9  5229 1 1  5 SER N    N    0.488 -17.302  -5.229 1.00 . A A .   5 SER N    1 1 
        9  5230 1 1  5 SER O    O   -1.351 -18.529  -7.231 1.00 . A A .   5 SER O    1 1 
        9  5231 1 1  5 SER OG   O   -2.153 -15.053  -6.457 1.00 . A A .   5 SER OG   1 1 
        9  5232 1 1  6 SER C    C   -4.079 -19.334  -7.275 1.00 . A A .   6 SER C    1 1 
        9  5233 1 1  6 SER CA   C   -3.513 -19.628  -5.890 1.00 . A A .   6 SER CA   1 1 
        9  5234 1 1  6 SER CB   C   -4.654 -19.894  -4.906 1.00 . A A .   6 SER CB   1 1 
        9  5235 1 1  6 SER H    H   -2.888 -18.109  -4.554 1.00 . A A .   6 SER H    1 1 
        9  5236 1 1  6 SER HA   H   -2.888 -20.507  -5.948 1.00 . A A .   6 SER HA   1 1 
        9  5237 1 1  6 SER HB2  H   -5.174 -20.794  -5.196 1.00 . A A .   6 SER HB2  1 1 
        9  5238 1 1  6 SER HB3  H   -4.248 -20.017  -3.912 1.00 . A A .   6 SER HB3  1 1 
        9  5239 1 1  6 SER HG   H   -5.919 -18.678  -5.779 1.00 . A A .   6 SER HG   1 1 
        9  5240 1 1  6 SER N    N   -2.687 -18.522  -5.420 1.00 . A A .   6 SER N    1 1 
        9  5241 1 1  6 SER O    O   -3.956 -18.221  -7.785 1.00 . A A .   6 SER O    1 1 
        9  5242 1 1  6 SER OG   O   -5.577 -18.818  -4.893 1.00 . A A .   6 SER OG   1 1 
        9  5243 1 1  7 GLY C    C   -5.920 -18.812  -9.383 1.00 . A A .   7 GLY C    1 1 
        9  5244 1 1  7 GLY CA   C   -5.277 -20.172  -9.202 1.00 . A A .   7 GLY CA   1 1 
        9  5245 1 1  7 GLY H    H   -4.769 -21.207  -7.426 1.00 . A A .   7 GLY H    1 1 
        9  5246 1 1  7 GLY HA2  H   -4.498 -20.292  -9.940 1.00 . A A .   7 GLY HA2  1 1 
        9  5247 1 1  7 GLY HA3  H   -6.026 -20.935  -9.356 1.00 . A A .   7 GLY HA3  1 1 
        9  5248 1 1  7 GLY N    N   -4.701 -20.342  -7.880 1.00 . A A .   7 GLY N    1 1 
        9  5249 1 1  7 GLY O    O   -5.436 -17.988 -10.158 1.00 . A A .   7 GLY O    1 1 
        9  5250 1 1  8 GLU C    C   -7.087 -16.260  -7.849 1.00 . A A .   8 GLU C    1 1 
        9  5251 1 1  8 GLU CA   C   -7.727 -17.307  -8.756 1.00 . A A .   8 GLU CA   1 1 
        9  5252 1 1  8 GLU CB   C   -9.198 -17.494  -8.378 1.00 . A A .   8 GLU CB   1 1 
        9  5253 1 1  8 GLU CD   C  -11.555 -16.600  -8.542 1.00 . A A .   8 GLU CD   1 1 
        9  5254 1 1  8 GLU CG   C  -10.082 -16.324  -8.776 1.00 . A A .   8 GLU CG   1 1 
        9  5255 1 1  8 GLU H    H   -7.353 -19.273  -8.066 1.00 . A A .   8 GLU H    1 1 
        9  5256 1 1  8 GLU HA   H   -7.669 -16.964  -9.778 1.00 . A A .   8 GLU HA   1 1 
        9  5257 1 1  8 GLU HB2  H   -9.572 -18.383  -8.863 1.00 . A A .   8 GLU HB2  1 1 
        9  5258 1 1  8 GLU HB3  H   -9.268 -17.622  -7.308 1.00 . A A .   8 GLU HB3  1 1 
        9  5259 1 1  8 GLU HG2  H   -9.797 -15.459  -8.196 1.00 . A A .   8 GLU HG2  1 1 
        9  5260 1 1  8 GLU HG3  H   -9.932 -16.117  -9.826 1.00 . A A .   8 GLU HG3  1 1 
        9  5261 1 1  8 GLU N    N   -7.016 -18.576  -8.667 1.00 . A A .   8 GLU N    1 1 
        9  5262 1 1  8 GLU O    O   -6.351 -16.593  -6.921 1.00 . A A .   8 GLU O    1 1 
        9  5263 1 1  8 GLU OE1  O  -12.078 -17.567  -9.135 1.00 . A A .   8 GLU OE1  1 1 
        9  5264 1 1  8 GLU OE2  O  -12.184 -15.849  -7.767 1.00 . A A .   8 GLU OE2  1 1 
        9  5265 1 1  9 GLY C    C   -6.324 -12.758  -8.177 1.00 . A A .   9 GLY C    1 1 
        9  5266 1 1  9 GLY CA   C   -6.816 -13.914  -7.328 1.00 . A A .   9 GLY CA   1 1 
        9  5267 1 1  9 GLY H    H   -7.966 -14.785  -8.879 1.00 . A A .   9 GLY H    1 1 
        9  5268 1 1  9 GLY HA2  H   -7.577 -13.552  -6.652 1.00 . A A .   9 GLY HA2  1 1 
        9  5269 1 1  9 GLY HA3  H   -5.989 -14.300  -6.751 1.00 . A A .   9 GLY HA3  1 1 
        9  5270 1 1  9 GLY N    N   -7.372 -14.991  -8.127 1.00 . A A .   9 GLY N    1 1 
        9  5271 1 1  9 GLY O    O   -5.314 -12.132  -7.857 1.00 . A A .   9 GLY O    1 1 
        9  5272 1 1 10 GLU C    C   -7.605 -10.200  -9.994 1.00 . A A .  10 GLU C    1 1 
        9  5273 1 1 10 GLU CA   C   -6.665 -11.390 -10.160 1.00 . A A .  10 GLU CA   1 1 
        9  5274 1 1 10 GLU CB   C   -6.683 -11.870 -11.613 1.00 . A A .  10 GLU CB   1 1 
        9  5275 1 1 10 GLU CD   C   -4.351 -12.673 -12.157 1.00 . A A .  10 GLU CD   1 1 
        9  5276 1 1 10 GLU CG   C   -5.786 -13.069 -11.869 1.00 . A A .  10 GLU CG   1 1 
        9  5277 1 1 10 GLU H    H   -7.833 -13.012  -9.464 1.00 . A A .  10 GLU H    1 1 
        9  5278 1 1 10 GLU HA   H   -5.662 -11.079  -9.906 1.00 . A A .  10 GLU HA   1 1 
        9  5279 1 1 10 GLU HB2  H   -7.695 -12.140 -11.877 1.00 . A A .  10 GLU HB2  1 1 
        9  5280 1 1 10 GLU HB3  H   -6.358 -11.061 -12.250 1.00 . A A .  10 GLU HB3  1 1 
        9  5281 1 1 10 GLU HG2  H   -5.800 -13.706 -10.998 1.00 . A A .  10 GLU HG2  1 1 
        9  5282 1 1 10 GLU HG3  H   -6.170 -13.615 -12.718 1.00 . A A .  10 GLU HG3  1 1 
        9  5283 1 1 10 GLU N    N   -7.038 -12.477  -9.262 1.00 . A A .  10 GLU N    1 1 
        9  5284 1 1 10 GLU O    O   -8.762 -10.244 -10.415 1.00 . A A .  10 GLU O    1 1 
        9  5285 1 1 10 GLU OE1  O   -4.142 -11.712 -12.927 1.00 . A A .  10 GLU OE1  1 1 
        9  5286 1 1 10 GLU OE2  O   -3.436 -13.324 -11.610 1.00 . A A .  10 GLU OE2  1 1 
        9  5287 1 1 11 LYS C    C   -7.721  -6.947 -10.306 1.00 . A A .  11 LYS C    1 1 
        9  5288 1 1 11 LYS CA   C   -7.894  -7.933  -9.155 1.00 . A A .  11 LYS CA   1 1 
        9  5289 1 1 11 LYS CB   C   -7.491  -7.269  -7.836 1.00 . A A .  11 LYS CB   1 1 
        9  5290 1 1 11 LYS CD   C   -9.376  -8.041  -6.366 1.00 . A A .  11 LYS CD   1 1 
        9  5291 1 1 11 LYS CE   C   -9.791  -9.035  -5.292 1.00 . A A .  11 LYS CE   1 1 
        9  5292 1 1 11 LYS CG   C   -7.877  -8.074  -6.607 1.00 . A A .  11 LYS CG   1 1 
        9  5293 1 1 11 LYS H    H   -6.172  -9.161  -9.064 1.00 . A A .  11 LYS H    1 1 
        9  5294 1 1 11 LYS HA   H   -8.932  -8.225  -9.099 1.00 . A A .  11 LYS HA   1 1 
        9  5295 1 1 11 LYS HB2  H   -6.420  -7.130  -7.829 1.00 . A A .  11 LYS HB2  1 1 
        9  5296 1 1 11 LYS HB3  H   -7.971  -6.303  -7.772 1.00 . A A .  11 LYS HB3  1 1 
        9  5297 1 1 11 LYS HD2  H   -9.660  -7.048  -6.050 1.00 . A A .  11 LYS HD2  1 1 
        9  5298 1 1 11 LYS HD3  H   -9.886  -8.286  -7.287 1.00 . A A .  11 LYS HD3  1 1 
        9  5299 1 1 11 LYS HE2  H   -9.105  -8.954  -4.462 1.00 . A A .  11 LYS HE2  1 1 
        9  5300 1 1 11 LYS HE3  H  -10.788  -8.790  -4.959 1.00 . A A .  11 LYS HE3  1 1 
        9  5301 1 1 11 LYS HG2  H   -7.568  -9.099  -6.748 1.00 . A A .  11 LYS HG2  1 1 
        9  5302 1 1 11 LYS HG3  H   -7.373  -7.660  -5.745 1.00 . A A .  11 LYS HG3  1 1 
        9  5303 1 1 11 LYS HZ1  H   -8.886 -10.628  -6.295 1.00 . A A .  11 LYS HZ1  1 1 
        9  5304 1 1 11 LYS HZ2  H  -10.569 -10.584  -6.456 1.00 . A A .  11 LYS HZ2  1 1 
        9  5305 1 1 11 LYS HZ3  H   -9.872 -11.102  -5.005 1.00 . A A .  11 LYS HZ3  1 1 
        9  5306 1 1 11 LYS N    N   -7.101  -9.136  -9.377 1.00 . A A .  11 LYS N    1 1 
        9  5307 1 1 11 LYS NZ   N   -9.778 -10.435  -5.798 1.00 . A A .  11 LYS NZ   1 1 
        9  5308 1 1 11 LYS O    O   -6.702  -6.934 -10.996 1.00 . A A .  11 LYS O    1 1 
        9  5309 1 1 12 PRO C    C   -7.722  -3.977 -11.311 1.00 . A A .  12 PRO C    1 1 
        9  5310 1 1 12 PRO CA   C   -8.723  -5.095 -11.585 1.00 . A A .  12 PRO CA   1 1 
        9  5311 1 1 12 PRO CB   C  -10.152  -4.547 -11.578 1.00 . A A .  12 PRO CB   1 1 
        9  5312 1 1 12 PRO CD   C   -9.986  -6.060  -9.735 1.00 . A A .  12 PRO CD   1 1 
        9  5313 1 1 12 PRO CG   C  -10.643  -4.788 -10.192 1.00 . A A .  12 PRO CG   1 1 
        9  5314 1 1 12 PRO HA   H   -8.510  -5.539 -12.546 1.00 . A A .  12 PRO HA   1 1 
        9  5315 1 1 12 PRO HB2  H  -10.137  -3.492 -11.815 1.00 . A A .  12 PRO HB2  1 1 
        9  5316 1 1 12 PRO HB3  H  -10.748  -5.076 -12.306 1.00 . A A .  12 PRO HB3  1 1 
        9  5317 1 1 12 PRO HD2  H   -9.774  -6.017  -8.677 1.00 . A A .  12 PRO HD2  1 1 
        9  5318 1 1 12 PRO HD3  H  -10.611  -6.911  -9.963 1.00 . A A .  12 PRO HD3  1 1 
        9  5319 1 1 12 PRO HG2  H  -10.357  -3.967  -9.553 1.00 . A A .  12 PRO HG2  1 1 
        9  5320 1 1 12 PRO HG3  H  -11.717  -4.903 -10.199 1.00 . A A .  12 PRO HG3  1 1 
        9  5321 1 1 12 PRO N    N   -8.740  -6.101 -10.519 1.00 . A A .  12 PRO N    1 1 
        9  5322 1 1 12 PRO O    O   -7.315  -3.258 -12.224 1.00 . A A .  12 PRO O    1 1 
        9  5323 1 1 13 TYR C    C   -5.187  -3.414  -8.921 1.00 . A A .  13 TYR C    1 1 
        9  5324 1 1 13 TYR CA   C   -6.377  -2.805  -9.656 1.00 . A A .  13 TYR CA   1 1 
        9  5325 1 1 13 TYR CB   C   -7.061  -1.763  -8.769 1.00 . A A .  13 TYR CB   1 1 
        9  5326 1 1 13 TYR CD1  C   -9.091  -1.241 -10.177 1.00 . A A .  13 TYR CD1  1 1 
        9  5327 1 1 13 TYR CD2  C   -7.621   0.550  -9.615 1.00 . A A .  13 TYR CD2  1 1 
        9  5328 1 1 13 TYR CE1  C   -9.898  -0.365 -10.877 1.00 . A A .  13 TYR CE1  1 1 
        9  5329 1 1 13 TYR CE2  C   -8.423   1.433 -10.312 1.00 . A A .  13 TYR CE2  1 1 
        9  5330 1 1 13 TYR CG   C   -7.940  -0.800  -9.534 1.00 . A A .  13 TYR CG   1 1 
        9  5331 1 1 13 TYR CZ   C   -9.560   0.971 -10.941 1.00 . A A .  13 TYR CZ   1 1 
        9  5332 1 1 13 TYR H    H   -7.689  -4.441  -9.367 1.00 . A A .  13 TYR H    1 1 
        9  5333 1 1 13 TYR HA   H   -6.022  -2.321 -10.554 1.00 . A A .  13 TYR HA   1 1 
        9  5334 1 1 13 TYR HB2  H   -7.677  -2.268  -8.042 1.00 . A A .  13 TYR HB2  1 1 
        9  5335 1 1 13 TYR HB3  H   -6.305  -1.186  -8.256 1.00 . A A .  13 TYR HB3  1 1 
        9  5336 1 1 13 TYR HD1  H   -9.353  -2.288 -10.125 1.00 . A A .  13 TYR HD1  1 1 
        9  5337 1 1 13 TYR HD2  H   -6.730   0.908  -9.121 1.00 . A A .  13 TYR HD2  1 1 
        9  5338 1 1 13 TYR HE1  H  -10.788  -0.726 -11.370 1.00 . A A .  13 TYR HE1  1 1 
        9  5339 1 1 13 TYR HE2  H   -8.158   2.478 -10.363 1.00 . A A .  13 TYR HE2  1 1 
        9  5340 1 1 13 TYR HH   H  -10.043   1.921 -12.541 1.00 . A A .  13 TYR HH   1 1 
        9  5341 1 1 13 TYR N    N   -7.329  -3.837 -10.050 1.00 . A A .  13 TYR N    1 1 
        9  5342 1 1 13 TYR O    O   -5.194  -3.527  -7.696 1.00 . A A .  13 TYR O    1 1 
        9  5343 1 1 13 TYR OH   O  -10.360   1.847 -11.638 1.00 . A A .  13 TYR OH   1 1 
        9  5344 1 1 14 GLN C    C   -1.787  -3.442  -9.186 1.00 . A A .  14 GLN C    1 1 
        9  5345 1 1 14 GLN CA   C   -2.970  -4.401  -9.100 1.00 . A A .  14 GLN CA   1 1 
        9  5346 1 1 14 GLN CB   C   -2.632  -5.711  -9.813 1.00 . A A .  14 GLN CB   1 1 
        9  5347 1 1 14 GLN CD   C   -0.148  -5.805 -10.265 1.00 . A A .  14 GLN CD   1 1 
        9  5348 1 1 14 GLN CG   C   -1.292  -6.299  -9.402 1.00 . A A .  14 GLN CG   1 1 
        9  5349 1 1 14 GLN H    H   -4.222  -3.687 -10.650 1.00 . A A .  14 GLN H    1 1 
        9  5350 1 1 14 GLN HA   H   -3.173  -4.609  -8.061 1.00 . A A .  14 GLN HA   1 1 
        9  5351 1 1 14 GLN HB2  H   -3.402  -6.435  -9.594 1.00 . A A .  14 GLN HB2  1 1 
        9  5352 1 1 14 GLN HB3  H   -2.610  -5.532 -10.878 1.00 . A A .  14 GLN HB3  1 1 
        9  5353 1 1 14 GLN HE21 H   -1.169  -6.244 -11.914 1.00 . A A .  14 GLN HE21 1 1 
        9  5354 1 1 14 GLN HE22 H    0.401  -5.566 -12.161 1.00 . A A .  14 GLN HE22 1 1 
        9  5355 1 1 14 GLN HG2  H   -1.093  -6.026  -8.377 1.00 . A A .  14 GLN HG2  1 1 
        9  5356 1 1 14 GLN HG3  H   -1.346  -7.375  -9.483 1.00 . A A .  14 GLN HG3  1 1 
        9  5357 1 1 14 GLN N    N   -4.168  -3.803  -9.679 1.00 . A A .  14 GLN N    1 1 
        9  5358 1 1 14 GLN NE2  N   -0.322  -5.880 -11.579 1.00 . A A .  14 GLN NE2  1 1 
        9  5359 1 1 14 GLN O    O   -1.272  -3.171 -10.271 1.00 . A A .  14 GLN O    1 1 
        9  5360 1 1 14 GLN OE1  O    0.881  -5.360  -9.756 1.00 . A A .  14 GLN OE1  1 1 
        9  5361 1 1 15 CYS C    C    0.926  -2.503  -8.827 1.00 . A A .  15 CYS C    1 1 
        9  5362 1 1 15 CYS CA   C   -0.240  -2.000  -7.981 1.00 . A A .  15 CYS CA   1 1 
        9  5363 1 1 15 CYS CB   C    0.214  -1.802  -6.533 1.00 . A A .  15 CYS CB   1 1 
        9  5364 1 1 15 CYS H    H   -1.814  -3.183  -7.203 1.00 . A A .  15 CYS H    1 1 
        9  5365 1 1 15 CYS HA   H   -0.574  -1.053  -8.377 1.00 . A A .  15 CYS HA   1 1 
        9  5366 1 1 15 CYS HB2  H   -0.657  -1.732  -5.897 1.00 . A A .  15 CYS HB2  1 1 
        9  5367 1 1 15 CYS HB3  H    0.807  -2.652  -6.231 1.00 . A A .  15 CYS HB3  1 1 
        9  5368 1 1 15 CYS N    N   -1.362  -2.930  -8.036 1.00 . A A .  15 CYS N    1 1 
        9  5369 1 1 15 CYS O    O    1.604  -3.462  -8.460 1.00 . A A .  15 CYS O    1 1 
        9  5370 1 1 15 CYS SG   S    1.215  -0.303  -6.266 1.00 . A A .  15 CYS SG   1 1 
        9  5371 1 1 16 SER C    C    3.551  -1.590 -10.431 1.00 . A A .  16 SER C    1 1 
        9  5372 1 1 16 SER CA   C    2.234  -2.230 -10.862 1.00 . A A .  16 SER CA   1 1 
        9  5373 1 1 16 SER CB   C    1.900  -1.819 -12.297 1.00 . A A .  16 SER CB   1 1 
        9  5374 1 1 16 SER H    H    0.577  -1.090 -10.198 1.00 . A A .  16 SER H    1 1 
        9  5375 1 1 16 SER HA   H    2.338  -3.304 -10.818 1.00 . A A .  16 SER HA   1 1 
        9  5376 1 1 16 SER HB2  H    0.871  -2.069 -12.510 1.00 . A A .  16 SER HB2  1 1 
        9  5377 1 1 16 SER HB3  H    2.042  -0.754 -12.406 1.00 . A A .  16 SER HB3  1 1 
        9  5378 1 1 16 SER HG   H    2.298  -2.524 -14.081 1.00 . A A .  16 SER HG   1 1 
        9  5379 1 1 16 SER N    N    1.153  -1.847  -9.961 1.00 . A A .  16 SER N    1 1 
        9  5380 1 1 16 SER O    O    4.437  -1.359 -11.252 1.00 . A A .  16 SER O    1 1 
        9  5381 1 1 16 SER OG   O    2.734  -2.489 -13.226 1.00 . A A .  16 SER OG   1 1 
        9  5382 1 1 17 GLU C    C    5.561  -1.626  -7.601 1.00 . A A .  17 GLU C    1 1 
        9  5383 1 1 17 GLU CA   C    4.877  -0.695  -8.598 1.00 . A A .  17 GLU CA   1 1 
        9  5384 1 1 17 GLU CB   C    4.542   0.636  -7.922 1.00 . A A .  17 GLU CB   1 1 
        9  5385 1 1 17 GLU CD   C    5.931   2.204  -9.335 1.00 . A A .  17 GLU CD   1 1 
        9  5386 1 1 17 GLU CG   C    4.538   1.819  -8.876 1.00 . A A .  17 GLU CG   1 1 
        9  5387 1 1 17 GLU H    H    2.928  -1.517  -8.532 1.00 . A A .  17 GLU H    1 1 
        9  5388 1 1 17 GLU HA   H    5.552  -0.511  -9.421 1.00 . A A .  17 GLU HA   1 1 
        9  5389 1 1 17 GLU HB2  H    3.564   0.561  -7.470 1.00 . A A .  17 GLU HB2  1 1 
        9  5390 1 1 17 GLU HB3  H    5.272   0.827  -7.149 1.00 . A A .  17 GLU HB3  1 1 
        9  5391 1 1 17 GLU HG2  H    3.948   1.563  -9.744 1.00 . A A .  17 GLU HG2  1 1 
        9  5392 1 1 17 GLU HG3  H    4.092   2.667  -8.377 1.00 . A A .  17 GLU HG3  1 1 
        9  5393 1 1 17 GLU N    N    3.670  -1.308  -9.138 1.00 . A A .  17 GLU N    1 1 
        9  5394 1 1 17 GLU O    O    6.771  -1.544  -7.387 1.00 . A A .  17 GLU O    1 1 
        9  5395 1 1 17 GLU OE1  O    6.813   2.380  -8.469 1.00 . A A .  17 GLU OE1  1 1 
        9  5396 1 1 17 GLU OE2  O    6.138   2.328 -10.560 1.00 . A A .  17 GLU OE2  1 1 
        9  5397 1 1 18 CYS C    C    4.776  -4.863  -6.283 1.00 . A A .  18 CYS C    1 1 
        9  5398 1 1 18 CYS CA   C    5.306  -3.457  -6.018 1.00 . A A .  18 CYS CA   1 1 
        9  5399 1 1 18 CYS CB   C    4.935  -3.020  -4.600 1.00 . A A .  18 CYS CB   1 1 
        9  5400 1 1 18 CYS H    H    3.821  -2.528  -7.206 1.00 . A A .  18 CYS H    1 1 
        9  5401 1 1 18 CYS HA   H    6.381  -3.467  -6.113 1.00 . A A .  18 CYS HA   1 1 
        9  5402 1 1 18 CYS HB2  H    5.278  -3.768  -3.899 1.00 . A A .  18 CYS HB2  1 1 
        9  5403 1 1 18 CYS HB3  H    5.422  -2.080  -4.382 1.00 . A A .  18 CYS HB3  1 1 
        9  5404 1 1 18 CYS N    N    4.778  -2.511  -6.993 1.00 . A A .  18 CYS N    1 1 
        9  5405 1 1 18 CYS O    O    5.502  -5.847  -6.148 1.00 . A A .  18 CYS O    1 1 
        9  5406 1 1 18 CYS SG   S    3.147  -2.793  -4.335 1.00 . A A .  18 CYS SG   1 1 
        9  5407 1 1 19 GLY C    C    1.802  -6.589  -5.955 1.00 . A A .  19 GLY C    1 1 
        9  5408 1 1 19 GLY CA   C    2.899  -6.239  -6.940 1.00 . A A .  19 GLY CA   1 1 
        9  5409 1 1 19 GLY H    H    2.973  -4.131  -6.753 1.00 . A A .  19 GLY H    1 1 
        9  5410 1 1 19 GLY HA2  H    2.482  -6.221  -7.936 1.00 . A A .  19 GLY HA2  1 1 
        9  5411 1 1 19 GLY HA3  H    3.664  -7.000  -6.895 1.00 . A A .  19 GLY HA3  1 1 
        9  5412 1 1 19 GLY N    N    3.505  -4.950  -6.662 1.00 . A A .  19 GLY N    1 1 
        9  5413 1 1 19 GLY O    O    1.778  -7.691  -5.406 1.00 . A A .  19 GLY O    1 1 
        9  5414 1 1 20 LYS C    C   -1.555  -5.752  -5.520 1.00 . A A .  20 LYS C    1 1 
        9  5415 1 1 20 LYS CA   C   -0.214  -5.862  -4.801 1.00 . A A .  20 LYS CA   1 1 
        9  5416 1 1 20 LYS CB   C   -0.152  -4.846  -3.658 1.00 . A A .  20 LYS CB   1 1 
        9  5417 1 1 20 LYS CD   C    0.844  -4.204  -1.443 1.00 . A A .  20 LYS CD   1 1 
        9  5418 1 1 20 LYS CE   C    2.065  -4.419  -0.562 1.00 . A A .  20 LYS CE   1 1 
        9  5419 1 1 20 LYS CG   C    0.716  -5.293  -2.494 1.00 . A A .  20 LYS CG   1 1 
        9  5420 1 1 20 LYS H    H    0.964  -4.790  -6.196 1.00 . A A .  20 LYS H    1 1 
        9  5421 1 1 20 LYS HA   H   -0.118  -6.856  -4.393 1.00 . A A .  20 LYS HA   1 1 
        9  5422 1 1 20 LYS HB2  H    0.245  -3.917  -4.039 1.00 . A A .  20 LYS HB2  1 1 
        9  5423 1 1 20 LYS HB3  H   -1.153  -4.676  -3.288 1.00 . A A .  20 LYS HB3  1 1 
        9  5424 1 1 20 LYS HD2  H    0.934  -3.248  -1.937 1.00 . A A .  20 LYS HD2  1 1 
        9  5425 1 1 20 LYS HD3  H   -0.042  -4.208  -0.823 1.00 . A A .  20 LYS HD3  1 1 
        9  5426 1 1 20 LYS HE2  H    2.882  -4.759  -1.180 1.00 . A A .  20 LYS HE2  1 1 
        9  5427 1 1 20 LYS HE3  H    2.330  -3.479  -0.101 1.00 . A A .  20 LYS HE3  1 1 
        9  5428 1 1 20 LYS HG2  H    0.272  -6.166  -2.040 1.00 . A A .  20 LYS HG2  1 1 
        9  5429 1 1 20 LYS HG3  H    1.701  -5.540  -2.865 1.00 . A A .  20 LYS HG3  1 1 
        9  5430 1 1 20 LYS HZ1  H    2.655  -5.540   1.099 1.00 . A A .  20 LYS HZ1  1 1 
        9  5431 1 1 20 LYS HZ2  H    1.576  -6.347   0.075 1.00 . A A .  20 LYS HZ2  1 1 
        9  5432 1 1 20 LYS HZ3  H    1.015  -5.124   1.100 1.00 . A A .  20 LYS HZ3  1 1 
        9  5433 1 1 20 LYS N    N    0.891  -5.649  -5.728 1.00 . A A .  20 LYS N    1 1 
        9  5434 1 1 20 LYS NZ   N    1.810  -5.428   0.503 1.00 . A A .  20 LYS NZ   1 1 
        9  5435 1 1 20 LYS O    O   -1.764  -4.848  -6.329 1.00 . A A .  20 LYS O    1 1 
        9  5436 1 1 21 SER C    C   -4.818  -6.050  -4.915 1.00 . A A .  21 SER C    1 1 
        9  5437 1 1 21 SER CA   C   -3.781  -6.685  -5.837 1.00 . A A .  21 SER CA   1 1 
        9  5438 1 1 21 SER CB   C   -4.197  -8.116  -6.182 1.00 . A A .  21 SER CB   1 1 
        9  5439 1 1 21 SER H    H   -2.234  -7.372  -4.565 1.00 . A A .  21 SER H    1 1 
        9  5440 1 1 21 SER HA   H   -3.724  -6.106  -6.747 1.00 . A A .  21 SER HA   1 1 
        9  5441 1 1 21 SER HB2  H   -3.883  -8.780  -5.392 1.00 . A A .  21 SER HB2  1 1 
        9  5442 1 1 21 SER HB3  H   -5.272  -8.161  -6.284 1.00 . A A .  21 SER HB3  1 1 
        9  5443 1 1 21 SER HG   H   -4.276  -8.933  -7.961 1.00 . A A .  21 SER HG   1 1 
        9  5444 1 1 21 SER N    N   -2.461  -6.677  -5.218 1.00 . A A .  21 SER N    1 1 
        9  5445 1 1 21 SER O    O   -4.959  -6.444  -3.757 1.00 . A A .  21 SER O    1 1 
        9  5446 1 1 21 SER OG   O   -3.605  -8.540  -7.398 1.00 . A A .  21 SER OG   1 1 
        9  5447 1 1 22 PHE C    C   -7.879  -4.308  -5.432 1.00 . A A .  22 PHE C    1 1 
        9  5448 1 1 22 PHE CA   C   -6.564  -4.374  -4.661 1.00 . A A .  22 PHE CA   1 1 
        9  5449 1 1 22 PHE CB   C   -6.097  -2.961  -4.305 1.00 . A A .  22 PHE CB   1 1 
        9  5450 1 1 22 PHE CD1  C   -4.890  -3.299  -2.131 1.00 . A A .  22 PHE CD1  1 1 
        9  5451 1 1 22 PHE CD2  C   -3.639  -2.546  -4.017 1.00 . A A .  22 PHE CD2  1 1 
        9  5452 1 1 22 PHE CE1  C   -3.745  -3.275  -1.358 1.00 . A A .  22 PHE CE1  1 1 
        9  5453 1 1 22 PHE CE2  C   -2.490  -2.520  -3.249 1.00 . A A .  22 PHE CE2  1 1 
        9  5454 1 1 22 PHE CG   C   -4.851  -2.935  -3.468 1.00 . A A .  22 PHE CG   1 1 
        9  5455 1 1 22 PHE CZ   C   -2.543  -2.886  -1.918 1.00 . A A .  22 PHE CZ   1 1 
        9  5456 1 1 22 PHE H    H   -5.381  -4.796  -6.366 1.00 . A A .  22 PHE H    1 1 
        9  5457 1 1 22 PHE HA   H   -6.722  -4.932  -3.751 1.00 . A A .  22 PHE HA   1 1 
        9  5458 1 1 22 PHE HB2  H   -5.896  -2.416  -5.215 1.00 . A A .  22 PHE HB2  1 1 
        9  5459 1 1 22 PHE HB3  H   -6.879  -2.459  -3.755 1.00 . A A .  22 PHE HB3  1 1 
        9  5460 1 1 22 PHE HD1  H   -5.829  -3.604  -1.693 1.00 . A A .  22 PHE HD1  1 1 
        9  5461 1 1 22 PHE HD2  H   -3.597  -2.260  -5.058 1.00 . A A .  22 PHE HD2  1 1 
        9  5462 1 1 22 PHE HE1  H   -3.788  -3.562  -0.318 1.00 . A A .  22 PHE HE1  1 1 
        9  5463 1 1 22 PHE HE2  H   -1.553  -2.216  -3.689 1.00 . A A .  22 PHE HE2  1 1 
        9  5464 1 1 22 PHE HZ   H   -1.647  -2.866  -1.316 1.00 . A A .  22 PHE HZ   1 1 
        9  5465 1 1 22 PHE N    N   -5.541  -5.065  -5.437 1.00 . A A .  22 PHE N    1 1 
        9  5466 1 1 22 PHE O    O   -7.894  -4.377  -6.661 1.00 . A A .  22 PHE O    1 1 
        9  5467 1 1 23 SER C    C  -10.832  -2.673  -5.299 1.00 . A A .  23 SER C    1 1 
        9  5468 1 1 23 SER CA   C  -10.302  -4.104  -5.315 1.00 . A A .  23 SER CA   1 1 
        9  5469 1 1 23 SER CB   C  -11.277  -5.029  -4.584 1.00 . A A .  23 SER CB   1 1 
        9  5470 1 1 23 SER H    H   -8.903  -4.125  -3.725 1.00 . A A .  23 SER H    1 1 
        9  5471 1 1 23 SER HA   H  -10.209  -4.430  -6.340 1.00 . A A .  23 SER HA   1 1 
        9  5472 1 1 23 SER HB2  H  -10.800  -5.980  -4.403 1.00 . A A .  23 SER HB2  1 1 
        9  5473 1 1 23 SER HB3  H  -11.557  -4.581  -3.642 1.00 . A A .  23 SER HB3  1 1 
        9  5474 1 1 23 SER HG   H  -12.348  -6.048  -5.870 1.00 . A A .  23 SER HG   1 1 
        9  5475 1 1 23 SER N    N   -8.981  -4.175  -4.701 1.00 . A A .  23 SER N    1 1 
        9  5476 1 1 23 SER O    O  -11.829  -2.376  -4.643 1.00 . A A .  23 SER O    1 1 
        9  5477 1 1 23 SER OG   O  -12.448  -5.245  -5.353 1.00 . A A .  23 SER OG   1 1 
        9  5478 1 1 24 GLY C    C   -9.442   0.528  -6.479 1.00 . A A .  24 GLY C    1 1 
        9  5479 1 1 24 GLY CA   C  -10.573  -0.401  -6.086 1.00 . A A .  24 GLY CA   1 1 
        9  5480 1 1 24 GLY H    H   -9.368  -2.084  -6.532 1.00 . A A .  24 GLY H    1 1 
        9  5481 1 1 24 GLY HA2  H  -11.371  -0.306  -6.807 1.00 . A A .  24 GLY HA2  1 1 
        9  5482 1 1 24 GLY HA3  H  -10.943  -0.108  -5.114 1.00 . A A .  24 GLY HA3  1 1 
        9  5483 1 1 24 GLY N    N  -10.156  -1.790  -6.029 1.00 . A A .  24 GLY N    1 1 
        9  5484 1 1 24 GLY O    O   -8.270   0.163  -6.387 1.00 . A A .  24 GLY O    1 1 
        9  5485 1 1 25 SER C    C   -8.227   3.451  -6.125 1.00 . A A .  25 SER C    1 1 
        9  5486 1 1 25 SER CA   C   -8.798   2.714  -7.333 1.00 . A A .  25 SER CA   1 1 
        9  5487 1 1 25 SER CB   C   -9.415   3.716  -8.311 1.00 . A A .  25 SER CB   1 1 
        9  5488 1 1 25 SER H    H  -10.744   1.964  -6.969 1.00 . A A .  25 SER H    1 1 
        9  5489 1 1 25 SER HA   H   -7.997   2.186  -7.829 1.00 . A A .  25 SER HA   1 1 
        9  5490 1 1 25 SER HB2  H   -9.825   3.184  -9.156 1.00 . A A .  25 SER HB2  1 1 
        9  5491 1 1 25 SER HB3  H  -10.203   4.262  -7.813 1.00 . A A .  25 SER HB3  1 1 
        9  5492 1 1 25 SER HG   H   -8.871   5.302  -9.324 1.00 . A A .  25 SER HG   1 1 
        9  5493 1 1 25 SER N    N   -9.793   1.732  -6.919 1.00 . A A .  25 SER N    1 1 
        9  5494 1 1 25 SER O    O   -7.025   3.710  -6.052 1.00 . A A .  25 SER O    1 1 
        9  5495 1 1 25 SER OG   O   -8.445   4.637  -8.778 1.00 . A A .  25 SER OG   1 1 
        9  5496 1 1 26 TYR C    C   -7.625   3.703  -3.213 1.00 . A A .  26 TYR C    1 1 
        9  5497 1 1 26 TYR CA   C   -8.682   4.497  -3.976 1.00 . A A .  26 TYR CA   1 1 
        9  5498 1 1 26 TYR CB   C   -9.888   4.761  -3.073 1.00 . A A .  26 TYR CB   1 1 
        9  5499 1 1 26 TYR CD1  C   -8.835   5.269  -0.834 1.00 . A A .  26 TYR CD1  1 1 
        9  5500 1 1 26 TYR CD2  C  -10.060   7.001  -1.920 1.00 . A A .  26 TYR CD2  1 1 
        9  5501 1 1 26 TYR CE1  C   -8.560   6.118   0.220 1.00 . A A .  26 TYR CE1  1 1 
        9  5502 1 1 26 TYR CE2  C   -9.789   7.858  -0.871 1.00 . A A .  26 TYR CE2  1 1 
        9  5503 1 1 26 TYR CG   C   -9.589   5.694  -1.921 1.00 . A A .  26 TYR CG   1 1 
        9  5504 1 1 26 TYR CZ   C   -9.039   7.411   0.197 1.00 . A A .  26 TYR CZ   1 1 
        9  5505 1 1 26 TYR H    H  -10.042   3.554  -5.295 1.00 . A A .  26 TYR H    1 1 
        9  5506 1 1 26 TYR HA   H   -8.257   5.443  -4.278 1.00 . A A .  26 TYR HA   1 1 
        9  5507 1 1 26 TYR HB2  H  -10.679   5.202  -3.659 1.00 . A A .  26 TYR HB2  1 1 
        9  5508 1 1 26 TYR HB3  H  -10.232   3.824  -2.660 1.00 . A A .  26 TYR HB3  1 1 
        9  5509 1 1 26 TYR HD1  H   -8.460   4.256  -0.820 1.00 . A A .  26 TYR HD1  1 1 
        9  5510 1 1 26 TYR HD2  H  -10.648   7.348  -2.758 1.00 . A A .  26 TYR HD2  1 1 
        9  5511 1 1 26 TYR HE1  H   -7.972   5.769   1.056 1.00 . A A .  26 TYR HE1  1 1 
        9  5512 1 1 26 TYR HE2  H  -10.164   8.870  -0.888 1.00 . A A .  26 TYR HE2  1 1 
        9  5513 1 1 26 TYR HH   H   -8.922   9.168   0.971 1.00 . A A .  26 TYR HH   1 1 
        9  5514 1 1 26 TYR N    N   -9.097   3.787  -5.180 1.00 . A A .  26 TYR N    1 1 
        9  5515 1 1 26 TYR O    O   -6.508   4.176  -3.006 1.00 . A A .  26 TYR O    1 1 
        9  5516 1 1 26 TYR OH   O   -8.766   8.261   1.245 1.00 . A A .  26 TYR OH   1 1 
        9  5517 1 1 27 ARG C    C   -5.721   1.546  -2.760 1.00 . A A .  27 ARG C    1 1 
        9  5518 1 1 27 ARG CA   C   -7.072   1.634  -2.058 1.00 . A A .  27 ARG CA   1 1 
        9  5519 1 1 27 ARG CB   C   -7.669   0.234  -1.901 1.00 . A A .  27 ARG CB   1 1 
        9  5520 1 1 27 ARG CD   C   -8.679   0.191   0.400 1.00 . A A .  27 ARG CD   1 1 
        9  5521 1 1 27 ARG CG   C   -8.957   0.208  -1.095 1.00 . A A .  27 ARG CG   1 1 
        9  5522 1 1 27 ARG CZ   C   -7.725  -1.329   2.080 1.00 . A A .  27 ARG CZ   1 1 
        9  5523 1 1 27 ARG H    H   -8.893   2.172  -2.994 1.00 . A A .  27 ARG H    1 1 
        9  5524 1 1 27 ARG HA   H   -6.929   2.066  -1.079 1.00 . A A .  27 ARG HA   1 1 
        9  5525 1 1 27 ARG HB2  H   -7.875  -0.169  -2.881 1.00 . A A .  27 ARG HB2  1 1 
        9  5526 1 1 27 ARG HB3  H   -6.947  -0.398  -1.406 1.00 . A A .  27 ARG HB3  1 1 
        9  5527 1 1 27 ARG HD2  H   -8.070   1.047   0.649 1.00 . A A .  27 ARG HD2  1 1 
        9  5528 1 1 27 ARG HD3  H   -9.619   0.252   0.928 1.00 . A A .  27 ARG HD3  1 1 
        9  5529 1 1 27 ARG HE   H   -7.689  -1.641   0.110 1.00 . A A .  27 ARG HE   1 1 
        9  5530 1 1 27 ARG HG2  H   -9.537   1.088  -1.332 1.00 . A A .  27 ARG HG2  1 1 
        9  5531 1 1 27 ARG HG3  H   -9.518  -0.677  -1.359 1.00 . A A .  27 ARG HG3  1 1 
        9  5532 1 1 27 ARG HH11 H   -8.591   0.334   2.832 1.00 . A A .  27 ARG HH11 1 1 
        9  5533 1 1 27 ARG HH12 H   -7.914  -0.746   4.006 1.00 . A A .  27 ARG HH12 1 1 
        9  5534 1 1 27 ARG HH21 H   -6.795  -3.070   1.646 1.00 . A A .  27 ARG HH21 1 1 
        9  5535 1 1 27 ARG HH22 H   -6.892  -2.681   3.330 1.00 . A A .  27 ARG HH22 1 1 
        9  5536 1 1 27 ARG N    N   -7.988   2.494  -2.798 1.00 . A A .  27 ARG N    1 1 
        9  5537 1 1 27 ARG NE   N   -7.981  -1.024   0.813 1.00 . A A .  27 ARG NE   1 1 
        9  5538 1 1 27 ARG NH1  N   -8.108  -0.513   3.053 1.00 . A A .  27 ARG NH1  1 1 
        9  5539 1 1 27 ARG NH2  N   -7.085  -2.453   2.377 1.00 . A A .  27 ARG NH2  1 1 
        9  5540 1 1 27 ARG O    O   -4.700   1.261  -2.133 1.00 . A A .  27 ARG O    1 1 
        9  5541 1 1 28 LEU C    C   -3.705   3.041  -4.718 1.00 . A A .  28 LEU C    1 1 
        9  5542 1 1 28 LEU CA   C   -4.495   1.743  -4.854 1.00 . A A .  28 LEU CA   1 1 
        9  5543 1 1 28 LEU CB   C   -4.822   1.483  -6.326 1.00 . A A .  28 LEU CB   1 1 
        9  5544 1 1 28 LEU CD1  C   -3.289  -0.284  -7.227 1.00 . A A .  28 LEU CD1  1 1 
        9  5545 1 1 28 LEU CD2  C   -3.917   1.670  -8.656 1.00 . A A .  28 LEU CD2  1 1 
        9  5546 1 1 28 LEU CG   C   -3.628   1.198  -7.238 1.00 . A A .  28 LEU CG   1 1 
        9  5547 1 1 28 LEU H    H   -6.565   2.016  -4.510 1.00 . A A .  28 LEU H    1 1 
        9  5548 1 1 28 LEU HA   H   -3.893   0.929  -4.478 1.00 . A A .  28 LEU HA   1 1 
        9  5549 1 1 28 LEU HB2  H   -5.483   0.632  -6.372 1.00 . A A .  28 LEU HB2  1 1 
        9  5550 1 1 28 LEU HB3  H   -5.332   2.355  -6.709 1.00 . A A .  28 LEU HB3  1 1 
        9  5551 1 1 28 LEU HD11 H   -3.611  -0.734  -8.153 1.00 . A A .  28 LEU HD11 1 1 
        9  5552 1 1 28 LEU HD12 H   -3.792  -0.762  -6.399 1.00 . A A .  28 LEU HD12 1 1 
        9  5553 1 1 28 LEU HD13 H   -2.221  -0.408  -7.118 1.00 . A A .  28 LEU HD13 1 1 
        9  5554 1 1 28 LEU HD21 H   -3.720   0.867  -9.350 1.00 . A A .  28 LEU HD21 1 1 
        9  5555 1 1 28 LEU HD22 H   -3.283   2.513  -8.891 1.00 . A A .  28 LEU HD22 1 1 
        9  5556 1 1 28 LEU HD23 H   -4.953   1.967  -8.733 1.00 . A A .  28 LEU HD23 1 1 
        9  5557 1 1 28 LEU HG   H   -2.767   1.741  -6.874 1.00 . A A .  28 LEU HG   1 1 
        9  5558 1 1 28 LEU N    N   -5.721   1.794  -4.065 1.00 . A A .  28 LEU N    1 1 
        9  5559 1 1 28 LEU O    O   -2.653   3.077  -4.080 1.00 . A A .  28 LEU O    1 1 
        9  5560 1 1 29 THR C    C   -3.075   5.718  -3.858 1.00 . A A .  29 THR C    1 1 
        9  5561 1 1 29 THR CA   C   -3.567   5.408  -5.267 1.00 . A A .  29 THR CA   1 1 
        9  5562 1 1 29 THR CB   C   -4.513   6.533  -5.727 1.00 . A A .  29 THR CB   1 1 
        9  5563 1 1 29 THR CG2  C   -5.782   6.549  -4.889 1.00 . A A .  29 THR CG2  1 1 
        9  5564 1 1 29 THR H    H   -5.063   4.015  -5.815 1.00 . A A .  29 THR H    1 1 
        9  5565 1 1 29 THR HA   H   -2.719   5.383  -5.936 1.00 . A A .  29 THR HA   1 1 
        9  5566 1 1 29 THR HB   H   -4.782   6.357  -6.759 1.00 . A A .  29 THR HB   1 1 
        9  5567 1 1 29 THR HG1  H   -4.456   8.498  -5.894 1.00 . A A .  29 THR HG1  1 1 
        9  5568 1 1 29 THR HG21 H   -6.112   5.536  -4.717 1.00 . A A .  29 THR HG21 1 1 
        9  5569 1 1 29 THR HG22 H   -6.553   7.094  -5.414 1.00 . A A .  29 THR HG22 1 1 
        9  5570 1 1 29 THR HG23 H   -5.583   7.029  -3.943 1.00 . A A .  29 THR HG23 1 1 
        9  5571 1 1 29 THR N    N   -4.222   4.107  -5.321 1.00 . A A .  29 THR N    1 1 
        9  5572 1 1 29 THR O    O   -1.901   6.026  -3.655 1.00 . A A .  29 THR O    1 1 
        9  5573 1 1 29 THR OG1  O   -3.853   7.800  -5.627 1.00 . A A .  29 THR OG1  1 1 
        9  5574 1 1 30 GLN C    C   -2.395   5.124  -1.081 1.00 . A A .  30 GLN C    1 1 
        9  5575 1 1 30 GLN CA   C   -3.637   5.905  -1.497 1.00 . A A .  30 GLN CA   1 1 
        9  5576 1 1 30 GLN CB   C   -4.809   5.549  -0.582 1.00 . A A .  30 GLN CB   1 1 
        9  5577 1 1 30 GLN CD   C   -3.775   3.723   0.826 1.00 . A A .  30 GLN CD   1 1 
        9  5578 1 1 30 GLN CG   C   -4.847   4.082  -0.185 1.00 . A A .  30 GLN CG   1 1 
        9  5579 1 1 30 GLN H    H   -4.900   5.383  -3.114 1.00 . A A .  30 GLN H    1 1 
        9  5580 1 1 30 GLN HA   H   -3.430   6.961  -1.407 1.00 . A A .  30 GLN HA   1 1 
        9  5581 1 1 30 GLN HB2  H   -4.741   6.141   0.318 1.00 . A A .  30 GLN HB2  1 1 
        9  5582 1 1 30 GLN HB3  H   -5.732   5.785  -1.090 1.00 . A A .  30 GLN HB3  1 1 
        9  5583 1 1 30 GLN HE21 H   -4.446   5.120   2.071 1.00 . A A .  30 GLN HE21 1 1 
        9  5584 1 1 30 GLN HE22 H   -3.086   4.211   2.625 1.00 . A A .  30 GLN HE22 1 1 
        9  5585 1 1 30 GLN HG2  H   -5.813   3.863   0.246 1.00 . A A .  30 GLN HG2  1 1 
        9  5586 1 1 30 GLN HG3  H   -4.703   3.479  -1.069 1.00 . A A .  30 GLN HG3  1 1 
        9  5587 1 1 30 GLN N    N   -3.980   5.634  -2.888 1.00 . A A .  30 GLN N    1 1 
        9  5588 1 1 30 GLN NE2  N   -3.767   4.422   1.955 1.00 . A A .  30 GLN NE2  1 1 
        9  5589 1 1 30 GLN O    O   -1.629   5.567  -0.225 1.00 . A A .  30 GLN O    1 1 
        9  5590 1 1 30 GLN OE1  O   -2.962   2.827   0.595 1.00 . A A .  30 GLN OE1  1 1 
        9  5591 1 1 31 HIS C    C    0.173   3.557  -2.178 1.00 . A A .  31 HIS C    1 1 
        9  5592 1 1 31 HIS CA   C   -1.052   3.116  -1.384 1.00 . A A .  31 HIS CA   1 1 
        9  5593 1 1 31 HIS CB   C   -1.371   1.652  -1.687 1.00 . A A .  31 HIS CB   1 1 
        9  5594 1 1 31 HIS CD2  C    0.380   0.237  -2.975 1.00 . A A .  31 HIS CD2  1 1 
        9  5595 1 1 31 HIS CE1  C    1.654  -0.317  -1.278 1.00 . A A .  31 HIS CE1  1 1 
        9  5596 1 1 31 HIS CG   C   -0.153   0.798  -1.865 1.00 . A A .  31 HIS CG   1 1 
        9  5597 1 1 31 HIS H    H   -2.848   3.660  -2.365 1.00 . A A .  31 HIS H    1 1 
        9  5598 1 1 31 HIS HA   H   -0.839   3.218  -0.330 1.00 . A A .  31 HIS HA   1 1 
        9  5599 1 1 31 HIS HB2  H   -1.949   1.240  -0.873 1.00 . A A .  31 HIS HB2  1 1 
        9  5600 1 1 31 HIS HB3  H   -1.951   1.597  -2.598 1.00 . A A .  31 HIS HB3  1 1 
        9  5601 1 1 31 HIS HD1  H    0.545   0.684   0.120 1.00 . A A .  31 HIS HD1  1 1 
        9  5602 1 1 31 HIS HD2  H   -0.004   0.315  -3.982 1.00 . A A .  31 HIS HD2  1 1 
        9  5603 1 1 31 HIS HE1  H    2.449  -0.748  -0.688 1.00 . A A .  31 HIS HE1  1 1 
        9  5604 1 1 31 HIS N    N   -2.202   3.959  -1.691 1.00 . A A .  31 HIS N    1 1 
        9  5605 1 1 31 HIS ND1  N    0.667   0.431  -0.819 1.00 . A A .  31 HIS ND1  1 1 
        9  5606 1 1 31 HIS NE2  N    1.503  -0.451  -2.584 1.00 . A A .  31 HIS NE2  1 1 
        9  5607 1 1 31 HIS O    O    1.278   3.633  -1.641 1.00 . A A .  31 HIS O    1 1 
        9  5608 1 1 32 TRP C    C    1.873   5.387  -3.666 1.00 . A A .  32 TRP C    1 1 
        9  5609 1 1 32 TRP CA   C    1.059   4.280  -4.326 1.00 . A A .  32 TRP CA   1 1 
        9  5610 1 1 32 TRP CB   C    0.507   4.766  -5.667 1.00 . A A .  32 TRP CB   1 1 
        9  5611 1 1 32 TRP CD1  C   -0.360   2.472  -6.409 1.00 . A A .  32 TRP CD1  1 1 
        9  5612 1 1 32 TRP CD2  C    0.665   3.636  -8.025 1.00 . A A .  32 TRP CD2  1 1 
        9  5613 1 1 32 TRP CE2  C    0.239   2.404  -8.560 1.00 . A A .  32 TRP CE2  1 1 
        9  5614 1 1 32 TRP CE3  C    1.333   4.536  -8.859 1.00 . A A .  32 TRP CE3  1 1 
        9  5615 1 1 32 TRP CG   C    0.271   3.659  -6.649 1.00 . A A .  32 TRP CG   1 1 
        9  5616 1 1 32 TRP CH2  C    1.120   2.952 -10.681 1.00 . A A .  32 TRP CH2  1 1 
        9  5617 1 1 32 TRP CZ2  C    0.463   2.052  -9.888 1.00 . A A .  32 TRP CZ2  1 1 
        9  5618 1 1 32 TRP CZ3  C    1.555   4.185 -10.177 1.00 . A A .  32 TRP CZ3  1 1 
        9  5619 1 1 32 TRP H    H   -0.935   3.768  -3.828 1.00 . A A .  32 TRP H    1 1 
        9  5620 1 1 32 TRP HA   H    1.702   3.430  -4.499 1.00 . A A .  32 TRP HA   1 1 
        9  5621 1 1 32 TRP HB2  H   -0.434   5.270  -5.501 1.00 . A A .  32 TRP HB2  1 1 
        9  5622 1 1 32 TRP HB3  H    1.209   5.459  -6.107 1.00 . A A .  32 TRP HB3  1 1 
        9  5623 1 1 32 TRP HD1  H   -0.774   2.185  -5.455 1.00 . A A .  32 TRP HD1  1 1 
        9  5624 1 1 32 TRP HE1  H   -0.780   0.819  -7.636 1.00 . A A .  32 TRP HE1  1 1 
        9  5625 1 1 32 TRP HE3  H    1.676   5.491  -8.489 1.00 . A A .  32 TRP HE3  1 1 
        9  5626 1 1 32 TRP HH2  H    1.315   2.720 -11.717 1.00 . A A .  32 TRP HH2  1 1 
        9  5627 1 1 32 TRP HZ2  H    0.133   1.106 -10.292 1.00 . A A .  32 TRP HZ2  1 1 
        9  5628 1 1 32 TRP HZ3  H    2.070   4.868 -10.836 1.00 . A A .  32 TRP HZ3  1 1 
        9  5629 1 1 32 TRP N    N   -0.031   3.847  -3.458 1.00 . A A .  32 TRP N    1 1 
        9  5630 1 1 32 TRP NE1  N   -0.382   1.712  -7.554 1.00 . A A .  32 TRP NE1  1 1 
        9  5631 1 1 32 TRP O    O    3.101   5.406  -3.760 1.00 . A A .  32 TRP O    1 1 
        9  5632 1 1 33 ILE C    C    3.105   6.948  -1.603 1.00 . A A .  33 ILE C    1 1 
        9  5633 1 1 33 ILE CA   C    1.845   7.415  -2.323 1.00 . A A .  33 ILE CA   1 1 
        9  5634 1 1 33 ILE CB   C    0.908   8.094  -1.306 1.00 . A A .  33 ILE CB   1 1 
        9  5635 1 1 33 ILE CD1  C   -1.365   9.224  -1.126 1.00 . A A .  33 ILE CD1  1 1 
        9  5636 1 1 33 ILE CG1  C   -0.218   8.834  -2.031 1.00 . A A .  33 ILE CG1  1 1 
        9  5637 1 1 33 ILE CG2  C    1.692   9.049  -0.419 1.00 . A A .  33 ILE CG2  1 1 
        9  5638 1 1 33 ILE H    H    0.207   6.237  -2.961 1.00 . A A .  33 ILE H    1 1 
        9  5639 1 1 33 ILE HA   H    2.120   8.145  -3.071 1.00 . A A .  33 ILE HA   1 1 
        9  5640 1 1 33 ILE HB   H    0.480   7.327  -0.678 1.00 . A A .  33 ILE HB   1 1 
        9  5641 1 1 33 ILE HD11 H   -0.991   9.403  -0.128 1.00 . A A .  33 ILE HD11 1 1 
        9  5642 1 1 33 ILE HD12 H   -1.830  10.124  -1.501 1.00 . A A .  33 ILE HD12 1 1 
        9  5643 1 1 33 ILE HD13 H   -2.092   8.427  -1.100 1.00 . A A .  33 ILE HD13 1 1 
        9  5644 1 1 33 ILE HG12 H    0.178   9.735  -2.472 1.00 . A A .  33 ILE HG12 1 1 
        9  5645 1 1 33 ILE HG13 H   -0.611   8.198  -2.812 1.00 . A A .  33 ILE HG13 1 1 
        9  5646 1 1 33 ILE HG21 H    2.659   9.238  -0.861 1.00 . A A .  33 ILE HG21 1 1 
        9  5647 1 1 33 ILE HG22 H    1.151   9.979  -0.327 1.00 . A A .  33 ILE HG22 1 1 
        9  5648 1 1 33 ILE HG23 H    1.822   8.609   0.558 1.00 . A A .  33 ILE HG23 1 1 
        9  5649 1 1 33 ILE N    N    1.183   6.306  -2.999 1.00 . A A .  33 ILE N    1 1 
        9  5650 1 1 33 ILE O    O    4.106   7.662  -1.552 1.00 . A A .  33 ILE O    1 1 
        9  5651 1 1 34 THR C    C    5.423   5.116  -1.222 1.00 . A A .  34 THR C    1 1 
        9  5652 1 1 34 THR CA   C    4.186   5.176  -0.332 1.00 . A A .  34 THR CA   1 1 
        9  5653 1 1 34 THR CB   C    3.875   3.761   0.190 1.00 . A A .  34 THR CB   1 1 
        9  5654 1 1 34 THR CG2  C    2.744   3.796   1.207 1.00 . A A .  34 THR CG2  1 1 
        9  5655 1 1 34 THR H    H    2.224   5.219  -1.124 1.00 . A A .  34 THR H    1 1 
        9  5656 1 1 34 THR HA   H    4.396   5.812   0.516 1.00 . A A .  34 THR HA   1 1 
        9  5657 1 1 34 THR HB   H    4.759   3.367   0.670 1.00 . A A .  34 THR HB   1 1 
        9  5658 1 1 34 THR HG1  H    3.042   2.139  -0.564 1.00 . A A .  34 THR HG1  1 1 
        9  5659 1 1 34 THR HG21 H    1.806   3.954   0.697 1.00 . A A .  34 THR HG21 1 1 
        9  5660 1 1 34 THR HG22 H    2.914   4.603   1.906 1.00 . A A .  34 THR HG22 1 1 
        9  5661 1 1 34 THR HG23 H    2.711   2.858   1.741 1.00 . A A .  34 THR HG23 1 1 
        9  5662 1 1 34 THR N    N    3.050   5.740  -1.049 1.00 . A A .  34 THR N    1 1 
        9  5663 1 1 34 THR O    O    6.523   5.473  -0.799 1.00 . A A .  34 THR O    1 1 
        9  5664 1 1 34 THR OG1  O    3.515   2.904  -0.900 1.00 . A A .  34 THR OG1  1 1 
        9  5665 1 1 35 HIS C    C    6.884   5.936  -3.760 1.00 . A A .  35 HIS C    1 1 
        9  5666 1 1 35 HIS CA   C    6.336   4.557  -3.409 1.00 . A A .  35 HIS CA   1 1 
        9  5667 1 1 35 HIS CB   C    5.875   3.840  -4.678 1.00 . A A .  35 HIS CB   1 1 
        9  5668 1 1 35 HIS CD2  C    4.137   1.925  -4.879 1.00 . A A .  35 HIS CD2  1 1 
        9  5669 1 1 35 HIS CE1  C    5.113   0.466  -3.566 1.00 . A A .  35 HIS CE1  1 1 
        9  5670 1 1 35 HIS CG   C    5.278   2.490  -4.420 1.00 . A A .  35 HIS CG   1 1 
        9  5671 1 1 35 HIS H    H    4.335   4.393  -2.736 1.00 . A A .  35 HIS H    1 1 
        9  5672 1 1 35 HIS HA   H    7.121   3.979  -2.944 1.00 . A A .  35 HIS HA   1 1 
        9  5673 1 1 35 HIS HB2  H    5.129   4.443  -5.173 1.00 . A A .  35 HIS HB2  1 1 
        9  5674 1 1 35 HIS HB3  H    6.721   3.708  -5.337 1.00 . A A .  35 HIS HB3  1 1 
        9  5675 1 1 35 HIS HD1  H    6.710   1.663  -3.115 1.00 . A A .  35 HIS HD1  1 1 
        9  5676 1 1 35 HIS HD2  H    3.421   2.378  -5.550 1.00 . A A .  35 HIS HD2  1 1 
        9  5677 1 1 35 HIS HE1  H    5.324  -0.433  -3.006 1.00 . A A .  35 HIS HE1  1 1 
        9  5678 1 1 35 HIS N    N    5.235   4.662  -2.458 1.00 . A A .  35 HIS N    1 1 
        9  5679 1 1 35 HIS ND1  N    5.866   1.551  -3.599 1.00 . A A .  35 HIS ND1  1 1 
        9  5680 1 1 35 HIS NE2  N    4.058   0.667  -4.334 1.00 . A A .  35 HIS NE2  1 1 
        9  5681 1 1 35 HIS O    O    8.087   6.105  -3.966 1.00 . A A .  35 HIS O    1 1 
        9  5682 1 1 36 THR C    C    7.586   8.728  -3.324 1.00 . A A .  36 THR C    1 1 
        9  5683 1 1 36 THR CA   C    6.388   8.286  -4.158 1.00 . A A .  36 THR CA   1 1 
        9  5684 1 1 36 THR CB   C    5.229   9.275  -3.935 1.00 . A A .  36 THR CB   1 1 
        9  5685 1 1 36 THR CG2  C    5.576  10.650  -4.485 1.00 . A A .  36 THR CG2  1 1 
        9  5686 1 1 36 THR H    H    5.051   6.725  -3.655 1.00 . A A .  36 THR H    1 1 
        9  5687 1 1 36 THR HA   H    6.660   8.312  -5.203 1.00 . A A .  36 THR HA   1 1 
        9  5688 1 1 36 THR HB   H    5.050   9.363  -2.872 1.00 . A A .  36 THR HB   1 1 
        9  5689 1 1 36 THR HG1  H    4.281   8.238  -5.319 1.00 . A A .  36 THR HG1  1 1 
        9  5690 1 1 36 THR HG21 H    4.882  11.379  -4.095 1.00 . A A .  36 THR HG21 1 1 
        9  5691 1 1 36 THR HG22 H    5.512  10.633  -5.563 1.00 . A A .  36 THR HG22 1 1 
        9  5692 1 1 36 THR HG23 H    6.581  10.913  -4.188 1.00 . A A .  36 THR HG23 1 1 
        9  5693 1 1 36 THR N    N    5.995   6.922  -3.829 1.00 . A A .  36 THR N    1 1 
        9  5694 1 1 36 THR O    O    8.617   9.129  -3.865 1.00 . A A .  36 THR O    1 1 
        9  5695 1 1 36 THR OG1  O    4.041   8.788  -4.569 1.00 . A A .  36 THR OG1  1 1 
        9  5696 1 1 37 ARG C    C    9.587   7.964  -1.021 1.00 . A A .  37 ARG C    1 1 
        9  5697 1 1 37 ARG CA   C    8.514   9.046  -1.097 1.00 . A A .  37 ARG CA   1 1 
        9  5698 1 1 37 ARG CB   C    7.952   9.321   0.299 1.00 . A A .  37 ARG CB   1 1 
        9  5699 1 1 37 ARG CD   C    6.472   8.491   2.153 1.00 . A A .  37 ARG CD   1 1 
        9  5700 1 1 37 ARG CG   C    7.322   8.103   0.953 1.00 . A A .  37 ARG CG   1 1 
        9  5701 1 1 37 ARG CZ   C    5.951   6.319   3.180 1.00 . A A .  37 ARG CZ   1 1 
        9  5702 1 1 37 ARG H    H    6.597   8.325  -1.633 1.00 . A A .  37 ARG H    1 1 
        9  5703 1 1 37 ARG HA   H    8.959   9.952  -1.481 1.00 . A A .  37 ARG HA   1 1 
        9  5704 1 1 37 ARG HB2  H    8.753   9.670   0.934 1.00 . A A .  37 ARG HB2  1 1 
        9  5705 1 1 37 ARG HB3  H    7.200  10.092   0.225 1.00 . A A .  37 ARG HB3  1 1 
        9  5706 1 1 37 ARG HD2  H    7.125   8.719   2.982 1.00 . A A .  37 ARG HD2  1 1 
        9  5707 1 1 37 ARG HD3  H    5.894   9.367   1.898 1.00 . A A .  37 ARG HD3  1 1 
        9  5708 1 1 37 ARG HE   H    4.612   7.528   2.330 1.00 . A A .  37 ARG HE   1 1 
        9  5709 1 1 37 ARG HG2  H    6.697   7.600   0.230 1.00 . A A .  37 ARG HG2  1 1 
        9  5710 1 1 37 ARG HG3  H    8.106   7.436   1.280 1.00 . A A .  37 ARG HG3  1 1 
        9  5711 1 1 37 ARG HH11 H    7.901   6.845   3.244 1.00 . A A .  37 ARG HH11 1 1 
        9  5712 1 1 37 ARG HH12 H    7.520   5.316   3.965 1.00 . A A .  37 ARG HH12 1 1 
        9  5713 1 1 37 ARG HH21 H    4.098   5.517   3.276 1.00 . A A .  37 ARG HH21 1 1 
        9  5714 1 1 37 ARG HH22 H    5.357   4.562   3.982 1.00 . A A .  37 ARG HH22 1 1 
        9  5715 1 1 37 ARG N    N    7.443   8.653  -2.005 1.00 . A A .  37 ARG N    1 1 
        9  5716 1 1 37 ARG NE   N    5.561   7.420   2.548 1.00 . A A .  37 ARG NE   1 1 
        9  5717 1 1 37 ARG NH1  N    7.229   6.145   3.488 1.00 . A A .  37 ARG NH1  1 1 
        9  5718 1 1 37 ARG NH2  N    5.062   5.390   3.506 1.00 . A A .  37 ARG NH2  1 1 
        9  5719 1 1 37 ARG O    O   10.781   8.258  -1.059 1.00 . A A .  37 ARG O    1 1 
        9  5720 1 1 38 GLU C    C   10.323   4.983  -2.208 1.00 . A A .  38 GLU C    1 1 
        9  5721 1 1 38 GLU CA   C   10.076   5.588  -0.829 1.00 . A A .  38 GLU CA   1 1 
        9  5722 1 1 38 GLU CB   C    9.529   4.518   0.119 1.00 . A A .  38 GLU CB   1 1 
        9  5723 1 1 38 GLU CD   C   11.660   3.689   1.190 1.00 . A A .  38 GLU CD   1 1 
        9  5724 1 1 38 GLU CG   C   10.470   3.342   0.318 1.00 . A A .  38 GLU CG   1 1 
        9  5725 1 1 38 GLU H    H    8.187   6.542  -0.886 1.00 . A A .  38 GLU H    1 1 
        9  5726 1 1 38 GLU HA   H   11.013   5.956  -0.438 1.00 . A A .  38 GLU HA   1 1 
        9  5727 1 1 38 GLU HB2  H    9.340   4.970   1.082 1.00 . A A .  38 GLU HB2  1 1 
        9  5728 1 1 38 GLU HB3  H    8.598   4.144  -0.281 1.00 . A A .  38 GLU HB3  1 1 
        9  5729 1 1 38 GLU HG2  H    9.924   2.536   0.784 1.00 . A A .  38 GLU HG2  1 1 
        9  5730 1 1 38 GLU HG3  H   10.832   3.020  -0.648 1.00 . A A .  38 GLU HG3  1 1 
        9  5731 1 1 38 GLU N    N    9.152   6.713  -0.912 1.00 . A A .  38 GLU N    1 1 
        9  5732 1 1 38 GLU O    O    9.612   4.075  -2.637 1.00 . A A .  38 GLU O    1 1 
        9  5733 1 1 38 GLU OE1  O   11.469   4.403   2.197 1.00 . A A .  38 GLU OE1  1 1 
        9  5734 1 1 38 GLU OE2  O   12.782   3.246   0.868 1.00 . A A .  38 GLU OE2  1 1 
        9  5735 1 1 39 LYS C    C   12.803   3.979  -4.159 1.00 . A A .  39 LYS C    1 1 
        9  5736 1 1 39 LYS CA   C   11.679   5.008  -4.229 1.00 . A A .  39 LYS CA   1 1 
        9  5737 1 1 39 LYS CB   C   12.095   6.172  -5.131 1.00 . A A .  39 LYS CB   1 1 
        9  5738 1 1 39 LYS CD   C   11.470   8.380  -6.153 1.00 . A A .  39 LYS CD   1 1 
        9  5739 1 1 39 LYS CE   C   11.991   9.417  -5.170 1.00 . A A .  39 LYS CE   1 1 
        9  5740 1 1 39 LYS CG   C   10.964   7.139  -5.437 1.00 . A A .  39 LYS CG   1 1 
        9  5741 1 1 39 LYS H    H   11.867   6.219  -2.504 1.00 . A A .  39 LYS H    1 1 
        9  5742 1 1 39 LYS HA   H   10.802   4.536  -4.647 1.00 . A A .  39 LYS HA   1 1 
        9  5743 1 1 39 LYS HB2  H   12.889   6.721  -4.645 1.00 . A A .  39 LYS HB2  1 1 
        9  5744 1 1 39 LYS HB3  H   12.464   5.774  -6.065 1.00 . A A .  39 LYS HB3  1 1 
        9  5745 1 1 39 LYS HD2  H   12.271   8.099  -6.821 1.00 . A A .  39 LYS HD2  1 1 
        9  5746 1 1 39 LYS HD3  H   10.659   8.811  -6.723 1.00 . A A .  39 LYS HD3  1 1 
        9  5747 1 1 39 LYS HE2  H   11.202   9.666  -4.478 1.00 . A A .  39 LYS HE2  1 1 
        9  5748 1 1 39 LYS HE3  H   12.824   8.994  -4.629 1.00 . A A .  39 LYS HE3  1 1 
        9  5749 1 1 39 LYS HG2  H   10.240   6.643  -6.066 1.00 . A A .  39 LYS HG2  1 1 
        9  5750 1 1 39 LYS HG3  H   10.495   7.435  -4.510 1.00 . A A .  39 LYS HG3  1 1 
        9  5751 1 1 39 LYS HZ1  H   11.994  11.490  -5.426 1.00 . A A .  39 LYS HZ1  1 1 
        9  5752 1 1 39 LYS HZ2  H   12.179  10.622  -6.866 1.00 . A A .  39 LYS HZ2  1 1 
        9  5753 1 1 39 LYS HZ3  H   13.474  10.754  -5.785 1.00 . A A .  39 LYS HZ3  1 1 
        9  5754 1 1 39 LYS N    N   11.336   5.495  -2.899 1.00 . A A .  39 LYS N    1 1 
        9  5755 1 1 39 LYS NZ   N   12.441  10.658  -5.860 1.00 . A A .  39 LYS NZ   1 1 
        9  5756 1 1 39 LYS O    O   13.717   4.078  -3.340 1.00 . A A .  39 LYS O    1 1 
        9  5757 1 1 40 PRO C    C   15.084   2.400  -5.620 1.00 . A A .  40 PRO C    1 1 
        9  5758 1 1 40 PRO CA   C   13.742   1.902  -5.095 1.00 . A A .  40 PRO CA   1 1 
        9  5759 1 1 40 PRO CB   C   13.130   0.889  -6.066 1.00 . A A .  40 PRO CB   1 1 
        9  5760 1 1 40 PRO CD   C   11.676   2.786  -6.042 1.00 . A A .  40 PRO CD   1 1 
        9  5761 1 1 40 PRO CG   C   12.213   1.692  -6.923 1.00 . A A .  40 PRO CG   1 1 
        9  5762 1 1 40 PRO HA   H   13.884   1.438  -4.130 1.00 . A A .  40 PRO HA   1 1 
        9  5763 1 1 40 PRO HB2  H   13.914   0.427  -6.650 1.00 . A A .  40 PRO HB2  1 1 
        9  5764 1 1 40 PRO HB3  H   12.593   0.134  -5.513 1.00 . A A .  40 PRO HB3  1 1 
        9  5765 1 1 40 PRO HD2  H   11.526   3.691  -6.612 1.00 . A A .  40 PRO HD2  1 1 
        9  5766 1 1 40 PRO HD3  H   10.752   2.475  -5.575 1.00 . A A .  40 PRO HD3  1 1 
        9  5767 1 1 40 PRO HG2  H   12.760   2.113  -7.752 1.00 . A A .  40 PRO HG2  1 1 
        9  5768 1 1 40 PRO HG3  H   11.406   1.069  -7.280 1.00 . A A .  40 PRO HG3  1 1 
        9  5769 1 1 40 PRO N    N   12.737   2.967  -5.037 1.00 . A A .  40 PRO N    1 1 
        9  5770 1 1 40 PRO O    O   15.252   3.588  -5.895 1.00 . A A .  40 PRO O    1 1 
        9  5771 1 1 41 SER C    C   17.324   2.185  -7.730 1.00 . A A .  41 SER C    1 1 
        9  5772 1 1 41 SER CA   C   17.366   1.830  -6.247 1.00 . A A .  41 SER CA   1 1 
        9  5773 1 1 41 SER CB   C   18.337   0.670  -6.016 1.00 . A A .  41 SER CB   1 1 
        9  5774 1 1 41 SER H    H   15.842   0.552  -5.522 1.00 . A A .  41 SER H    1 1 
        9  5775 1 1 41 SER HA   H   17.710   2.691  -5.693 1.00 . A A .  41 SER HA   1 1 
        9  5776 1 1 41 SER HB2  H   18.577   0.609  -4.966 1.00 . A A .  41 SER HB2  1 1 
        9  5777 1 1 41 SER HB3  H   17.873  -0.252  -6.335 1.00 . A A .  41 SER HB3  1 1 
        9  5778 1 1 41 SER HG   H   19.713   1.794  -6.843 1.00 . A A .  41 SER HG   1 1 
        9  5779 1 1 41 SER N    N   16.037   1.483  -5.758 1.00 . A A .  41 SER N    1 1 
        9  5780 1 1 41 SER O    O   17.905   3.181  -8.159 1.00 . A A .  41 SER O    1 1 
        9  5781 1 1 41 SER OG   O   19.536   0.855  -6.749 1.00 . A A .  41 SER OG   1 1 
        9  5782 1 1 42 GLY C    C   17.689   1.024 -10.712 1.00 . A A .  42 GLY C    1 1 
        9  5783 1 1 42 GLY CA   C   16.523   1.605  -9.937 1.00 . A A .  42 GLY CA   1 1 
        9  5784 1 1 42 GLY H    H   16.186   0.583  -8.113 1.00 . A A .  42 GLY H    1 1 
        9  5785 1 1 42 GLY HA2  H   15.607   1.162 -10.299 1.00 . A A .  42 GLY HA2  1 1 
        9  5786 1 1 42 GLY HA3  H   16.488   2.671 -10.107 1.00 . A A .  42 GLY HA3  1 1 
        9  5787 1 1 42 GLY N    N   16.630   1.362  -8.510 1.00 . A A .  42 GLY N    1 1 
        9  5788 1 1 42 GLY O    O   18.463   1.745 -11.342 1.00 . A A .  42 GLY O    1 1 
        9  5789 1 1 43 PRO C    C   18.735  -0.982 -12.883 1.00 . A A .  43 PRO C    1 1 
        9  5790 1 1 43 PRO CA   C   18.906  -1.015 -11.368 1.00 . A A .  43 PRO CA   1 1 
        9  5791 1 1 43 PRO CB   C   18.786  -2.450 -10.848 1.00 . A A .  43 PRO CB   1 1 
        9  5792 1 1 43 PRO CD   C   16.941  -1.230  -9.939 1.00 . A A .  43 PRO CD   1 1 
        9  5793 1 1 43 PRO CG   C   17.360  -2.586 -10.438 1.00 . A A .  43 PRO CG   1 1 
        9  5794 1 1 43 PRO HA   H   19.875  -0.616 -11.108 1.00 . A A .  43 PRO HA   1 1 
        9  5795 1 1 43 PRO HB2  H   19.039  -3.144 -11.637 1.00 . A A .  43 PRO HB2  1 1 
        9  5796 1 1 43 PRO HB3  H   19.452  -2.590 -10.010 1.00 . A A .  43 PRO HB3  1 1 
        9  5797 1 1 43 PRO HD2  H   15.906  -1.043 -10.181 1.00 . A A .  43 PRO HD2  1 1 
        9  5798 1 1 43 PRO HD3  H   17.102  -1.154  -8.874 1.00 . A A .  43 PRO HD3  1 1 
        9  5799 1 1 43 PRO HG2  H   16.760  -2.875 -11.287 1.00 . A A .  43 PRO HG2  1 1 
        9  5800 1 1 43 PRO HG3  H   17.273  -3.318  -9.649 1.00 . A A .  43 PRO HG3  1 1 
        9  5801 1 1 43 PRO N    N   17.827  -0.309 -10.671 1.00 . A A .  43 PRO N    1 1 
        9  5802 1 1 43 PRO O    O   19.713  -0.896 -13.626 1.00 . A A .  43 PRO O    1 1 
        9  5803 1 1 44 SER C    C   16.296   0.154 -15.115 1.00 . A A .  44 SER C    1 1 
        9  5804 1 1 44 SER CA   C   17.189  -1.032 -14.763 1.00 . A A .  44 SER CA   1 1 
        9  5805 1 1 44 SER CB   C   16.510  -2.338 -15.181 1.00 . A A .  44 SER CB   1 1 
        9  5806 1 1 44 SER H    H   16.750  -1.119 -12.693 1.00 . A A .  44 SER H    1 1 
        9  5807 1 1 44 SER HA   H   18.123  -0.936 -15.295 1.00 . A A .  44 SER HA   1 1 
        9  5808 1 1 44 SER HB2  H   16.242  -2.283 -16.224 1.00 . A A .  44 SER HB2  1 1 
        9  5809 1 1 44 SER HB3  H   17.193  -3.161 -15.027 1.00 . A A .  44 SER HB3  1 1 
        9  5810 1 1 44 SER HG   H   14.883  -3.344 -14.759 1.00 . A A .  44 SER HG   1 1 
        9  5811 1 1 44 SER N    N   17.487  -1.051 -13.335 1.00 . A A .  44 SER N    1 1 
        9  5812 1 1 44 SER O    O   15.129   0.203 -14.727 1.00 . A A .  44 SER O    1 1 
        9  5813 1 1 44 SER OG   O   15.338  -2.570 -14.419 1.00 . A A .  44 SER OG   1 1 
        9  5814 1 1 45 SER C    C   15.813   2.268 -17.753 1.00 . A A .  45 SER C    1 1 
        9  5815 1 1 45 SER CA   C   16.112   2.296 -16.257 1.00 . A A .  45 SER CA   1 1 
        9  5816 1 1 45 SER CB   C   16.900   3.559 -15.906 1.00 . A A .  45 SER CB   1 1 
        9  5817 1 1 45 SER H    H   17.789   1.010 -16.132 1.00 . A A .  45 SER H    1 1 
        9  5818 1 1 45 SER HA   H   15.178   2.302 -15.715 1.00 . A A .  45 SER HA   1 1 
        9  5819 1 1 45 SER HB2  H   17.046   3.603 -14.837 1.00 . A A .  45 SER HB2  1 1 
        9  5820 1 1 45 SER HB3  H   17.860   3.530 -16.400 1.00 . A A .  45 SER HB3  1 1 
        9  5821 1 1 45 SER HG   H   16.416   5.449 -15.727 1.00 . A A .  45 SER HG   1 1 
        9  5822 1 1 45 SER N    N   16.854   1.107 -15.854 1.00 . A A .  45 SER N    1 1 
        9  5823 1 1 45 SER O    O   16.718   2.369 -18.580 1.00 . A A .  45 SER O    1 1 
        9  5824 1 1 45 SER OG   O   16.207   4.724 -16.320 1.00 . A A .  45 SER OG   1 1 
        9  5825 1 1 46 GLY C    C   12.749   1.515 -19.680 1.00 . A A .  46 GLY C    1 1 
        9  5826 1 1 46 GLY CA   C   14.137   2.093 -19.487 1.00 . A A .  46 GLY CA   1 1 
        9  5827 1 1 46 GLY H    H   13.855   2.056 -17.389 1.00 . A A .  46 GLY H    1 1 
        9  5828 1 1 46 GLY HA2  H   14.156   3.097 -19.884 1.00 . A A .  46 GLY HA2  1 1 
        9  5829 1 1 46 GLY HA3  H   14.845   1.488 -20.035 1.00 . A A .  46 GLY HA3  1 1 
        9  5830 1 1 46 GLY N    N   14.534   2.132 -18.092 1.00 . A A .  46 GLY N    1 1 
        9  5831 1 1 46 GLY O    O   12.607   0.521 -20.389 1.00 . A A .  46 GLY O    1 1 
        9  5832 2 2  1 ZN  ZN   ZN   2.398  -0.607  -4.374 1.00 . B A . 181 ZN  ZN   1 1 
       10  5833 1 1  1 GLY C    C    1.052 -19.132   2.456 1.00 . A A .   1 GLY C    1 1 
       10  5834 1 1  1 GLY CA   C    0.073 -20.186   1.978 1.00 . A A .   1 GLY CA   1 1 
       10  5835 1 1  1 GLY H1   H    0.075 -21.616   3.539 1.00 . A A .   1 GLY H1   1 1 
       10  5836 1 1  1 GLY HA2  H    0.582 -20.854   1.299 1.00 . A A .   1 GLY HA2  1 1 
       10  5837 1 1  1 GLY HA3  H   -0.734 -19.699   1.450 1.00 . A A .   1 GLY HA3  1 1 
       10  5838 1 1  1 GLY N    N   -0.484 -20.963   3.070 1.00 . A A .   1 GLY N    1 1 
       10  5839 1 1  1 GLY O    O    0.757 -18.375   3.380 1.00 . A A .   1 GLY O    1 1 
       10  5840 1 1  2 SER C    C    3.101 -16.831   1.392 1.00 . A A .   2 SER C    1 1 
       10  5841 1 1  2 SER CA   C    3.250 -18.119   2.196 1.00 . A A .   2 SER CA   1 1 
       10  5842 1 1  2 SER CB   C    4.642 -18.714   1.974 1.00 . A A .   2 SER CB   1 1 
       10  5843 1 1  2 SER H    H    2.398 -19.715   1.097 1.00 . A A .   2 SER H    1 1 
       10  5844 1 1  2 SER HA   H    3.128 -17.891   3.245 1.00 . A A .   2 SER HA   1 1 
       10  5845 1 1  2 SER HB2  H    5.389 -17.971   2.206 1.00 . A A .   2 SER HB2  1 1 
       10  5846 1 1  2 SER HB3  H    4.772 -19.570   2.621 1.00 . A A .   2 SER HB3  1 1 
       10  5847 1 1  2 SER HG   H    4.309 -19.932   0.476 1.00 . A A .   2 SER HG   1 1 
       10  5848 1 1  2 SER N    N    2.222 -19.085   1.826 1.00 . A A .   2 SER N    1 1 
       10  5849 1 1  2 SER O    O    3.054 -15.737   1.954 1.00 . A A .   2 SER O    1 1 
       10  5850 1 1  2 SER OG   O    4.810 -19.128   0.629 1.00 . A A .   2 SER OG   1 1 
       10  5851 1 1  3 SER C    C    1.673 -15.977  -1.722 1.00 . A A .   3 SER C    1 1 
       10  5852 1 1  3 SER CA   C    2.886 -15.819  -0.811 1.00 . A A .   3 SER CA   1 1 
       10  5853 1 1  3 SER CB   C    4.150 -15.639  -1.654 1.00 . A A .   3 SER CB   1 1 
       10  5854 1 1  3 SER H    H    3.069 -17.869  -0.316 1.00 . A A .   3 SER H    1 1 
       10  5855 1 1  3 SER HA   H    2.747 -14.943  -0.195 1.00 . A A .   3 SER HA   1 1 
       10  5856 1 1  3 SER HB2  H    4.566 -16.607  -1.886 1.00 . A A .   3 SER HB2  1 1 
       10  5857 1 1  3 SER HB3  H    3.899 -15.125  -2.570 1.00 . A A .   3 SER HB3  1 1 
       10  5858 1 1  3 SER HG   H    4.980 -14.964  -0.012 1.00 . A A .   3 SER HG   1 1 
       10  5859 1 1  3 SER N    N    3.026 -16.970   0.072 1.00 . A A .   3 SER N    1 1 
       10  5860 1 1  3 SER O    O    1.595 -16.915  -2.515 1.00 . A A .   3 SER O    1 1 
       10  5861 1 1  3 SER OG   O    5.124 -14.880  -0.957 1.00 . A A .   3 SER OG   1 1 
       10  5862 1 1  4 GLY C    C   -1.638 -15.753  -1.698 1.00 . A A .   4 GLY C    1 1 
       10  5863 1 1  4 GLY CA   C   -0.473 -15.106  -2.419 1.00 . A A .   4 GLY CA   1 1 
       10  5864 1 1  4 GLY H    H    0.841 -14.326  -0.952 1.00 . A A .   4 GLY H    1 1 
       10  5865 1 1  4 GLY HA2  H   -0.749 -14.100  -2.700 1.00 . A A .   4 GLY HA2  1 1 
       10  5866 1 1  4 GLY HA3  H   -0.259 -15.672  -3.314 1.00 . A A .   4 GLY HA3  1 1 
       10  5867 1 1  4 GLY N    N    0.725 -15.052  -1.602 1.00 . A A .   4 GLY N    1 1 
       10  5868 1 1  4 GLY O    O   -1.629 -16.958  -1.445 1.00 . A A .   4 GLY O    1 1 
       10  5869 1 1  5 SER C    C   -4.920 -15.834  -1.648 1.00 . A A .   5 SER C    1 1 
       10  5870 1 1  5 SER CA   C   -3.820 -15.452  -0.662 1.00 . A A .   5 SER CA   1 1 
       10  5871 1 1  5 SER CB   C   -4.342 -14.400   0.318 1.00 . A A .   5 SER CB   1 1 
       10  5872 1 1  5 SER H    H   -2.593 -13.999  -1.593 1.00 . A A .   5 SER H    1 1 
       10  5873 1 1  5 SER HA   H   -3.527 -16.332  -0.109 1.00 . A A .   5 SER HA   1 1 
       10  5874 1 1  5 SER HB2  H   -3.602 -14.227   1.085 1.00 . A A .   5 SER HB2  1 1 
       10  5875 1 1  5 SER HB3  H   -4.530 -13.478  -0.214 1.00 . A A .   5 SER HB3  1 1 
       10  5876 1 1  5 SER HG   H   -5.415 -14.893   1.881 1.00 . A A .   5 SER HG   1 1 
       10  5877 1 1  5 SER N    N   -2.644 -14.951  -1.364 1.00 . A A .   5 SER N    1 1 
       10  5878 1 1  5 SER O    O   -5.340 -16.990  -1.709 1.00 . A A .   5 SER O    1 1 
       10  5879 1 1  5 SER OG   O   -5.546 -14.827   0.932 1.00 . A A .   5 SER OG   1 1 
       10  5880 1 1  6 SER C    C   -5.962 -14.715  -4.803 1.00 . A A .   6 SER C    1 1 
       10  5881 1 1  6 SER CA   C   -6.435 -15.086  -3.400 1.00 . A A .   6 SER CA   1 1 
       10  5882 1 1  6 SER CB   C   -7.683 -14.278  -3.040 1.00 . A A .   6 SER CB   1 1 
       10  5883 1 1  6 SER H    H   -5.006 -13.954  -2.323 1.00 . A A .   6 SER H    1 1 
       10  5884 1 1  6 SER HA   H   -6.680 -16.138  -3.382 1.00 . A A .   6 SER HA   1 1 
       10  5885 1 1  6 SER HB2  H   -7.386 -13.354  -2.567 1.00 . A A .   6 SER HB2  1 1 
       10  5886 1 1  6 SER HB3  H   -8.238 -14.058  -3.941 1.00 . A A .   6 SER HB3  1 1 
       10  5887 1 1  6 SER HG   H   -8.818 -14.416  -1.450 1.00 . A A .   6 SER HG   1 1 
       10  5888 1 1  6 SER N    N   -5.381 -14.855  -2.419 1.00 . A A .   6 SER N    1 1 
       10  5889 1 1  6 SER O    O   -5.981 -13.547  -5.188 1.00 . A A .   6 SER O    1 1 
       10  5890 1 1  6 SER OG   O   -8.519 -14.999  -2.152 1.00 . A A .   6 SER OG   1 1 
       10  5891 1 1  7 GLY C    C   -6.083 -15.878  -7.963 1.00 . A A .   7 GLY C    1 1 
       10  5892 1 1  7 GLY CA   C   -5.064 -15.481  -6.913 1.00 . A A .   7 GLY CA   1 1 
       10  5893 1 1  7 GLY H    H   -5.543 -16.632  -5.202 1.00 . A A .   7 GLY H    1 1 
       10  5894 1 1  7 GLY HA2  H   -4.839 -14.431  -7.023 1.00 . A A .   7 GLY HA2  1 1 
       10  5895 1 1  7 GLY HA3  H   -4.160 -16.051  -7.072 1.00 . A A .   7 GLY HA3  1 1 
       10  5896 1 1  7 GLY N    N   -5.536 -15.720  -5.562 1.00 . A A .   7 GLY N    1 1 
       10  5897 1 1  7 GLY O    O   -6.105 -17.023  -8.413 1.00 . A A .   7 GLY O    1 1 
       10  5898 1 1  8 GLU C    C   -7.508 -14.711 -10.730 1.00 . A A .   8 GLU C    1 1 
       10  5899 1 1  8 GLU CA   C   -7.958 -15.189  -9.353 1.00 . A A .   8 GLU CA   1 1 
       10  5900 1 1  8 GLU CB   C   -9.266 -14.497  -8.963 1.00 . A A .   8 GLU CB   1 1 
       10  5901 1 1  8 GLU CD   C   -9.336 -12.280 -10.171 1.00 . A A .   8 GLU CD   1 1 
       10  5902 1 1  8 GLU CG   C   -9.145 -12.987  -8.844 1.00 . A A .   8 GLU CG   1 1 
       10  5903 1 1  8 GLU H    H   -6.862 -14.036  -7.955 1.00 . A A .   8 GLU H    1 1 
       10  5904 1 1  8 GLU HA   H   -8.123 -16.255  -9.391 1.00 . A A .   8 GLU HA   1 1 
       10  5905 1 1  8 GLU HB2  H  -10.013 -14.720  -9.710 1.00 . A A .   8 GLU HB2  1 1 
       10  5906 1 1  8 GLU HB3  H   -9.595 -14.887  -8.011 1.00 . A A .   8 GLU HB3  1 1 
       10  5907 1 1  8 GLU HG2  H   -9.895 -12.632  -8.153 1.00 . A A .   8 GLU HG2  1 1 
       10  5908 1 1  8 GLU HG3  H   -8.163 -12.747  -8.463 1.00 . A A .   8 GLU HG3  1 1 
       10  5909 1 1  8 GLU N    N   -6.930 -14.930  -8.351 1.00 . A A .   8 GLU N    1 1 
       10  5910 1 1  8 GLU O    O   -8.305 -14.192 -11.510 1.00 . A A .   8 GLU O    1 1 
       10  5911 1 1  8 GLU OE1  O  -10.466 -12.306 -10.701 1.00 . A A .   8 GLU OE1  1 1 
       10  5912 1 1  8 GLU OE2  O   -8.354 -11.700 -10.681 1.00 . A A .   8 GLU OE2  1 1 
       10  5913 1 1  9 GLY C    C   -5.204 -13.035 -12.290 1.00 . A A .   9 GLY C    1 1 
       10  5914 1 1  9 GLY CA   C   -5.688 -14.472 -12.304 1.00 . A A .   9 GLY CA   1 1 
       10  5915 1 1  9 GLY H    H   -5.633 -15.309 -10.361 1.00 . A A .   9 GLY H    1 1 
       10  5916 1 1  9 GLY HA2  H   -4.862 -15.117 -12.565 1.00 . A A .   9 GLY HA2  1 1 
       10  5917 1 1  9 GLY HA3  H   -6.460 -14.571 -13.053 1.00 . A A .   9 GLY HA3  1 1 
       10  5918 1 1  9 GLY N    N   -6.223 -14.890 -11.022 1.00 . A A .   9 GLY N    1 1 
       10  5919 1 1  9 GLY O    O   -4.359 -12.667 -11.474 1.00 . A A .   9 GLY O    1 1 
       10  5920 1 1 10 GLU C    C   -6.393  -9.926 -12.616 1.00 . A A .  10 GLU C    1 1 
       10  5921 1 1 10 GLU CA   C   -5.353 -10.819 -13.285 1.00 . A A .  10 GLU CA   1 1 
       10  5922 1 1 10 GLU CB   C   -5.177 -10.408 -14.748 1.00 . A A .  10 GLU CB   1 1 
       10  5923 1 1 10 GLU CD   C   -7.358  -9.312 -15.400 1.00 . A A .  10 GLU CD   1 1 
       10  5924 1 1 10 GLU CG   C   -6.451 -10.516 -15.569 1.00 . A A .  10 GLU CG   1 1 
       10  5925 1 1 10 GLU H    H   -6.407 -12.576 -13.820 1.00 . A A .  10 GLU H    1 1 
       10  5926 1 1 10 GLU HA   H   -4.411 -10.701 -12.772 1.00 . A A .  10 GLU HA   1 1 
       10  5927 1 1 10 GLU HB2  H   -4.837  -9.383 -14.783 1.00 . A A .  10 GLU HB2  1 1 
       10  5928 1 1 10 GLU HB3  H   -4.428 -11.042 -15.200 1.00 . A A .  10 GLU HB3  1 1 
       10  5929 1 1 10 GLU HG2  H   -6.187 -10.605 -16.612 1.00 . A A .  10 GLU HG2  1 1 
       10  5930 1 1 10 GLU HG3  H   -6.990 -11.400 -15.259 1.00 . A A .  10 GLU HG3  1 1 
       10  5931 1 1 10 GLU N    N   -5.739 -12.223 -13.196 1.00 . A A .  10 GLU N    1 1 
       10  5932 1 1 10 GLU O    O   -7.592 -10.056 -12.863 1.00 . A A .  10 GLU O    1 1 
       10  5933 1 1 10 GLU OE1  O   -6.834  -8.181 -15.333 1.00 . A A .  10 GLU OE1  1 1 
       10  5934 1 1 10 GLU OE2  O   -8.591  -9.502 -15.334 1.00 . A A .  10 GLU OE2  1 1 
       10  5935 1 1 11 LYS C    C   -6.831  -6.734 -11.734 1.00 . A A .  11 LYS C    1 1 
       10  5936 1 1 11 LYS CA   C   -6.812  -8.102 -11.059 1.00 . A A .  11 LYS CA   1 1 
       10  5937 1 1 11 LYS CB   C   -6.372  -7.956  -9.601 1.00 . A A .  11 LYS CB   1 1 
       10  5938 1 1 11 LYS CD   C   -6.438  -8.918  -7.281 1.00 . A A .  11 LYS CD   1 1 
       10  5939 1 1 11 LYS CE   C   -6.126 -10.190  -6.507 1.00 . A A .  11 LYS CE   1 1 
       10  5940 1 1 11 LYS CG   C   -6.620  -9.199  -8.763 1.00 . A A .  11 LYS CG   1 1 
       10  5941 1 1 11 LYS H    H   -4.958  -8.963 -11.609 1.00 . A A .  11 LYS H    1 1 
       10  5942 1 1 11 LYS HA   H   -7.808  -8.517 -11.086 1.00 . A A .  11 LYS HA   1 1 
       10  5943 1 1 11 LYS HB2  H   -5.315  -7.736  -9.576 1.00 . A A .  11 LYS HB2  1 1 
       10  5944 1 1 11 LYS HB3  H   -6.913  -7.134  -9.155 1.00 . A A .  11 LYS HB3  1 1 
       10  5945 1 1 11 LYS HD2  H   -5.622  -8.223  -7.153 1.00 . A A .  11 LYS HD2  1 1 
       10  5946 1 1 11 LYS HD3  H   -7.349  -8.484  -6.891 1.00 . A A .  11 LYS HD3  1 1 
       10  5947 1 1 11 LYS HE2  H   -6.338 -10.021  -5.463 1.00 . A A .  11 LYS HE2  1 1 
       10  5948 1 1 11 LYS HE3  H   -6.756 -10.985  -6.878 1.00 . A A .  11 LYS HE3  1 1 
       10  5949 1 1 11 LYS HG2  H   -7.631  -9.540  -8.932 1.00 . A A .  11 LYS HG2  1 1 
       10  5950 1 1 11 LYS HG3  H   -5.923  -9.969  -9.063 1.00 . A A .  11 LYS HG3  1 1 
       10  5951 1 1 11 LYS HZ1  H   -4.081  -9.883  -6.212 1.00 . A A .  11 LYS HZ1  1 1 
       10  5952 1 1 11 LYS HZ2  H   -4.453 -10.673  -7.661 1.00 . A A .  11 LYS HZ2  1 1 
       10  5953 1 1 11 LYS HZ3  H   -4.539 -11.511  -6.195 1.00 . A A .  11 LYS HZ3  1 1 
       10  5954 1 1 11 LYS N    N   -5.925  -9.018 -11.765 1.00 . A A .  11 LYS N    1 1 
       10  5955 1 1 11 LYS NZ   N   -4.700 -10.592  -6.654 1.00 . A A .  11 LYS NZ   1 1 
       10  5956 1 1 11 LYS O    O   -5.820  -6.255 -12.248 1.00 . A A .  11 LYS O    1 1 
       10  5957 1 1 12 PRO C    C   -7.472  -3.670 -11.559 1.00 . A A .  12 PRO C    1 1 
       10  5958 1 1 12 PRO CA   C   -8.185  -4.767 -12.341 1.00 . A A .  12 PRO CA   1 1 
       10  5959 1 1 12 PRO CB   C   -9.701  -4.557 -12.297 1.00 . A A .  12 PRO CB   1 1 
       10  5960 1 1 12 PRO CD   C   -9.254  -6.602 -11.141 1.00 . A A .  12 PRO CD   1 1 
       10  5961 1 1 12 PRO CG   C  -10.168  -5.407 -11.166 1.00 . A A .  12 PRO CG   1 1 
       10  5962 1 1 12 PRO HA   H   -7.848  -4.753 -13.368 1.00 . A A .  12 PRO HA   1 1 
       10  5963 1 1 12 PRO HB2  H   -9.917  -3.513 -12.122 1.00 . A A .  12 PRO HB2  1 1 
       10  5964 1 1 12 PRO HB3  H  -10.139  -4.870 -13.233 1.00 . A A .  12 PRO HB3  1 1 
       10  5965 1 1 12 PRO HD2  H   -9.091  -6.931 -10.125 1.00 . A A .  12 PRO HD2  1 1 
       10  5966 1 1 12 PRO HD3  H   -9.664  -7.403 -11.738 1.00 . A A .  12 PRO HD3  1 1 
       10  5967 1 1 12 PRO HG2  H  -10.094  -4.859 -10.239 1.00 . A A .  12 PRO HG2  1 1 
       10  5968 1 1 12 PRO HG3  H  -11.187  -5.720 -11.339 1.00 . A A .  12 PRO HG3  1 1 
       10  5969 1 1 12 PRO N    N   -8.007  -6.089 -11.734 1.00 . A A .  12 PRO N    1 1 
       10  5970 1 1 12 PRO O    O   -7.216  -2.586 -12.085 1.00 . A A .  12 PRO O    1 1 
       10  5971 1 1 13 TYR C    C   -5.314  -3.650  -8.701 1.00 . A A .  13 TYR C    1 1 
       10  5972 1 1 13 TYR CA   C   -6.471  -2.993  -9.447 1.00 . A A .  13 TYR CA   1 1 
       10  5973 1 1 13 TYR CB   C   -7.454  -2.380  -8.449 1.00 . A A .  13 TYR CB   1 1 
       10  5974 1 1 13 TYR CD1  C   -8.557  -0.482  -9.698 1.00 . A A .  13 TYR CD1  1 1 
       10  5975 1 1 13 TYR CD2  C   -9.888  -2.374  -9.122 1.00 . A A .  13 TYR CD2  1 1 
       10  5976 1 1 13 TYR CE1  C   -9.652   0.112 -10.295 1.00 . A A .  13 TYR CE1  1 1 
       10  5977 1 1 13 TYR CE2  C  -10.988  -1.788  -9.717 1.00 . A A .  13 TYR CE2  1 1 
       10  5978 1 1 13 TYR CG   C   -8.655  -1.733  -9.101 1.00 . A A .  13 TYR CG   1 1 
       10  5979 1 1 13 TYR CZ   C  -10.865  -0.544 -10.302 1.00 . A A .  13 TYR CZ   1 1 
       10  5980 1 1 13 TYR H    H   -7.383  -4.838  -9.940 1.00 . A A .  13 TYR H    1 1 
       10  5981 1 1 13 TYR HA   H   -6.078  -2.209 -10.078 1.00 . A A .  13 TYR HA   1 1 
       10  5982 1 1 13 TYR HB2  H   -7.813  -3.152  -7.787 1.00 . A A .  13 TYR HB2  1 1 
       10  5983 1 1 13 TYR HB3  H   -6.944  -1.624  -7.870 1.00 . A A .  13 TYR HB3  1 1 
       10  5984 1 1 13 TYR HD1  H   -7.605   0.029  -9.691 1.00 . A A .  13 TYR HD1  1 1 
       10  5985 1 1 13 TYR HD2  H   -9.981  -3.348  -8.663 1.00 . A A .  13 TYR HD2  1 1 
       10  5986 1 1 13 TYR HE1  H   -9.556   1.085 -10.753 1.00 . A A .  13 TYR HE1  1 1 
       10  5987 1 1 13 TYR HE2  H  -11.938  -2.301  -9.723 1.00 . A A .  13 TYR HE2  1 1 
       10  5988 1 1 13 TYR HH   H  -12.321   0.711 -10.309 1.00 . A A .  13 TYR HH   1 1 
       10  5989 1 1 13 TYR N    N   -7.153  -3.957 -10.302 1.00 . A A .  13 TYR N    1 1 
       10  5990 1 1 13 TYR O    O   -5.426  -3.967  -7.517 1.00 . A A .  13 TYR O    1 1 
       10  5991 1 1 13 TYR OH   O  -11.958   0.044 -10.896 1.00 . A A .  13 TYR OH   1 1 
       10  5992 1 1 14 GLN C    C   -1.786  -3.610  -9.030 1.00 . A A .  14 GLN C    1 1 
       10  5993 1 1 14 GLN CA   C   -3.026  -4.471  -8.807 1.00 . A A .  14 GLN CA   1 1 
       10  5994 1 1 14 GLN CB   C   -2.805  -5.866  -9.393 1.00 . A A .  14 GLN CB   1 1 
       10  5995 1 1 14 GLN CD   C   -0.369  -6.094 -10.021 1.00 . A A .  14 GLN CD   1 1 
       10  5996 1 1 14 GLN CG   C   -1.457  -6.470  -9.036 1.00 . A A .  14 GLN CG   1 1 
       10  5997 1 1 14 GLN H    H   -4.176  -3.577 -10.342 1.00 . A A .  14 GLN H    1 1 
       10  5998 1 1 14 GLN HA   H   -3.199  -4.560  -7.745 1.00 . A A .  14 GLN HA   1 1 
       10  5999 1 1 14 GLN HB2  H   -3.579  -6.524  -9.027 1.00 . A A .  14 GLN HB2  1 1 
       10  6000 1 1 14 GLN HB3  H   -2.874  -5.806 -10.469 1.00 . A A .  14 GLN HB3  1 1 
       10  6001 1 1 14 GLN HE21 H    1.024  -6.806  -8.794 1.00 . A A .  14 GLN HE21 1 1 
       10  6002 1 1 14 GLN HE22 H    1.601  -6.144 -10.281 1.00 . A A .  14 GLN HE22 1 1 
       10  6003 1 1 14 GLN HG2  H   -1.169  -6.121  -8.055 1.00 . A A .  14 GLN HG2  1 1 
       10  6004 1 1 14 GLN HG3  H   -1.552  -7.546  -9.020 1.00 . A A .  14 GLN HG3  1 1 
       10  6005 1 1 14 GLN N    N   -4.204  -3.851  -9.402 1.00 . A A .  14 GLN N    1 1 
       10  6006 1 1 14 GLN NE2  N    0.879  -6.376  -9.663 1.00 . A A .  14 GLN NE2  1 1 
       10  6007 1 1 14 GLN O    O   -1.372  -3.384 -10.168 1.00 . A A .  14 GLN O    1 1 
       10  6008 1 1 14 GLN OE1  O   -0.645  -5.555 -11.093 1.00 . A A .  14 GLN OE1  1 1 
       10  6009 1 1 15 CYS C    C    1.189  -3.099  -8.520 1.00 . A A .  15 CYS C    1 1 
       10  6010 1 1 15 CYS CA   C   -0.007  -2.297  -8.014 1.00 . A A .  15 CYS CA   1 1 
       10  6011 1 1 15 CYS CB   C    0.310  -1.699  -6.642 1.00 . A A .  15 CYS CB   1 1 
       10  6012 1 1 15 CYS H    H   -1.575  -3.349  -7.059 1.00 . A A .  15 CYS H    1 1 
       10  6013 1 1 15 CYS HA   H   -0.207  -1.496  -8.709 1.00 . A A .  15 CYS HA   1 1 
       10  6014 1 1 15 CYS HB2  H   -0.507  -1.062  -6.339 1.00 . A A .  15 CYS HB2  1 1 
       10  6015 1 1 15 CYS HB3  H    0.422  -2.499  -5.926 1.00 . A A .  15 CYS HB3  1 1 
       10  6016 1 1 15 CYS N    N   -1.198  -3.133  -7.938 1.00 . A A .  15 CYS N    1 1 
       10  6017 1 1 15 CYS O    O    1.681  -3.998  -7.838 1.00 . A A .  15 CYS O    1 1 
       10  6018 1 1 15 CYS SG   S    1.834  -0.700  -6.601 1.00 . A A .  15 CYS SG   1 1 
       10  6019 1 1 16 SER C    C    4.092  -3.050  -9.641 1.00 . A A .  16 SER C    1 1 
       10  6020 1 1 16 SER CA   C    2.788  -3.457 -10.321 1.00 . A A .  16 SER CA   1 1 
       10  6021 1 1 16 SER CB   C    2.864  -3.152 -11.818 1.00 . A A .  16 SER CB   1 1 
       10  6022 1 1 16 SER H    H    1.218  -2.040 -10.216 1.00 . A A .  16 SER H    1 1 
       10  6023 1 1 16 SER HA   H    2.640  -4.518 -10.185 1.00 . A A .  16 SER HA   1 1 
       10  6024 1 1 16 SER HB2  H    1.873  -3.194 -12.242 1.00 . A A .  16 SER HB2  1 1 
       10  6025 1 1 16 SER HB3  H    3.276  -2.164 -11.961 1.00 . A A .  16 SER HB3  1 1 
       10  6026 1 1 16 SER HG   H    3.509  -4.058 -13.431 1.00 . A A .  16 SER HG   1 1 
       10  6027 1 1 16 SER N    N    1.652  -2.766  -9.721 1.00 . A A .  16 SER N    1 1 
       10  6028 1 1 16 SER O    O    4.976  -3.879  -9.426 1.00 . A A .  16 SER O    1 1 
       10  6029 1 1 16 SER OG   O    3.687  -4.092 -12.488 1.00 . A A .  16 SER OG   1 1 
       10  6030 1 1 17 GLU C    C    5.958  -2.268  -7.659 1.00 . A A .  17 GLU C    1 1 
       10  6031 1 1 17 GLU CA   C    5.398  -1.252  -8.650 1.00 . A A .  17 GLU CA   1 1 
       10  6032 1 1 17 GLU CB   C    5.085   0.060  -7.928 1.00 . A A .  17 GLU CB   1 1 
       10  6033 1 1 17 GLU CD   C    5.374   1.425 -10.034 1.00 . A A .  17 GLU CD   1 1 
       10  6034 1 1 17 GLU CG   C    4.495   1.128  -8.835 1.00 . A A .  17 GLU CG   1 1 
       10  6035 1 1 17 GLU H    H    3.463  -1.157  -9.503 1.00 . A A .  17 GLU H    1 1 
       10  6036 1 1 17 GLU HA   H    6.139  -1.065  -9.412 1.00 . A A .  17 GLU HA   1 1 
       10  6037 1 1 17 GLU HB2  H    4.380  -0.138  -7.134 1.00 . A A .  17 GLU HB2  1 1 
       10  6038 1 1 17 GLU HB3  H    5.997   0.447  -7.498 1.00 . A A .  17 GLU HB3  1 1 
       10  6039 1 1 17 GLU HG2  H    3.532   0.790  -9.188 1.00 . A A .  17 GLU HG2  1 1 
       10  6040 1 1 17 GLU HG3  H    4.369   2.037  -8.265 1.00 . A A .  17 GLU HG3  1 1 
       10  6041 1 1 17 GLU N    N    4.202  -1.769  -9.305 1.00 . A A .  17 GLU N    1 1 
       10  6042 1 1 17 GLU O    O    7.130  -2.640  -7.729 1.00 . A A .  17 GLU O    1 1 
       10  6043 1 1 17 GLU OE1  O    6.600   1.206  -9.941 1.00 . A A .  17 GLU OE1  1 1 
       10  6044 1 1 17 GLU OE2  O    4.835   1.876 -11.067 1.00 . A A .  17 GLU OE2  1 1 
       10  6045 1 1 18 CYS C    C    4.800  -5.016  -5.933 1.00 . A A .  18 CYS C    1 1 
       10  6046 1 1 18 CYS CA   C    5.521  -3.686  -5.729 1.00 . A A .  18 CYS CA   1 1 
       10  6047 1 1 18 CYS CB   C    5.237  -3.149  -4.326 1.00 . A A .  18 CYS CB   1 1 
       10  6048 1 1 18 CYS H    H    4.190  -2.380  -6.731 1.00 . A A .  18 CYS H    1 1 
       10  6049 1 1 18 CYS HA   H    6.583  -3.847  -5.835 1.00 . A A .  18 CYS HA   1 1 
       10  6050 1 1 18 CYS HB2  H    5.557  -3.880  -3.597 1.00 . A A .  18 CYS HB2  1 1 
       10  6051 1 1 18 CYS HB3  H    5.793  -2.235  -4.179 1.00 . A A .  18 CYS HB3  1 1 
       10  6052 1 1 18 CYS N    N    5.113  -2.714  -6.736 1.00 . A A .  18 CYS N    1 1 
       10  6053 1 1 18 CYS O    O    5.419  -6.078  -5.919 1.00 . A A .  18 CYS O    1 1 
       10  6054 1 1 18 CYS SG   S    3.480  -2.787  -4.010 1.00 . A A .  18 CYS SG   1 1 
       10  6055 1 1 19 GLY C    C    1.681  -6.371  -5.227 1.00 . A A .  19 GLY C    1 1 
       10  6056 1 1 19 GLY CA   C    2.702  -6.150  -6.326 1.00 . A A .  19 GLY CA   1 1 
       10  6057 1 1 19 GLY H    H    3.045  -4.071  -6.123 1.00 . A A .  19 GLY H    1 1 
       10  6058 1 1 19 GLY HA2  H    2.186  -6.075  -7.272 1.00 . A A .  19 GLY HA2  1 1 
       10  6059 1 1 19 GLY HA3  H    3.368  -7.000  -6.357 1.00 . A A .  19 GLY HA3  1 1 
       10  6060 1 1 19 GLY N    N    3.486  -4.947  -6.122 1.00 . A A .  19 GLY N    1 1 
       10  6061 1 1 19 GLY O    O    1.802  -7.305  -4.435 1.00 . A A .  19 GLY O    1 1 
       10  6062 1 1 20 LYS C    C   -1.756  -5.577  -4.810 1.00 . A A .  20 LYS C    1 1 
       10  6063 1 1 20 LYS CA   C   -0.374  -5.610  -4.166 1.00 . A A .  20 LYS CA   1 1 
       10  6064 1 1 20 LYS CB   C   -0.245  -4.472  -3.151 1.00 . A A .  20 LYS CB   1 1 
       10  6065 1 1 20 LYS CD   C   -0.003  -5.472  -0.860 1.00 . A A .  20 LYS CD   1 1 
       10  6066 1 1 20 LYS CE   C    0.753  -5.298   0.449 1.00 . A A .  20 LYS CE   1 1 
       10  6067 1 1 20 LYS CG   C    0.709  -4.780  -2.010 1.00 . A A .  20 LYS CG   1 1 
       10  6068 1 1 20 LYS H    H    0.631  -4.782  -5.836 1.00 . A A .  20 LYS H    1 1 
       10  6069 1 1 20 LYS HA   H   -0.250  -6.553  -3.655 1.00 . A A .  20 LYS HA   1 1 
       10  6070 1 1 20 LYS HB2  H    0.110  -3.589  -3.662 1.00 . A A .  20 LYS HB2  1 1 
       10  6071 1 1 20 LYS HB3  H   -1.220  -4.268  -2.732 1.00 . A A .  20 LYS HB3  1 1 
       10  6072 1 1 20 LYS HD2  H   -0.990  -5.047  -0.751 1.00 . A A .  20 LYS HD2  1 1 
       10  6073 1 1 20 LYS HD3  H   -0.085  -6.527  -1.081 1.00 . A A .  20 LYS HD3  1 1 
       10  6074 1 1 20 LYS HE2  H    1.674  -5.858   0.394 1.00 . A A .  20 LYS HE2  1 1 
       10  6075 1 1 20 LYS HE3  H    0.977  -4.250   0.584 1.00 . A A .  20 LYS HE3  1 1 
       10  6076 1 1 20 LYS HG2  H    1.494  -5.426  -2.374 1.00 . A A .  20 LYS HG2  1 1 
       10  6077 1 1 20 LYS HG3  H    1.138  -3.855  -1.652 1.00 . A A .  20 LYS HG3  1 1 
       10  6078 1 1 20 LYS HZ1  H   -1.013  -5.992   1.322 1.00 . A A .  20 LYS HZ1  1 1 
       10  6079 1 1 20 LYS HZ2  H   -0.060  -5.051   2.356 1.00 . A A .  20 LYS HZ2  1 1 
       10  6080 1 1 20 LYS HZ3  H    0.391  -6.643   2.006 1.00 . A A .  20 LYS HZ3  1 1 
       10  6081 1 1 20 LYS N    N    0.673  -5.507  -5.177 1.00 . A A .  20 LYS N    1 1 
       10  6082 1 1 20 LYS NZ   N   -0.038  -5.780   1.615 1.00 . A A .  20 LYS NZ   1 1 
       10  6083 1 1 20 LYS O    O   -1.896  -5.247  -5.988 1.00 . A A .  20 LYS O    1 1 
       10  6084 1 1 21 SER C    C   -5.103  -5.345  -3.490 1.00 . A A .  21 SER C    1 1 
       10  6085 1 1 21 SER CA   C   -4.148  -5.932  -4.524 1.00 . A A .  21 SER CA   1 1 
       10  6086 1 1 21 SER CB   C   -4.573  -7.359  -4.876 1.00 . A A .  21 SER CB   1 1 
       10  6087 1 1 21 SER H    H   -2.601  -6.174  -3.099 1.00 . A A .  21 SER H    1 1 
       10  6088 1 1 21 SER HA   H   -4.183  -5.325  -5.416 1.00 . A A .  21 SER HA   1 1 
       10  6089 1 1 21 SER HB2  H   -4.077  -7.666  -5.784 1.00 . A A .  21 SER HB2  1 1 
       10  6090 1 1 21 SER HB3  H   -4.294  -8.024  -4.071 1.00 . A A .  21 SER HB3  1 1 
       10  6091 1 1 21 SER HG   H   -6.363  -7.978  -4.376 1.00 . A A .  21 SER HG   1 1 
       10  6092 1 1 21 SER N    N   -2.776  -5.920  -4.029 1.00 . A A .  21 SER N    1 1 
       10  6093 1 1 21 SER O    O   -5.015  -5.653  -2.301 1.00 . A A .  21 SER O    1 1 
       10  6094 1 1 21 SER OG   O   -5.974  -7.440  -5.070 1.00 . A A .  21 SER OG   1 1 
       10  6095 1 1 22 PHE C    C   -8.376  -3.854  -3.705 1.00 . A A .  22 PHE C    1 1 
       10  6096 1 1 22 PHE CA   C   -6.989  -3.865  -3.068 1.00 . A A .  22 PHE CA   1 1 
       10  6097 1 1 22 PHE CB   C   -6.556  -2.435  -2.738 1.00 . A A .  22 PHE CB   1 1 
       10  6098 1 1 22 PHE CD1  C   -5.113  -2.597  -0.691 1.00 . A A .  22 PHE CD1  1 1 
       10  6099 1 1 22 PHE CD2  C   -4.078  -2.042  -2.766 1.00 . A A .  22 PHE CD2  1 1 
       10  6100 1 1 22 PHE CE1  C   -3.888  -2.525  -0.057 1.00 . A A .  22 PHE CE1  1 1 
       10  6101 1 1 22 PHE CE2  C   -2.849  -1.968  -2.137 1.00 . A A .  22 PHE CE2  1 1 
       10  6102 1 1 22 PHE CG   C   -5.223  -2.356  -2.051 1.00 . A A .  22 PHE CG   1 1 
       10  6103 1 1 22 PHE CZ   C   -2.754  -2.211  -0.781 1.00 . A A .  22 PHE CZ   1 1 
       10  6104 1 1 22 PHE H    H   -6.037  -4.292  -4.910 1.00 . A A .  22 PHE H    1 1 
       10  6105 1 1 22 PHE HA   H   -7.029  -4.440  -2.156 1.00 . A A .  22 PHE HA   1 1 
       10  6106 1 1 22 PHE HB2  H   -6.492  -1.866  -3.653 1.00 . A A .  22 PHE HB2  1 1 
       10  6107 1 1 22 PHE HB3  H   -7.292  -1.985  -2.089 1.00 . A A .  22 PHE HB3  1 1 
       10  6108 1 1 22 PHE HD1  H   -5.999  -2.844  -0.124 1.00 . A A .  22 PHE HD1  1 1 
       10  6109 1 1 22 PHE HD2  H   -4.152  -1.852  -3.828 1.00 . A A .  22 PHE HD2  1 1 
       10  6110 1 1 22 PHE HE1  H   -3.816  -2.715   1.003 1.00 . A A .  22 PHE HE1  1 1 
       10  6111 1 1 22 PHE HE2  H   -1.965  -1.722  -2.707 1.00 . A A .  22 PHE HE2  1 1 
       10  6112 1 1 22 PHE HZ   H   -1.795  -2.153  -0.288 1.00 . A A .  22 PHE HZ   1 1 
       10  6113 1 1 22 PHE N    N   -6.017  -4.497  -3.952 1.00 . A A .  22 PHE N    1 1 
       10  6114 1 1 22 PHE O    O   -8.542  -4.233  -4.864 1.00 . A A .  22 PHE O    1 1 
       10  6115 1 1 23 SER C    C  -11.182  -1.918  -3.647 1.00 . A A .  23 SER C    1 1 
       10  6116 1 1 23 SER CA   C  -10.743  -3.362  -3.423 1.00 . A A .  23 SER CA   1 1 
       10  6117 1 1 23 SER CB   C  -11.686  -4.046  -2.431 1.00 . A A .  23 SER CB   1 1 
       10  6118 1 1 23 SER H    H   -9.174  -3.130  -2.020 1.00 . A A .  23 SER H    1 1 
       10  6119 1 1 23 SER HA   H  -10.783  -3.888  -4.365 1.00 . A A .  23 SER HA   1 1 
       10  6120 1 1 23 SER HB2  H  -12.691  -4.030  -2.824 1.00 . A A .  23 SER HB2  1 1 
       10  6121 1 1 23 SER HB3  H  -11.372  -5.069  -2.286 1.00 . A A .  23 SER HB3  1 1 
       10  6122 1 1 23 SER HG   H  -12.364  -2.714  -1.164 1.00 . A A .  23 SER HG   1 1 
       10  6123 1 1 23 SER N    N   -9.370  -3.418  -2.937 1.00 . A A .  23 SER N    1 1 
       10  6124 1 1 23 SER O    O  -11.829  -1.315  -2.792 1.00 . A A .  23 SER O    1 1 
       10  6125 1 1 23 SER OG   O  -11.676  -3.383  -1.178 1.00 . A A .  23 SER OG   1 1 
       10  6126 1 1 24 GLY C    C   -9.995   0.832  -5.549 1.00 . A A .  24 GLY C    1 1 
       10  6127 1 1 24 GLY CA   C  -11.187  -0.001  -5.120 1.00 . A A .  24 GLY CA   1 1 
       10  6128 1 1 24 GLY H    H  -10.307  -1.899  -5.447 1.00 . A A .  24 GLY H    1 1 
       10  6129 1 1 24 GLY HA2  H  -11.913  -0.009  -5.919 1.00 . A A .  24 GLY HA2  1 1 
       10  6130 1 1 24 GLY HA3  H  -11.632   0.452  -4.246 1.00 . A A .  24 GLY HA3  1 1 
       10  6131 1 1 24 GLY N    N  -10.823  -1.370  -4.804 1.00 . A A .  24 GLY N    1 1 
       10  6132 1 1 24 GLY O    O   -8.884   0.638  -5.055 1.00 . A A .  24 GLY O    1 1 
       10  6133 1 1 25 SER C    C   -8.701   3.599  -5.893 1.00 . A A .  25 SER C    1 1 
       10  6134 1 1 25 SER CA   C   -9.159   2.622  -6.971 1.00 . A A .  25 SER CA   1 1 
       10  6135 1 1 25 SER CB   C   -9.634   3.391  -8.205 1.00 . A A .  25 SER CB   1 1 
       10  6136 1 1 25 SER H    H  -11.132   1.866  -6.827 1.00 . A A .  25 SER H    1 1 
       10  6137 1 1 25 SER HA   H   -8.327   1.992  -7.248 1.00 . A A .  25 SER HA   1 1 
       10  6138 1 1 25 SER HB2  H   -9.008   4.259  -8.348 1.00 . A A .  25 SER HB2  1 1 
       10  6139 1 1 25 SER HB3  H   -9.565   2.752  -9.073 1.00 . A A .  25 SER HB3  1 1 
       10  6140 1 1 25 SER HG   H  -11.154   3.999  -7.130 1.00 . A A .  25 SER HG   1 1 
       10  6141 1 1 25 SER N    N  -10.225   1.760  -6.472 1.00 . A A .  25 SER N    1 1 
       10  6142 1 1 25 SER O    O   -7.637   4.209  -6.004 1.00 . A A .  25 SER O    1 1 
       10  6143 1 1 25 SER OG   O  -10.977   3.817  -8.056 1.00 . A A .  25 SER OG   1 1 
       10  6144 1 1 26 TYR C    C   -8.109   4.054  -2.856 1.00 . A A .  26 TYR C    1 1 
       10  6145 1 1 26 TYR CA   C   -9.191   4.647  -3.753 1.00 . A A .  26 TYR CA   1 1 
       10  6146 1 1 26 TYR CB   C  -10.445   4.946  -2.929 1.00 . A A .  26 TYR CB   1 1 
       10  6147 1 1 26 TYR CD1  C   -9.935   7.054  -1.636 1.00 . A A .  26 TYR CD1  1 1 
       10  6148 1 1 26 TYR CD2  C  -10.117   5.009  -0.426 1.00 . A A .  26 TYR CD2  1 1 
       10  6149 1 1 26 TYR CE1  C   -9.674   7.732  -0.460 1.00 . A A .  26 TYR CE1  1 1 
       10  6150 1 1 26 TYR CE2  C   -9.858   5.678   0.754 1.00 . A A .  26 TYR CE2  1 1 
       10  6151 1 1 26 TYR CG   C  -10.161   5.683  -1.640 1.00 . A A .  26 TYR CG   1 1 
       10  6152 1 1 26 TYR CZ   C   -9.637   7.040   0.732 1.00 . A A .  26 TYR CZ   1 1 
       10  6153 1 1 26 TYR H    H  -10.345   3.229  -4.819 1.00 . A A .  26 TYR H    1 1 
       10  6154 1 1 26 TYR HA   H   -8.824   5.569  -4.179 1.00 . A A .  26 TYR HA   1 1 
       10  6155 1 1 26 TYR HB2  H  -11.117   5.553  -3.516 1.00 . A A .  26 TYR HB2  1 1 
       10  6156 1 1 26 TYR HB3  H  -10.933   4.016  -2.679 1.00 . A A .  26 TYR HB3  1 1 
       10  6157 1 1 26 TYR HD1  H   -9.964   7.594  -2.571 1.00 . A A .  26 TYR HD1  1 1 
       10  6158 1 1 26 TYR HD2  H  -10.290   3.942  -0.412 1.00 . A A .  26 TYR HD2  1 1 
       10  6159 1 1 26 TYR HE1  H   -9.501   8.798  -0.477 1.00 . A A .  26 TYR HE1  1 1 
       10  6160 1 1 26 TYR HE2  H   -9.829   5.136   1.688 1.00 . A A .  26 TYR HE2  1 1 
       10  6161 1 1 26 TYR HH   H  -10.167   7.715   2.452 1.00 . A A .  26 TYR HH   1 1 
       10  6162 1 1 26 TYR N    N   -9.511   3.742  -4.850 1.00 . A A .  26 TYR N    1 1 
       10  6163 1 1 26 TYR O    O   -7.199   4.756  -2.415 1.00 . A A .  26 TYR O    1 1 
       10  6164 1 1 26 TYR OH   O   -9.378   7.710   1.905 1.00 . A A .  26 TYR OH   1 1 
       10  6165 1 1 27 ARG C    C   -5.910   1.914  -2.464 1.00 . A A .  27 ARG C    1 1 
       10  6166 1 1 27 ARG CA   C   -7.248   2.067  -1.745 1.00 . A A .  27 ARG CA   1 1 
       10  6167 1 1 27 ARG CB   C   -7.781   0.692  -1.339 1.00 . A A .  27 ARG CB   1 1 
       10  6168 1 1 27 ARG CD   C   -7.628   0.739   1.169 1.00 . A A .  27 ARG CD   1 1 
       10  6169 1 1 27 ARG CG   C   -7.098   0.112  -0.111 1.00 . A A .  27 ARG CG   1 1 
       10  6170 1 1 27 ARG CZ   C   -7.590   2.970   2.200 1.00 . A A .  27 ARG CZ   1 1 
       10  6171 1 1 27 ARG H    H   -8.964   2.250  -2.970 1.00 . A A .  27 ARG H    1 1 
       10  6172 1 1 27 ARG HA   H   -7.099   2.662  -0.857 1.00 . A A .  27 ARG HA   1 1 
       10  6173 1 1 27 ARG HB2  H   -8.837   0.775  -1.131 1.00 . A A .  27 ARG HB2  1 1 
       10  6174 1 1 27 ARG HB3  H   -7.637   0.007  -2.161 1.00 . A A .  27 ARG HB3  1 1 
       10  6175 1 1 27 ARG HD2  H   -8.698   0.853   1.082 1.00 . A A .  27 ARG HD2  1 1 
       10  6176 1 1 27 ARG HD3  H   -7.402   0.082   1.995 1.00 . A A .  27 ARG HD3  1 1 
       10  6177 1 1 27 ARG HE   H   -6.173   2.247   0.997 1.00 . A A .  27 ARG HE   1 1 
       10  6178 1 1 27 ARG HG2  H   -7.278  -0.952  -0.079 1.00 . A A .  27 ARG HG2  1 1 
       10  6179 1 1 27 ARG HG3  H   -6.036   0.297  -0.180 1.00 . A A .  27 ARG HG3  1 1 
       10  6180 1 1 27 ARG HH11 H   -9.209   1.850   2.655 1.00 . A A .  27 ARG HH11 1 1 
       10  6181 1 1 27 ARG HH12 H   -9.170   3.426   3.376 1.00 . A A .  27 ARG HH12 1 1 
       10  6182 1 1 27 ARG HH21 H   -6.110   4.323   1.940 1.00 . A A .  27 ARG HH21 1 1 
       10  6183 1 1 27 ARG HH22 H   -7.407   4.831   2.968 1.00 . A A .  27 ARG HH22 1 1 
       10  6184 1 1 27 ARG N    N   -8.216   2.756  -2.590 1.00 . A A .  27 ARG N    1 1 
       10  6185 1 1 27 ARG NE   N   -7.032   2.047   1.425 1.00 . A A .  27 ARG NE   1 1 
       10  6186 1 1 27 ARG NH1  N   -8.752   2.729   2.792 1.00 . A A .  27 ARG NH1  1 1 
       10  6187 1 1 27 ARG NH2  N   -6.986   4.137   2.385 1.00 . A A .  27 ARG NH2  1 1 
       10  6188 1 1 27 ARG O    O   -4.851   2.163  -1.887 1.00 . A A .  27 ARG O    1 1 
       10  6189 1 1 28 LEU C    C   -3.965   2.615  -4.622 1.00 . A A .  28 LEU C    1 1 
       10  6190 1 1 28 LEU CA   C   -4.761   1.317  -4.525 1.00 . A A .  28 LEU CA   1 1 
       10  6191 1 1 28 LEU CB   C   -5.124   0.822  -5.926 1.00 . A A .  28 LEU CB   1 1 
       10  6192 1 1 28 LEU CD1  C   -3.566  -0.991  -6.679 1.00 . A A .  28 LEU CD1  1 1 
       10  6193 1 1 28 LEU CD2  C   -4.292   0.778  -8.291 1.00 . A A .  28 LEU CD2  1 1 
       10  6194 1 1 28 LEU CG   C   -3.949   0.471  -6.840 1.00 . A A .  28 LEU CG   1 1 
       10  6195 1 1 28 LEU H    H   -6.840   1.321  -4.132 1.00 . A A .  28 LEU H    1 1 
       10  6196 1 1 28 LEU HA   H   -4.152   0.571  -4.036 1.00 . A A .  28 LEU HA   1 1 
       10  6197 1 1 28 LEU HB2  H   -5.733  -0.062  -5.817 1.00 . A A .  28 LEU HB2  1 1 
       10  6198 1 1 28 LEU HB3  H   -5.701   1.597  -6.410 1.00 . A A .  28 LEU HB3  1 1 
       10  6199 1 1 28 LEU HD11 H   -3.921  -1.552  -7.530 1.00 . A A .  28 LEU HD11 1 1 
       10  6200 1 1 28 LEU HD12 H   -4.013  -1.384  -5.777 1.00 . A A .  28 LEU HD12 1 1 
       10  6201 1 1 28 LEU HD13 H   -2.491  -1.077  -6.613 1.00 . A A .  28 LEU HD13 1 1 
       10  6202 1 1 28 LEU HD21 H   -4.602  -0.129  -8.787 1.00 . A A .  28 LEU HD21 1 1 
       10  6203 1 1 28 LEU HD22 H   -3.422   1.181  -8.788 1.00 . A A .  28 LEU HD22 1 1 
       10  6204 1 1 28 LEU HD23 H   -5.094   1.501  -8.326 1.00 . A A .  28 LEU HD23 1 1 
       10  6205 1 1 28 LEU HG   H   -3.094   1.072  -6.563 1.00 . A A .  28 LEU HG   1 1 
       10  6206 1 1 28 LEU N    N   -5.967   1.503  -3.726 1.00 . A A .  28 LEU N    1 1 
       10  6207 1 1 28 LEU O    O   -2.830   2.697  -4.152 1.00 . A A .  28 LEU O    1 1 
       10  6208 1 1 29 THR C    C   -3.225   5.350  -4.103 1.00 . A A .  29 THR C    1 1 
       10  6209 1 1 29 THR CA   C   -3.919   4.923  -5.391 1.00 . A A .  29 THR CA   1 1 
       10  6210 1 1 29 THR CB   C   -4.927   6.013  -5.802 1.00 . A A .  29 THR CB   1 1 
       10  6211 1 1 29 THR CG2  C   -5.306   5.873  -7.269 1.00 . A A .  29 THR CG2  1 1 
       10  6212 1 1 29 THR H    H   -5.475   3.502  -5.587 1.00 . A A .  29 THR H    1 1 
       10  6213 1 1 29 THR HA   H   -3.180   4.832  -6.174 1.00 . A A .  29 THR HA   1 1 
       10  6214 1 1 29 THR HB   H   -4.470   6.980  -5.654 1.00 . A A .  29 THR HB   1 1 
       10  6215 1 1 29 THR HG1  H   -6.857   6.263  -5.479 1.00 . A A .  29 THR HG1  1 1 
       10  6216 1 1 29 THR HG21 H   -4.754   5.056  -7.707 1.00 . A A .  29 THR HG21 1 1 
       10  6217 1 1 29 THR HG22 H   -5.067   6.788  -7.791 1.00 . A A .  29 THR HG22 1 1 
       10  6218 1 1 29 THR HG23 H   -6.365   5.678  -7.350 1.00 . A A .  29 THR HG23 1 1 
       10  6219 1 1 29 THR N    N   -4.570   3.629  -5.233 1.00 . A A .  29 THR N    1 1 
       10  6220 1 1 29 THR O    O   -2.010   5.549  -4.079 1.00 . A A .  29 THR O    1 1 
       10  6221 1 1 29 THR OG1  O   -6.104   5.923  -4.990 1.00 . A A .  29 THR OG1  1 1 
       10  6222 1 1 30 GLN C    C   -2.236   5.058  -1.381 1.00 . A A .  30 GLN C    1 1 
       10  6223 1 1 30 GLN CA   C   -3.461   5.892  -1.742 1.00 . A A .  30 GLN CA   1 1 
       10  6224 1 1 30 GLN CB   C   -4.526   5.753  -0.653 1.00 . A A .  30 GLN CB   1 1 
       10  6225 1 1 30 GLN CD   C   -5.345   8.142  -0.563 1.00 . A A .  30 GLN CD   1 1 
       10  6226 1 1 30 GLN CG   C   -5.706   6.694  -0.832 1.00 . A A .  30 GLN CG   1 1 
       10  6227 1 1 30 GLN H    H   -4.963   5.316  -3.117 1.00 . A A .  30 GLN H    1 1 
       10  6228 1 1 30 GLN HA   H   -3.167   6.928  -1.815 1.00 . A A .  30 GLN HA   1 1 
       10  6229 1 1 30 GLN HB2  H   -4.897   4.740  -0.656 1.00 . A A .  30 GLN HB2  1 1 
       10  6230 1 1 30 GLN HB3  H   -4.072   5.959   0.306 1.00 . A A .  30 GLN HB3  1 1 
       10  6231 1 1 30 GLN HE21 H   -6.962   8.359   0.574 1.00 . A A .  30 GLN HE21 1 1 
       10  6232 1 1 30 GLN HE22 H   -5.965   9.760   0.411 1.00 . A A .  30 GLN HE22 1 1 
       10  6233 1 1 30 GLN HG2  H   -6.064   6.613  -1.848 1.00 . A A .  30 GLN HG2  1 1 
       10  6234 1 1 30 GLN HG3  H   -6.491   6.401  -0.150 1.00 . A A .  30 GLN HG3  1 1 
       10  6235 1 1 30 GLN N    N   -4.003   5.489  -3.034 1.00 . A A .  30 GLN N    1 1 
       10  6236 1 1 30 GLN NE2  N   -6.174   8.823   0.219 1.00 . A A .  30 GLN NE2  1 1 
       10  6237 1 1 30 GLN O    O   -1.325   5.535  -0.703 1.00 . A A .  30 GLN O    1 1 
       10  6238 1 1 30 GLN OE1  O   -4.331   8.642  -1.051 1.00 . A A .  30 GLN OE1  1 1 
       10  6239 1 1 31 HIS C    C    0.039   3.146  -2.545 1.00 . A A .  31 HIS C    1 1 
       10  6240 1 1 31 HIS CA   C   -1.106   2.910  -1.564 1.00 . A A .  31 HIS CA   1 1 
       10  6241 1 1 31 HIS CB   C   -1.568   1.454  -1.642 1.00 . A A .  31 HIS CB   1 1 
       10  6242 1 1 31 HIS CD2  C    0.143   0.268  -3.189 1.00 . A A .  31 HIS CD2  1 1 
       10  6243 1 1 31 HIS CE1  C    1.035  -1.079  -1.707 1.00 . A A .  31 HIS CE1  1 1 
       10  6244 1 1 31 HIS CG   C   -0.474   0.498  -2.007 1.00 . A A .  31 HIS CG   1 1 
       10  6245 1 1 31 HIS H    H   -2.975   3.488  -2.373 1.00 . A A .  31 HIS H    1 1 
       10  6246 1 1 31 HIS HA   H   -0.754   3.113  -0.564 1.00 . A A .  31 HIS HA   1 1 
       10  6247 1 1 31 HIS HB2  H   -1.962   1.156  -0.682 1.00 . A A .  31 HIS HB2  1 1 
       10  6248 1 1 31 HIS HB3  H   -2.346   1.370  -2.387 1.00 . A A .  31 HIS HB3  1 1 
       10  6249 1 1 31 HIS HD1  H   -0.126  -0.436  -0.150 1.00 . A A .  31 HIS HD1  1 1 
       10  6250 1 1 31 HIS HD2  H   -0.060   0.766  -4.127 1.00 . A A .  31 HIS HD2  1 1 
       10  6251 1 1 31 HIS HE1  H    1.654  -1.834  -1.246 1.00 . A A .  31 HIS HE1  1 1 
       10  6252 1 1 31 HIS N    N   -2.220   3.810  -1.838 1.00 . A A .  31 HIS N    1 1 
       10  6253 1 1 31 HIS ND1  N    0.106  -0.363  -1.099 1.00 . A A .  31 HIS ND1  1 1 
       10  6254 1 1 31 HIS NE2  N    1.077  -0.716  -2.976 1.00 . A A .  31 HIS NE2  1 1 
       10  6255 1 1 31 HIS O    O    1.193   2.836  -2.252 1.00 . A A .  31 HIS O    1 1 
       10  6256 1 1 32 TRP C    C    1.635   5.106  -4.297 1.00 . A A .  32 TRP C    1 1 
       10  6257 1 1 32 TRP CA   C    0.711   3.974  -4.732 1.00 . A A .  32 TRP CA   1 1 
       10  6258 1 1 32 TRP CB   C    0.031   4.333  -6.054 1.00 . A A .  32 TRP CB   1 1 
       10  6259 1 1 32 TRP CD1  C   -0.847   1.975  -6.541 1.00 . A A .  32 TRP CD1  1 1 
       10  6260 1 1 32 TRP CD2  C    0.061   3.003  -8.312 1.00 . A A .  32 TRP CD2  1 1 
       10  6261 1 1 32 TRP CE2  C   -0.378   1.726  -8.710 1.00 . A A .  32 TRP CE2  1 1 
       10  6262 1 1 32 TRP CE3  C    0.665   3.834  -9.259 1.00 . A A .  32 TRP CE3  1 1 
       10  6263 1 1 32 TRP CG   C   -0.248   3.142  -6.921 1.00 . A A .  32 TRP CG   1 1 
       10  6264 1 1 32 TRP CH2  C    0.364   2.096 -10.922 1.00 . A A .  32 TRP CH2  1 1 
       10  6265 1 1 32 TRP CZ2  C   -0.231   1.262 -10.015 1.00 . A A .  32 TRP CZ2  1 1 
       10  6266 1 1 32 TRP CZ3  C    0.811   3.372 -10.553 1.00 . A A .  32 TRP CZ3  1 1 
       10  6267 1 1 32 TRP H    H   -1.228   3.922  -3.882 1.00 . A A .  32 TRP H    1 1 
       10  6268 1 1 32 TRP HA   H    1.298   3.078  -4.871 1.00 . A A .  32 TRP HA   1 1 
       10  6269 1 1 32 TRP HB2  H   -0.909   4.823  -5.848 1.00 . A A .  32 TRP HB2  1 1 
       10  6270 1 1 32 TRP HB3  H    0.670   5.006  -6.607 1.00 . A A .  32 TRP HB3  1 1 
       10  6271 1 1 32 TRP HD1  H   -1.198   1.769  -5.542 1.00 . A A .  32 TRP HD1  1 1 
       10  6272 1 1 32 TRP HE1  H   -1.317   0.219  -7.593 1.00 . A A .  32 TRP HE1  1 1 
       10  6273 1 1 32 TRP HE3  H    1.016   4.820  -8.994 1.00 . A A .  32 TRP HE3  1 1 
       10  6274 1 1 32 TRP HH2  H    0.499   1.777 -11.944 1.00 . A A .  32 TRP HH2  1 1 
       10  6275 1 1 32 TRP HZ2  H   -0.571   0.281 -10.315 1.00 . A A .  32 TRP HZ2  1 1 
       10  6276 1 1 32 TRP HZ3  H    1.276   4.000 -11.299 1.00 . A A .  32 TRP HZ3  1 1 
       10  6277 1 1 32 TRP N    N   -0.290   3.697  -3.707 1.00 . A A .  32 TRP N    1 1 
       10  6278 1 1 32 TRP NE1  N   -0.928   1.118  -7.612 1.00 . A A .  32 TRP NE1  1 1 
       10  6279 1 1 32 TRP O    O    2.858   4.976  -4.352 1.00 . A A .  32 TRP O    1 1 
       10  6280 1 1 33 ILE C    C    3.050   6.935  -2.639 1.00 . A A .  33 ILE C    1 1 
       10  6281 1 1 33 ILE CA   C    1.815   7.369  -3.422 1.00 . A A .  33 ILE CA   1 1 
       10  6282 1 1 33 ILE CB   C    0.968   8.308  -2.543 1.00 . A A .  33 ILE CB   1 1 
       10  6283 1 1 33 ILE CD1  C   -1.423   8.138  -3.397 1.00 . A A .  33 ILE CD1  1 1 
       10  6284 1 1 33 ILE CG1  C   -0.147   8.949  -3.371 1.00 . A A .  33 ILE CG1  1 1 
       10  6285 1 1 33 ILE CG2  C    1.847   9.376  -1.909 1.00 . A A .  33 ILE CG2  1 1 
       10  6286 1 1 33 ILE H    H    0.065   6.258  -3.847 1.00 . A A .  33 ILE H    1 1 
       10  6287 1 1 33 ILE HA   H    2.131   7.916  -4.298 1.00 . A A .  33 ILE HA   1 1 
       10  6288 1 1 33 ILE HB   H    0.527   7.722  -1.750 1.00 . A A .  33 ILE HB   1 1 
       10  6289 1 1 33 ILE HD11 H   -2.250   8.757  -3.076 1.00 . A A .  33 ILE HD11 1 1 
       10  6290 1 1 33 ILE HD12 H   -1.607   7.787  -4.402 1.00 . A A .  33 ILE HD12 1 1 
       10  6291 1 1 33 ILE HD13 H   -1.328   7.294  -2.731 1.00 . A A .  33 ILE HD13 1 1 
       10  6292 1 1 33 ILE HG12 H   -0.379   9.919  -2.960 1.00 . A A .  33 ILE HG12 1 1 
       10  6293 1 1 33 ILE HG13 H    0.194   9.066  -4.390 1.00 . A A .  33 ILE HG13 1 1 
       10  6294 1 1 33 ILE HG21 H    1.223  10.122  -1.439 1.00 . A A .  33 ILE HG21 1 1 
       10  6295 1 1 33 ILE HG22 H    2.486   8.922  -1.166 1.00 . A A .  33 ILE HG22 1 1 
       10  6296 1 1 33 ILE HG23 H    2.454   9.842  -2.671 1.00 . A A .  33 ILE HG23 1 1 
       10  6297 1 1 33 ILE N    N    1.043   6.215  -3.866 1.00 . A A .  33 ILE N    1 1 
       10  6298 1 1 33 ILE O    O    4.100   7.576  -2.708 1.00 . A A .  33 ILE O    1 1 
       10  6299 1 1 34 THR C    C    5.310   5.262  -1.918 1.00 . A A .  34 THR C    1 1 
       10  6300 1 1 34 THR CA   C    4.025   5.320  -1.101 1.00 . A A .  34 THR CA   1 1 
       10  6301 1 1 34 THR CB   C    3.712   3.914  -0.557 1.00 . A A .  34 THR CB   1 1 
       10  6302 1 1 34 THR CG2  C    2.400   3.911   0.214 1.00 . A A .  34 THR CG2  1 1 
       10  6303 1 1 34 THR H    H    2.058   5.374  -1.882 1.00 . A A .  34 THR H    1 1 
       10  6304 1 1 34 THR HA   H    4.173   5.983  -0.261 1.00 . A A .  34 THR HA   1 1 
       10  6305 1 1 34 THR HB   H    4.507   3.618   0.113 1.00 . A A .  34 THR HB   1 1 
       10  6306 1 1 34 THR HG1  H    4.010   2.136  -1.358 1.00 . A A .  34 THR HG1  1 1 
       10  6307 1 1 34 THR HG21 H    1.843   3.019  -0.028 1.00 . A A .  34 THR HG21 1 1 
       10  6308 1 1 34 THR HG22 H    1.822   4.782  -0.057 1.00 . A A .  34 THR HG22 1 1 
       10  6309 1 1 34 THR HG23 H    2.606   3.930   1.274 1.00 . A A .  34 THR HG23 1 1 
       10  6310 1 1 34 THR N    N    2.920   5.841  -1.896 1.00 . A A .  34 THR N    1 1 
       10  6311 1 1 34 THR O    O    6.372   5.679  -1.454 1.00 . A A .  34 THR O    1 1 
       10  6312 1 1 34 THR OG1  O    3.638   2.976  -1.637 1.00 . A A .  34 THR OG1  1 1 
       10  6313 1 1 35 HIS C    C    6.802   6.007  -4.517 1.00 . A A .  35 HIS C    1 1 
       10  6314 1 1 35 HIS CA   C    6.364   4.633  -4.020 1.00 . A A .  35 HIS CA   1 1 
       10  6315 1 1 35 HIS CB   C    6.039   3.727  -5.209 1.00 . A A .  35 HIS CB   1 1 
       10  6316 1 1 35 HIS CD2  C    4.006   2.129  -5.021 1.00 . A A .  35 HIS CD2  1 1 
       10  6317 1 1 35 HIS CE1  C    4.992   0.477  -3.969 1.00 . A A .  35 HIS CE1  1 1 
       10  6318 1 1 35 HIS CG   C    5.298   2.483  -4.829 1.00 . A A .  35 HIS CG   1 1 
       10  6319 1 1 35 HIS H    H    4.335   4.428  -3.451 1.00 . A A .  35 HIS H    1 1 
       10  6320 1 1 35 HIS HA   H    7.172   4.194  -3.455 1.00 . A A .  35 HIS HA   1 1 
       10  6321 1 1 35 HIS HB2  H    5.430   4.274  -5.913 1.00 . A A .  35 HIS HB2  1 1 
       10  6322 1 1 35 HIS HB3  H    6.960   3.432  -5.691 1.00 . A A .  35 HIS HB3  1 1 
       10  6323 1 1 35 HIS HD1  H    6.826   1.381  -3.885 1.00 . A A .  35 HIS HD1  1 1 
       10  6324 1 1 35 HIS HD2  H    3.244   2.719  -5.511 1.00 . A A .  35 HIS HD2  1 1 
       10  6325 1 1 35 HIS HE1  H    5.169  -0.466  -3.475 1.00 . A A .  35 HIS HE1  1 1 
       10  6326 1 1 35 HIS N    N    5.208   4.743  -3.138 1.00 . A A .  35 HIS N    1 1 
       10  6327 1 1 35 HIS ND1  N    5.888   1.427  -4.167 1.00 . A A .  35 HIS ND1  1 1 
       10  6328 1 1 35 HIS NE2  N    3.841   0.878  -4.477 1.00 . A A .  35 HIS NE2  1 1 
       10  6329 1 1 35 HIS O    O    7.996   6.286  -4.633 1.00 . A A .  35 HIS O    1 1 
       10  6330 1 1 36 THR C    C    7.050   8.947  -4.350 1.00 . A A .  36 THR C    1 1 
       10  6331 1 1 36 THR CA   C    6.113   8.207  -5.297 1.00 . A A .  36 THR CA   1 1 
       10  6332 1 1 36 THR CB   C    4.821   9.028  -5.468 1.00 . A A .  36 THR CB   1 1 
       10  6333 1 1 36 THR CG2  C    5.115  10.373  -6.115 1.00 . A A .  36 THR CG2  1 1 
       10  6334 1 1 36 THR H    H    4.896   6.582  -4.698 1.00 . A A .  36 THR H    1 1 
       10  6335 1 1 36 THR HA   H    6.588   8.119  -6.263 1.00 . A A .  36 THR HA   1 1 
       10  6336 1 1 36 THR HB   H    4.390   9.201  -4.492 1.00 . A A .  36 THR HB   1 1 
       10  6337 1 1 36 THR HG1  H    3.563   7.541  -5.780 1.00 . A A .  36 THR HG1  1 1 
       10  6338 1 1 36 THR HG21 H    4.281  10.665  -6.734 1.00 . A A .  36 THR HG21 1 1 
       10  6339 1 1 36 THR HG22 H    6.004  10.293  -6.723 1.00 . A A .  36 THR HG22 1 1 
       10  6340 1 1 36 THR HG23 H    5.271  11.116  -5.346 1.00 . A A .  36 THR HG23 1 1 
       10  6341 1 1 36 THR N    N    5.828   6.863  -4.811 1.00 . A A .  36 THR N    1 1 
       10  6342 1 1 36 THR O    O    8.045   9.533  -4.778 1.00 . A A .  36 THR O    1 1 
       10  6343 1 1 36 THR OG1  O    3.882   8.303  -6.270 1.00 . A A .  36 THR OG1  1 1 
       10  6344 1 1 37 ARG C    C    8.868   8.859  -1.856 1.00 . A A .  37 ARG C    1 1 
       10  6345 1 1 37 ARG CA   C    7.541   9.585  -2.053 1.00 . A A .  37 ARG CA   1 1 
       10  6346 1 1 37 ARG CB   C    6.786   9.660  -0.725 1.00 . A A .  37 ARG CB   1 1 
       10  6347 1 1 37 ARG CD   C    5.956   8.430   1.304 1.00 . A A .  37 ARG CD   1 1 
       10  6348 1 1 37 ARG CG   C    6.494   8.300  -0.113 1.00 . A A .  37 ARG CG   1 1 
       10  6349 1 1 37 ARG CZ   C    3.826   9.103   2.331 1.00 . A A .  37 ARG CZ   1 1 
       10  6350 1 1 37 ARG H    H    5.922   8.433  -2.781 1.00 . A A .  37 ARG H    1 1 
       10  6351 1 1 37 ARG HA   H    7.741  10.588  -2.400 1.00 . A A .  37 ARG HA   1 1 
       10  6352 1 1 37 ARG HB2  H    7.376  10.228  -0.020 1.00 . A A .  37 ARG HB2  1 1 
       10  6353 1 1 37 ARG HB3  H    5.847  10.167  -0.887 1.00 . A A .  37 ARG HB3  1 1 
       10  6354 1 1 37 ARG HD2  H    5.769   7.442   1.696 1.00 . A A .  37 ARG HD2  1 1 
       10  6355 1 1 37 ARG HD3  H    6.700   8.923   1.912 1.00 . A A .  37 ARG HD3  1 1 
       10  6356 1 1 37 ARG HE   H    4.541   9.822   0.613 1.00 . A A .  37 ARG HE   1 1 
       10  6357 1 1 37 ARG HG2  H    5.759   7.793  -0.720 1.00 . A A .  37 ARG HG2  1 1 
       10  6358 1 1 37 ARG HG3  H    7.406   7.722  -0.091 1.00 . A A .  37 ARG HG3  1 1 
       10  6359 1 1 37 ARG HH11 H    4.869   7.716   3.366 1.00 . A A .  37 ARG HH11 1 1 
       10  6360 1 1 37 ARG HH12 H    3.365   8.199   4.079 1.00 . A A .  37 ARG HH12 1 1 
       10  6361 1 1 37 ARG HH21 H    2.560  10.467   1.542 1.00 . A A .  37 ARG HH21 1 1 
       10  6362 1 1 37 ARG HH22 H    2.053   9.763   3.040 1.00 . A A .  37 ARG HH22 1 1 
       10  6363 1 1 37 ARG N    N    6.727   8.916  -3.061 1.00 . A A .  37 ARG N    1 1 
       10  6364 1 1 37 ARG NE   N    4.717   9.201   1.350 1.00 . A A .  37 ARG NE   1 1 
       10  6365 1 1 37 ARG NH1  N    4.037   8.271   3.341 1.00 . A A .  37 ARG NH1  1 1 
       10  6366 1 1 37 ARG NH2  N    2.722   9.838   2.302 1.00 . A A .  37 ARG NH2  1 1 
       10  6367 1 1 37 ARG O    O    8.932   7.632  -1.930 1.00 . A A .  37 ARG O    1 1 
       10  6368 1 1 38 GLU C    C   11.883   9.593  -0.119 1.00 . A A .  38 GLU C    1 1 
       10  6369 1 1 38 GLU CA   C   11.251   9.053  -1.399 1.00 . A A .  38 GLU CA   1 1 
       10  6370 1 1 38 GLU CB   C   12.154   9.360  -2.595 1.00 . A A .  38 GLU CB   1 1 
       10  6371 1 1 38 GLU CD   C   14.136   8.511  -3.912 1.00 . A A .  38 GLU CD   1 1 
       10  6372 1 1 38 GLU CG   C   13.494   8.646  -2.545 1.00 . A A .  38 GLU CG   1 1 
       10  6373 1 1 38 GLU H    H    9.811  10.597  -1.559 1.00 . A A .  38 GLU H    1 1 
       10  6374 1 1 38 GLU HA   H   11.140   7.984  -1.309 1.00 . A A .  38 GLU HA   1 1 
       10  6375 1 1 38 GLU HB2  H   11.645   9.064  -3.501 1.00 . A A .  38 GLU HB2  1 1 
       10  6376 1 1 38 GLU HB3  H   12.338  10.424  -2.628 1.00 . A A .  38 GLU HB3  1 1 
       10  6377 1 1 38 GLU HG2  H   14.161   9.204  -1.905 1.00 . A A .  38 GLU HG2  1 1 
       10  6378 1 1 38 GLU HG3  H   13.346   7.658  -2.134 1.00 . A A .  38 GLU HG3  1 1 
       10  6379 1 1 38 GLU N    N    9.925   9.625  -1.605 1.00 . A A .  38 GLU N    1 1 
       10  6380 1 1 38 GLU O    O   12.395  10.712  -0.090 1.00 . A A .  38 GLU O    1 1 
       10  6381 1 1 38 GLU OE1  O   13.397   8.528  -4.919 1.00 . A A .  38 GLU OE1  1 1 
       10  6382 1 1 38 GLU OE2  O   15.377   8.390  -3.975 1.00 . A A .  38 GLU OE2  1 1 
       10  6383 1 1 39 LYS C    C   12.907   7.964   2.993 1.00 . A A .  39 LYS C    1 1 
       10  6384 1 1 39 LYS CA   C   12.410   9.183   2.222 1.00 . A A .  39 LYS CA   1 1 
       10  6385 1 1 39 LYS CB   C   11.370   9.936   3.054 1.00 . A A .  39 LYS CB   1 1 
       10  6386 1 1 39 LYS CD   C    9.213   9.791   4.334 1.00 . A A .  39 LYS CD   1 1 
       10  6387 1 1 39 LYS CE   C    8.359  10.926   3.790 1.00 . A A .  39 LYS CE   1 1 
       10  6388 1 1 39 LYS CG   C   10.073   9.170   3.245 1.00 . A A .  39 LYS CG   1 1 
       10  6389 1 1 39 LYS H    H   11.419   7.908   0.852 1.00 . A A .  39 LYS H    1 1 
       10  6390 1 1 39 LYS HA   H   13.246   9.837   2.028 1.00 . A A .  39 LYS HA   1 1 
       10  6391 1 1 39 LYS HB2  H   11.788  10.145   4.027 1.00 . A A .  39 LYS HB2  1 1 
       10  6392 1 1 39 LYS HB3  H   11.141  10.871   2.562 1.00 . A A .  39 LYS HB3  1 1 
       10  6393 1 1 39 LYS HD2  H    8.564   9.032   4.745 1.00 . A A .  39 LYS HD2  1 1 
       10  6394 1 1 39 LYS HD3  H    9.857  10.177   5.112 1.00 . A A .  39 LYS HD3  1 1 
       10  6395 1 1 39 LYS HE2  H    8.017  10.660   2.802 1.00 . A A .  39 LYS HE2  1 1 
       10  6396 1 1 39 LYS HE3  H    7.508  11.061   4.441 1.00 . A A .  39 LYS HE3  1 1 
       10  6397 1 1 39 LYS HG2  H    9.520   9.177   2.318 1.00 . A A .  39 LYS HG2  1 1 
       10  6398 1 1 39 LYS HG3  H   10.305   8.150   3.520 1.00 . A A .  39 LYS HG3  1 1 
       10  6399 1 1 39 LYS HZ1  H    9.775  12.279   4.516 1.00 . A A .  39 LYS HZ1  1 1 
       10  6400 1 1 39 LYS HZ2  H    8.463  13.011   3.736 1.00 . A A .  39 LYS HZ2  1 1 
       10  6401 1 1 39 LYS HZ3  H    9.665  12.242   2.829 1.00 . A A .  39 LYS HZ3  1 1 
       10  6402 1 1 39 LYS N    N   11.841   8.789   0.938 1.00 . A A .  39 LYS N    1 1 
       10  6403 1 1 39 LYS NZ   N    9.119  12.204   3.713 1.00 . A A .  39 LYS NZ   1 1 
       10  6404 1 1 39 LYS O    O   12.314   6.887   2.948 1.00 . A A .  39 LYS O    1 1 
       10  6405 1 1 40 PRO C    C   13.772   6.696   5.727 1.00 . A A .  40 PRO C    1 1 
       10  6406 1 1 40 PRO CA   C   14.622   7.063   4.516 1.00 . A A .  40 PRO CA   1 1 
       10  6407 1 1 40 PRO CB   C   15.960   7.657   4.962 1.00 . A A .  40 PRO CB   1 1 
       10  6408 1 1 40 PRO CD   C   14.781   9.395   3.819 1.00 . A A .  40 PRO CD   1 1 
       10  6409 1 1 40 PRO CG   C   15.745   9.131   4.943 1.00 . A A .  40 PRO CG   1 1 
       10  6410 1 1 40 PRO HA   H   14.799   6.179   3.921 1.00 . A A .  40 PRO HA   1 1 
       10  6411 1 1 40 PRO HB2  H   16.200   7.305   5.955 1.00 . A A .  40 PRO HB2  1 1 
       10  6412 1 1 40 PRO HB3  H   16.737   7.363   4.272 1.00 . A A .  40 PRO HB3  1 1 
       10  6413 1 1 40 PRO HD2  H   14.130  10.220   4.065 1.00 . A A .  40 PRO HD2  1 1 
       10  6414 1 1 40 PRO HD3  H   15.316   9.595   2.902 1.00 . A A .  40 PRO HD3  1 1 
       10  6415 1 1 40 PRO HG2  H   15.323   9.453   5.882 1.00 . A A .  40 PRO HG2  1 1 
       10  6416 1 1 40 PRO HG3  H   16.682   9.636   4.758 1.00 . A A .  40 PRO HG3  1 1 
       10  6417 1 1 40 PRO N    N   14.022   8.137   3.719 1.00 . A A .  40 PRO N    1 1 
       10  6418 1 1 40 PRO O    O   13.889   7.309   6.788 1.00 . A A .  40 PRO O    1 1 
       10  6419 1 1 41 SER C    C   11.544   3.827   6.385 1.00 . A A .  41 SER C    1 1 
       10  6420 1 1 41 SER CA   C   12.045   5.245   6.642 1.00 . A A .  41 SER CA   1 1 
       10  6421 1 1 41 SER CB   C   10.857   6.197   6.794 1.00 . A A .  41 SER CB   1 1 
       10  6422 1 1 41 SER H    H   12.870   5.242   4.692 1.00 . A A .  41 SER H    1 1 
       10  6423 1 1 41 SER HA   H   12.620   5.251   7.556 1.00 . A A .  41 SER HA   1 1 
       10  6424 1 1 41 SER HB2  H   11.220   7.186   7.031 1.00 . A A .  41 SER HB2  1 1 
       10  6425 1 1 41 SER HB3  H   10.304   6.229   5.867 1.00 . A A .  41 SER HB3  1 1 
       10  6426 1 1 41 SER HG   H   10.077   4.820   7.949 1.00 . A A .  41 SER HG   1 1 
       10  6427 1 1 41 SER N    N   12.917   5.691   5.562 1.00 . A A .  41 SER N    1 1 
       10  6428 1 1 41 SER O    O   10.772   3.588   5.458 1.00 . A A .  41 SER O    1 1 
       10  6429 1 1 41 SER OG   O    9.990   5.769   7.829 1.00 . A A .  41 SER OG   1 1 
       10  6430 1 1 42 GLY C    C   11.877   0.962   5.677 1.00 . A A .  42 GLY C    1 1 
       10  6431 1 1 42 GLY CA   C   11.579   1.505   7.061 1.00 . A A .  42 GLY CA   1 1 
       10  6432 1 1 42 GLY H    H   12.606   3.137   7.936 1.00 . A A .  42 GLY H    1 1 
       10  6433 1 1 42 GLY HA2  H   12.098   0.903   7.792 1.00 . A A .  42 GLY HA2  1 1 
       10  6434 1 1 42 GLY HA3  H   10.517   1.436   7.241 1.00 . A A .  42 GLY HA3  1 1 
       10  6435 1 1 42 GLY N    N   11.991   2.888   7.214 1.00 . A A .  42 GLY N    1 1 
       10  6436 1 1 42 GLY O    O   12.731   1.476   4.955 1.00 . A A .  42 GLY O    1 1 
       10  6437 1 1 43 PRO C    C   10.834   0.133   2.838 1.00 . A A .  43 PRO C    1 1 
       10  6438 1 1 43 PRO CA   C   11.337  -0.742   3.981 1.00 . A A .  43 PRO CA   1 1 
       10  6439 1 1 43 PRO CB   C   10.493  -2.015   4.091 1.00 . A A .  43 PRO CB   1 1 
       10  6440 1 1 43 PRO CD   C   10.126  -0.770   6.098 1.00 . A A .  43 PRO CD   1 1 
       10  6441 1 1 43 PRO CG   C    9.463  -1.699   5.120 1.00 . A A .  43 PRO CG   1 1 
       10  6442 1 1 43 PRO HA   H   12.369  -1.007   3.804 1.00 . A A .  43 PRO HA   1 1 
       10  6443 1 1 43 PRO HB2  H   10.042  -2.234   3.133 1.00 . A A .  43 PRO HB2  1 1 
       10  6444 1 1 43 PRO HB3  H   11.118  -2.840   4.399 1.00 . A A .  43 PRO HB3  1 1 
       10  6445 1 1 43 PRO HD2  H    9.415  -0.052   6.480 1.00 . A A .  43 PRO HD2  1 1 
       10  6446 1 1 43 PRO HD3  H   10.571  -1.330   6.908 1.00 . A A .  43 PRO HD3  1 1 
       10  6447 1 1 43 PRO HG2  H    8.618  -1.213   4.656 1.00 . A A .  43 PRO HG2  1 1 
       10  6448 1 1 43 PRO HG3  H    9.151  -2.605   5.617 1.00 . A A .  43 PRO HG3  1 1 
       10  6449 1 1 43 PRO N    N   11.162  -0.105   5.289 1.00 . A A .  43 PRO N    1 1 
       10  6450 1 1 43 PRO O    O    9.730   0.674   2.897 1.00 . A A .  43 PRO O    1 1 
       10  6451 1 1 44 SER C    C   11.787   0.437  -0.649 1.00 . A A .  44 SER C    1 1 
       10  6452 1 1 44 SER CA   C   11.291   1.080   0.642 1.00 . A A .  44 SER CA   1 1 
       10  6453 1 1 44 SER CB   C   11.873   2.488   0.781 1.00 . A A .  44 SER CB   1 1 
       10  6454 1 1 44 SER H    H   12.519  -0.190   1.810 1.00 . A A .  44 SER H    1 1 
       10  6455 1 1 44 SER HA   H   10.214   1.146   0.607 1.00 . A A .  44 SER HA   1 1 
       10  6456 1 1 44 SER HB2  H   11.812   2.800   1.812 1.00 . A A .  44 SER HB2  1 1 
       10  6457 1 1 44 SER HB3  H   12.907   2.480   0.467 1.00 . A A .  44 SER HB3  1 1 
       10  6458 1 1 44 SER HG   H   10.265   3.096  -0.160 1.00 . A A .  44 SER HG   1 1 
       10  6459 1 1 44 SER N    N   11.652   0.267   1.798 1.00 . A A .  44 SER N    1 1 
       10  6460 1 1 44 SER O    O   12.836  -0.207  -0.673 1.00 . A A .  44 SER O    1 1 
       10  6461 1 1 44 SER OG   O   11.160   3.415  -0.019 1.00 . A A .  44 SER OG   1 1 
       10  6462 1 1 45 SER C    C   11.302   1.111  -4.114 1.00 . A A .  45 SER C    1 1 
       10  6463 1 1 45 SER CA   C   11.383   0.052  -3.019 1.00 . A A .  45 SER CA   1 1 
       10  6464 1 1 45 SER CB   C   10.464  -1.122  -3.359 1.00 . A A .  45 SER CB   1 1 
       10  6465 1 1 45 SER H    H   10.200   1.140  -1.641 1.00 . A A .  45 SER H    1 1 
       10  6466 1 1 45 SER HA   H   12.400  -0.305  -2.955 1.00 . A A .  45 SER HA   1 1 
       10  6467 1 1 45 SER HB2  H   10.272  -1.696  -2.466 1.00 . A A .  45 SER HB2  1 1 
       10  6468 1 1 45 SER HB3  H    9.531  -0.744  -3.751 1.00 . A A .  45 SER HB3  1 1 
       10  6469 1 1 45 SER HG   H   12.012  -1.887  -4.285 1.00 . A A .  45 SER HG   1 1 
       10  6470 1 1 45 SER N    N   11.025   0.617  -1.723 1.00 . A A .  45 SER N    1 1 
       10  6471 1 1 45 SER O    O   10.683   2.159  -3.935 1.00 . A A .  45 SER O    1 1 
       10  6472 1 1 45 SER OG   O   11.056  -1.970  -4.328 1.00 . A A .  45 SER OG   1 1 
       10  6473 1 1 46 GLY C    C   11.804   1.071  -7.702 1.00 . A A .  46 GLY C    1 1 
       10  6474 1 1 46 GLY CA   C   11.919   1.764  -6.359 1.00 . A A .  46 GLY CA   1 1 
       10  6475 1 1 46 GLY H    H   12.409  -0.024  -5.337 1.00 . A A .  46 GLY H    1 1 
       10  6476 1 1 46 GLY HA2  H   11.082   2.436  -6.239 1.00 . A A .  46 GLY HA2  1 1 
       10  6477 1 1 46 GLY HA3  H   12.834   2.338  -6.341 1.00 . A A .  46 GLY HA3  1 1 
       10  6478 1 1 46 GLY N    N   11.932   0.828  -5.251 1.00 . A A .  46 GLY N    1 1 
       10  6479 1 1 46 GLY O    O   11.560  -0.134  -7.735 1.00 . A A .  46 GLY O    1 1 
       10  6480 2 2  1 ZN  ZN   ZN   2.630  -0.799  -4.367 1.00 . B A . 181 ZN  ZN   1 1 
       11  6481 1 1  1 GLY C    C    7.549 -26.663 -25.015 1.00 . A A .   1 GLY C    1 1 
       11  6482 1 1  1 GLY CA   C    7.887 -26.583 -26.491 1.00 . A A .   1 GLY CA   1 1 
       11  6483 1 1  1 GLY H1   H    6.534 -28.161 -26.897 1.00 . A A .   1 GLY H1   1 1 
       11  6484 1 1  1 GLY HA2  H    8.960 -26.610 -26.606 1.00 . A A .   1 GLY HA2  1 1 
       11  6485 1 1  1 GLY HA3  H    7.516 -25.647 -26.883 1.00 . A A .   1 GLY HA3  1 1 
       11  6486 1 1  1 GLY N    N    7.306 -27.673 -27.253 1.00 . A A .   1 GLY N    1 1 
       11  6487 1 1  1 GLY O    O    6.898 -27.609 -24.571 1.00 . A A .   1 GLY O    1 1 
       11  6488 1 1  2 SER C    C    6.265 -25.360 -22.534 1.00 . A A .   2 SER C    1 1 
       11  6489 1 1  2 SER CA   C    7.739 -25.633 -22.818 1.00 . A A .   2 SER CA   1 1 
       11  6490 1 1  2 SER CB   C    8.605 -24.563 -22.151 1.00 . A A .   2 SER CB   1 1 
       11  6491 1 1  2 SER H    H    8.507 -24.943 -24.666 1.00 . A A .   2 SER H    1 1 
       11  6492 1 1  2 SER HA   H    7.999 -26.599 -22.411 1.00 . A A .   2 SER HA   1 1 
       11  6493 1 1  2 SER HB2  H    8.402 -23.605 -22.606 1.00 . A A .   2 SER HB2  1 1 
       11  6494 1 1  2 SER HB3  H    8.370 -24.518 -21.098 1.00 . A A .   2 SER HB3  1 1 
       11  6495 1 1  2 SER HG   H   10.501 -24.070 -22.111 1.00 . A A .   2 SER HG   1 1 
       11  6496 1 1  2 SER N    N    7.993 -25.669 -24.253 1.00 . A A .   2 SER N    1 1 
       11  6497 1 1  2 SER O    O    5.565 -24.761 -23.350 1.00 . A A .   2 SER O    1 1 
       11  6498 1 1  2 SER OG   O    9.983 -24.856 -22.300 1.00 . A A .   2 SER OG   1 1 
       11  6499 1 1  3 SER C    C    4.309 -25.194 -19.516 1.00 . A A .   3 SER C    1 1 
       11  6500 1 1  3 SER CA   C    4.409 -25.613 -20.979 1.00 . A A .   3 SER CA   1 1 
       11  6501 1 1  3 SER CB   C    3.611 -26.898 -21.209 1.00 . A A .   3 SER CB   1 1 
       11  6502 1 1  3 SER H    H    6.408 -26.276 -20.762 1.00 . A A .   3 SER H    1 1 
       11  6503 1 1  3 SER HA   H    3.997 -24.828 -21.595 1.00 . A A .   3 SER HA   1 1 
       11  6504 1 1  3 SER HB2  H    3.685 -27.184 -22.247 1.00 . A A .   3 SER HB2  1 1 
       11  6505 1 1  3 SER HB3  H    4.015 -27.685 -20.588 1.00 . A A .   3 SER HB3  1 1 
       11  6506 1 1  3 SER HG   H    1.868 -27.551 -20.598 1.00 . A A .   3 SER HG   1 1 
       11  6507 1 1  3 SER N    N    5.801 -25.805 -21.371 1.00 . A A .   3 SER N    1 1 
       11  6508 1 1  3 SER O    O    5.255 -25.357 -18.746 1.00 . A A .   3 SER O    1 1 
       11  6509 1 1  3 SER OG   O    2.244 -26.715 -20.882 1.00 . A A .   3 SER OG   1 1 
       11  6510 1 1  4 GLY C    C    1.576 -24.577 -17.245 1.00 . A A .   4 GLY C    1 1 
       11  6511 1 1  4 GLY CA   C    2.952 -24.216 -17.770 1.00 . A A .   4 GLY CA   1 1 
       11  6512 1 1  4 GLY H    H    2.436 -24.546 -19.797 1.00 . A A .   4 GLY H    1 1 
       11  6513 1 1  4 GLY HA2  H    3.698 -24.679 -17.142 1.00 . A A .   4 GLY HA2  1 1 
       11  6514 1 1  4 GLY HA3  H    3.072 -23.144 -17.724 1.00 . A A .   4 GLY HA3  1 1 
       11  6515 1 1  4 GLY N    N    3.155 -24.652 -19.139 1.00 . A A .   4 GLY N    1 1 
       11  6516 1 1  4 GLY O    O    0.974 -25.557 -17.684 1.00 . A A .   4 GLY O    1 1 
       11  6517 1 1  5 SER C    C   -1.139 -22.813 -15.877 1.00 . A A .   5 SER C    1 1 
       11  6518 1 1  5 SER CA   C   -0.233 -24.030 -15.712 1.00 . A A .   5 SER CA   1 1 
       11  6519 1 1  5 SER CB   C   -0.092 -24.377 -14.228 1.00 . A A .   5 SER CB   1 1 
       11  6520 1 1  5 SER H    H    1.606 -23.019 -15.993 1.00 . A A .   5 SER H    1 1 
       11  6521 1 1  5 SER HA   H   -0.678 -24.867 -16.228 1.00 . A A .   5 SER HA   1 1 
       11  6522 1 1  5 SER HB2  H   -1.072 -24.428 -13.778 1.00 . A A .   5 SER HB2  1 1 
       11  6523 1 1  5 SER HB3  H    0.399 -25.334 -14.131 1.00 . A A .   5 SER HB3  1 1 
       11  6524 1 1  5 SER HG   H    0.284 -22.532 -13.687 1.00 . A A .   5 SER HG   1 1 
       11  6525 1 1  5 SER N    N    1.078 -23.785 -16.301 1.00 . A A .   5 SER N    1 1 
       11  6526 1 1  5 SER O    O   -0.684 -21.735 -16.260 1.00 . A A .   5 SER O    1 1 
       11  6527 1 1  5 SER OG   O    0.673 -23.398 -13.546 1.00 . A A .   5 SER OG   1 1 
       11  6528 1 1  6 SER C    C   -4.360 -21.918 -14.524 1.00 . A A .   6 SER C    1 1 
       11  6529 1 1  6 SER CA   C   -3.394 -21.914 -15.706 1.00 . A A .   6 SER CA   1 1 
       11  6530 1 1  6 SER CB   C   -4.174 -22.043 -17.016 1.00 . A A .   6 SER CB   1 1 
       11  6531 1 1  6 SER H    H   -2.724 -23.878 -15.286 1.00 . A A .   6 SER H    1 1 
       11  6532 1 1  6 SER HA   H   -2.852 -20.980 -15.710 1.00 . A A .   6 SER HA   1 1 
       11  6533 1 1  6 SER HB2  H   -3.494 -21.940 -17.848 1.00 . A A .   6 SER HB2  1 1 
       11  6534 1 1  6 SER HB3  H   -4.647 -23.014 -17.056 1.00 . A A .   6 SER HB3  1 1 
       11  6535 1 1  6 SER HG   H   -6.035 -21.435 -16.960 1.00 . A A .   6 SER HG   1 1 
       11  6536 1 1  6 SER N    N   -2.423 -22.995 -15.586 1.00 . A A .   6 SER N    1 1 
       11  6537 1 1  6 SER O    O   -4.629 -22.962 -13.931 1.00 . A A .   6 SER O    1 1 
       11  6538 1 1  6 SER OG   O   -5.173 -21.043 -17.116 1.00 . A A .   6 SER OG   1 1 
       11  6539 1 1  7 GLY C    C   -6.016 -19.193 -12.639 1.00 . A A .   7 GLY C    1 1 
       11  6540 1 1  7 GLY CA   C   -5.807 -20.629 -13.078 1.00 . A A .   7 GLY CA   1 1 
       11  6541 1 1  7 GLY H    H   -4.627 -19.941 -14.696 1.00 . A A .   7 GLY H    1 1 
       11  6542 1 1  7 GLY HA2  H   -6.758 -21.045 -13.377 1.00 . A A .   7 GLY HA2  1 1 
       11  6543 1 1  7 GLY HA3  H   -5.423 -21.197 -12.244 1.00 . A A .   7 GLY HA3  1 1 
       11  6544 1 1  7 GLY N    N   -4.878 -20.740 -14.188 1.00 . A A .   7 GLY N    1 1 
       11  6545 1 1  7 GLY O    O   -7.002 -18.560 -13.013 1.00 . A A .   7 GLY O    1 1 
       11  6546 1 1  8 GLU C    C   -5.701 -16.375 -12.432 1.00 . A A .   8 GLU C    1 1 
       11  6547 1 1  8 GLU CA   C   -5.174 -17.310 -11.347 1.00 . A A .   8 GLU CA   1 1 
       11  6548 1 1  8 GLU CB   C   -3.804 -16.828 -10.865 1.00 . A A .   8 GLU CB   1 1 
       11  6549 1 1  8 GLU CD   C   -1.639 -15.758 -11.606 1.00 . A A .   8 GLU CD   1 1 
       11  6550 1 1  8 GLU CG   C   -2.784 -16.679 -11.981 1.00 . A A .   8 GLU CG   1 1 
       11  6551 1 1  8 GLU H    H   -4.322 -19.234 -11.576 1.00 . A A .   8 GLU H    1 1 
       11  6552 1 1  8 GLU HA   H   -5.861 -17.301 -10.515 1.00 . A A .   8 GLU HA   1 1 
       11  6553 1 1  8 GLU HB2  H   -3.922 -15.870 -10.382 1.00 . A A .   8 GLU HB2  1 1 
       11  6554 1 1  8 GLU HB3  H   -3.419 -17.537 -10.147 1.00 . A A .   8 GLU HB3  1 1 
       11  6555 1 1  8 GLU HG2  H   -2.380 -17.652 -12.215 1.00 . A A .   8 GLU HG2  1 1 
       11  6556 1 1  8 GLU HG3  H   -3.279 -16.277 -12.853 1.00 . A A .   8 GLU HG3  1 1 
       11  6557 1 1  8 GLU N    N   -5.085 -18.680 -11.840 1.00 . A A .   8 GLU N    1 1 
       11  6558 1 1  8 GLU O    O   -5.341 -16.497 -13.601 1.00 . A A .   8 GLU O    1 1 
       11  6559 1 1  8 GLU OE1  O   -1.049 -15.954 -10.523 1.00 . A A .   8 GLU OE1  1 1 
       11  6560 1 1  8 GLU OE2  O   -1.334 -14.840 -12.396 1.00 . A A .   8 GLU OE2  1 1 
       11  6561 1 1  9 GLY C    C   -6.511 -13.117 -12.861 1.00 . A A .   9 GLY C    1 1 
       11  6562 1 1  9 GLY CA   C   -7.123 -14.498 -12.981 1.00 . A A .   9 GLY CA   1 1 
       11  6563 1 1  9 GLY H    H   -6.810 -15.390 -11.087 1.00 . A A .   9 GLY H    1 1 
       11  6564 1 1  9 GLY HA2  H   -6.958 -14.868 -13.982 1.00 . A A .   9 GLY HA2  1 1 
       11  6565 1 1  9 GLY HA3  H   -8.187 -14.423 -12.807 1.00 . A A .   9 GLY HA3  1 1 
       11  6566 1 1  9 GLY N    N   -6.559 -15.440 -12.033 1.00 . A A .   9 GLY N    1 1 
       11  6567 1 1  9 GLY O    O   -5.519 -12.930 -12.156 1.00 . A A .   9 GLY O    1 1 
       11  6568 1 1 10 GLU C    C   -7.338  -9.955 -12.465 1.00 . A A .  10 GLU C    1 1 
       11  6569 1 1 10 GLU CA   C   -6.604 -10.776 -13.521 1.00 . A A .  10 GLU CA   1 1 
       11  6570 1 1 10 GLU CB   C   -6.764 -10.121 -14.895 1.00 . A A .  10 GLU CB   1 1 
       11  6571 1 1 10 GLU CD   C   -5.696 -11.908 -16.325 1.00 . A A .  10 GLU CD   1 1 
       11  6572 1 1 10 GLU CG   C   -5.648 -10.463 -15.867 1.00 . A A .  10 GLU CG   1 1 
       11  6573 1 1 10 GLU H    H   -7.888 -12.358 -14.097 1.00 . A A .  10 GLU H    1 1 
       11  6574 1 1 10 GLU HA   H   -5.555 -10.809 -13.269 1.00 . A A .  10 GLU HA   1 1 
       11  6575 1 1 10 GLU HB2  H   -7.701 -10.441 -15.326 1.00 . A A .  10 GLU HB2  1 1 
       11  6576 1 1 10 GLU HB3  H   -6.786  -9.048 -14.767 1.00 . A A .  10 GLU HB3  1 1 
       11  6577 1 1 10 GLU HG2  H   -5.733  -9.824 -16.732 1.00 . A A .  10 GLU HG2  1 1 
       11  6578 1 1 10 GLU HG3  H   -4.699 -10.286 -15.382 1.00 . A A .  10 GLU HG3  1 1 
       11  6579 1 1 10 GLU N    N   -7.101 -12.147 -13.553 1.00 . A A .  10 GLU N    1 1 
       11  6580 1 1 10 GLU O    O   -8.553 -10.072 -12.305 1.00 . A A .  10 GLU O    1 1 
       11  6581 1 1 10 GLU OE1  O   -6.781 -12.520 -16.240 1.00 . A A .  10 GLU OE1  1 1 
       11  6582 1 1 10 GLU OE2  O   -4.650 -12.425 -16.769 1.00 . A A .  10 GLU OE2  1 1 
       11  6583 1 1 11 LYS C    C   -7.569  -6.921 -11.265 1.00 . A A .  11 LYS C    1 1 
       11  6584 1 1 11 LYS CA   C   -7.169  -8.282 -10.705 1.00 . A A .  11 LYS CA   1 1 
       11  6585 1 1 11 LYS CB   C   -6.173  -8.101  -9.557 1.00 . A A .  11 LYS CB   1 1 
       11  6586 1 1 11 LYS CD   C   -5.018 -10.315  -9.287 1.00 . A A .  11 LYS CD   1 1 
       11  6587 1 1 11 LYS CE   C   -5.196 -11.712  -8.714 1.00 . A A .  11 LYS CE   1 1 
       11  6588 1 1 11 LYS CG   C   -6.014  -9.336  -8.688 1.00 . A A .  11 LYS CG   1 1 
       11  6589 1 1 11 LYS H    H   -5.628  -9.075 -11.920 1.00 . A A .  11 LYS H    1 1 
       11  6590 1 1 11 LYS HA   H   -8.052  -8.777 -10.329 1.00 . A A .  11 LYS HA   1 1 
       11  6591 1 1 11 LYS HB2  H   -5.208  -7.850  -9.970 1.00 . A A .  11 LYS HB2  1 1 
       11  6592 1 1 11 LYS HB3  H   -6.510  -7.287  -8.930 1.00 . A A .  11 LYS HB3  1 1 
       11  6593 1 1 11 LYS HD2  H   -5.165 -10.356 -10.356 1.00 . A A .  11 LYS HD2  1 1 
       11  6594 1 1 11 LYS HD3  H   -4.016  -9.972  -9.072 1.00 . A A .  11 LYS HD3  1 1 
       11  6595 1 1 11 LYS HE2  H   -5.247 -11.642  -7.638 1.00 . A A .  11 LYS HE2  1 1 
       11  6596 1 1 11 LYS HE3  H   -6.118 -12.127  -9.092 1.00 . A A .  11 LYS HE3  1 1 
       11  6597 1 1 11 LYS HG2  H   -5.665  -9.037  -7.711 1.00 . A A .  11 LYS HG2  1 1 
       11  6598 1 1 11 LYS HG3  H   -6.974  -9.825  -8.595 1.00 . A A .  11 LYS HG3  1 1 
       11  6599 1 1 11 LYS HZ1  H   -3.987 -13.387  -8.399 1.00 . A A .  11 LYS HZ1  1 1 
       11  6600 1 1 11 LYS HZ2  H   -3.177 -12.080  -9.104 1.00 . A A .  11 LYS HZ2  1 1 
       11  6601 1 1 11 LYS HZ3  H   -4.235 -13.018 -10.031 1.00 . A A .  11 LYS HZ3  1 1 
       11  6602 1 1 11 LYS N    N   -6.591  -9.124 -11.746 1.00 . A A .  11 LYS N    1 1 
       11  6603 1 1 11 LYS NZ   N   -4.070 -12.613  -9.088 1.00 . A A .  11 LYS NZ   1 1 
       11  6604 1 1 11 LYS O    O   -6.920  -6.376 -12.158 1.00 . A A .  11 LYS O    1 1 
       11  6605 1 1 12 PRO C    C   -8.256  -3.906 -10.742 1.00 . A A .  12 PRO C    1 1 
       11  6606 1 1 12 PRO CA   C   -9.171  -5.052 -11.160 1.00 . A A .  12 PRO CA   1 1 
       11  6607 1 1 12 PRO CB   C  -10.521  -4.945 -10.446 1.00 . A A .  12 PRO CB   1 1 
       11  6608 1 1 12 PRO CD   C   -9.484  -6.951  -9.662 1.00 . A A .  12 PRO CD   1 1 
       11  6609 1 1 12 PRO CG   C  -10.387  -5.822  -9.249 1.00 . A A .  12 PRO CG   1 1 
       11  6610 1 1 12 PRO HA   H   -9.323  -5.019 -12.229 1.00 . A A .  12 PRO HA   1 1 
       11  6611 1 1 12 PRO HB2  H  -10.702  -3.917 -10.166 1.00 . A A .  12 PRO HB2  1 1 
       11  6612 1 1 12 PRO HB3  H  -11.307  -5.290 -11.102 1.00 . A A .  12 PRO HB3  1 1 
       11  6613 1 1 12 PRO HD2  H   -8.870  -7.266  -8.831 1.00 . A A .  12 PRO HD2  1 1 
       11  6614 1 1 12 PRO HD3  H  -10.065  -7.780 -10.039 1.00 . A A .  12 PRO HD3  1 1 
       11  6615 1 1 12 PRO HG2  H   -9.946  -5.267  -8.435 1.00 . A A .  12 PRO HG2  1 1 
       11  6616 1 1 12 PRO HG3  H  -11.357  -6.203  -8.964 1.00 . A A .  12 PRO HG3  1 1 
       11  6617 1 1 12 PRO N    N   -8.662  -6.358 -10.729 1.00 . A A .  12 PRO N    1 1 
       11  6618 1 1 12 PRO O    O   -8.323  -2.810 -11.298 1.00 . A A .  12 PRO O    1 1 
       11  6619 1 1 13 TYR C    C   -5.267  -3.806  -8.593 1.00 . A A .  13 TYR C    1 1 
       11  6620 1 1 13 TYR CA   C   -6.472  -3.157  -9.267 1.00 . A A .  13 TYR CA   1 1 
       11  6621 1 1 13 TYR CB   C   -7.178  -2.223  -8.282 1.00 . A A .  13 TYR CB   1 1 
       11  6622 1 1 13 TYR CD1  C   -9.665  -2.301  -8.715 1.00 . A A .  13 TYR CD1  1 1 
       11  6623 1 1 13 TYR CD2  C   -8.455  -0.383  -9.451 1.00 . A A .  13 TYR CD2  1 1 
       11  6624 1 1 13 TYR CE1  C  -10.835  -1.759  -9.211 1.00 . A A .  13 TYR CE1  1 1 
       11  6625 1 1 13 TYR CE2  C   -9.620   0.167  -9.948 1.00 . A A .  13 TYR CE2  1 1 
       11  6626 1 1 13 TYR CG   C   -8.456  -1.624  -8.826 1.00 . A A .  13 TYR CG   1 1 
       11  6627 1 1 13 TYR CZ   C  -10.807  -0.524  -9.826 1.00 . A A .  13 TYR CZ   1 1 
       11  6628 1 1 13 TYR H    H   -7.393  -5.060  -9.356 1.00 . A A .  13 TYR H    1 1 
       11  6629 1 1 13 TYR HA   H   -6.129  -2.579 -10.113 1.00 . A A .  13 TYR HA   1 1 
       11  6630 1 1 13 TYR HB2  H   -7.425  -2.773  -7.388 1.00 . A A .  13 TYR HB2  1 1 
       11  6631 1 1 13 TYR HB3  H   -6.513  -1.410  -8.027 1.00 . A A .  13 TYR HB3  1 1 
       11  6632 1 1 13 TYR HD1  H   -9.683  -3.268  -8.233 1.00 . A A .  13 TYR HD1  1 1 
       11  6633 1 1 13 TYR HD2  H   -7.523   0.155  -9.545 1.00 . A A .  13 TYR HD2  1 1 
       11  6634 1 1 13 TYR HE1  H  -11.765  -2.300  -9.115 1.00 . A A .  13 TYR HE1  1 1 
       11  6635 1 1 13 TYR HE2  H   -9.599   1.133 -10.430 1.00 . A A .  13 TYR HE2  1 1 
       11  6636 1 1 13 TYR HH   H  -12.574   0.199  -9.596 1.00 . A A .  13 TYR HH   1 1 
       11  6637 1 1 13 TYR N    N   -7.400  -4.167  -9.760 1.00 . A A .  13 TYR N    1 1 
       11  6638 1 1 13 TYR O    O   -5.373  -4.342  -7.490 1.00 . A A .  13 TYR O    1 1 
       11  6639 1 1 13 TYR OH   O  -11.970   0.020 -10.321 1.00 . A A .  13 TYR OH   1 1 
       11  6640 1 1 14 GLN C    C   -1.713  -3.394  -8.935 1.00 . A A .  14 GLN C    1 1 
       11  6641 1 1 14 GLN CA   C   -2.896  -4.336  -8.733 1.00 . A A .  14 GLN CA   1 1 
       11  6642 1 1 14 GLN CB   C   -2.612  -5.681  -9.405 1.00 . A A .  14 GLN CB   1 1 
       11  6643 1 1 14 GLN CD   C   -0.822  -7.384  -9.931 1.00 . A A .  14 GLN CD   1 1 
       11  6644 1 1 14 GLN CG   C   -1.299  -6.312  -8.971 1.00 . A A .  14 GLN CG   1 1 
       11  6645 1 1 14 GLN H    H   -4.101  -3.312 -10.140 1.00 . A A .  14 GLN H    1 1 
       11  6646 1 1 14 GLN HA   H   -3.037  -4.495  -7.675 1.00 . A A .  14 GLN HA   1 1 
       11  6647 1 1 14 GLN HB2  H   -3.412  -6.365  -9.165 1.00 . A A .  14 GLN HB2  1 1 
       11  6648 1 1 14 GLN HB3  H   -2.581  -5.536 -10.474 1.00 . A A .  14 GLN HB3  1 1 
       11  6649 1 1 14 GLN HE21 H    0.955  -7.426  -9.040 1.00 . A A .  14 GLN HE21 1 1 
       11  6650 1 1 14 GLN HE22 H    0.756  -8.511 -10.370 1.00 . A A .  14 GLN HE22 1 1 
       11  6651 1 1 14 GLN HG2  H   -0.545  -5.541  -8.915 1.00 . A A .  14 GLN HG2  1 1 
       11  6652 1 1 14 GLN HG3  H   -1.432  -6.755  -7.996 1.00 . A A .  14 GLN HG3  1 1 
       11  6653 1 1 14 GLN N    N   -4.122  -3.753  -9.266 1.00 . A A .  14 GLN N    1 1 
       11  6654 1 1 14 GLN NE2  N    0.422  -7.817  -9.764 1.00 . A A .  14 GLN NE2  1 1 
       11  6655 1 1 14 GLN O    O   -1.487  -2.890 -10.035 1.00 . A A .  14 GLN O    1 1 
       11  6656 1 1 14 GLN OE1  O   -1.564  -7.820 -10.812 1.00 . A A .  14 GLN OE1  1 1 
       11  6657 1 1 15 CYS C    C    1.425  -3.025  -8.439 1.00 . A A .  15 CYS C    1 1 
       11  6658 1 1 15 CYS CA   C    0.198  -2.278  -7.922 1.00 . A A .  15 CYS CA   1 1 
       11  6659 1 1 15 CYS CB   C    0.489  -1.692  -6.539 1.00 . A A .  15 CYS CB   1 1 
       11  6660 1 1 15 CYS H    H   -1.191  -3.591  -7.014 1.00 . A A .  15 CYS H    1 1 
       11  6661 1 1 15 CYS HA   H   -0.031  -1.473  -8.603 1.00 . A A .  15 CYS HA   1 1 
       11  6662 1 1 15 CYS HB2  H   -0.373  -1.134  -6.204 1.00 . A A .  15 CYS HB2  1 1 
       11  6663 1 1 15 CYS HB3  H    0.680  -2.500  -5.847 1.00 . A A .  15 CYS HB3  1 1 
       11  6664 1 1 15 CYS N    N   -0.961  -3.160  -7.864 1.00 . A A .  15 CYS N    1 1 
       11  6665 1 1 15 CYS O    O    1.936  -3.930  -7.780 1.00 . A A .  15 CYS O    1 1 
       11  6666 1 1 15 CYS SG   S    1.925  -0.572  -6.493 1.00 . A A .  15 CYS SG   1 1 
       11  6667 1 1 16 SER C    C    4.336  -2.860  -9.509 1.00 . A A .  16 SER C    1 1 
       11  6668 1 1 16 SER CA   C    3.056  -3.273 -10.229 1.00 . A A .  16 SER CA   1 1 
       11  6669 1 1 16 SER CB   C    3.149  -2.905 -11.711 1.00 . A A .  16 SER CB   1 1 
       11  6670 1 1 16 SER H    H    1.441  -1.910 -10.098 1.00 . A A .  16 SER H    1 1 
       11  6671 1 1 16 SER HA   H    2.935  -4.342 -10.139 1.00 . A A .  16 SER HA   1 1 
       11  6672 1 1 16 SER HB2  H    2.154  -2.773 -12.109 1.00 . A A .  16 SER HB2  1 1 
       11  6673 1 1 16 SER HB3  H    3.704  -1.984 -11.816 1.00 . A A .  16 SER HB3  1 1 
       11  6674 1 1 16 SER HG   H    3.240  -4.696 -12.500 1.00 . A A .  16 SER HG   1 1 
       11  6675 1 1 16 SER N    N    1.892  -2.638  -9.622 1.00 . A A .  16 SER N    1 1 
       11  6676 1 1 16 SER O    O    5.202  -3.691  -9.237 1.00 . A A .  16 SER O    1 1 
       11  6677 1 1 16 SER OG   O    3.805  -3.921 -12.449 1.00 . A A .  16 SER OG   1 1 
       11  6678 1 1 17 GLU C    C    6.160  -2.060  -7.511 1.00 . A A .  17 GLU C    1 1 
       11  6679 1 1 17 GLU CA   C    5.623  -1.048  -8.518 1.00 . A A .  17 GLU CA   1 1 
       11  6680 1 1 17 GLU CB   C    5.283   0.264  -7.807 1.00 . A A .  17 GLU CB   1 1 
       11  6681 1 1 17 GLU CD   C    4.674   1.265 -10.045 1.00 . A A .  17 GLU CD   1 1 
       11  6682 1 1 17 GLU CG   C    5.360   1.483  -8.710 1.00 . A A .  17 GLU CG   1 1 
       11  6683 1 1 17 GLU H    H    3.723  -0.958  -9.448 1.00 . A A .  17 GLU H    1 1 
       11  6684 1 1 17 GLU HA   H    6.383  -0.858  -9.260 1.00 . A A .  17 GLU HA   1 1 
       11  6685 1 1 17 GLU HB2  H    4.280   0.196  -7.412 1.00 . A A .  17 GLU HB2  1 1 
       11  6686 1 1 17 GLU HB3  H    5.974   0.405  -6.989 1.00 . A A .  17 GLU HB3  1 1 
       11  6687 1 1 17 GLU HG2  H    4.886   2.316  -8.212 1.00 . A A .  17 GLU HG2  1 1 
       11  6688 1 1 17 GLU HG3  H    6.399   1.718  -8.890 1.00 . A A .  17 GLU HG3  1 1 
       11  6689 1 1 17 GLU N    N    4.448  -1.571  -9.205 1.00 . A A .  17 GLU N    1 1 
       11  6690 1 1 17 GLU O    O    7.367  -2.294  -7.432 1.00 . A A .  17 GLU O    1 1 
       11  6691 1 1 17 GLU OE1  O    3.427   1.193 -10.066 1.00 . A A .  17 GLU OE1  1 1 
       11  6692 1 1 17 GLU OE2  O    5.383   1.166 -11.068 1.00 . A A .  17 GLU OE2  1 1 
       11  6693 1 1 18 CYS C    C    4.954  -4.984  -6.006 1.00 . A A .  18 CYS C    1 1 
       11  6694 1 1 18 CYS CA   C    5.637  -3.645  -5.739 1.00 . A A .  18 CYS CA   1 1 
       11  6695 1 1 18 CYS CB   C    5.276  -3.146  -4.339 1.00 . A A .  18 CYS CB   1 1 
       11  6696 1 1 18 CYS H    H    4.308  -2.430  -6.852 1.00 . A A .  18 CYS H    1 1 
       11  6697 1 1 18 CYS HA   H    6.706  -3.783  -5.798 1.00 . A A .  18 CYS HA   1 1 
       11  6698 1 1 18 CYS HB2  H    5.520  -3.912  -3.617 1.00 . A A .  18 CYS HB2  1 1 
       11  6699 1 1 18 CYS HB3  H    5.851  -2.258  -4.122 1.00 . A A .  18 CYS HB3  1 1 
       11  6700 1 1 18 CYS N    N    5.256  -2.659  -6.742 1.00 . A A .  18 CYS N    1 1 
       11  6701 1 1 18 CYS O    O    5.598  -6.032  -6.008 1.00 . A A .  18 CYS O    1 1 
       11  6702 1 1 18 CYS SG   S    3.514  -2.732  -4.129 1.00 . A A .  18 CYS SG   1 1 
       11  6703 1 1 19 GLY C    C    1.859  -6.440  -5.426 1.00 . A A .  19 GLY C    1 1 
       11  6704 1 1 19 GLY CA   C    2.895  -6.154  -6.495 1.00 . A A .  19 GLY CA   1 1 
       11  6705 1 1 19 GLY H    H    3.183  -4.074  -6.215 1.00 . A A .  19 GLY H    1 1 
       11  6706 1 1 19 GLY HA2  H    2.397  -6.056  -7.447 1.00 . A A .  19 GLY HA2  1 1 
       11  6707 1 1 19 GLY HA3  H    3.584  -6.984  -6.544 1.00 . A A .  19 GLY HA3  1 1 
       11  6708 1 1 19 GLY N    N    3.644  -4.939  -6.230 1.00 . A A .  19 GLY N    1 1 
       11  6709 1 1 19 GLY O    O    1.839  -7.526  -4.846 1.00 . A A .  19 GLY O    1 1 
       11  6710 1 1 20 LYS C    C   -1.430  -5.451  -4.777 1.00 . A A .  20 LYS C    1 1 
       11  6711 1 1 20 LYS CA   C   -0.046  -5.615  -4.156 1.00 . A A .  20 LYS CA   1 1 
       11  6712 1 1 20 LYS CB   C    0.146  -4.592  -3.034 1.00 . A A .  20 LYS CB   1 1 
       11  6713 1 1 20 LYS CD   C   -0.314  -3.934  -0.654 1.00 . A A .  20 LYS CD   1 1 
       11  6714 1 1 20 LYS CE   C   -0.291  -4.547   0.738 1.00 . A A .  20 LYS CE   1 1 
       11  6715 1 1 20 LYS CG   C   -0.514  -4.992  -1.726 1.00 . A A .  20 LYS CG   1 1 
       11  6716 1 1 20 LYS H    H    1.064  -4.621  -5.658 1.00 . A A .  20 LYS H    1 1 
       11  6717 1 1 20 LYS HA   H    0.033  -6.609  -3.742 1.00 . A A .  20 LYS HA   1 1 
       11  6718 1 1 20 LYS HB2  H    1.203  -4.465  -2.856 1.00 . A A .  20 LYS HB2  1 1 
       11  6719 1 1 20 LYS HB3  H   -0.274  -3.647  -3.350 1.00 . A A .  20 LYS HB3  1 1 
       11  6720 1 1 20 LYS HD2  H    0.625  -3.430  -0.828 1.00 . A A .  20 LYS HD2  1 1 
       11  6721 1 1 20 LYS HD3  H   -1.123  -3.220  -0.710 1.00 . A A .  20 LYS HD3  1 1 
       11  6722 1 1 20 LYS HE2  H    0.213  -5.501   0.688 1.00 . A A .  20 LYS HE2  1 1 
       11  6723 1 1 20 LYS HE3  H    0.252  -3.887   1.398 1.00 . A A .  20 LYS HE3  1 1 
       11  6724 1 1 20 LYS HG2  H   -1.572  -5.125  -1.892 1.00 . A A .  20 LYS HG2  1 1 
       11  6725 1 1 20 LYS HG3  H   -0.081  -5.922  -1.385 1.00 . A A .  20 LYS HG3  1 1 
       11  6726 1 1 20 LYS HZ1  H   -1.963  -5.736   1.130 1.00 . A A .  20 LYS HZ1  1 1 
       11  6727 1 1 20 LYS HZ2  H   -2.334  -4.120   0.793 1.00 . A A .  20 LYS HZ2  1 1 
       11  6728 1 1 20 LYS HZ3  H   -1.682  -4.543   2.295 1.00 . A A .  20 LYS HZ3  1 1 
       11  6729 1 1 20 LYS N    N    0.997  -5.464  -5.162 1.00 . A A .  20 LYS N    1 1 
       11  6730 1 1 20 LYS NZ   N   -1.664  -4.751   1.277 1.00 . A A .  20 LYS NZ   1 1 
       11  6731 1 1 20 LYS O    O   -1.680  -4.497  -5.513 1.00 . A A .  20 LYS O    1 1 
       11  6732 1 1 21 SER C    C   -4.626  -5.647  -4.031 1.00 . A A .  21 SER C    1 1 
       11  6733 1 1 21 SER CA   C   -3.682  -6.345  -5.006 1.00 . A A .  21 SER CA   1 1 
       11  6734 1 1 21 SER CB   C   -4.183  -7.762  -5.292 1.00 . A A .  21 SER CB   1 1 
       11  6735 1 1 21 SER H    H   -2.064  -7.122  -3.882 1.00 . A A .  21 SER H    1 1 
       11  6736 1 1 21 SER HA   H   -3.660  -5.787  -5.930 1.00 . A A .  21 SER HA   1 1 
       11  6737 1 1 21 SER HB2  H   -3.499  -8.254  -5.967 1.00 . A A .  21 SER HB2  1 1 
       11  6738 1 1 21 SER HB3  H   -4.235  -8.316  -4.366 1.00 . A A .  21 SER HB3  1 1 
       11  6739 1 1 21 SER HG   H   -5.559  -6.951  -6.425 1.00 . A A .  21 SER HG   1 1 
       11  6740 1 1 21 SER N    N   -2.325  -6.386  -4.475 1.00 . A A .  21 SER N    1 1 
       11  6741 1 1 21 SER O    O   -4.585  -5.893  -2.826 1.00 . A A .  21 SER O    1 1 
       11  6742 1 1 21 SER OG   O   -5.470  -7.738  -5.884 1.00 . A A .  21 SER OG   1 1 
       11  6743 1 1 22 PHE C    C   -7.855  -4.241  -4.251 1.00 . A A .  22 PHE C    1 1 
       11  6744 1 1 22 PHE CA   C   -6.430  -4.040  -3.742 1.00 . A A .  22 PHE CA   1 1 
       11  6745 1 1 22 PHE CB   C   -6.085  -2.549  -3.733 1.00 . A A .  22 PHE CB   1 1 
       11  6746 1 1 22 PHE CD1  C   -3.639  -2.517  -4.291 1.00 . A A .  22 PHE CD1  1 1 
       11  6747 1 1 22 PHE CD2  C   -4.320  -1.754  -2.137 1.00 . A A .  22 PHE CD2  1 1 
       11  6748 1 1 22 PHE CE1  C   -2.320  -2.259  -3.970 1.00 . A A .  22 PHE CE1  1 1 
       11  6749 1 1 22 PHE CE2  C   -3.002  -1.493  -1.811 1.00 . A A .  22 PHE CE2  1 1 
       11  6750 1 1 22 PHE CG   C   -4.653  -2.268  -3.380 1.00 . A A .  22 PHE CG   1 1 
       11  6751 1 1 22 PHE CZ   C   -2.001  -1.747  -2.727 1.00 . A A .  22 PHE CZ   1 1 
       11  6752 1 1 22 PHE H    H   -5.461  -4.623  -5.531 1.00 . A A .  22 PHE H    1 1 
       11  6753 1 1 22 PHE HA   H   -6.364  -4.422  -2.735 1.00 . A A .  22 PHE HA   1 1 
       11  6754 1 1 22 PHE HB2  H   -6.272  -2.138  -4.713 1.00 . A A .  22 PHE HB2  1 1 
       11  6755 1 1 22 PHE HB3  H   -6.711  -2.047  -3.011 1.00 . A A .  22 PHE HB3  1 1 
       11  6756 1 1 22 PHE HD1  H   -3.888  -2.919  -5.264 1.00 . A A .  22 PHE HD1  1 1 
       11  6757 1 1 22 PHE HD2  H   -5.101  -1.555  -1.419 1.00 . A A .  22 PHE HD2  1 1 
       11  6758 1 1 22 PHE HE1  H   -1.540  -2.459  -4.689 1.00 . A A .  22 PHE HE1  1 1 
       11  6759 1 1 22 PHE HE2  H   -2.756  -1.093  -0.838 1.00 . A A .  22 PHE HE2  1 1 
       11  6760 1 1 22 PHE HZ   H   -0.971  -1.544  -2.475 1.00 . A A .  22 PHE HZ   1 1 
       11  6761 1 1 22 PHE N    N   -5.476  -4.775  -4.563 1.00 . A A .  22 PHE N    1 1 
       11  6762 1 1 22 PHE O    O   -8.069  -4.821  -5.316 1.00 . A A .  22 PHE O    1 1 
       11  6763 1 1 23 SER C    C  -10.913  -2.523  -3.880 1.00 . A A .  23 SER C    1 1 
       11  6764 1 1 23 SER CA   C  -10.230  -3.887  -3.853 1.00 . A A .  23 SER CA   1 1 
       11  6765 1 1 23 SER CB   C  -10.954  -4.813  -2.874 1.00 . A A .  23 SER CB   1 1 
       11  6766 1 1 23 SER H    H   -8.591  -3.305  -2.645 1.00 . A A .  23 SER H    1 1 
       11  6767 1 1 23 SER HA   H  -10.273  -4.318  -4.842 1.00 . A A .  23 SER HA   1 1 
       11  6768 1 1 23 SER HB2  H  -10.336  -5.675  -2.674 1.00 . A A .  23 SER HB2  1 1 
       11  6769 1 1 23 SER HB3  H  -11.140  -4.282  -1.951 1.00 . A A .  23 SER HB3  1 1 
       11  6770 1 1 23 SER HG   H  -12.115  -6.166  -3.685 1.00 . A A .  23 SER HG   1 1 
       11  6771 1 1 23 SER N    N   -8.825  -3.757  -3.483 1.00 . A A .  23 SER N    1 1 
       11  6772 1 1 23 SER O    O  -12.026  -2.363  -3.380 1.00 . A A .  23 SER O    1 1 
       11  6773 1 1 23 SER OG   O  -12.192  -5.251  -3.406 1.00 . A A .  23 SER OG   1 1 
       11  6774 1 1 24 GLY C    C   -9.930   0.734  -5.373 1.00 . A A .  24 GLY C    1 1 
       11  6775 1 1 24 GLY CA   C  -10.792  -0.202  -4.549 1.00 . A A .  24 GLY CA   1 1 
       11  6776 1 1 24 GLY H    H   -9.352  -1.726  -4.849 1.00 . A A .  24 GLY H    1 1 
       11  6777 1 1 24 GLY HA2  H  -11.773  -0.258  -4.996 1.00 . A A .  24 GLY HA2  1 1 
       11  6778 1 1 24 GLY HA3  H  -10.885   0.198  -3.550 1.00 . A A .  24 GLY HA3  1 1 
       11  6779 1 1 24 GLY N    N  -10.236  -1.541  -4.468 1.00 . A A .  24 GLY N    1 1 
       11  6780 1 1 24 GLY O    O   -8.820   1.082  -4.970 1.00 . A A .  24 GLY O    1 1 
       11  6781 1 1 25 SER C    C   -8.996   3.127  -6.618 1.00 . A A .  25 SER C    1 1 
       11  6782 1 1 25 SER CA   C   -9.708   2.039  -7.415 1.00 . A A .  25 SER CA   1 1 
       11  6783 1 1 25 SER CB   C  -10.657   2.675  -8.432 1.00 . A A .  25 SER CB   1 1 
       11  6784 1 1 25 SER H    H  -11.331   0.829  -6.796 1.00 . A A .  25 SER H    1 1 
       11  6785 1 1 25 SER HA   H   -8.969   1.454  -7.943 1.00 . A A .  25 SER HA   1 1 
       11  6786 1 1 25 SER HB2  H  -10.131   3.438  -8.984 1.00 . A A .  25 SER HB2  1 1 
       11  6787 1 1 25 SER HB3  H  -11.010   1.915  -9.115 1.00 . A A .  25 SER HB3  1 1 
       11  6788 1 1 25 SER HG   H  -12.563   3.114  -8.314 1.00 . A A .  25 SER HG   1 1 
       11  6789 1 1 25 SER N    N  -10.441   1.142  -6.530 1.00 . A A .  25 SER N    1 1 
       11  6790 1 1 25 SER O    O   -7.774   3.264  -6.685 1.00 . A A .  25 SER O    1 1 
       11  6791 1 1 25 SER OG   O  -11.774   3.264  -7.788 1.00 . A A .  25 SER OG   1 1 
       11  6792 1 1 26 TYR C    C   -8.157   4.447  -4.089 1.00 . A A .  26 TYR C    1 1 
       11  6793 1 1 26 TYR CA   C   -9.214   4.978  -5.053 1.00 . A A .  26 TYR CA   1 1 
       11  6794 1 1 26 TYR CB   C  -10.326   5.681  -4.271 1.00 . A A .  26 TYR CB   1 1 
       11  6795 1 1 26 TYR CD1  C   -9.064   7.429  -2.957 1.00 . A A .  26 TYR CD1  1 1 
       11  6796 1 1 26 TYR CD2  C  -10.652   8.167  -4.574 1.00 . A A .  26 TYR CD2  1 1 
       11  6797 1 1 26 TYR CE1  C   -8.771   8.741  -2.639 1.00 . A A .  26 TYR CE1  1 1 
       11  6798 1 1 26 TYR CE2  C  -10.365   9.482  -4.263 1.00 . A A .  26 TYR CE2  1 1 
       11  6799 1 1 26 TYR CG   C  -10.008   7.118  -3.927 1.00 . A A .  26 TYR CG   1 1 
       11  6800 1 1 26 TYR CZ   C   -9.424   9.764  -3.295 1.00 . A A .  26 TYR CZ   1 1 
       11  6801 1 1 26 TYR H    H  -10.736   3.742  -5.850 1.00 . A A .  26 TYR H    1 1 
       11  6802 1 1 26 TYR HA   H   -8.752   5.690  -5.721 1.00 . A A .  26 TYR HA   1 1 
       11  6803 1 1 26 TYR HB2  H  -11.230   5.674  -4.860 1.00 . A A .  26 TYR HB2  1 1 
       11  6804 1 1 26 TYR HB3  H  -10.499   5.149  -3.348 1.00 . A A .  26 TYR HB3  1 1 
       11  6805 1 1 26 TYR HD1  H   -8.554   6.625  -2.445 1.00 . A A .  26 TYR HD1  1 1 
       11  6806 1 1 26 TYR HD2  H  -11.389   7.942  -5.332 1.00 . A A .  26 TYR HD2  1 1 
       11  6807 1 1 26 TYR HE1  H   -8.034   8.962  -1.881 1.00 . A A .  26 TYR HE1  1 1 
       11  6808 1 1 26 TYR HE2  H  -10.876  10.283  -4.776 1.00 . A A .  26 TYR HE2  1 1 
       11  6809 1 1 26 TYR HH   H   -9.923  11.503  -2.646 1.00 . A A .  26 TYR HH   1 1 
       11  6810 1 1 26 TYR N    N   -9.769   3.899  -5.862 1.00 . A A .  26 TYR N    1 1 
       11  6811 1 1 26 TYR O    O   -7.036   4.954  -4.040 1.00 . A A .  26 TYR O    1 1 
       11  6812 1 1 26 TYR OH   O   -9.134  11.072  -2.982 1.00 . A A .  26 TYR OH   1 1 
       11  6813 1 1 27 ARG C    C   -6.211   2.679  -2.957 1.00 . A A .  27 ARG C    1 1 
       11  6814 1 1 27 ARG CA   C   -7.608   2.824  -2.361 1.00 . A A .  27 ARG CA   1 1 
       11  6815 1 1 27 ARG CB   C   -8.128   1.456  -1.915 1.00 . A A .  27 ARG CB   1 1 
       11  6816 1 1 27 ARG CD   C   -8.555   1.653   0.554 1.00 . A A .  27 ARG CD   1 1 
       11  6817 1 1 27 ARG CG   C   -7.666   1.053  -0.524 1.00 . A A .  27 ARG CG   1 1 
       11  6818 1 1 27 ARG CZ   C   -7.389   1.271   2.684 1.00 . A A .  27 ARG CZ   1 1 
       11  6819 1 1 27 ARG H    H   -9.431   3.064  -3.410 1.00 . A A .  27 ARG H    1 1 
       11  6820 1 1 27 ARG HA   H   -7.555   3.476  -1.503 1.00 . A A .  27 ARG HA   1 1 
       11  6821 1 1 27 ARG HB2  H   -9.208   1.475  -1.920 1.00 . A A .  27 ARG HB2  1 1 
       11  6822 1 1 27 ARG HB3  H   -7.787   0.709  -2.615 1.00 . A A .  27 ARG HB3  1 1 
       11  6823 1 1 27 ARG HD2  H   -8.309   2.699   0.662 1.00 . A A .  27 ARG HD2  1 1 
       11  6824 1 1 27 ARG HD3  H   -9.585   1.556   0.248 1.00 . A A .  27 ARG HD3  1 1 
       11  6825 1 1 27 ARG HE   H   -9.026   0.299   2.090 1.00 . A A .  27 ARG HE   1 1 
       11  6826 1 1 27 ARG HG2  H   -7.697  -0.024  -0.443 1.00 . A A .  27 ARG HG2  1 1 
       11  6827 1 1 27 ARG HG3  H   -6.653   1.398  -0.378 1.00 . A A .  27 ARG HG3  1 1 
       11  6828 1 1 27 ARG HH11 H   -6.564   2.690   1.507 1.00 . A A .  27 ARG HH11 1 1 
       11  6829 1 1 27 ARG HH12 H   -5.753   2.411   3.012 1.00 . A A .  27 ARG HH12 1 1 
       11  6830 1 1 27 ARG HH21 H   -7.967  -0.078   4.075 1.00 . A A .  27 ARG HH21 1 1 
       11  6831 1 1 27 ARG HH22 H   -6.551   0.835   4.471 1.00 . A A .  27 ARG HH22 1 1 
       11  6832 1 1 27 ARG N    N   -8.523   3.424  -3.325 1.00 . A A .  27 ARG N    1 1 
       11  6833 1 1 27 ARG NE   N   -8.377   0.989   1.842 1.00 . A A .  27 ARG NE   1 1 
       11  6834 1 1 27 ARG NH1  N   -6.495   2.200   2.376 1.00 . A A .  27 ARG NH1  1 1 
       11  6835 1 1 27 ARG NH2  N   -7.294   0.623   3.838 1.00 . A A .  27 ARG NH2  1 1 
       11  6836 1 1 27 ARG O    O   -5.230   3.164  -2.391 1.00 . A A .  27 ARG O    1 1 
       11  6837 1 1 28 LEU C    C   -4.008   3.070  -4.752 1.00 . A A .  28 LEU C    1 1 
       11  6838 1 1 28 LEU CA   C   -4.850   1.799  -4.773 1.00 . A A .  28 LEU CA   1 1 
       11  6839 1 1 28 LEU CB   C   -5.079   1.350  -6.217 1.00 . A A .  28 LEU CB   1 1 
       11  6840 1 1 28 LEU CD1  C   -3.334  -0.372  -6.742 1.00 . A A .  28 LEU CD1  1 1 
       11  6841 1 1 28 LEU CD2  C   -4.092   1.217  -8.518 1.00 . A A .  28 LEU CD2  1 1 
       11  6842 1 1 28 LEU CG   C   -3.822   1.039  -7.031 1.00 . A A .  28 LEU CG   1 1 
       11  6843 1 1 28 LEU H    H   -6.943   1.645  -4.503 1.00 . A A .  28 LEU H    1 1 
       11  6844 1 1 28 LEU HA   H   -4.320   1.021  -4.243 1.00 . A A .  28 LEU HA   1 1 
       11  6845 1 1 28 LEU HB2  H   -5.686   0.458  -6.194 1.00 . A A .  28 LEU HB2  1 1 
       11  6846 1 1 28 LEU HB3  H   -5.618   2.137  -6.726 1.00 . A A .  28 LEU HB3  1 1 
       11  6847 1 1 28 LEU HD11 H   -3.656  -1.034  -7.531 1.00 . A A .  28 LEU HD11 1 1 
       11  6848 1 1 28 LEU HD12 H   -3.744  -0.709  -5.801 1.00 . A A .  28 LEU HD12 1 1 
       11  6849 1 1 28 LEU HD13 H   -2.255  -0.375  -6.686 1.00 . A A .  28 LEU HD13 1 1 
       11  6850 1 1 28 LEU HD21 H   -4.410   0.276  -8.942 1.00 . A A .  28 LEU HD21 1 1 
       11  6851 1 1 28 LEU HD22 H   -3.189   1.547  -9.010 1.00 . A A .  28 LEU HD22 1 1 
       11  6852 1 1 28 LEU HD23 H   -4.868   1.956  -8.657 1.00 . A A .  28 LEU HD23 1 1 
       11  6853 1 1 28 LEU HG   H   -3.038   1.727  -6.747 1.00 . A A .  28 LEU HG   1 1 
       11  6854 1 1 28 LEU N    N   -6.127   2.008  -4.100 1.00 . A A .  28 LEU N    1 1 
       11  6855 1 1 28 LEU O    O   -2.821   3.037  -4.426 1.00 . A A .  28 LEU O    1 1 
       11  6856 1 1 29 THR C    C   -3.280   5.765  -3.774 1.00 . A A .  29 THR C    1 1 
       11  6857 1 1 29 THR CA   C   -3.940   5.476  -5.118 1.00 . A A .  29 THR CA   1 1 
       11  6858 1 1 29 THR CB   C   -4.903   6.627  -5.463 1.00 . A A .  29 THR CB   1 1 
       11  6859 1 1 29 THR CG2  C   -4.138   7.921  -5.698 1.00 . A A .  29 THR CG2  1 1 
       11  6860 1 1 29 THR H    H   -5.578   4.155  -5.347 1.00 . A A .  29 THR H    1 1 
       11  6861 1 1 29 THR HA   H   -3.177   5.432  -5.881 1.00 . A A .  29 THR HA   1 1 
       11  6862 1 1 29 THR HB   H   -5.580   6.772  -4.632 1.00 . A A .  29 THR HB   1 1 
       11  6863 1 1 29 THR HG1  H   -6.118   7.081  -6.949 1.00 . A A .  29 THR HG1  1 1 
       11  6864 1 1 29 THR HG21 H   -4.817   8.757  -5.627 1.00 . A A .  29 THR HG21 1 1 
       11  6865 1 1 29 THR HG22 H   -3.692   7.902  -6.681 1.00 . A A .  29 THR HG22 1 1 
       11  6866 1 1 29 THR HG23 H   -3.364   8.021  -4.952 1.00 . A A .  29 THR HG23 1 1 
       11  6867 1 1 29 THR N    N   -4.631   4.193  -5.098 1.00 . A A .  29 THR N    1 1 
       11  6868 1 1 29 THR O    O   -2.117   6.162  -3.718 1.00 . A A .  29 THR O    1 1 
       11  6869 1 1 29 THR OG1  O   -5.663   6.297  -6.631 1.00 . A A .  29 THR OG1  1 1 
       11  6870 1 1 30 GLN C    C   -2.205   5.059  -1.130 1.00 . A A .  30 GLN C    1 1 
       11  6871 1 1 30 GLN CA   C   -3.517   5.804  -1.353 1.00 . A A .  30 GLN CA   1 1 
       11  6872 1 1 30 GLN CB   C   -4.546   5.373  -0.306 1.00 . A A .  30 GLN CB   1 1 
       11  6873 1 1 30 GLN CD   C   -6.688   5.937   0.909 1.00 . A A .  30 GLN CD   1 1 
       11  6874 1 1 30 GLN CG   C   -5.772   6.271  -0.252 1.00 . A A .  30 GLN CG   1 1 
       11  6875 1 1 30 GLN H    H   -4.951   5.247  -2.806 1.00 . A A .  30 GLN H    1 1 
       11  6876 1 1 30 GLN HA   H   -3.337   6.864  -1.252 1.00 . A A .  30 GLN HA   1 1 
       11  6877 1 1 30 GLN HB2  H   -4.871   4.368  -0.531 1.00 . A A .  30 GLN HB2  1 1 
       11  6878 1 1 30 GLN HB3  H   -4.077   5.382   0.667 1.00 . A A .  30 GLN HB3  1 1 
       11  6879 1 1 30 GLN HE21 H   -6.826   7.863   1.385 1.00 . A A .  30 GLN HE21 1 1 
       11  6880 1 1 30 GLN HE22 H   -7.714   6.775   2.391 1.00 . A A .  30 GLN HE22 1 1 
       11  6881 1 1 30 GLN HG2  H   -5.447   7.296  -0.151 1.00 . A A .  30 GLN HG2  1 1 
       11  6882 1 1 30 GLN HG3  H   -6.325   6.159  -1.173 1.00 . A A .  30 GLN HG3  1 1 
       11  6883 1 1 30 GLN N    N   -4.031   5.564  -2.696 1.00 . A A .  30 GLN N    1 1 
       11  6884 1 1 30 GLN NE2  N   -7.120   6.961   1.636 1.00 . A A .  30 GLN NE2  1 1 
       11  6885 1 1 30 GLN O    O   -1.221   5.638  -0.670 1.00 . A A .  30 GLN O    1 1 
       11  6886 1 1 30 GLN OE1  O   -7.006   4.772   1.149 1.00 . A A .  30 GLN OE1  1 1 
       11  6887 1 1 31 HIS C    C    0.119   3.431  -2.206 1.00 . A A .  31 HIS C    1 1 
       11  6888 1 1 31 HIS CA   C   -1.006   2.947  -1.296 1.00 . A A .  31 HIS CA   1 1 
       11  6889 1 1 31 HIS CB   C   -1.328   1.483  -1.598 1.00 . A A .  31 HIS CB   1 1 
       11  6890 1 1 31 HIS CD2  C    0.486   0.641  -3.250 1.00 . A A .  31 HIS CD2  1 1 
       11  6891 1 1 31 HIS CE1  C    1.534  -0.734  -1.902 1.00 . A A .  31 HIS CE1  1 1 
       11  6892 1 1 31 HIS CG   C   -0.141   0.690  -2.051 1.00 . A A .  31 HIS CG   1 1 
       11  6893 1 1 31 HIS H    H   -3.014   3.367  -1.822 1.00 . A A .  31 HIS H    1 1 
       11  6894 1 1 31 HIS HA   H   -0.683   3.031  -0.270 1.00 . A A .  31 HIS HA   1 1 
       11  6895 1 1 31 HIS HB2  H   -1.717   1.015  -0.706 1.00 . A A .  31 HIS HB2  1 1 
       11  6896 1 1 31 HIS HB3  H   -2.075   1.438  -2.378 1.00 . A A .  31 HIS HB3  1 1 
       11  6897 1 1 31 HIS HD1  H    0.326  -0.370  -0.292 1.00 . A A .  31 HIS HD1  1 1 
       11  6898 1 1 31 HIS HD2  H    0.220   1.200  -4.136 1.00 . A A .  31 HIS HD2  1 1 
       11  6899 1 1 31 HIS HE1  H    2.236  -1.456  -1.514 1.00 . A A .  31 HIS HE1  1 1 
       11  6900 1 1 31 HIS N    N   -2.198   3.771  -1.460 1.00 . A A .  31 HIS N    1 1 
       11  6901 1 1 31 HIS ND1  N    0.539  -0.183  -1.229 1.00 . A A .  31 HIS ND1  1 1 
       11  6902 1 1 31 HIS NE2  N    1.523  -0.251  -3.131 1.00 . A A .  31 HIS NE2  1 1 
       11  6903 1 1 31 HIS O    O    1.233   3.685  -1.749 1.00 . A A .  31 HIS O    1 1 
       11  6904 1 1 32 TRP C    C    1.663   5.131  -3.892 1.00 . A A .  32 TRP C    1 1 
       11  6905 1 1 32 TRP CA   C    0.805   4.009  -4.468 1.00 . A A .  32 TRP CA   1 1 
       11  6906 1 1 32 TRP CB   C    0.111   4.485  -5.745 1.00 . A A .  32 TRP CB   1 1 
       11  6907 1 1 32 TRP CD1  C   -0.649   2.171  -6.542 1.00 . A A .  32 TRP CD1  1 1 
       11  6908 1 1 32 TRP CD2  C    0.285   3.434  -8.138 1.00 . A A .  32 TRP CD2  1 1 
       11  6909 1 1 32 TRP CE2  C   -0.085   2.198  -8.703 1.00 . A A .  32 TRP CE2  1 1 
       11  6910 1 1 32 TRP CE3  C    0.890   4.393  -8.955 1.00 . A A .  32 TRP CE3  1 1 
       11  6911 1 1 32 TRP CG   C   -0.085   3.396  -6.756 1.00 . A A .  32 TRP CG   1 1 
       11  6912 1 1 32 TRP CH2  C    0.727   2.855 -10.821 1.00 . A A .  32 TRP CH2  1 1 
       11  6913 1 1 32 TRP CZ2  C    0.132   1.898 -10.045 1.00 . A A .  32 TRP CZ2  1 1 
       11  6914 1 1 32 TRP CZ3  C    1.106   4.094 -10.287 1.00 . A A .  32 TRP CZ3  1 1 
       11  6915 1 1 32 TRP H    H   -1.088   3.338  -3.797 1.00 . A A .  32 TRP H    1 1 
       11  6916 1 1 32 TRP HA   H    1.443   3.171  -4.707 1.00 . A A .  32 TRP HA   1 1 
       11  6917 1 1 32 TRP HB2  H   -0.861   4.883  -5.492 1.00 . A A .  32 TRP HB2  1 1 
       11  6918 1 1 32 TRP HB3  H    0.707   5.262  -6.201 1.00 . A A .  32 TRP HB3  1 1 
       11  6919 1 1 32 TRP HD1  H   -1.030   1.835  -5.590 1.00 . A A .  32 TRP HD1  1 1 
       11  6920 1 1 32 TRP HE1  H   -1.004   0.536  -7.812 1.00 . A A .  32 TRP HE1  1 1 
       11  6921 1 1 32 TRP HE3  H    1.189   5.353  -8.561 1.00 . A A .  32 TRP HE3  1 1 
       11  6922 1 1 32 TRP HH2  H    0.915   2.664 -11.866 1.00 . A A .  32 TRP HH2  1 1 
       11  6923 1 1 32 TRP HZ2  H   -0.155   0.948 -10.472 1.00 . A A .  32 TRP HZ2  1 1 
       11  6924 1 1 32 TRP HZ3  H    1.573   4.822 -10.933 1.00 . A A .  32 TRP HZ3  1 1 
       11  6925 1 1 32 TRP N    N   -0.181   3.556  -3.494 1.00 . A A .  32 TRP N    1 1 
       11  6926 1 1 32 TRP NE1  N   -0.652   1.445  -7.709 1.00 . A A .  32 TRP NE1  1 1 
       11  6927 1 1 32 TRP O    O    2.855   5.226  -4.187 1.00 . A A .  32 TRP O    1 1 
       11  6928 1 1 33 ILE C    C    3.162   6.678  -2.023 1.00 . A A .  33 ILE C    1 1 
       11  6929 1 1 33 ILE CA   C    1.759   7.090  -2.454 1.00 . A A .  33 ILE CA   1 1 
       11  6930 1 1 33 ILE CB   C    0.997   7.634  -1.231 1.00 . A A .  33 ILE CB   1 1 
       11  6931 1 1 33 ILE CD1  C   -1.219   8.644  -0.491 1.00 . A A .  33 ILE CD1  1 1 
       11  6932 1 1 33 ILE CG1  C   -0.377   8.159  -1.650 1.00 . A A .  33 ILE CG1  1 1 
       11  6933 1 1 33 ILE CG2  C    1.804   8.730  -0.549 1.00 . A A .  33 ILE CG2  1 1 
       11  6934 1 1 33 ILE H    H    0.099   5.848  -2.875 1.00 . A A .  33 ILE H    1 1 
       11  6935 1 1 33 ILE HA   H    1.837   7.882  -3.186 1.00 . A A .  33 ILE HA   1 1 
       11  6936 1 1 33 ILE HB   H    0.867   6.826  -0.528 1.00 . A A .  33 ILE HB   1 1 
       11  6937 1 1 33 ILE HD11 H   -2.072   9.189  -0.868 1.00 . A A .  33 ILE HD11 1 1 
       11  6938 1 1 33 ILE HD12 H   -1.561   7.797   0.085 1.00 . A A .  33 ILE HD12 1 1 
       11  6939 1 1 33 ILE HD13 H   -0.627   9.292   0.138 1.00 . A A .  33 ILE HD13 1 1 
       11  6940 1 1 33 ILE HG12 H   -0.247   8.984  -2.333 1.00 . A A .  33 ILE HG12 1 1 
       11  6941 1 1 33 ILE HG13 H   -0.920   7.368  -2.148 1.00 . A A .  33 ILE HG13 1 1 
       11  6942 1 1 33 ILE HG21 H    2.834   8.418  -0.462 1.00 . A A .  33 ILE HG21 1 1 
       11  6943 1 1 33 ILE HG22 H    1.751   9.634  -1.137 1.00 . A A .  33 ILE HG22 1 1 
       11  6944 1 1 33 ILE HG23 H    1.400   8.915   0.435 1.00 . A A .  33 ILE HG23 1 1 
       11  6945 1 1 33 ILE N    N    1.050   5.977  -3.071 1.00 . A A .  33 ILE N    1 1 
       11  6946 1 1 33 ILE O    O    4.133   7.399  -2.255 1.00 . A A .  33 ILE O    1 1 
       11  6947 1 1 34 THR C    C    5.618   5.150  -2.006 1.00 . A A .  34 THR C    1 1 
       11  6948 1 1 34 THR CA   C    4.548   5.001  -0.932 1.00 . A A .  34 THR CA   1 1 
       11  6949 1 1 34 THR CB   C    4.449   3.519  -0.523 1.00 . A A .  34 THR CB   1 1 
       11  6950 1 1 34 THR CG2  C    4.182   2.640  -1.736 1.00 . A A .  34 THR CG2  1 1 
       11  6951 1 1 34 THR H    H    2.453   4.981  -1.239 1.00 . A A .  34 THR H    1 1 
       11  6952 1 1 34 THR HA   H    4.840   5.573  -0.063 1.00 . A A .  34 THR HA   1 1 
       11  6953 1 1 34 THR HB   H    3.629   3.406   0.172 1.00 . A A .  34 THR HB   1 1 
       11  6954 1 1 34 THR HG1  H    5.721   2.146   0.101 1.00 . A A .  34 THR HG1  1 1 
       11  6955 1 1 34 THR HG21 H    3.301   2.994  -2.249 1.00 . A A .  34 THR HG21 1 1 
       11  6956 1 1 34 THR HG22 H    4.025   1.621  -1.414 1.00 . A A .  34 THR HG22 1 1 
       11  6957 1 1 34 THR HG23 H    5.030   2.680  -2.403 1.00 . A A .  34 THR HG23 1 1 
       11  6958 1 1 34 THR N    N    3.263   5.511  -1.395 1.00 . A A .  34 THR N    1 1 
       11  6959 1 1 34 THR O    O    6.750   5.540  -1.719 1.00 . A A .  34 THR O    1 1 
       11  6960 1 1 34 THR OG1  O    5.663   3.105   0.115 1.00 . A A .  34 THR OG1  1 1 
       11  6961 1 1 35 HIS C    C    6.354   6.390  -4.801 1.00 . A A .  35 HIS C    1 1 
       11  6962 1 1 35 HIS CA   C    6.184   4.938  -4.365 1.00 . A A .  35 HIS CA   1 1 
       11  6963 1 1 35 HIS CB   C    5.693   4.094  -5.541 1.00 . A A .  35 HIS CB   1 1 
       11  6964 1 1 35 HIS CD2  C    4.210   1.987  -5.248 1.00 . A A .  35 HIS CD2  1 1 
       11  6965 1 1 35 HIS CE1  C    5.728   0.639  -4.420 1.00 . A A .  35 HIS CE1  1 1 
       11  6966 1 1 35 HIS CG   C    5.370   2.679  -5.170 1.00 . A A .  35 HIS CG   1 1 
       11  6967 1 1 35 HIS H    H    4.338   4.532  -3.412 1.00 . A A .  35 HIS H    1 1 
       11  6968 1 1 35 HIS HA   H    7.140   4.559  -4.036 1.00 . A A .  35 HIS HA   1 1 
       11  6969 1 1 35 HIS HB2  H    4.799   4.542  -5.948 1.00 . A A .  35 HIS HB2  1 1 
       11  6970 1 1 35 HIS HB3  H    6.458   4.071  -6.304 1.00 . A A .  35 HIS HB3  1 1 
       11  6971 1 1 35 HIS HD1  H    7.242   2.013  -4.469 1.00 . A A .  35 HIS HD1  1 1 
       11  6972 1 1 35 HIS HD2  H    3.263   2.359  -5.614 1.00 . A A .  35 HIS HD2  1 1 
       11  6973 1 1 35 HIS HE1  H    6.213  -0.235  -4.013 1.00 . A A .  35 HIS HE1  1 1 
       11  6974 1 1 35 HIS N    N    5.254   4.837  -3.246 1.00 . A A .  35 HIS N    1 1 
       11  6975 1 1 35 HIS ND1  N    6.301   1.807  -4.647 1.00 . A A .  35 HIS ND1  1 1 
       11  6976 1 1 35 HIS NE2  N    4.458   0.721  -4.776 1.00 . A A .  35 HIS NE2  1 1 
       11  6977 1 1 35 HIS O    O    7.454   6.821  -5.148 1.00 . A A .  35 HIS O    1 1 
       11  6978 1 1 36 THR C    C    6.533   9.240  -4.647 1.00 . A A .  36 THR C    1 1 
       11  6979 1 1 36 THR CA   C    5.285   8.544  -5.176 1.00 . A A .  36 THR CA   1 1 
       11  6980 1 1 36 THR CB   C    4.039   9.294  -4.669 1.00 . A A .  36 THR CB   1 1 
       11  6981 1 1 36 THR CG2  C    4.030  10.730  -5.172 1.00 . A A .  36 THR CG2  1 1 
       11  6982 1 1 36 THR H    H    4.410   6.741  -4.494 1.00 . A A .  36 THR H    1 1 
       11  6983 1 1 36 THR HA   H    5.290   8.586  -6.255 1.00 . A A .  36 THR HA   1 1 
       11  6984 1 1 36 THR HB   H    4.059   9.307  -3.589 1.00 . A A .  36 THR HB   1 1 
       11  6985 1 1 36 THR HG1  H    2.134   9.258  -5.181 1.00 . A A .  36 THR HG1  1 1 
       11  6986 1 1 36 THR HG21 H    3.225  11.272  -4.698 1.00 . A A .  36 THR HG21 1 1 
       11  6987 1 1 36 THR HG22 H    3.887  10.736  -6.242 1.00 . A A .  36 THR HG22 1 1 
       11  6988 1 1 36 THR HG23 H    4.972  11.201  -4.932 1.00 . A A .  36 THR HG23 1 1 
       11  6989 1 1 36 THR N    N    5.257   7.141  -4.781 1.00 . A A .  36 THR N    1 1 
       11  6990 1 1 36 THR O    O    7.147  10.049  -5.343 1.00 . A A .  36 THR O    1 1 
       11  6991 1 1 36 THR OG1  O    2.851   8.623  -5.106 1.00 . A A .  36 THR OG1  1 1 
       11  6992 1 1 37 ARG C    C    9.169   8.468  -2.570 1.00 . A A .  37 ARG C    1 1 
       11  6993 1 1 37 ARG CA   C    8.081   9.515  -2.789 1.00 . A A .  37 ARG CA   1 1 
       11  6994 1 1 37 ARG CB   C    7.706  10.163  -1.455 1.00 . A A .  37 ARG CB   1 1 
       11  6995 1 1 37 ARG CD   C    6.999   9.670   0.906 1.00 . A A .  37 ARG CD   1 1 
       11  6996 1 1 37 ARG CG   C    6.874   9.264  -0.554 1.00 . A A .  37 ARG CG   1 1 
       11  6997 1 1 37 ARG CZ   C    8.722   9.680   2.660 1.00 . A A .  37 ARG CZ   1 1 
       11  6998 1 1 37 ARG H    H    6.375   8.268  -2.906 1.00 . A A .  37 ARG H    1 1 
       11  6999 1 1 37 ARG HA   H    8.459  10.277  -3.455 1.00 . A A .  37 ARG HA   1 1 
       11  7000 1 1 37 ARG HB2  H    8.611  10.425  -0.928 1.00 . A A .  37 ARG HB2  1 1 
       11  7001 1 1 37 ARG HB3  H    7.140  11.061  -1.651 1.00 . A A .  37 ARG HB3  1 1 
       11  7002 1 1 37 ARG HD2  H    6.649  10.685   1.015 1.00 . A A .  37 ARG HD2  1 1 
       11  7003 1 1 37 ARG HD3  H    6.385   9.011   1.502 1.00 . A A .  37 ARG HD3  1 1 
       11  7004 1 1 37 ARG HE   H    9.082   9.465   0.710 1.00 . A A .  37 ARG HE   1 1 
       11  7005 1 1 37 ARG HG2  H    5.837   9.336  -0.849 1.00 . A A .  37 ARG HG2  1 1 
       11  7006 1 1 37 ARG HG3  H    7.213   8.245  -0.667 1.00 . A A .  37 ARG HG3  1 1 
       11  7007 1 1 37 ARG HH11 H    6.829   9.910   3.326 1.00 . A A .  37 ARG HH11 1 1 
       11  7008 1 1 37 ARG HH12 H    8.053   9.915   4.552 1.00 . A A .  37 ARG HH12 1 1 
       11  7009 1 1 37 ARG HH21 H   10.703   9.470   2.315 1.00 . A A .  37 ARG HH21 1 1 
       11  7010 1 1 37 ARG HH22 H   10.256   9.666   3.976 1.00 . A A .  37 ARG HH22 1 1 
       11  7011 1 1 37 ARG N    N    6.905   8.920  -3.411 1.00 . A A .  37 ARG N    1 1 
       11  7012 1 1 37 ARG NE   N    8.378   9.590   1.380 1.00 . A A .  37 ARG NE   1 1 
       11  7013 1 1 37 ARG NH1  N    7.791   9.850   3.589 1.00 . A A .  37 ARG NH1  1 1 
       11  7014 1 1 37 ARG NH2  N    9.998   9.598   3.013 1.00 . A A .  37 ARG NH2  1 1 
       11  7015 1 1 37 ARG O    O    8.976   7.504  -1.830 1.00 . A A .  37 ARG O    1 1 
       11  7016 1 1 38 GLU C    C   12.493   8.289  -2.149 1.00 . A A .  38 GLU C    1 1 
       11  7017 1 1 38 GLU CA   C   11.431   7.738  -3.096 1.00 . A A .  38 GLU CA   1 1 
       11  7018 1 1 38 GLU CB   C   12.048   7.463  -4.468 1.00 . A A .  38 GLU CB   1 1 
       11  7019 1 1 38 GLU CD   C   11.865   6.211  -6.655 1.00 . A A .  38 GLU CD   1 1 
       11  7020 1 1 38 GLU CG   C   11.365   6.338  -5.228 1.00 . A A .  38 GLU CG   1 1 
       11  7021 1 1 38 GLU H    H   10.406   9.454  -3.794 1.00 . A A .  38 GLU H    1 1 
       11  7022 1 1 38 GLU HA   H   11.050   6.812  -2.691 1.00 . A A .  38 GLU HA   1 1 
       11  7023 1 1 38 GLU HB2  H   11.987   8.362  -5.064 1.00 . A A .  38 GLU HB2  1 1 
       11  7024 1 1 38 GLU HB3  H   13.087   7.200  -4.336 1.00 . A A .  38 GLU HB3  1 1 
       11  7025 1 1 38 GLU HG2  H   11.552   5.407  -4.714 1.00 . A A .  38 GLU HG2  1 1 
       11  7026 1 1 38 GLU HG3  H   10.302   6.529  -5.250 1.00 . A A .  38 GLU HG3  1 1 
       11  7027 1 1 38 GLU N    N   10.313   8.666  -3.219 1.00 . A A .  38 GLU N    1 1 
       11  7028 1 1 38 GLU O    O   13.495   8.857  -2.584 1.00 . A A .  38 GLU O    1 1 
       11  7029 1 1 38 GLU OE1  O   13.044   6.539  -6.901 1.00 . A A .  38 GLU OE1  1 1 
       11  7030 1 1 38 GLU OE2  O   11.077   5.783  -7.524 1.00 . A A .  38 GLU OE2  1 1 
       11  7031 1 1 39 LYS C    C   13.166   7.707   1.399 1.00 . A A .  39 LYS C    1 1 
       11  7032 1 1 39 LYS CA   C   13.204   8.594   0.159 1.00 . A A .  39 LYS CA   1 1 
       11  7033 1 1 39 LYS CB   C   12.878  10.039   0.543 1.00 . A A .  39 LYS CB   1 1 
       11  7034 1 1 39 LYS CD   C   13.218  12.484   0.075 1.00 . A A .  39 LYS CD   1 1 
       11  7035 1 1 39 LYS CE   C   13.931  13.501  -0.802 1.00 . A A .  39 LYS CE   1 1 
       11  7036 1 1 39 LYS CG   C   13.433  11.067  -0.429 1.00 . A A .  39 LYS CG   1 1 
       11  7037 1 1 39 LYS H    H   11.450   7.655  -0.565 1.00 . A A .  39 LYS H    1 1 
       11  7038 1 1 39 LYS HA   H   14.196   8.558  -0.265 1.00 . A A .  39 LYS HA   1 1 
       11  7039 1 1 39 LYS HB2  H   11.805  10.156   0.583 1.00 . A A .  39 LYS HB2  1 1 
       11  7040 1 1 39 LYS HB3  H   13.290  10.241   1.521 1.00 . A A .  39 LYS HB3  1 1 
       11  7041 1 1 39 LYS HD2  H   12.160  12.701   0.071 1.00 . A A .  39 LYS HD2  1 1 
       11  7042 1 1 39 LYS HD3  H   13.599  12.560   1.083 1.00 . A A .  39 LYS HD3  1 1 
       11  7043 1 1 39 LYS HE2  H   14.992  13.436  -0.617 1.00 . A A .  39 LYS HE2  1 1 
       11  7044 1 1 39 LYS HE3  H   13.731  13.267  -1.838 1.00 . A A .  39 LYS HE3  1 1 
       11  7045 1 1 39 LYS HG2  H   14.493  10.897  -0.552 1.00 . A A .  39 LYS HG2  1 1 
       11  7046 1 1 39 LYS HG3  H   12.936  10.953  -1.382 1.00 . A A .  39 LYS HG3  1 1 
       11  7047 1 1 39 LYS HZ1  H   14.295  15.511  -0.365 1.00 . A A .  39 LYS HZ1  1 1 
       11  7048 1 1 39 LYS HZ2  H   12.874  14.906   0.326 1.00 . A A .  39 LYS HZ2  1 1 
       11  7049 1 1 39 LYS HZ3  H   12.927  15.256  -1.327 1.00 . A A .  39 LYS HZ3  1 1 
       11  7050 1 1 39 LYS N    N   12.267   8.116  -0.851 1.00 . A A .  39 LYS N    1 1 
       11  7051 1 1 39 LYS NZ   N   13.475  14.891  -0.523 1.00 . A A .  39 LYS NZ   1 1 
       11  7052 1 1 39 LYS O    O   12.175   7.032   1.679 1.00 . A A .  39 LYS O    1 1 
       11  7053 1 1 40 PRO C    C   13.491   7.432   4.506 1.00 . A A .  40 PRO C    1 1 
       11  7054 1 1 40 PRO CA   C   14.385   6.910   3.387 1.00 . A A .  40 PRO CA   1 1 
       11  7055 1 1 40 PRO CB   C   15.861   7.058   3.767 1.00 . A A .  40 PRO CB   1 1 
       11  7056 1 1 40 PRO CD   C   15.487   8.489   1.890 1.00 . A A .  40 PRO CD   1 1 
       11  7057 1 1 40 PRO CG   C   16.281   8.351   3.159 1.00 . A A .  40 PRO CG   1 1 
       11  7058 1 1 40 PRO HA   H   14.161   5.869   3.204 1.00 . A A .  40 PRO HA   1 1 
       11  7059 1 1 40 PRO HB2  H   15.957   7.077   4.844 1.00 . A A .  40 PRO HB2  1 1 
       11  7060 1 1 40 PRO HB3  H   16.425   6.230   3.364 1.00 . A A .  40 PRO HB3  1 1 
       11  7061 1 1 40 PRO HD2  H   15.247   9.526   1.706 1.00 . A A .  40 PRO HD2  1 1 
       11  7062 1 1 40 PRO HD3  H   16.033   8.072   1.056 1.00 . A A .  40 PRO HD3  1 1 
       11  7063 1 1 40 PRO HG2  H   16.056   9.164   3.833 1.00 . A A .  40 PRO HG2  1 1 
       11  7064 1 1 40 PRO HG3  H   17.338   8.326   2.939 1.00 . A A .  40 PRO HG3  1 1 
       11  7065 1 1 40 PRO N    N   14.269   7.708   2.163 1.00 . A A .  40 PRO N    1 1 
       11  7066 1 1 40 PRO O    O   13.137   8.610   4.532 1.00 . A A .  40 PRO O    1 1 
       11  7067 1 1 41 SER C    C   12.562   8.347   7.004 1.00 . A A .  41 SER C    1 1 
       11  7068 1 1 41 SER CA   C   12.275   6.919   6.551 1.00 . A A .  41 SER CA   1 1 
       11  7069 1 1 41 SER CB   C   12.479   5.951   7.718 1.00 . A A .  41 SER CB   1 1 
       11  7070 1 1 41 SER H    H   13.446   5.622   5.355 1.00 . A A .  41 SER H    1 1 
       11  7071 1 1 41 SER HA   H   11.249   6.858   6.219 1.00 . A A .  41 SER HA   1 1 
       11  7072 1 1 41 SER HB2  H   13.460   6.103   8.142 1.00 . A A .  41 SER HB2  1 1 
       11  7073 1 1 41 SER HB3  H   11.728   6.138   8.473 1.00 . A A .  41 SER HB3  1 1 
       11  7074 1 1 41 SER HG   H   13.210   4.158   7.418 1.00 . A A .  41 SER HG   1 1 
       11  7075 1 1 41 SER N    N   13.131   6.547   5.430 1.00 . A A .  41 SER N    1 1 
       11  7076 1 1 41 SER O    O   13.639   8.641   7.521 1.00 . A A .  41 SER O    1 1 
       11  7077 1 1 41 SER OG   O   12.370   4.604   7.290 1.00 . A A .  41 SER OG   1 1 
       11  7078 1 1 42 GLY C    C   11.518  10.834   8.680 1.00 . A A .  42 GLY C    1 1 
       11  7079 1 1 42 GLY CA   C   11.756  10.618   7.198 1.00 . A A .  42 GLY CA   1 1 
       11  7080 1 1 42 GLY H    H   10.752   8.939   6.389 1.00 . A A .  42 GLY H    1 1 
       11  7081 1 1 42 GLY HA2  H   12.761  10.931   6.956 1.00 . A A .  42 GLY HA2  1 1 
       11  7082 1 1 42 GLY HA3  H   11.057  11.225   6.641 1.00 . A A .  42 GLY HA3  1 1 
       11  7083 1 1 42 GLY N    N   11.589   9.231   6.805 1.00 . A A .  42 GLY N    1 1 
       11  7084 1 1 42 GLY O    O   10.701  10.156   9.304 1.00 . A A .  42 GLY O    1 1 
       11  7085 1 1 43 PRO C    C   10.795  12.786  11.025 1.00 . A A .  43 PRO C    1 1 
       11  7086 1 1 43 PRO CA   C   12.126  12.122  10.690 1.00 . A A .  43 PRO CA   1 1 
       11  7087 1 1 43 PRO CB   C   13.284  13.094  10.930 1.00 . A A .  43 PRO CB   1 1 
       11  7088 1 1 43 PRO CD   C   13.236  12.645   8.582 1.00 . A A .  43 PRO CD   1 1 
       11  7089 1 1 43 PRO CG   C   13.543  13.710   9.598 1.00 . A A .  43 PRO CG   1 1 
       11  7090 1 1 43 PRO HA   H   12.256  11.246  11.309 1.00 . A A .  43 PRO HA   1 1 
       11  7091 1 1 43 PRO HB2  H   12.989  13.836  11.658 1.00 . A A .  43 PRO HB2  1 1 
       11  7092 1 1 43 PRO HB3  H   14.146  12.552  11.288 1.00 . A A .  43 PRO HB3  1 1 
       11  7093 1 1 43 PRO HD2  H   12.818  13.084   7.689 1.00 . A A .  43 PRO HD2  1 1 
       11  7094 1 1 43 PRO HD3  H   14.126  12.081   8.346 1.00 . A A .  43 PRO HD3  1 1 
       11  7095 1 1 43 PRO HG2  H   12.895  14.562   9.455 1.00 . A A .  43 PRO HG2  1 1 
       11  7096 1 1 43 PRO HG3  H   14.578  14.008   9.527 1.00 . A A .  43 PRO HG3  1 1 
       11  7097 1 1 43 PRO N    N   12.244  11.797   9.266 1.00 . A A .  43 PRO N    1 1 
       11  7098 1 1 43 PRO O    O   10.661  14.006  10.942 1.00 . A A .  43 PRO O    1 1 
       11  7099 1 1 44 SER C    C    8.543  13.307  13.033 1.00 . A A .  44 SER C    1 1 
       11  7100 1 1 44 SER CA   C    8.491  12.483  11.750 1.00 . A A .  44 SER CA   1 1 
       11  7101 1 1 44 SER CB   C    7.503  11.326  11.913 1.00 . A A .  44 SER CB   1 1 
       11  7102 1 1 44 SER H    H    9.982  11.009  11.452 1.00 . A A .  44 SER H    1 1 
       11  7103 1 1 44 SER HA   H    8.159  13.118  10.942 1.00 . A A .  44 SER HA   1 1 
       11  7104 1 1 44 SER HB2  H    8.025  10.460  12.287 1.00 . A A .  44 SER HB2  1 1 
       11  7105 1 1 44 SER HB3  H    6.731  11.612  12.613 1.00 . A A .  44 SER HB3  1 1 
       11  7106 1 1 44 SER HG   H    6.905  11.763  10.099 1.00 . A A .  44 SER HG   1 1 
       11  7107 1 1 44 SER N    N    9.813  11.974  11.405 1.00 . A A .  44 SER N    1 1 
       11  7108 1 1 44 SER O    O    8.532  12.760  14.136 1.00 . A A .  44 SER O    1 1 
       11  7109 1 1 44 SER OG   O    6.897  10.995  10.675 1.00 . A A .  44 SER OG   1 1 
       11  7110 1 1 45 SER C    C    7.260  15.809  14.565 1.00 . A A .  45 SER C    1 1 
       11  7111 1 1 45 SER CA   C    8.659  15.526  14.025 1.00 . A A .  45 SER CA   1 1 
       11  7112 1 1 45 SER CB   C    9.342  16.838  13.635 1.00 . A A .  45 SER CB   1 1 
       11  7113 1 1 45 SER H    H    8.606  15.002  11.975 1.00 . A A .  45 SER H    1 1 
       11  7114 1 1 45 SER HA   H    9.239  15.044  14.797 1.00 . A A .  45 SER HA   1 1 
       11  7115 1 1 45 SER HB2  H    8.996  17.146  12.661 1.00 . A A .  45 SER HB2  1 1 
       11  7116 1 1 45 SER HB3  H    9.096  17.599  14.362 1.00 . A A .  45 SER HB3  1 1 
       11  7117 1 1 45 SER HG   H   10.969  15.766  13.428 1.00 . A A .  45 SER HG   1 1 
       11  7118 1 1 45 SER N    N    8.601  14.626  12.880 1.00 . A A .  45 SER N    1 1 
       11  7119 1 1 45 SER O    O    6.289  15.858  13.811 1.00 . A A .  45 SER O    1 1 
       11  7120 1 1 45 SER OG   O   10.751  16.686  13.592 1.00 . A A .  45 SER OG   1 1 
       11  7121 1 1 46 GLY C    C    5.958  17.400  17.508 1.00 . A A .  46 GLY C    1 1 
       11  7122 1 1 46 GLY CA   C    5.883  16.271  16.499 1.00 . A A .  46 GLY CA   1 1 
       11  7123 1 1 46 GLY H    H    7.974  15.945  16.431 1.00 . A A .  46 GLY H    1 1 
       11  7124 1 1 46 GLY HA2  H    5.173  16.536  15.729 1.00 . A A .  46 GLY HA2  1 1 
       11  7125 1 1 46 GLY HA3  H    5.539  15.378  17.000 1.00 . A A .  46 GLY HA3  1 1 
       11  7126 1 1 46 GLY N    N    7.166  15.996  15.879 1.00 . A A .  46 GLY N    1 1 
       11  7127 1 1 46 GLY O    O    6.634  17.251  18.524 1.00 . A A .  46 GLY O    1 1 
       11  7128 2 2  1 ZN  ZN   ZN   3.006  -0.602  -4.441 1.00 . B A . 181 ZN  ZN   1 1 
       12  7129 1 1  1 GLY C    C   13.107 -15.944  -3.689 1.00 . A A .   1 GLY C    1 1 
       12  7130 1 1  1 GLY CA   C   14.395 -15.801  -2.902 1.00 . A A .   1 GLY CA   1 1 
       12  7131 1 1  1 GLY H1   H   14.664 -13.864  -3.713 1.00 . A A .   1 GLY H1   1 1 
       12  7132 1 1  1 GLY HA2  H   15.115 -16.513  -3.277 1.00 . A A .   1 GLY HA2  1 1 
       12  7133 1 1  1 GLY HA3  H   14.194 -16.019  -1.864 1.00 . A A .   1 GLY HA3  1 1 
       12  7134 1 1  1 GLY N    N   14.960 -14.468  -3.000 1.00 . A A .   1 GLY N    1 1 
       12  7135 1 1  1 GLY O    O   12.742 -15.058  -4.461 1.00 . A A .   1 GLY O    1 1 
       12  7136 1 1  2 SER C    C   10.370 -18.421  -3.500 1.00 . A A .   2 SER C    1 1 
       12  7137 1 1  2 SER CA   C   11.167 -17.323  -4.197 1.00 . A A .   2 SER CA   1 1 
       12  7138 1 1  2 SER CB   C   11.444 -17.722  -5.648 1.00 . A A .   2 SER CB   1 1 
       12  7139 1 1  2 SER H    H   12.762 -17.733  -2.867 1.00 . A A .   2 SER H    1 1 
       12  7140 1 1  2 SER HA   H   10.587 -16.412  -4.188 1.00 . A A .   2 SER HA   1 1 
       12  7141 1 1  2 SER HB2  H   10.508 -17.826  -6.175 1.00 . A A .   2 SER HB2  1 1 
       12  7142 1 1  2 SER HB3  H   12.041 -16.956  -6.121 1.00 . A A .   2 SER HB3  1 1 
       12  7143 1 1  2 SER HG   H   11.714 -19.597  -5.148 1.00 . A A .   2 SER HG   1 1 
       12  7144 1 1  2 SER N    N   12.418 -17.064  -3.495 1.00 . A A .   2 SER N    1 1 
       12  7145 1 1  2 SER O    O   10.912 -19.469  -3.148 1.00 . A A .   2 SER O    1 1 
       12  7146 1 1  2 SER OG   O   12.145 -18.952  -5.714 1.00 . A A .   2 SER OG   1 1 
       12  7147 1 1  3 SER C    C    6.816 -19.131  -3.273 1.00 . A A .   3 SER C    1 1 
       12  7148 1 1  3 SER CA   C    8.206 -19.138  -2.644 1.00 . A A .   3 SER CA   1 1 
       12  7149 1 1  3 SER CB   C    8.104 -18.827  -1.149 1.00 . A A .   3 SER CB   1 1 
       12  7150 1 1  3 SER H    H    8.705 -17.319  -3.606 1.00 . A A .   3 SER H    1 1 
       12  7151 1 1  3 SER HA   H    8.641 -20.118  -2.771 1.00 . A A .   3 SER HA   1 1 
       12  7152 1 1  3 SER HB2  H    7.667 -17.849  -1.017 1.00 . A A .   3 SER HB2  1 1 
       12  7153 1 1  3 SER HB3  H    7.479 -19.569  -0.673 1.00 . A A .   3 SER HB3  1 1 
       12  7154 1 1  3 SER HG   H    9.901 -18.103  -0.858 1.00 . A A .   3 SER HG   1 1 
       12  7155 1 1  3 SER N    N    9.079 -18.173  -3.303 1.00 . A A .   3 SER N    1 1 
       12  7156 1 1  3 SER O    O    6.507 -18.289  -4.115 1.00 . A A .   3 SER O    1 1 
       12  7157 1 1  3 SER OG   O    9.382 -18.844  -0.537 1.00 . A A .   3 SER OG   1 1 
       12  7158 1 1  4 GLY C    C    3.763 -19.000  -2.955 1.00 . A A .   4 GLY C    1 1 
       12  7159 1 1  4 GLY CA   C    4.633 -20.164  -3.388 1.00 . A A .   4 GLY CA   1 1 
       12  7160 1 1  4 GLY H    H    6.281 -20.722  -2.182 1.00 . A A .   4 GLY H    1 1 
       12  7161 1 1  4 GLY HA2  H    4.684 -20.181  -4.466 1.00 . A A .   4 GLY HA2  1 1 
       12  7162 1 1  4 GLY HA3  H    4.181 -21.083  -3.044 1.00 . A A .   4 GLY HA3  1 1 
       12  7163 1 1  4 GLY N    N    5.980 -20.077  -2.856 1.00 . A A .   4 GLY N    1 1 
       12  7164 1 1  4 GLY O    O    3.993 -18.401  -1.905 1.00 . A A .   4 GLY O    1 1 
       12  7165 1 1  5 SER C    C    0.408 -17.978  -3.708 1.00 . A A .   5 SER C    1 1 
       12  7166 1 1  5 SER CA   C    1.859 -17.573  -3.467 1.00 . A A .   5 SER CA   1 1 
       12  7167 1 1  5 SER CB   C    2.208 -16.353  -4.321 1.00 . A A .   5 SER CB   1 1 
       12  7168 1 1  5 SER H    H    2.631 -19.192  -4.592 1.00 . A A .   5 SER H    1 1 
       12  7169 1 1  5 SER HA   H    1.981 -17.319  -2.425 1.00 . A A .   5 SER HA   1 1 
       12  7170 1 1  5 SER HB2  H    3.248 -16.101  -4.178 1.00 . A A .   5 SER HB2  1 1 
       12  7171 1 1  5 SER HB3  H    2.033 -16.583  -5.362 1.00 . A A .   5 SER HB3  1 1 
       12  7172 1 1  5 SER HG   H    1.296 -14.667  -4.727 1.00 . A A .   5 SER HG   1 1 
       12  7173 1 1  5 SER N    N    2.763 -18.677  -3.768 1.00 . A A .   5 SER N    1 1 
       12  7174 1 1  5 SER O    O    0.129 -18.917  -4.453 1.00 . A A .   5 SER O    1 1 
       12  7175 1 1  5 SER OG   O    1.414 -15.235  -3.962 1.00 . A A .   5 SER OG   1 1 
       12  7176 1 1  6 SER C    C   -2.609 -16.523  -4.119 1.00 . A A .   6 SER C    1 1 
       12  7177 1 1  6 SER CA   C   -1.936 -17.548  -3.211 1.00 . A A .   6 SER CA   1 1 
       12  7178 1 1  6 SER CB   C   -2.615 -17.555  -1.840 1.00 . A A .   6 SER CB   1 1 
       12  7179 1 1  6 SER H    H   -0.229 -16.525  -2.490 1.00 . A A .   6 SER H    1 1 
       12  7180 1 1  6 SER HA   H   -2.035 -18.526  -3.658 1.00 . A A .   6 SER HA   1 1 
       12  7181 1 1  6 SER HB2  H   -2.513 -16.581  -1.386 1.00 . A A .   6 SER HB2  1 1 
       12  7182 1 1  6 SER HB3  H   -3.663 -17.788  -1.962 1.00 . A A .   6 SER HB3  1 1 
       12  7183 1 1  6 SER HG   H   -2.718 -18.994  -0.515 1.00 . A A .   6 SER HG   1 1 
       12  7184 1 1  6 SER N    N   -0.513 -17.262  -3.071 1.00 . A A .   6 SER N    1 1 
       12  7185 1 1  6 SER O    O   -2.309 -15.331  -4.058 1.00 . A A .   6 SER O    1 1 
       12  7186 1 1  6 SER OG   O   -2.028 -18.521  -0.986 1.00 . A A .   6 SER OG   1 1 
       12  7187 1 1  7 GLY C    C   -5.571 -15.672  -5.330 1.00 . A A .   7 GLY C    1 1 
       12  7188 1 1  7 GLY CA   C   -4.224 -16.109  -5.871 1.00 . A A .   7 GLY CA   1 1 
       12  7189 1 1  7 GLY H    H   -3.721 -17.956  -4.966 1.00 . A A .   7 GLY H    1 1 
       12  7190 1 1  7 GLY HA2  H   -3.616 -15.234  -6.044 1.00 . A A .   7 GLY HA2  1 1 
       12  7191 1 1  7 GLY HA3  H   -4.376 -16.621  -6.810 1.00 . A A .   7 GLY HA3  1 1 
       12  7192 1 1  7 GLY N    N   -3.522 -16.996  -4.962 1.00 . A A .   7 GLY N    1 1 
       12  7193 1 1  7 GLY O    O   -5.754 -14.509  -4.971 1.00 . A A .   7 GLY O    1 1 
       12  7194 1 1  8 GLU C    C   -8.510 -15.207  -5.601 1.00 . A A .   8 GLU C    1 1 
       12  7195 1 1  8 GLU CA   C   -7.853 -16.308  -4.774 1.00 . A A .   8 GLU CA   1 1 
       12  7196 1 1  8 GLU CB   C   -7.792 -15.888  -3.304 1.00 . A A .   8 GLU CB   1 1 
       12  7197 1 1  8 GLU CD   C   -9.597 -17.437  -2.454 1.00 . A A .   8 GLU CD   1 1 
       12  7198 1 1  8 GLU CG   C   -9.124 -16.002  -2.582 1.00 . A A .   8 GLU CG   1 1 
       12  7199 1 1  8 GLU H    H   -6.309 -17.515  -5.574 1.00 . A A .   8 GLU H    1 1 
       12  7200 1 1  8 GLU HA   H   -8.446 -17.207  -4.857 1.00 . A A .   8 GLU HA   1 1 
       12  7201 1 1  8 GLU HB2  H   -7.073 -16.512  -2.793 1.00 . A A .   8 GLU HB2  1 1 
       12  7202 1 1  8 GLU HB3  H   -7.464 -14.860  -3.249 1.00 . A A .   8 GLU HB3  1 1 
       12  7203 1 1  8 GLU HG2  H   -9.019 -15.585  -1.591 1.00 . A A .   8 GLU HG2  1 1 
       12  7204 1 1  8 GLU HG3  H   -9.866 -15.441  -3.131 1.00 . A A .   8 GLU HG3  1 1 
       12  7205 1 1  8 GLU N    N   -6.516 -16.605  -5.273 1.00 . A A .   8 GLU N    1 1 
       12  7206 1 1  8 GLU O    O   -9.147 -14.304  -5.060 1.00 . A A .   8 GLU O    1 1 
       12  7207 1 1  8 GLU OE1  O   -9.134 -18.135  -1.528 1.00 . A A .   8 GLU OE1  1 1 
       12  7208 1 1  8 GLU OE2  O  -10.431 -17.862  -3.282 1.00 . A A .   8 GLU OE2  1 1 
       12  7209 1 1  9 GLY C    C   -8.044 -13.080  -7.971 1.00 . A A .   9 GLY C    1 1 
       12  7210 1 1  9 GLY CA   C   -8.933 -14.295  -7.801 1.00 . A A .   9 GLY CA   1 1 
       12  7211 1 1  9 GLY H    H   -7.833 -16.032  -7.295 1.00 . A A .   9 GLY H    1 1 
       12  7212 1 1  9 GLY HA2  H   -9.102 -14.743  -8.768 1.00 . A A .   9 GLY HA2  1 1 
       12  7213 1 1  9 GLY HA3  H   -9.881 -13.978  -7.391 1.00 . A A .   9 GLY HA3  1 1 
       12  7214 1 1  9 GLY N    N   -8.351 -15.290  -6.919 1.00 . A A .   9 GLY N    1 1 
       12  7215 1 1  9 GLY O    O   -7.599 -12.486  -6.989 1.00 . A A .   9 GLY O    1 1 
       12  7216 1 1 10 GLU C    C   -7.784 -10.343  -9.884 1.00 . A A .  10 GLU C    1 1 
       12  7217 1 1 10 GLU CA   C   -6.938 -11.558  -9.515 1.00 . A A .  10 GLU CA   1 1 
       12  7218 1 1 10 GLU CB   C   -5.970 -11.885 -10.655 1.00 . A A .  10 GLU CB   1 1 
       12  7219 1 1 10 GLU CD   C   -5.693 -12.180 -13.148 1.00 . A A .  10 GLU CD   1 1 
       12  7220 1 1 10 GLU CG   C   -6.661 -12.154 -11.981 1.00 . A A .  10 GLU CG   1 1 
       12  7221 1 1 10 GLU H    H   -8.166 -13.223  -9.962 1.00 . A A .  10 GLU H    1 1 
       12  7222 1 1 10 GLU HA   H   -6.368 -11.329  -8.627 1.00 . A A .  10 GLU HA   1 1 
       12  7223 1 1 10 GLU HB2  H   -5.294 -11.053 -10.786 1.00 . A A .  10 GLU HB2  1 1 
       12  7224 1 1 10 GLU HB3  H   -5.400 -12.762 -10.386 1.00 . A A .  10 GLU HB3  1 1 
       12  7225 1 1 10 GLU HG2  H   -7.160 -13.110 -11.925 1.00 . A A .  10 GLU HG2  1 1 
       12  7226 1 1 10 GLU HG3  H   -7.392 -11.378 -12.155 1.00 . A A .  10 GLU HG3  1 1 
       12  7227 1 1 10 GLU N    N   -7.782 -12.709  -9.221 1.00 . A A .  10 GLU N    1 1 
       12  7228 1 1 10 GLU O    O   -8.785 -10.460 -10.591 1.00 . A A .  10 GLU O    1 1 
       12  7229 1 1 10 GLU OE1  O   -4.534 -12.597 -12.947 1.00 . A A .  10 GLU OE1  1 1 
       12  7230 1 1 10 GLU OE2  O   -6.095 -11.783 -14.262 1.00 . A A .  10 GLU OE2  1 1 
       12  7231 1 1 11 LYS C    C   -7.291  -7.043 -10.619 1.00 . A A .  11 LYS C    1 1 
       12  7232 1 1 11 LYS CA   C   -8.092  -7.937  -9.677 1.00 . A A .  11 LYS CA   1 1 
       12  7233 1 1 11 LYS CB   C   -8.386  -7.190  -8.374 1.00 . A A .  11 LYS CB   1 1 
       12  7234 1 1 11 LYS CD   C   -9.443  -9.069  -7.085 1.00 . A A .  11 LYS CD   1 1 
       12  7235 1 1 11 LYS CE   C  -10.727  -9.598  -6.464 1.00 . A A .  11 LYS CE   1 1 
       12  7236 1 1 11 LYS CG   C   -9.636  -7.677  -7.663 1.00 . A A .  11 LYS CG   1 1 
       12  7237 1 1 11 LYS H    H   -6.568  -9.145  -8.842 1.00 . A A .  11 LYS H    1 1 
       12  7238 1 1 11 LYS HA   H   -9.026  -8.194 -10.153 1.00 . A A .  11 LYS HA   1 1 
       12  7239 1 1 11 LYS HB2  H   -7.546  -7.312  -7.706 1.00 . A A .  11 LYS HB2  1 1 
       12  7240 1 1 11 LYS HB3  H   -8.509  -6.139  -8.596 1.00 . A A .  11 LYS HB3  1 1 
       12  7241 1 1 11 LYS HD2  H   -9.136  -9.738  -7.875 1.00 . A A .  11 LYS HD2  1 1 
       12  7242 1 1 11 LYS HD3  H   -8.675  -9.030  -6.325 1.00 . A A .  11 LYS HD3  1 1 
       12  7243 1 1 11 LYS HE2  H  -10.493 -10.474  -5.879 1.00 . A A .  11 LYS HE2  1 1 
       12  7244 1 1 11 LYS HE3  H  -11.141  -8.835  -5.822 1.00 . A A .  11 LYS HE3  1 1 
       12  7245 1 1 11 LYS HG2  H   -9.871  -6.995  -6.859 1.00 . A A .  11 LYS HG2  1 1 
       12  7246 1 1 11 LYS HG3  H  -10.455  -7.700  -8.368 1.00 . A A .  11 LYS HG3  1 1 
       12  7247 1 1 11 LYS HZ1  H  -12.131  -9.101  -7.929 1.00 . A A .  11 LYS HZ1  1 1 
       12  7248 1 1 11 LYS HZ2  H  -12.507 -10.508  -7.068 1.00 . A A .  11 LYS HZ2  1 1 
       12  7249 1 1 11 LYS HZ3  H  -11.291 -10.536  -8.243 1.00 . A A .  11 LYS HZ3  1 1 
       12  7250 1 1 11 LYS N    N   -7.374  -9.175  -9.399 1.00 . A A .  11 LYS N    1 1 
       12  7251 1 1 11 LYS NZ   N  -11.735  -9.961  -7.499 1.00 . A A .  11 LYS NZ   1 1 
       12  7252 1 1 11 LYS O    O   -6.063  -6.981 -10.560 1.00 . A A .  11 LYS O    1 1 
       12  7253 1 1 12 PRO C    C   -6.780  -4.189 -11.814 1.00 . A A .  12 PRO C    1 1 
       12  7254 1 1 12 PRO CA   C   -7.375  -5.427 -12.477 1.00 . A A .  12 PRO CA   1 1 
       12  7255 1 1 12 PRO CB   C   -8.535  -5.036 -13.396 1.00 . A A .  12 PRO CB   1 1 
       12  7256 1 1 12 PRO CD   C   -9.467  -6.356 -11.635 1.00 . A A .  12 PRO CD   1 1 
       12  7257 1 1 12 PRO CG   C   -9.756  -5.206 -12.559 1.00 . A A .  12 PRO CG   1 1 
       12  7258 1 1 12 PRO HA   H   -6.611  -5.928 -13.052 1.00 . A A .  12 PRO HA   1 1 
       12  7259 1 1 12 PRO HB2  H   -8.414  -4.010 -13.716 1.00 . A A .  12 PRO HB2  1 1 
       12  7260 1 1 12 PRO HB3  H   -8.553  -5.688 -14.256 1.00 . A A .  12 PRO HB3  1 1 
       12  7261 1 1 12 PRO HD2  H   -9.940  -6.198 -10.677 1.00 . A A .  12 PRO HD2  1 1 
       12  7262 1 1 12 PRO HD3  H   -9.800  -7.285 -12.073 1.00 . A A .  12 PRO HD3  1 1 
       12  7263 1 1 12 PRO HG2  H   -9.941  -4.306 -11.992 1.00 . A A .  12 PRO HG2  1 1 
       12  7264 1 1 12 PRO HG3  H  -10.603  -5.435 -13.188 1.00 . A A .  12 PRO HG3  1 1 
       12  7265 1 1 12 PRO N    N   -8.000  -6.332 -11.508 1.00 . A A .  12 PRO N    1 1 
       12  7266 1 1 12 PRO O    O   -6.248  -3.307 -12.488 1.00 . A A .  12 PRO O    1 1 
       12  7267 1 1 13 TYR C    C   -5.051  -3.376  -9.023 1.00 . A A .  13 TYR C    1 1 
       12  7268 1 1 13 TYR CA   C   -6.346  -2.999  -9.737 1.00 . A A .  13 TYR CA   1 1 
       12  7269 1 1 13 TYR CB   C   -7.379  -2.511  -8.719 1.00 . A A .  13 TYR CB   1 1 
       12  7270 1 1 13 TYR CD1  C   -9.522  -2.684 -10.043 1.00 . A A .  13 TYR CD1  1 1 
       12  7271 1 1 13 TYR CD2  C   -8.857  -0.535  -9.257 1.00 . A A .  13 TYR CD2  1 1 
       12  7272 1 1 13 TYR CE1  C  -10.647  -2.130 -10.622 1.00 . A A .  13 TYR CE1  1 1 
       12  7273 1 1 13 TYR CE2  C   -9.980   0.028  -9.832 1.00 . A A .  13 TYR CE2  1 1 
       12  7274 1 1 13 TYR CG   C   -8.609  -1.899  -9.351 1.00 . A A .  13 TYR CG   1 1 
       12  7275 1 1 13 TYR CZ   C  -10.872  -0.773 -10.513 1.00 . A A .  13 TYR CZ   1 1 
       12  7276 1 1 13 TYR H    H   -7.309  -4.864 -10.008 1.00 . A A .  13 TYR H    1 1 
       12  7277 1 1 13 TYR HA   H   -6.140  -2.202 -10.436 1.00 . A A .  13 TYR HA   1 1 
       12  7278 1 1 13 TYR HB2  H   -7.698  -3.344  -8.113 1.00 . A A .  13 TYR HB2  1 1 
       12  7279 1 1 13 TYR HB3  H   -6.924  -1.763  -8.085 1.00 . A A .  13 TYR HB3  1 1 
       12  7280 1 1 13 TYR HD1  H   -9.344  -3.747 -10.126 1.00 . A A .  13 TYR HD1  1 1 
       12  7281 1 1 13 TYR HD2  H   -8.156   0.090  -8.722 1.00 . A A .  13 TYR HD2  1 1 
       12  7282 1 1 13 TYR HE1  H  -11.346  -2.757 -11.156 1.00 . A A .  13 TYR HE1  1 1 
       12  7283 1 1 13 TYR HE2  H  -10.155   1.091  -9.747 1.00 . A A .  13 TYR HE2  1 1 
       12  7284 1 1 13 TYR HH   H  -12.190  -0.673 -11.909 1.00 . A A .  13 TYR HH   1 1 
       12  7285 1 1 13 TYR N    N   -6.874  -4.130 -10.490 1.00 . A A .  13 TYR N    1 1 
       12  7286 1 1 13 TYR O    O   -4.860  -3.053  -7.851 1.00 . A A .  13 TYR O    1 1 
       12  7287 1 1 13 TYR OH   O  -11.990  -0.216 -11.089 1.00 . A A .  13 TYR OH   1 1 
       12  7288 1 1 14 GLN C    C   -1.834  -3.395  -9.347 1.00 . A A .  14 GLN C    1 1 
       12  7289 1 1 14 GLN CA   C   -2.889  -4.482  -9.176 1.00 . A A .  14 GLN CA   1 1 
       12  7290 1 1 14 GLN CB   C   -2.417  -5.777  -9.840 1.00 . A A .  14 GLN CB   1 1 
       12  7291 1 1 14 GLN CD   C   -0.663  -7.593  -9.927 1.00 . A A .  14 GLN CD   1 1 
       12  7292 1 1 14 GLN CG   C   -1.046  -6.236  -9.371 1.00 . A A .  14 GLN CG   1 1 
       12  7293 1 1 14 GLN H    H   -4.377  -4.288 -10.669 1.00 . A A .  14 GLN H    1 1 
       12  7294 1 1 14 GLN HA   H   -3.036  -4.662  -8.122 1.00 . A A .  14 GLN HA   1 1 
       12  7295 1 1 14 GLN HB2  H   -3.129  -6.559  -9.622 1.00 . A A .  14 GLN HB2  1 1 
       12  7296 1 1 14 GLN HB3  H   -2.376  -5.625 -10.908 1.00 . A A .  14 GLN HB3  1 1 
       12  7297 1 1 14 GLN HE21 H    1.193  -7.374  -9.250 1.00 . A A .  14 GLN HE21 1 1 
       12  7298 1 1 14 GLN HE22 H    0.867  -8.852 -10.083 1.00 . A A .  14 GLN HE22 1 1 
       12  7299 1 1 14 GLN HG2  H   -0.310  -5.513  -9.690 1.00 . A A .  14 GLN HG2  1 1 
       12  7300 1 1 14 GLN HG3  H   -1.049  -6.292  -8.292 1.00 . A A .  14 GLN HG3  1 1 
       12  7301 1 1 14 GLN N    N   -4.166  -4.061  -9.740 1.00 . A A .  14 GLN N    1 1 
       12  7302 1 1 14 GLN NE2  N    0.593  -7.979  -9.735 1.00 . A A .  14 GLN NE2  1 1 
       12  7303 1 1 14 GLN O    O   -1.793  -2.709 -10.368 1.00 . A A .  14 GLN O    1 1 
       12  7304 1 1 14 GLN OE1  O   -1.487  -8.287 -10.524 1.00 . A A .  14 GLN OE1  1 1 
       12  7305 1 1 15 CYS C    C    1.235  -2.700  -9.256 1.00 . A A .  15 CYS C    1 1 
       12  7306 1 1 15 CYS CA   C    0.076  -2.239  -8.377 1.00 . A A .  15 CYS CA   1 1 
       12  7307 1 1 15 CYS CB   C    0.580  -1.946  -6.962 1.00 . A A .  15 CYS CB   1 1 
       12  7308 1 1 15 CYS H    H   -1.062  -3.820  -7.551 1.00 . A A .  15 CYS H    1 1 
       12  7309 1 1 15 CYS HA   H   -0.339  -1.335  -8.796 1.00 . A A .  15 CYS HA   1 1 
       12  7310 1 1 15 CYS HB2  H   -0.087  -1.239  -6.490 1.00 . A A .  15 CYS HB2  1 1 
       12  7311 1 1 15 CYS HB3  H    0.586  -2.863  -6.393 1.00 . A A .  15 CYS HB3  1 1 
       12  7312 1 1 15 CYS N    N   -0.980  -3.243  -8.340 1.00 . A A .  15 CYS N    1 1 
       12  7313 1 1 15 CYS O    O    1.954  -3.638  -8.911 1.00 . A A .  15 CYS O    1 1 
       12  7314 1 1 15 CYS SG   S    2.261  -1.244  -6.902 1.00 . A A .  15 CYS SG   1 1 
       12  7315 1 1 16 SER C    C    3.762  -1.631 -10.977 1.00 . A A .  16 SER C    1 1 
       12  7316 1 1 16 SER CA   C    2.478  -2.378 -11.324 1.00 . A A .  16 SER CA   1 1 
       12  7317 1 1 16 SER CB   C    2.057  -2.054 -12.759 1.00 . A A .  16 SER CB   1 1 
       12  7318 1 1 16 SER H    H    0.803  -1.297 -10.613 1.00 . A A .  16 SER H    1 1 
       12  7319 1 1 16 SER HA   H    2.660  -3.440 -11.243 1.00 . A A .  16 SER HA   1 1 
       12  7320 1 1 16 SER HB2  H    1.084  -2.478 -12.951 1.00 . A A .  16 SER HB2  1 1 
       12  7321 1 1 16 SER HB3  H    2.014  -0.982 -12.884 1.00 . A A .  16 SER HB3  1 1 
       12  7322 1 1 16 SER HG   H    2.507  -2.897 -14.469 1.00 . A A .  16 SER HG   1 1 
       12  7323 1 1 16 SER N    N    1.409  -2.035 -10.393 1.00 . A A .  16 SER N    1 1 
       12  7324 1 1 16 SER O    O    4.437  -1.096 -11.855 1.00 . A A .  16 SER O    1 1 
       12  7325 1 1 16 SER OG   O    2.980  -2.586 -13.694 1.00 . A A .  16 SER OG   1 1 
       12  7326 1 1 17 GLU C    C    6.063  -1.785  -8.234 1.00 . A A .  17 GLU C    1 1 
       12  7327 1 1 17 GLU CA   C    5.294  -0.917  -9.226 1.00 . A A .  17 GLU CA   1 1 
       12  7328 1 1 17 GLU CB   C    4.930   0.420  -8.577 1.00 . A A .  17 GLU CB   1 1 
       12  7329 1 1 17 GLU CD   C    6.205   1.986 -10.094 1.00 . A A .  17 GLU CD   1 1 
       12  7330 1 1 17 GLU CG   C    4.846   1.572  -9.563 1.00 . A A .  17 GLU CG   1 1 
       12  7331 1 1 17 GLU H    H    3.512  -2.045  -9.037 1.00 . A A .  17 GLU H    1 1 
       12  7332 1 1 17 GLU HA   H    5.921  -0.731 -10.084 1.00 . A A .  17 GLU HA   1 1 
       12  7333 1 1 17 GLU HB2  H    3.972   0.320  -8.088 1.00 . A A .  17 GLU HB2  1 1 
       12  7334 1 1 17 GLU HB3  H    5.678   0.661  -7.836 1.00 . A A .  17 GLU HB3  1 1 
       12  7335 1 1 17 GLU HG2  H    4.228   1.272 -10.396 1.00 . A A .  17 GLU HG2  1 1 
       12  7336 1 1 17 GLU HG3  H    4.395   2.420  -9.069 1.00 . A A .  17 GLU HG3  1 1 
       12  7337 1 1 17 GLU N    N    4.091  -1.600  -9.690 1.00 . A A .  17 GLU N    1 1 
       12  7338 1 1 17 GLU O    O    7.294  -1.773  -8.206 1.00 . A A .  17 GLU O    1 1 
       12  7339 1 1 17 GLU OE1  O    6.908   2.747  -9.396 1.00 . A A .  17 GLU OE1  1 1 
       12  7340 1 1 17 GLU OE2  O    6.565   1.549 -11.207 1.00 . A A .  17 GLU OE2  1 1 
       12  7341 1 1 18 CYS C    C    5.291  -4.790  -6.442 1.00 . A A .  18 CYS C    1 1 
       12  7342 1 1 18 CYS CA   C    5.939  -3.408  -6.424 1.00 . A A .  18 CYS CA   1 1 
       12  7343 1 1 18 CYS CB   C    5.814  -2.792  -5.030 1.00 . A A .  18 CYS CB   1 1 
       12  7344 1 1 18 CYS H    H    4.351  -2.502  -7.490 1.00 . A A .  18 CYS H    1 1 
       12  7345 1 1 18 CYS HA   H    6.985  -3.512  -6.671 1.00 . A A .  18 CYS HA   1 1 
       12  7346 1 1 18 CYS HB2  H    6.475  -3.314  -4.353 1.00 . A A .  18 CYS HB2  1 1 
       12  7347 1 1 18 CYS HB3  H    6.104  -1.753  -5.077 1.00 . A A .  18 CYS HB3  1 1 
       12  7348 1 1 18 CYS N    N    5.328  -2.536  -7.420 1.00 . A A .  18 CYS N    1 1 
       12  7349 1 1 18 CYS O    O    5.975  -5.809  -6.358 1.00 . A A .  18 CYS O    1 1 
       12  7350 1 1 18 CYS SG   S    4.134  -2.869  -4.330 1.00 . A A .  18 CYS SG   1 1 
       12  7351 1 1 19 GLY C    C    2.249  -6.198  -5.445 1.00 . A A .  19 GLY C    1 1 
       12  7352 1 1 19 GLY CA   C    3.248  -6.076  -6.578 1.00 . A A .  19 GLY CA   1 1 
       12  7353 1 1 19 GLY H    H    3.473  -3.971  -6.615 1.00 . A A .  19 GLY H    1 1 
       12  7354 1 1 19 GLY HA2  H    2.723  -6.159  -7.518 1.00 . A A .  19 GLY HA2  1 1 
       12  7355 1 1 19 GLY HA3  H    3.960  -6.884  -6.503 1.00 . A A .  19 GLY HA3  1 1 
       12  7356 1 1 19 GLY N    N    3.966  -4.815  -6.551 1.00 . A A .  19 GLY N    1 1 
       12  7357 1 1 19 GLY O    O    2.529  -6.829  -4.425 1.00 . A A .  19 GLY O    1 1 
       12  7358 1 1 20 LYS C    C   -1.348  -5.658  -5.248 1.00 . A A .  20 LYS C    1 1 
       12  7359 1 1 20 LYS CA   C    0.035  -5.633  -4.605 1.00 . A A .  20 LYS CA   1 1 
       12  7360 1 1 20 LYS CB   C    0.153  -4.426  -3.671 1.00 . A A .  20 LYS CB   1 1 
       12  7361 1 1 20 LYS CD   C    1.083  -5.356  -1.531 1.00 . A A .  20 LYS CD   1 1 
       12  7362 1 1 20 LYS CE   C    2.297  -5.436  -0.618 1.00 . A A .  20 LYS CE   1 1 
       12  7363 1 1 20 LYS CG   C    1.357  -4.488  -2.747 1.00 . A A .  20 LYS CG   1 1 
       12  7364 1 1 20 LYS H    H    0.916  -5.103  -6.455 1.00 . A A .  20 LYS H    1 1 
       12  7365 1 1 20 LYS HA   H    0.168  -6.537  -4.030 1.00 . A A .  20 LYS HA   1 1 
       12  7366 1 1 20 LYS HB2  H    0.230  -3.530  -4.269 1.00 . A A .  20 LYS HB2  1 1 
       12  7367 1 1 20 LYS HB3  H   -0.738  -4.368  -3.063 1.00 . A A .  20 LYS HB3  1 1 
       12  7368 1 1 20 LYS HD2  H    0.257  -4.934  -0.977 1.00 . A A .  20 LYS HD2  1 1 
       12  7369 1 1 20 LYS HD3  H    0.825  -6.352  -1.861 1.00 . A A .  20 LYS HD3  1 1 
       12  7370 1 1 20 LYS HE2  H    2.974  -6.180  -1.006 1.00 . A A .  20 LYS HE2  1 1 
       12  7371 1 1 20 LYS HE3  H    2.786  -4.473  -0.607 1.00 . A A .  20 LYS HE3  1 1 
       12  7372 1 1 20 LYS HG2  H    2.195  -4.901  -3.289 1.00 . A A .  20 LYS HG2  1 1 
       12  7373 1 1 20 LYS HG3  H    1.598  -3.487  -2.417 1.00 . A A .  20 LYS HG3  1 1 
       12  7374 1 1 20 LYS HZ1  H    1.068  -6.400   0.770 1.00 . A A .  20 LYS HZ1  1 1 
       12  7375 1 1 20 LYS HZ2  H    1.725  -4.945   1.331 1.00 . A A .  20 LYS HZ2  1 1 
       12  7376 1 1 20 LYS HZ3  H    2.694  -6.327   1.229 1.00 . A A .  20 LYS HZ3  1 1 
       12  7377 1 1 20 LYS N    N    1.080  -5.591  -5.621 1.00 . A A .  20 LYS N    1 1 
       12  7378 1 1 20 LYS NZ   N    1.919  -5.803   0.775 1.00 . A A .  20 LYS NZ   1 1 
       12  7379 1 1 20 LYS O    O   -1.534  -5.167  -6.361 1.00 . A A .  20 LYS O    1 1 
       12  7380 1 1 21 SER C    C   -4.622  -5.451  -4.217 1.00 . A A .  21 SER C    1 1 
       12  7381 1 1 21 SER CA   C   -3.681  -6.322  -5.042 1.00 . A A .  21 SER CA   1 1 
       12  7382 1 1 21 SER CB   C   -4.160  -7.775  -5.019 1.00 . A A .  21 SER CB   1 1 
       12  7383 1 1 21 SER H    H   -2.104  -6.605  -3.657 1.00 . A A .  21 SER H    1 1 
       12  7384 1 1 21 SER HA   H   -3.682  -5.968  -6.062 1.00 . A A .  21 SER HA   1 1 
       12  7385 1 1 21 SER HB2  H   -5.123  -7.841  -5.502 1.00 . A A .  21 SER HB2  1 1 
       12  7386 1 1 21 SER HB3  H   -3.449  -8.394  -5.546 1.00 . A A .  21 SER HB3  1 1 
       12  7387 1 1 21 SER HG   H   -4.698  -7.577  -3.145 1.00 . A A .  21 SER HG   1 1 
       12  7388 1 1 21 SER N    N   -2.315  -6.231  -4.539 1.00 . A A .  21 SER N    1 1 
       12  7389 1 1 21 SER O    O   -4.503  -5.373  -2.994 1.00 . A A .  21 SER O    1 1 
       12  7390 1 1 21 SER OG   O   -4.282  -8.250  -3.689 1.00 . A A .  21 SER OG   1 1 
       12  7391 1 1 22 PHE C    C   -7.903  -4.057  -4.862 1.00 . A A .  22 PHE C    1 1 
       12  7392 1 1 22 PHE CA   C   -6.522  -3.928  -4.226 1.00 . A A .  22 PHE CA   1 1 
       12  7393 1 1 22 PHE CB   C   -6.055  -2.472  -4.283 1.00 . A A .  22 PHE CB   1 1 
       12  7394 1 1 22 PHE CD1  C   -3.563  -2.563  -4.003 1.00 . A A .  22 PHE CD1  1 1 
       12  7395 1 1 22 PHE CD2  C   -4.867  -1.619  -2.244 1.00 . A A .  22 PHE CD2  1 1 
       12  7396 1 1 22 PHE CE1  C   -2.409  -2.325  -3.280 1.00 . A A .  22 PHE CE1  1 1 
       12  7397 1 1 22 PHE CE2  C   -3.717  -1.379  -1.516 1.00 . A A .  22 PHE CE2  1 1 
       12  7398 1 1 22 PHE CG   C   -4.803  -2.213  -3.494 1.00 . A A .  22 PHE CG   1 1 
       12  7399 1 1 22 PHE CZ   C   -2.487  -1.733  -2.034 1.00 . A A .  22 PHE CZ   1 1 
       12  7400 1 1 22 PHE H    H   -5.603  -4.898  -5.869 1.00 . A A .  22 PHE H    1 1 
       12  7401 1 1 22 PHE HA   H   -6.584  -4.237  -3.194 1.00 . A A .  22 PHE HA   1 1 
       12  7402 1 1 22 PHE HB2  H   -5.860  -2.205  -5.311 1.00 . A A .  22 PHE HB2  1 1 
       12  7403 1 1 22 PHE HB3  H   -6.834  -1.836  -3.891 1.00 . A A .  22 PHE HB3  1 1 
       12  7404 1 1 22 PHE HD1  H   -3.501  -3.027  -4.978 1.00 . A A .  22 PHE HD1  1 1 
       12  7405 1 1 22 PHE HD2  H   -5.829  -1.343  -1.837 1.00 . A A .  22 PHE HD2  1 1 
       12  7406 1 1 22 PHE HE1  H   -1.449  -2.603  -3.688 1.00 . A A .  22 PHE HE1  1 1 
       12  7407 1 1 22 PHE HE2  H   -3.781  -0.916  -0.543 1.00 . A A .  22 PHE HE2  1 1 
       12  7408 1 1 22 PHE HZ   H   -1.587  -1.546  -1.468 1.00 . A A .  22 PHE HZ   1 1 
       12  7409 1 1 22 PHE N    N   -5.559  -4.796  -4.895 1.00 . A A .  22 PHE N    1 1 
       12  7410 1 1 22 PHE O    O   -8.065  -4.706  -5.895 1.00 . A A .  22 PHE O    1 1 
       12  7411 1 1 23 SER C    C  -10.855  -2.076  -4.837 1.00 . A A .  23 SER C    1 1 
       12  7412 1 1 23 SER CA   C  -10.264  -3.479  -4.738 1.00 . A A .  23 SER CA   1 1 
       12  7413 1 1 23 SER CB   C  -11.134  -4.348  -3.826 1.00 . A A .  23 SER CB   1 1 
       12  7414 1 1 23 SER H    H   -8.704  -2.930  -3.417 1.00 . A A .  23 SER H    1 1 
       12  7415 1 1 23 SER HA   H  -10.241  -3.918  -5.724 1.00 . A A .  23 SER HA   1 1 
       12  7416 1 1 23 SER HB2  H  -10.552  -5.182  -3.466 1.00 . A A .  23 SER HB2  1 1 
       12  7417 1 1 23 SER HB3  H  -11.474  -3.757  -2.988 1.00 . A A .  23 SER HB3  1 1 
       12  7418 1 1 23 SER HG   H  -12.648  -5.575  -4.030 1.00 . A A .  23 SER HG   1 1 
       12  7419 1 1 23 SER N    N   -8.896  -3.432  -4.236 1.00 . A A .  23 SER N    1 1 
       12  7420 1 1 23 SER O    O  -11.727  -1.701  -4.054 1.00 . A A .  23 SER O    1 1 
       12  7421 1 1 23 SER OG   O  -12.263  -4.846  -4.523 1.00 . A A .  23 SER OG   1 1 
       12  7422 1 1 24 GLY C    C   -9.758   1.022  -6.345 1.00 . A A .  24 GLY C    1 1 
       12  7423 1 1 24 GLY CA   C  -10.864   0.048  -5.992 1.00 . A A .  24 GLY CA   1 1 
       12  7424 1 1 24 GLY H    H   -9.679  -1.658  -6.402 1.00 . A A .  24 GLY H    1 1 
       12  7425 1 1 24 GLY HA2  H  -11.597   0.048  -6.785 1.00 . A A .  24 GLY HA2  1 1 
       12  7426 1 1 24 GLY HA3  H  -11.338   0.375  -5.078 1.00 . A A .  24 GLY HA3  1 1 
       12  7427 1 1 24 GLY N    N  -10.373  -1.305  -5.807 1.00 . A A .  24 GLY N    1 1 
       12  7428 1 1 24 GLY O    O   -8.615   0.854  -5.922 1.00 . A A .  24 GLY O    1 1 
       12  7429 1 1 25 SER C    C   -8.591   3.817  -6.335 1.00 . A A .  25 SER C    1 1 
       12  7430 1 1 25 SER CA   C   -9.125   3.047  -7.539 1.00 . A A .  25 SER CA   1 1 
       12  7431 1 1 25 SER CB   C   -9.754   4.017  -8.541 1.00 . A A .  25 SER CB   1 1 
       12  7432 1 1 25 SER H    H  -11.027   2.124  -7.429 1.00 . A A .  25 SER H    1 1 
       12  7433 1 1 25 SER HA   H   -8.303   2.533  -8.016 1.00 . A A .  25 SER HA   1 1 
       12  7434 1 1 25 SER HB2  H  -10.693   4.376  -8.149 1.00 . A A .  25 SER HB2  1 1 
       12  7435 1 1 25 SER HB3  H   -9.086   4.851  -8.698 1.00 . A A .  25 SER HB3  1 1 
       12  7436 1 1 25 SER HG   H   -9.269   3.574 -10.387 1.00 . A A .  25 SER HG   1 1 
       12  7437 1 1 25 SER N    N  -10.099   2.044  -7.124 1.00 . A A .  25 SER N    1 1 
       12  7438 1 1 25 SER O    O   -7.381   3.936  -6.146 1.00 . A A .  25 SER O    1 1 
       12  7439 1 1 25 SER OG   O   -9.992   3.381  -9.785 1.00 . A A .  25 SER OG   1 1 
       12  7440 1 1 26 TYR C    C   -8.139   4.317  -3.479 1.00 . A A .  26 TYR C    1 1 
       12  7441 1 1 26 TYR CA   C   -9.128   5.100  -4.338 1.00 . A A .  26 TYR CA   1 1 
       12  7442 1 1 26 TYR CB   C  -10.369   5.451  -3.516 1.00 . A A .  26 TYR CB   1 1 
       12  7443 1 1 26 TYR CD1  C   -9.415   7.174  -1.935 1.00 . A A .  26 TYR CD1  1 1 
       12  7444 1 1 26 TYR CD2  C  -10.387   5.208  -1.002 1.00 . A A .  26 TYR CD2  1 1 
       12  7445 1 1 26 TYR CE1  C   -9.123   7.637  -0.667 1.00 . A A .  26 TYR CE1  1 1 
       12  7446 1 1 26 TYR CE2  C  -10.100   5.663   0.270 1.00 . A A .  26 TYR CE2  1 1 
       12  7447 1 1 26 TYR CG   C  -10.052   5.953  -2.125 1.00 . A A .  26 TYR CG   1 1 
       12  7448 1 1 26 TYR CZ   C   -9.468   6.878   0.432 1.00 . A A .  26 TYR CZ   1 1 
       12  7449 1 1 26 TYR H    H  -10.454   4.210  -5.726 1.00 . A A .  26 TYR H    1 1 
       12  7450 1 1 26 TYR HA   H   -8.655   6.014  -4.667 1.00 . A A .  26 TYR HA   1 1 
       12  7451 1 1 26 TYR HB2  H  -10.925   6.221  -4.027 1.00 . A A .  26 TYR HB2  1 1 
       12  7452 1 1 26 TYR HB3  H  -10.988   4.571  -3.418 1.00 . A A .  26 TYR HB3  1 1 
       12  7453 1 1 26 TYR HD1  H   -9.147   7.766  -2.798 1.00 . A A .  26 TYR HD1  1 1 
       12  7454 1 1 26 TYR HD2  H  -10.882   4.256  -1.133 1.00 . A A .  26 TYR HD2  1 1 
       12  7455 1 1 26 TYR HE1  H   -8.628   8.589  -0.539 1.00 . A A .  26 TYR HE1  1 1 
       12  7456 1 1 26 TYR HE2  H  -10.370   5.069   1.131 1.00 . A A .  26 TYR HE2  1 1 
       12  7457 1 1 26 TYR HH   H   -8.235   7.495   1.773 1.00 . A A .  26 TYR HH   1 1 
       12  7458 1 1 26 TYR N    N   -9.504   4.338  -5.523 1.00 . A A .  26 TYR N    1 1 
       12  7459 1 1 26 TYR O    O   -7.049   4.798  -3.172 1.00 . A A .  26 TYR O    1 1 
       12  7460 1 1 26 TYR OH   O   -9.179   7.335   1.698 1.00 . A A .  26 TYR OH   1 1 
       12  7461 1 1 27 ARG C    C   -6.268   2.178  -2.844 1.00 . A A .  27 ARG C    1 1 
       12  7462 1 1 27 ARG CA   C   -7.680   2.255  -2.271 1.00 . A A .  27 ARG CA   1 1 
       12  7463 1 1 27 ARG CB   C   -8.276   0.850  -2.167 1.00 . A A .  27 ARG CB   1 1 
       12  7464 1 1 27 ARG CD   C   -8.557   0.667   0.324 1.00 . A A .  27 ARG CD   1 1 
       12  7465 1 1 27 ARG CG   C   -7.864   0.105  -0.907 1.00 . A A .  27 ARG CG   1 1 
       12  7466 1 1 27 ARG CZ   C  -10.067  -1.090   1.148 1.00 . A A .  27 ARG CZ   1 1 
       12  7467 1 1 27 ARG H    H   -9.410   2.777  -3.371 1.00 . A A .  27 ARG H    1 1 
       12  7468 1 1 27 ARG HA   H   -7.632   2.690  -1.284 1.00 . A A .  27 ARG HA   1 1 
       12  7469 1 1 27 ARG HB2  H   -9.353   0.927  -2.176 1.00 . A A .  27 ARG HB2  1 1 
       12  7470 1 1 27 ARG HB3  H   -7.957   0.272  -3.021 1.00 . A A .  27 ARG HB3  1 1 
       12  7471 1 1 27 ARG HD2  H   -7.942   0.467   1.189 1.00 . A A .  27 ARG HD2  1 1 
       12  7472 1 1 27 ARG HD3  H   -8.669   1.734   0.202 1.00 . A A .  27 ARG HD3  1 1 
       12  7473 1 1 27 ARG HE   H  -10.652   0.561   0.193 1.00 . A A .  27 ARG HE   1 1 
       12  7474 1 1 27 ARG HG2  H   -8.130  -0.937  -1.013 1.00 . A A .  27 ARG HG2  1 1 
       12  7475 1 1 27 ARG HG3  H   -6.795   0.194  -0.781 1.00 . A A .  27 ARG HG3  1 1 
       12  7476 1 1 27 ARG HH11 H   -8.106  -1.418   1.505 1.00 . A A .  27 ARG HH11 1 1 
       12  7477 1 1 27 ARG HH12 H   -9.181  -2.648   2.081 1.00 . A A .  27 ARG HH12 1 1 
       12  7478 1 1 27 ARG HH21 H  -12.078  -1.053   0.946 1.00 . A A .  27 ARG HH21 1 1 
       12  7479 1 1 27 ARG HH22 H  -11.440  -2.440   1.762 1.00 . A A .  27 ARG HH22 1 1 
       12  7480 1 1 27 ARG N    N   -8.530   3.106  -3.095 1.00 . A A .  27 ARG N    1 1 
       12  7481 1 1 27 ARG NE   N   -9.874   0.071   0.531 1.00 . A A .  27 ARG NE   1 1 
       12  7482 1 1 27 ARG NH1  N   -9.033  -1.775   1.616 1.00 . A A .  27 ARG NH1  1 1 
       12  7483 1 1 27 ARG NH2  N  -11.296  -1.567   1.298 1.00 . A A .  27 ARG NH2  1 1 
       12  7484 1 1 27 ARG O    O   -5.302   2.594  -2.202 1.00 . A A .  27 ARG O    1 1 
       12  7485 1 1 28 LEU C    C   -4.005   2.755  -4.490 1.00 . A A .  28 LEU C    1 1 
       12  7486 1 1 28 LEU CA   C   -4.861   1.512  -4.715 1.00 . A A .  28 LEU CA   1 1 
       12  7487 1 1 28 LEU CB   C   -5.053   1.276  -6.214 1.00 . A A .  28 LEU CB   1 1 
       12  7488 1 1 28 LEU CD1  C   -3.276  -0.435  -6.663 1.00 . A A .  28 LEU CD1  1 1 
       12  7489 1 1 28 LEU CD2  C   -4.054   1.068  -8.505 1.00 . A A .  28 LEU CD2  1 1 
       12  7490 1 1 28 LEU CG   C   -3.787   0.955  -7.011 1.00 . A A .  28 LEU CG   1 1 
       12  7491 1 1 28 LEU H    H   -6.960   1.330  -4.517 1.00 . A A .  28 LEU H    1 1 
       12  7492 1 1 28 LEU HA   H   -4.355   0.659  -4.287 1.00 . A A .  28 LEU HA   1 1 
       12  7493 1 1 28 LEU HB2  H   -5.737   0.450  -6.334 1.00 . A A .  28 LEU HB2  1 1 
       12  7494 1 1 28 LEU HB3  H   -5.492   2.169  -6.635 1.00 . A A .  28 LEU HB3  1 1 
       12  7495 1 1 28 LEU HD11 H   -3.775  -1.167  -7.279 1.00 . A A .  28 LEU HD11 1 1 
       12  7496 1 1 28 LEU HD12 H   -3.477  -0.642  -5.622 1.00 . A A .  28 LEU HD12 1 1 
       12  7497 1 1 28 LEU HD13 H   -2.211  -0.481  -6.840 1.00 . A A .  28 LEU HD13 1 1 
       12  7498 1 1 28 LEU HD21 H   -5.015   1.535  -8.664 1.00 . A A .  28 LEU HD21 1 1 
       12  7499 1 1 28 LEU HD22 H   -4.055   0.082  -8.946 1.00 . A A .  28 LEU HD22 1 1 
       12  7500 1 1 28 LEU HD23 H   -3.281   1.667  -8.964 1.00 . A A .  28 LEU HD23 1 1 
       12  7501 1 1 28 LEU HG   H   -3.016   1.668  -6.753 1.00 . A A .  28 LEU HG   1 1 
       12  7502 1 1 28 LEU N    N   -6.155   1.644  -4.055 1.00 . A A .  28 LEU N    1 1 
       12  7503 1 1 28 LEU O    O   -2.840   2.659  -4.104 1.00 . A A .  28 LEU O    1 1 
       12  7504 1 1 29 THR C    C   -3.200   5.245  -3.196 1.00 . A A .  29 THR C    1 1 
       12  7505 1 1 29 THR CA   C   -3.885   5.185  -4.556 1.00 . A A .  29 THR CA   1 1 
       12  7506 1 1 29 THR CB   C   -4.839   6.387  -4.691 1.00 . A A .  29 THR CB   1 1 
       12  7507 1 1 29 THR CG2  C   -4.077   7.698  -4.576 1.00 . A A .  29 THR CG2  1 1 
       12  7508 1 1 29 THR H    H   -5.523   3.934  -5.039 1.00 . A A .  29 THR H    1 1 
       12  7509 1 1 29 THR HA   H   -3.135   5.258  -5.330 1.00 . A A .  29 THR HA   1 1 
       12  7510 1 1 29 THR HB   H   -5.568   6.340  -3.895 1.00 . A A .  29 THR HB   1 1 
       12  7511 1 1 29 THR HG1  H   -4.880   6.193  -6.653 1.00 . A A .  29 THR HG1  1 1 
       12  7512 1 1 29 THR HG21 H   -4.727   8.457  -4.169 1.00 . A A .  29 THR HG21 1 1 
       12  7513 1 1 29 THR HG22 H   -3.736   8.003  -5.554 1.00 . A A .  29 THR HG22 1 1 
       12  7514 1 1 29 THR HG23 H   -3.227   7.564  -3.924 1.00 . A A .  29 THR HG23 1 1 
       12  7515 1 1 29 THR N    N   -4.592   3.923  -4.733 1.00 . A A .  29 THR N    1 1 
       12  7516 1 1 29 THR O    O   -1.992   5.466  -3.109 1.00 . A A .  29 THR O    1 1 
       12  7517 1 1 29 THR OG1  O   -5.519   6.333  -5.950 1.00 . A A .  29 THR OG1  1 1 
       12  7518 1 1 30 GLN C    C   -2.106   4.352  -0.705 1.00 . A A .  30 GLN C    1 1 
       12  7519 1 1 30 GLN CA   C   -3.445   5.079  -0.780 1.00 . A A .  30 GLN CA   1 1 
       12  7520 1 1 30 GLN CB   C   -4.437   4.446   0.196 1.00 . A A .  30 GLN CB   1 1 
       12  7521 1 1 30 GLN CD   C   -5.163   6.349   1.690 1.00 . A A .  30 GLN CD   1 1 
       12  7522 1 1 30 GLN CG   C   -5.569   5.376   0.601 1.00 . A A .  30 GLN CG   1 1 
       12  7523 1 1 30 GLN H    H   -4.933   4.875  -2.271 1.00 . A A .  30 GLN H    1 1 
       12  7524 1 1 30 GLN HA   H   -3.295   6.112  -0.507 1.00 . A A .  30 GLN HA   1 1 
       12  7525 1 1 30 GLN HB2  H   -4.868   3.569  -0.264 1.00 . A A .  30 GLN HB2  1 1 
       12  7526 1 1 30 GLN HB3  H   -3.907   4.150   1.089 1.00 . A A .  30 GLN HB3  1 1 
       12  7527 1 1 30 GLN HE21 H   -6.314   5.398   3.004 1.00 . A A .  30 GLN HE21 1 1 
       12  7528 1 1 30 GLN HE22 H   -5.452   6.766   3.612 1.00 . A A .  30 GLN HE22 1 1 
       12  7529 1 1 30 GLN HG2  H   -5.883   5.939  -0.265 1.00 . A A .  30 GLN HG2  1 1 
       12  7530 1 1 30 GLN HG3  H   -6.396   4.780   0.960 1.00 . A A .  30 GLN HG3  1 1 
       12  7531 1 1 30 GLN N    N   -3.978   5.047  -2.137 1.00 . A A .  30 GLN N    1 1 
       12  7532 1 1 30 GLN NE2  N   -5.697   6.152   2.890 1.00 . A A .  30 GLN NE2  1 1 
       12  7533 1 1 30 GLN O    O   -1.142   4.863  -0.133 1.00 . A A .  30 GLN O    1 1 
       12  7534 1 1 30 GLN OE1  O   -4.379   7.269   1.456 1.00 . A A .  30 GLN OE1  1 1 
       12  7535 1 1 31 HIS C    C    0.214   2.967  -2.215 1.00 . A A .  31 HIS C    1 1 
       12  7536 1 1 31 HIS CA   C   -0.831   2.361  -1.284 1.00 . A A .  31 HIS CA   1 1 
       12  7537 1 1 31 HIS CB   C   -1.135   0.923  -1.705 1.00 . A A .  31 HIS CB   1 1 
       12  7538 1 1 31 HIS CD2  C    0.594  -0.025  -3.391 1.00 . A A .  31 HIS CD2  1 1 
       12  7539 1 1 31 HIS CE1  C    1.879  -1.088  -1.969 1.00 . A A .  31 HIS CE1  1 1 
       12  7540 1 1 31 HIS CG   C    0.075   0.162  -2.155 1.00 . A A .  31 HIS CG   1 1 
       12  7541 1 1 31 HIS H    H   -2.853   2.804  -1.725 1.00 . A A .  31 HIS H    1 1 
       12  7542 1 1 31 HIS HA   H   -0.439   2.356  -0.278 1.00 . A A .  31 HIS HA   1 1 
       12  7543 1 1 31 HIS HB2  H   -1.566   0.393  -0.869 1.00 . A A .  31 HIS HB2  1 1 
       12  7544 1 1 31 HIS HB3  H   -1.842   0.935  -2.522 1.00 . A A .  31 HIS HB3  1 1 
       12  7545 1 1 31 HIS HD1  H    0.792  -0.571  -0.315 1.00 . A A .  31 HIS HD1  1 1 
       12  7546 1 1 31 HIS HD2  H    0.200   0.367  -4.319 1.00 . A A .  31 HIS HD2  1 1 
       12  7547 1 1 31 HIS HE1  H    2.677  -1.685  -1.553 1.00 . A A .  31 HIS HE1  1 1 
       12  7548 1 1 31 HIS N    N   -2.053   3.157  -1.285 1.00 . A A .  31 HIS N    1 1 
       12  7549 1 1 31 HIS ND1  N    0.903  -0.517  -1.287 1.00 . A A .  31 HIS ND1  1 1 
       12  7550 1 1 31 HIS NE2  N    1.715  -0.805  -3.249 1.00 . A A .  31 HIS NE2  1 1 
       12  7551 1 1 31 HIS O    O    1.409   2.949  -1.919 1.00 . A A .  31 HIS O    1 1 
       12  7552 1 1 32 TRP C    C    1.417   5.277  -3.699 1.00 . A A .  32 TRP C    1 1 
       12  7553 1 1 32 TRP CA   C    0.652   4.111  -4.317 1.00 . A A .  32 TRP CA   1 1 
       12  7554 1 1 32 TRP CB   C   -0.138   4.593  -5.535 1.00 . A A .  32 TRP CB   1 1 
       12  7555 1 1 32 TRP CD1  C   -0.747   2.279  -6.453 1.00 . A A .  32 TRP CD1  1 1 
       12  7556 1 1 32 TRP CD2  C    0.065   3.693  -7.987 1.00 . A A .  32 TRP CD2  1 1 
       12  7557 1 1 32 TRP CE2  C   -0.227   2.467  -8.616 1.00 . A A .  32 TRP CE2  1 1 
       12  7558 1 1 32 TRP CE3  C    0.587   4.737  -8.757 1.00 . A A .  32 TRP CE3  1 1 
       12  7559 1 1 32 TRP CG   C   -0.275   3.551  -6.604 1.00 . A A .  32 TRP CG   1 1 
       12  7560 1 1 32 TRP CH2  C    0.498   3.298 -10.705 1.00 . A A .  32 TRP CH2  1 1 
       12  7561 1 1 32 TRP CZ2  C   -0.013   2.259  -9.976 1.00 . A A .  32 TRP CZ2  1 1 
       12  7562 1 1 32 TRP CZ3  C    0.798   4.528 -10.106 1.00 . A A .  32 TRP CZ3  1 1 
       12  7563 1 1 32 TRP H    H   -1.207   3.485  -3.522 1.00 . A A .  32 TRP H    1 1 
       12  7564 1 1 32 TRP HA   H    1.360   3.359  -4.633 1.00 . A A .  32 TRP HA   1 1 
       12  7565 1 1 32 TRP HB2  H   -1.130   4.881  -5.222 1.00 . A A .  32 TRP HB2  1 1 
       12  7566 1 1 32 TRP HB3  H    0.363   5.448  -5.965 1.00 . A A .  32 TRP HB3  1 1 
       12  7567 1 1 32 TRP HD1  H   -1.086   1.863  -5.516 1.00 . A A .  32 TRP HD1  1 1 
       12  7568 1 1 32 TRP HE1  H   -1.009   0.696  -7.809 1.00 . A A .  32 TRP HE1  1 1 
       12  7569 1 1 32 TRP HE3  H    0.825   5.693  -8.313 1.00 . A A .  32 TRP HE3  1 1 
       12  7570 1 1 32 TRP HH2  H    0.679   3.180 -11.762 1.00 . A A .  32 TRP HH2  1 1 
       12  7571 1 1 32 TRP HZ2  H   -0.240   1.316 -10.453 1.00 . A A .  32 TRP HZ2  1 1 
       12  7572 1 1 32 TRP HZ3  H    1.201   5.324 -10.716 1.00 . A A .  32 TRP HZ3  1 1 
       12  7573 1 1 32 TRP N    N   -0.244   3.501  -3.342 1.00 . A A .  32 TRP N    1 1 
       12  7574 1 1 32 TRP NE1  N   -0.720   1.621  -7.659 1.00 . A A .  32 TRP NE1  1 1 
       12  7575 1 1 32 TRP O    O    2.524   5.603  -4.130 1.00 . A A .  32 TRP O    1 1 
       12  7576 1 1 33 ILE C    C    2.806   6.638  -1.435 1.00 . A A .  33 ILE C    1 1 
       12  7577 1 1 33 ILE CA   C    1.449   7.028  -2.011 1.00 . A A .  33 ILE CA   1 1 
       12  7578 1 1 33 ILE CB   C    0.559   7.569  -0.877 1.00 . A A .  33 ILE CB   1 1 
       12  7579 1 1 33 ILE CD1  C   -1.708   8.616  -0.383 1.00 . A A .  33 ILE CD1  1 1 
       12  7580 1 1 33 ILE CG1  C   -0.786   8.039  -1.435 1.00 . A A .  33 ILE CG1  1 1 
       12  7581 1 1 33 ILE CG2  C    1.262   8.705  -0.148 1.00 . A A .  33 ILE CG2  1 1 
       12  7582 1 1 33 ILE H    H   -0.060   5.593  -2.390 1.00 . A A .  33 ILE H    1 1 
       12  7583 1 1 33 ILE HA   H    1.591   7.815  -2.737 1.00 . A A .  33 ILE HA   1 1 
       12  7584 1 1 33 ILE HB   H    0.389   6.771  -0.171 1.00 . A A .  33 ILE HB   1 1 
       12  7585 1 1 33 ILE HD11 H   -2.225   9.474  -0.790 1.00 . A A .  33 ILE HD11 1 1 
       12  7586 1 1 33 ILE HD12 H   -2.430   7.870  -0.088 1.00 . A A .  33 ILE HD12 1 1 
       12  7587 1 1 33 ILE HD13 H   -1.130   8.920   0.476 1.00 . A A .  33 ILE HD13 1 1 
       12  7588 1 1 33 ILE HG12 H   -0.614   8.802  -2.178 1.00 . A A .  33 ILE HG12 1 1 
       12  7589 1 1 33 ILE HG13 H   -1.289   7.201  -1.894 1.00 . A A .  33 ILE HG13 1 1 
       12  7590 1 1 33 ILE HG21 H    0.642   9.589  -0.176 1.00 . A A .  33 ILE HG21 1 1 
       12  7591 1 1 33 ILE HG22 H    1.435   8.420   0.879 1.00 . A A .  33 ILE HG22 1 1 
       12  7592 1 1 33 ILE HG23 H    2.206   8.911  -0.628 1.00 . A A .  33 ILE HG23 1 1 
       12  7593 1 1 33 ILE N    N    0.822   5.900  -2.688 1.00 . A A .  33 ILE N    1 1 
       12  7594 1 1 33 ILE O    O    3.712   7.466  -1.333 1.00 . A A .  33 ILE O    1 1 
       12  7595 1 1 34 THR C    C    5.296   4.846  -1.540 1.00 . A A .  34 THR C    1 1 
       12  7596 1 1 34 THR CA   C    4.188   4.868  -0.494 1.00 . A A .  34 THR CA   1 1 
       12  7597 1 1 34 THR CB   C    4.013   3.451   0.082 1.00 . A A .  34 THR CB   1 1 
       12  7598 1 1 34 THR CG2  C    2.916   3.426   1.136 1.00 . A A .  34 THR CG2  1 1 
       12  7599 1 1 34 THR H    H    2.183   4.758  -1.166 1.00 . A A .  34 THR H    1 1 
       12  7600 1 1 34 THR HA   H    4.478   5.528   0.310 1.00 . A A .  34 THR HA   1 1 
       12  7601 1 1 34 THR HB   H    4.942   3.149   0.544 1.00 . A A .  34 THR HB   1 1 
       12  7602 1 1 34 THR HG1  H    3.189   1.797  -0.608 1.00 . A A .  34 THR HG1  1 1 
       12  7603 1 1 34 THR HG21 H    2.056   3.968   0.772 1.00 . A A .  34 THR HG21 1 1 
       12  7604 1 1 34 THR HG22 H    3.277   3.890   2.042 1.00 . A A .  34 THR HG22 1 1 
       12  7605 1 1 34 THR HG23 H    2.638   2.403   1.342 1.00 . A A .  34 THR HG23 1 1 
       12  7606 1 1 34 THR N    N    2.941   5.369  -1.060 1.00 . A A .  34 THR N    1 1 
       12  7607 1 1 34 THR O    O    6.479   4.771  -1.205 1.00 . A A .  34 THR O    1 1 
       12  7608 1 1 34 THR OG1  O    3.693   2.531  -0.968 1.00 . A A .  34 THR OG1  1 1 
       12  7609 1 1 35 HIS C    C    6.300   6.321  -4.265 1.00 . A A .  35 HIS C    1 1 
       12  7610 1 1 35 HIS CA   C    5.869   4.902  -3.906 1.00 . A A .  35 HIS CA   1 1 
       12  7611 1 1 35 HIS CB   C    5.270   4.213  -5.132 1.00 . A A .  35 HIS CB   1 1 
       12  7612 1 1 35 HIS CD2  C    3.784   2.087  -5.185 1.00 . A A .  35 HIS CD2  1 1 
       12  7613 1 1 35 HIS CE1  C    5.182   0.696  -4.227 1.00 . A A .  35 HIS CE1  1 1 
       12  7614 1 1 35 HIS CG   C    4.913   2.777  -4.898 1.00 . A A .  35 HIS CG   1 1 
       12  7615 1 1 35 HIS H    H    3.951   4.971  -3.014 1.00 . A A .  35 HIS H    1 1 
       12  7616 1 1 35 HIS HA   H    6.737   4.348  -3.580 1.00 . A A .  35 HIS HA   1 1 
       12  7617 1 1 35 HIS HB2  H    4.371   4.734  -5.426 1.00 . A A .  35 HIS HB2  1 1 
       12  7618 1 1 35 HIS HB3  H    5.983   4.250  -5.943 1.00 . A A .  35 HIS HB3  1 1 
       12  7619 1 1 35 HIS HD1  H    6.671   2.075  -3.973 1.00 . A A .  35 HIS HD1  1 1 
       12  7620 1 1 35 HIS HD2  H    2.897   2.479  -5.661 1.00 . A A .  35 HIS HD2  1 1 
       12  7621 1 1 35 HIS HE1  H    5.614  -0.200  -3.807 1.00 . A A .  35 HIS HE1  1 1 
       12  7622 1 1 35 HIS N    N    4.907   4.913  -2.810 1.00 . A A .  35 HIS N    1 1 
       12  7623 1 1 35 HIS ND1  N    5.768   1.877  -4.297 1.00 . A A .  35 HIS ND1  1 1 
       12  7624 1 1 35 HIS NE2  N    3.977   0.796  -4.758 1.00 . A A .  35 HIS NE2  1 1 
       12  7625 1 1 35 HIS O    O    7.466   6.568  -4.574 1.00 . A A .  35 HIS O    1 1 
       12  7626 1 1 36 THR C    C    6.241   9.373  -3.354 1.00 . A A .  36 THR C    1 1 
       12  7627 1 1 36 THR CA   C    5.631   8.644  -4.546 1.00 . A A .  36 THR CA   1 1 
       12  7628 1 1 36 THR CB   C    4.356   9.386  -4.988 1.00 . A A .  36 THR CB   1 1 
       12  7629 1 1 36 THR CG2  C    3.298   9.342  -3.896 1.00 . A A .  36 THR CG2  1 1 
       12  7630 1 1 36 THR H    H    4.440   6.992  -3.970 1.00 . A A .  36 THR H    1 1 
       12  7631 1 1 36 THR HA   H    6.335   8.662  -5.365 1.00 . A A .  36 THR HA   1 1 
       12  7632 1 1 36 THR HB   H    3.962   8.900  -5.870 1.00 . A A .  36 THR HB   1 1 
       12  7633 1 1 36 THR HG1  H    3.991  11.102  -5.890 1.00 . A A .  36 THR HG1  1 1 
       12  7634 1 1 36 THR HG21 H    3.443   8.460  -3.290 1.00 . A A .  36 THR HG21 1 1 
       12  7635 1 1 36 THR HG22 H    2.316   9.311  -4.346 1.00 . A A .  36 THR HG22 1 1 
       12  7636 1 1 36 THR HG23 H    3.383  10.223  -3.277 1.00 . A A .  36 THR HG23 1 1 
       12  7637 1 1 36 THR N    N    5.351   7.251  -4.223 1.00 . A A .  36 THR N    1 1 
       12  7638 1 1 36 THR O    O    6.991  10.335  -3.520 1.00 . A A .  36 THR O    1 1 
       12  7639 1 1 36 THR OG1  O    4.665  10.748  -5.305 1.00 . A A .  36 THR OG1  1 1 
       12  7640 1 1 37 ARG C    C    7.596   8.704  -0.371 1.00 . A A .  37 ARG C    1 1 
       12  7641 1 1 37 ARG CA   C    6.432   9.515  -0.932 1.00 . A A .  37 ARG CA   1 1 
       12  7642 1 1 37 ARG CB   C    5.323   9.628   0.116 1.00 . A A .  37 ARG CB   1 1 
       12  7643 1 1 37 ARG CD   C    4.606  12.003  -0.287 1.00 . A A .  37 ARG CD   1 1 
       12  7644 1 1 37 ARG CG   C    4.182  10.542  -0.301 1.00 . A A .  37 ARG CG   1 1 
       12  7645 1 1 37 ARG CZ   C    3.074  13.182   1.233 1.00 . A A .  37 ARG CZ   1 1 
       12  7646 1 1 37 ARG H    H    5.314   8.137  -2.085 1.00 . A A .  37 ARG H    1 1 
       12  7647 1 1 37 ARG HA   H    6.784  10.506  -1.178 1.00 . A A .  37 ARG HA   1 1 
       12  7648 1 1 37 ARG HB2  H    4.917   8.644   0.301 1.00 . A A .  37 ARG HB2  1 1 
       12  7649 1 1 37 ARG HB3  H    5.747  10.012   1.031 1.00 . A A .  37 ARG HB3  1 1 
       12  7650 1 1 37 ARG HD2  H    5.365  12.137   0.470 1.00 . A A .  37 ARG HD2  1 1 
       12  7651 1 1 37 ARG HD3  H    5.014  12.255  -1.254 1.00 . A A .  37 ARG HD3  1 1 
       12  7652 1 1 37 ARG HE   H    3.019  13.298  -0.758 1.00 . A A .  37 ARG HE   1 1 
       12  7653 1 1 37 ARG HG2  H    3.869  10.280  -1.300 1.00 . A A .  37 ARG HG2  1 1 
       12  7654 1 1 37 ARG HG3  H    3.358  10.409   0.384 1.00 . A A .  37 ARG HG3  1 1 
       12  7655 1 1 37 ARG HH11 H    4.461  12.033   2.147 1.00 . A A .  37 ARG HH11 1 1 
       12  7656 1 1 37 ARG HH12 H    3.375  12.869   3.207 1.00 . A A .  37 ARG HH12 1 1 
       12  7657 1 1 37 ARG HH21 H    1.583  14.405   0.627 1.00 . A A .  37 ARG HH21 1 1 
       12  7658 1 1 37 ARG HH22 H    1.738  14.218   2.341 1.00 . A A .  37 ARG HH22 1 1 
       12  7659 1 1 37 ARG N    N    5.916   8.907  -2.152 1.00 . A A .  37 ARG N    1 1 
       12  7660 1 1 37 ARG NE   N    3.486  12.895   0.003 1.00 . A A .  37 ARG NE   1 1 
       12  7661 1 1 37 ARG NH1  N    3.687  12.650   2.282 1.00 . A A .  37 ARG NH1  1 1 
       12  7662 1 1 37 ARG NH2  N    2.047  14.002   1.415 1.00 . A A .  37 ARG NH2  1 1 
       12  7663 1 1 37 ARG O    O    7.858   7.587  -0.815 1.00 . A A .  37 ARG O    1 1 
       12  7664 1 1 38 GLU C    C    9.069   8.105   2.625 1.00 . A A .  38 GLU C    1 1 
       12  7665 1 1 38 GLU CA   C    9.428   8.605   1.229 1.00 . A A .  38 GLU CA   1 1 
       12  7666 1 1 38 GLU CB   C   10.626   9.553   1.307 1.00 . A A .  38 GLU CB   1 1 
       12  7667 1 1 38 GLU CD   C   12.596  10.583   0.107 1.00 . A A .  38 GLU CD   1 1 
       12  7668 1 1 38 GLU CG   C   11.334   9.752  -0.022 1.00 . A A .  38 GLU CG   1 1 
       12  7669 1 1 38 GLU H    H    8.034  10.168   0.920 1.00 . A A .  38 GLU H    1 1 
       12  7670 1 1 38 GLU HA   H    9.691   7.759   0.612 1.00 . A A .  38 GLU HA   1 1 
       12  7671 1 1 38 GLU HB2  H   10.286  10.516   1.658 1.00 . A A .  38 GLU HB2  1 1 
       12  7672 1 1 38 GLU HB3  H   11.339   9.155   2.014 1.00 . A A .  38 GLU HB3  1 1 
       12  7673 1 1 38 GLU HG2  H   11.599   8.784  -0.423 1.00 . A A .  38 GLU HG2  1 1 
       12  7674 1 1 38 GLU HG3  H   10.660  10.250  -0.704 1.00 . A A .  38 GLU HG3  1 1 
       12  7675 1 1 38 GLU N    N    8.291   9.275   0.608 1.00 . A A .  38 GLU N    1 1 
       12  7676 1 1 38 GLU O    O    9.435   8.715   3.629 1.00 . A A .  38 GLU O    1 1 
       12  7677 1 1 38 GLU OE1  O   13.322  10.408   1.108 1.00 . A A .  38 GLU OE1  1 1 
       12  7678 1 1 38 GLU OE2  O   12.857  11.409  -0.793 1.00 . A A .  38 GLU OE2  1 1 
       12  7679 1 1 39 LYS C    C    8.344   4.935   4.029 1.00 . A A .  39 LYS C    1 1 
       12  7680 1 1 39 LYS CA   C    7.940   6.404   3.951 1.00 . A A .  39 LYS CA   1 1 
       12  7681 1 1 39 LYS CB   C    6.426   6.537   4.133 1.00 . A A .  39 LYS CB   1 1 
       12  7682 1 1 39 LYS CD   C    5.900   8.783   5.128 1.00 . A A .  39 LYS CD   1 1 
       12  7683 1 1 39 LYS CE   C    7.213   9.531   5.301 1.00 . A A .  39 LYS CE   1 1 
       12  7684 1 1 39 LYS CG   C    5.902   7.938   3.865 1.00 . A A .  39 LYS CG   1 1 
       12  7685 1 1 39 LYS H    H    8.087   6.548   1.844 1.00 . A A .  39 LYS H    1 1 
       12  7686 1 1 39 LYS HA   H    8.438   6.945   4.741 1.00 . A A .  39 LYS HA   1 1 
       12  7687 1 1 39 LYS HB2  H    5.932   5.856   3.457 1.00 . A A .  39 LYS HB2  1 1 
       12  7688 1 1 39 LYS HB3  H    6.173   6.269   5.149 1.00 . A A .  39 LYS HB3  1 1 
       12  7689 1 1 39 LYS HD2  H    5.095   9.501   5.069 1.00 . A A .  39 LYS HD2  1 1 
       12  7690 1 1 39 LYS HD3  H    5.748   8.138   5.982 1.00 . A A .  39 LYS HD3  1 1 
       12  7691 1 1 39 LYS HE2  H    7.190  10.061   6.241 1.00 . A A .  39 LYS HE2  1 1 
       12  7692 1 1 39 LYS HE3  H    8.021   8.815   5.311 1.00 . A A .  39 LYS HE3  1 1 
       12  7693 1 1 39 LYS HG2  H    6.532   8.413   3.128 1.00 . A A .  39 LYS HG2  1 1 
       12  7694 1 1 39 LYS HG3  H    4.892   7.868   3.488 1.00 . A A .  39 LYS HG3  1 1 
       12  7695 1 1 39 LYS HZ1  H    7.212  11.469   4.519 1.00 . A A .  39 LYS HZ1  1 1 
       12  7696 1 1 39 LYS HZ2  H    6.847  10.271   3.382 1.00 . A A .  39 LYS HZ2  1 1 
       12  7697 1 1 39 LYS HZ3  H    8.441  10.483   3.904 1.00 . A A .  39 LYS HZ3  1 1 
       12  7698 1 1 39 LYS N    N    8.349   6.989   2.679 1.00 . A A .  39 LYS N    1 1 
       12  7699 1 1 39 LYS NZ   N    7.444  10.507   4.200 1.00 . A A .  39 LYS NZ   1 1 
       12  7700 1 1 39 LYS O    O    8.406   4.229   3.022 1.00 . A A .  39 LYS O    1 1 
       12  7701 1 1 40 PRO C    C    7.881   2.092   5.268 1.00 . A A .  40 PRO C    1 1 
       12  7702 1 1 40 PRO CA   C    9.027   3.073   5.491 1.00 . A A .  40 PRO CA   1 1 
       12  7703 1 1 40 PRO CB   C    9.452   3.074   6.961 1.00 . A A .  40 PRO CB   1 1 
       12  7704 1 1 40 PRO CD   C    8.573   5.248   6.497 1.00 . A A .  40 PRO CD   1 1 
       12  7705 1 1 40 PRO CG   C    8.699   4.205   7.572 1.00 . A A .  40 PRO CG   1 1 
       12  7706 1 1 40 PRO HA   H    9.866   2.790   4.872 1.00 . A A .  40 PRO HA   1 1 
       12  7707 1 1 40 PRO HB2  H    9.187   2.130   7.416 1.00 . A A .  40 PRO HB2  1 1 
       12  7708 1 1 40 PRO HB3  H   10.518   3.226   7.031 1.00 . A A .  40 PRO HB3  1 1 
       12  7709 1 1 40 PRO HD2  H    7.631   5.769   6.585 1.00 . A A .  40 PRO HD2  1 1 
       12  7710 1 1 40 PRO HD3  H    9.397   5.944   6.548 1.00 . A A .  40 PRO HD3  1 1 
       12  7711 1 1 40 PRO HG2  H    7.722   3.869   7.885 1.00 . A A .  40 PRO HG2  1 1 
       12  7712 1 1 40 PRO HG3  H    9.249   4.599   8.414 1.00 . A A .  40 PRO HG3  1 1 
       12  7713 1 1 40 PRO N    N    8.626   4.462   5.252 1.00 . A A .  40 PRO N    1 1 
       12  7714 1 1 40 PRO O    O    6.969   1.991   6.089 1.00 . A A .  40 PRO O    1 1 
       12  7715 1 1 41 SER C    C    6.913  -0.768   4.802 1.00 . A A .  41 SER C    1 1 
       12  7716 1 1 41 SER CA   C    6.897   0.400   3.821 1.00 . A A .  41 SER CA   1 1 
       12  7717 1 1 41 SER CB   C    7.089  -0.115   2.394 1.00 . A A .  41 SER CB   1 1 
       12  7718 1 1 41 SER H    H    8.686   1.497   3.538 1.00 . A A .  41 SER H    1 1 
       12  7719 1 1 41 SER HA   H    5.941   0.899   3.889 1.00 . A A .  41 SER HA   1 1 
       12  7720 1 1 41 SER HB2  H    7.488   0.677   1.778 1.00 . A A .  41 SER HB2  1 1 
       12  7721 1 1 41 SER HB3  H    7.781  -0.946   2.404 1.00 . A A .  41 SER HB3  1 1 
       12  7722 1 1 41 SER HG   H    5.950  -0.633   0.887 1.00 . A A .  41 SER HG   1 1 
       12  7723 1 1 41 SER N    N    7.933   1.371   4.153 1.00 . A A .  41 SER N    1 1 
       12  7724 1 1 41 SER O    O    5.873  -1.171   5.323 1.00 . A A .  41 SER O    1 1 
       12  7725 1 1 41 SER OG   O    5.860  -0.551   1.839 1.00 . A A .  41 SER OG   1 1 
       12  7726 1 1 42 GLY C    C    8.960  -3.603   5.347 1.00 . A A .  42 GLY C    1 1 
       12  7727 1 1 42 GLY CA   C    8.233  -2.426   5.967 1.00 . A A .  42 GLY CA   1 1 
       12  7728 1 1 42 GLY H    H    8.897  -0.947   4.605 1.00 . A A .  42 GLY H    1 1 
       12  7729 1 1 42 GLY HA2  H    8.777  -2.099   6.840 1.00 . A A .  42 GLY HA2  1 1 
       12  7730 1 1 42 GLY HA3  H    7.246  -2.746   6.269 1.00 . A A .  42 GLY HA3  1 1 
       12  7731 1 1 42 GLY N    N    8.102  -1.309   5.050 1.00 . A A .  42 GLY N    1 1 
       12  7732 1 1 42 GLY O    O    9.119  -3.691   4.130 1.00 . A A .  42 GLY O    1 1 
       12  7733 1 1 43 PRO C    C    9.237  -6.708   5.006 1.00 . A A .  43 PRO C    1 1 
       12  7734 1 1 43 PRO CA   C   10.140  -5.729   5.748 1.00 . A A .  43 PRO CA   1 1 
       12  7735 1 1 43 PRO CB   C   10.643  -6.350   7.054 1.00 . A A .  43 PRO CB   1 1 
       12  7736 1 1 43 PRO CD   C    9.263  -4.496   7.661 1.00 . A A .  43 PRO CD   1 1 
       12  7737 1 1 43 PRO CG   C    9.690  -5.871   8.094 1.00 . A A .  43 PRO CG   1 1 
       12  7738 1 1 43 PRO HA   H   10.982  -5.471   5.122 1.00 . A A .  43 PRO HA   1 1 
       12  7739 1 1 43 PRO HB2  H   10.630  -7.428   6.971 1.00 . A A .  43 PRO HB2  1 1 
       12  7740 1 1 43 PRO HB3  H   11.649  -6.012   7.253 1.00 . A A .  43 PRO HB3  1 1 
       12  7741 1 1 43 PRO HD2  H    8.234  -4.316   7.936 1.00 . A A .  43 PRO HD2  1 1 
       12  7742 1 1 43 PRO HD3  H    9.907  -3.746   8.096 1.00 . A A .  43 PRO HD3  1 1 
       12  7743 1 1 43 PRO HG2  H    8.838  -6.530   8.143 1.00 . A A .  43 PRO HG2  1 1 
       12  7744 1 1 43 PRO HG3  H   10.186  -5.824   9.052 1.00 . A A .  43 PRO HG3  1 1 
       12  7745 1 1 43 PRO N    N    9.417  -4.535   6.197 1.00 . A A .  43 PRO N    1 1 
       12  7746 1 1 43 PRO O    O    8.087  -6.396   4.698 1.00 . A A .  43 PRO O    1 1 
       12  7747 1 1 44 SER C    C    8.602  -8.430   2.625 1.00 . A A .  44 SER C    1 1 
       12  7748 1 1 44 SER CA   C    9.009  -8.918   4.012 1.00 . A A .  44 SER CA   1 1 
       12  7749 1 1 44 SER CB   C    7.765  -9.309   4.812 1.00 . A A .  44 SER CB   1 1 
       12  7750 1 1 44 SER H    H   10.688  -8.084   4.994 1.00 . A A .  44 SER H    1 1 
       12  7751 1 1 44 SER HA   H    9.644  -9.785   3.903 1.00 . A A .  44 SER HA   1 1 
       12  7752 1 1 44 SER HB2  H    7.166  -8.430   4.995 1.00 . A A .  44 SER HB2  1 1 
       12  7753 1 1 44 SER HB3  H    7.187 -10.027   4.247 1.00 . A A .  44 SER HB3  1 1 
       12  7754 1 1 44 SER HG   H    8.935 -10.384   5.958 1.00 . A A .  44 SER HG   1 1 
       12  7755 1 1 44 SER N    N    9.766  -7.894   4.721 1.00 . A A .  44 SER N    1 1 
       12  7756 1 1 44 SER O    O    7.467  -8.631   2.192 1.00 . A A .  44 SER O    1 1 
       12  7757 1 1 44 SER OG   O    8.120  -9.887   6.056 1.00 . A A .  44 SER OG   1 1 
       12  7758 1 1 45 SER C    C   10.245  -7.865  -0.419 1.00 . A A .  45 SER C    1 1 
       12  7759 1 1 45 SER CA   C    9.277  -7.266   0.596 1.00 . A A .  45 SER CA   1 1 
       12  7760 1 1 45 SER CB   C    9.392  -5.741   0.589 1.00 . A A .  45 SER CB   1 1 
       12  7761 1 1 45 SER H    H   10.423  -7.659   2.332 1.00 . A A .  45 SER H    1 1 
       12  7762 1 1 45 SER HA   H    8.270  -7.544   0.323 1.00 . A A .  45 SER HA   1 1 
       12  7763 1 1 45 SER HB2  H   10.330  -5.451   1.038 1.00 . A A .  45 SER HB2  1 1 
       12  7764 1 1 45 SER HB3  H    9.355  -5.384  -0.430 1.00 . A A .  45 SER HB3  1 1 
       12  7765 1 1 45 SER HG   H    7.522  -5.198   0.808 1.00 . A A .  45 SER HG   1 1 
       12  7766 1 1 45 SER N    N    9.537  -7.787   1.933 1.00 . A A .  45 SER N    1 1 
       12  7767 1 1 45 SER O    O   11.279  -7.275  -0.731 1.00 . A A .  45 SER O    1 1 
       12  7768 1 1 45 SER OG   O    8.333  -5.146   1.319 1.00 . A A .  45 SER OG   1 1 
       12  7769 1 1 46 GLY C    C   10.232  -9.555  -3.323 1.00 . A A .  46 GLY C    1 1 
       12  7770 1 1 46 GLY CA   C   10.751  -9.704  -1.906 1.00 . A A .  46 GLY CA   1 1 
       12  7771 1 1 46 GLY H    H    9.066  -9.467  -0.646 1.00 . A A .  46 GLY H    1 1 
       12  7772 1 1 46 GLY HA2  H   11.742  -9.279  -1.851 1.00 . A A .  46 GLY HA2  1 1 
       12  7773 1 1 46 GLY HA3  H   10.806 -10.755  -1.664 1.00 . A A .  46 GLY HA3  1 1 
       12  7774 1 1 46 GLY N    N    9.902  -9.043  -0.932 1.00 . A A .  46 GLY N    1 1 
       12  7775 1 1 46 GLY O    O    9.635  -8.526  -3.637 1.00 . A A .  46 GLY O    1 1 
       12  7776 2 2  1 ZN  ZN   ZN   3.032  -1.044  -4.852 1.00 . B A . 181 ZN  ZN   1 1 
       13  7777 1 1  1 GLY C    C    6.732 -32.882  -7.538 1.00 . A A .   1 GLY C    1 1 
       13  7778 1 1  1 GLY CA   C    7.484 -33.508  -8.696 1.00 . A A .   1 GLY CA   1 1 
       13  7779 1 1  1 GLY H1   H    9.250 -33.715  -7.546 1.00 . A A .   1 GLY H1   1 1 
       13  7780 1 1  1 GLY HA2  H    7.689 -32.745  -9.433 1.00 . A A .   1 GLY HA2  1 1 
       13  7781 1 1  1 GLY HA3  H    6.863 -34.269  -9.144 1.00 . A A .   1 GLY HA3  1 1 
       13  7782 1 1  1 GLY N    N    8.738 -34.110  -8.283 1.00 . A A .   1 GLY N    1 1 
       13  7783 1 1  1 GLY O    O    6.487 -33.534  -6.523 1.00 . A A .   1 GLY O    1 1 
       13  7784 1 1  2 SER C    C    5.208 -29.518  -7.132 1.00 . A A .   2 SER C    1 1 
       13  7785 1 1  2 SER CA   C    5.641 -30.898  -6.645 1.00 . A A .   2 SER CA   1 1 
       13  7786 1 1  2 SER CB   C    6.511 -30.760  -5.394 1.00 . A A .   2 SER CB   1 1 
       13  7787 1 1  2 SER H    H    6.590 -31.147  -8.522 1.00 . A A .   2 SER H    1 1 
       13  7788 1 1  2 SER HA   H    4.761 -31.472  -6.399 1.00 . A A .   2 SER HA   1 1 
       13  7789 1 1  2 SER HB2  H    5.989 -30.168  -4.659 1.00 . A A .   2 SER HB2  1 1 
       13  7790 1 1  2 SER HB3  H    6.714 -31.741  -4.990 1.00 . A A .   2 SER HB3  1 1 
       13  7791 1 1  2 SER HG   H    8.413 -30.795  -5.863 1.00 . A A .   2 SER HG   1 1 
       13  7792 1 1  2 SER N    N    6.365 -31.614  -7.689 1.00 . A A .   2 SER N    1 1 
       13  7793 1 1  2 SER O    O    5.990 -28.791  -7.745 1.00 . A A .   2 SER O    1 1 
       13  7794 1 1  2 SER OG   O    7.743 -30.128  -5.697 1.00 . A A .   2 SER OG   1 1 
       13  7795 1 1  3 SER C    C    2.174 -27.522  -6.457 1.00 . A A .   3 SER C    1 1 
       13  7796 1 1  3 SER CA   C    3.418 -27.875  -7.268 1.00 . A A .   3 SER CA   1 1 
       13  7797 1 1  3 SER CB   C    3.079 -27.894  -8.760 1.00 . A A .   3 SER CB   1 1 
       13  7798 1 1  3 SER H    H    3.383 -29.789  -6.364 1.00 . A A .   3 SER H    1 1 
       13  7799 1 1  3 SER HA   H    4.175 -27.127  -7.089 1.00 . A A .   3 SER HA   1 1 
       13  7800 1 1  3 SER HB2  H    2.736 -28.879  -9.036 1.00 . A A .   3 SER HB2  1 1 
       13  7801 1 1  3 SER HB3  H    2.301 -27.172  -8.959 1.00 . A A .   3 SER HB3  1 1 
       13  7802 1 1  3 SER HG   H    4.268 -28.168 -10.293 1.00 . A A .   3 SER HG   1 1 
       13  7803 1 1  3 SER N    N    3.957 -29.166  -6.855 1.00 . A A .   3 SER N    1 1 
       13  7804 1 1  3 SER O    O    1.496 -28.400  -5.927 1.00 . A A .   3 SER O    1 1 
       13  7805 1 1  3 SER OG   O    4.214 -27.569  -9.544 1.00 . A A .   3 SER OG   1 1 
       13  7806 1 1  4 GLY C    C   -0.153 -24.836  -6.420 1.00 . A A .   4 GLY C    1 1 
       13  7807 1 1  4 GLY CA   C    0.722 -25.780  -5.620 1.00 . A A .   4 GLY CA   1 1 
       13  7808 1 1  4 GLY H    H    2.460 -25.572  -6.811 1.00 . A A .   4 GLY H    1 1 
       13  7809 1 1  4 GLY HA2  H    0.137 -26.641  -5.334 1.00 . A A .   4 GLY HA2  1 1 
       13  7810 1 1  4 GLY HA3  H    1.057 -25.272  -4.727 1.00 . A A .   4 GLY HA3  1 1 
       13  7811 1 1  4 GLY N    N    1.882 -26.228  -6.367 1.00 . A A .   4 GLY N    1 1 
       13  7812 1 1  4 GLY O    O   -0.395 -25.058  -7.606 1.00 . A A .   4 GLY O    1 1 
       13  7813 1 1  5 SER C    C   -1.770 -21.618  -5.504 1.00 . A A .   5 SER C    1 1 
       13  7814 1 1  5 SER CA   C   -1.490 -22.801  -6.426 1.00 . A A .   5 SER CA   1 1 
       13  7815 1 1  5 SER CB   C   -2.807 -23.452  -6.853 1.00 . A A .   5 SER CB   1 1 
       13  7816 1 1  5 SER H    H   -0.402 -23.657  -4.823 1.00 . A A .   5 SER H    1 1 
       13  7817 1 1  5 SER HA   H   -0.973 -22.443  -7.304 1.00 . A A .   5 SER HA   1 1 
       13  7818 1 1  5 SER HB2  H   -2.619 -24.469  -7.160 1.00 . A A .   5 SER HB2  1 1 
       13  7819 1 1  5 SER HB3  H   -3.494 -23.448  -6.020 1.00 . A A .   5 SER HB3  1 1 
       13  7820 1 1  5 SER HG   H   -2.830 -22.819  -8.707 1.00 . A A .   5 SER HG   1 1 
       13  7821 1 1  5 SER N    N   -0.631 -23.779  -5.769 1.00 . A A .   5 SER N    1 1 
       13  7822 1 1  5 SER O    O   -1.536 -21.688  -4.297 1.00 . A A .   5 SER O    1 1 
       13  7823 1 1  5 SER OG   O   -3.395 -22.750  -7.935 1.00 . A A .   5 SER OG   1 1 
       13  7824 1 1  6 SER C    C   -4.007 -18.863  -5.586 1.00 . A A .   6 SER C    1 1 
       13  7825 1 1  6 SER CA   C   -2.581 -19.331  -5.313 1.00 . A A .   6 SER CA   1 1 
       13  7826 1 1  6 SER CB   C   -1.592 -18.214  -5.653 1.00 . A A .   6 SER CB   1 1 
       13  7827 1 1  6 SER H    H   -2.436 -20.537  -7.048 1.00 . A A .   6 SER H    1 1 
       13  7828 1 1  6 SER HA   H   -2.489 -19.575  -4.265 1.00 . A A .   6 SER HA   1 1 
       13  7829 1 1  6 SER HB2  H   -0.641 -18.648  -5.923 1.00 . A A .   6 SER HB2  1 1 
       13  7830 1 1  6 SER HB3  H   -1.975 -17.639  -6.484 1.00 . A A .   6 SER HB3  1 1 
       13  7831 1 1  6 SER HG   H   -0.472 -17.334  -4.308 1.00 . A A .   6 SER HG   1 1 
       13  7832 1 1  6 SER N    N   -2.272 -20.531  -6.081 1.00 . A A .   6 SER N    1 1 
       13  7833 1 1  6 SER O    O   -4.233 -17.956  -6.386 1.00 . A A .   6 SER O    1 1 
       13  7834 1 1  6 SER OG   O   -1.401 -17.348  -4.548 1.00 . A A .   6 SER OG   1 1 
       13  7835 1 1  7 GLY C    C   -6.682 -18.769  -6.535 1.00 . A A .   7 GLY C    1 1 
       13  7836 1 1  7 GLY CA   C   -6.361 -19.127  -5.098 1.00 . A A .   7 GLY CA   1 1 
       13  7837 1 1  7 GLY H    H   -4.729 -20.207  -4.289 1.00 . A A .   7 GLY H    1 1 
       13  7838 1 1  7 GLY HA2  H   -6.981 -19.957  -4.797 1.00 . A A .   7 GLY HA2  1 1 
       13  7839 1 1  7 GLY HA3  H   -6.584 -18.277  -4.469 1.00 . A A .   7 GLY HA3  1 1 
       13  7840 1 1  7 GLY N    N   -4.968 -19.491  -4.914 1.00 . A A .   7 GLY N    1 1 
       13  7841 1 1  7 GLY O    O   -6.061 -19.286  -7.463 1.00 . A A .   7 GLY O    1 1 
       13  7842 1 1  8 GLU C    C   -8.916 -16.198  -7.990 1.00 . A A .   8 GLU C    1 1 
       13  7843 1 1  8 GLU CA   C   -8.060 -17.460  -8.055 1.00 . A A .   8 GLU CA   1 1 
       13  7844 1 1  8 GLU CB   C   -8.834 -18.578  -8.757 1.00 . A A .   8 GLU CB   1 1 
       13  7845 1 1  8 GLU CD   C  -10.967 -19.926  -8.872 1.00 . A A .   8 GLU CD   1 1 
       13  7846 1 1  8 GLU CG   C  -10.146 -18.930  -8.077 1.00 . A A .   8 GLU CG   1 1 
       13  7847 1 1  8 GLU H    H   -8.114 -17.507  -5.939 1.00 . A A .   8 GLU H    1 1 
       13  7848 1 1  8 GLU HA   H   -7.166 -17.245  -8.619 1.00 . A A .   8 GLU HA   1 1 
       13  7849 1 1  8 GLU HB2  H   -9.048 -18.271  -9.770 1.00 . A A .   8 GLU HB2  1 1 
       13  7850 1 1  8 GLU HB3  H   -8.217 -19.465  -8.782 1.00 . A A .   8 GLU HB3  1 1 
       13  7851 1 1  8 GLU HG2  H   -9.933 -19.356  -7.108 1.00 . A A .   8 GLU HG2  1 1 
       13  7852 1 1  8 GLU HG3  H  -10.725 -18.027  -7.951 1.00 . A A .   8 GLU HG3  1 1 
       13  7853 1 1  8 GLU N    N   -7.656 -17.883  -6.719 1.00 . A A .   8 GLU N    1 1 
       13  7854 1 1  8 GLU O    O   -9.868 -16.119  -7.215 1.00 . A A .   8 GLU O    1 1 
       13  7855 1 1  8 GLU OE1  O  -11.370 -19.590 -10.006 1.00 . A A .   8 GLU OE1  1 1 
       13  7856 1 1  8 GLU OE2  O  -11.208 -21.040  -8.362 1.00 . A A .   8 GLU OE2  1 1 
       13  7857 1 1  9 GLY C    C   -8.446 -12.778  -9.194 1.00 . A A .   9 GLY C    1 1 
       13  7858 1 1  9 GLY CA   C   -9.314 -13.966  -8.832 1.00 . A A .   9 GLY CA   1 1 
       13  7859 1 1  9 GLY H    H   -7.800 -15.331  -9.408 1.00 . A A .   9 GLY H    1 1 
       13  7860 1 1  9 GLY HA2  H  -10.112 -14.049  -9.554 1.00 . A A .   9 GLY HA2  1 1 
       13  7861 1 1  9 GLY HA3  H   -9.741 -13.800  -7.854 1.00 . A A .   9 GLY HA3  1 1 
       13  7862 1 1  9 GLY N    N   -8.569 -15.212  -8.812 1.00 . A A .   9 GLY N    1 1 
       13  7863 1 1  9 GLY O    O   -7.841 -12.155  -8.322 1.00 . A A .   9 GLY O    1 1 
       13  7864 1 1 10 GLU C    C   -8.321 -10.022 -10.765 1.00 . A A .  10 GLU C    1 1 
       13  7865 1 1 10 GLU CA   C   -7.580 -11.342 -10.958 1.00 . A A .  10 GLU CA   1 1 
       13  7866 1 1 10 GLU CB   C   -7.226 -11.529 -12.435 1.00 . A A .  10 GLU CB   1 1 
       13  7867 1 1 10 GLU CD   C   -9.462 -12.383 -13.240 1.00 . A A .  10 GLU CD   1 1 
       13  7868 1 1 10 GLU CG   C   -8.399 -11.311 -13.375 1.00 . A A .  10 GLU CG   1 1 
       13  7869 1 1 10 GLU H    H   -8.888 -12.998 -11.132 1.00 . A A .  10 GLU H    1 1 
       13  7870 1 1 10 GLU HA   H   -6.670 -11.318 -10.379 1.00 . A A .  10 GLU HA   1 1 
       13  7871 1 1 10 GLU HB2  H   -6.445 -10.830 -12.697 1.00 . A A .  10 GLU HB2  1 1 
       13  7872 1 1 10 GLU HB3  H   -6.858 -12.534 -12.580 1.00 . A A .  10 GLU HB3  1 1 
       13  7873 1 1 10 GLU HG2  H   -8.846 -10.353 -13.156 1.00 . A A .  10 GLU HG2  1 1 
       13  7874 1 1 10 GLU HG3  H   -8.034 -11.312 -14.392 1.00 . A A .  10 GLU HG3  1 1 
       13  7875 1 1 10 GLU N    N   -8.383 -12.463 -10.484 1.00 . A A .  10 GLU N    1 1 
       13  7876 1 1 10 GLU O    O   -9.499  -9.902 -11.102 1.00 . A A .  10 GLU O    1 1 
       13  7877 1 1 10 GLU OE1  O   -9.203 -13.532 -13.654 1.00 . A A .  10 GLU OE1  1 1 
       13  7878 1 1 10 GLU OE2  O  -10.554 -12.073 -12.720 1.00 . A A .  10 GLU OE2  1 1 
       13  7879 1 1 11 LYS C    C   -7.571  -6.666 -10.878 1.00 . A A .  11 LYS C    1 1 
       13  7880 1 1 11 LYS CA   C   -8.210  -7.720  -9.980 1.00 . A A .  11 LYS CA   1 1 
       13  7881 1 1 11 LYS CB   C   -8.044  -7.324  -8.512 1.00 . A A .  11 LYS CB   1 1 
       13  7882 1 1 11 LYS CD   C   -8.958  -7.535  -6.181 1.00 . A A .  11 LYS CD   1 1 
       13  7883 1 1 11 LYS CE   C   -9.389  -8.542  -5.126 1.00 . A A .  11 LYS CE   1 1 
       13  7884 1 1 11 LYS CG   C   -8.860  -8.176  -7.555 1.00 . A A .  11 LYS CG   1 1 
       13  7885 1 1 11 LYS H    H   -6.686  -9.189  -9.971 1.00 . A A .  11 LYS H    1 1 
       13  7886 1 1 11 LYS HA   H   -9.263  -7.782 -10.211 1.00 . A A .  11 LYS HA   1 1 
       13  7887 1 1 11 LYS HB2  H   -7.002  -7.415  -8.242 1.00 . A A .  11 LYS HB2  1 1 
       13  7888 1 1 11 LYS HB3  H   -8.349  -6.294  -8.393 1.00 . A A .  11 LYS HB3  1 1 
       13  7889 1 1 11 LYS HD2  H   -7.991  -7.137  -5.910 1.00 . A A .  11 LYS HD2  1 1 
       13  7890 1 1 11 LYS HD3  H   -9.682  -6.733  -6.219 1.00 . A A .  11 LYS HD3  1 1 
       13  7891 1 1 11 LYS HE2  H  -10.461  -8.654  -5.171 1.00 . A A .  11 LYS HE2  1 1 
       13  7892 1 1 11 LYS HE3  H   -8.918  -9.490  -5.339 1.00 . A A .  11 LYS HE3  1 1 
       13  7893 1 1 11 LYS HG2  H   -9.856  -8.297  -7.956 1.00 . A A .  11 LYS HG2  1 1 
       13  7894 1 1 11 LYS HG3  H   -8.389  -9.144  -7.459 1.00 . A A .  11 LYS HG3  1 1 
       13  7895 1 1 11 LYS HZ1  H   -8.541  -8.889  -3.248 1.00 . A A .  11 LYS HZ1  1 1 
       13  7896 1 1 11 LYS HZ2  H   -9.848  -7.814  -3.223 1.00 . A A .  11 LYS HZ2  1 1 
       13  7897 1 1 11 LYS HZ3  H   -8.345  -7.304  -3.806 1.00 . A A .  11 LYS HZ3  1 1 
       13  7898 1 1 11 LYS N    N   -7.622  -9.033 -10.219 1.00 . A A .  11 LYS N    1 1 
       13  7899 1 1 11 LYS NZ   N   -9.004  -8.107  -3.755 1.00 . A A .  11 LYS NZ   1 1 
       13  7900 1 1 11 LYS O    O   -6.376  -6.708 -11.172 1.00 . A A .  11 LYS O    1 1 
       13  7901 1 1 12 PRO C    C   -6.995  -3.639 -11.463 1.00 . A A .  12 PRO C    1 1 
       13  7902 1 1 12 PRO CA   C   -7.917  -4.611 -12.192 1.00 . A A .  12 PRO CA   1 1 
       13  7903 1 1 12 PRO CB   C   -9.212  -3.909 -12.608 1.00 . A A .  12 PRO CB   1 1 
       13  7904 1 1 12 PRO CD   C   -9.817  -5.583 -11.013 1.00 . A A .  12 PRO CD   1 1 
       13  7905 1 1 12 PRO CG   C  -10.175  -4.210 -11.513 1.00 . A A .  12 PRO CG   1 1 
       13  7906 1 1 12 PRO HA   H   -7.415  -4.992 -13.069 1.00 . A A .  12 PRO HA   1 1 
       13  7907 1 1 12 PRO HB2  H   -9.035  -2.846 -12.699 1.00 . A A .  12 PRO HB2  1 1 
       13  7908 1 1 12 PRO HB3  H   -9.553  -4.304 -13.553 1.00 . A A .  12 PRO HB3  1 1 
       13  7909 1 1 12 PRO HD2  H   -9.989  -5.653  -9.949 1.00 . A A .  12 PRO HD2  1 1 
       13  7910 1 1 12 PRO HD3  H  -10.386  -6.336 -11.540 1.00 . A A .  12 PRO HD3  1 1 
       13  7911 1 1 12 PRO HG2  H  -10.070  -3.484 -10.721 1.00 . A A .  12 PRO HG2  1 1 
       13  7912 1 1 12 PRO HG3  H  -11.184  -4.203 -11.899 1.00 . A A .  12 PRO HG3  1 1 
       13  7913 1 1 12 PRO N    N   -8.382  -5.696 -11.324 1.00 . A A .  12 PRO N    1 1 
       13  7914 1 1 12 PRO O    O   -6.246  -2.890 -12.091 1.00 . A A .  12 PRO O    1 1 
       13  7915 1 1 13 TYR C    C   -5.021  -3.527  -8.762 1.00 . A A .  13 TYR C    1 1 
       13  7916 1 1 13 TYR CA   C   -6.225  -2.777  -9.322 1.00 . A A .  13 TYR CA   1 1 
       13  7917 1 1 13 TYR CB   C   -7.048  -2.183  -8.178 1.00 . A A .  13 TYR CB   1 1 
       13  7918 1 1 13 TYR CD1  C   -8.313  -0.327  -9.332 1.00 . A A .  13 TYR CD1  1 1 
       13  7919 1 1 13 TYR CD2  C   -9.565  -2.108  -8.362 1.00 . A A .  13 TYR CD2  1 1 
       13  7920 1 1 13 TYR CE1  C   -9.484   0.276  -9.748 1.00 . A A .  13 TYR CE1  1 1 
       13  7921 1 1 13 TYR CE2  C  -10.741  -1.513  -8.776 1.00 . A A .  13 TYR CE2  1 1 
       13  7922 1 1 13 TYR CG   C   -8.332  -1.527  -8.632 1.00 . A A .  13 TYR CG   1 1 
       13  7923 1 1 13 TYR CZ   C  -10.696  -0.321  -9.468 1.00 . A A .  13 TYR CZ   1 1 
       13  7924 1 1 13 TYR H    H   -7.671  -4.277  -9.694 1.00 . A A .  13 TYR H    1 1 
       13  7925 1 1 13 TYR HA   H   -5.874  -1.975  -9.954 1.00 . A A .  13 TYR HA   1 1 
       13  7926 1 1 13 TYR HB2  H   -7.305  -2.967  -7.483 1.00 . A A .  13 TYR HB2  1 1 
       13  7927 1 1 13 TYR HB3  H   -6.456  -1.436  -7.668 1.00 . A A .  13 TYR HB3  1 1 
       13  7928 1 1 13 TYR HD1  H   -7.363   0.138  -9.551 1.00 . A A .  13 TYR HD1  1 1 
       13  7929 1 1 13 TYR HD2  H   -9.598  -3.042  -7.819 1.00 . A A .  13 TYR HD2  1 1 
       13  7930 1 1 13 TYR HE1  H   -9.449   1.209 -10.291 1.00 . A A .  13 TYR HE1  1 1 
       13  7931 1 1 13 TYR HE2  H  -11.690  -1.980  -8.556 1.00 . A A .  13 TYR HE2  1 1 
       13  7932 1 1 13 TYR HH   H  -12.592  -0.035  -9.338 1.00 . A A .  13 TYR HH   1 1 
       13  7933 1 1 13 TYR N    N   -7.054  -3.658 -10.137 1.00 . A A .  13 TYR N    1 1 
       13  7934 1 1 13 TYR O    O   -5.030  -3.965  -7.612 1.00 . A A .  13 TYR O    1 1 
       13  7935 1 1 13 TYR OH   O  -11.865   0.276  -9.882 1.00 . A A .  13 TYR OH   1 1 
       13  7936 1 1 14 GLN C    C   -1.541  -3.496  -9.400 1.00 . A A .  14 GLN C    1 1 
       13  7937 1 1 14 GLN CA   C   -2.773  -4.365  -9.170 1.00 . A A .  14 GLN CA   1 1 
       13  7938 1 1 14 GLN CB   C   -2.631  -5.683  -9.933 1.00 . A A .  14 GLN CB   1 1 
       13  7939 1 1 14 GLN CD   C   -1.522  -7.345  -8.387 1.00 . A A .  14 GLN CD   1 1 
       13  7940 1 1 14 GLN CG   C   -1.361  -6.447  -9.598 1.00 . A A .  14 GLN CG   1 1 
       13  7941 1 1 14 GLN H    H   -4.039  -3.296 -10.488 1.00 . A A .  14 GLN H    1 1 
       13  7942 1 1 14 GLN HA   H   -2.856  -4.577  -8.115 1.00 . A A .  14 GLN HA   1 1 
       13  7943 1 1 14 GLN HB2  H   -3.477  -6.313  -9.700 1.00 . A A .  14 GLN HB2  1 1 
       13  7944 1 1 14 GLN HB3  H   -2.630  -5.473 -10.993 1.00 . A A .  14 GLN HB3  1 1 
       13  7945 1 1 14 GLN HE21 H   -1.572  -8.953  -9.556 1.00 . A A .  14 GLN HE21 1 1 
       13  7946 1 1 14 GLN HE22 H   -1.719  -9.252  -7.861 1.00 . A A .  14 GLN HE22 1 1 
       13  7947 1 1 14 GLN HG2  H   -1.088  -7.058 -10.446 1.00 . A A .  14 GLN HG2  1 1 
       13  7948 1 1 14 GLN HG3  H   -0.572  -5.737  -9.398 1.00 . A A .  14 GLN HG3  1 1 
       13  7949 1 1 14 GLN N    N   -3.985  -3.668  -9.583 1.00 . A A .  14 GLN N    1 1 
       13  7950 1 1 14 GLN NE2  N   -1.615  -8.648  -8.625 1.00 . A A .  14 GLN NE2  1 1 
       13  7951 1 1 14 GLN O    O   -1.155  -3.236 -10.540 1.00 . A A .  14 GLN O    1 1 
       13  7952 1 1 14 GLN OE1  O   -1.564  -6.873  -7.251 1.00 . A A .  14 GLN OE1  1 1 
       13  7953 1 1 15 CYS C    C    1.469  -3.016  -8.857 1.00 . A A .  15 CYS C    1 1 
       13  7954 1 1 15 CYS CA   C    0.261  -2.208  -8.392 1.00 . A A .  15 CYS CA   1 1 
       13  7955 1 1 15 CYS CB   C    0.554  -1.569  -7.033 1.00 . A A .  15 CYS CB   1 1 
       13  7956 1 1 15 CYS H    H   -1.281  -3.289  -7.428 1.00 . A A .  15 CYS H    1 1 
       13  7957 1 1 15 CYS HA   H    0.067  -1.427  -9.112 1.00 . A A .  15 CYS HA   1 1 
       13  7958 1 1 15 CYS HB2  H   -0.247  -0.889  -6.783 1.00 . A A .  15 CYS HB2  1 1 
       13  7959 1 1 15 CYS HB3  H    0.608  -2.345  -6.283 1.00 . A A .  15 CYS HB3  1 1 
       13  7960 1 1 15 CYS N    N   -0.927  -3.048  -8.310 1.00 . A A .  15 CYS N    1 1 
       13  7961 1 1 15 CYS O    O    1.936  -3.913  -8.155 1.00 . A A .  15 CYS O    1 1 
       13  7962 1 1 15 CYS SG   S    2.114  -0.630  -6.973 1.00 . A A .  15 CYS SG   1 1 
       13  7963 1 1 16 SER C    C    4.401  -3.004  -9.871 1.00 . A A .  16 SER C    1 1 
       13  7964 1 1 16 SER CA   C    3.120  -3.389 -10.606 1.00 . A A .  16 SER CA   1 1 
       13  7965 1 1 16 SER CB   C    3.259  -3.072 -12.096 1.00 . A A .  16 SER CB   1 1 
       13  7966 1 1 16 SER H    H    1.553  -1.967 -10.557 1.00 . A A .  16 SER H    1 1 
       13  7967 1 1 16 SER HA   H    2.956  -4.450 -10.487 1.00 . A A .  16 SER HA   1 1 
       13  7968 1 1 16 SER HB2  H    2.920  -2.064 -12.280 1.00 . A A .  16 SER HB2  1 1 
       13  7969 1 1 16 SER HB3  H    4.296  -3.161 -12.386 1.00 . A A .  16 SER HB3  1 1 
       13  7970 1 1 16 SER HG   H    1.646  -3.554 -13.099 1.00 . A A .  16 SER HG   1 1 
       13  7971 1 1 16 SER N    N    1.969  -2.692 -10.045 1.00 . A A .  16 SER N    1 1 
       13  7972 1 1 16 SER O    O    5.222  -3.860  -9.544 1.00 . A A .  16 SER O    1 1 
       13  7973 1 1 16 SER OG   O    2.487  -3.964 -12.882 1.00 . A A .  16 SER OG   1 1 
       13  7974 1 1 17 GLU C    C    6.221  -2.211  -7.873 1.00 . A A .  17 GLU C    1 1 
       13  7975 1 1 17 GLU CA   C    5.743  -1.210  -8.921 1.00 . A A .  17 GLU CA   1 1 
       13  7976 1 1 17 GLU CB   C    5.441   0.135  -8.257 1.00 . A A .  17 GLU CB   1 1 
       13  7977 1 1 17 GLU CD   C    6.372   2.202  -7.143 1.00 . A A .  17 GLU CD   1 1 
       13  7978 1 1 17 GLU CG   C    6.683   0.950  -7.940 1.00 . A A .  17 GLU CG   1 1 
       13  7979 1 1 17 GLU H    H    3.873  -1.075  -9.903 1.00 . A A .  17 GLU H    1 1 
       13  7980 1 1 17 GLU HA   H    6.525  -1.073  -9.652 1.00 . A A .  17 GLU HA   1 1 
       13  7981 1 1 17 GLU HB2  H    4.813   0.715  -8.917 1.00 . A A .  17 GLU HB2  1 1 
       13  7982 1 1 17 GLU HB3  H    4.909  -0.045  -7.335 1.00 . A A .  17 GLU HB3  1 1 
       13  7983 1 1 17 GLU HG2  H    7.364   0.337  -7.368 1.00 . A A .  17 GLU HG2  1 1 
       13  7984 1 1 17 GLU HG3  H    7.155   1.239  -8.868 1.00 . A A .  17 GLU HG3  1 1 
       13  7985 1 1 17 GLU N    N    4.563  -1.709  -9.616 1.00 . A A .  17 GLU N    1 1 
       13  7986 1 1 17 GLU O    O    7.392  -2.591  -7.849 1.00 . A A .  17 GLU O    1 1 
       13  7987 1 1 17 GLU OE1  O    5.280   2.775  -7.340 1.00 . A A .  17 GLU OE1  1 1 
       13  7988 1 1 17 GLU OE2  O    7.221   2.607  -6.321 1.00 . A A .  17 GLU OE2  1 1 
       13  7989 1 1 18 CYS C    C    4.974  -4.940  -6.224 1.00 . A A .  18 CYS C    1 1 
       13  7990 1 1 18 CYS CA   C    5.632  -3.589  -5.955 1.00 . A A .  18 CYS CA   1 1 
       13  7991 1 1 18 CYS CB   C    5.184  -3.054  -4.594 1.00 . A A .  18 CYS CB   1 1 
       13  7992 1 1 18 CYS H    H    4.389  -2.295  -7.076 1.00 . A A .  18 CYS H    1 1 
       13  7993 1 1 18 CYS HA   H    6.703  -3.721  -5.946 1.00 . A A .  18 CYS HA   1 1 
       13  7994 1 1 18 CYS HB2  H    5.482  -3.752  -3.825 1.00 . A A .  18 CYS HB2  1 1 
       13  7995 1 1 18 CYS HB3  H    5.664  -2.103  -4.414 1.00 . A A .  18 CYS HB3  1 1 
       13  7996 1 1 18 CYS N    N    5.306  -2.634  -7.007 1.00 . A A .  18 CYS N    1 1 
       13  7997 1 1 18 CYS O    O    5.615  -5.985  -6.125 1.00 . A A .  18 CYS O    1 1 
       13  7998 1 1 18 CYS SG   S    3.386  -2.805  -4.447 1.00 . A A .  18 CYS SG   1 1 
       13  7999 1 1 19 GLY C    C    1.885  -6.416  -5.817 1.00 . A A .  19 GLY C    1 1 
       13  8000 1 1 19 GLY CA   C    2.965  -6.135  -6.843 1.00 . A A .  19 GLY CA   1 1 
       13  8001 1 1 19 GLY H    H    3.229  -4.045  -6.628 1.00 . A A .  19 GLY H    1 1 
       13  8002 1 1 19 GLY HA2  H    2.510  -6.058  -7.819 1.00 . A A .  19 GLY HA2  1 1 
       13  8003 1 1 19 GLY HA3  H    3.664  -6.959  -6.847 1.00 . A A .  19 GLY HA3  1 1 
       13  8004 1 1 19 GLY N    N    3.689  -4.908  -6.565 1.00 . A A .  19 GLY N    1 1 
       13  8005 1 1 19 GLY O    O    1.791  -7.526  -5.292 1.00 . A A .  19 GLY O    1 1 
       13  8006 1 1 20 LYS C    C   -1.365  -5.290  -5.210 1.00 . A A .  20 LYS C    1 1 
       13  8007 1 1 20 LYS CA   C   -0.010  -5.551  -4.559 1.00 . A A .  20 LYS CA   1 1 
       13  8008 1 1 20 LYS CB   C    0.198  -4.588  -3.388 1.00 . A A .  20 LYS CB   1 1 
       13  8009 1 1 20 LYS CD   C    0.910  -4.339  -0.992 1.00 . A A .  20 LYS CD   1 1 
       13  8010 1 1 20 LYS CE   C    1.871  -4.821   0.083 1.00 . A A .  20 LYS CE   1 1 
       13  8011 1 1 20 LYS CG   C    1.016  -5.180  -2.253 1.00 . A A .  20 LYS CG   1 1 
       13  8012 1 1 20 LYS H    H    1.194  -4.547  -5.981 1.00 . A A .  20 LYS H    1 1 
       13  8013 1 1 20 LYS HA   H    0.008  -6.565  -4.188 1.00 . A A .  20 LYS HA   1 1 
       13  8014 1 1 20 LYS HB2  H    0.707  -3.707  -3.749 1.00 . A A .  20 LYS HB2  1 1 
       13  8015 1 1 20 LYS HB3  H   -0.767  -4.302  -2.997 1.00 . A A .  20 LYS HB3  1 1 
       13  8016 1 1 20 LYS HD2  H    1.143  -3.312  -1.233 1.00 . A A .  20 LYS HD2  1 1 
       13  8017 1 1 20 LYS HD3  H   -0.101  -4.400  -0.613 1.00 . A A .  20 LYS HD3  1 1 
       13  8018 1 1 20 LYS HE2  H    2.800  -5.109  -0.386 1.00 . A A .  20 LYS HE2  1 1 
       13  8019 1 1 20 LYS HE3  H    2.053  -4.012   0.775 1.00 . A A .  20 LYS HE3  1 1 
       13  8020 1 1 20 LYS HG2  H    0.654  -6.175  -2.040 1.00 . A A .  20 LYS HG2  1 1 
       13  8021 1 1 20 LYS HG3  H    2.052  -5.229  -2.555 1.00 . A A .  20 LYS HG3  1 1 
       13  8022 1 1 20 LYS HZ1  H    1.662  -6.874   0.410 1.00 . A A .  20 LYS HZ1  1 1 
       13  8023 1 1 20 LYS HZ2  H    0.286  -5.973   0.805 1.00 . A A .  20 LYS HZ2  1 1 
       13  8024 1 1 20 LYS HZ3  H    1.634  -5.949   1.826 1.00 . A A .  20 LYS HZ3  1 1 
       13  8025 1 1 20 LYS N    N    1.069  -5.409  -5.529 1.00 . A A .  20 LYS N    1 1 
       13  8026 1 1 20 LYS NZ   N    1.325  -5.986   0.833 1.00 . A A .  20 LYS NZ   1 1 
       13  8027 1 1 20 LYS O    O   -1.533  -4.320  -5.948 1.00 . A A .  20 LYS O    1 1 
       13  8028 1 1 21 SER C    C   -4.630  -5.436  -4.463 1.00 . A A .  21 SER C    1 1 
       13  8029 1 1 21 SER CA   C   -3.668  -6.027  -5.490 1.00 . A A .  21 SER CA   1 1 
       13  8030 1 1 21 SER CB   C   -4.184  -7.386  -5.966 1.00 . A A .  21 SER CB   1 1 
       13  8031 1 1 21 SER H    H   -2.133  -6.915  -4.334 1.00 . A A .  21 SER H    1 1 
       13  8032 1 1 21 SER HA   H   -3.608  -5.358  -6.335 1.00 . A A .  21 SER HA   1 1 
       13  8033 1 1 21 SER HB2  H   -3.503  -7.790  -6.699 1.00 . A A .  21 SER HB2  1 1 
       13  8034 1 1 21 SER HB3  H   -4.248  -8.059  -5.123 1.00 . A A .  21 SER HB3  1 1 
       13  8035 1 1 21 SER HG   H   -5.938  -6.532  -6.151 1.00 . A A .  21 SER HG   1 1 
       13  8036 1 1 21 SER N    N   -2.329  -6.162  -4.929 1.00 . A A .  21 SER N    1 1 
       13  8037 1 1 21 SER O    O   -4.463  -5.626  -3.258 1.00 . A A .  21 SER O    1 1 
       13  8038 1 1 21 SER OG   O   -5.469  -7.267  -6.553 1.00 . A A .  21 SER OG   1 1 
       13  8039 1 1 22 PHE C    C   -8.029  -4.237  -4.656 1.00 . A A .  22 PHE C    1 1 
       13  8040 1 1 22 PHE CA   C   -6.626  -4.099  -4.074 1.00 . A A .  22 PHE CA   1 1 
       13  8041 1 1 22 PHE CB   C   -6.293  -2.621  -3.860 1.00 . A A .  22 PHE CB   1 1 
       13  8042 1 1 22 PHE CD1  C   -4.242  -2.950  -2.453 1.00 . A A .  22 PHE CD1  1 1 
       13  8043 1 1 22 PHE CD2  C   -4.082  -1.555  -4.380 1.00 . A A .  22 PHE CD2  1 1 
       13  8044 1 1 22 PHE CE1  C   -2.908  -2.720  -2.173 1.00 . A A .  22 PHE CE1  1 1 
       13  8045 1 1 22 PHE CE2  C   -2.748  -1.322  -4.105 1.00 . A A .  22 PHE CE2  1 1 
       13  8046 1 1 22 PHE CG   C   -4.843  -2.370  -3.559 1.00 . A A .  22 PHE CG   1 1 
       13  8047 1 1 22 PHE CZ   C   -2.160  -1.906  -3.001 1.00 . A A .  22 PHE CZ   1 1 
       13  8048 1 1 22 PHE H    H   -5.717  -4.603  -5.919 1.00 . A A .  22 PHE H    1 1 
       13  8049 1 1 22 PHE HA   H   -6.592  -4.608  -3.123 1.00 . A A .  22 PHE HA   1 1 
       13  8050 1 1 22 PHE HB2  H   -6.546  -2.069  -4.753 1.00 . A A .  22 PHE HB2  1 1 
       13  8051 1 1 22 PHE HB3  H   -6.876  -2.244  -3.033 1.00 . A A .  22 PHE HB3  1 1 
       13  8052 1 1 22 PHE HD1  H   -4.825  -3.588  -1.806 1.00 . A A .  22 PHE HD1  1 1 
       13  8053 1 1 22 PHE HD2  H   -4.541  -1.097  -5.246 1.00 . A A .  22 PHE HD2  1 1 
       13  8054 1 1 22 PHE HE1  H   -2.451  -3.179  -1.309 1.00 . A A .  22 PHE HE1  1 1 
       13  8055 1 1 22 PHE HE2  H   -2.166  -0.685  -4.755 1.00 . A A .  22 PHE HE2  1 1 
       13  8056 1 1 22 PHE HZ   H   -1.118  -1.725  -2.784 1.00 . A A .  22 PHE HZ   1 1 
       13  8057 1 1 22 PHE N    N   -5.637  -4.719  -4.949 1.00 . A A .  22 PHE N    1 1 
       13  8058 1 1 22 PHE O    O   -8.198  -4.431  -5.860 1.00 . A A .  22 PHE O    1 1 
       13  8059 1 1 23 SER C    C  -11.073  -2.879  -4.342 1.00 . A A .  23 SER C    1 1 
       13  8060 1 1 23 SER CA   C  -10.424  -4.254  -4.219 1.00 . A A .  23 SER CA   1 1 
       13  8061 1 1 23 SER CB   C  -11.212  -5.116  -3.230 1.00 . A A .  23 SER CB   1 1 
       13  8062 1 1 23 SER H    H   -8.836  -3.981  -2.845 1.00 . A A .  23 SER H    1 1 
       13  8063 1 1 23 SER HA   H  -10.434  -4.732  -5.187 1.00 . A A .  23 SER HA   1 1 
       13  8064 1 1 23 SER HB2  H  -12.205  -5.286  -3.617 1.00 . A A .  23 SER HB2  1 1 
       13  8065 1 1 23 SER HB3  H  -10.708  -6.063  -3.101 1.00 . A A .  23 SER HB3  1 1 
       13  8066 1 1 23 SER HG   H  -12.240  -4.301  -1.775 1.00 . A A .  23 SER HG   1 1 
       13  8067 1 1 23 SER N    N   -9.035  -4.136  -3.792 1.00 . A A .  23 SER N    1 1 
       13  8068 1 1 23 SER O    O  -12.206  -2.674  -3.909 1.00 . A A .  23 SER O    1 1 
       13  8069 1 1 23 SER OG   O  -11.316  -4.479  -1.969 1.00 . A A .  23 SER OG   1 1 
       13  8070 1 1 24 GLY C    C   -9.870   0.332  -5.776 1.00 . A A .  24 GLY C    1 1 
       13  8071 1 1 24 GLY CA   C  -10.865  -0.594  -5.106 1.00 . A A .  24 GLY CA   1 1 
       13  8072 1 1 24 GLY H    H   -9.447  -2.159  -5.262 1.00 . A A .  24 GLY H    1 1 
       13  8073 1 1 24 GLY HA2  H  -11.760  -0.640  -5.707 1.00 . A A .  24 GLY HA2  1 1 
       13  8074 1 1 24 GLY HA3  H  -11.115  -0.192  -4.135 1.00 . A A .  24 GLY HA3  1 1 
       13  8075 1 1 24 GLY N    N  -10.345  -1.938  -4.936 1.00 . A A .  24 GLY N    1 1 
       13  8076 1 1 24 GLY O    O   -8.669   0.062  -5.785 1.00 . A A .  24 GLY O    1 1 
       13  8077 1 1 25 SER C    C   -8.732   3.229  -6.016 1.00 . A A .  25 SER C    1 1 
       13  8078 1 1 25 SER CA   C   -9.516   2.393  -7.022 1.00 . A A .  25 SER CA   1 1 
       13  8079 1 1 25 SER CB   C  -10.357   3.307  -7.916 1.00 . A A .  25 SER CB   1 1 
       13  8080 1 1 25 SER H    H  -11.336   1.586  -6.301 1.00 . A A .  25 SER H    1 1 
       13  8081 1 1 25 SER HA   H   -8.819   1.844  -7.638 1.00 . A A .  25 SER HA   1 1 
       13  8082 1 1 25 SER HB2  H   -9.704   3.884  -8.552 1.00 . A A .  25 SER HB2  1 1 
       13  8083 1 1 25 SER HB3  H  -11.014   2.704  -8.526 1.00 . A A .  25 SER HB3  1 1 
       13  8084 1 1 25 SER HG   H  -10.774   5.081  -7.196 1.00 . A A .  25 SER HG   1 1 
       13  8085 1 1 25 SER N    N  -10.370   1.426  -6.341 1.00 . A A .  25 SER N    1 1 
       13  8086 1 1 25 SER O    O   -7.535   3.465  -6.187 1.00 . A A .  25 SER O    1 1 
       13  8087 1 1 25 SER OG   O  -11.142   4.196  -7.140 1.00 . A A .  25 SER OG   1 1 
       13  8088 1 1 26 TYR C    C   -7.639   3.727  -3.267 1.00 . A A .  26 TYR C    1 1 
       13  8089 1 1 26 TYR CA   C   -8.782   4.486  -3.933 1.00 . A A .  26 TYR CA   1 1 
       13  8090 1 1 26 TYR CB   C   -9.813   4.903  -2.882 1.00 . A A .  26 TYR CB   1 1 
       13  8091 1 1 26 TYR CD1  C   -8.324   6.221  -1.326 1.00 . A A .  26 TYR CD1  1 1 
       13  8092 1 1 26 TYR CD2  C   -9.537   4.377  -0.428 1.00 . A A .  26 TYR CD2  1 1 
       13  8093 1 1 26 TYR CE1  C   -7.774   6.471  -0.084 1.00 . A A .  26 TYR CE1  1 1 
       13  8094 1 1 26 TYR CE2  C   -8.993   4.620   0.818 1.00 . A A .  26 TYR CE2  1 1 
       13  8095 1 1 26 TYR CG   C   -9.214   5.172  -1.520 1.00 . A A .  26 TYR CG   1 1 
       13  8096 1 1 26 TYR CZ   C   -8.112   5.668   0.985 1.00 . A A .  26 TYR CZ   1 1 
       13  8097 1 1 26 TYR H    H  -10.365   3.453  -4.886 1.00 . A A .  26 TYR H    1 1 
       13  8098 1 1 26 TYR HA   H   -8.385   5.372  -4.404 1.00 . A A .  26 TYR HA   1 1 
       13  8099 1 1 26 TYR HB2  H  -10.307   5.804  -3.211 1.00 . A A .  26 TYR HB2  1 1 
       13  8100 1 1 26 TYR HB3  H  -10.545   4.116  -2.774 1.00 . A A .  26 TYR HB3  1 1 
       13  8101 1 1 26 TYR HD1  H   -8.061   6.849  -2.166 1.00 . A A .  26 TYR HD1  1 1 
       13  8102 1 1 26 TYR HD2  H  -10.228   3.557  -0.562 1.00 . A A .  26 TYR HD2  1 1 
       13  8103 1 1 26 TYR HE1  H   -7.084   7.291   0.047 1.00 . A A .  26 TYR HE1  1 1 
       13  8104 1 1 26 TYR HE2  H   -9.258   3.991   1.656 1.00 . A A .  26 TYR HE2  1 1 
       13  8105 1 1 26 TYR HH   H   -7.445   5.081   2.690 1.00 . A A .  26 TYR HH   1 1 
       13  8106 1 1 26 TYR N    N   -9.414   3.674  -4.967 1.00 . A A .  26 TYR N    1 1 
       13  8107 1 1 26 TYR O    O   -6.558   4.275  -3.051 1.00 . A A .  26 TYR O    1 1 
       13  8108 1 1 26 TYR OH   O   -7.567   5.912   2.225 1.00 . A A .  26 TYR OH   1 1 
       13  8109 1 1 27 ARG C    C   -5.560   1.679  -3.068 1.00 . A A .  27 ARG C    1 1 
       13  8110 1 1 27 ARG CA   C   -6.879   1.626  -2.302 1.00 . A A .  27 ARG CA   1 1 
       13  8111 1 1 27 ARG CB   C   -7.369   0.180  -2.208 1.00 . A A .  27 ARG CB   1 1 
       13  8112 1 1 27 ARG CD   C   -7.440  -0.264   0.265 1.00 . A A .  27 ARG CD   1 1 
       13  8113 1 1 27 ARG CG   C   -8.258  -0.085  -1.004 1.00 . A A .  27 ARG CG   1 1 
       13  8114 1 1 27 ARG CZ   C   -5.897  -1.904   1.251 1.00 . A A .  27 ARG CZ   1 1 
       13  8115 1 1 27 ARG H    H   -8.767   2.081  -3.142 1.00 . A A .  27 ARG H    1 1 
       13  8116 1 1 27 ARG HA   H   -6.718   2.007  -1.305 1.00 . A A .  27 ARG HA   1 1 
       13  8117 1 1 27 ARG HB2  H   -7.929  -0.057  -3.101 1.00 . A A .  27 ARG HB2  1 1 
       13  8118 1 1 27 ARG HB3  H   -6.513  -0.474  -2.147 1.00 . A A .  27 ARG HB3  1 1 
       13  8119 1 1 27 ARG HD2  H   -6.776   0.581   0.371 1.00 . A A .  27 ARG HD2  1 1 
       13  8120 1 1 27 ARG HD3  H   -8.112  -0.302   1.108 1.00 . A A .  27 ARG HD3  1 1 
       13  8121 1 1 27 ARG HE   H   -6.671  -2.027  -0.583 1.00 . A A .  27 ARG HE   1 1 
       13  8122 1 1 27 ARG HG2  H   -8.928   0.752  -0.872 1.00 . A A .  27 ARG HG2  1 1 
       13  8123 1 1 27 ARG HG3  H   -8.831  -0.983  -1.183 1.00 . A A .  27 ARG HG3  1 1 
       13  8124 1 1 27 ARG HH11 H   -6.366  -0.349   2.452 1.00 . A A .  27 ARG HH11 1 1 
       13  8125 1 1 27 ARG HH12 H   -5.279  -1.513   3.135 1.00 . A A .  27 ARG HH12 1 1 
       13  8126 1 1 27 ARG HH21 H   -5.241  -3.566   0.305 1.00 . A A .  27 ARG HH21 1 1 
       13  8127 1 1 27 ARG HH22 H   -4.640  -3.342   1.913 1.00 . A A .  27 ARG HH22 1 1 
       13  8128 1 1 27 ARG N    N   -7.886   2.461  -2.944 1.00 . A A .  27 ARG N    1 1 
       13  8129 1 1 27 ARG NE   N   -6.645  -1.489   0.235 1.00 . A A .  27 ARG NE   1 1 
       13  8130 1 1 27 ARG NH1  N   -5.842  -1.197   2.371 1.00 . A A .  27 ARG NH1  1 1 
       13  8131 1 1 27 ARG NH2  N   -5.202  -3.030   1.148 1.00 . A A .  27 ARG NH2  1 1 
       13  8132 1 1 27 ARG O    O   -4.482   1.650  -2.472 1.00 . A A .  27 ARG O    1 1 
       13  8133 1 1 28 LEU C    C   -3.768   3.160  -5.109 1.00 . A A .  28 LEU C    1 1 
       13  8134 1 1 28 LEU CA   C   -4.468   1.811  -5.239 1.00 . A A .  28 LEU CA   1 1 
       13  8135 1 1 28 LEU CB   C   -4.849   1.560  -6.699 1.00 . A A .  28 LEU CB   1 1 
       13  8136 1 1 28 LEU CD1  C   -3.367  -0.175  -7.737 1.00 . A A .  28 LEU CD1  1 1 
       13  8137 1 1 28 LEU CD2  C   -4.015   1.856  -9.045 1.00 . A A .  28 LEU CD2  1 1 
       13  8138 1 1 28 LEU CG   C   -3.688   1.309  -7.663 1.00 . A A .  28 LEU CG   1 1 
       13  8139 1 1 28 LEU H    H   -6.539   1.774  -4.808 1.00 . A A .  28 LEU H    1 1 
       13  8140 1 1 28 LEU HA   H   -3.791   1.035  -4.914 1.00 . A A .  28 LEU HA   1 1 
       13  8141 1 1 28 LEU HB2  H   -5.495   0.695  -6.728 1.00 . A A .  28 LEU HB2  1 1 
       13  8142 1 1 28 LEU HB3  H   -5.392   2.425  -7.052 1.00 . A A .  28 LEU HB3  1 1 
       13  8143 1 1 28 LEU HD11 H   -2.653  -0.350  -8.527 1.00 . A A .  28 LEU HD11 1 1 
       13  8144 1 1 28 LEU HD12 H   -4.271  -0.730  -7.940 1.00 . A A .  28 LEU HD12 1 1 
       13  8145 1 1 28 LEU HD13 H   -2.949  -0.501  -6.795 1.00 . A A .  28 LEU HD13 1 1 
       13  8146 1 1 28 LEU HD21 H   -3.583   2.839  -9.154 1.00 . A A .  28 LEU HD21 1 1 
       13  8147 1 1 28 LEU HD22 H   -5.087   1.917  -9.163 1.00 . A A .  28 LEU HD22 1 1 
       13  8148 1 1 28 LEU HD23 H   -3.607   1.197  -9.798 1.00 . A A .  28 LEU HD23 1 1 
       13  8149 1 1 28 LEU HG   H   -2.809   1.823  -7.298 1.00 . A A .  28 LEU HG   1 1 
       13  8150 1 1 28 LEU N    N   -5.653   1.754  -4.391 1.00 . A A .  28 LEU N    1 1 
       13  8151 1 1 28 LEU O    O   -2.621   3.238  -4.668 1.00 . A A .  28 LEU O    1 1 
       13  8152 1 1 29 THR C    C   -3.277   5.827  -4.060 1.00 . A A .  29 THR C    1 1 
       13  8153 1 1 29 THR CA   C   -3.915   5.569  -5.420 1.00 . A A .  29 THR CA   1 1 
       13  8154 1 1 29 THR CB   C   -4.997   6.636  -5.677 1.00 . A A .  29 THR CB   1 1 
       13  8155 1 1 29 THR CG2  C   -5.456   6.602  -7.127 1.00 . A A .  29 THR CG2  1 1 
       13  8156 1 1 29 THR H    H   -5.377   4.097  -5.837 1.00 . A A .  29 THR H    1 1 
       13  8157 1 1 29 THR HA   H   -3.159   5.662  -6.186 1.00 . A A .  29 THR HA   1 1 
       13  8158 1 1 29 THR HB   H   -4.577   7.610  -5.470 1.00 . A A .  29 THR HB   1 1 
       13  8159 1 1 29 THR HG1  H   -6.008   6.933  -4.010 1.00 . A A .  29 THR HG1  1 1 
       13  8160 1 1 29 THR HG21 H   -4.605   6.737  -7.777 1.00 . A A .  29 THR HG21 1 1 
       13  8161 1 1 29 THR HG22 H   -6.168   7.396  -7.298 1.00 . A A .  29 THR HG22 1 1 
       13  8162 1 1 29 THR HG23 H   -5.921   5.650  -7.335 1.00 . A A .  29 THR HG23 1 1 
       13  8163 1 1 29 THR N    N   -4.468   4.223  -5.494 1.00 . A A .  29 THR N    1 1 
       13  8164 1 1 29 THR O    O   -2.099   6.174  -3.974 1.00 . A A .  29 THR O    1 1 
       13  8165 1 1 29 THR OG1  O   -6.117   6.416  -4.812 1.00 . A A .  29 THR OG1  1 1 
       13  8166 1 1 30 GLN C    C   -2.329   5.026  -1.375 1.00 . A A .  30 GLN C    1 1 
       13  8167 1 1 30 GLN CA   C   -3.570   5.870  -1.645 1.00 . A A .  30 GLN CA   1 1 
       13  8168 1 1 30 GLN CB   C   -4.661   5.535  -0.626 1.00 . A A .  30 GLN CB   1 1 
       13  8169 1 1 30 GLN CD   C   -4.035   3.263   0.287 1.00 . A A .  30 GLN CD   1 1 
       13  8170 1 1 30 GLN CG   C   -5.005   4.055  -0.568 1.00 . A A .  30 GLN CG   1 1 
       13  8171 1 1 30 GLN H    H   -4.991   5.378  -3.135 1.00 . A A .  30 GLN H    1 1 
       13  8172 1 1 30 GLN HA   H   -3.309   6.913  -1.548 1.00 . A A .  30 GLN HA   1 1 
       13  8173 1 1 30 GLN HB2  H   -4.329   5.844   0.354 1.00 . A A .  30 GLN HB2  1 1 
       13  8174 1 1 30 GLN HB3  H   -5.557   6.080  -0.883 1.00 . A A .  30 GLN HB3  1 1 
       13  8175 1 1 30 GLN HE21 H   -5.064   1.595  -0.049 1.00 . A A .  30 GLN HE21 1 1 
       13  8176 1 1 30 GLN HE22 H   -3.670   1.428   0.958 1.00 . A A .  30 GLN HE22 1 1 
       13  8177 1 1 30 GLN HG2  H   -5.997   3.945  -0.156 1.00 . A A .  30 GLN HG2  1 1 
       13  8178 1 1 30 GLN HG3  H   -4.987   3.655  -1.572 1.00 . A A .  30 GLN HG3  1 1 
       13  8179 1 1 30 GLN N    N   -4.061   5.655  -3.001 1.00 . A A .  30 GLN N    1 1 
       13  8180 1 1 30 GLN NE2  N   -4.281   1.964   0.412 1.00 . A A .  30 GLN NE2  1 1 
       13  8181 1 1 30 GLN O    O   -1.367   5.495  -0.767 1.00 . A A .  30 GLN O    1 1 
       13  8182 1 1 30 GLN OE1  O   -3.076   3.813   0.828 1.00 . A A .  30 GLN OE1  1 1 
       13  8183 1 1 31 HIS C    C   -0.015   3.335  -2.429 1.00 . A A .  31 HIS C    1 1 
       13  8184 1 1 31 HIS CA   C   -1.234   2.868  -1.639 1.00 . A A .  31 HIS CA   1 1 
       13  8185 1 1 31 HIS CB   C   -1.619   1.451  -2.065 1.00 . A A .  31 HIS CB   1 1 
       13  8186 1 1 31 HIS CD2  C    0.168   0.369  -3.603 1.00 . A A .  31 HIS CD2  1 1 
       13  8187 1 1 31 HIS CE1  C    1.219  -0.816  -2.089 1.00 . A A .  31 HIS CE1  1 1 
       13  8188 1 1 31 HIS CG   C   -0.445   0.591  -2.417 1.00 . A A .  31 HIS CG   1 1 
       13  8189 1 1 31 HIS H    H   -3.152   3.462  -2.309 1.00 . A A .  31 HIS H    1 1 
       13  8190 1 1 31 HIS HA   H   -0.986   2.864  -0.589 1.00 . A A .  31 HIS HA   1 1 
       13  8191 1 1 31 HIS HB2  H   -2.151   0.971  -1.257 1.00 . A A .  31 HIS HB2  1 1 
       13  8192 1 1 31 HIS HB3  H   -2.263   1.505  -2.932 1.00 . A A .  31 HIS HB3  1 1 
       13  8193 1 1 31 HIS HD1  H    0.033  -0.220  -0.532 1.00 . A A .  31 HIS HD1  1 1 
       13  8194 1 1 31 HIS HD2  H   -0.104   0.803  -4.556 1.00 . A A .  31 HIS HD2  1 1 
       13  8195 1 1 31 HIS HE1  H    1.920  -1.485  -1.612 1.00 . A A .  31 HIS HE1  1 1 
       13  8196 1 1 31 HIS N    N   -2.357   3.778  -1.831 1.00 . A A .  31 HIS N    1 1 
       13  8197 1 1 31 HIS ND1  N    0.238  -0.167  -1.488 1.00 . A A .  31 HIS ND1  1 1 
       13  8198 1 1 31 HIS NE2  N    1.198  -0.508  -3.373 1.00 . A A .  31 HIS NE2  1 1 
       13  8199 1 1 31 HIS O    O    1.123   3.168  -1.990 1.00 . A A .  31 HIS O    1 1 
       13  8200 1 1 32 TRP C    C    1.601   5.518  -3.749 1.00 . A A .  32 TRP C    1 1 
       13  8201 1 1 32 TRP CA   C    0.817   4.412  -4.446 1.00 . A A .  32 TRP CA   1 1 
       13  8202 1 1 32 TRP CB   C    0.254   4.928  -5.772 1.00 . A A .  32 TRP CB   1 1 
       13  8203 1 1 32 TRP CD1  C   -0.503   2.626  -6.608 1.00 . A A .  32 TRP CD1  1 1 
       13  8204 1 1 32 TRP CD2  C    0.464   3.903  -8.174 1.00 . A A .  32 TRP CD2  1 1 
       13  8205 1 1 32 TRP CE2  C    0.097   2.674  -8.758 1.00 . A A .  32 TRP CE2  1 1 
       13  8206 1 1 32 TRP CE3  C    1.087   4.867  -8.969 1.00 . A A .  32 TRP CE3  1 1 
       13  8207 1 1 32 TRP CG   C    0.070   3.851  -6.798 1.00 . A A .  32 TRP CG   1 1 
       13  8208 1 1 32 TRP CH2  C    0.949   3.351 -10.855 1.00 . A A .  32 TRP CH2  1 1 
       13  8209 1 1 32 TRP CZ2  C    0.336   2.388 -10.100 1.00 . A A .  32 TRP CZ2  1 1 
       13  8210 1 1 32 TRP CZ3  C    1.324   4.582 -10.300 1.00 . A A .  32 TRP CZ3  1 1 
       13  8211 1 1 32 TRP H    H   -1.190   4.026  -3.892 1.00 . A A .  32 TRP H    1 1 
       13  8212 1 1 32 TRP HA   H    1.483   3.585  -4.646 1.00 . A A .  32 TRP HA   1 1 
       13  8213 1 1 32 TRP HB2  H   -0.708   5.385  -5.593 1.00 . A A .  32 TRP HB2  1 1 
       13  8214 1 1 32 TRP HB3  H    0.930   5.666  -6.179 1.00 . A A .  32 TRP HB3  1 1 
       13  8215 1 1 32 TRP HD1  H   -0.901   2.281  -5.666 1.00 . A A .  32 TRP HD1  1 1 
       13  8216 1 1 32 TRP HE1  H   -0.844   1.007  -7.902 1.00 . A A .  32 TRP HE1  1 1 
       13  8217 1 1 32 TRP HE3  H    1.384   5.822  -8.560 1.00 . A A .  32 TRP HE3  1 1 
       13  8218 1 1 32 TRP HH2  H    1.154   3.171 -11.899 1.00 . A A .  32 TRP HH2  1 1 
       13  8219 1 1 32 TRP HZ2  H    0.053   1.445 -10.542 1.00 . A A .  32 TRP HZ2  1 1 
       13  8220 1 1 32 TRP HZ3  H    1.806   5.315 -10.931 1.00 . A A .  32 TRP HZ3  1 1 
       13  8221 1 1 32 TRP N    N   -0.261   3.921  -3.595 1.00 . A A .  32 TRP N    1 1 
       13  8222 1 1 32 TRP NE1  N   -0.489   1.913  -7.782 1.00 . A A .  32 TRP NE1  1 1 
       13  8223 1 1 32 TRP O    O    2.826   5.582  -3.853 1.00 . A A .  32 TRP O    1 1 
       13  8224 1 1 33 ILE C    C    2.807   7.035  -1.643 1.00 . A A .  33 ILE C    1 1 
       13  8225 1 1 33 ILE CA   C    1.519   7.487  -2.322 1.00 . A A .  33 ILE CA   1 1 
       13  8226 1 1 33 ILE CB   C    0.574   8.083  -1.262 1.00 . A A .  33 ILE CB   1 1 
       13  8227 1 1 33 ILE CD1  C   -1.779   8.995  -0.928 1.00 . A A .  33 ILE CD1  1 1 
       13  8228 1 1 33 ILE CG1  C   -0.709   8.595  -1.920 1.00 . A A .  33 ILE CG1  1 1 
       13  8229 1 1 33 ILE CG2  C    1.270   9.204  -0.503 1.00 . A A .  33 ILE CG2  1 1 
       13  8230 1 1 33 ILE H    H   -0.085   6.280  -2.993 1.00 . A A .  33 ILE H    1 1 
       13  8231 1 1 33 ILE HA   H    1.754   8.259  -3.041 1.00 . A A .  33 ILE HA   1 1 
       13  8232 1 1 33 ILE HB   H    0.323   7.305  -0.557 1.00 . A A .  33 ILE HB   1 1 
       13  8233 1 1 33 ILE HD11 H   -1.385   9.744  -0.257 1.00 . A A .  33 ILE HD11 1 1 
       13  8234 1 1 33 ILE HD12 H   -2.629   9.399  -1.458 1.00 . A A .  33 ILE HD12 1 1 
       13  8235 1 1 33 ILE HD13 H   -2.086   8.129  -0.361 1.00 . A A .  33 ILE HD13 1 1 
       13  8236 1 1 33 ILE HG12 H   -0.477   9.458  -2.523 1.00 . A A .  33 ILE HG12 1 1 
       13  8237 1 1 33 ILE HG13 H   -1.115   7.818  -2.552 1.00 . A A .  33 ILE HG13 1 1 
       13  8238 1 1 33 ILE HG21 H    2.222   8.851  -0.134 1.00 . A A .  33 ILE HG21 1 1 
       13  8239 1 1 33 ILE HG22 H    1.429  10.041  -1.165 1.00 . A A .  33 ILE HG22 1 1 
       13  8240 1 1 33 ILE HG23 H    0.654   9.513   0.328 1.00 . A A .  33 ILE HG23 1 1 
       13  8241 1 1 33 ILE N    N    0.888   6.385  -3.038 1.00 . A A .  33 ILE N    1 1 
       13  8242 1 1 33 ILE O    O    3.841   7.697  -1.744 1.00 . A A .  33 ILE O    1 1 
       13  8243 1 1 34 THR C    C    5.111   5.293  -1.177 1.00 . A A .  34 THR C    1 1 
       13  8244 1 1 34 THR CA   C    3.899   5.361  -0.254 1.00 . A A .  34 THR CA   1 1 
       13  8245 1 1 34 THR CB   C    3.614   3.955   0.304 1.00 . A A .  34 THR CB   1 1 
       13  8246 1 1 34 THR CG2  C    2.412   3.977   1.237 1.00 . A A .  34 THR CG2  1 1 
       13  8247 1 1 34 THR H    H    1.887   5.421  -0.906 1.00 . A A .  34 THR H    1 1 
       13  8248 1 1 34 THR HA   H    4.127   6.016   0.575 1.00 . A A .  34 THR HA   1 1 
       13  8249 1 1 34 THR HB   H    4.478   3.623   0.862 1.00 . A A .  34 THR HB   1 1 
       13  8250 1 1 34 THR HG1  H    2.794   2.336  -0.468 1.00 . A A .  34 THR HG1  1 1 
       13  8251 1 1 34 THR HG21 H    2.473   3.144   1.922 1.00 . A A .  34 THR HG21 1 1 
       13  8252 1 1 34 THR HG22 H    1.504   3.900   0.657 1.00 . A A .  34 THR HG22 1 1 
       13  8253 1 1 34 THR HG23 H    2.407   4.901   1.795 1.00 . A A .  34 THR HG23 1 1 
       13  8254 1 1 34 THR N    N    2.739   5.903  -0.950 1.00 . A A .  34 THR N    1 1 
       13  8255 1 1 34 THR O    O    6.240   5.548  -0.756 1.00 . A A .  34 THR O    1 1 
       13  8256 1 1 34 THR OG1  O    3.372   3.040  -0.771 1.00 . A A .  34 THR OG1  1 1 
       13  8257 1 1 35 HIS C    C    6.574   6.212  -3.678 1.00 . A A .  35 HIS C    1 1 
       13  8258 1 1 35 HIS CA   C    5.943   4.846  -3.421 1.00 . A A .  35 HIS CA   1 1 
       13  8259 1 1 35 HIS CB   C    5.410   4.263  -4.730 1.00 . A A .  35 HIS CB   1 1 
       13  8260 1 1 35 HIS CD2  C    3.968   2.144  -5.125 1.00 . A A .  35 HIS CD2  1 1 
       13  8261 1 1 35 HIS CE1  C    5.217   0.701  -4.045 1.00 . A A .  35 HIS CE1  1 1 
       13  8262 1 1 35 HIS CG   C    5.034   2.817  -4.632 1.00 . A A .  35 HIS CG   1 1 
       13  8263 1 1 35 HIS H    H    3.950   4.756  -2.713 1.00 . A A .  35 HIS H    1 1 
       13  8264 1 1 35 HIS HA   H    6.697   4.185  -3.022 1.00 . A A .  35 HIS HA   1 1 
       13  8265 1 1 35 HIS HB2  H    4.531   4.815  -5.031 1.00 . A A .  35 HIS HB2  1 1 
       13  8266 1 1 35 HIS HB3  H    6.168   4.359  -5.494 1.00 . A A .  35 HIS HB3  1 1 
       13  8267 1 1 35 HIS HD1  H    6.638   2.064  -3.492 1.00 . A A .  35 HIS HD1  1 1 
       13  8268 1 1 35 HIS HD2  H    3.160   2.562  -5.709 1.00 . A A .  35 HIS HD2  1 1 
       13  8269 1 1 35 HIS HE1  H    5.587  -0.217  -3.615 1.00 . A A .  35 HIS HE1  1 1 
       13  8270 1 1 35 HIS N    N    4.870   4.947  -2.438 1.00 . A A .  35 HIS N    1 1 
       13  8271 1 1 35 HIS ND1  N    5.797   1.885  -3.960 1.00 . A A .  35 HIS ND1  1 1 
       13  8272 1 1 35 HIS NE2  N    4.105   0.831  -4.747 1.00 . A A .  35 HIS NE2  1 1 
       13  8273 1 1 35 HIS O    O    7.773   6.314  -3.940 1.00 . A A .  35 HIS O    1 1 
       13  8274 1 1 36 THR C    C    6.924   9.173  -2.586 1.00 . A A .  36 THR C    1 1 
       13  8275 1 1 36 THR CA   C    6.237   8.617  -3.828 1.00 . A A .  36 THR CA   1 1 
       13  8276 1 1 36 THR CB   C    5.085   9.559  -4.228 1.00 . A A .  36 THR CB   1 1 
       13  8277 1 1 36 THR CG2  C    5.623  10.903  -4.695 1.00 . A A .  36 THR CG2  1 1 
       13  8278 1 1 36 THR H    H    4.814   7.113  -3.390 1.00 . A A .  36 THR H    1 1 
       13  8279 1 1 36 THR HA   H    6.950   8.589  -4.639 1.00 . A A .  36 THR HA   1 1 
       13  8280 1 1 36 THR HB   H    4.455   9.719  -3.365 1.00 . A A .  36 THR HB   1 1 
       13  8281 1 1 36 THR HG1  H    4.816   8.947  -6.084 1.00 . A A .  36 THR HG1  1 1 
       13  8282 1 1 36 THR HG21 H    5.136  11.695  -4.147 1.00 . A A .  36 THR HG21 1 1 
       13  8283 1 1 36 THR HG22 H    5.426  11.023  -5.750 1.00 . A A .  36 THR HG22 1 1 
       13  8284 1 1 36 THR HG23 H    6.687  10.945  -4.521 1.00 . A A .  36 THR HG23 1 1 
       13  8285 1 1 36 THR N    N    5.759   7.259  -3.602 1.00 . A A .  36 THR N    1 1 
       13  8286 1 1 36 THR O    O    6.706  10.324  -2.207 1.00 . A A .  36 THR O    1 1 
       13  8287 1 1 36 THR OG1  O    4.306   8.963  -5.271 1.00 . A A .  36 THR OG1  1 1 
       13  8288 1 1 37 ARG C    C    9.936   8.335  -0.826 1.00 . A A .  37 ARG C    1 1 
       13  8289 1 1 37 ARG CA   C    8.472   8.757  -0.754 1.00 . A A .  37 ARG CA   1 1 
       13  8290 1 1 37 ARG CB   C    7.816   8.153   0.489 1.00 . A A .  37 ARG CB   1 1 
       13  8291 1 1 37 ARG CD   C    6.112   9.787   1.349 1.00 . A A .  37 ARG CD   1 1 
       13  8292 1 1 37 ARG CG   C    6.336   8.475   0.614 1.00 . A A .  37 ARG CG   1 1 
       13  8293 1 1 37 ARG CZ   C    5.947  10.486   3.700 1.00 . A A .  37 ARG CZ   1 1 
       13  8294 1 1 37 ARG H    H    7.885   7.442  -2.306 1.00 . A A .  37 ARG H    1 1 
       13  8295 1 1 37 ARG HA   H    8.422   9.834  -0.689 1.00 . A A .  37 ARG HA   1 1 
       13  8296 1 1 37 ARG HB2  H    7.926   7.079   0.454 1.00 . A A .  37 ARG HB2  1 1 
       13  8297 1 1 37 ARG HB3  H    8.320   8.530   1.366 1.00 . A A .  37 ARG HB3  1 1 
       13  8298 1 1 37 ARG HD2  H    6.729  10.548   0.895 1.00 . A A .  37 ARG HD2  1 1 
       13  8299 1 1 37 ARG HD3  H    5.072  10.064   1.254 1.00 . A A .  37 ARG HD3  1 1 
       13  8300 1 1 37 ARG HE   H    7.083   8.988   3.033 1.00 . A A .  37 ARG HE   1 1 
       13  8301 1 1 37 ARG HG2  H    5.908   8.551  -0.375 1.00 . A A .  37 ARG HG2  1 1 
       13  8302 1 1 37 ARG HG3  H    5.849   7.680   1.159 1.00 . A A .  37 ARG HG3  1 1 
       13  8303 1 1 37 ARG HH11 H    4.816  11.557   2.414 1.00 . A A .  37 ARG HH11 1 1 
       13  8304 1 1 37 ARG HH12 H    4.709  12.039   4.074 1.00 . A A .  37 ARG HH12 1 1 
       13  8305 1 1 37 ARG HH21 H    6.950   9.613   5.222 1.00 . A A .  37 ARG HH21 1 1 
       13  8306 1 1 37 ARG HH22 H    5.924  10.933   5.671 1.00 . A A .  37 ARG HH22 1 1 
       13  8307 1 1 37 ARG N    N    7.753   8.348  -1.955 1.00 . A A .  37 ARG N    1 1 
       13  8308 1 1 37 ARG NE   N    6.450   9.686   2.766 1.00 . A A .  37 ARG NE   1 1 
       13  8309 1 1 37 ARG NH1  N    5.087  11.439   3.369 1.00 . A A .  37 ARG NH1  1 1 
       13  8310 1 1 37 ARG NH2  N    6.303  10.331   4.969 1.00 . A A .  37 ARG NH2  1 1 
       13  8311 1 1 37 ARG O    O   10.244   7.151  -0.961 1.00 . A A .  37 ARG O    1 1 
       13  8312 1 1 38 GLU C    C   12.895   9.154   0.593 1.00 . A A .  38 GLU C    1 1 
       13  8313 1 1 38 GLU CA   C   12.265   9.041  -0.793 1.00 . A A .  38 GLU CA   1 1 
       13  8314 1 1 38 GLU CB   C   12.952  10.008  -1.758 1.00 . A A .  38 GLU CB   1 1 
       13  8315 1 1 38 GLU CD   C   13.024  10.979  -4.089 1.00 . A A .  38 GLU CD   1 1 
       13  8316 1 1 38 GLU CG   C   12.441   9.910  -3.185 1.00 . A A .  38 GLU CG   1 1 
       13  8317 1 1 38 GLU H    H   10.526  10.236  -0.630 1.00 . A A .  38 GLU H    1 1 
       13  8318 1 1 38 GLU HA   H   12.398   8.032  -1.154 1.00 . A A .  38 GLU HA   1 1 
       13  8319 1 1 38 GLU HB2  H   12.795  11.018  -1.409 1.00 . A A .  38 GLU HB2  1 1 
       13  8320 1 1 38 GLU HB3  H   14.012   9.800  -1.763 1.00 . A A .  38 GLU HB3  1 1 
       13  8321 1 1 38 GLU HG2  H   12.705   8.942  -3.583 1.00 . A A .  38 GLU HG2  1 1 
       13  8322 1 1 38 GLU HG3  H   11.366  10.014  -3.177 1.00 . A A .  38 GLU HG3  1 1 
       13  8323 1 1 38 GLU N    N   10.834   9.312  -0.736 1.00 . A A .  38 GLU N    1 1 
       13  8324 1 1 38 GLU O    O   12.337   9.782   1.492 1.00 . A A .  38 GLU O    1 1 
       13  8325 1 1 38 GLU OE1  O   14.260  10.997  -4.264 1.00 . A A .  38 GLU OE1  1 1 
       13  8326 1 1 38 GLU OE2  O   12.244  11.797  -4.621 1.00 . A A .  38 GLU OE2  1 1 
       13  8327 1 1 39 LYS C    C   16.281   8.548   1.815 1.00 . A A .  39 LYS C    1 1 
       13  8328 1 1 39 LYS CA   C   14.771   8.571   2.031 1.00 . A A .  39 LYS CA   1 1 
       13  8329 1 1 39 LYS CB   C   14.351   7.384   2.900 1.00 . A A .  39 LYS CB   1 1 
       13  8330 1 1 39 LYS CD   C   14.465   4.906   3.294 1.00 . A A .  39 LYS CD   1 1 
       13  8331 1 1 39 LYS CE   C   14.980   3.576   2.764 1.00 . A A .  39 LYS CE   1 1 
       13  8332 1 1 39 LYS CG   C   14.730   6.036   2.313 1.00 . A A .  39 LYS CG   1 1 
       13  8333 1 1 39 LYS H    H   14.458   8.055   0.002 1.00 . A A .  39 LYS H    1 1 
       13  8334 1 1 39 LYS HA   H   14.506   9.488   2.536 1.00 . A A .  39 LYS HA   1 1 
       13  8335 1 1 39 LYS HB2  H   14.822   7.477   3.868 1.00 . A A .  39 LYS HB2  1 1 
       13  8336 1 1 39 LYS HB3  H   13.278   7.409   3.028 1.00 . A A .  39 LYS HB3  1 1 
       13  8337 1 1 39 LYS HD2  H   14.962   5.126   4.226 1.00 . A A .  39 LYS HD2  1 1 
       13  8338 1 1 39 LYS HD3  H   13.400   4.829   3.461 1.00 . A A .  39 LYS HD3  1 1 
       13  8339 1 1 39 LYS HE2  H   14.223   3.138   2.131 1.00 . A A .  39 LYS HE2  1 1 
       13  8340 1 1 39 LYS HE3  H   15.874   3.756   2.186 1.00 . A A .  39 LYS HE3  1 1 
       13  8341 1 1 39 LYS HG2  H   14.148   5.866   1.419 1.00 . A A .  39 LYS HG2  1 1 
       13  8342 1 1 39 LYS HG3  H   15.781   6.045   2.063 1.00 . A A .  39 LYS HG3  1 1 
       13  8343 1 1 39 LYS HZ1  H   15.924   3.082   4.561 1.00 . A A .  39 LYS HZ1  1 1 
       13  8344 1 1 39 LYS HZ2  H   15.775   1.784   3.485 1.00 . A A .  39 LYS HZ2  1 1 
       13  8345 1 1 39 LYS HZ3  H   14.425   2.329   4.345 1.00 . A A .  39 LYS HZ3  1 1 
       13  8346 1 1 39 LYS N    N   14.062   8.540   0.757 1.00 . A A .  39 LYS N    1 1 
       13  8347 1 1 39 LYS NZ   N   15.299   2.626   3.866 1.00 . A A .  39 LYS NZ   1 1 
       13  8348 1 1 39 LYS O    O   16.785   7.973   0.850 1.00 . A A .  39 LYS O    1 1 
       13  8349 1 1 40 PRO C    C   19.137   7.898   2.935 1.00 . A A .  40 PRO C    1 1 
       13  8350 1 1 40 PRO CA   C   18.484   9.249   2.666 1.00 . A A .  40 PRO CA   1 1 
       13  8351 1 1 40 PRO CB   C   18.847  10.247   3.768 1.00 . A A .  40 PRO CB   1 1 
       13  8352 1 1 40 PRO CD   C   16.487   9.892   3.910 1.00 . A A .  40 PRO CD   1 1 
       13  8353 1 1 40 PRO CG   C   17.714  10.175   4.733 1.00 . A A .  40 PRO CG   1 1 
       13  8354 1 1 40 PRO HA   H   18.821   9.627   1.711 1.00 . A A .  40 PRO HA   1 1 
       13  8355 1 1 40 PRO HB2  H   19.779   9.954   4.230 1.00 . A A .  40 PRO HB2  1 1 
       13  8356 1 1 40 PRO HB3  H   18.943  11.236   3.346 1.00 . A A .  40 PRO HB3  1 1 
       13  8357 1 1 40 PRO HD2  H   15.801   9.263   4.459 1.00 . A A .  40 PRO HD2  1 1 
       13  8358 1 1 40 PRO HD3  H   16.007  10.814   3.619 1.00 . A A .  40 PRO HD3  1 1 
       13  8359 1 1 40 PRO HG2  H   17.884   9.377   5.439 1.00 . A A .  40 PRO HG2  1 1 
       13  8360 1 1 40 PRO HG3  H   17.610  11.118   5.248 1.00 . A A .  40 PRO HG3  1 1 
       13  8361 1 1 40 PRO N    N   17.021   9.185   2.734 1.00 . A A .  40 PRO N    1 1 
       13  8362 1 1 40 PRO O    O   18.699   7.149   3.808 1.00 . A A .  40 PRO O    1 1 
       13  8363 1 1 41 SER C    C   21.619   6.272   3.678 1.00 . A A .  41 SER C    1 1 
       13  8364 1 1 41 SER CA   C   20.898   6.328   2.335 1.00 . A A .  41 SER CA   1 1 
       13  8365 1 1 41 SER CB   C   21.902   6.141   1.196 1.00 . A A .  41 SER CB   1 1 
       13  8366 1 1 41 SER H    H   20.489   8.230   1.500 1.00 . A A .  41 SER H    1 1 
       13  8367 1 1 41 SER HA   H   20.170   5.531   2.296 1.00 . A A .  41 SER HA   1 1 
       13  8368 1 1 41 SER HB2  H   21.374   6.110   0.255 1.00 . A A .  41 SER HB2  1 1 
       13  8369 1 1 41 SER HB3  H   22.597   6.969   1.192 1.00 . A A .  41 SER HB3  1 1 
       13  8370 1 1 41 SER HG   H   23.510   5.131   1.681 1.00 . A A .  41 SER HG   1 1 
       13  8371 1 1 41 SER N    N   20.187   7.592   2.179 1.00 . A A .  41 SER N    1 1 
       13  8372 1 1 41 SER O    O   22.665   6.893   3.861 1.00 . A A .  41 SER O    1 1 
       13  8373 1 1 41 SER OG   O   22.630   4.935   1.351 1.00 . A A .  41 SER OG   1 1 
       13  8374 1 1 42 GLY C    C   22.765   4.370   5.966 1.00 . A A .  42 GLY C    1 1 
       13  8375 1 1 42 GLY CA   C   21.651   5.397   5.932 1.00 . A A .  42 GLY CA   1 1 
       13  8376 1 1 42 GLY H    H   20.216   5.049   4.415 1.00 . A A .  42 GLY H    1 1 
       13  8377 1 1 42 GLY HA2  H   22.051   6.357   6.225 1.00 . A A .  42 GLY HA2  1 1 
       13  8378 1 1 42 GLY HA3  H   20.887   5.106   6.638 1.00 . A A .  42 GLY HA3  1 1 
       13  8379 1 1 42 GLY N    N   21.050   5.522   4.617 1.00 . A A .  42 GLY N    1 1 
       13  8380 1 1 42 GLY O    O   23.267   3.933   4.930 1.00 . A A .  42 GLY O    1 1 
       13  8381 1 1 43 PRO C    C   23.816   1.582   6.944 1.00 . A A .  43 PRO C    1 1 
       13  8382 1 1 43 PRO CA   C   24.236   2.983   7.374 1.00 . A A .  43 PRO CA   1 1 
       13  8383 1 1 43 PRO CB   C   24.489   3.026   8.883 1.00 . A A .  43 PRO CB   1 1 
       13  8384 1 1 43 PRO CD   C   22.615   4.448   8.458 1.00 . A A .  43 PRO CD   1 1 
       13  8385 1 1 43 PRO CG   C   23.206   3.505   9.469 1.00 . A A .  43 PRO CG   1 1 
       13  8386 1 1 43 PRO HA   H   25.137   3.265   6.849 1.00 . A A .  43 PRO HA   1 1 
       13  8387 1 1 43 PRO HB2  H   24.741   2.036   9.237 1.00 . A A .  43 PRO HB2  1 1 
       13  8388 1 1 43 PRO HB3  H   25.299   3.708   9.097 1.00 . A A .  43 PRO HB3  1 1 
       13  8389 1 1 43 PRO HD2  H   21.538   4.379   8.461 1.00 . A A .  43 PRO HD2  1 1 
       13  8390 1 1 43 PRO HD3  H   22.930   5.462   8.659 1.00 . A A .  43 PRO HD3  1 1 
       13  8391 1 1 43 PRO HG2  H   22.543   2.668   9.634 1.00 . A A .  43 PRO HG2  1 1 
       13  8392 1 1 43 PRO HG3  H   23.397   4.022  10.398 1.00 . A A .  43 PRO HG3  1 1 
       13  8393 1 1 43 PRO N    N   23.169   3.970   7.181 1.00 . A A .  43 PRO N    1 1 
       13  8394 1 1 43 PRO O    O   24.563   0.881   6.263 1.00 . A A .  43 PRO O    1 1 
       13  8395 1 1 44 SER C    C   20.576  -0.109   6.878 1.00 . A A .  44 SER C    1 1 
       13  8396 1 1 44 SER CA   C   22.096  -0.139   7.006 1.00 . A A .  44 SER CA   1 1 
       13  8397 1 1 44 SER CB   C   22.510  -1.163   8.065 1.00 . A A .  44 SER CB   1 1 
       13  8398 1 1 44 SER H    H   22.065   1.785   7.889 1.00 . A A .  44 SER H    1 1 
       13  8399 1 1 44 SER HA   H   22.520  -0.427   6.055 1.00 . A A .  44 SER HA   1 1 
       13  8400 1 1 44 SER HB2  H   23.587  -1.194   8.131 1.00 . A A .  44 SER HB2  1 1 
       13  8401 1 1 44 SER HB3  H   22.098  -0.873   9.021 1.00 . A A .  44 SER HB3  1 1 
       13  8402 1 1 44 SER HG   H   21.191  -2.384   7.285 1.00 . A A .  44 SER HG   1 1 
       13  8403 1 1 44 SER N    N   22.615   1.180   7.347 1.00 . A A .  44 SER N    1 1 
       13  8404 1 1 44 SER O    O   19.907   0.722   7.491 1.00 . A A .  44 SER O    1 1 
       13  8405 1 1 44 SER OG   O   22.035  -2.457   7.737 1.00 . A A .  44 SER OG   1 1 
       13  8406 1 1 45 SER C    C   17.896  -1.666   7.095 1.00 . A A .  45 SER C    1 1 
       13  8407 1 1 45 SER CA   C   18.597  -1.100   5.864 1.00 . A A .  45 SER CA   1 1 
       13  8408 1 1 45 SER CB   C   18.286  -1.967   4.643 1.00 . A A .  45 SER CB   1 1 
       13  8409 1 1 45 SER H    H   20.624  -1.659   5.616 1.00 . A A .  45 SER H    1 1 
       13  8410 1 1 45 SER HA   H   18.234  -0.099   5.686 1.00 . A A .  45 SER HA   1 1 
       13  8411 1 1 45 SER HB2  H   19.038  -1.802   3.886 1.00 . A A .  45 SER HB2  1 1 
       13  8412 1 1 45 SER HB3  H   18.291  -3.008   4.933 1.00 . A A .  45 SER HB3  1 1 
       13  8413 1 1 45 SER HG   H   16.835  -2.220   3.351 1.00 . A A .  45 SER HG   1 1 
       13  8414 1 1 45 SER N    N   20.038  -1.023   6.077 1.00 . A A .  45 SER N    1 1 
       13  8415 1 1 45 SER O    O   17.075  -0.995   7.719 1.00 . A A .  45 SER O    1 1 
       13  8416 1 1 45 SER OG   O   17.016  -1.649   4.102 1.00 . A A .  45 SER OG   1 1 
       13  8417 1 1 46 GLY C    C   16.266  -4.149   8.278 1.00 . A A .  46 GLY C    1 1 
       13  8418 1 1 46 GLY CA   C   17.620  -3.544   8.594 1.00 . A A .  46 GLY CA   1 1 
       13  8419 1 1 46 GLY H    H   18.887  -3.395   6.904 1.00 . A A .  46 GLY H    1 1 
       13  8420 1 1 46 GLY HA2  H   18.277  -4.323   8.948 1.00 . A A .  46 GLY HA2  1 1 
       13  8421 1 1 46 GLY HA3  H   17.498  -2.807   9.374 1.00 . A A .  46 GLY HA3  1 1 
       13  8422 1 1 46 GLY N    N   18.226  -2.907   7.439 1.00 . A A .  46 GLY N    1 1 
       13  8423 1 1 46 GLY O    O   15.249  -3.505   8.528 1.00 . A A .  46 GLY O    1 1 
       13  8424 2 2  1 ZN  ZN   ZN   2.736  -0.571  -4.741 1.00 . B A . 181 ZN  ZN   1 1 
       14  8425 1 1  1 GLY C    C   -3.446 -19.930 -15.123 1.00 . A A .   1 GLY C    1 1 
       14  8426 1 1  1 GLY CA   C   -2.458 -18.870 -14.679 1.00 . A A .   1 GLY CA   1 1 
       14  8427 1 1  1 GLY H1   H   -0.972 -19.819 -15.852 1.00 . A A .   1 GLY H1   1 1 
       14  8428 1 1  1 GLY HA2  H   -2.411 -18.866 -13.600 1.00 . A A .   1 GLY HA2  1 1 
       14  8429 1 1  1 GLY HA3  H   -2.807 -17.905 -15.018 1.00 . A A .   1 GLY HA3  1 1 
       14  8430 1 1  1 GLY N    N   -1.125 -19.097 -15.206 1.00 . A A .   1 GLY N    1 1 
       14  8431 1 1  1 GLY O    O   -3.493 -20.290 -16.299 1.00 . A A .   1 GLY O    1 1 
       14  8432 1 1  2 SER C    C   -6.639 -20.894 -14.410 1.00 . A A .   2 SER C    1 1 
       14  8433 1 1  2 SER CA   C   -5.225 -21.462 -14.479 1.00 . A A .   2 SER CA   1 1 
       14  8434 1 1  2 SER CB   C   -5.085 -22.632 -13.504 1.00 . A A .   2 SER CB   1 1 
       14  8435 1 1  2 SER H    H   -4.151 -20.104 -13.260 1.00 . A A .   2 SER H    1 1 
       14  8436 1 1  2 SER HA   H   -5.040 -21.817 -15.482 1.00 . A A .   2 SER HA   1 1 
       14  8437 1 1  2 SER HB2  H   -5.640 -23.478 -13.878 1.00 . A A .   2 SER HB2  1 1 
       14  8438 1 1  2 SER HB3  H   -4.041 -22.898 -13.413 1.00 . A A .   2 SER HB3  1 1 
       14  8439 1 1  2 SER HG   H   -5.177 -21.471 -11.929 1.00 . A A .   2 SER HG   1 1 
       14  8440 1 1  2 SER N    N   -4.237 -20.432 -14.180 1.00 . A A .   2 SER N    1 1 
       14  8441 1 1  2 SER O    O   -7.465 -21.148 -15.287 1.00 . A A .   2 SER O    1 1 
       14  8442 1 1  2 SER OG   O   -5.583 -22.290 -12.222 1.00 . A A .   2 SER OG   1 1 
       14  8443 1 1  3 SER C    C   -9.330 -20.491 -13.591 1.00 . A A .   3 SER C    1 1 
       14  8444 1 1  3 SER CA   C   -8.226 -19.523 -13.174 1.00 . A A .   3 SER CA   1 1 
       14  8445 1 1  3 SER CB   C   -8.337 -18.228 -13.980 1.00 . A A .   3 SER CB   1 1 
       14  8446 1 1  3 SER H    H   -6.210 -19.960 -12.696 1.00 . A A .   3 SER H    1 1 
       14  8447 1 1  3 SER HA   H   -8.340 -19.296 -12.125 1.00 . A A .   3 SER HA   1 1 
       14  8448 1 1  3 SER HB2  H   -9.343 -17.845 -13.905 1.00 . A A .   3 SER HB2  1 1 
       14  8449 1 1  3 SER HB3  H   -7.644 -17.500 -13.583 1.00 . A A .   3 SER HB3  1 1 
       14  8450 1 1  3 SER HG   H   -8.052 -17.614 -15.818 1.00 . A A .   3 SER HG   1 1 
       14  8451 1 1  3 SER N    N   -6.911 -20.125 -13.361 1.00 . A A .   3 SER N    1 1 
       14  8452 1 1  3 SER O    O  -10.302 -20.100 -14.235 1.00 . A A .   3 SER O    1 1 
       14  8453 1 1  3 SER OG   O   -8.033 -18.449 -15.346 1.00 . A A .   3 SER OG   1 1 
       14  8454 1 1  4 GLY C    C  -11.570 -22.329 -13.211 1.00 . A A .   4 GLY C    1 1 
       14  8455 1 1  4 GLY CA   C  -10.160 -22.761 -13.561 1.00 . A A .   4 GLY CA   1 1 
       14  8456 1 1  4 GLY H    H   -8.374 -22.011 -12.705 1.00 . A A .   4 GLY H    1 1 
       14  8457 1 1  4 GLY HA2  H  -10.107 -22.956 -14.621 1.00 . A A .   4 GLY HA2  1 1 
       14  8458 1 1  4 GLY HA3  H   -9.932 -23.672 -13.026 1.00 . A A .   4 GLY HA3  1 1 
       14  8459 1 1  4 GLY N    N   -9.170 -21.757 -13.218 1.00 . A A .   4 GLY N    1 1 
       14  8460 1 1  4 GLY O    O  -12.356 -21.980 -14.092 1.00 . A A .   4 GLY O    1 1 
       14  8461 1 1  5 SER C    C  -13.124 -20.963 -10.314 1.00 . A A .   5 SER C    1 1 
       14  8462 1 1  5 SER CA   C  -13.220 -21.967 -11.458 1.00 . A A .   5 SER CA   1 1 
       14  8463 1 1  5 SER CB   C  -14.005 -23.200 -11.005 1.00 . A A .   5 SER CB   1 1 
       14  8464 1 1  5 SER H    H  -11.222 -22.643 -11.267 1.00 . A A .   5 SER H    1 1 
       14  8465 1 1  5 SER HA   H  -13.738 -21.505 -12.285 1.00 . A A .   5 SER HA   1 1 
       14  8466 1 1  5 SER HB2  H  -13.880 -23.989 -11.731 1.00 . A A .   5 SER HB2  1 1 
       14  8467 1 1  5 SER HB3  H  -13.630 -23.529 -10.047 1.00 . A A .   5 SER HB3  1 1 
       14  8468 1 1  5 SER HG   H  -15.624 -22.214 -11.500 1.00 . A A .   5 SER HG   1 1 
       14  8469 1 1  5 SER N    N  -11.893 -22.354 -11.922 1.00 . A A .   5 SER N    1 1 
       14  8470 1 1  5 SER O    O  -12.964 -21.340  -9.153 1.00 . A A .   5 SER O    1 1 
       14  8471 1 1  5 SER OG   O  -15.386 -22.908 -10.881 1.00 . A A .   5 SER OG   1 1 
       14  8472 1 1  6 SER C    C  -11.931 -18.815  -8.748 1.00 . A A .   6 SER C    1 1 
       14  8473 1 1  6 SER CA   C  -13.144 -18.620  -9.653 1.00 . A A .   6 SER CA   1 1 
       14  8474 1 1  6 SER CB   C  -14.421 -18.585  -8.812 1.00 . A A .   6 SER CB   1 1 
       14  8475 1 1  6 SER H    H  -13.350 -19.442 -11.593 1.00 . A A .   6 SER H    1 1 
       14  8476 1 1  6 SER HA   H  -13.041 -17.680 -10.175 1.00 . A A .   6 SER HA   1 1 
       14  8477 1 1  6 SER HB2  H  -15.280 -18.640  -9.464 1.00 . A A .   6 SER HB2  1 1 
       14  8478 1 1  6 SER HB3  H  -14.428 -19.429  -8.137 1.00 . A A .   6 SER HB3  1 1 
       14  8479 1 1  6 SER HG   H  -15.284 -16.901  -8.307 1.00 . A A .   6 SER HG   1 1 
       14  8480 1 1  6 SER N    N  -13.223 -19.680 -10.650 1.00 . A A .   6 SER N    1 1 
       14  8481 1 1  6 SER O    O  -12.005 -18.606  -7.538 1.00 . A A .   6 SER O    1 1 
       14  8482 1 1  6 SER OG   O  -14.500 -17.392  -8.052 1.00 . A A .   6 SER OG   1 1 
       14  8483 1 1  7 GLY C    C   -9.007 -18.142  -8.054 1.00 . A A .   7 GLY C    1 1 
       14  8484 1 1  7 GLY CA   C   -9.600 -19.434  -8.579 1.00 . A A .   7 GLY CA   1 1 
       14  8485 1 1  7 GLY H    H  -10.813 -19.368 -10.314 1.00 . A A .   7 GLY H    1 1 
       14  8486 1 1  7 GLY HA2  H   -9.825 -20.081  -7.744 1.00 . A A .   7 GLY HA2  1 1 
       14  8487 1 1  7 GLY HA3  H   -8.871 -19.920  -9.212 1.00 . A A .   7 GLY HA3  1 1 
       14  8488 1 1  7 GLY N    N  -10.813 -19.217  -9.345 1.00 . A A .   7 GLY N    1 1 
       14  8489 1 1  7 GLY O    O   -9.414 -17.648  -7.003 1.00 . A A .   7 GLY O    1 1 
       14  8490 1 1  8 GLU C    C   -8.075 -15.149  -9.024 1.00 . A A .   8 GLU C    1 1 
       14  8491 1 1  8 GLU CA   C   -7.390 -16.353  -8.385 1.00 . A A .   8 GLU CA   1 1 
       14  8492 1 1  8 GLU CB   C   -5.911 -16.379  -8.773 1.00 . A A .   8 GLU CB   1 1 
       14  8493 1 1  8 GLU CD   C   -4.205 -16.499 -10.633 1.00 . A A .   8 GLU CD   1 1 
       14  8494 1 1  8 GLU CG   C   -5.676 -16.541 -10.266 1.00 . A A .   8 GLU CG   1 1 
       14  8495 1 1  8 GLU H    H   -7.760 -18.036  -9.614 1.00 . A A .   8 GLU H    1 1 
       14  8496 1 1  8 GLU HA   H   -7.469 -16.269  -7.311 1.00 . A A .   8 GLU HA   1 1 
       14  8497 1 1  8 GLU HB2  H   -5.451 -15.454  -8.456 1.00 . A A .   8 GLU HB2  1 1 
       14  8498 1 1  8 GLU HB3  H   -5.432 -17.202  -8.264 1.00 . A A .   8 GLU HB3  1 1 
       14  8499 1 1  8 GLU HG2  H   -6.083 -17.491 -10.580 1.00 . A A .   8 GLU HG2  1 1 
       14  8500 1 1  8 GLU HG3  H   -6.185 -15.743 -10.786 1.00 . A A .   8 GLU HG3  1 1 
       14  8501 1 1  8 GLU N    N   -8.041 -17.595  -8.786 1.00 . A A .   8 GLU N    1 1 
       14  8502 1 1  8 GLU O    O   -8.353 -14.153  -8.358 1.00 . A A .   8 GLU O    1 1 
       14  8503 1 1  8 GLU OE1  O   -3.669 -15.384 -10.804 1.00 . A A .   8 GLU OE1  1 1 
       14  8504 1 1  8 GLU OE2  O   -3.591 -17.580 -10.750 1.00 . A A .   8 GLU OE2  1 1 
       14  8505 1 1  9 GLY C    C   -8.170 -12.887 -11.017 1.00 . A A .   9 GLY C    1 1 
       14  8506 1 1  9 GLY CA   C   -8.991 -14.160 -11.032 1.00 . A A .   9 GLY CA   1 1 
       14  8507 1 1  9 GLY H    H   -8.098 -16.066 -10.803 1.00 . A A .   9 GLY H    1 1 
       14  8508 1 1  9 GLY HA2  H   -9.154 -14.459 -12.057 1.00 . A A .   9 GLY HA2  1 1 
       14  8509 1 1  9 GLY HA3  H   -9.947 -13.964 -10.569 1.00 . A A .   9 GLY HA3  1 1 
       14  8510 1 1  9 GLY N    N   -8.343 -15.248 -10.323 1.00 . A A .   9 GLY N    1 1 
       14  8511 1 1  9 GLY O    O   -7.691 -12.463  -9.965 1.00 . A A .   9 GLY O    1 1 
       14  8512 1 1 10 GLU C    C   -7.999  -9.864 -11.712 1.00 . A A .  10 GLU C    1 1 
       14  8513 1 1 10 GLU CA   C   -7.233 -11.045 -12.302 1.00 . A A .  10 GLU CA   1 1 
       14  8514 1 1 10 GLU CB   C   -6.893 -10.765 -13.768 1.00 . A A .  10 GLU CB   1 1 
       14  8515 1 1 10 GLU CD   C   -5.932  -8.978 -15.272 1.00 . A A .  10 GLU CD   1 1 
       14  8516 1 1 10 GLU CG   C   -5.811  -9.715 -13.952 1.00 . A A .  10 GLU CG   1 1 
       14  8517 1 1 10 GLU H    H   -8.411 -12.663 -12.989 1.00 . A A .  10 GLU H    1 1 
       14  8518 1 1 10 GLU HA   H   -6.315 -11.175 -11.748 1.00 . A A .  10 GLU HA   1 1 
       14  8519 1 1 10 GLU HB2  H   -6.559 -11.683 -14.228 1.00 . A A .  10 GLU HB2  1 1 
       14  8520 1 1 10 GLU HB3  H   -7.785 -10.425 -14.272 1.00 . A A .  10 GLU HB3  1 1 
       14  8521 1 1 10 GLU HG2  H   -5.883  -8.997 -13.149 1.00 . A A .  10 GLU HG2  1 1 
       14  8522 1 1 10 GLU HG3  H   -4.846 -10.200 -13.915 1.00 . A A .  10 GLU HG3  1 1 
       14  8523 1 1 10 GLU N    N   -8.005 -12.276 -12.186 1.00 . A A .  10 GLU N    1 1 
       14  8524 1 1 10 GLU O    O   -9.229  -9.822 -11.759 1.00 . A A .  10 GLU O    1 1 
       14  8525 1 1 10 GLU OE1  O   -6.086  -9.648 -16.314 1.00 . A A .  10 GLU OE1  1 1 
       14  8526 1 1 10 GLU OE2  O   -5.874  -7.731 -15.261 1.00 . A A .  10 GLU OE2  1 1 
       14  8527 1 1 11 LYS C    C   -7.693  -6.506 -11.457 1.00 . A A .  11 LYS C    1 1 
       14  8528 1 1 11 LYS CA   C   -7.872  -7.725 -10.557 1.00 . A A .  11 LYS CA   1 1 
       14  8529 1 1 11 LYS CB   C   -7.258  -7.452  -9.182 1.00 . A A .  11 LYS CB   1 1 
       14  8530 1 1 11 LYS CD   C   -7.014  -9.704  -8.096 1.00 . A A .  11 LYS CD   1 1 
       14  8531 1 1 11 LYS CE   C   -5.738  -9.620  -7.271 1.00 . A A .  11 LYS CE   1 1 
       14  8532 1 1 11 LYS CG   C   -7.765  -8.383  -8.094 1.00 . A A .  11 LYS CG   1 1 
       14  8533 1 1 11 LYS H    H   -6.288  -8.998 -11.150 1.00 . A A .  11 LYS H    1 1 
       14  8534 1 1 11 LYS HA   H   -8.927  -7.919 -10.439 1.00 . A A .  11 LYS HA   1 1 
       14  8535 1 1 11 LYS HB2  H   -6.186  -7.563  -9.251 1.00 . A A .  11 LYS HB2  1 1 
       14  8536 1 1 11 LYS HB3  H   -7.488  -6.436  -8.894 1.00 . A A .  11 LYS HB3  1 1 
       14  8537 1 1 11 LYS HD2  H   -7.650 -10.470  -7.677 1.00 . A A .  11 LYS HD2  1 1 
       14  8538 1 1 11 LYS HD3  H   -6.759  -9.961  -9.114 1.00 . A A .  11 LYS HD3  1 1 
       14  8539 1 1 11 LYS HE2  H   -5.894  -8.926  -6.460 1.00 . A A .  11 LYS HE2  1 1 
       14  8540 1 1 11 LYS HE3  H   -5.520 -10.599  -6.870 1.00 . A A .  11 LYS HE3  1 1 
       14  8541 1 1 11 LYS HG2  H   -7.631  -7.906  -7.134 1.00 . A A .  11 LYS HG2  1 1 
       14  8542 1 1 11 LYS HG3  H   -8.816  -8.576  -8.259 1.00 . A A .  11 LYS HG3  1 1 
       14  8543 1 1 11 LYS HZ1  H   -4.829  -9.166  -9.097 1.00 . A A .  11 LYS HZ1  1 1 
       14  8544 1 1 11 LYS HZ2  H   -3.767  -9.793  -7.939 1.00 . A A .  11 LYS HZ2  1 1 
       14  8545 1 1 11 LYS HZ3  H   -4.309  -8.196  -7.812 1.00 . A A .  11 LYS HZ3  1 1 
       14  8546 1 1 11 LYS N    N   -7.264  -8.907 -11.156 1.00 . A A .  11 LYS N    1 1 
       14  8547 1 1 11 LYS NZ   N   -4.580  -9.162  -8.087 1.00 . A A .  11 LYS NZ   1 1 
       14  8548 1 1 11 LYS O    O   -6.686  -6.359 -12.150 1.00 . A A .  11 LYS O    1 1 
       14  8549 1 1 12 PRO C    C   -7.630  -3.385 -11.757 1.00 . A A .  12 PRO C    1 1 
       14  8550 1 1 12 PRO CA   C   -8.666  -4.387 -12.254 1.00 . A A .  12 PRO CA   1 1 
       14  8551 1 1 12 PRO CB   C  -10.079  -3.823 -12.087 1.00 . A A .  12 PRO CB   1 1 
       14  8552 1 1 12 PRO CD   C   -9.921  -5.722 -10.644 1.00 . A A .  12 PRO CD   1 1 
       14  8553 1 1 12 PRO CG   C  -10.551  -4.363 -10.782 1.00 . A A .  12 PRO CG   1 1 
       14  8554 1 1 12 PRO HA   H   -8.484  -4.604 -13.296 1.00 . A A .  12 PRO HA   1 1 
       14  8555 1 1 12 PRO HB2  H  -10.039  -2.743 -12.077 1.00 . A A .  12 PRO HB2  1 1 
       14  8556 1 1 12 PRO HB3  H  -10.703  -4.158 -12.902 1.00 . A A .  12 PRO HB3  1 1 
       14  8557 1 1 12 PRO HD2  H   -9.689  -5.927  -9.609 1.00 . A A .  12 PRO HD2  1 1 
       14  8558 1 1 12 PRO HD3  H  -10.574  -6.483 -11.044 1.00 . A A .  12 PRO HD3  1 1 
       14  8559 1 1 12 PRO HG2  H  -10.230  -3.717  -9.979 1.00 . A A .  12 PRO HG2  1 1 
       14  8560 1 1 12 PRO HG3  H  -11.628  -4.449 -10.788 1.00 . A A .  12 PRO HG3  1 1 
       14  8561 1 1 12 PRO N    N   -8.691  -5.610 -11.446 1.00 . A A .  12 PRO N    1 1 
       14  8562 1 1 12 PRO O    O   -7.217  -2.488 -12.492 1.00 . A A .  12 PRO O    1 1 
       14  8563 1 1 13 TYR C    C   -5.153  -3.444  -9.168 1.00 . A A .  13 TYR C    1 1 
       14  8564 1 1 13 TYR CA   C   -6.226  -2.652  -9.910 1.00 . A A .  13 TYR CA   1 1 
       14  8565 1 1 13 TYR CB   C   -6.905  -1.672  -8.952 1.00 . A A .  13 TYR CB   1 1 
       14  8566 1 1 13 TYR CD1  C   -8.259  -0.259 -10.549 1.00 . A A .  13 TYR CD1  1 1 
       14  8567 1 1 13 TYR CD2  C   -9.424  -1.499  -8.880 1.00 . A A .  13 TYR CD2  1 1 
       14  8568 1 1 13 TYR CE1  C   -9.458   0.236 -11.025 1.00 . A A .  13 TYR CE1  1 1 
       14  8569 1 1 13 TYR CE2  C  -10.627  -1.010  -9.350 1.00 . A A .  13 TYR CE2  1 1 
       14  8570 1 1 13 TYR CG   C   -8.220  -1.133  -9.470 1.00 . A A .  13 TYR CG   1 1 
       14  8571 1 1 13 TYR CZ   C  -10.639  -0.143 -10.422 1.00 . A A .  13 TYR CZ   1 1 
       14  8572 1 1 13 TYR H    H   -7.578  -4.278  -9.969 1.00 . A A .  13 TYR H    1 1 
       14  8573 1 1 13 TYR HA   H   -5.758  -2.094 -10.708 1.00 . A A .  13 TYR HA   1 1 
       14  8574 1 1 13 TYR HB2  H   -7.098  -2.170  -8.015 1.00 . A A .  13 TYR HB2  1 1 
       14  8575 1 1 13 TYR HB3  H   -6.248  -0.833  -8.780 1.00 . A A .  13 TYR HB3  1 1 
       14  8576 1 1 13 TYR HD1  H   -7.332   0.035 -11.019 1.00 . A A .  13 TYR HD1  1 1 
       14  8577 1 1 13 TYR HD2  H   -9.411  -2.179  -8.040 1.00 . A A .  13 TYR HD2  1 1 
       14  8578 1 1 13 TYR HE1  H   -9.467   0.915 -11.865 1.00 . A A .  13 TYR HE1  1 1 
       14  8579 1 1 13 TYR HE2  H  -11.553  -1.306  -8.878 1.00 . A A .  13 TYR HE2  1 1 
       14  8580 1 1 13 TYR HH   H  -11.876   1.294 -10.741 1.00 . A A .  13 TYR HH   1 1 
       14  8581 1 1 13 TYR N    N   -7.213  -3.544 -10.506 1.00 . A A .  13 TYR N    1 1 
       14  8582 1 1 13 TYR O    O   -5.387  -3.946  -8.069 1.00 . A A .  13 TYR O    1 1 
       14  8583 1 1 13 TYR OH   O  -11.835   0.347 -10.894 1.00 . A A .  13 TYR OH   1 1 
       14  8584 1 1 14 GLN C    C   -1.569  -3.488  -9.290 1.00 . A A .  14 GLN C    1 1 
       14  8585 1 1 14 GLN CA   C   -2.868  -4.279  -9.175 1.00 . A A .  14 GLN CA   1 1 
       14  8586 1 1 14 GLN CB   C   -2.707  -5.646  -9.843 1.00 . A A .  14 GLN CB   1 1 
       14  8587 1 1 14 GLN CD   C   -1.377  -7.794  -9.889 1.00 . A A .  14 GLN CD   1 1 
       14  8588 1 1 14 GLN CG   C   -1.378  -6.319  -9.540 1.00 . A A .  14 GLN CG   1 1 
       14  8589 1 1 14 GLN H    H   -3.852  -3.127 -10.652 1.00 . A A .  14 GLN H    1 1 
       14  8590 1 1 14 GLN HA   H   -3.095  -4.424  -8.130 1.00 . A A .  14 GLN HA   1 1 
       14  8591 1 1 14 GLN HB2  H   -3.500  -6.295  -9.503 1.00 . A A .  14 GLN HB2  1 1 
       14  8592 1 1 14 GLN HB3  H   -2.787  -5.523 -10.913 1.00 . A A .  14 GLN HB3  1 1 
       14  8593 1 1 14 GLN HE21 H   -0.114  -8.171  -8.401 1.00 . A A .  14 GLN HE21 1 1 
       14  8594 1 1 14 GLN HE22 H   -0.603  -9.539  -9.335 1.00 . A A .  14 GLN HE22 1 1 
       14  8595 1 1 14 GLN HG2  H   -0.603  -5.830 -10.112 1.00 . A A .  14 GLN HG2  1 1 
       14  8596 1 1 14 GLN HG3  H   -1.168  -6.213  -8.486 1.00 . A A .  14 GLN HG3  1 1 
       14  8597 1 1 14 GLN N    N   -3.977  -3.549  -9.777 1.00 . A A .  14 GLN N    1 1 
       14  8598 1 1 14 GLN NE2  N   -0.622  -8.582  -9.133 1.00 . A A .  14 GLN NE2  1 1 
       14  8599 1 1 14 GLN O    O   -0.956  -3.433 -10.357 1.00 . A A .  14 GLN O    1 1 
       14  8600 1 1 14 GLN OE1  O   -2.049  -8.222 -10.828 1.00 . A A .  14 GLN OE1  1 1 
       14  8601 1 1 15 CYS C    C    1.253  -2.903  -8.681 1.00 . A A .  15 CYS C    1 1 
       14  8602 1 1 15 CYS CA   C    0.072  -2.088  -8.162 1.00 . A A .  15 CYS CA   1 1 
       14  8603 1 1 15 CYS CB   C    0.361  -1.599  -6.741 1.00 . A A .  15 CYS CB   1 1 
       14  8604 1 1 15 CYS H    H   -1.686  -2.959  -7.365 1.00 . A A .  15 CYS H    1 1 
       14  8605 1 1 15 CYS HA   H   -0.071  -1.234  -8.805 1.00 . A A .  15 CYS HA   1 1 
       14  8606 1 1 15 CYS HB2  H   -0.475  -1.009  -6.395 1.00 . A A .  15 CYS HB2  1 1 
       14  8607 1 1 15 CYS HB3  H    0.484  -2.454  -6.093 1.00 . A A .  15 CYS HB3  1 1 
       14  8608 1 1 15 CYS N    N   -1.154  -2.877  -8.186 1.00 . A A .  15 CYS N    1 1 
       14  8609 1 1 15 CYS O    O    1.446  -4.054  -8.291 1.00 . A A .  15 CYS O    1 1 
       14  8610 1 1 15 CYS SG   S    1.859  -0.573  -6.599 1.00 . A A .  15 CYS SG   1 1 
       14  8611 1 1 16 SER C    C    4.468  -2.621  -9.363 1.00 . A A .  16 SER C    1 1 
       14  8612 1 1 16 SER CA   C    3.201  -2.965 -10.140 1.00 . A A .  16 SER CA   1 1 
       14  8613 1 1 16 SER CB   C    3.366  -2.570 -11.609 1.00 . A A .  16 SER CB   1 1 
       14  8614 1 1 16 SER H    H    1.834  -1.377  -9.836 1.00 . A A .  16 SER H    1 1 
       14  8615 1 1 16 SER HA   H    3.033  -4.030 -10.079 1.00 . A A .  16 SER HA   1 1 
       14  8616 1 1 16 SER HB2  H    4.215  -3.091 -12.026 1.00 . A A .  16 SER HB2  1 1 
       14  8617 1 1 16 SER HB3  H    2.474  -2.841 -12.155 1.00 . A A .  16 SER HB3  1 1 
       14  8618 1 1 16 SER HG   H    4.248  -0.892 -11.115 1.00 . A A .  16 SER HG   1 1 
       14  8619 1 1 16 SER N    N    2.040  -2.296  -9.564 1.00 . A A .  16 SER N    1 1 
       14  8620 1 1 16 SER O    O    5.384  -3.435  -9.258 1.00 . A A .  16 SER O    1 1 
       14  8621 1 1 16 SER OG   O    3.577  -1.175 -11.741 1.00 . A A .  16 SER OG   1 1 
       14  8622 1 1 17 GLU C    C    6.122  -2.030  -7.072 1.00 . A A .  17 GLU C    1 1 
       14  8623 1 1 17 GLU CA   C    5.665  -0.955  -8.054 1.00 . A A .  17 GLU CA   1 1 
       14  8624 1 1 17 GLU CB   C    5.330   0.332  -7.297 1.00 . A A .  17 GLU CB   1 1 
       14  8625 1 1 17 GLU CD   C    4.387   2.015  -8.928 1.00 . A A .  17 GLU CD   1 1 
       14  8626 1 1 17 GLU CG   C    5.587   1.595  -8.102 1.00 . A A .  17 GLU CG   1 1 
       14  8627 1 1 17 GLU H    H    3.748  -0.803  -8.940 1.00 . A A .  17 GLU H    1 1 
       14  8628 1 1 17 GLU HA   H    6.467  -0.755  -8.749 1.00 . A A .  17 GLU HA   1 1 
       14  8629 1 1 17 GLU HB2  H    4.286   0.312  -7.021 1.00 . A A .  17 GLU HB2  1 1 
       14  8630 1 1 17 GLU HB3  H    5.930   0.374  -6.400 1.00 . A A .  17 GLU HB3  1 1 
       14  8631 1 1 17 GLU HG2  H    5.834   2.396  -7.421 1.00 . A A .  17 GLU HG2  1 1 
       14  8632 1 1 17 GLU HG3  H    6.420   1.420  -8.767 1.00 . A A .  17 GLU HG3  1 1 
       14  8633 1 1 17 GLU N    N    4.510  -1.408  -8.821 1.00 . A A .  17 GLU N    1 1 
       14  8634 1 1 17 GLU O    O    7.319  -2.225  -6.860 1.00 . A A .  17 GLU O    1 1 
       14  8635 1 1 17 GLU OE1  O    3.246   1.766  -8.485 1.00 . A A .  17 GLU OE1  1 1 
       14  8636 1 1 17 GLU OE2  O    4.588   2.591 -10.017 1.00 . A A .  17 GLU OE2  1 1 
       14  8637 1 1 18 CYS C    C    4.785  -5.089  -5.915 1.00 . A A .  18 CYS C    1 1 
       14  8638 1 1 18 CYS CA   C    5.461  -3.781  -5.516 1.00 . A A .  18 CYS CA   1 1 
       14  8639 1 1 18 CYS CB   C    5.008  -3.368  -4.114 1.00 . A A .  18 CYS CB   1 1 
       14  8640 1 1 18 CYS H    H    4.223  -2.524  -6.686 1.00 . A A .  18 CYS H    1 1 
       14  8641 1 1 18 CYS HA   H    6.530  -3.930  -5.510 1.00 . A A .  18 CYS HA   1 1 
       14  8642 1 1 18 CYS HB2  H    5.193  -4.183  -3.429 1.00 . A A .  18 CYS HB2  1 1 
       14  8643 1 1 18 CYS HB3  H    5.577  -2.505  -3.800 1.00 . A A .  18 CYS HB3  1 1 
       14  8644 1 1 18 CYS N    N    5.160  -2.726  -6.476 1.00 . A A .  18 CYS N    1 1 
       14  8645 1 1 18 CYS O    O    5.417  -6.144  -5.941 1.00 . A A .  18 CYS O    1 1 
       14  8646 1 1 18 CYS SG   S    3.241  -2.940  -3.999 1.00 . A A .  18 CYS SG   1 1 
       14  8647 1 1 19 GLY C    C    1.636  -6.529  -5.653 1.00 . A A .  19 GLY C    1 1 
       14  8648 1 1 19 GLY CA   C    2.753  -6.195  -6.621 1.00 . A A .  19 GLY CA   1 1 
       14  8649 1 1 19 GLY H    H    3.042  -4.143  -6.188 1.00 . A A .  19 GLY H    1 1 
       14  8650 1 1 19 GLY HA2  H    2.331  -6.032  -7.601 1.00 . A A .  19 GLY HA2  1 1 
       14  8651 1 1 19 GLY HA3  H    3.434  -7.032  -6.669 1.00 . A A .  19 GLY HA3  1 1 
       14  8652 1 1 19 GLY N    N    3.494  -5.011  -6.227 1.00 . A A .  19 GLY N    1 1 
       14  8653 1 1 19 GLY O    O    1.268  -7.693  -5.494 1.00 . A A .  19 GLY O    1 1 
       14  8654 1 1 20 LYS C    C   -1.341  -5.386  -4.682 1.00 . A A .  20 LYS C    1 1 
       14  8655 1 1 20 LYS CA   C    0.010  -5.694  -4.045 1.00 . A A .  20 LYS CA   1 1 
       14  8656 1 1 20 LYS CB   C    0.224  -4.801  -2.820 1.00 . A A .  20 LYS CB   1 1 
       14  8657 1 1 20 LYS CD   C   -0.627  -4.003  -0.596 1.00 . A A .  20 LYS CD   1 1 
       14  8658 1 1 20 LYS CE   C    0.460  -4.541   0.322 1.00 . A A .  20 LYS CE   1 1 
       14  8659 1 1 20 LYS CG   C   -0.870  -4.931  -1.775 1.00 . A A .  20 LYS CG   1 1 
       14  8660 1 1 20 LYS H    H    1.429  -4.599  -5.173 1.00 . A A .  20 LYS H    1 1 
       14  8661 1 1 20 LYS HA   H    0.020  -6.727  -3.732 1.00 . A A .  20 LYS HA   1 1 
       14  8662 1 1 20 LYS HB2  H    1.166  -5.060  -2.360 1.00 . A A .  20 LYS HB2  1 1 
       14  8663 1 1 20 LYS HB3  H    0.263  -3.770  -3.144 1.00 . A A .  20 LYS HB3  1 1 
       14  8664 1 1 20 LYS HD2  H   -0.324  -3.035  -0.967 1.00 . A A .  20 LYS HD2  1 1 
       14  8665 1 1 20 LYS HD3  H   -1.545  -3.903  -0.033 1.00 . A A .  20 LYS HD3  1 1 
       14  8666 1 1 20 LYS HE2  H    0.174  -5.525   0.659 1.00 . A A .  20 LYS HE2  1 1 
       14  8667 1 1 20 LYS HE3  H    1.383  -4.604  -0.235 1.00 . A A .  20 LYS HE3  1 1 
       14  8668 1 1 20 LYS HG2  H   -1.819  -4.681  -2.226 1.00 . A A .  20 LYS HG2  1 1 
       14  8669 1 1 20 LYS HG3  H   -0.896  -5.951  -1.419 1.00 . A A .  20 LYS HG3  1 1 
       14  8670 1 1 20 LYS HZ1  H    0.403  -2.685   1.280 1.00 . A A .  20 LYS HZ1  1 1 
       14  8671 1 1 20 LYS HZ2  H    1.668  -3.684   1.795 1.00 . A A .  20 LYS HZ2  1 1 
       14  8672 1 1 20 LYS HZ3  H    0.085  -3.994   2.303 1.00 . A A .  20 LYS HZ3  1 1 
       14  8673 1 1 20 LYS N    N    1.093  -5.505  -5.003 1.00 . A A .  20 LYS N    1 1 
       14  8674 1 1 20 LYS NZ   N    0.668  -3.664   1.508 1.00 . A A .  20 LYS NZ   1 1 
       14  8675 1 1 20 LYS O    O   -1.478  -4.419  -5.431 1.00 . A A .  20 LYS O    1 1 
       14  8676 1 1 21 SER C    C   -4.552  -5.241  -3.959 1.00 . A A .  21 SER C    1 1 
       14  8677 1 1 21 SER CA   C   -3.675  -6.031  -4.925 1.00 . A A .  21 SER CA   1 1 
       14  8678 1 1 21 SER CB   C   -4.317  -7.387  -5.222 1.00 . A A .  21 SER CB   1 1 
       14  8679 1 1 21 SER H    H   -2.163  -6.967  -3.776 1.00 . A A .  21 SER H    1 1 
       14  8680 1 1 21 SER HA   H   -3.585  -5.475  -5.847 1.00 . A A .  21 SER HA   1 1 
       14  8681 1 1 21 SER HB2  H   -5.341  -7.238  -5.530 1.00 . A A .  21 SER HB2  1 1 
       14  8682 1 1 21 SER HB3  H   -3.770  -7.876  -6.015 1.00 . A A .  21 SER HB3  1 1 
       14  8683 1 1 21 SER HG   H   -3.583  -8.852  -4.148 1.00 . A A .  21 SER HG   1 1 
       14  8684 1 1 21 SER N    N   -2.335  -6.214  -4.380 1.00 . A A .  21 SER N    1 1 
       14  8685 1 1 21 SER O    O   -4.237  -5.118  -2.775 1.00 . A A .  21 SER O    1 1 
       14  8686 1 1 21 SER OG   O   -4.302  -8.220  -4.076 1.00 . A A .  21 SER OG   1 1 
       14  8687 1 1 22 PHE C    C   -8.021  -4.163  -4.092 1.00 . A A .  22 PHE C    1 1 
       14  8688 1 1 22 PHE CA   C   -6.578  -3.926  -3.657 1.00 . A A .  22 PHE CA   1 1 
       14  8689 1 1 22 PHE CB   C   -6.243  -2.436  -3.752 1.00 . A A .  22 PHE CB   1 1 
       14  8690 1 1 22 PHE CD1  C   -3.786  -2.402  -4.261 1.00 . A A .  22 PHE CD1  1 1 
       14  8691 1 1 22 PHE CD2  C   -4.521  -1.532  -2.166 1.00 . A A .  22 PHE CD2  1 1 
       14  8692 1 1 22 PHE CE1  C   -2.477  -2.109  -3.928 1.00 . A A .  22 PHE CE1  1 1 
       14  8693 1 1 22 PHE CE2  C   -3.214  -1.236  -1.828 1.00 . A A .  22 PHE CE2  1 1 
       14  8694 1 1 22 PHE CG   C   -4.822  -2.117  -3.386 1.00 . A A .  22 PHE CG   1 1 
       14  8695 1 1 22 PHE CZ   C   -2.191  -1.526  -2.709 1.00 . A A .  22 PHE CZ   1 1 
       14  8696 1 1 22 PHE H    H   -5.852  -4.838  -5.424 1.00 . A A .  22 PHE H    1 1 
       14  8697 1 1 22 PHE HA   H   -6.466  -4.246  -2.633 1.00 . A A .  22 PHE HA   1 1 
       14  8698 1 1 22 PHE HB2  H   -6.407  -2.101  -4.765 1.00 . A A .  22 PHE HB2  1 1 
       14  8699 1 1 22 PHE HB3  H   -6.890  -1.885  -3.086 1.00 . A A .  22 PHE HB3  1 1 
       14  8700 1 1 22 PHE HD1  H   -4.009  -2.858  -5.216 1.00 . A A .  22 PHE HD1  1 1 
       14  8701 1 1 22 PHE HD2  H   -5.320  -1.305  -1.476 1.00 . A A .  22 PHE HD2  1 1 
       14  8702 1 1 22 PHE HE1  H   -1.680  -2.337  -4.619 1.00 . A A .  22 PHE HE1  1 1 
       14  8703 1 1 22 PHE HE2  H   -2.993  -0.781  -0.874 1.00 . A A .  22 PHE HE2  1 1 
       14  8704 1 1 22 PHE HZ   H   -1.169  -1.296  -2.447 1.00 . A A .  22 PHE HZ   1 1 
       14  8705 1 1 22 PHE N    N   -5.655  -4.705  -4.473 1.00 . A A .  22 PHE N    1 1 
       14  8706 1 1 22 PHE O    O   -8.300  -4.363  -5.274 1.00 . A A .  22 PHE O    1 1 
       14  8707 1 1 23 SER C    C  -10.875  -3.310  -4.388 1.00 . A A .  23 SER C    1 1 
       14  8708 1 1 23 SER CA   C  -10.350  -4.355  -3.408 1.00 . A A .  23 SER CA   1 1 
       14  8709 1 1 23 SER CB   C  -11.162  -4.309  -2.112 1.00 . A A .  23 SER CB   1 1 
       14  8710 1 1 23 SER H    H   -8.651  -3.974  -2.203 1.00 . A A .  23 SER H    1 1 
       14  8711 1 1 23 SER HA   H  -10.453  -5.333  -3.853 1.00 . A A .  23 SER HA   1 1 
       14  8712 1 1 23 SER HB2  H  -10.750  -3.556  -1.459 1.00 . A A .  23 SER HB2  1 1 
       14  8713 1 1 23 SER HB3  H  -12.189  -4.064  -2.343 1.00 . A A .  23 SER HB3  1 1 
       14  8714 1 1 23 SER HG   H  -10.567  -5.494  -0.670 1.00 . A A .  23 SER HG   1 1 
       14  8715 1 1 23 SER N    N   -8.935  -4.139  -3.127 1.00 . A A .  23 SER N    1 1 
       14  8716 1 1 23 SER O    O  -11.613  -3.631  -5.318 1.00 . A A .  23 SER O    1 1 
       14  8717 1 1 23 SER OG   O  -11.130  -5.559  -1.446 1.00 . A A .  23 SER OG   1 1 
       14  8718 1 1 24 GLY C    C   -9.775  -0.139  -5.551 1.00 . A A .  24 GLY C    1 1 
       14  8719 1 1 24 GLY CA   C  -10.927  -0.983  -5.043 1.00 . A A .  24 GLY CA   1 1 
       14  8720 1 1 24 GLY H    H   -9.897  -1.860  -3.414 1.00 . A A .  24 GLY H    1 1 
       14  8721 1 1 24 GLY HA2  H  -11.447  -1.410  -5.887 1.00 . A A .  24 GLY HA2  1 1 
       14  8722 1 1 24 GLY HA3  H  -11.609  -0.348  -4.496 1.00 . A A .  24 GLY HA3  1 1 
       14  8723 1 1 24 GLY N    N  -10.487  -2.057  -4.171 1.00 . A A .  24 GLY N    1 1 
       14  8724 1 1 24 GLY O    O   -8.617  -0.397  -5.224 1.00 . A A .  24 GLY O    1 1 
       14  8725 1 1 25 SER C    C   -8.651   2.808  -5.895 1.00 . A A .  25 SER C    1 1 
       14  8726 1 1 25 SER CA   C   -9.075   1.753  -6.913 1.00 . A A .  25 SER CA   1 1 
       14  8727 1 1 25 SER CB   C   -9.597   2.431  -8.180 1.00 . A A .  25 SER CB   1 1 
       14  8728 1 1 25 SER H    H  -11.035   1.026  -6.577 1.00 . A A .  25 SER H    1 1 
       14  8729 1 1 25 SER HA   H   -8.216   1.149  -7.166 1.00 . A A .  25 SER HA   1 1 
       14  8730 1 1 25 SER HB2  H   -8.810   3.026  -8.618 1.00 . A A .  25 SER HB2  1 1 
       14  8731 1 1 25 SER HB3  H   -9.912   1.676  -8.886 1.00 . A A .  25 SER HB3  1 1 
       14  8732 1 1 25 SER HG   H  -11.514   2.773  -7.968 1.00 . A A .  25 SER HG   1 1 
       14  8733 1 1 25 SER N    N  -10.093   0.871  -6.354 1.00 . A A .  25 SER N    1 1 
       14  8734 1 1 25 SER O    O   -7.461   3.050  -5.694 1.00 . A A .  25 SER O    1 1 
       14  8735 1 1 25 SER OG   O  -10.699   3.274  -7.891 1.00 . A A .  25 SER OG   1 1 
       14  8736 1 1 26 TYR C    C   -8.217   4.051  -3.346 1.00 . A A .  26 TYR C    1 1 
       14  8737 1 1 26 TYR CA   C   -9.366   4.464  -4.262 1.00 . A A .  26 TYR CA   1 1 
       14  8738 1 1 26 TYR CB   C  -10.620   4.741  -3.432 1.00 . A A .  26 TYR CB   1 1 
       14  8739 1 1 26 TYR CD1  C  -10.746   7.245  -3.135 1.00 . A A .  26 TYR CD1  1 1 
       14  8740 1 1 26 TYR CD2  C  -10.205   5.913  -1.234 1.00 . A A .  26 TYR CD2  1 1 
       14  8741 1 1 26 TYR CE1  C  -10.657   8.389  -2.364 1.00 . A A .  26 TYR CE1  1 1 
       14  8742 1 1 26 TYR CE2  C  -10.116   7.051  -0.456 1.00 . A A .  26 TYR CE2  1 1 
       14  8743 1 1 26 TYR CG   C  -10.522   5.989  -2.584 1.00 . A A .  26 TYR CG   1 1 
       14  8744 1 1 26 TYR CZ   C  -10.342   8.286  -1.025 1.00 . A A .  26 TYR CZ   1 1 
       14  8745 1 1 26 TYR H    H  -10.563   3.196  -5.460 1.00 . A A .  26 TYR H    1 1 
       14  8746 1 1 26 TYR HA   H   -9.086   5.366  -4.786 1.00 . A A .  26 TYR HA   1 1 
       14  8747 1 1 26 TYR HB2  H  -11.464   4.856  -4.095 1.00 . A A .  26 TYR HB2  1 1 
       14  8748 1 1 26 TYR HB3  H  -10.799   3.905  -2.772 1.00 . A A .  26 TYR HB3  1 1 
       14  8749 1 1 26 TYR HD1  H  -10.992   7.323  -4.184 1.00 . A A .  26 TYR HD1  1 1 
       14  8750 1 1 26 TYR HD2  H  -10.028   4.943  -0.791 1.00 . A A .  26 TYR HD2  1 1 
       14  8751 1 1 26 TYR HE1  H  -10.834   9.357  -2.810 1.00 . A A .  26 TYR HE1  1 1 
       14  8752 1 1 26 TYR HE2  H   -9.868   6.971   0.593 1.00 . A A .  26 TYR HE2  1 1 
       14  8753 1 1 26 TYR HH   H   -9.971   9.185   0.633 1.00 . A A .  26 TYR HH   1 1 
       14  8754 1 1 26 TYR N    N   -9.634   3.433  -5.257 1.00 . A A .  26 TYR N    1 1 
       14  8755 1 1 26 TYR O    O   -7.368   4.868  -2.990 1.00 . A A .  26 TYR O    1 1 
       14  8756 1 1 26 TYR OH   O  -10.252   9.422  -0.254 1.00 . A A .  26 TYR OH   1 1 
       14  8757 1 1 27 ARG C    C   -5.817   2.192  -2.821 1.00 . A A .  27 ARG C    1 1 
       14  8758 1 1 27 ARG CA   C   -7.157   2.254  -2.094 1.00 . A A .  27 ARG CA   1 1 
       14  8759 1 1 27 ARG CB   C   -7.538   0.862  -1.586 1.00 . A A .  27 ARG CB   1 1 
       14  8760 1 1 27 ARG CD   C   -8.683   1.560   0.540 1.00 . A A .  27 ARG CD   1 1 
       14  8761 1 1 27 ARG CG   C   -8.833   0.838  -0.790 1.00 . A A .  27 ARG CG   1 1 
       14  8762 1 1 27 ARG CZ   C   -9.699  -0.023   2.122 1.00 . A A .  27 ARG CZ   1 1 
       14  8763 1 1 27 ARG H    H   -8.904   2.174  -3.285 1.00 . A A .  27 ARG H    1 1 
       14  8764 1 1 27 ARG HA   H   -7.064   2.922  -1.251 1.00 . A A .  27 ARG HA   1 1 
       14  8765 1 1 27 ARG HB2  H   -7.649   0.201  -2.432 1.00 . A A .  27 ARG HB2  1 1 
       14  8766 1 1 27 ARG HB3  H   -6.745   0.494  -0.953 1.00 . A A .  27 ARG HB3  1 1 
       14  8767 1 1 27 ARG HD2  H   -7.708   1.339   0.947 1.00 . A A .  27 ARG HD2  1 1 
       14  8768 1 1 27 ARG HD3  H   -8.768   2.623   0.368 1.00 . A A .  27 ARG HD3  1 1 
       14  8769 1 1 27 ARG HE   H  -10.424   1.785   1.696 1.00 . A A .  27 ARG HE   1 1 
       14  8770 1 1 27 ARG HG2  H   -9.607   1.324  -1.365 1.00 . A A .  27 ARG HG2  1 1 
       14  8771 1 1 27 ARG HG3  H   -9.110  -0.189  -0.603 1.00 . A A .  27 ARG HG3  1 1 
       14  8772 1 1 27 ARG HH11 H   -8.008  -0.678   1.232 1.00 . A A .  27 ARG HH11 1 1 
       14  8773 1 1 27 ARG HH12 H   -8.734  -1.785   2.349 1.00 . A A .  27 ARG HH12 1 1 
       14  8774 1 1 27 ARG HH21 H  -11.389   0.337   3.170 1.00 . A A .  27 ARG HH21 1 1 
       14  8775 1 1 27 ARG HH22 H  -10.658  -1.207   3.451 1.00 . A A .  27 ARG HH22 1 1 
       14  8776 1 1 27 ARG N    N   -8.199   2.777  -2.968 1.00 . A A .  27 ARG N    1 1 
       14  8777 1 1 27 ARG NE   N   -9.702   1.152   1.503 1.00 . A A .  27 ARG NE   1 1 
       14  8778 1 1 27 ARG NH1  N   -8.735  -0.901   1.881 1.00 . A A .  27 ARG NH1  1 1 
       14  8779 1 1 27 ARG NH2  N  -10.661  -0.322   2.985 1.00 . A A .  27 ARG NH2  1 1 
       14  8780 1 1 27 ARG O    O   -4.778   2.546  -2.263 1.00 . A A .  27 ARG O    1 1 
       14  8781 1 1 28 LEU C    C   -3.845   2.934  -4.847 1.00 . A A .  28 LEU C    1 1 
       14  8782 1 1 28 LEU CA   C   -4.636   1.630  -4.875 1.00 . A A .  28 LEU CA   1 1 
       14  8783 1 1 28 LEU CB   C   -4.990   1.266  -6.318 1.00 . A A .  28 LEU CB   1 1 
       14  8784 1 1 28 LEU CD1  C   -3.549  -0.607  -7.153 1.00 . A A .  28 LEU CD1  1 1 
       14  8785 1 1 28 LEU CD2  C   -4.087   1.318  -8.656 1.00 . A A .  28 LEU CD2  1 1 
       14  8786 1 1 28 LEU CG   C   -3.816   0.889  -7.222 1.00 . A A .  28 LEU CG   1 1 
       14  8787 1 1 28 LEU H    H   -6.706   1.472  -4.461 1.00 . A A .  28 LEU H    1 1 
       14  8788 1 1 28 LEU HA   H   -4.028   0.844  -4.452 1.00 . A A .  28 LEU HA   1 1 
       14  8789 1 1 28 LEU HB2  H   -5.668   0.427  -6.290 1.00 . A A .  28 LEU HB2  1 1 
       14  8790 1 1 28 LEU HB3  H   -5.489   2.116  -6.760 1.00 . A A .  28 LEU HB3  1 1 
       14  8791 1 1 28 LEU HD11 H   -3.776  -1.057  -8.107 1.00 . A A .  28 LEU HD11 1 1 
       14  8792 1 1 28 LEU HD12 H   -4.170  -1.049  -6.389 1.00 . A A .  28 LEU HD12 1 1 
       14  8793 1 1 28 LEU HD13 H   -2.509  -0.776  -6.913 1.00 . A A .  28 LEU HD13 1 1 
       14  8794 1 1 28 LEU HD21 H   -3.584   2.253  -8.853 1.00 . A A .  28 LEU HD21 1 1 
       14  8795 1 1 28 LEU HD22 H   -5.151   1.445  -8.798 1.00 . A A .  28 LEU HD22 1 1 
       14  8796 1 1 28 LEU HD23 H   -3.721   0.561  -9.334 1.00 . A A .  28 LEU HD23 1 1 
       14  8797 1 1 28 LEU HG   H   -2.927   1.402  -6.880 1.00 . A A .  28 LEU HG   1 1 
       14  8798 1 1 28 LEU N    N   -5.848   1.739  -4.070 1.00 . A A .  28 LEU N    1 1 
       14  8799 1 1 28 LEU O    O   -2.776   3.012  -4.240 1.00 . A A .  28 LEU O    1 1 
       14  8800 1 1 29 THR C    C   -3.172   5.650  -4.189 1.00 . A A .  29 THR C    1 1 
       14  8801 1 1 29 THR CA   C   -3.722   5.259  -5.556 1.00 . A A .  29 THR CA   1 1 
       14  8802 1 1 29 THR CB   C   -4.688   6.356  -6.041 1.00 . A A .  29 THR CB   1 1 
       14  8803 1 1 29 THR CG2  C   -5.899   6.454  -5.126 1.00 . A A .  29 THR CG2  1 1 
       14  8804 1 1 29 THR H    H   -5.232   3.834  -5.970 1.00 . A A .  29 THR H    1 1 
       14  8805 1 1 29 THR HA   H   -2.903   5.193  -6.258 1.00 . A A .  29 THR HA   1 1 
       14  8806 1 1 29 THR HB   H   -5.026   6.103  -7.036 1.00 . A A .  29 THR HB   1 1 
       14  8807 1 1 29 THR HG1  H   -3.074   7.475  -6.226 1.00 . A A .  29 THR HG1  1 1 
       14  8808 1 1 29 THR HG21 H   -5.627   6.981  -4.224 1.00 . A A .  29 THR HG21 1 1 
       14  8809 1 1 29 THR HG22 H   -6.241   5.462  -4.874 1.00 . A A .  29 THR HG22 1 1 
       14  8810 1 1 29 THR HG23 H   -6.689   6.990  -5.632 1.00 . A A .  29 THR HG23 1 1 
       14  8811 1 1 29 THR N    N   -4.377   3.958  -5.506 1.00 . A A .  29 THR N    1 1 
       14  8812 1 1 29 THR O    O   -1.996   5.988  -4.058 1.00 . A A .  29 THR O    1 1 
       14  8813 1 1 29 THR OG1  O   -4.013   7.618  -6.085 1.00 . A A .  29 THR OG1  1 1 
       14  8814 1 1 30 GLN C    C   -2.320   5.263  -1.443 1.00 . A A .  30 GLN C    1 1 
       14  8815 1 1 30 GLN CA   C   -3.628   5.952  -1.818 1.00 . A A .  30 GLN CA   1 1 
       14  8816 1 1 30 GLN CB   C   -4.724   5.567  -0.823 1.00 . A A .  30 GLN CB   1 1 
       14  8817 1 1 30 GLN CD   C   -6.491   6.619   0.645 1.00 . A A .  30 GLN CD   1 1 
       14  8818 1 1 30 GLN CG   C   -5.843   6.592  -0.725 1.00 . A A .  30 GLN CG   1 1 
       14  8819 1 1 30 GLN H    H   -4.954   5.325  -3.344 1.00 . A A .  30 GLN H    1 1 
       14  8820 1 1 30 GLN HA   H   -3.480   7.020  -1.781 1.00 . A A .  30 GLN HA   1 1 
       14  8821 1 1 30 GLN HB2  H   -5.154   4.624  -1.127 1.00 . A A .  30 GLN HB2  1 1 
       14  8822 1 1 30 GLN HB3  H   -4.283   5.454   0.156 1.00 . A A .  30 GLN HB3  1 1 
       14  8823 1 1 30 GLN HE21 H   -7.852   5.294   0.055 1.00 . A A .  30 GLN HE21 1 1 
       14  8824 1 1 30 GLN HE22 H   -7.990   5.835   1.690 1.00 . A A .  30 GLN HE22 1 1 
       14  8825 1 1 30 GLN HG2  H   -5.437   7.571  -0.934 1.00 . A A .  30 GLN HG2  1 1 
       14  8826 1 1 30 GLN HG3  H   -6.598   6.352  -1.460 1.00 . A A .  30 GLN HG3  1 1 
       14  8827 1 1 30 GLN N    N   -4.030   5.602  -3.175 1.00 . A A .  30 GLN N    1 1 
       14  8828 1 1 30 GLN NE2  N   -7.552   5.838   0.814 1.00 . A A .  30 GLN NE2  1 1 
       14  8829 1 1 30 GLN O    O   -1.465   5.850  -0.779 1.00 . A A .  30 GLN O    1 1 
       14  8830 1 1 30 GLN OE1  O   -6.044   7.334   1.542 1.00 . A A .  30 GLN OE1  1 1 
       14  8831 1 1 31 HIS C    C    0.178   3.656  -2.501 1.00 . A A .  31 HIS C    1 1 
       14  8832 1 1 31 HIS CA   C   -0.967   3.244  -1.581 1.00 . A A .  31 HIS CA   1 1 
       14  8833 1 1 31 HIS CB   C   -1.243   1.747  -1.731 1.00 . A A .  31 HIS CB   1 1 
       14  8834 1 1 31 HIS CD2  C    0.402   0.457  -3.266 1.00 . A A .  31 HIS CD2  1 1 
       14  8835 1 1 31 HIS CE1  C    1.864  -0.135  -1.743 1.00 . A A .  31 HIS CE1  1 1 
       14  8836 1 1 31 HIS CG   C   -0.027   0.945  -2.079 1.00 . A A .  31 HIS CG   1 1 
       14  8837 1 1 31 HIS H    H   -2.887   3.600  -2.396 1.00 . A A .  31 HIS H    1 1 
       14  8838 1 1 31 HIS HA   H   -0.682   3.447  -0.560 1.00 . A A .  31 HIS HA   1 1 
       14  8839 1 1 31 HIS HB2  H   -1.637   1.365  -0.801 1.00 . A A .  31 HIS HB2  1 1 
       14  8840 1 1 31 HIS HB3  H   -1.974   1.600  -2.513 1.00 . A A .  31 HIS HB3  1 1 
       14  8841 1 1 31 HIS HD1  H    0.881   0.758  -0.187 1.00 . A A .  31 HIS HD1  1 1 
       14  8842 1 1 31 HIS HD2  H   -0.090   0.571  -4.222 1.00 . A A .  31 HIS HD2  1 1 
       14  8843 1 1 31 HIS HE1  H    2.729  -0.566  -1.262 1.00 . A A .  31 HIS HE1  1 1 
       14  8844 1 1 31 HIS N    N   -2.171   4.013  -1.872 1.00 . A A .  31 HIS N    1 1 
       14  8845 1 1 31 HIS ND1  N    0.910   0.556  -1.145 1.00 . A A .  31 HIS ND1  1 1 
       14  8846 1 1 31 HIS NE2  N    1.579  -0.210  -3.031 1.00 . A A .  31 HIS NE2  1 1 
       14  8847 1 1 31 HIS O    O    1.283   3.945  -2.042 1.00 . A A .  31 HIS O    1 1 
       14  8848 1 1 32 TRP C    C    1.764   5.216  -4.278 1.00 . A A .  32 TRP C    1 1 
       14  8849 1 1 32 TRP CA   C    0.913   4.058  -4.786 1.00 . A A .  32 TRP CA   1 1 
       14  8850 1 1 32 TRP CB   C    0.245   4.441  -6.108 1.00 . A A .  32 TRP CB   1 1 
       14  8851 1 1 32 TRP CD1  C   -0.630   2.105  -6.697 1.00 . A A .  32 TRP CD1  1 1 
       14  8852 1 1 32 TRP CD2  C    0.405   3.153  -8.384 1.00 . A A .  32 TRP CD2  1 1 
       14  8853 1 1 32 TRP CE2  C   -0.024   1.890  -8.836 1.00 . A A .  32 TRP CE2  1 1 
       14  8854 1 1 32 TRP CE3  C    1.081   3.993  -9.274 1.00 . A A .  32 TRP CE3  1 1 
       14  8855 1 1 32 TRP CG   C    0.007   3.271  -7.014 1.00 . A A .  32 TRP CG   1 1 
       14  8856 1 1 32 TRP CH2  C    0.866   2.291 -10.987 1.00 . A A .  32 TRP CH2  1 1 
       14  8857 1 1 32 TRP CZ2  C    0.202   1.449 -10.137 1.00 . A A .  32 TRP CZ2  1 1 
       14  8858 1 1 32 TRP CZ3  C    1.305   3.553 -10.565 1.00 . A A .  32 TRP CZ3  1 1 
       14  8859 1 1 32 TRP H    H   -0.995   3.441  -4.106 1.00 . A A .  32 TRP H    1 1 
       14  8860 1 1 32 TRP HA   H    1.551   3.202  -4.950 1.00 . A A .  32 TRP HA   1 1 
       14  8861 1 1 32 TRP HB2  H   -0.709   4.902  -5.902 1.00 . A A .  32 TRP HB2  1 1 
       14  8862 1 1 32 TRP HB3  H    0.876   5.145  -6.630 1.00 . A A .  32 TRP HB3  1 1 
       14  8863 1 1 32 TRP HD1  H   -1.048   1.885  -5.727 1.00 . A A .  32 TRP HD1  1 1 
       14  8864 1 1 32 TRP HE1  H   -1.054   0.376  -7.812 1.00 . A A .  32 TRP HE1  1 1 
       14  8865 1 1 32 TRP HE3  H    1.427   4.969  -8.968 1.00 . A A .  32 TRP HE3  1 1 
       14  8866 1 1 32 TRP HH2  H    1.063   1.989 -12.004 1.00 . A A .  32 TRP HH2  1 1 
       14  8867 1 1 32 TRP HZ2  H   -0.130   0.479 -10.477 1.00 . A A .  32 TRP HZ2  1 1 
       14  8868 1 1 32 TRP HZ3  H    1.826   4.188 -11.266 1.00 . A A .  32 TRP HZ3  1 1 
       14  8869 1 1 32 TRP N    N   -0.095   3.681  -3.801 1.00 . A A .  32 TRP N    1 1 
       14  8870 1 1 32 TRP NE1  N   -0.652   1.270  -7.788 1.00 . A A .  32 TRP NE1  1 1 
       14  8871 1 1 32 TRP O    O    2.968   5.271  -4.532 1.00 . A A .  32 TRP O    1 1 
       14  8872 1 1 33 ILE C    C    3.108   6.874  -2.291 1.00 . A A .  33 ILE C    1 1 
       14  8873 1 1 33 ILE CA   C    1.834   7.295  -3.016 1.00 . A A .  33 ILE CA   1 1 
       14  8874 1 1 33 ILE CB   C    0.942   8.089  -2.044 1.00 . A A .  33 ILE CB   1 1 
       14  8875 1 1 33 ILE CD1  C   -1.370   9.144  -1.891 1.00 . A A .  33 ILE CD1  1 1 
       14  8876 1 1 33 ILE CG1  C   -0.234   8.718  -2.795 1.00 . A A .  33 ILE CG1  1 1 
       14  8877 1 1 33 ILE CG2  C    1.755   9.159  -1.332 1.00 . A A .  33 ILE CG2  1 1 
       14  8878 1 1 33 ILE H    H    0.173   6.040  -3.392 1.00 . A A .  33 ILE H    1 1 
       14  8879 1 1 33 ILE HA   H    2.099   7.942  -3.840 1.00 . A A .  33 ILE HA   1 1 
       14  8880 1 1 33 ILE HB   H    0.561   7.405  -1.301 1.00 . A A .  33 ILE HB   1 1 
       14  8881 1 1 33 ILE HD11 H   -0.977   9.732  -1.073 1.00 . A A .  33 ILE HD11 1 1 
       14  8882 1 1 33 ILE HD12 H   -2.075   9.738  -2.453 1.00 . A A .  33 ILE HD12 1 1 
       14  8883 1 1 33 ILE HD13 H   -1.866   8.269  -1.498 1.00 . A A .  33 ILE HD13 1 1 
       14  8884 1 1 33 ILE HG12 H    0.111   9.590  -3.326 1.00 . A A .  33 ILE HG12 1 1 
       14  8885 1 1 33 ILE HG13 H   -0.624   8.001  -3.503 1.00 . A A .  33 ILE HG13 1 1 
       14  8886 1 1 33 ILE HG21 H    2.639   8.712  -0.901 1.00 . A A .  33 ILE HG21 1 1 
       14  8887 1 1 33 ILE HG22 H    2.046   9.920  -2.040 1.00 . A A .  33 ILE HG22 1 1 
       14  8888 1 1 33 ILE HG23 H    1.159   9.603  -0.549 1.00 . A A .  33 ILE HG23 1 1 
       14  8889 1 1 33 ILE N    N    1.133   6.139  -3.560 1.00 . A A .  33 ILE N    1 1 
       14  8890 1 1 33 ILE O    O    4.171   7.463  -2.487 1.00 . A A .  33 ILE O    1 1 
       14  8891 1 1 34 THR C    C    5.353   5.172  -1.596 1.00 . A A .  34 THR C    1 1 
       14  8892 1 1 34 THR CA   C    4.135   5.348  -0.697 1.00 . A A .  34 THR CA   1 1 
       14  8893 1 1 34 THR CB   C    3.813   4.003  -0.019 1.00 . A A .  34 THR CB   1 1 
       14  8894 1 1 34 THR CG2  C    2.629   4.143   0.926 1.00 . A A .  34 THR CG2  1 1 
       14  8895 1 1 34 THR H    H    2.119   5.421  -1.339 1.00 . A A .  34 THR H    1 1 
       14  8896 1 1 34 THR HA   H    4.368   6.069   0.072 1.00 . A A .  34 THR HA   1 1 
       14  8897 1 1 34 THR HB   H    4.675   3.689   0.552 1.00 . A A .  34 THR HB   1 1 
       14  8898 1 1 34 THR HG1  H    3.015   2.300  -0.613 1.00 . A A .  34 THR HG1  1 1 
       14  8899 1 1 34 THR HG21 H    1.730   3.816   0.427 1.00 . A A .  34 THR HG21 1 1 
       14  8900 1 1 34 THR HG22 H    2.522   5.177   1.218 1.00 . A A .  34 THR HG22 1 1 
       14  8901 1 1 34 THR HG23 H    2.796   3.536   1.804 1.00 . A A .  34 THR HG23 1 1 
       14  8902 1 1 34 THR N    N    2.993   5.849  -1.452 1.00 . A A .  34 THR N    1 1 
       14  8903 1 1 34 THR O    O    6.492   5.309  -1.149 1.00 . A A .  34 THR O    1 1 
       14  8904 1 1 34 THR OG1  O    3.523   3.011  -1.010 1.00 . A A .  34 THR OG1  1 1 
       14  8905 1 1 35 HIS C    C    6.782   6.013  -4.253 1.00 . A A .  35 HIS C    1 1 
       14  8906 1 1 35 HIS CA   C    6.186   4.674  -3.829 1.00 . A A .  35 HIS CA   1 1 
       14  8907 1 1 35 HIS CB   C    5.674   3.919  -5.056 1.00 . A A .  35 HIS CB   1 1 
       14  8908 1 1 35 HIS CD2  C    4.199   1.788  -5.158 1.00 . A A .  35 HIS CD2  1 1 
       14  8909 1 1 35 HIS CE1  C    5.439   0.480  -3.909 1.00 . A A .  35 HIS CE1  1 1 
       14  8910 1 1 35 HIS CG   C    5.279   2.503  -4.766 1.00 . A A .  35 HIS CG   1 1 
       14  8911 1 1 35 HIS H    H    4.179   4.771  -3.163 1.00 . A A .  35 HIS H    1 1 
       14  8912 1 1 35 HIS HA   H    6.955   4.087  -3.351 1.00 . A A .  35 HIS HA   1 1 
       14  8913 1 1 35 HIS HB2  H    4.807   4.430  -5.449 1.00 . A A .  35 HIS HB2  1 1 
       14  8914 1 1 35 HIS HB3  H    6.448   3.901  -5.809 1.00 . A A .  35 HIS HB3  1 1 
       14  8915 1 1 35 HIS HD1  H    6.884   1.883  -3.551 1.00 . A A .  35 HIS HD1  1 1 
       14  8916 1 1 35 HIS HD2  H    3.389   2.137  -5.784 1.00 . A A .  35 HIS HD2  1 1 
       14  8917 1 1 35 HIS HE1  H    5.801  -0.379  -3.365 1.00 . A A .  35 HIS HE1  1 1 
       14  8918 1 1 35 HIS N    N    5.107   4.867  -2.866 1.00 . A A .  35 HIS N    1 1 
       14  8919 1 1 35 HIS ND1  N    6.035   1.656  -3.985 1.00 . A A .  35 HIS ND1  1 1 
       14  8920 1 1 35 HIS NE2  N    4.321   0.534  -4.612 1.00 . A A .  35 HIS NE2  1 1 
       14  8921 1 1 35 HIS O    O    7.994   6.136  -4.434 1.00 . A A .  35 HIS O    1 1 
       14  8922 1 1 36 THR C    C    5.822   9.413  -3.875 1.00 . A A .  36 THR C    1 1 
       14  8923 1 1 36 THR CA   C    6.363   8.343  -4.817 1.00 . A A .  36 THR CA   1 1 
       14  8924 1 1 36 THR CB   C    5.918   8.669  -6.255 1.00 . A A .  36 THR CB   1 1 
       14  8925 1 1 36 THR CG2  C    6.509   7.675  -7.243 1.00 . A A .  36 THR CG2  1 1 
       14  8926 1 1 36 THR H    H    4.969   6.854  -4.253 1.00 . A A .  36 THR H    1 1 
       14  8927 1 1 36 THR HA   H    7.443   8.361  -4.784 1.00 . A A .  36 THR HA   1 1 
       14  8928 1 1 36 THR HB   H    6.270   9.659  -6.509 1.00 . A A .  36 THR HB   1 1 
       14  8929 1 1 36 THR HG1  H    4.151   9.543  -6.319 1.00 . A A .  36 THR HG1  1 1 
       14  8930 1 1 36 THR HG21 H    5.886   7.629  -8.123 1.00 . A A .  36 THR HG21 1 1 
       14  8931 1 1 36 THR HG22 H    6.557   6.697  -6.785 1.00 . A A .  36 THR HG22 1 1 
       14  8932 1 1 36 THR HG23 H    7.503   7.991  -7.521 1.00 . A A .  36 THR HG23 1 1 
       14  8933 1 1 36 THR N    N    5.922   7.015  -4.412 1.00 . A A .  36 THR N    1 1 
       14  8934 1 1 36 THR O    O    4.631   9.723  -3.891 1.00 . A A .  36 THR O    1 1 
       14  8935 1 1 36 THR OG1  O    4.489   8.645  -6.343 1.00 . A A .  36 THR OG1  1 1 
       14  8936 1 1 37 ARG C    C    7.075  12.305  -2.371 1.00 . A A .  37 ARG C    1 1 
       14  8937 1 1 37 ARG CA   C    6.315  11.009  -2.105 1.00 . A A .  37 ARG CA   1 1 
       14  8938 1 1 37 ARG CB   C    6.571  10.539  -0.672 1.00 . A A .  37 ARG CB   1 1 
       14  8939 1 1 37 ARG CD   C    6.583   8.548   0.862 1.00 . A A .  37 ARG CD   1 1 
       14  8940 1 1 37 ARG CG   C    5.928   9.202  -0.346 1.00 . A A .  37 ARG CG   1 1 
       14  8941 1 1 37 ARG CZ   C    4.914   9.051   2.595 1.00 . A A .  37 ARG CZ   1 1 
       14  8942 1 1 37 ARG H    H    7.641   9.685  -3.089 1.00 . A A .  37 ARG H    1 1 
       14  8943 1 1 37 ARG HA   H    5.258  11.194  -2.231 1.00 . A A .  37 ARG HA   1 1 
       14  8944 1 1 37 ARG HB2  H    7.637  10.448  -0.521 1.00 . A A .  37 ARG HB2  1 1 
       14  8945 1 1 37 ARG HB3  H    6.181  11.278   0.011 1.00 . A A .  37 ARG HB3  1 1 
       14  8946 1 1 37 ARG HD2  H    6.324   7.500   0.872 1.00 . A A .  37 ARG HD2  1 1 
       14  8947 1 1 37 ARG HD3  H    7.654   8.653   0.773 1.00 . A A .  37 ARG HD3  1 1 
       14  8948 1 1 37 ARG HE   H    6.810   9.670   2.625 1.00 . A A .  37 ARG HE   1 1 
       14  8949 1 1 37 ARG HG2  H    4.881   9.358  -0.132 1.00 . A A .  37 ARG HG2  1 1 
       14  8950 1 1 37 ARG HG3  H    6.030   8.546  -1.198 1.00 . A A .  37 ARG HG3  1 1 
       14  8951 1 1 37 ARG HH11 H    4.235   7.922   1.063 1.00 . A A .  37 ARG HH11 1 1 
       14  8952 1 1 37 ARG HH12 H    3.069   8.283   2.292 1.00 . A A .  37 ARG HH12 1 1 
       14  8953 1 1 37 ARG HH21 H    5.283  10.152   4.250 1.00 . A A .  37 ARG HH21 1 1 
       14  8954 1 1 37 ARG HH22 H    3.666   9.552   4.104 1.00 . A A .  37 ARG HH22 1 1 
       14  8955 1 1 37 ARG N    N    6.705   9.974  -3.055 1.00 . A A .  37 ARG N    1 1 
       14  8956 1 1 37 ARG NE   N    6.148   9.157   2.116 1.00 . A A .  37 ARG NE   1 1 
       14  8957 1 1 37 ARG NH1  N    3.997   8.363   1.929 1.00 . A A .  37 ARG NH1  1 1 
       14  8958 1 1 37 ARG NH2  N    4.595   9.633   3.744 1.00 . A A .  37 ARG NH2  1 1 
       14  8959 1 1 37 ARG O    O    7.432  13.028  -1.441 1.00 . A A .  37 ARG O    1 1 
       14  8960 1 1 38 GLU C    C    7.193  15.043  -3.775 1.00 . A A .  38 GLU C    1 1 
       14  8961 1 1 38 GLU CA   C    8.039  13.799  -4.033 1.00 . A A .  38 GLU CA   1 1 
       14  8962 1 1 38 GLU CB   C    8.433  13.734  -5.510 1.00 . A A .  38 GLU CB   1 1 
       14  8963 1 1 38 GLU CD   C   10.694  12.754  -4.955 1.00 . A A .  38 GLU CD   1 1 
       14  8964 1 1 38 GLU CG   C    9.453  12.652  -5.820 1.00 . A A .  38 GLU CG   1 1 
       14  8965 1 1 38 GLU H    H    7.009  11.976  -4.342 1.00 . A A .  38 GLU H    1 1 
       14  8966 1 1 38 GLU HA   H    8.935  13.858  -3.433 1.00 . A A .  38 GLU HA   1 1 
       14  8967 1 1 38 GLU HB2  H    7.547  13.545  -6.098 1.00 . A A .  38 GLU HB2  1 1 
       14  8968 1 1 38 GLU HB3  H    8.851  14.687  -5.800 1.00 . A A .  38 GLU HB3  1 1 
       14  8969 1 1 38 GLU HG2  H    8.997  11.687  -5.655 1.00 . A A .  38 GLU HG2  1 1 
       14  8970 1 1 38 GLU HG3  H    9.747  12.738  -6.856 1.00 . A A .  38 GLU HG3  1 1 
       14  8971 1 1 38 GLU N    N    7.320  12.591  -3.646 1.00 . A A .  38 GLU N    1 1 
       14  8972 1 1 38 GLU O    O    6.058  15.144  -4.243 1.00 . A A .  38 GLU O    1 1 
       14  8973 1 1 38 GLU OE1  O   11.064  13.886  -4.578 1.00 . A A .  38 GLU OE1  1 1 
       14  8974 1 1 38 GLU OE2  O   11.296  11.702  -4.655 1.00 . A A .  38 GLU OE2  1 1 
       14  8975 1 1 39 LYS C    C    7.989  18.424  -2.809 1.00 . A A .  39 LYS C    1 1 
       14  8976 1 1 39 LYS CA   C    7.051  17.225  -2.706 1.00 . A A .  39 LYS CA   1 1 
       14  8977 1 1 39 LYS CB   C    6.456  17.149  -1.299 1.00 . A A .  39 LYS CB   1 1 
       14  8978 1 1 39 LYS CD   C    4.946  15.870   0.249 1.00 . A A .  39 LYS CD   1 1 
       14  8979 1 1 39 LYS CE   C    4.143  14.582   0.347 1.00 . A A .  39 LYS CE   1 1 
       14  8980 1 1 39 LYS CG   C    5.254  16.226  -1.196 1.00 . A A .  39 LYS CG   1 1 
       14  8981 1 1 39 LYS H    H    8.660  15.849  -2.682 1.00 . A A .  39 LYS H    1 1 
       14  8982 1 1 39 LYS HA   H    6.251  17.348  -3.420 1.00 . A A .  39 LYS HA   1 1 
       14  8983 1 1 39 LYS HB2  H    7.216  16.793  -0.618 1.00 . A A .  39 LYS HB2  1 1 
       14  8984 1 1 39 LYS HB3  H    6.150  18.140  -0.996 1.00 . A A .  39 LYS HB3  1 1 
       14  8985 1 1 39 LYS HD2  H    5.875  15.743   0.785 1.00 . A A .  39 LYS HD2  1 1 
       14  8986 1 1 39 LYS HD3  H    4.378  16.674   0.696 1.00 . A A .  39 LYS HD3  1 1 
       14  8987 1 1 39 LYS HE2  H    4.463  13.913  -0.437 1.00 . A A .  39 LYS HE2  1 1 
       14  8988 1 1 39 LYS HE3  H    4.333  14.127   1.308 1.00 . A A .  39 LYS HE3  1 1 
       14  8989 1 1 39 LYS HG2  H    4.395  16.720  -1.624 1.00 . A A .  39 LYS HG2  1 1 
       14  8990 1 1 39 LYS HG3  H    5.461  15.318  -1.744 1.00 . A A .  39 LYS HG3  1 1 
       14  8991 1 1 39 LYS HZ1  H    2.513  15.789  -0.156 1.00 . A A .  39 LYS HZ1  1 1 
       14  8992 1 1 39 LYS HZ2  H    2.213  14.732   1.131 1.00 . A A .  39 LYS HZ2  1 1 
       14  8993 1 1 39 LYS HZ3  H    2.264  14.142  -0.453 1.00 . A A .  39 LYS HZ3  1 1 
       14  8994 1 1 39 LYS N    N    7.752  15.987  -3.027 1.00 . A A .  39 LYS N    1 1 
       14  8995 1 1 39 LYS NZ   N    2.681  14.829   0.207 1.00 . A A .  39 LYS NZ   1 1 
       14  8996 1 1 39 LYS O    O    9.172  18.347  -2.476 1.00 . A A .  39 LYS O    1 1 
       14  8997 1 1 40 PRO C    C    8.600  21.415  -2.093 1.00 . A A .  40 PRO C    1 1 
       14  8998 1 1 40 PRO CA   C    8.222  20.796  -3.434 1.00 . A A .  40 PRO CA   1 1 
       14  8999 1 1 40 PRO CB   C    7.267  21.716  -4.198 1.00 . A A .  40 PRO CB   1 1 
       14  9000 1 1 40 PRO CD   C    6.048  19.722  -3.696 1.00 . A A .  40 PRO CD   1 1 
       14  9001 1 1 40 PRO CG   C    5.906  21.210  -3.866 1.00 . A A .  40 PRO CG   1 1 
       14  9002 1 1 40 PRO HA   H    9.116  20.635  -4.020 1.00 . A A .  40 PRO HA   1 1 
       14  9003 1 1 40 PRO HB2  H    7.403  22.736  -3.865 1.00 . A A .  40 PRO HB2  1 1 
       14  9004 1 1 40 PRO HB3  H    7.466  21.648  -5.257 1.00 . A A .  40 PRO HB3  1 1 
       14  9005 1 1 40 PRO HD2  H    5.375  19.364  -2.931 1.00 . A A .  40 PRO HD2  1 1 
       14  9006 1 1 40 PRO HD3  H    5.863  19.216  -4.631 1.00 . A A .  40 PRO HD3  1 1 
       14  9007 1 1 40 PRO HG2  H    5.560  21.661  -2.948 1.00 . A A .  40 PRO HG2  1 1 
       14  9008 1 1 40 PRO HG3  H    5.225  21.431  -4.674 1.00 . A A .  40 PRO HG3  1 1 
       14  9009 1 1 40 PRO N    N    7.451  19.559  -3.279 1.00 . A A .  40 PRO N    1 1 
       14  9010 1 1 40 PRO O    O    9.725  21.880  -1.908 1.00 . A A .  40 PRO O    1 1 
       14  9011 1 1 41 SER C    C    8.698  21.025   1.029 1.00 . A A .  41 SER C    1 1 
       14  9012 1 1 41 SER CA   C    7.886  21.984   0.164 1.00 . A A .  41 SER CA   1 1 
       14  9013 1 1 41 SER CB   C    6.555  22.303   0.847 1.00 . A A .  41 SER CB   1 1 
       14  9014 1 1 41 SER H    H    6.776  21.033  -1.368 1.00 . A A .  41 SER H    1 1 
       14  9015 1 1 41 SER HA   H    8.445  22.899   0.039 1.00 . A A .  41 SER HA   1 1 
       14  9016 1 1 41 SER HB2  H    5.988  22.980   0.226 1.00 . A A .  41 SER HB2  1 1 
       14  9017 1 1 41 SER HB3  H    5.996  21.388   0.986 1.00 . A A .  41 SER HB3  1 1 
       14  9018 1 1 41 SER HG   H    6.544  22.283   2.805 1.00 . A A .  41 SER HG   1 1 
       14  9019 1 1 41 SER N    N    7.653  21.418  -1.160 1.00 . A A .  41 SER N    1 1 
       14  9020 1 1 41 SER O    O    8.415  19.829   1.083 1.00 . A A .  41 SER O    1 1 
       14  9021 1 1 41 SER OG   O    6.762  22.908   2.111 1.00 . A A .  41 SER OG   1 1 
       14  9022 1 1 42 GLY C    C   11.234  19.623   1.799 1.00 . A A .  42 GLY C    1 1 
       14  9023 1 1 42 GLY CA   C   10.547  20.739   2.560 1.00 . A A .  42 GLY CA   1 1 
       14  9024 1 1 42 GLY H    H    9.888  22.520   1.625 1.00 . A A .  42 GLY H    1 1 
       14  9025 1 1 42 GLY HA2  H   11.299  21.365   3.017 1.00 . A A .  42 GLY HA2  1 1 
       14  9026 1 1 42 GLY HA3  H    9.934  20.305   3.336 1.00 . A A .  42 GLY HA3  1 1 
       14  9027 1 1 42 GLY N    N    9.709  21.560   1.706 1.00 . A A .  42 GLY N    1 1 
       14  9028 1 1 42 GLY O    O   10.690  19.068   0.844 1.00 . A A .  42 GLY O    1 1 
       14  9029 1 1 43 PRO C    C   12.666  16.833   1.837 1.00 . A A .  43 PRO C    1 1 
       14  9030 1 1 43 PRO CA   C   13.248  18.220   1.586 1.00 . A A .  43 PRO CA   1 1 
       14  9031 1 1 43 PRO CB   C   14.621  18.352   2.250 1.00 . A A .  43 PRO CB   1 1 
       14  9032 1 1 43 PRO CD   C   13.169  19.898   3.354 1.00 . A A .  43 PRO CD   1 1 
       14  9033 1 1 43 PRO CG   C   14.343  18.983   3.571 1.00 . A A .  43 PRO CG   1 1 
       14  9034 1 1 43 PRO HA   H   13.344  18.381   0.522 1.00 . A A .  43 PRO HA   1 1 
       14  9035 1 1 43 PRO HB2  H   15.063  17.372   2.365 1.00 . A A .  43 PRO HB2  1 1 
       14  9036 1 1 43 PRO HB3  H   15.261  18.973   1.643 1.00 . A A .  43 PRO HB3  1 1 
       14  9037 1 1 43 PRO HD2  H   12.543  19.924   4.233 1.00 . A A .  43 PRO HD2  1 1 
       14  9038 1 1 43 PRO HD3  H   13.507  20.891   3.099 1.00 . A A .  43 PRO HD3  1 1 
       14  9039 1 1 43 PRO HG2  H   14.097  18.223   4.297 1.00 . A A .  43 PRO HG2  1 1 
       14  9040 1 1 43 PRO HG3  H   15.204  19.549   3.895 1.00 . A A .  43 PRO HG3  1 1 
       14  9041 1 1 43 PRO N    N   12.459  19.279   2.222 1.00 . A A .  43 PRO N    1 1 
       14  9042 1 1 43 PRO O    O   11.966  16.613   2.825 1.00 . A A .  43 PRO O    1 1 
       14  9043 1 1 44 SER C    C   13.617  13.543   1.157 1.00 . A A .  44 SER C    1 1 
       14  9044 1 1 44 SER CA   C   12.462  14.535   1.059 1.00 . A A .  44 SER CA   1 1 
       14  9045 1 1 44 SER CB   C   11.573  14.185  -0.135 1.00 . A A .  44 SER CB   1 1 
       14  9046 1 1 44 SER H    H   13.523  16.137   0.170 1.00 . A A .  44 SER H    1 1 
       14  9047 1 1 44 SER HA   H   11.875  14.477   1.964 1.00 . A A .  44 SER HA   1 1 
       14  9048 1 1 44 SER HB2  H   11.302  13.141  -0.085 1.00 . A A .  44 SER HB2  1 1 
       14  9049 1 1 44 SER HB3  H   10.678  14.791  -0.105 1.00 . A A .  44 SER HB3  1 1 
       14  9050 1 1 44 SER HG   H   13.102  13.993  -1.344 1.00 . A A .  44 SER HG   1 1 
       14  9051 1 1 44 SER N    N   12.960  15.900   0.936 1.00 . A A .  44 SER N    1 1 
       14  9052 1 1 44 SER O    O   14.013  12.936   0.162 1.00 . A A .  44 SER O    1 1 
       14  9053 1 1 44 SER OG   O   12.245  14.424  -1.359 1.00 . A A .  44 SER OG   1 1 
       14  9054 1 1 45 SER C    C   14.895  11.415   3.632 1.00 . A A .  45 SER C    1 1 
       14  9055 1 1 45 SER CA   C   15.264  12.468   2.591 1.00 . A A .  45 SER CA   1 1 
       14  9056 1 1 45 SER CB   C   16.503  13.241   3.047 1.00 . A A .  45 SER CB   1 1 
       14  9057 1 1 45 SER H    H   13.791  13.896   3.117 1.00 . A A .  45 SER H    1 1 
       14  9058 1 1 45 SER HA   H   15.482  11.973   1.657 1.00 . A A .  45 SER HA   1 1 
       14  9059 1 1 45 SER HB2  H   17.368  12.598   2.985 1.00 . A A .  45 SER HB2  1 1 
       14  9060 1 1 45 SER HB3  H   16.645  14.099   2.406 1.00 . A A .  45 SER HB3  1 1 
       14  9061 1 1 45 SER HG   H   16.474  14.641   4.417 1.00 . A A .  45 SER HG   1 1 
       14  9062 1 1 45 SER N    N   14.152  13.384   2.363 1.00 . A A .  45 SER N    1 1 
       14  9063 1 1 45 SER O    O   15.112  10.222   3.427 1.00 . A A .  45 SER O    1 1 
       14  9064 1 1 45 SER OG   O   16.361  13.689   4.384 1.00 . A A .  45 SER OG   1 1 
       14  9065 1 1 46 GLY C    C   12.810  10.040   5.394 1.00 . A A .  46 GLY C    1 1 
       14  9066 1 1 46 GLY CA   C   13.947  10.953   5.808 1.00 . A A .  46 GLY CA   1 1 
       14  9067 1 1 46 GLY H    H   14.188  12.830   4.859 1.00 . A A .  46 GLY H    1 1 
       14  9068 1 1 46 GLY HA2  H   14.800  10.349   6.078 1.00 . A A .  46 GLY HA2  1 1 
       14  9069 1 1 46 GLY HA3  H   13.637  11.527   6.669 1.00 . A A .  46 GLY HA3  1 1 
       14  9070 1 1 46 GLY N    N   14.337  11.868   4.750 1.00 . A A .  46 GLY N    1 1 
       14  9071 1 1 46 GLY O    O   11.799   9.988   6.093 1.00 . A A .  46 GLY O    1 1 
       14  9072 2 2  1 ZN  ZN   ZN   2.706  -0.783  -4.505 1.00 . B A . 181 ZN  ZN   1 1 
       15  9073 1 1  1 GLY C    C   -8.406 -30.164  -5.555 1.00 . A A .   1 GLY C    1 1 
       15  9074 1 1  1 GLY CA   C   -7.323 -31.117  -6.021 1.00 . A A .   1 GLY CA   1 1 
       15  9075 1 1  1 GLY H1   H   -5.376 -30.746  -6.766 1.00 . A A .   1 GLY H1   1 1 
       15  9076 1 1  1 GLY HA2  H   -7.777 -31.901  -6.608 1.00 . A A .   1 GLY HA2  1 1 
       15  9077 1 1  1 GLY HA3  H   -6.850 -31.556  -5.156 1.00 . A A .   1 GLY HA3  1 1 
       15  9078 1 1  1 GLY N    N   -6.311 -30.456  -6.824 1.00 . A A .   1 GLY N    1 1 
       15  9079 1 1  1 GLY O    O   -8.255 -29.493  -4.534 1.00 . A A .   1 GLY O    1 1 
       15  9080 1 1  2 SER C    C  -10.104 -27.922  -5.344 1.00 . A A .   2 SER C    1 1 
       15  9081 1 1  2 SER CA   C  -10.611 -29.219  -5.967 1.00 . A A .   2 SER CA   1 1 
       15  9082 1 1  2 SER CB   C  -11.571 -29.919  -5.003 1.00 . A A .   2 SER CB   1 1 
       15  9083 1 1  2 SER H    H   -9.562 -30.661  -7.109 1.00 . A A .   2 SER H    1 1 
       15  9084 1 1  2 SER HA   H  -11.139 -28.984  -6.879 1.00 . A A .   2 SER HA   1 1 
       15  9085 1 1  2 SER HB2  H  -12.413 -29.273  -4.804 1.00 . A A .   2 SER HB2  1 1 
       15  9086 1 1  2 SER HB3  H  -11.920 -30.838  -5.452 1.00 . A A .   2 SER HB3  1 1 
       15  9087 1 1  2 SER HG   H  -10.903 -31.177  -3.658 1.00 . A A .   2 SER HG   1 1 
       15  9088 1 1  2 SER N    N   -9.501 -30.101  -6.306 1.00 . A A .   2 SER N    1 1 
       15  9089 1 1  2 SER O    O  -10.661 -27.432  -4.362 1.00 . A A .   2 SER O    1 1 
       15  9090 1 1  2 SER OG   O  -10.930 -30.225  -3.777 1.00 . A A .   2 SER OG   1 1 
       15  9091 1 1  3 SER C    C   -8.455 -25.057  -6.505 1.00 . A A .   3 SER C    1 1 
       15  9092 1 1  3 SER CA   C   -8.455 -26.133  -5.423 1.00 . A A .   3 SER CA   1 1 
       15  9093 1 1  3 SER CB   C   -7.026 -26.381  -4.935 1.00 . A A .   3 SER CB   1 1 
       15  9094 1 1  3 SER H    H   -8.641 -27.809  -6.703 1.00 . A A .   3 SER H    1 1 
       15  9095 1 1  3 SER HA   H   -9.056 -25.793  -4.593 1.00 . A A .   3 SER HA   1 1 
       15  9096 1 1  3 SER HB2  H   -7.001 -27.286  -4.348 1.00 . A A .   3 SER HB2  1 1 
       15  9097 1 1  3 SER HB3  H   -6.371 -26.487  -5.788 1.00 . A A .   3 SER HB3  1 1 
       15  9098 1 1  3 SER HG   H   -7.204 -25.129  -3.439 1.00 . A A .   3 SER HG   1 1 
       15  9099 1 1  3 SER N    N   -9.041 -27.371  -5.923 1.00 . A A .   3 SER N    1 1 
       15  9100 1 1  3 SER O    O   -7.490 -24.914  -7.254 1.00 . A A .   3 SER O    1 1 
       15  9101 1 1  3 SER OG   O   -6.566 -25.305  -4.135 1.00 . A A .   3 SER OG   1 1 
       15  9102 1 1  4 GLY C    C  -10.808 -22.305  -7.294 1.00 . A A .   4 GLY C    1 1 
       15  9103 1 1  4 GLY CA   C   -9.653 -23.247  -7.571 1.00 . A A .   4 GLY CA   1 1 
       15  9104 1 1  4 GLY H    H  -10.285 -24.460  -5.954 1.00 . A A .   4 GLY H    1 1 
       15  9105 1 1  4 GLY HA2  H   -8.734 -22.681  -7.579 1.00 . A A .   4 GLY HA2  1 1 
       15  9106 1 1  4 GLY HA3  H   -9.796 -23.697  -8.543 1.00 . A A .   4 GLY HA3  1 1 
       15  9107 1 1  4 GLY N    N   -9.546 -24.301  -6.579 1.00 . A A .   4 GLY N    1 1 
       15  9108 1 1  4 GLY O    O  -11.868 -22.413  -7.911 1.00 . A A .   4 GLY O    1 1 
       15  9109 1 1  5 SER C    C  -12.298 -19.834  -7.247 1.00 . A A .   5 SER C    1 1 
       15  9110 1 1  5 SER CA   C  -11.639 -20.418  -6.001 1.00 . A A .   5 SER CA   1 1 
       15  9111 1 1  5 SER CB   C  -11.045 -19.293  -5.151 1.00 . A A .   5 SER CB   1 1 
       15  9112 1 1  5 SER H    H   -9.738 -21.344  -5.906 1.00 . A A .   5 SER H    1 1 
       15  9113 1 1  5 SER HA   H  -12.388 -20.938  -5.422 1.00 . A A .   5 SER HA   1 1 
       15  9114 1 1  5 SER HB2  H  -10.051 -19.065  -5.503 1.00 . A A .   5 SER HB2  1 1 
       15  9115 1 1  5 SER HB3  H  -11.668 -18.414  -5.236 1.00 . A A .   5 SER HB3  1 1 
       15  9116 1 1  5 SER HG   H  -10.889 -18.884  -3.241 1.00 . A A .   5 SER HG   1 1 
       15  9117 1 1  5 SER N    N  -10.604 -21.379  -6.362 1.00 . A A .   5 SER N    1 1 
       15  9118 1 1  5 SER O    O  -11.788 -19.979  -8.358 1.00 . A A .   5 SER O    1 1 
       15  9119 1 1  5 SER OG   O  -10.972 -19.669  -3.786 1.00 . A A .   5 SER OG   1 1 
       15  9120 1 1  6 SER C    C  -13.846 -17.086  -8.281 1.00 . A A .   6 SER C    1 1 
       15  9121 1 1  6 SER CA   C  -14.168 -18.572  -8.162 1.00 . A A .   6 SER CA   1 1 
       15  9122 1 1  6 SER CB   C  -15.673 -18.767  -7.971 1.00 . A A .   6 SER CB   1 1 
       15  9123 1 1  6 SER H    H  -13.792 -19.094  -6.144 1.00 . A A .   6 SER H    1 1 
       15  9124 1 1  6 SER HA   H  -13.862 -19.069  -9.071 1.00 . A A .   6 SER HA   1 1 
       15  9125 1 1  6 SER HB2  H  -16.179 -18.579  -8.906 1.00 . A A .   6 SER HB2  1 1 
       15  9126 1 1  6 SER HB3  H  -15.865 -19.782  -7.655 1.00 . A A .   6 SER HB3  1 1 
       15  9127 1 1  6 SER HG   H  -15.483 -17.646  -6.376 1.00 . A A .   6 SER HG   1 1 
       15  9128 1 1  6 SER N    N  -13.436 -19.175  -7.054 1.00 . A A .   6 SER N    1 1 
       15  9129 1 1  6 SER O    O  -13.967 -16.334  -7.315 1.00 . A A .   6 SER O    1 1 
       15  9130 1 1  6 SER OG   O  -16.182 -17.878  -6.991 1.00 . A A .   6 SER OG   1 1 
       15  9131 1 1  7 GLY C    C  -12.272 -14.688  -8.576 1.00 . A A .   7 GLY C    1 1 
       15  9132 1 1  7 GLY CA   C  -13.103 -15.275  -9.700 1.00 . A A .   7 GLY CA   1 1 
       15  9133 1 1  7 GLY H    H  -13.359 -17.314 -10.209 1.00 . A A .   7 GLY H    1 1 
       15  9134 1 1  7 GLY HA2  H  -12.549 -15.193 -10.624 1.00 . A A .   7 GLY HA2  1 1 
       15  9135 1 1  7 GLY HA3  H  -14.018 -14.708  -9.789 1.00 . A A .   7 GLY HA3  1 1 
       15  9136 1 1  7 GLY N    N  -13.436 -16.669  -9.475 1.00 . A A .   7 GLY N    1 1 
       15  9137 1 1  7 GLY O    O  -12.796 -13.993  -7.707 1.00 . A A .   7 GLY O    1 1 
       15  9138 1 1  8 GLU C    C   -8.614 -14.726  -7.946 1.00 . A A .   8 GLU C    1 1 
       15  9139 1 1  8 GLU CA   C  -10.069 -14.467  -7.565 1.00 . A A .   8 GLU CA   1 1 
       15  9140 1 1  8 GLU CB   C  -10.380 -15.122  -6.217 1.00 . A A .   8 GLU CB   1 1 
       15  9141 1 1  8 GLU CD   C   -9.814 -15.200  -3.757 1.00 . A A .   8 GLU CD   1 1 
       15  9142 1 1  8 GLU CG   C   -9.335 -14.842  -5.150 1.00 . A A .   8 GLU CG   1 1 
       15  9143 1 1  8 GLU H    H  -10.614 -15.530  -9.313 1.00 . A A .   8 GLU H    1 1 
       15  9144 1 1  8 GLU HA   H  -10.223 -13.402  -7.481 1.00 . A A .   8 GLU HA   1 1 
       15  9145 1 1  8 GLU HB2  H  -11.332 -14.756  -5.864 1.00 . A A .   8 GLU HB2  1 1 
       15  9146 1 1  8 GLU HB3  H  -10.444 -16.191  -6.357 1.00 . A A .   8 GLU HB3  1 1 
       15  9147 1 1  8 GLU HG2  H   -8.451 -15.422  -5.370 1.00 . A A .   8 GLU HG2  1 1 
       15  9148 1 1  8 GLU HG3  H   -9.089 -13.791  -5.172 1.00 . A A .   8 GLU HG3  1 1 
       15  9149 1 1  8 GLU N    N  -10.973 -14.970  -8.593 1.00 . A A .   8 GLU N    1 1 
       15  9150 1 1  8 GLU O    O   -8.228 -15.859  -8.229 1.00 . A A .   8 GLU O    1 1 
       15  9151 1 1  8 GLU OE1  O  -10.537 -14.381  -3.151 1.00 . A A .   8 GLU OE1  1 1 
       15  9152 1 1  8 GLU OE2  O   -9.467 -16.297  -3.272 1.00 . A A .   8 GLU OE2  1 1 
       15  9153 1 1  9 GLY C    C   -5.919 -12.661  -9.172 1.00 . A A .   9 GLY C    1 1 
       15  9154 1 1  9 GLY CA   C   -6.410 -13.798  -8.299 1.00 . A A .   9 GLY CA   1 1 
       15  9155 1 1  9 GLY H    H   -8.176 -12.786  -7.717 1.00 . A A .   9 GLY H    1 1 
       15  9156 1 1  9 GLY HA2  H   -5.825 -13.819  -7.391 1.00 . A A .   9 GLY HA2  1 1 
       15  9157 1 1  9 GLY HA3  H   -6.268 -14.729  -8.827 1.00 . A A .   9 GLY HA3  1 1 
       15  9158 1 1  9 GLY N    N   -7.812 -13.666  -7.951 1.00 . A A .   9 GLY N    1 1 
       15  9159 1 1  9 GLY O    O   -4.949 -11.984  -8.833 1.00 . A A .   9 GLY O    1 1 
       15  9160 1 1 10 GLU C    C   -7.218 -10.242 -11.175 1.00 . A A .  10 GLU C    1 1 
       15  9161 1 1 10 GLU CA   C   -6.214 -11.389 -11.227 1.00 . A A .  10 GLU CA   1 1 
       15  9162 1 1 10 GLU CB   C   -6.119 -11.935 -12.653 1.00 . A A .  10 GLU CB   1 1 
       15  9163 1 1 10 GLU CD   C   -4.541 -12.620 -14.503 1.00 . A A .  10 GLU CD   1 1 
       15  9164 1 1 10 GLU CG   C   -4.745 -12.479 -13.007 1.00 . A A .  10 GLU CG   1 1 
       15  9165 1 1 10 GLU H    H   -7.355 -13.025 -10.516 1.00 . A A .  10 GLU H    1 1 
       15  9166 1 1 10 GLU HA   H   -5.245 -11.017 -10.929 1.00 . A A .  10 GLU HA   1 1 
       15  9167 1 1 10 GLU HB2  H   -6.840 -12.731 -12.769 1.00 . A A .  10 GLU HB2  1 1 
       15  9168 1 1 10 GLU HB3  H   -6.358 -11.142 -13.345 1.00 . A A .  10 GLU HB3  1 1 
       15  9169 1 1 10 GLU HG2  H   -3.995 -11.806 -12.619 1.00 . A A .  10 GLU HG2  1 1 
       15  9170 1 1 10 GLU HG3  H   -4.627 -13.450 -12.549 1.00 . A A .  10 GLU HG3  1 1 
       15  9171 1 1 10 GLU N    N   -6.590 -12.451 -10.301 1.00 . A A .  10 GLU N    1 1 
       15  9172 1 1 10 GLU O    O   -8.338 -10.358 -11.674 1.00 . A A .  10 GLU O    1 1 
       15  9173 1 1 10 GLU OE1  O   -4.454 -11.581 -15.190 1.00 . A A .  10 GLU OE1  1 1 
       15  9174 1 1 10 GLU OE2  O   -4.469 -13.769 -14.986 1.00 . A A .  10 GLU OE2  1 1 
       15  9175 1 1 11 LYS C    C   -7.099  -6.785 -11.231 1.00 . A A .  11 LYS C    1 1 
       15  9176 1 1 11 LYS CA   C   -7.672  -7.963 -10.450 1.00 . A A .  11 LYS CA   1 1 
       15  9177 1 1 11 LYS CB   C   -7.846  -7.577  -8.979 1.00 . A A .  11 LYS CB   1 1 
       15  9178 1 1 11 LYS CD   C   -8.447  -8.306  -6.652 1.00 . A A .  11 LYS CD   1 1 
       15  9179 1 1 11 LYS CE   C   -9.759  -7.629  -6.284 1.00 . A A .  11 LYS CE   1 1 
       15  9180 1 1 11 LYS CG   C   -8.414  -8.694  -8.120 1.00 . A A .  11 LYS CG   1 1 
       15  9181 1 1 11 LYS H    H   -5.906  -9.101 -10.189 1.00 . A A .  11 LYS H    1 1 
       15  9182 1 1 11 LYS HA   H   -8.636  -8.218 -10.862 1.00 . A A .  11 LYS HA   1 1 
       15  9183 1 1 11 LYS HB2  H   -6.883  -7.296  -8.577 1.00 . A A .  11 LYS HB2  1 1 
       15  9184 1 1 11 LYS HB3  H   -8.513  -6.730  -8.918 1.00 . A A .  11 LYS HB3  1 1 
       15  9185 1 1 11 LYS HD2  H   -8.334  -9.196  -6.050 1.00 . A A .  11 LYS HD2  1 1 
       15  9186 1 1 11 LYS HD3  H   -7.632  -7.626  -6.449 1.00 . A A .  11 LYS HD3  1 1 
       15  9187 1 1 11 LYS HE2  H  -10.566  -8.329  -6.438 1.00 . A A .  11 LYS HE2  1 1 
       15  9188 1 1 11 LYS HE3  H   -9.722  -7.346  -5.242 1.00 . A A .  11 LYS HE3  1 1 
       15  9189 1 1 11 LYS HG2  H   -9.420  -8.911  -8.447 1.00 . A A .  11 LYS HG2  1 1 
       15  9190 1 1 11 LYS HG3  H   -7.798  -9.574  -8.237 1.00 . A A .  11 LYS HG3  1 1 
       15  9191 1 1 11 LYS HZ1  H   -9.131  -5.858  -7.198 1.00 . A A .  11 LYS HZ1  1 1 
       15  9192 1 1 11 LYS HZ2  H  -10.736  -5.822  -6.663 1.00 . A A .  11 LYS HZ2  1 1 
       15  9193 1 1 11 LYS HZ3  H  -10.329  -6.687  -8.058 1.00 . A A .  11 LYS HZ3  1 1 
       15  9194 1 1 11 LYS N    N   -6.810  -9.133 -10.567 1.00 . A A .  11 LYS N    1 1 
       15  9195 1 1 11 LYS NZ   N  -10.006  -6.414  -7.108 1.00 . A A .  11 LYS NZ   1 1 
       15  9196 1 1 11 LYS O    O   -5.885  -6.607 -11.332 1.00 . A A .  11 LYS O    1 1 
       15  9197 1 1 12 PRO C    C   -6.989  -3.687 -11.707 1.00 . A A .  12 PRO C    1 1 
       15  9198 1 1 12 PRO CA   C   -7.598  -4.781 -12.576 1.00 . A A .  12 PRO CA   1 1 
       15  9199 1 1 12 PRO CB   C   -8.916  -4.305 -13.190 1.00 . A A .  12 PRO CB   1 1 
       15  9200 1 1 12 PRO CD   C   -9.454  -6.109 -11.717 1.00 . A A .  12 PRO CD   1 1 
       15  9201 1 1 12 PRO CG   C   -9.969  -4.805 -12.262 1.00 . A A .  12 PRO CG   1 1 
       15  9202 1 1 12 PRO HA   H   -6.905  -5.041 -13.364 1.00 . A A .  12 PRO HA   1 1 
       15  9203 1 1 12 PRO HB2  H   -8.920  -3.225 -13.248 1.00 . A A .  12 PRO HB2  1 1 
       15  9204 1 1 12 PRO HB3  H   -9.030  -4.724 -14.179 1.00 . A A .  12 PRO HB3  1 1 
       15  9205 1 1 12 PRO HD2  H   -9.774  -6.242 -10.694 1.00 . A A .  12 PRO HD2  1 1 
       15  9206 1 1 12 PRO HD3  H   -9.790  -6.933 -12.330 1.00 . A A .  12 PRO HD3  1 1 
       15  9207 1 1 12 PRO HG2  H  -10.120  -4.097 -11.462 1.00 . A A .  12 PRO HG2  1 1 
       15  9208 1 1 12 PRO HG3  H  -10.890  -4.963 -12.804 1.00 . A A .  12 PRO HG3  1 1 
       15  9209 1 1 12 PRO N    N   -7.992  -5.958 -11.796 1.00 . A A .  12 PRO N    1 1 
       15  9210 1 1 12 PRO O    O   -6.287  -2.805 -12.203 1.00 . A A .  12 PRO O    1 1 
       15  9211 1 1 13 TYR C    C   -5.500  -3.290  -8.755 1.00 . A A .  13 TYR C    1 1 
       15  9212 1 1 13 TYR CA   C   -6.740  -2.763  -9.470 1.00 . A A .  13 TYR CA   1 1 
       15  9213 1 1 13 TYR CB   C   -7.812  -2.388  -8.445 1.00 . A A .  13 TYR CB   1 1 
       15  9214 1 1 13 TYR CD1  C   -8.876  -0.594  -9.868 1.00 . A A .  13 TYR CD1  1 1 
       15  9215 1 1 13 TYR CD2  C  -10.302  -2.183  -8.809 1.00 . A A .  13 TYR CD2  1 1 
       15  9216 1 1 13 TYR CE1  C   -9.976   0.031 -10.423 1.00 . A A .  13 TYR CE1  1 1 
       15  9217 1 1 13 TYR CE2  C  -11.408  -1.566  -9.361 1.00 . A A .  13 TYR CE2  1 1 
       15  9218 1 1 13 TYR CG   C   -9.019  -1.709  -9.051 1.00 . A A .  13 TYR CG   1 1 
       15  9219 1 1 13 TYR CZ   C  -11.240  -0.459 -10.167 1.00 . A A .  13 TYR CZ   1 1 
       15  9220 1 1 13 TYR H    H   -7.825  -4.477 -10.072 1.00 . A A .  13 TYR H    1 1 
       15  9221 1 1 13 TYR HA   H   -6.470  -1.881 -10.032 1.00 . A A .  13 TYR HA   1 1 
       15  9222 1 1 13 TYR HB2  H   -8.152  -3.283  -7.946 1.00 . A A .  13 TYR HB2  1 1 
       15  9223 1 1 13 TYR HB3  H   -7.384  -1.716  -7.716 1.00 . A A .  13 TYR HB3  1 1 
       15  9224 1 1 13 TYR HD1  H   -7.884  -0.213 -10.066 1.00 . A A .  13 TYR HD1  1 1 
       15  9225 1 1 13 TYR HD2  H  -10.431  -3.050  -8.177 1.00 . A A .  13 TYR HD2  1 1 
       15  9226 1 1 13 TYR HE1  H   -9.844   0.897 -11.055 1.00 . A A .  13 TYR HE1  1 1 
       15  9227 1 1 13 TYR HE2  H  -12.398  -1.948  -9.161 1.00 . A A .  13 TYR HE2  1 1 
       15  9228 1 1 13 TYR HH   H  -12.655   0.841 -10.123 1.00 . A A .  13 TYR HH   1 1 
       15  9229 1 1 13 TYR N    N   -7.260  -3.750 -10.408 1.00 . A A .  13 TYR N    1 1 
       15  9230 1 1 13 TYR O    O   -5.413  -3.249  -7.529 1.00 . A A .  13 TYR O    1 1 
       15  9231 1 1 13 TYR OH   O  -12.338   0.159 -10.720 1.00 . A A .  13 TYR OH   1 1 
       15  9232 1 1 14 GLN C    C   -2.131  -3.396  -9.269 1.00 . A A .  14 GLN C    1 1 
       15  9233 1 1 14 GLN CA   C   -3.307  -4.322  -8.976 1.00 . A A .  14 GLN CA   1 1 
       15  9234 1 1 14 GLN CB   C   -3.028  -5.715  -9.544 1.00 . A A .  14 GLN CB   1 1 
       15  9235 1 1 14 GLN CD   C   -1.349  -7.590  -9.763 1.00 . A A .  14 GLN CD   1 1 
       15  9236 1 1 14 GLN CG   C   -1.771  -6.360  -8.983 1.00 . A A .  14 GLN CG   1 1 
       15  9237 1 1 14 GLN H    H   -4.671  -3.791 -10.504 1.00 . A A .  14 GLN H    1 1 
       15  9238 1 1 14 GLN HA   H   -3.431  -4.397  -7.906 1.00 . A A .  14 GLN HA   1 1 
       15  9239 1 1 14 GLN HB2  H   -3.867  -6.356  -9.320 1.00 . A A .  14 GLN HB2  1 1 
       15  9240 1 1 14 GLN HB3  H   -2.920  -5.638 -10.616 1.00 . A A .  14 GLN HB3  1 1 
       15  9241 1 1 14 GLN HE21 H   -0.012  -8.048  -8.364 1.00 . A A .  14 GLN HE21 1 1 
       15  9242 1 1 14 GLN HE22 H   -0.096  -9.132  -9.706 1.00 . A A .  14 GLN HE22 1 1 
       15  9243 1 1 14 GLN HG2  H   -0.967  -5.640  -9.014 1.00 . A A .  14 GLN HG2  1 1 
       15  9244 1 1 14 GLN HG3  H   -1.957  -6.647  -7.958 1.00 . A A .  14 GLN HG3  1 1 
       15  9245 1 1 14 GLN N    N   -4.543  -3.786  -9.533 1.00 . A A .  14 GLN N    1 1 
       15  9246 1 1 14 GLN NE2  N   -0.388  -8.331  -9.224 1.00 . A A .  14 GLN NE2  1 1 
       15  9247 1 1 14 GLN O    O   -1.976  -2.907 -10.389 1.00 . A A .  14 GLN O    1 1 
       15  9248 1 1 14 GLN OE1  O   -1.880  -7.870 -10.838 1.00 . A A .  14 GLN OE1  1 1 
       15  9249 1 1 15 CYS C    C    1.003  -3.027  -9.094 1.00 . A A .  15 CYS C    1 1 
       15  9250 1 1 15 CYS CA   C   -0.142  -2.290  -8.404 1.00 . A A .  15 CYS CA   1 1 
       15  9251 1 1 15 CYS CB   C    0.316  -1.779  -7.037 1.00 . A A .  15 CYS CB   1 1 
       15  9252 1 1 15 CYS H    H   -1.480  -3.577  -7.387 1.00 . A A .  15 CYS H    1 1 
       15  9253 1 1 15 CYS HA   H   -0.432  -1.449  -9.014 1.00 . A A .  15 CYS HA   1 1 
       15  9254 1 1 15 CYS HB2  H   -0.397  -1.052  -6.675 1.00 . A A .  15 CYS HB2  1 1 
       15  9255 1 1 15 CYS HB3  H    0.357  -2.609  -6.346 1.00 . A A .  15 CYS HB3  1 1 
       15  9256 1 1 15 CYS N    N   -1.304  -3.158  -8.256 1.00 . A A .  15 CYS N    1 1 
       15  9257 1 1 15 CYS O    O    1.064  -4.256  -9.075 1.00 . A A .  15 CYS O    1 1 
       15  9258 1 1 15 CYS SG   S    1.956  -0.986  -7.051 1.00 . A A .  15 CYS SG   1 1 
       15  9259 1 1 16 SER C    C    4.349  -2.547  -9.659 1.00 . A A .  16 SER C    1 1 
       15  9260 1 1 16 SER CA   C    3.049  -2.846 -10.400 1.00 . A A .  16 SER CA   1 1 
       15  9261 1 1 16 SER CB   C    3.127  -2.305 -11.829 1.00 . A A .  16 SER CB   1 1 
       15  9262 1 1 16 SER H    H    1.804  -1.292  -9.681 1.00 . A A .  16 SER H    1 1 
       15  9263 1 1 16 SER HA   H    2.907  -3.916 -10.436 1.00 . A A .  16 SER HA   1 1 
       15  9264 1 1 16 SER HB2  H    2.225  -2.569 -12.360 1.00 . A A .  16 SER HB2  1 1 
       15  9265 1 1 16 SER HB3  H    3.226  -1.230 -11.799 1.00 . A A .  16 SER HB3  1 1 
       15  9266 1 1 16 SER HG   H    4.961  -2.990 -11.903 1.00 . A A .  16 SER HG   1 1 
       15  9267 1 1 16 SER N    N    1.908  -2.266  -9.701 1.00 . A A .  16 SER N    1 1 
       15  9268 1 1 16 SER O    O    5.220  -3.408  -9.541 1.00 . A A .  16 SER O    1 1 
       15  9269 1 1 16 SER OG   O    4.239  -2.848 -12.519 1.00 . A A .  16 SER OG   1 1 
       15  9270 1 1 17 GLU C    C    6.165  -2.028  -7.529 1.00 . A A .  17 GLU C    1 1 
       15  9271 1 1 17 GLU CA   C    5.664  -0.906  -8.434 1.00 . A A .  17 GLU CA   1 1 
       15  9272 1 1 17 GLU CB   C    5.373   0.344  -7.601 1.00 . A A .  17 GLU CB   1 1 
       15  9273 1 1 17 GLU CD   C    4.115   1.815  -9.224 1.00 . A A .  17 GLU CD   1 1 
       15  9274 1 1 17 GLU CG   C    5.381   1.630  -8.410 1.00 . A A .  17 GLU CG   1 1 
       15  9275 1 1 17 GLU H    H    3.741  -0.678  -9.289 1.00 . A A .  17 GLU H    1 1 
       15  9276 1 1 17 GLU HA   H    6.431  -0.675  -9.158 1.00 . A A .  17 GLU HA   1 1 
       15  9277 1 1 17 GLU HB2  H    4.401   0.238  -7.142 1.00 . A A .  17 GLU HB2  1 1 
       15  9278 1 1 17 GLU HB3  H    6.120   0.427  -6.826 1.00 . A A .  17 GLU HB3  1 1 
       15  9279 1 1 17 GLU HG2  H    5.481   2.465  -7.734 1.00 . A A .  17 GLU HG2  1 1 
       15  9280 1 1 17 GLU HG3  H    6.225   1.611  -9.084 1.00 . A A .  17 GLU HG3  1 1 
       15  9281 1 1 17 GLU N    N    4.470  -1.320  -9.162 1.00 . A A .  17 GLU N    1 1 
       15  9282 1 1 17 GLU O    O    7.348  -2.369  -7.540 1.00 . A A .  17 GLU O    1 1 
       15  9283 1 1 17 GLU OE1  O    3.974   1.139 -10.265 1.00 . A A .  17 GLU OE1  1 1 
       15  9284 1 1 17 GLU OE2  O    3.266   2.637  -8.820 1.00 . A A .  17 GLU OE2  1 1 
       15  9285 1 1 18 CYS C    C    4.847  -4.957  -6.189 1.00 . A A .  18 CYS C    1 1 
       15  9286 1 1 18 CYS CA   C    5.603  -3.681  -5.832 1.00 . A A .  18 CYS CA   1 1 
       15  9287 1 1 18 CYS CB   C    5.294  -3.278  -4.389 1.00 . A A .  18 CYS CB   1 1 
       15  9288 1 1 18 CYS H    H    4.328  -2.283  -6.780 1.00 . A A .  18 CYS H    1 1 
       15  9289 1 1 18 CYS HA   H    6.662  -3.867  -5.926 1.00 . A A .  18 CYS HA   1 1 
       15  9290 1 1 18 CYS HB2  H    5.588  -4.081  -3.729 1.00 . A A .  18 CYS HB2  1 1 
       15  9291 1 1 18 CYS HB3  H    5.860  -2.392  -4.142 1.00 . A A .  18 CYS HB3  1 1 
       15  9292 1 1 18 CYS N    N    5.256  -2.598  -6.745 1.00 . A A .  18 CYS N    1 1 
       15  9293 1 1 18 CYS O    O    5.427  -6.040  -6.246 1.00 . A A .  18 CYS O    1 1 
       15  9294 1 1 18 CYS SG   S    3.536  -2.921  -4.077 1.00 . A A .  18 CYS SG   1 1 
       15  9295 1 1 19 GLY C    C    1.718  -6.309  -5.702 1.00 . A A .  19 GLY C    1 1 
       15  9296 1 1 19 GLY CA   C    2.731  -5.969  -6.777 1.00 . A A .  19 GLY CA   1 1 
       15  9297 1 1 19 GLY H    H    3.137  -3.931  -6.369 1.00 . A A .  19 GLY H    1 1 
       15  9298 1 1 19 GLY HA2  H    2.206  -5.759  -7.698 1.00 . A A .  19 GLY HA2  1 1 
       15  9299 1 1 19 GLY HA3  H    3.377  -6.821  -6.929 1.00 . A A .  19 GLY HA3  1 1 
       15  9300 1 1 19 GLY N    N    3.546  -4.820  -6.429 1.00 . A A .  19 GLY N    1 1 
       15  9301 1 1 19 GLY O    O    1.802  -7.362  -5.070 1.00 . A A .  19 GLY O    1 1 
       15  9302 1 1 20 LYS C    C   -1.660  -5.347  -5.060 1.00 . A A .  20 LYS C    1 1 
       15  9303 1 1 20 LYS CA   C   -0.275  -5.623  -4.484 1.00 . A A .  20 LYS CA   1 1 
       15  9304 1 1 20 LYS CB   C   -0.026  -4.721  -3.273 1.00 . A A .  20 LYS CB   1 1 
       15  9305 1 1 20 LYS CD   C    0.098  -4.734  -0.764 1.00 . A A .  20 LYS CD   1 1 
       15  9306 1 1 20 LYS CE   C   -0.311  -5.490   0.491 1.00 . A A .  20 LYS CE   1 1 
       15  9307 1 1 20 LYS CG   C   -0.645  -5.243  -1.988 1.00 . A A .  20 LYS CG   1 1 
       15  9308 1 1 20 LYS H    H    0.745  -4.592  -6.026 1.00 . A A .  20 LYS H    1 1 
       15  9309 1 1 20 LYS HA   H   -0.228  -6.654  -4.169 1.00 . A A .  20 LYS HA   1 1 
       15  9310 1 1 20 LYS HB2  H    1.040  -4.627  -3.122 1.00 . A A .  20 LYS HB2  1 1 
       15  9311 1 1 20 LYS HB3  H   -0.440  -3.744  -3.476 1.00 . A A .  20 LYS HB3  1 1 
       15  9312 1 1 20 LYS HD2  H    1.159  -4.864  -0.918 1.00 . A A .  20 LYS HD2  1 1 
       15  9313 1 1 20 LYS HD3  H   -0.123  -3.685  -0.630 1.00 . A A .  20 LYS HD3  1 1 
       15  9314 1 1 20 LYS HE2  H   -0.581  -6.498   0.216 1.00 . A A .  20 LYS HE2  1 1 
       15  9315 1 1 20 LYS HE3  H    0.528  -5.515   1.171 1.00 . A A .  20 LYS HE3  1 1 
       15  9316 1 1 20 LYS HG2  H   -1.672  -4.915  -1.934 1.00 . A A .  20 LYS HG2  1 1 
       15  9317 1 1 20 LYS HG3  H   -0.610  -6.323  -1.995 1.00 . A A .  20 LYS HG3  1 1 
       15  9318 1 1 20 LYS HZ1  H   -2.215  -5.549   1.348 1.00 . A A .  20 LYS HZ1  1 1 
       15  9319 1 1 20 LYS HZ2  H   -1.856  -4.087   0.578 1.00 . A A .  20 LYS HZ2  1 1 
       15  9320 1 1 20 LYS HZ3  H   -1.168  -4.442   2.082 1.00 . A A .  20 LYS HZ3  1 1 
       15  9321 1 1 20 LYS N    N    0.759  -5.414  -5.491 1.00 . A A .  20 LYS N    1 1 
       15  9322 1 1 20 LYS NZ   N   -1.469  -4.847   1.173 1.00 . A A .  20 LYS NZ   1 1 
       15  9323 1 1 20 LYS O    O   -1.861  -4.363  -5.773 1.00 . A A .  20 LYS O    1 1 
       15  9324 1 1 21 SER C    C   -4.813  -5.238  -4.268 1.00 . A A .  21 SER C    1 1 
       15  9325 1 1 21 SER CA   C   -3.977  -6.071  -5.235 1.00 . A A .  21 SER CA   1 1 
       15  9326 1 1 21 SER CB   C   -4.623  -7.443  -5.433 1.00 . A A .  21 SER CB   1 1 
       15  9327 1 1 21 SER H    H   -2.389  -6.984  -4.174 1.00 . A A .  21 SER H    1 1 
       15  9328 1 1 21 SER HA   H   -3.935  -5.562  -6.186 1.00 . A A .  21 SER HA   1 1 
       15  9329 1 1 21 SER HB2  H   -4.586  -7.993  -4.505 1.00 . A A .  21 SER HB2  1 1 
       15  9330 1 1 21 SER HB3  H   -5.653  -7.313  -5.734 1.00 . A A .  21 SER HB3  1 1 
       15  9331 1 1 21 SER HG   H   -4.587  -8.621  -6.998 1.00 . A A .  21 SER HG   1 1 
       15  9332 1 1 21 SER N    N   -2.611  -6.220  -4.746 1.00 . A A .  21 SER N    1 1 
       15  9333 1 1 21 SER O    O   -4.492  -5.133  -3.084 1.00 . A A .  21 SER O    1 1 
       15  9334 1 1 21 SER OG   O   -3.945  -8.187  -6.431 1.00 . A A .  21 SER OG   1 1 
       15  9335 1 1 22 PHE C    C   -8.210  -3.915  -4.456 1.00 . A A .  22 PHE C    1 1 
       15  9336 1 1 22 PHE CA   C   -6.769  -3.822  -3.964 1.00 . A A .  22 PHE CA   1 1 
       15  9337 1 1 22 PHE CB   C   -6.304  -2.364  -3.986 1.00 . A A .  22 PHE CB   1 1 
       15  9338 1 1 22 PHE CD1  C   -3.798  -2.280  -3.907 1.00 . A A .  22 PHE CD1  1 1 
       15  9339 1 1 22 PHE CD2  C   -5.011  -1.779  -1.917 1.00 . A A .  22 PHE CD2  1 1 
       15  9340 1 1 22 PHE CE1  C   -2.606  -2.070  -3.238 1.00 . A A .  22 PHE CE1  1 1 
       15  9341 1 1 22 PHE CE2  C   -3.824  -1.567  -1.242 1.00 . A A .  22 PHE CE2  1 1 
       15  9342 1 1 22 PHE CG   C   -5.012  -2.136  -3.255 1.00 . A A .  22 PHE CG   1 1 
       15  9343 1 1 22 PHE CZ   C   -2.620  -1.714  -1.903 1.00 . A A .  22 PHE CZ   1 1 
       15  9344 1 1 22 PHE H    H   -6.090  -4.768  -5.732 1.00 . A A .  22 PHE H    1 1 
       15  9345 1 1 22 PHE HA   H   -6.722  -4.190  -2.951 1.00 . A A .  22 PHE HA   1 1 
       15  9346 1 1 22 PHE HB2  H   -6.165  -2.054  -5.011 1.00 . A A .  22 PHE HB2  1 1 
       15  9347 1 1 22 PHE HB3  H   -7.060  -1.746  -3.526 1.00 . A A .  22 PHE HB3  1 1 
       15  9348 1 1 22 PHE HD1  H   -3.786  -2.558  -4.952 1.00 . A A .  22 PHE HD1  1 1 
       15  9349 1 1 22 PHE HD2  H   -5.952  -1.664  -1.398 1.00 . A A .  22 PHE HD2  1 1 
       15  9350 1 1 22 PHE HE1  H   -1.667  -2.186  -3.758 1.00 . A A .  22 PHE HE1  1 1 
       15  9351 1 1 22 PHE HE2  H   -3.837  -1.290  -0.199 1.00 . A A .  22 PHE HE2  1 1 
       15  9352 1 1 22 PHE HZ   H   -1.690  -1.550  -1.379 1.00 . A A .  22 PHE HZ   1 1 
       15  9353 1 1 22 PHE N    N   -5.887  -4.647  -4.781 1.00 . A A .  22 PHE N    1 1 
       15  9354 1 1 22 PHE O    O   -8.466  -3.956  -5.659 1.00 . A A .  22 PHE O    1 1 
       15  9355 1 1 23 SER C    C  -11.148  -2.661  -4.133 1.00 . A A .  23 SER C    1 1 
       15  9356 1 1 23 SER CA   C  -10.565  -4.042  -3.852 1.00 . A A .  23 SER CA   1 1 
       15  9357 1 1 23 SER CB   C  -11.338  -4.712  -2.715 1.00 . A A .  23 SER CB   1 1 
       15  9358 1 1 23 SER H    H   -8.883  -3.913  -2.573 1.00 . A A .  23 SER H    1 1 
       15  9359 1 1 23 SER HA   H  -10.655  -4.646  -4.742 1.00 . A A .  23 SER HA   1 1 
       15  9360 1 1 23 SER HB2  H  -10.893  -4.440  -1.770 1.00 . A A .  23 SER HB2  1 1 
       15  9361 1 1 23 SER HB3  H  -12.366  -4.380  -2.737 1.00 . A A .  23 SER HB3  1 1 
       15  9362 1 1 23 SER HG   H  -11.779  -6.382  -3.639 1.00 . A A .  23 SER HG   1 1 
       15  9363 1 1 23 SER N    N   -9.149  -3.949  -3.516 1.00 . A A .  23 SER N    1 1 
       15  9364 1 1 23 SER O    O  -12.204  -2.302  -3.613 1.00 . A A .  23 SER O    1 1 
       15  9365 1 1 23 SER OG   O  -11.311  -6.123  -2.842 1.00 . A A .  23 SER OG   1 1 
       15  9366 1 1 24 GLY C    C   -9.806   0.324  -5.842 1.00 . A A .  24 GLY C    1 1 
       15  9367 1 1 24 GLY CA   C  -10.915  -0.555  -5.300 1.00 . A A .  24 GLY CA   1 1 
       15  9368 1 1 24 GLY H    H   -9.617  -2.227  -5.348 1.00 . A A .  24 GLY H    1 1 
       15  9369 1 1 24 GLY HA2  H  -11.694  -0.634  -6.043 1.00 . A A .  24 GLY HA2  1 1 
       15  9370 1 1 24 GLY HA3  H  -11.324  -0.093  -4.413 1.00 . A A .  24 GLY HA3  1 1 
       15  9371 1 1 24 GLY N    N  -10.452  -1.889  -4.962 1.00 . A A .  24 GLY N    1 1 
       15  9372 1 1 24 GLY O    O   -8.625   0.040  -5.641 1.00 . A A .  24 GLY O    1 1 
       15  9373 1 1 25 SER C    C   -8.716   3.307  -6.064 1.00 . A A .  25 SER C    1 1 
       15  9374 1 1 25 SER CA   C   -9.214   2.315  -7.111 1.00 . A A .  25 SER CA   1 1 
       15  9375 1 1 25 SER CB   C   -9.832   3.069  -8.290 1.00 . A A .  25 SER CB   1 1 
       15  9376 1 1 25 SER H    H  -11.142   1.567  -6.659 1.00 . A A .  25 SER H    1 1 
       15  9377 1 1 25 SER HA   H   -8.376   1.733  -7.466 1.00 . A A .  25 SER HA   1 1 
       15  9378 1 1 25 SER HB2  H   -9.088   3.713  -8.732 1.00 . A A .  25 SER HB2  1 1 
       15  9379 1 1 25 SER HB3  H  -10.176   2.357  -9.027 1.00 . A A .  25 SER HB3  1 1 
       15  9380 1 1 25 SER HG   H  -11.595   3.878  -8.563 1.00 . A A .  25 SER HG   1 1 
       15  9381 1 1 25 SER N    N  -10.185   1.394  -6.533 1.00 . A A .  25 SER N    1 1 
       15  9382 1 1 25 SER O    O   -7.520   3.586  -5.976 1.00 . A A .  25 SER O    1 1 
       15  9383 1 1 25 SER OG   O  -10.930   3.860  -7.870 1.00 . A A .  25 SER OG   1 1 
       15  9384 1 1 26 TYR C    C   -8.187   4.260  -3.336 1.00 . A A .  26 TYR C    1 1 
       15  9385 1 1 26 TYR CA   C   -9.298   4.799  -4.232 1.00 . A A .  26 TYR CA   1 1 
       15  9386 1 1 26 TYR CB   C  -10.531   5.132  -3.390 1.00 . A A .  26 TYR CB   1 1 
       15  9387 1 1 26 TYR CD1  C   -9.974   7.267  -2.160 1.00 . A A .  26 TYR CD1  1 1 
       15  9388 1 1 26 TYR CD2  C  -10.146   5.252  -0.897 1.00 . A A .  26 TYR CD2  1 1 
       15  9389 1 1 26 TYR CE1  C   -9.681   7.970  -1.008 1.00 . A A .  26 TYR CE1  1 1 
       15  9390 1 1 26 TYR CE2  C   -9.855   5.948   0.260 1.00 . A A .  26 TYR CE2  1 1 
       15  9391 1 1 26 TYR CG   C  -10.212   5.898  -2.126 1.00 . A A .  26 TYR CG   1 1 
       15  9392 1 1 26 TYR CZ   C   -9.623   7.306   0.200 1.00 . A A .  26 TYR CZ   1 1 
       15  9393 1 1 26 TYR H    H  -10.578   3.574  -5.390 1.00 . A A .  26 TYR H    1 1 
       15  9394 1 1 26 TYR HA   H   -8.951   5.700  -4.716 1.00 . A A .  26 TYR HA   1 1 
       15  9395 1 1 26 TYR HB2  H  -11.208   5.732  -3.978 1.00 . A A .  26 TYR HB2  1 1 
       15  9396 1 1 26 TYR HB3  H  -11.024   4.214  -3.106 1.00 . A A .  26 TYR HB3  1 1 
       15  9397 1 1 26 TYR HD1  H  -10.021   7.784  -3.108 1.00 . A A .  26 TYR HD1  1 1 
       15  9398 1 1 26 TYR HD2  H  -10.327   4.188  -0.853 1.00 . A A .  26 TYR HD2  1 1 
       15  9399 1 1 26 TYR HE1  H   -9.500   9.034  -1.054 1.00 . A A .  26 TYR HE1  1 1 
       15  9400 1 1 26 TYR HE2  H   -9.809   5.429   1.206 1.00 . A A .  26 TYR HE2  1 1 
       15  9401 1 1 26 TYR HH   H   -9.496   7.443   2.113 1.00 . A A .  26 TYR HH   1 1 
       15  9402 1 1 26 TYR N    N   -9.641   3.836  -5.272 1.00 . A A .  26 TYR N    1 1 
       15  9403 1 1 26 TYR O    O   -7.203   4.949  -3.068 1.00 . A A .  26 TYR O    1 1 
       15  9404 1 1 26 TYR OH   O   -9.332   8.003   1.351 1.00 . A A .  26 TYR OH   1 1 
       15  9405 1 1 27 ARG C    C   -6.016   2.280  -2.716 1.00 . A A .  27 ARG C    1 1 
       15  9406 1 1 27 ARG CA   C   -7.365   2.392  -2.011 1.00 . A A .  27 ARG CA   1 1 
       15  9407 1 1 27 ARG CB   C   -7.845   1.004  -1.583 1.00 . A A .  27 ARG CB   1 1 
       15  9408 1 1 27 ARG CD   C   -9.018  -0.290   0.225 1.00 . A A .  27 ARG CD   1 1 
       15  9409 1 1 27 ARG CG   C   -8.924   1.036  -0.513 1.00 . A A .  27 ARG CG   1 1 
       15  9410 1 1 27 ARG CZ   C  -10.726  -1.655   1.348 1.00 . A A .  27 ARG CZ   1 1 
       15  9411 1 1 27 ARG H    H   -9.159   2.525  -3.126 1.00 . A A .  27 ARG H    1 1 
       15  9412 1 1 27 ARG HA   H   -7.249   3.010  -1.134 1.00 . A A .  27 ARG HA   1 1 
       15  9413 1 1 27 ARG HB2  H   -8.241   0.490  -2.446 1.00 . A A .  27 ARG HB2  1 1 
       15  9414 1 1 27 ARG HB3  H   -7.003   0.448  -1.198 1.00 . A A .  27 ARG HB3  1 1 
       15  9415 1 1 27 ARG HD2  H   -8.790  -1.088  -0.467 1.00 . A A .  27 ARG HD2  1 1 
       15  9416 1 1 27 ARG HD3  H   -8.295  -0.293   1.027 1.00 . A A .  27 ARG HD3  1 1 
       15  9417 1 1 27 ARG HE   H  -10.990   0.225   0.736 1.00 . A A .  27 ARG HE   1 1 
       15  9418 1 1 27 ARG HG2  H   -8.690   1.815   0.198 1.00 . A A .  27 ARG HG2  1 1 
       15  9419 1 1 27 ARG HG3  H   -9.875   1.247  -0.980 1.00 . A A .  27 ARG HG3  1 1 
       15  9420 1 1 27 ARG HH11 H   -8.953  -2.579   1.063 1.00 . A A .  27 ARG HH11 1 1 
       15  9421 1 1 27 ARG HH12 H  -10.166  -3.530   1.854 1.00 . A A .  27 ARG HH12 1 1 
       15  9422 1 1 27 ARG HH21 H  -12.596  -1.016   1.777 1.00 . A A .  27 ARG HH21 1 1 
       15  9423 1 1 27 ARG HH22 H  -12.238  -2.640   2.259 1.00 . A A .  27 ARG HH22 1 1 
       15  9424 1 1 27 ARG N    N   -8.353   3.024  -2.877 1.00 . A A .  27 ARG N    1 1 
       15  9425 1 1 27 ARG NE   N  -10.348  -0.513   0.784 1.00 . A A .  27 ARG NE   1 1 
       15  9426 1 1 27 ARG NH1  N   -9.879  -2.672   1.427 1.00 . A A .  27 ARG NH1  1 1 
       15  9427 1 1 27 ARG NH2  N  -11.954  -1.781   1.835 1.00 . A A .  27 ARG NH2  1 1 
       15  9428 1 1 27 ARG O    O   -4.972   2.566  -2.129 1.00 . A A .  27 ARG O    1 1 
       15  9429 1 1 28 LEU C    C   -3.982   2.981  -4.706 1.00 . A A .  28 LEU C    1 1 
       15  9430 1 1 28 LEU CA   C   -4.826   1.712  -4.762 1.00 . A A .  28 LEU CA   1 1 
       15  9431 1 1 28 LEU CB   C   -5.169   1.378  -6.215 1.00 . A A .  28 LEU CB   1 1 
       15  9432 1 1 28 LEU CD1  C   -3.790  -0.591  -6.927 1.00 . A A .  28 LEU CD1  1 1 
       15  9433 1 1 28 LEU CD2  C   -4.258   1.257  -8.547 1.00 . A A .  28 LEU CD2  1 1 
       15  9434 1 1 28 LEU CG   C   -4.006   0.906  -7.088 1.00 . A A .  28 LEU CG   1 1 
       15  9435 1 1 28 LEU H    H   -6.909   1.650  -4.390 1.00 . A A .  28 LEU H    1 1 
       15  9436 1 1 28 LEU HA   H   -4.258   0.897  -4.338 1.00 . A A .  28 LEU HA   1 1 
       15  9437 1 1 28 LEU HB2  H   -5.914   0.597  -6.207 1.00 . A A .  28 LEU HB2  1 1 
       15  9438 1 1 28 LEU HB3  H   -5.586   2.266  -6.668 1.00 . A A .  28 LEU HB3  1 1 
       15  9439 1 1 28 LEU HD11 H   -4.716  -1.058  -6.629 1.00 . A A .  28 LEU HD11 1 1 
       15  9440 1 1 28 LEU HD12 H   -3.039  -0.766  -6.171 1.00 . A A .  28 LEU HD12 1 1 
       15  9441 1 1 28 LEU HD13 H   -3.460  -1.010  -7.866 1.00 . A A .  28 LEU HD13 1 1 
       15  9442 1 1 28 LEU HD21 H   -4.140   0.372  -9.155 1.00 . A A .  28 LEU HD21 1 1 
       15  9443 1 1 28 LEU HD22 H   -3.550   2.009  -8.864 1.00 . A A .  28 LEU HD22 1 1 
       15  9444 1 1 28 LEU HD23 H   -5.262   1.639  -8.657 1.00 . A A .  28 LEU HD23 1 1 
       15  9445 1 1 28 LEU HG   H   -3.101   1.409  -6.774 1.00 . A A .  28 LEU HG   1 1 
       15  9446 1 1 28 LEU N    N   -6.046   1.862  -3.977 1.00 . A A .  28 LEU N    1 1 
       15  9447 1 1 28 LEU O    O   -2.818   2.949  -4.307 1.00 . A A .  28 LEU O    1 1 
       15  9448 1 1 29 THR C    C   -3.124   5.589  -3.794 1.00 . A A .  29 THR C    1 1 
       15  9449 1 1 29 THR CA   C   -3.883   5.381  -5.100 1.00 . A A .  29 THR CA   1 1 
       15  9450 1 1 29 THR CB   C   -4.862   6.553  -5.304 1.00 . A A .  29 THR CB   1 1 
       15  9451 1 1 29 THR CG2  C   -4.109   7.862  -5.483 1.00 . A A .  29 THR CG2  1 1 
       15  9452 1 1 29 THR H    H   -5.509   4.062  -5.412 1.00 . A A .  29 THR H    1 1 
       15  9453 1 1 29 THR HA   H   -3.179   5.382  -5.919 1.00 . A A .  29 THR HA   1 1 
       15  9454 1 1 29 THR HB   H   -5.491   6.633  -4.428 1.00 . A A .  29 THR HB   1 1 
       15  9455 1 1 29 THR HG1  H   -5.133   6.237  -7.231 1.00 . A A .  29 THR HG1  1 1 
       15  9456 1 1 29 THR HG21 H   -3.978   8.060  -6.536 1.00 . A A .  29 THR HG21 1 1 
       15  9457 1 1 29 THR HG22 H   -3.142   7.790  -5.007 1.00 . A A .  29 THR HG22 1 1 
       15  9458 1 1 29 THR HG23 H   -4.672   8.666  -5.033 1.00 . A A .  29 THR HG23 1 1 
       15  9459 1 1 29 THR N    N   -4.579   4.100  -5.106 1.00 . A A .  29 THR N    1 1 
       15  9460 1 1 29 THR O    O   -1.913   5.806  -3.799 1.00 . A A .  29 THR O    1 1 
       15  9461 1 1 29 THR OG1  O   -5.686   6.310  -6.449 1.00 . A A .  29 THR OG1  1 1 
       15  9462 1 1 30 GLN C    C   -2.016   4.803  -1.203 1.00 . A A .  30 GLN C    1 1 
       15  9463 1 1 30 GLN CA   C   -3.237   5.702  -1.366 1.00 . A A .  30 GLN CA   1 1 
       15  9464 1 1 30 GLN CB   C   -4.256   5.404  -0.264 1.00 . A A .  30 GLN CB   1 1 
       15  9465 1 1 30 GLN CD   C   -5.183   7.715   0.162 1.00 . A A .  30 GLN CD   1 1 
       15  9466 1 1 30 GLN CG   C   -5.480   6.304  -0.308 1.00 . A A .  30 GLN CG   1 1 
       15  9467 1 1 30 GLN H    H   -4.806   5.345  -2.741 1.00 . A A .  30 GLN H    1 1 
       15  9468 1 1 30 GLN HA   H   -2.924   6.731  -1.285 1.00 . A A .  30 GLN HA   1 1 
       15  9469 1 1 30 GLN HB2  H   -4.585   4.380  -0.362 1.00 . A A .  30 GLN HB2  1 1 
       15  9470 1 1 30 GLN HB3  H   -3.777   5.530   0.696 1.00 . A A .  30 GLN HB3  1 1 
       15  9471 1 1 30 GLN HE21 H   -7.029   7.889   0.881 1.00 . A A .  30 GLN HE21 1 1 
       15  9472 1 1 30 GLN HE22 H   -6.010   9.270   1.085 1.00 . A A .  30 GLN HE22 1 1 
       15  9473 1 1 30 GLN HG2  H   -5.842   6.349  -1.324 1.00 . A A .  30 GLN HG2  1 1 
       15  9474 1 1 30 GLN HG3  H   -6.244   5.882   0.327 1.00 . A A .  30 GLN HG3  1 1 
       15  9475 1 1 30 GLN N    N   -3.845   5.521  -2.679 1.00 . A A .  30 GLN N    1 1 
       15  9476 1 1 30 GLN NE2  N   -6.174   8.357   0.770 1.00 . A A .  30 GLN NE2  1 1 
       15  9477 1 1 30 GLN O    O   -1.004   5.210  -0.631 1.00 . A A .  30 GLN O    1 1 
       15  9478 1 1 30 GLN OE1  O   -4.076   8.222  -0.020 1.00 . A A .  30 GLN OE1  1 1 
       15  9479 1 1 31 HIS C    C    0.128   3.022  -2.537 1.00 . A A .  31 HIS C    1 1 
       15  9480 1 1 31 HIS CA   C   -1.021   2.620  -1.617 1.00 . A A .  31 HIS CA   1 1 
       15  9481 1 1 31 HIS CB   C   -1.510   1.217  -1.976 1.00 . A A .  31 HIS CB   1 1 
       15  9482 1 1 31 HIS CD2  C   -0.285  -0.218  -3.756 1.00 . A A .  31 HIS CD2  1 1 
       15  9483 1 1 31 HIS CE1  C    1.422  -0.853  -2.536 1.00 . A A .  31 HIS CE1  1 1 
       15  9484 1 1 31 HIS CG   C   -0.436   0.331  -2.528 1.00 . A A .  31 HIS CG   1 1 
       15  9485 1 1 31 HIS H    H   -2.950   3.311  -2.151 1.00 . A A .  31 HIS H    1 1 
       15  9486 1 1 31 HIS HA   H   -0.666   2.618  -0.598 1.00 . A A .  31 HIS HA   1 1 
       15  9487 1 1 31 HIS HB2  H   -1.907   0.743  -1.090 1.00 . A A .  31 HIS HB2  1 1 
       15  9488 1 1 31 HIS HB3  H   -2.292   1.293  -2.718 1.00 . A A .  31 HIS HB3  1 1 
       15  9489 1 1 31 HIS HD1  H    0.828   0.145  -0.852 1.00 . A A .  31 HIS HD1  1 1 
       15  9490 1 1 31 HIS HD2  H   -0.954  -0.103  -4.597 1.00 . A A .  31 HIS HD2  1 1 
       15  9491 1 1 31 HIS HE1  H    2.343  -1.322  -2.222 1.00 . A A .  31 HIS HE1  1 1 
       15  9492 1 1 31 HIS N    N   -2.118   3.577  -1.707 1.00 . A A .  31 HIS N    1 1 
       15  9493 1 1 31 HIS ND1  N    0.650  -0.087  -1.787 1.00 . A A .  31 HIS ND1  1 1 
       15  9494 1 1 31 HIS NE2  N    0.877  -0.949  -3.735 1.00 . A A .  31 HIS NE2  1 1 
       15  9495 1 1 31 HIS O    O    1.289   2.715  -2.266 1.00 . A A .  31 HIS O    1 1 
       15  9496 1 1 32 TRP C    C    1.624   5.304  -4.018 1.00 . A A .  32 TRP C    1 1 
       15  9497 1 1 32 TRP CA   C    0.801   4.152  -4.584 1.00 . A A .  32 TRP CA   1 1 
       15  9498 1 1 32 TRP CB   C    0.132   4.581  -5.891 1.00 . A A .  32 TRP CB   1 1 
       15  9499 1 1 32 TRP CD1  C   -0.727   2.236  -6.470 1.00 . A A .  32 TRP CD1  1 1 
       15  9500 1 1 32 TRP CD2  C    0.085   3.377  -8.218 1.00 . A A .  32 TRP CD2  1 1 
       15  9501 1 1 32 TRP CE2  C   -0.351   2.115  -8.668 1.00 . A A .  32 TRP CE2  1 1 
       15  9502 1 1 32 TRP CE3  C    0.632   4.270  -9.143 1.00 . A A .  32 TRP CE3  1 1 
       15  9503 1 1 32 TRP CG   C   -0.165   3.434  -6.809 1.00 . A A .  32 TRP CG   1 1 
       15  9504 1 1 32 TRP CH2  C    0.286   2.621 -10.886 1.00 . A A .  32 TRP CH2  1 1 
       15  9505 1 1 32 TRP CZ2  C   -0.254   1.727 -10.001 1.00 . A A .  32 TRP CZ2  1 1 
       15  9506 1 1 32 TRP CZ3  C    0.728   3.883 -10.466 1.00 . A A .  32 TRP CZ3  1 1 
       15  9507 1 1 32 TRP H    H   -1.147   3.924  -3.785 1.00 . A A .  32 TRP H    1 1 
       15  9508 1 1 32 TRP HA   H    1.458   3.319  -4.782 1.00 . A A .  32 TRP HA   1 1 
       15  9509 1 1 32 TRP HB2  H   -0.799   5.078  -5.666 1.00 . A A .  32 TRP HB2  1 1 
       15  9510 1 1 32 TRP HB3  H    0.785   5.266  -6.413 1.00 . A A .  32 TRP HB3  1 1 
       15  9511 1 1 32 TRP HD1  H   -1.030   1.969  -5.469 1.00 . A A .  32 TRP HD1  1 1 
       15  9512 1 1 32 TRP HE1  H   -1.214   0.532  -7.596 1.00 . A A .  32 TRP HE1  1 1 
       15  9513 1 1 32 TRP HE3  H    0.978   5.247  -8.840 1.00 . A A .  32 TRP HE3  1 1 
       15  9514 1 1 32 TRP HH2  H    0.381   2.360 -11.928 1.00 . A A .  32 TRP HH2  1 1 
       15  9515 1 1 32 TRP HZ2  H   -0.590   0.758 -10.340 1.00 . A A .  32 TRP HZ2  1 1 
       15  9516 1 1 32 TRP HZ3  H    1.149   4.559 -11.196 1.00 . A A .  32 TRP HZ3  1 1 
       15  9517 1 1 32 TRP N    N   -0.204   3.709  -3.624 1.00 . A A .  32 TRP N    1 1 
       15  9518 1 1 32 TRP NE1  N   -0.841   1.438  -7.582 1.00 . A A .  32 TRP NE1  1 1 
       15  9519 1 1 32 TRP O    O    2.690   5.632  -4.540 1.00 . A A .  32 TRP O    1 1 
       15  9520 1 1 33 ILE C    C    3.212   6.622  -1.858 1.00 . A A .  33 ILE C    1 1 
       15  9521 1 1 33 ILE CA   C    1.814   7.029  -2.312 1.00 . A A .  33 ILE CA   1 1 
       15  9522 1 1 33 ILE CB   C    1.027   7.560  -1.100 1.00 . A A .  33 ILE CB   1 1 
       15  9523 1 1 33 ILE CD1  C   -0.259   9.270  -2.479 1.00 . A A .  33 ILE CD1  1 1 
       15  9524 1 1 33 ILE CG1  C   -0.340   8.085  -1.542 1.00 . A A .  33 ILE CG1  1 1 
       15  9525 1 1 33 ILE CG2  C    1.817   8.652  -0.394 1.00 . A A .  33 ILE CG2  1 1 
       15  9526 1 1 33 ILE H    H    0.270   5.607  -2.579 1.00 . A A .  33 ILE H    1 1 
       15  9527 1 1 33 ILE HA   H    1.901   7.825  -3.038 1.00 . A A .  33 ILE HA   1 1 
       15  9528 1 1 33 ILE HB   H    0.885   6.746  -0.406 1.00 . A A .  33 ILE HB   1 1 
       15  9529 1 1 33 ILE HD11 H    0.682   9.781  -2.331 1.00 . A A .  33 ILE HD11 1 1 
       15  9530 1 1 33 ILE HD12 H   -0.323   8.927  -3.501 1.00 . A A .  33 ILE HD12 1 1 
       15  9531 1 1 33 ILE HD13 H   -1.073   9.949  -2.274 1.00 . A A .  33 ILE HD13 1 1 
       15  9532 1 1 33 ILE HG12 H   -0.874   7.297  -2.050 1.00 . A A .  33 ILE HG12 1 1 
       15  9533 1 1 33 ILE HG13 H   -0.900   8.389  -0.669 1.00 . A A .  33 ILE HG13 1 1 
       15  9534 1 1 33 ILE HG21 H    1.991   8.365   0.633 1.00 . A A .  33 ILE HG21 1 1 
       15  9535 1 1 33 ILE HG22 H    2.764   8.792  -0.893 1.00 . A A .  33 ILE HG22 1 1 
       15  9536 1 1 33 ILE HG23 H    1.257   9.575  -0.419 1.00 . A A .  33 ILE HG23 1 1 
       15  9537 1 1 33 ILE N    N    1.123   5.914  -2.949 1.00 . A A .  33 ILE N    1 1 
       15  9538 1 1 33 ILE O    O    4.187   7.336  -2.094 1.00 . A A .  33 ILE O    1 1 
       15  9539 1 1 34 THR C    C    5.586   4.820  -1.857 1.00 . A A .  34 THR C    1 1 
       15  9540 1 1 34 THR CA   C    4.582   4.963  -0.719 1.00 . A A .  34 THR CA   1 1 
       15  9541 1 1 34 THR CB   C    4.419   3.601  -0.019 1.00 . A A .  34 THR CB   1 1 
       15  9542 1 1 34 THR CG2  C    4.164   2.498  -1.034 1.00 . A A .  34 THR CG2  1 1 
       15  9543 1 1 34 THR H    H    2.491   4.942  -1.049 1.00 . A A .  34 THR H    1 1 
       15  9544 1 1 34 THR HA   H    4.967   5.671   0.001 1.00 . A A .  34 THR HA   1 1 
       15  9545 1 1 34 THR HB   H    3.573   3.657   0.651 1.00 . A A .  34 THR HB   1 1 
       15  9546 1 1 34 THR HG1  H    5.483   2.450   1.178 1.00 . A A .  34 THR HG1  1 1 
       15  9547 1 1 34 THR HG21 H    5.107   2.129  -1.409 1.00 . A A .  34 THR HG21 1 1 
       15  9548 1 1 34 THR HG22 H    3.580   2.890  -1.853 1.00 . A A .  34 THR HG22 1 1 
       15  9549 1 1 34 THR HG23 H    3.624   1.691  -0.561 1.00 . A A .  34 THR HG23 1 1 
       15  9550 1 1 34 THR N    N    3.304   5.467  -1.206 1.00 . A A .  34 THR N    1 1 
       15  9551 1 1 34 THR O    O    6.786   4.669  -1.625 1.00 . A A .  34 THR O    1 1 
       15  9552 1 1 34 THR OG1  O    5.595   3.296   0.739 1.00 . A A .  34 THR OG1  1 1 
       15  9553 1 1 35 HIS C    C    6.403   6.117  -4.748 1.00 . A A .  35 HIS C    1 1 
       15  9554 1 1 35 HIS CA   C    5.943   4.745  -4.264 1.00 . A A .  35 HIS CA   1 1 
       15  9555 1 1 35 HIS CB   C    5.202   4.018  -5.386 1.00 . A A .  35 HIS CB   1 1 
       15  9556 1 1 35 HIS CD2  C    3.643   1.946  -5.310 1.00 . A A .  35 HIS CD2  1 1 
       15  9557 1 1 35 HIS CE1  C    4.918   0.630  -4.107 1.00 . A A .  35 HIS CE1  1 1 
       15  9558 1 1 35 HIS CG   C    4.775   2.629  -5.021 1.00 . A A .  35 HIS CG   1 1 
       15  9559 1 1 35 HIS H    H    4.124   4.990  -3.210 1.00 . A A .  35 HIS H    1 1 
       15  9560 1 1 35 HIS HA   H    6.811   4.167  -3.984 1.00 . A A .  35 HIS HA   1 1 
       15  9561 1 1 35 HIS HB2  H    4.316   4.579  -5.646 1.00 . A A .  35 HIS HB2  1 1 
       15  9562 1 1 35 HIS HB3  H    5.846   3.951  -6.251 1.00 . A A .  35 HIS HB3  1 1 
       15  9563 1 1 35 HIS HD1  H    6.438   1.983  -3.900 1.00 . A A .  35 HIS HD1  1 1 
       15  9564 1 1 35 HIS HD2  H    2.806   2.308  -5.890 1.00 . A A .  35 HIS HD2  1 1 
       15  9565 1 1 35 HIS HE1  H    5.286  -0.226  -3.560 1.00 . A A .  35 HIS HE1  1 1 
       15  9566 1 1 35 HIS N    N    5.088   4.868  -3.089 1.00 . A A .  35 HIS N    1 1 
       15  9567 1 1 35 HIS ND1  N    5.553   1.778  -4.265 1.00 . A A .  35 HIS ND1  1 1 
       15  9568 1 1 35 HIS NE2  N    3.757   0.706  -4.731 1.00 . A A .  35 HIS NE2  1 1 
       15  9569 1 1 35 HIS O    O    6.988   6.244  -5.824 1.00 . A A .  35 HIS O    1 1 
       15  9570 1 1 36 THR C    C    6.304   9.453  -3.118 1.00 . A A .  36 THR C    1 1 
       15  9571 1 1 36 THR CA   C    6.517   8.505  -4.293 1.00 . A A .  36 THR CA   1 1 
       15  9572 1 1 36 THR CB   C    5.720   9.022  -5.506 1.00 . A A .  36 THR CB   1 1 
       15  9573 1 1 36 THR CG2  C    4.242   8.696  -5.361 1.00 . A A .  36 THR CG2  1 1 
       15  9574 1 1 36 THR H    H    5.664   6.978  -3.102 1.00 . A A .  36 THR H    1 1 
       15  9575 1 1 36 THR HA   H    7.566   8.501  -4.553 1.00 . A A .  36 THR HA   1 1 
       15  9576 1 1 36 THR HB   H    6.095   8.537  -6.397 1.00 . A A .  36 THR HB   1 1 
       15  9577 1 1 36 THR HG1  H    5.499  10.732  -6.463 1.00 . A A .  36 THR HG1  1 1 
       15  9578 1 1 36 THR HG21 H    4.130   7.766  -4.825 1.00 . A A .  36 THR HG21 1 1 
       15  9579 1 1 36 THR HG22 H    3.795   8.603  -6.340 1.00 . A A .  36 THR HG22 1 1 
       15  9580 1 1 36 THR HG23 H    3.751   9.488  -4.814 1.00 . A A .  36 THR HG23 1 1 
       15  9581 1 1 36 THR N    N    6.133   7.143  -3.946 1.00 . A A .  36 THR N    1 1 
       15  9582 1 1 36 THR O    O    5.170   9.802  -2.788 1.00 . A A .  36 THR O    1 1 
       15  9583 1 1 36 THR OG1  O    5.891  10.438  -5.638 1.00 . A A .  36 THR OG1  1 1 
       15  9584 1 1 37 ARG C    C    8.291  11.947  -1.533 1.00 . A A .  37 ARG C    1 1 
       15  9585 1 1 37 ARG CA   C    7.332  10.774  -1.352 1.00 . A A .  37 ARG CA   1 1 
       15  9586 1 1 37 ARG CB   C    7.660  10.028  -0.058 1.00 . A A .  37 ARG CB   1 1 
       15  9587 1 1 37 ARG CD   C    5.650  10.444   1.393 1.00 . A A .  37 ARG CD   1 1 
       15  9588 1 1 37 ARG CG   C    6.445   9.408   0.613 1.00 . A A .  37 ARG CG   1 1 
       15  9589 1 1 37 ARG CZ   C    3.865  10.465   3.083 1.00 . A A .  37 ARG CZ   1 1 
       15  9590 1 1 37 ARG H    H    8.275   9.554  -2.801 1.00 . A A .  37 ARG H    1 1 
       15  9591 1 1 37 ARG HA   H    6.323  11.155  -1.291 1.00 . A A .  37 ARG HA   1 1 
       15  9592 1 1 37 ARG HB2  H    8.363   9.238  -0.280 1.00 . A A .  37 ARG HB2  1 1 
       15  9593 1 1 37 ARG HB3  H    8.114  10.718   0.636 1.00 . A A .  37 ARG HB3  1 1 
       15  9594 1 1 37 ARG HD2  H    6.339  11.148   1.835 1.00 . A A .  37 ARG HD2  1 1 
       15  9595 1 1 37 ARG HD3  H    4.994  10.962   0.710 1.00 . A A .  37 ARG HD3  1 1 
       15  9596 1 1 37 ARG HE   H    5.058   8.912   2.705 1.00 . A A .  37 ARG HE   1 1 
       15  9597 1 1 37 ARG HG2  H    5.807   8.977  -0.145 1.00 . A A .  37 ARG HG2  1 1 
       15  9598 1 1 37 ARG HG3  H    6.775   8.635   1.291 1.00 . A A .  37 ARG HG3  1 1 
       15  9599 1 1 37 ARG HH11 H    4.073  12.185   2.043 1.00 . A A .  37 ARG HH11 1 1 
       15  9600 1 1 37 ARG HH12 H    2.818  12.187   3.238 1.00 . A A .  37 ARG HH12 1 1 
       15  9601 1 1 37 ARG HH21 H    3.408   8.902   4.280 1.00 . A A .  37 ARG HH21 1 1 
       15  9602 1 1 37 ARG HH22 H    2.441  10.320   4.510 1.00 . A A .  37 ARG HH22 1 1 
       15  9603 1 1 37 ARG N    N    7.400   9.867  -2.491 1.00 . A A .  37 ARG N    1 1 
       15  9604 1 1 37 ARG NE   N    4.850   9.835   2.452 1.00 . A A .  37 ARG NE   1 1 
       15  9605 1 1 37 ARG NH1  N    3.561  11.715   2.762 1.00 . A A .  37 ARG NH1  1 1 
       15  9606 1 1 37 ARG NH2  N    3.182   9.845   4.036 1.00 . A A .  37 ARG NH2  1 1 
       15  9607 1 1 37 ARG O    O    8.936  12.078  -2.572 1.00 . A A .  37 ARG O    1 1 
       15  9608 1 1 38 GLU C    C   10.596  13.655   0.105 1.00 . A A .  38 GLU C    1 1 
       15  9609 1 1 38 GLU CA   C    9.257  13.958  -0.562 1.00 . A A .  38 GLU CA   1 1 
       15  9610 1 1 38 GLU CB   C    8.594  15.156   0.121 1.00 . A A .  38 GLU CB   1 1 
       15  9611 1 1 38 GLU CD   C    6.520  16.595   0.210 1.00 . A A .  38 GLU CD   1 1 
       15  9612 1 1 38 GLU CG   C    7.408  15.715  -0.648 1.00 . A A .  38 GLU CG   1 1 
       15  9613 1 1 38 GLU H    H    7.838  12.638   0.288 1.00 . A A .  38 GLU H    1 1 
       15  9614 1 1 38 GLU HA   H    9.433  14.199  -1.600 1.00 . A A .  38 GLU HA   1 1 
       15  9615 1 1 38 GLU HB2  H    8.253  14.854   1.100 1.00 . A A .  38 GLU HB2  1 1 
       15  9616 1 1 38 GLU HB3  H    9.327  15.942   0.232 1.00 . A A .  38 GLU HB3  1 1 
       15  9617 1 1 38 GLU HG2  H    7.776  16.301  -1.477 1.00 . A A .  38 GLU HG2  1 1 
       15  9618 1 1 38 GLU HG3  H    6.819  14.891  -1.023 1.00 . A A .  38 GLU HG3  1 1 
       15  9619 1 1 38 GLU N    N    8.378  12.796  -0.514 1.00 . A A .  38 GLU N    1 1 
       15  9620 1 1 38 GLU O    O   10.675  13.503   1.324 1.00 . A A .  38 GLU O    1 1 
       15  9621 1 1 38 GLU OE1  O    7.036  17.196   1.175 1.00 . A A .  38 GLU OE1  1 1 
       15  9622 1 1 38 GLU OE2  O    5.309  16.682  -0.083 1.00 . A A .  38 GLU OE2  1 1 
       15  9623 1 1 39 LYS C    C   13.846  14.543  -0.199 1.00 . A A .  39 LYS C    1 1 
       15  9624 1 1 39 LYS CA   C   12.984  13.285  -0.194 1.00 . A A .  39 LYS CA   1 1 
       15  9625 1 1 39 LYS CB   C   13.650  12.193  -1.033 1.00 . A A .  39 LYS CB   1 1 
       15  9626 1 1 39 LYS CD   C   13.572  10.188   0.478 1.00 . A A .  39 LYS CD   1 1 
       15  9627 1 1 39 LYS CE   C   13.293   8.693   0.523 1.00 . A A .  39 LYS CE   1 1 
       15  9628 1 1 39 LYS CG   C   13.062  10.811  -0.811 1.00 . A A .  39 LYS CG   1 1 
       15  9629 1 1 39 LYS H    H   11.521  13.700  -1.667 1.00 . A A .  39 LYS H    1 1 
       15  9630 1 1 39 LYS HA   H   12.884  12.936   0.823 1.00 . A A .  39 LYS HA   1 1 
       15  9631 1 1 39 LYS HB2  H   13.544  12.443  -2.078 1.00 . A A .  39 LYS HB2  1 1 
       15  9632 1 1 39 LYS HB3  H   14.702  12.158  -0.786 1.00 . A A .  39 LYS HB3  1 1 
       15  9633 1 1 39 LYS HD2  H   14.638  10.346   0.547 1.00 . A A .  39 LYS HD2  1 1 
       15  9634 1 1 39 LYS HD3  H   13.080  10.662   1.316 1.00 . A A .  39 LYS HD3  1 1 
       15  9635 1 1 39 LYS HE2  H   13.501   8.272  -0.449 1.00 . A A .  39 LYS HE2  1 1 
       15  9636 1 1 39 LYS HE3  H   13.944   8.241   1.257 1.00 . A A .  39 LYS HE3  1 1 
       15  9637 1 1 39 LYS HG2  H   11.986  10.892  -0.758 1.00 . A A .  39 LYS HG2  1 1 
       15  9638 1 1 39 LYS HG3  H   13.336  10.175  -1.641 1.00 . A A .  39 LYS HG3  1 1 
       15  9639 1 1 39 LYS HZ1  H   11.648   8.836   1.802 1.00 . A A .  39 LYS HZ1  1 1 
       15  9640 1 1 39 LYS HZ2  H   11.730   7.376   0.951 1.00 . A A .  39 LYS HZ2  1 1 
       15  9641 1 1 39 LYS HZ3  H   11.238   8.788   0.161 1.00 . A A .  39 LYS HZ3  1 1 
       15  9642 1 1 39 LYS N    N   11.647  13.569  -0.703 1.00 . A A .  39 LYS N    1 1 
       15  9643 1 1 39 LYS NZ   N   11.878   8.403   0.885 1.00 . A A .  39 LYS NZ   1 1 
       15  9644 1 1 39 LYS O    O   13.702  15.420  -1.051 1.00 . A A .  39 LYS O    1 1 
       15  9645 1 1 40 PRO C    C   16.707  15.829  -0.218 1.00 . A A .  40 PRO C    1 1 
       15  9646 1 1 40 PRO CA   C   15.671  15.781   0.900 1.00 . A A .  40 PRO CA   1 1 
       15  9647 1 1 40 PRO CB   C   16.353  15.546   2.251 1.00 . A A .  40 PRO CB   1 1 
       15  9648 1 1 40 PRO CD   C   14.993  13.628   1.823 1.00 . A A .  40 PRO CD   1 1 
       15  9649 1 1 40 PRO CG   C   16.279  14.073   2.461 1.00 . A A .  40 PRO CG   1 1 
       15  9650 1 1 40 PRO HA   H   15.128  16.715   0.927 1.00 . A A .  40 PRO HA   1 1 
       15  9651 1 1 40 PRO HB2  H   17.377  15.889   2.204 1.00 . A A .  40 PRO HB2  1 1 
       15  9652 1 1 40 PRO HB3  H   15.823  16.082   3.024 1.00 . A A .  40 PRO HB3  1 1 
       15  9653 1 1 40 PRO HD2  H   15.105  12.643   1.394 1.00 . A A .  40 PRO HD2  1 1 
       15  9654 1 1 40 PRO HD3  H   14.190  13.637   2.545 1.00 . A A .  40 PRO HD3  1 1 
       15  9655 1 1 40 PRO HG2  H   17.120  13.592   1.986 1.00 . A A .  40 PRO HG2  1 1 
       15  9656 1 1 40 PRO HG3  H   16.268  13.854   3.519 1.00 . A A .  40 PRO HG3  1 1 
       15  9657 1 1 40 PRO N    N   14.766  14.635   0.773 1.00 . A A .  40 PRO N    1 1 
       15  9658 1 1 40 PRO O    O   17.330  16.863  -0.456 1.00 . A A .  40 PRO O    1 1 
       15  9659 1 1 41 SER C    C   19.071  15.481  -1.709 1.00 . A A .  41 SER C    1 1 
       15  9660 1 1 41 SER CA   C   17.847  14.616  -1.994 1.00 . A A .  41 SER CA   1 1 
       15  9661 1 1 41 SER CB   C   17.198  15.048  -3.310 1.00 . A A .  41 SER CB   1 1 
       15  9662 1 1 41 SER H    H   16.357  13.912  -0.665 1.00 . A A .  41 SER H    1 1 
       15  9663 1 1 41 SER HA   H   18.161  13.586  -2.078 1.00 . A A .  41 SER HA   1 1 
       15  9664 1 1 41 SER HB2  H   17.959  15.142  -4.070 1.00 . A A .  41 SER HB2  1 1 
       15  9665 1 1 41 SER HB3  H   16.476  14.303  -3.614 1.00 . A A .  41 SER HB3  1 1 
       15  9666 1 1 41 SER HG   H   17.188  16.993  -3.073 1.00 . A A .  41 SER HG   1 1 
       15  9667 1 1 41 SER N    N   16.884  14.703  -0.902 1.00 . A A .  41 SER N    1 1 
       15  9668 1 1 41 SER O    O   19.475  16.297  -2.537 1.00 . A A .  41 SER O    1 1 
       15  9669 1 1 41 SER OG   O   16.537  16.294  -3.168 1.00 . A A .  41 SER OG   1 1 
       15  9670 1 1 42 GLY C    C   21.301  15.758   1.251 1.00 . A A .  42 GLY C    1 1 
       15  9671 1 1 42 GLY CA   C   20.829  16.067  -0.156 1.00 . A A .  42 GLY CA   1 1 
       15  9672 1 1 42 GLY H    H   19.291  14.633   0.091 1.00 . A A .  42 GLY H    1 1 
       15  9673 1 1 42 GLY HA2  H   21.627  15.848  -0.849 1.00 . A A .  42 GLY HA2  1 1 
       15  9674 1 1 42 GLY HA3  H   20.589  17.119  -0.219 1.00 . A A .  42 GLY HA3  1 1 
       15  9675 1 1 42 GLY N    N   19.657  15.297  -0.530 1.00 . A A .  42 GLY N    1 1 
       15  9676 1 1 42 GLY O    O   21.006  14.701   1.809 1.00 . A A .  42 GLY O    1 1 
       15  9677 1 1 43 PRO C    C   21.491  16.604   4.265 1.00 . A A .  43 PRO C    1 1 
       15  9678 1 1 43 PRO CA   C   22.584  16.539   3.204 1.00 . A A .  43 PRO CA   1 1 
       15  9679 1 1 43 PRO CB   C   23.541  17.725   3.349 1.00 . A A .  43 PRO CB   1 1 
       15  9680 1 1 43 PRO CD   C   22.444  17.979   1.241 1.00 . A A .  43 PRO CD   1 1 
       15  9681 1 1 43 PRO CG   C   23.025  18.747   2.396 1.00 . A A .  43 PRO CG   1 1 
       15  9682 1 1 43 PRO HA   H   23.134  15.616   3.311 1.00 . A A .  43 PRO HA   1 1 
       15  9683 1 1 43 PRO HB2  H   23.518  18.087   4.368 1.00 . A A .  43 PRO HB2  1 1 
       15  9684 1 1 43 PRO HB3  H   24.543  17.418   3.094 1.00 . A A .  43 PRO HB3  1 1 
       15  9685 1 1 43 PRO HD2  H   21.583  18.494   0.840 1.00 . A A .  43 PRO HD2  1 1 
       15  9686 1 1 43 PRO HD3  H   23.189  17.832   0.473 1.00 . A A .  43 PRO HD3  1 1 
       15  9687 1 1 43 PRO HG2  H   22.261  19.342   2.873 1.00 . A A .  43 PRO HG2  1 1 
       15  9688 1 1 43 PRO HG3  H   23.835  19.375   2.057 1.00 . A A .  43 PRO HG3  1 1 
       15  9689 1 1 43 PRO N    N   22.053  16.695   1.847 1.00 . A A .  43 PRO N    1 1 
       15  9690 1 1 43 PRO O    O   20.714  17.557   4.312 1.00 . A A .  43 PRO O    1 1 
       15  9691 1 1 44 SER C    C   21.068  15.797   7.535 1.00 . A A .  44 SER C    1 1 
       15  9692 1 1 44 SER CA   C   20.436  15.523   6.174 1.00 . A A .  44 SER CA   1 1 
       15  9693 1 1 44 SER CB   C   19.754  14.153   6.183 1.00 . A A .  44 SER CB   1 1 
       15  9694 1 1 44 SER H    H   22.084  14.853   5.026 1.00 . A A .  44 SER H    1 1 
       15  9695 1 1 44 SER HA   H   19.695  16.283   5.974 1.00 . A A .  44 SER HA   1 1 
       15  9696 1 1 44 SER HB2  H   20.479  13.392   5.940 1.00 . A A .  44 SER HB2  1 1 
       15  9697 1 1 44 SER HB3  H   19.347  13.963   7.165 1.00 . A A .  44 SER HB3  1 1 
       15  9698 1 1 44 SER HG   H   18.142  13.344   5.419 1.00 . A A .  44 SER HG   1 1 
       15  9699 1 1 44 SER N    N   21.437  15.583   5.115 1.00 . A A .  44 SER N    1 1 
       15  9700 1 1 44 SER O    O   22.291  15.817   7.672 1.00 . A A .  44 SER O    1 1 
       15  9701 1 1 44 SER OG   O   18.702  14.102   5.235 1.00 . A A .  44 SER OG   1 1 
       15  9702 1 1 45 SER C    C   21.564  15.142  10.409 1.00 . A A .  45 SER C    1 1 
       15  9703 1 1 45 SER CA   C   20.699  16.287   9.891 1.00 . A A .  45 SER CA   1 1 
       15  9704 1 1 45 SER CB   C   19.515  16.513  10.834 1.00 . A A .  45 SER CB   1 1 
       15  9705 1 1 45 SER H    H   19.260  15.980   8.369 1.00 . A A .  45 SER H    1 1 
       15  9706 1 1 45 SER HA   H   21.296  17.185   9.854 1.00 . A A .  45 SER HA   1 1 
       15  9707 1 1 45 SER HB2  H   18.850  15.664  10.783 1.00 . A A .  45 SER HB2  1 1 
       15  9708 1 1 45 SER HB3  H   19.880  16.625  11.845 1.00 . A A .  45 SER HB3  1 1 
       15  9709 1 1 45 SER HG   H   18.118  17.454   9.834 1.00 . A A .  45 SER HG   1 1 
       15  9710 1 1 45 SER N    N   20.224  16.009   8.540 1.00 . A A .  45 SER N    1 1 
       15  9711 1 1 45 SER O    O   21.077  14.036  10.639 1.00 . A A .  45 SER O    1 1 
       15  9712 1 1 45 SER OG   O   18.795  17.680  10.476 1.00 . A A .  45 SER OG   1 1 
       15  9713 1 1 46 GLY C    C   25.145  14.956  11.375 1.00 . A A .  46 GLY C    1 1 
       15  9714 1 1 46 GLY CA   C   23.766  14.400  11.078 1.00 . A A .  46 GLY CA   1 1 
       15  9715 1 1 46 GLY H    H   23.185  16.316  10.389 1.00 . A A .  46 GLY H    1 1 
       15  9716 1 1 46 GLY HA2  H   23.360  13.971  11.982 1.00 . A A .  46 GLY HA2  1 1 
       15  9717 1 1 46 GLY HA3  H   23.856  13.625  10.332 1.00 . A A .  46 GLY HA3  1 1 
       15  9718 1 1 46 GLY N    N   22.852  15.416  10.589 1.00 . A A .  46 GLY N    1 1 
       15  9719 1 1 46 GLY O    O   26.042  14.806  10.547 1.00 . A A .  46 GLY O    1 1 
       15  9720 2 2  1 ZN  ZN   ZN   2.676  -0.976  -4.789 1.00 . B A . 181 ZN  ZN   1 1 
       16  9721 1 1  1 GLY C    C   -1.646 -28.773 -12.861 1.00 . A A .   1 GLY C    1 1 
       16  9722 1 1  1 GLY CA   C   -2.967 -29.446 -13.175 1.00 . A A .   1 GLY CA   1 1 
       16  9723 1 1  1 GLY H1   H   -3.451 -31.467 -12.766 1.00 . A A .   1 GLY H1   1 1 
       16  9724 1 1  1 GLY HA2  H   -2.970 -29.746 -14.212 1.00 . A A .   1 GLY HA2  1 1 
       16  9725 1 1  1 GLY HA3  H   -3.766 -28.737 -13.013 1.00 . A A .   1 GLY HA3  1 1 
       16  9726 1 1  1 GLY N    N   -3.204 -30.615 -12.348 1.00 . A A .   1 GLY N    1 1 
       16  9727 1 1  1 GLY O    O   -1.466 -28.216 -11.778 1.00 . A A .   1 GLY O    1 1 
       16  9728 1 1  2 SER C    C    1.076 -27.563 -14.919 1.00 . A A .   2 SER C    1 1 
       16  9729 1 1  2 SER CA   C    0.598 -28.221 -13.629 1.00 . A A .   2 SER CA   1 1 
       16  9730 1 1  2 SER CB   C    1.609 -29.276 -13.175 1.00 . A A .   2 SER CB   1 1 
       16  9731 1 1  2 SER H    H   -0.920 -29.285 -14.653 1.00 . A A .   2 SER H    1 1 
       16  9732 1 1  2 SER HA   H    0.511 -27.465 -12.863 1.00 . A A .   2 SER HA   1 1 
       16  9733 1 1  2 SER HB2  H    2.513 -28.786 -12.846 1.00 . A A .   2 SER HB2  1 1 
       16  9734 1 1  2 SER HB3  H    1.189 -29.846 -12.359 1.00 . A A .   2 SER HB3  1 1 
       16  9735 1 1  2 SER HG   H    1.147 -30.658 -14.485 1.00 . A A .   2 SER HG   1 1 
       16  9736 1 1  2 SER N    N   -0.717 -28.826 -13.811 1.00 . A A .   2 SER N    1 1 
       16  9737 1 1  2 SER O    O    0.457 -27.713 -15.972 1.00 . A A .   2 SER O    1 1 
       16  9738 1 1  2 SER OG   O    1.930 -30.162 -14.233 1.00 . A A .   2 SER OG   1 1 
       16  9739 1 1  3 SER C    C    1.683 -25.300 -16.683 1.00 . A A .   3 SER C    1 1 
       16  9740 1 1  3 SER CA   C    2.744 -26.147 -15.986 1.00 . A A .   3 SER CA   1 1 
       16  9741 1 1  3 SER CB   C    3.331 -27.161 -16.971 1.00 . A A .   3 SER CB   1 1 
       16  9742 1 1  3 SER H    H    2.632 -26.751 -13.960 1.00 . A A .   3 SER H    1 1 
       16  9743 1 1  3 SER HA   H    3.534 -25.498 -15.637 1.00 . A A .   3 SER HA   1 1 
       16  9744 1 1  3 SER HB2  H    2.549 -27.822 -17.312 1.00 . A A .   3 SER HB2  1 1 
       16  9745 1 1  3 SER HB3  H    3.753 -26.635 -17.815 1.00 . A A .   3 SER HB3  1 1 
       16  9746 1 1  3 SER HG   H    5.163 -27.427 -16.331 1.00 . A A .   3 SER HG   1 1 
       16  9747 1 1  3 SER N    N    2.183 -26.833 -14.828 1.00 . A A .   3 SER N    1 1 
       16  9748 1 1  3 SER O    O    1.602 -25.273 -17.910 1.00 . A A .   3 SER O    1 1 
       16  9749 1 1  3 SER OG   O    4.349 -27.934 -16.359 1.00 . A A .   3 SER OG   1 1 
       16  9750 1 1  4 GLY C    C   -0.902 -22.970 -15.384 1.00 . A A .   4 GLY C    1 1 
       16  9751 1 1  4 GLY CA   C   -0.175 -23.771 -16.445 1.00 . A A .   4 GLY CA   1 1 
       16  9752 1 1  4 GLY H    H    0.983 -24.670 -14.917 1.00 . A A .   4 GLY H    1 1 
       16  9753 1 1  4 GLY HA2  H    0.266 -23.089 -17.157 1.00 . A A .   4 GLY HA2  1 1 
       16  9754 1 1  4 GLY HA3  H   -0.889 -24.399 -16.958 1.00 . A A .   4 GLY HA3  1 1 
       16  9755 1 1  4 GLY N    N    0.871 -24.609 -15.889 1.00 . A A .   4 GLY N    1 1 
       16  9756 1 1  4 GLY O    O   -0.279 -22.416 -14.478 1.00 . A A .   4 GLY O    1 1 
       16  9757 1 1  5 SER C    C   -4.010 -23.089 -13.817 1.00 . A A .   5 SER C    1 1 
       16  9758 1 1  5 SER CA   C   -3.038 -22.163 -14.541 1.00 . A A .   5 SER CA   1 1 
       16  9759 1 1  5 SER CB   C   -3.811 -21.051 -15.254 1.00 . A A .   5 SER CB   1 1 
       16  9760 1 1  5 SER H    H   -2.665 -23.370 -16.240 1.00 . A A .   5 SER H    1 1 
       16  9761 1 1  5 SER HA   H   -2.374 -21.718 -13.815 1.00 . A A .   5 SER HA   1 1 
       16  9762 1 1  5 SER HB2  H   -4.487 -20.581 -14.556 1.00 . A A .   5 SER HB2  1 1 
       16  9763 1 1  5 SER HB3  H   -3.114 -20.317 -15.631 1.00 . A A .   5 SER HB3  1 1 
       16  9764 1 1  5 SER HG   H   -4.004 -22.140 -16.871 1.00 . A A .   5 SER HG   1 1 
       16  9765 1 1  5 SER N    N   -2.225 -22.907 -15.496 1.00 . A A .   5 SER N    1 1 
       16  9766 1 1  5 SER O    O   -4.440 -24.105 -14.363 1.00 . A A .   5 SER O    1 1 
       16  9767 1 1  5 SER OG   O   -4.562 -21.568 -16.339 1.00 . A A .   5 SER OG   1 1 
       16  9768 1 1  6 SER C    C   -6.718 -23.246 -12.166 1.00 . A A .   6 SER C    1 1 
       16  9769 1 1  6 SER CA   C   -5.269 -23.531 -11.781 1.00 . A A .   6 SER CA   1 1 
       16  9770 1 1  6 SER CB   C   -5.060 -23.247 -10.292 1.00 . A A .   6 SER CB   1 1 
       16  9771 1 1  6 SER H    H   -3.975 -21.910 -12.203 1.00 . A A .   6 SER H    1 1 
       16  9772 1 1  6 SER HA   H   -5.056 -24.572 -11.973 1.00 . A A .   6 SER HA   1 1 
       16  9773 1 1  6 SER HB2  H   -4.029 -23.437 -10.033 1.00 . A A .   6 SER HB2  1 1 
       16  9774 1 1  6 SER HB3  H   -5.297 -22.213 -10.089 1.00 . A A .   6 SER HB3  1 1 
       16  9775 1 1  6 SER HG   H   -5.963 -24.940  -9.897 1.00 . A A .   6 SER HG   1 1 
       16  9776 1 1  6 SER N    N   -4.352 -22.731 -12.583 1.00 . A A .   6 SER N    1 1 
       16  9777 1 1  6 SER O    O   -7.532 -24.160 -12.284 1.00 . A A .   6 SER O    1 1 
       16  9778 1 1  6 SER OG   O   -5.891 -24.072  -9.494 1.00 . A A .   6 SER OG   1 1 
       16  9779 1 1  7 GLY C    C   -8.483 -20.121 -13.112 1.00 . A A .   7 GLY C    1 1 
       16  9780 1 1  7 GLY CA   C   -8.381 -21.584 -12.729 1.00 . A A .   7 GLY CA   1 1 
       16  9781 1 1  7 GLY H    H   -6.341 -21.281 -12.251 1.00 . A A .   7 GLY H    1 1 
       16  9782 1 1  7 GLY HA2  H   -8.700 -22.187 -13.566 1.00 . A A .   7 GLY HA2  1 1 
       16  9783 1 1  7 GLY HA3  H   -9.038 -21.771 -11.892 1.00 . A A .   7 GLY HA3  1 1 
       16  9784 1 1  7 GLY N    N   -7.031 -21.968 -12.360 1.00 . A A .   7 GLY N    1 1 
       16  9785 1 1  7 GLY O    O   -8.044 -19.724 -14.191 1.00 . A A .   7 GLY O    1 1 
       16  9786 1 1  8 GLU C    C   -8.727 -17.068 -11.295 1.00 . A A .   8 GLU C    1 1 
       16  9787 1 1  8 GLU CA   C   -9.224 -17.890 -12.481 1.00 . A A .   8 GLU CA   1 1 
       16  9788 1 1  8 GLU CB   C  -10.691 -17.561 -12.764 1.00 . A A .   8 GLU CB   1 1 
       16  9789 1 1  8 GLU CD   C  -13.044 -18.058 -11.990 1.00 . A A .   8 GLU CD   1 1 
       16  9790 1 1  8 GLU CG   C  -11.609 -17.797 -11.576 1.00 . A A .   8 GLU CG   1 1 
       16  9791 1 1  8 GLU H    H   -9.394 -19.693 -11.384 1.00 . A A .   8 GLU H    1 1 
       16  9792 1 1  8 GLU HA   H   -8.634 -17.640 -13.349 1.00 . A A .   8 GLU HA   1 1 
       16  9793 1 1  8 GLU HB2  H  -10.766 -16.523 -13.051 1.00 . A A .   8 GLU HB2  1 1 
       16  9794 1 1  8 GLU HB3  H  -11.033 -18.177 -13.583 1.00 . A A .   8 GLU HB3  1 1 
       16  9795 1 1  8 GLU HG2  H  -11.249 -18.652 -11.023 1.00 . A A .   8 GLU HG2  1 1 
       16  9796 1 1  8 GLU HG3  H  -11.585 -16.924 -10.941 1.00 . A A .   8 GLU HG3  1 1 
       16  9797 1 1  8 GLU N    N   -9.064 -19.317 -12.227 1.00 . A A .   8 GLU N    1 1 
       16  9798 1 1  8 GLU O    O   -8.801 -17.506 -10.147 1.00 . A A .   8 GLU O    1 1 
       16  9799 1 1  8 GLU OE1  O  -13.586 -17.259 -12.783 1.00 . A A .   8 GLU OE1  1 1 
       16  9800 1 1  8 GLU OE2  O  -13.625 -19.059 -11.521 1.00 . A A .   8 GLU OE2  1 1 
       16  9801 1 1  9 GLY C    C   -7.159 -13.706 -11.068 1.00 . A A .   9 GLY C    1 1 
       16  9802 1 1  9 GLY CA   C   -7.717 -15.009 -10.531 1.00 . A A .   9 GLY CA   1 1 
       16  9803 1 1  9 GLY H    H   -8.186 -15.576 -12.516 1.00 . A A .   9 GLY H    1 1 
       16  9804 1 1  9 GLY HA2  H   -8.522 -14.788  -9.846 1.00 . A A .   9 GLY HA2  1 1 
       16  9805 1 1  9 GLY HA3  H   -6.935 -15.528  -9.996 1.00 . A A .   9 GLY HA3  1 1 
       16  9806 1 1  9 GLY N    N   -8.220 -15.873 -11.582 1.00 . A A .   9 GLY N    1 1 
       16  9807 1 1  9 GLY O    O   -5.973 -13.420 -10.909 1.00 . A A .   9 GLY O    1 1 
       16  9808 1 1 10 GLU C    C   -8.166 -10.475 -11.465 1.00 . A A .  10 GLU C    1 1 
       16  9809 1 1 10 GLU CA   C   -7.599 -11.638 -12.273 1.00 . A A .  10 GLU CA   1 1 
       16  9810 1 1 10 GLU CB   C   -8.050 -11.528 -13.731 1.00 . A A .  10 GLU CB   1 1 
       16  9811 1 1 10 GLU CD   C  -10.013 -11.392 -15.315 1.00 . A A .  10 GLU CD   1 1 
       16  9812 1 1 10 GLU CG   C   -9.529 -11.218 -13.889 1.00 . A A .  10 GLU CG   1 1 
       16  9813 1 1 10 GLU H    H   -8.949 -13.199 -11.802 1.00 . A A .  10 GLU H    1 1 
       16  9814 1 1 10 GLU HA   H   -6.521 -11.594 -12.236 1.00 . A A .  10 GLU HA   1 1 
       16  9815 1 1 10 GLU HB2  H   -7.485 -10.744 -14.212 1.00 . A A .  10 GLU HB2  1 1 
       16  9816 1 1 10 GLU HB3  H   -7.845 -12.464 -14.230 1.00 . A A .  10 GLU HB3  1 1 
       16  9817 1 1 10 GLU HG2  H  -10.093 -11.882 -13.250 1.00 . A A .  10 GLU HG2  1 1 
       16  9818 1 1 10 GLU HG3  H   -9.704 -10.196 -13.587 1.00 . A A .  10 GLU HG3  1 1 
       16  9819 1 1 10 GLU N    N   -8.015 -12.916 -11.708 1.00 . A A .  10 GLU N    1 1 
       16  9820 1 1 10 GLU O    O   -9.349 -10.459 -11.123 1.00 . A A .  10 GLU O    1 1 
       16  9821 1 1 10 GLU OE1  O   -9.369 -10.842 -16.232 1.00 . A A .  10 GLU OE1  1 1 
       16  9822 1 1 10 GLU OE2  O  -11.037 -12.079 -15.514 1.00 . A A .  10 GLU OE2  1 1 
       16  9823 1 1 11 LYS C    C   -7.807  -7.097 -11.285 1.00 . A A .  11 LYS C    1 1 
       16  9824 1 1 11 LYS CA   C   -7.728  -8.333 -10.394 1.00 . A A .  11 LYS CA   1 1 
       16  9825 1 1 11 LYS CB   C   -6.753  -8.082  -9.241 1.00 . A A .  11 LYS CB   1 1 
       16  9826 1 1 11 LYS CD   C   -4.307  -8.141  -8.676 1.00 . A A .  11 LYS CD   1 1 
       16  9827 1 1 11 LYS CE   C   -3.973  -9.621  -8.793 1.00 . A A .  11 LYS CE   1 1 
       16  9828 1 1 11 LYS CG   C   -5.350  -7.724  -9.698 1.00 . A A .  11 LYS CG   1 1 
       16  9829 1 1 11 LYS H    H   -6.383  -9.570 -11.462 1.00 . A A .  11 LYS H    1 1 
       16  9830 1 1 11 LYS HA   H   -8.709  -8.532  -9.988 1.00 . A A .  11 LYS HA   1 1 
       16  9831 1 1 11 LYS HB2  H   -7.131  -7.271  -8.636 1.00 . A A .  11 LYS HB2  1 1 
       16  9832 1 1 11 LYS HB3  H   -6.695  -8.975  -8.635 1.00 . A A .  11 LYS HB3  1 1 
       16  9833 1 1 11 LYS HD2  H   -3.407  -7.567  -8.838 1.00 . A A .  11 LYS HD2  1 1 
       16  9834 1 1 11 LYS HD3  H   -4.688  -7.945  -7.684 1.00 . A A .  11 LYS HD3  1 1 
       16  9835 1 1 11 LYS HE2  H   -3.285  -9.884  -8.004 1.00 . A A .  11 LYS HE2  1 1 
       16  9836 1 1 11 LYS HE3  H   -4.883 -10.191  -8.682 1.00 . A A .  11 LYS HE3  1 1 
       16  9837 1 1 11 LYS HG2  H   -5.146  -8.227 -10.632 1.00 . A A .  11 LYS HG2  1 1 
       16  9838 1 1 11 LYS HG3  H   -5.291  -6.654  -9.843 1.00 . A A .  11 LYS HG3  1 1 
       16  9839 1 1 11 LYS HZ1  H   -2.556 -10.602  -9.973 1.00 . A A .  11 LYS HZ1  1 1 
       16  9840 1 1 11 LYS HZ2  H   -3.003  -9.080 -10.562 1.00 . A A .  11 LYS HZ2  1 1 
       16  9841 1 1 11 LYS HZ3  H   -4.054 -10.394 -10.731 1.00 . A A .  11 LYS HZ3  1 1 
       16  9842 1 1 11 LYS N    N   -7.314  -9.501 -11.162 1.00 . A A .  11 LYS N    1 1 
       16  9843 1 1 11 LYS NZ   N   -3.353  -9.947 -10.107 1.00 . A A .  11 LYS NZ   1 1 
       16  9844 1 1 11 LYS O    O   -7.008  -6.911 -12.202 1.00 . A A .  11 LYS O    1 1 
       16  9845 1 1 12 PRO C    C   -7.894  -3.971 -11.527 1.00 . A A .  12 PRO C    1 1 
       16  9846 1 1 12 PRO CA   C   -8.997  -4.995 -11.773 1.00 . A A .  12 PRO CA   1 1 
       16  9847 1 1 12 PRO CB   C  -10.338  -4.473 -11.250 1.00 . A A .  12 PRO CB   1 1 
       16  9848 1 1 12 PRO CD   C   -9.782  -6.387  -9.930 1.00 . A A .  12 PRO CD   1 1 
       16  9849 1 1 12 PRO CG   C  -10.459  -5.045  -9.880 1.00 . A A .  12 PRO CG   1 1 
       16  9850 1 1 12 PRO HA   H   -9.074  -5.192 -12.832 1.00 . A A .  12 PRO HA   1 1 
       16  9851 1 1 12 PRO HB2  H  -10.322  -3.392 -11.228 1.00 . A A .  12 PRO HB2  1 1 
       16  9852 1 1 12 PRO HB3  H  -11.136  -4.814 -11.892 1.00 . A A .  12 PRO HB3  1 1 
       16  9853 1 1 12 PRO HD2  H   -9.296  -6.600  -8.989 1.00 . A A .  12 PRO HD2  1 1 
       16  9854 1 1 12 PRO HD3  H  -10.495  -7.160 -10.172 1.00 . A A .  12 PRO HD3  1 1 
       16  9855 1 1 12 PRO HG2  H   -9.964  -4.401  -9.168 1.00 . A A .  12 PRO HG2  1 1 
       16  9856 1 1 12 PRO HG3  H  -11.501  -5.161  -9.622 1.00 . A A .  12 PRO HG3  1 1 
       16  9857 1 1 12 PRO N    N   -8.792  -6.230 -11.009 1.00 . A A .  12 PRO N    1 1 
       16  9858 1 1 12 PRO O    O   -7.697  -3.054 -12.324 1.00 . A A .  12 PRO O    1 1 
       16  9859 1 1 13 TYR C    C   -4.933  -3.978  -9.432 1.00 . A A .  13 TYR C    1 1 
       16  9860 1 1 13 TYR CA   C   -6.095  -3.223 -10.069 1.00 . A A .  13 TYR CA   1 1 
       16  9861 1 1 13 TYR CB   C   -6.602  -2.142  -9.113 1.00 . A A .  13 TYR CB   1 1 
       16  9862 1 1 13 TYR CD1  C   -7.879  -0.468 -10.506 1.00 . A A .  13 TYR CD1  1 1 
       16  9863 1 1 13 TYR CD2  C   -9.114  -1.893  -9.048 1.00 . A A .  13 TYR CD2  1 1 
       16  9864 1 1 13 TYR CE1  C   -9.052   0.132 -10.920 1.00 . A A .  13 TYR CE1  1 1 
       16  9865 1 1 13 TYR CE2  C  -10.292  -1.300  -9.458 1.00 . A A .  13 TYR CE2  1 1 
       16  9866 1 1 13 TYR CG   C   -7.888  -1.489  -9.564 1.00 . A A .  13 TYR CG   1 1 
       16  9867 1 1 13 TYR CZ   C  -10.256  -0.287 -10.394 1.00 . A A .  13 TYR CZ   1 1 
       16  9868 1 1 13 TYR H    H   -7.382  -4.886  -9.825 1.00 . A A .  13 TYR H    1 1 
       16  9869 1 1 13 TYR HA   H   -5.750  -2.753 -10.978 1.00 . A A .  13 TYR HA   1 1 
       16  9870 1 1 13 TYR HB2  H   -6.776  -2.582  -8.143 1.00 . A A .  13 TYR HB2  1 1 
       16  9871 1 1 13 TYR HB3  H   -5.851  -1.371  -9.023 1.00 . A A .  13 TYR HB3  1 1 
       16  9872 1 1 13 TYR HD1  H   -6.934  -0.142 -10.917 1.00 . A A .  13 TYR HD1  1 1 
       16  9873 1 1 13 TYR HD2  H   -9.139  -2.687  -8.315 1.00 . A A .  13 TYR HD2  1 1 
       16  9874 1 1 13 TYR HE1  H   -9.024   0.925 -11.653 1.00 . A A .  13 TYR HE1  1 1 
       16  9875 1 1 13 TYR HE2  H  -11.235  -1.628  -9.046 1.00 . A A .  13 TYR HE2  1 1 
       16  9876 1 1 13 TYR HH   H  -11.228   1.005 -11.434 1.00 . A A .  13 TYR HH   1 1 
       16  9877 1 1 13 TYR N    N   -7.178  -4.135 -10.420 1.00 . A A .  13 TYR N    1 1 
       16  9878 1 1 13 TYR O    O   -5.100  -4.653  -8.416 1.00 . A A .  13 TYR O    1 1 
       16  9879 1 1 13 TYR OH   O  -11.427   0.307 -10.805 1.00 . A A .  13 TYR OH   1 1 
       16  9880 1 1 14 GLN C    C   -1.386  -3.563  -9.455 1.00 . A A .  14 GLN C    1 1 
       16  9881 1 1 14 GLN CA   C   -2.564  -4.529  -9.529 1.00 . A A .  14 GLN CA   1 1 
       16  9882 1 1 14 GLN CB   C   -2.207  -5.721 -10.418 1.00 . A A .  14 GLN CB   1 1 
       16  9883 1 1 14 GLN CD   C   -0.560  -7.578 -10.890 1.00 . A A .  14 GLN CD   1 1 
       16  9884 1 1 14 GLN CG   C   -1.043  -6.545  -9.891 1.00 . A A .  14 GLN CG   1 1 
       16  9885 1 1 14 GLN H    H   -3.686  -3.306 -10.843 1.00 . A A .  14 GLN H    1 1 
       16  9886 1 1 14 GLN HA   H   -2.784  -4.886  -8.534 1.00 . A A .  14 GLN HA   1 1 
       16  9887 1 1 14 GLN HB2  H   -3.069  -6.366 -10.498 1.00 . A A .  14 GLN HB2  1 1 
       16  9888 1 1 14 GLN HB3  H   -1.946  -5.357 -11.400 1.00 . A A .  14 GLN HB3  1 1 
       16  9889 1 1 14 GLN HE21 H    1.105  -7.853  -9.838 1.00 . A A .  14 GLN HE21 1 1 
       16  9890 1 1 14 GLN HE22 H    0.955  -8.807 -11.271 1.00 . A A .  14 GLN HE22 1 1 
       16  9891 1 1 14 GLN HG2  H   -0.223  -5.881  -9.660 1.00 . A A .  14 GLN HG2  1 1 
       16  9892 1 1 14 GLN HG3  H   -1.357  -7.054  -8.992 1.00 . A A .  14 GLN HG3  1 1 
       16  9893 1 1 14 GLN N    N   -3.755  -3.858 -10.036 1.00 . A A .  14 GLN N    1 1 
       16  9894 1 1 14 GLN NE2  N    0.619  -8.136 -10.642 1.00 . A A .  14 GLN NE2  1 1 
       16  9895 1 1 14 GLN O    O   -0.872  -3.115 -10.479 1.00 . A A .  14 GLN O    1 1 
       16  9896 1 1 14 GLN OE1  O   -1.240  -7.872 -11.874 1.00 . A A .  14 GLN OE1  1 1 
       16  9897 1 1 15 CYS C    C    1.444  -2.913  -8.599 1.00 . A A .  15 CYS C    1 1 
       16  9898 1 1 15 CYS CA   C    0.154  -2.334  -8.026 1.00 . A A .  15 CYS CA   1 1 
       16  9899 1 1 15 CYS CB   C    0.331  -2.044  -6.534 1.00 . A A .  15 CYS CB   1 1 
       16  9900 1 1 15 CYS H    H   -1.414  -3.637  -7.456 1.00 . A A .  15 CYS H    1 1 
       16  9901 1 1 15 CYS HA   H   -0.071  -1.411  -8.539 1.00 . A A .  15 CYS HA   1 1 
       16  9902 1 1 15 CYS HB2  H   -0.628  -1.785  -6.110 1.00 . A A .  15 CYS HB2  1 1 
       16  9903 1 1 15 CYS HB3  H    0.708  -2.930  -6.046 1.00 . A A .  15 CYS HB3  1 1 
       16  9904 1 1 15 CYS N    N   -0.963  -3.247  -8.235 1.00 . A A .  15 CYS N    1 1 
       16  9905 1 1 15 CYS O    O    2.058  -3.798  -8.003 1.00 . A A .  15 CYS O    1 1 
       16  9906 1 1 15 CYS SG   S    1.481  -0.678  -6.173 1.00 . A A .  15 CYS SG   1 1 
       16  9907 1 1 16 SER C    C    4.302  -2.472  -9.620 1.00 . A A .  16 SER C    1 1 
       16  9908 1 1 16 SER CA   C    3.065  -2.875 -10.416 1.00 . A A .  16 SER CA   1 1 
       16  9909 1 1 16 SER CB   C    3.152  -2.313 -11.836 1.00 . A A .  16 SER CB   1 1 
       16  9910 1 1 16 SER H    H    1.317  -1.703 -10.186 1.00 . A A .  16 SER H    1 1 
       16  9911 1 1 16 SER HA   H    3.019  -3.953 -10.466 1.00 . A A .  16 SER HA   1 1 
       16  9912 1 1 16 SER HB2  H    2.210  -2.467 -12.340 1.00 . A A .  16 SER HB2  1 1 
       16  9913 1 1 16 SER HB3  H    3.367  -1.255 -11.789 1.00 . A A .  16 SER HB3  1 1 
       16  9914 1 1 16 SER HG   H    4.514  -2.353 -13.243 1.00 . A A .  16 SER HG   1 1 
       16  9915 1 1 16 SER N    N    1.850  -2.407  -9.760 1.00 . A A .  16 SER N    1 1 
       16  9916 1 1 16 SER O    O    5.242  -3.253  -9.477 1.00 . A A .  16 SER O    1 1 
       16  9917 1 1 16 SER OG   O    4.176  -2.955 -12.576 1.00 . A A .  16 SER OG   1 1 
       16  9918 1 1 17 GLU C    C    6.021  -1.842  -7.461 1.00 . A A .  17 GLU C    1 1 
       16  9919 1 1 17 GLU CA   C    5.415  -0.739  -8.323 1.00 . A A .  17 GLU CA   1 1 
       16  9920 1 1 17 GLU CB   C    4.963   0.425  -7.439 1.00 . A A .  17 GLU CB   1 1 
       16  9921 1 1 17 GLU CD   C    5.575   2.480  -8.775 1.00 . A A .  17 GLU CD   1 1 
       16  9922 1 1 17 GLU CG   C    4.453   1.623  -8.222 1.00 . A A .  17 GLU CG   1 1 
       16  9923 1 1 17 GLU H    H    3.514  -0.671  -9.253 1.00 . A A .  17 GLU H    1 1 
       16  9924 1 1 17 GLU HA   H    6.165  -0.384  -9.013 1.00 . A A .  17 GLU HA   1 1 
       16  9925 1 1 17 GLU HB2  H    4.172   0.082  -6.788 1.00 . A A .  17 GLU HB2  1 1 
       16  9926 1 1 17 GLU HB3  H    5.799   0.747  -6.834 1.00 . A A .  17 GLU HB3  1 1 
       16  9927 1 1 17 GLU HG2  H    3.852   1.269  -9.046 1.00 . A A .  17 GLU HG2  1 1 
       16  9928 1 1 17 GLU HG3  H    3.844   2.231  -7.569 1.00 . A A .  17 GLU HG3  1 1 
       16  9929 1 1 17 GLU N    N    4.293  -1.247  -9.104 1.00 . A A .  17 GLU N    1 1 
       16  9930 1 1 17 GLU O    O    7.194  -2.188  -7.609 1.00 . A A .  17 GLU O    1 1 
       16  9931 1 1 17 GLU OE1  O    6.558   1.908  -9.292 1.00 . A A .  17 GLU OE1  1 1 
       16  9932 1 1 17 GLU OE2  O    5.472   3.721  -8.690 1.00 . A A .  17 GLU OE2  1 1 
       16  9933 1 1 18 CYS C    C    5.113  -4.805  -6.111 1.00 . A A .  18 CYS C    1 1 
       16  9934 1 1 18 CYS CA   C    5.669  -3.454  -5.671 1.00 . A A .  18 CYS CA   1 1 
       16  9935 1 1 18 CYS CB   C    5.246  -3.160  -4.231 1.00 . A A .  18 CYS CB   1 1 
       16  9936 1 1 18 CYS H    H    4.289  -2.073  -6.488 1.00 . A A .  18 CYS H    1 1 
       16  9937 1 1 18 CYS HA   H    6.747  -3.489  -5.721 1.00 . A A .  18 CYS HA   1 1 
       16  9938 1 1 18 CYS HB2  H    5.505  -4.004  -3.608 1.00 . A A .  18 CYS HB2  1 1 
       16  9939 1 1 18 CYS HB3  H    5.774  -2.286  -3.880 1.00 . A A .  18 CYS HB3  1 1 
       16  9940 1 1 18 CYS N    N    5.214  -2.391  -6.559 1.00 . A A .  18 CYS N    1 1 
       16  9941 1 1 18 CYS O    O    5.841  -5.793  -6.188 1.00 . A A .  18 CYS O    1 1 
       16  9942 1 1 18 CYS SG   S    3.463  -2.850  -4.028 1.00 . A A .  18 CYS SG   1 1 
       16  9943 1 1 19 GLY C    C    2.092  -6.526  -5.876 1.00 . A A .  19 GLY C    1 1 
       16  9944 1 1 19 GLY CA   C    3.182  -6.073  -6.827 1.00 . A A .  19 GLY CA   1 1 
       16  9945 1 1 19 GLY H    H    3.283  -4.020  -6.319 1.00 . A A .  19 GLY H    1 1 
       16  9946 1 1 19 GLY HA2  H    2.752  -5.923  -7.806 1.00 . A A .  19 GLY HA2  1 1 
       16  9947 1 1 19 GLY HA3  H    3.934  -6.847  -6.889 1.00 . A A .  19 GLY HA3  1 1 
       16  9948 1 1 19 GLY N    N    3.815  -4.839  -6.399 1.00 . A A .  19 GLY N    1 1 
       16  9949 1 1 19 GLY O    O    1.974  -7.714  -5.575 1.00 . A A .  19 GLY O    1 1 
       16  9950 1 1 20 LYS C    C   -1.146  -5.766  -5.170 1.00 . A A .  20 LYS C    1 1 
       16  9951 1 1 20 LYS CA   C    0.207  -5.884  -4.476 1.00 . A A .  20 LYS CA   1 1 
       16  9952 1 1 20 LYS CB   C    0.257  -4.945  -3.268 1.00 . A A .  20 LYS CB   1 1 
       16  9953 1 1 20 LYS CD   C    0.192  -4.978  -0.758 1.00 . A A .  20 LYS CD   1 1 
       16  9954 1 1 20 LYS CE   C    1.376  -5.832  -0.332 1.00 . A A .  20 LYS CE   1 1 
       16  9955 1 1 20 LYS CG   C   -0.439  -5.500  -2.038 1.00 . A A .  20 LYS CG   1 1 
       16  9956 1 1 20 LYS H    H    1.437  -4.648  -5.676 1.00 . A A .  20 LYS H    1 1 
       16  9957 1 1 20 LYS HA   H    0.337  -6.900  -4.137 1.00 . A A .  20 LYS HA   1 1 
       16  9958 1 1 20 LYS HB2  H    1.290  -4.755  -3.018 1.00 . A A .  20 LYS HB2  1 1 
       16  9959 1 1 20 LYS HB3  H   -0.218  -4.011  -3.534 1.00 . A A .  20 LYS HB3  1 1 
       16  9960 1 1 20 LYS HD2  H    0.532  -3.967  -0.920 1.00 . A A .  20 LYS HD2  1 1 
       16  9961 1 1 20 LYS HD3  H   -0.550  -4.989   0.029 1.00 . A A .  20 LYS HD3  1 1 
       16  9962 1 1 20 LYS HE2  H    2.018  -5.986  -1.186 1.00 . A A .  20 LYS HE2  1 1 
       16  9963 1 1 20 LYS HE3  H    1.922  -5.308   0.439 1.00 . A A .  20 LYS HE3  1 1 
       16  9964 1 1 20 LYS HG2  H   -1.478  -5.207  -2.060 1.00 . A A .  20 LYS HG2  1 1 
       16  9965 1 1 20 LYS HG3  H   -0.367  -6.579  -2.050 1.00 . A A .  20 LYS HG3  1 1 
       16  9966 1 1 20 LYS HZ1  H    0.106  -7.491  -0.321 1.00 . A A .  20 LYS HZ1  1 1 
       16  9967 1 1 20 LYS HZ2  H    0.709  -7.079   1.206 1.00 . A A .  20 LYS HZ2  1 1 
       16  9968 1 1 20 LYS HZ3  H    1.709  -7.852   0.082 1.00 . A A .  20 LYS HZ3  1 1 
       16  9969 1 1 20 LYS N    N    1.293  -5.577  -5.399 1.00 . A A .  20 LYS N    1 1 
       16  9970 1 1 20 LYS NZ   N    0.944  -7.156   0.195 1.00 . A A .  20 LYS NZ   1 1 
       16  9971 1 1 20 LYS O    O   -1.222  -5.416  -6.348 1.00 . A A .  20 LYS O    1 1 
       16  9972 1 1 21 SER C    C   -4.493  -5.239  -4.027 1.00 . A A .  21 SER C    1 1 
       16  9973 1 1 21 SER CA   C   -3.563  -5.987  -4.977 1.00 . A A .  21 SER CA   1 1 
       16  9974 1 1 21 SER CB   C   -4.105  -7.393  -5.238 1.00 . A A .  21 SER CB   1 1 
       16  9975 1 1 21 SER H    H   -2.087  -6.331  -3.499 1.00 . A A .  21 SER H    1 1 
       16  9976 1 1 21 SER HA   H   -3.514  -5.450  -5.913 1.00 . A A .  21 SER HA   1 1 
       16  9977 1 1 21 SER HB2  H   -3.519  -7.865  -6.012 1.00 . A A .  21 SER HB2  1 1 
       16  9978 1 1 21 SER HB3  H   -4.038  -7.976  -4.331 1.00 . A A .  21 SER HB3  1 1 
       16  9979 1 1 21 SER HG   H   -5.579  -6.630  -6.279 1.00 . A A .  21 SER HG   1 1 
       16  9980 1 1 21 SER N    N   -2.212  -6.058  -4.432 1.00 . A A .  21 SER N    1 1 
       16  9981 1 1 21 SER O    O   -4.274  -5.215  -2.816 1.00 . A A .  21 SER O    1 1 
       16  9982 1 1 21 SER OG   O   -5.459  -7.349  -5.654 1.00 . A A .  21 SER OG   1 1 
       16  9983 1 1 22 PHE C    C   -7.853  -3.821  -4.491 1.00 . A A .  22 PHE C    1 1 
       16  9984 1 1 22 PHE CA   C   -6.498  -3.879  -3.791 1.00 . A A .  22 PHE CA   1 1 
       16  9985 1 1 22 PHE CB   C   -5.984  -2.461  -3.531 1.00 . A A .  22 PHE CB   1 1 
       16  9986 1 1 22 PHE CD1  C   -4.826  -2.368  -1.307 1.00 . A A .  22 PHE CD1  1 1 
       16  9987 1 1 22 PHE CD2  C   -3.488  -2.431  -3.280 1.00 . A A .  22 PHE CD2  1 1 
       16  9988 1 1 22 PHE CE1  C   -3.683  -2.328  -0.531 1.00 . A A .  22 PHE CE1  1 1 
       16  9989 1 1 22 PHE CE2  C   -2.342  -2.392  -2.508 1.00 . A A .  22 PHE CE2  1 1 
       16  9990 1 1 22 PHE CG   C   -4.741  -2.419  -2.689 1.00 . A A .  22 PHE CG   1 1 
       16  9991 1 1 22 PHE CZ   C   -2.440  -2.342  -1.132 1.00 . A A .  22 PHE CZ   1 1 
       16  9992 1 1 22 PHE H    H   -5.655  -4.685  -5.558 1.00 . A A .  22 PHE H    1 1 
       16  9993 1 1 22 PHE HA   H   -6.616  -4.389  -2.847 1.00 . A A .  22 PHE HA   1 1 
       16  9994 1 1 22 PHE HB2  H   -5.761  -1.988  -4.475 1.00 . A A .  22 PHE HB2  1 1 
       16  9995 1 1 22 PHE HB3  H   -6.751  -1.896  -3.022 1.00 . A A .  22 PHE HB3  1 1 
       16  9996 1 1 22 PHE HD1  H   -5.797  -2.359  -0.835 1.00 . A A .  22 PHE HD1  1 1 
       16  9997 1 1 22 PHE HD2  H   -3.410  -2.471  -4.358 1.00 . A A .  22 PHE HD2  1 1 
       16  9998 1 1 22 PHE HE1  H   -3.763  -2.289   0.546 1.00 . A A .  22 PHE HE1  1 1 
       16  9999 1 1 22 PHE HE2  H   -1.371  -2.402  -2.982 1.00 . A A .  22 PHE HE2  1 1 
       16 10000 1 1 22 PHE HZ   H   -1.546  -2.310  -0.527 1.00 . A A .  22 PHE HZ   1 1 
       16 10001 1 1 22 PHE N    N   -5.533  -4.629  -4.586 1.00 . A A .  22 PHE N    1 1 
       16 10002 1 1 22 PHE O    O   -7.940  -3.476  -5.669 1.00 . A A .  22 PHE O    1 1 
       16 10003 1 1 23 SER C    C  -10.860  -2.752  -4.246 1.00 . A A .  23 SER C    1 1 
       16 10004 1 1 23 SER CA   C  -10.257  -4.152  -4.307 1.00 . A A .  23 SER CA   1 1 
       16 10005 1 1 23 SER CB   C  -11.147  -5.137  -3.546 1.00 . A A .  23 SER CB   1 1 
       16 10006 1 1 23 SER H    H   -8.773  -4.427  -2.822 1.00 . A A .  23 SER H    1 1 
       16 10007 1 1 23 SER HA   H  -10.196  -4.460  -5.340 1.00 . A A .  23 SER HA   1 1 
       16 10008 1 1 23 SER HB2  H  -11.192  -4.848  -2.507 1.00 . A A .  23 SER HB2  1 1 
       16 10009 1 1 23 SER HB3  H  -12.142  -5.118  -3.968 1.00 . A A .  23 SER HB3  1 1 
       16 10010 1 1 23 SER HG   H   -9.687  -6.425  -3.760 1.00 . A A .  23 SER HG   1 1 
       16 10011 1 1 23 SER N    N   -8.907  -4.161  -3.756 1.00 . A A .  23 SER N    1 1 
       16 10012 1 1 23 SER O    O  -11.975  -2.564  -3.761 1.00 . A A .  23 SER O    1 1 
       16 10013 1 1 23 SER OG   O  -10.638  -6.456  -3.633 1.00 . A A .  23 SER OG   1 1 
       16 10014 1 1 24 GLY C    C   -9.803   0.492  -5.675 1.00 . A A .  24 GLY C    1 1 
       16 10015 1 1 24 GLY CA   C  -10.588  -0.399  -4.733 1.00 . A A .  24 GLY CA   1 1 
       16 10016 1 1 24 GLY H    H   -9.230  -1.979  -5.114 1.00 . A A .  24 GLY H    1 1 
       16 10017 1 1 24 GLY HA2  H  -11.627  -0.388  -5.026 1.00 . A A .  24 GLY HA2  1 1 
       16 10018 1 1 24 GLY HA3  H  -10.502  -0.007  -3.730 1.00 . A A .  24 GLY HA3  1 1 
       16 10019 1 1 24 GLY N    N  -10.112  -1.770  -4.741 1.00 . A A .  24 GLY N    1 1 
       16 10020 1 1 24 GLY O    O   -8.579   0.394  -5.758 1.00 . A A .  24 GLY O    1 1 
       16 10021 1 1 25 SER C    C   -9.154   3.403  -6.601 1.00 . A A .  25 SER C    1 1 
       16 10022 1 1 25 SER CA   C   -9.871   2.273  -7.334 1.00 . A A .  25 SER CA   1 1 
       16 10023 1 1 25 SER CB   C  -10.909   2.852  -8.297 1.00 . A A .  25 SER CB   1 1 
       16 10024 1 1 25 SER H    H  -11.482   1.394  -6.278 1.00 . A A .  25 SER H    1 1 
       16 10025 1 1 25 SER HA   H   -9.145   1.707  -7.898 1.00 . A A .  25 SER HA   1 1 
       16 10026 1 1 25 SER HB2  H  -10.404   3.381  -9.090 1.00 . A A .  25 SER HB2  1 1 
       16 10027 1 1 25 SER HB3  H  -11.495   2.047  -8.716 1.00 . A A .  25 SER HB3  1 1 
       16 10028 1 1 25 SER HG   H  -11.773   4.597  -8.082 1.00 . A A .  25 SER HG   1 1 
       16 10029 1 1 25 SER N    N  -10.509   1.364  -6.388 1.00 . A A .  25 SER N    1 1 
       16 10030 1 1 25 SER O    O   -8.051   3.800  -6.978 1.00 . A A .  25 SER O    1 1 
       16 10031 1 1 25 SER OG   O  -11.778   3.750  -7.629 1.00 . A A .  25 SER OG   1 1 
       16 10032 1 1 26 TYR C    C   -8.178   4.471  -3.780 1.00 . A A .  26 TYR C    1 1 
       16 10033 1 1 26 TYR CA   C   -9.213   5.002  -4.768 1.00 . A A .  26 TYR CA   1 1 
       16 10034 1 1 26 TYR CB   C  -10.313   5.754  -4.018 1.00 . A A .  26 TYR CB   1 1 
       16 10035 1 1 26 TYR CD1  C   -9.456   8.117  -3.769 1.00 . A A .  26 TYR CD1  1 1 
       16 10036 1 1 26 TYR CD2  C   -9.651   6.778  -1.806 1.00 . A A .  26 TYR CD2  1 1 
       16 10037 1 1 26 TYR CE1  C   -8.984   9.170  -3.010 1.00 . A A .  26 TYR CE1  1 1 
       16 10038 1 1 26 TYR CE2  C   -9.181   7.827  -1.039 1.00 . A A .  26 TYR CE2  1 1 
       16 10039 1 1 26 TYR CG   C   -9.797   6.904  -3.182 1.00 . A A .  26 TYR CG   1 1 
       16 10040 1 1 26 TYR CZ   C   -8.849   9.020  -1.645 1.00 . A A .  26 TYR CZ   1 1 
       16 10041 1 1 26 TYR H    H  -10.664   3.557  -5.301 1.00 . A A .  26 TYR H    1 1 
       16 10042 1 1 26 TYR HA   H   -8.726   5.683  -5.451 1.00 . A A .  26 TYR HA   1 1 
       16 10043 1 1 26 TYR HB2  H  -11.018   6.153  -4.730 1.00 . A A .  26 TYR HB2  1 1 
       16 10044 1 1 26 TYR HB3  H  -10.824   5.068  -3.358 1.00 . A A .  26 TYR HB3  1 1 
       16 10045 1 1 26 TYR HD1  H   -9.563   8.231  -4.838 1.00 . A A .  26 TYR HD1  1 1 
       16 10046 1 1 26 TYR HD2  H   -9.912   5.842  -1.334 1.00 . A A .  26 TYR HD2  1 1 
       16 10047 1 1 26 TYR HE1  H   -8.724  10.105  -3.484 1.00 . A A .  26 TYR HE1  1 1 
       16 10048 1 1 26 TYR HE2  H   -9.075   7.710   0.030 1.00 . A A .  26 TYR HE2  1 1 
       16 10049 1 1 26 TYR HH   H   -7.964  10.716  -1.456 1.00 . A A .  26 TYR HH   1 1 
       16 10050 1 1 26 TYR N    N   -9.788   3.916  -5.553 1.00 . A A .  26 TYR N    1 1 
       16 10051 1 1 26 TYR O    O   -7.069   4.996  -3.684 1.00 . A A .  26 TYR O    1 1 
       16 10052 1 1 26 TYR OH   O   -8.380  10.067  -0.885 1.00 . A A .  26 TYR OH   1 1 
       16 10053 1 1 27 ARG C    C   -6.268   2.605  -2.658 1.00 . A A .  27 ARG C    1 1 
       16 10054 1 1 27 ARG CA   C   -7.657   2.825  -2.066 1.00 . A A .  27 ARG CA   1 1 
       16 10055 1 1 27 ARG CB   C   -8.229   1.495  -1.572 1.00 . A A .  27 ARG CB   1 1 
       16 10056 1 1 27 ARG CD   C   -8.854   2.014   0.806 1.00 . A A .  27 ARG CD   1 1 
       16 10057 1 1 27 ARG CG   C   -9.368   1.653  -0.579 1.00 . A A .  27 ARG CG   1 1 
       16 10058 1 1 27 ARG CZ   C   -9.764   2.798   2.951 1.00 . A A .  27 ARG CZ   1 1 
       16 10059 1 1 27 ARG H    H   -9.448   3.053  -3.169 1.00 . A A .  27 ARG H    1 1 
       16 10060 1 1 27 ARG HA   H   -7.575   3.504  -1.230 1.00 . A A .  27 ARG HA   1 1 
       16 10061 1 1 27 ARG HB2  H   -8.595   0.936  -2.421 1.00 . A A .  27 ARG HB2  1 1 
       16 10062 1 1 27 ARG HB3  H   -7.440   0.933  -1.095 1.00 . A A .  27 ARG HB3  1 1 
       16 10063 1 1 27 ARG HD2  H   -8.258   1.195   1.180 1.00 . A A .  27 ARG HD2  1 1 
       16 10064 1 1 27 ARG HD3  H   -8.240   2.899   0.727 1.00 . A A .  27 ARG HD3  1 1 
       16 10065 1 1 27 ARG HE   H  -10.852   2.047   1.458 1.00 . A A .  27 ARG HE   1 1 
       16 10066 1 1 27 ARG HG2  H  -10.026   2.437  -0.922 1.00 . A A .  27 ARG HG2  1 1 
       16 10067 1 1 27 ARG HG3  H   -9.913   0.723  -0.520 1.00 . A A .  27 ARG HG3  1 1 
       16 10068 1 1 27 ARG HH11 H   -7.759   2.962   2.768 1.00 . A A .  27 ARG HH11 1 1 
       16 10069 1 1 27 ARG HH12 H   -8.413   3.511   4.275 1.00 . A A .  27 ARG HH12 1 1 
       16 10070 1 1 27 ARG HH21 H  -11.726   2.766   3.438 1.00 . A A .  27 ARG HH21 1 1 
       16 10071 1 1 27 ARG HH22 H  -10.669   3.398   4.656 1.00 . A A .  27 ARG HH22 1 1 
       16 10072 1 1 27 ARG N    N   -8.551   3.427  -3.047 1.00 . A A .  27 ARG N    1 1 
       16 10073 1 1 27 ARG NE   N   -9.943   2.274   1.744 1.00 . A A .  27 ARG NE   1 1 
       16 10074 1 1 27 ARG NH1  N   -8.545   3.116   3.366 1.00 . A A .  27 ARG NH1  1 1 
       16 10075 1 1 27 ARG NH2  N  -10.805   3.004   3.747 1.00 . A A .  27 ARG NH2  1 1 
       16 10076 1 1 27 ARG O    O   -5.256   2.908  -2.025 1.00 . A A .  27 ARG O    1 1 
       16 10077 1 1 28 LEU C    C   -4.059   3.043  -4.515 1.00 . A A .  28 LEU C    1 1 
       16 10078 1 1 28 LEU CA   C   -4.962   1.814  -4.555 1.00 . A A .  28 LEU CA   1 1 
       16 10079 1 1 28 LEU CB   C   -5.215   1.400  -6.005 1.00 . A A .  28 LEU CB   1 1 
       16 10080 1 1 28 LEU CD1  C   -3.675  -0.465  -6.663 1.00 . A A .  28 LEU CD1  1 1 
       16 10081 1 1 28 LEU CD2  C   -4.175   1.371  -8.286 1.00 . A A .  28 LEU CD2  1 1 
       16 10082 1 1 28 LEU CG   C   -3.979   1.017  -6.819 1.00 . A A .  28 LEU CG   1 1 
       16 10083 1 1 28 LEU H    H   -7.066   1.855  -4.331 1.00 . A A .  28 LEU H    1 1 
       16 10084 1 1 28 LEU HA   H   -4.470   1.004  -4.038 1.00 . A A .  28 LEU HA   1 1 
       16 10085 1 1 28 LEU HB2  H   -5.880   0.550  -5.995 1.00 . A A .  28 LEU HB2  1 1 
       16 10086 1 1 28 LEU HB3  H   -5.699   2.227  -6.505 1.00 . A A .  28 LEU HB3  1 1 
       16 10087 1 1 28 LEU HD11 H   -4.537  -0.968  -6.254 1.00 . A A .  28 LEU HD11 1 1 
       16 10088 1 1 28 LEU HD12 H   -2.834  -0.592  -5.997 1.00 . A A .  28 LEU HD12 1 1 
       16 10089 1 1 28 LEU HD13 H   -3.435  -0.887  -7.628 1.00 . A A .  28 LEU HD13 1 1 
       16 10090 1 1 28 LEU HD21 H   -4.776   2.265  -8.363 1.00 . A A .  28 LEU HD21 1 1 
       16 10091 1 1 28 LEU HD22 H   -4.675   0.557  -8.789 1.00 . A A .  28 LEU HD22 1 1 
       16 10092 1 1 28 LEU HD23 H   -3.213   1.543  -8.747 1.00 . A A .  28 LEU HD23 1 1 
       16 10093 1 1 28 LEU HG   H   -3.127   1.572  -6.451 1.00 . A A .  28 LEU HG   1 1 
       16 10094 1 1 28 LEU N    N   -6.227   2.076  -3.876 1.00 . A A .  28 LEU N    1 1 
       16 10095 1 1 28 LEU O    O   -2.932   2.984  -4.022 1.00 . A A .  28 LEU O    1 1 
       16 10096 1 1 29 THR C    C   -3.135   5.663  -3.714 1.00 . A A .  29 THR C    1 1 
       16 10097 1 1 29 THR CA   C   -3.802   5.401  -5.060 1.00 . A A .  29 THR CA   1 1 
       16 10098 1 1 29 THR CB   C   -4.699   6.601  -5.418 1.00 . A A .  29 THR CB   1 1 
       16 10099 1 1 29 THR CG2  C   -3.864   7.854  -5.637 1.00 . A A .  29 THR CG2  1 1 
       16 10100 1 1 29 THR H    H   -5.466   4.142  -5.414 1.00 . A A .  29 THR H    1 1 
       16 10101 1 1 29 THR HA   H   -3.038   5.311  -5.818 1.00 . A A .  29 THR HA   1 1 
       16 10102 1 1 29 THR HB   H   -5.380   6.779  -4.598 1.00 . A A .  29 THR HB   1 1 
       16 10103 1 1 29 THR HG1  H   -4.955   5.715  -7.161 1.00 . A A .  29 THR HG1  1 1 
       16 10104 1 1 29 THR HG21 H   -3.043   7.866  -4.937 1.00 . A A .  29 THR HG21 1 1 
       16 10105 1 1 29 THR HG22 H   -4.480   8.728  -5.485 1.00 . A A .  29 THR HG22 1 1 
       16 10106 1 1 29 THR HG23 H   -3.477   7.857  -6.646 1.00 . A A .  29 THR HG23 1 1 
       16 10107 1 1 29 THR N    N   -4.562   4.158  -5.036 1.00 . A A .  29 THR N    1 1 
       16 10108 1 1 29 THR O    O   -1.920   5.845  -3.639 1.00 . A A .  29 THR O    1 1 
       16 10109 1 1 29 THR OG1  O   -5.454   6.313  -6.599 1.00 . A A .  29 THR OG1  1 1 
       16 10110 1 1 30 GLN C    C   -2.138   5.136  -1.072 1.00 . A A .  30 GLN C    1 1 
       16 10111 1 1 30 GLN CA   C   -3.423   5.921  -1.312 1.00 . A A .  30 GLN CA   1 1 
       16 10112 1 1 30 GLN CB   C   -4.471   5.538  -0.265 1.00 . A A .  30 GLN CB   1 1 
       16 10113 1 1 30 GLN CD   C   -5.400   7.823   0.283 1.00 . A A .  30 GLN CD   1 1 
       16 10114 1 1 30 GLN CG   C   -5.694   6.442  -0.269 1.00 . A A .  30 GLN CG   1 1 
       16 10115 1 1 30 GLN H    H   -4.897   5.530  -2.779 1.00 . A A .  30 GLN H    1 1 
       16 10116 1 1 30 GLN HA   H   -3.208   6.975  -1.223 1.00 . A A .  30 GLN HA   1 1 
       16 10117 1 1 30 GLN HB2  H   -4.797   4.526  -0.453 1.00 . A A .  30 GLN HB2  1 1 
       16 10118 1 1 30 GLN HB3  H   -4.018   5.586   0.714 1.00 . A A .  30 GLN HB3  1 1 
       16 10119 1 1 30 GLN HE21 H   -6.321   7.365   1.984 1.00 . A A .  30 GLN HE21 1 1 
       16 10120 1 1 30 GLN HE22 H   -5.664   8.960   1.892 1.00 . A A .  30 GLN HE22 1 1 
       16 10121 1 1 30 GLN HG2  H   -6.046   6.545  -1.285 1.00 . A A .  30 GLN HG2  1 1 
       16 10122 1 1 30 GLN HG3  H   -6.464   5.985   0.333 1.00 . A A .  30 GLN HG3  1 1 
       16 10123 1 1 30 GLN N    N   -3.937   5.681  -2.655 1.00 . A A .  30 GLN N    1 1 
       16 10124 1 1 30 GLN NE2  N   -5.840   8.075   1.510 1.00 . A A .  30 GLN NE2  1 1 
       16 10125 1 1 30 GLN O    O   -1.149   5.679  -0.578 1.00 . A A .  30 GLN O    1 1 
       16 10126 1 1 30 GLN OE1  O   -4.786   8.654  -0.386 1.00 . A A .  30 GLN OE1  1 1 
       16 10127 1 1 31 HIS C    C    0.160   3.453  -2.138 1.00 . A A .  31 HIS C    1 1 
       16 10128 1 1 31 HIS CA   C   -0.993   2.995  -1.250 1.00 . A A .  31 HIS CA   1 1 
       16 10129 1 1 31 HIS CB   C   -1.352   1.543  -1.569 1.00 . A A .  31 HIS CB   1 1 
       16 10130 1 1 31 HIS CD2  C    0.317   0.266  -3.089 1.00 . A A .  31 HIS CD2  1 1 
       16 10131 1 1 31 HIS CE1  C    1.628  -0.534  -1.524 1.00 . A A .  31 HIS CE1  1 1 
       16 10132 1 1 31 HIS CG   C   -0.165   0.691  -1.897 1.00 . A A .  31 HIS CG   1 1 
       16 10133 1 1 31 HIS H    H   -2.975   3.480  -1.816 1.00 . A A .  31 HIS H    1 1 
       16 10134 1 1 31 HIS HA   H   -0.684   3.062  -0.218 1.00 . A A .  31 HIS HA   1 1 
       16 10135 1 1 31 HIS HB2  H   -1.848   1.106  -0.715 1.00 . A A .  31 HIS HB2  1 1 
       16 10136 1 1 31 HIS HB3  H   -2.022   1.522  -2.417 1.00 . A A .  31 HIS HB3  1 1 
       16 10137 1 1 31 HIS HD1  H    0.592   0.302   0.030 1.00 . A A .  31 HIS HD1  1 1 
       16 10138 1 1 31 HIS HD2  H   -0.097   0.484  -4.063 1.00 . A A .  31 HIS HD2  1 1 
       16 10139 1 1 31 HIS HE1  H    2.428  -1.056  -1.022 1.00 . A A .  31 HIS HE1  1 1 
       16 10140 1 1 31 HIS N    N   -2.158   3.855  -1.426 1.00 . A A .  31 HIS N    1 1 
       16 10141 1 1 31 HIS ND1  N    0.677   0.172  -0.937 1.00 . A A .  31 HIS ND1  1 1 
       16 10142 1 1 31 HIS NE2  N    1.432  -0.493  -2.829 1.00 . A A .  31 HIS NE2  1 1 
       16 10143 1 1 31 HIS O    O    1.273   3.676  -1.661 1.00 . A A .  31 HIS O    1 1 
       16 10144 1 1 32 TRP C    C    1.726   5.173  -3.820 1.00 . A A .  32 TRP C    1 1 
       16 10145 1 1 32 TRP CA   C    0.902   4.021  -4.385 1.00 . A A .  32 TRP CA   1 1 
       16 10146 1 1 32 TRP CB   C    0.247   4.444  -5.701 1.00 . A A .  32 TRP CB   1 1 
       16 10147 1 1 32 TRP CD1  C   -0.695   2.126  -6.256 1.00 . A A .  32 TRP CD1  1 1 
       16 10148 1 1 32 TRP CD2  C    0.220   3.189  -8.001 1.00 . A A .  32 TRP CD2  1 1 
       16 10149 1 1 32 TRP CE2  C   -0.256   1.937  -8.437 1.00 . A A .  32 TRP CE2  1 1 
       16 10150 1 1 32 TRP CE3  C    0.835   4.036  -8.928 1.00 . A A .  32 TRP CE3  1 1 
       16 10151 1 1 32 TRP CG   C   -0.072   3.290  -6.603 1.00 . A A .  32 TRP CG   1 1 
       16 10152 1 1 32 TRP CH2  C    0.472   2.362 -10.644 1.00 . A A .  32 TRP CH2  1 1 
       16 10153 1 1 32 TRP CZ2  C   -0.134   1.513  -9.758 1.00 . A A .  32 TRP CZ2  1 1 
       16 10154 1 1 32 TRP CZ3  C    0.955   3.614 -10.238 1.00 . A A .  32 TRP CZ3  1 1 
       16 10155 1 1 32 TRP H    H   -1.020   3.398  -3.751 1.00 . A A .  32 TRP H    1 1 
       16 10156 1 1 32 TRP HA   H    1.556   3.183  -4.572 1.00 . A A .  32 TRP HA   1 1 
       16 10157 1 1 32 TRP HB2  H   -0.675   4.963  -5.487 1.00 . A A .  32 TRP HB2  1 1 
       16 10158 1 1 32 TRP HB3  H    0.916   5.107  -6.230 1.00 . A A .  32 TRP HB3  1 1 
       16 10159 1 1 32 TRP HD1  H   -1.041   1.895  -5.260 1.00 . A A .  32 TRP HD1  1 1 
       16 10160 1 1 32 TRP HE1  H   -1.221   0.418  -7.360 1.00 . A A .  32 TRP HE1  1 1 
       16 10161 1 1 32 TRP HE3  H    1.213   5.004  -8.635 1.00 . A A .  32 TRP HE3  1 1 
       16 10162 1 1 32 TRP HH2  H    0.588   2.074 -11.677 1.00 . A A .  32 TRP HH2  1 1 
       16 10163 1 1 32 TRP HZ2  H   -0.502   0.552 -10.086 1.00 . A A .  32 TRP HZ2  1 1 
       16 10164 1 1 32 TRP HZ3  H    1.428   4.254 -10.968 1.00 . A A .  32 TRP HZ3  1 1 
       16 10165 1 1 32 TRP N    N   -0.114   3.590  -3.430 1.00 . A A .  32 TRP N    1 1 
       16 10166 1 1 32 TRP NE1  N   -0.809   1.307  -7.354 1.00 . A A .  32 TRP NE1  1 1 
       16 10167 1 1 32 TRP O    O    2.910   5.311  -4.130 1.00 . A A .  32 TRP O    1 1 
       16 10168 1 1 33 ILE C    C    3.157   6.746  -1.880 1.00 . A A .  33 ILE C    1 1 
       16 10169 1 1 33 ILE CA   C    1.771   7.135  -2.383 1.00 . A A .  33 ILE CA   1 1 
       16 10170 1 1 33 ILE CB   C    0.956   7.714  -1.211 1.00 . A A .  33 ILE CB   1 1 
       16 10171 1 1 33 ILE CD1  C   -1.277   8.782  -0.617 1.00 . A A .  33 ILE CD1  1 1 
       16 10172 1 1 33 ILE CG1  C   -0.352   8.322  -1.722 1.00 . A A .  33 ILE CG1  1 1 
       16 10173 1 1 33 ILE CG2  C    1.773   8.755  -0.461 1.00 . A A .  33 ILE CG2  1 1 
       16 10174 1 1 33 ILE H    H    0.150   5.834  -2.783 1.00 . A A .  33 ILE H    1 1 
       16 10175 1 1 33 ILE HA   H    1.875   7.902  -3.137 1.00 . A A .  33 ILE HA   1 1 
       16 10176 1 1 33 ILE HB   H    0.728   6.910  -0.528 1.00 . A A .  33 ILE HB   1 1 
       16 10177 1 1 33 ILE HD11 H   -1.289   8.045   0.173 1.00 . A A .  33 ILE HD11 1 1 
       16 10178 1 1 33 ILE HD12 H   -0.926   9.725  -0.223 1.00 . A A .  33 ILE HD12 1 1 
       16 10179 1 1 33 ILE HD13 H   -2.275   8.905  -1.010 1.00 . A A .  33 ILE HD13 1 1 
       16 10180 1 1 33 ILE HG12 H   -0.127   9.175  -2.343 1.00 . A A .  33 ILE HG12 1 1 
       16 10181 1 1 33 ILE HG13 H   -0.878   7.583  -2.310 1.00 . A A .  33 ILE HG13 1 1 
       16 10182 1 1 33 ILE HG21 H    2.440   8.261   0.229 1.00 . A A .  33 ILE HG21 1 1 
       16 10183 1 1 33 ILE HG22 H    2.351   9.334  -1.166 1.00 . A A .  33 ILE HG22 1 1 
       16 10184 1 1 33 ILE HG23 H    1.110   9.409   0.084 1.00 . A A .  33 ILE HG23 1 1 
       16 10185 1 1 33 ILE N    N    1.094   5.996  -2.991 1.00 . A A .  33 ILE N    1 1 
       16 10186 1 1 33 ILE O    O    4.143   7.433  -2.149 1.00 . A A .  33 ILE O    1 1 
       16 10187 1 1 34 THR C    C    5.585   5.177  -1.670 1.00 . A A .  34 THR C    1 1 
       16 10188 1 1 34 THR CA   C    4.491   5.156  -0.609 1.00 . A A .  34 THR CA   1 1 
       16 10189 1 1 34 THR CB   C    4.357   3.725  -0.054 1.00 . A A .  34 THR CB   1 1 
       16 10190 1 1 34 THR CG2  C    4.148   2.726  -1.182 1.00 . A A .  34 THR CG2  1 1 
       16 10191 1 1 34 THR H    H    2.405   5.134  -0.968 1.00 . A A .  34 THR H    1 1 
       16 10192 1 1 34 THR HA   H    4.777   5.809   0.203 1.00 . A A .  34 THR HA   1 1 
       16 10193 1 1 34 THR HB   H    3.500   3.689   0.603 1.00 . A A .  34 THR HB   1 1 
       16 10194 1 1 34 THR HG1  H    5.403   3.604   1.613 1.00 . A A .  34 THR HG1  1 1 
       16 10195 1 1 34 THR HG21 H    3.742   1.810  -0.779 1.00 . A A .  34 THR HG21 1 1 
       16 10196 1 1 34 THR HG22 H    5.094   2.520  -1.661 1.00 . A A .  34 THR HG22 1 1 
       16 10197 1 1 34 THR HG23 H    3.459   3.137  -1.905 1.00 . A A .  34 THR HG23 1 1 
       16 10198 1 1 34 THR N    N    3.226   5.638  -1.149 1.00 . A A .  34 THR N    1 1 
       16 10199 1 1 34 THR O    O    6.732   5.528  -1.387 1.00 . A A .  34 THR O    1 1 
       16 10200 1 1 34 THR OG1  O    5.530   3.376   0.689 1.00 . A A .  34 THR OG1  1 1 
       16 10201 1 1 35 HIS C    C    6.539   6.195  -4.432 1.00 . A A .  35 HIS C    1 1 
       16 10202 1 1 35 HIS CA   C    6.178   4.778  -3.997 1.00 . A A .  35 HIS CA   1 1 
       16 10203 1 1 35 HIS CB   C    5.600   4.001  -5.180 1.00 . A A .  35 HIS CB   1 1 
       16 10204 1 1 35 HIS CD2  C    4.013   1.954  -5.045 1.00 . A A .  35 HIS CD2  1 1 
       16 10205 1 1 35 HIS CE1  C    5.364   0.568  -4.015 1.00 . A A .  35 HIS CE1  1 1 
       16 10206 1 1 35 HIS CG   C    5.180   2.606  -4.833 1.00 . A A .  35 HIS CG   1 1 
       16 10207 1 1 35 HIS H    H    4.297   4.533  -3.056 1.00 . A A .  35 HIS H    1 1 
       16 10208 1 1 35 HIS HA   H    7.072   4.282  -3.654 1.00 . A A .  35 HIS HA   1 1 
       16 10209 1 1 35 HIS HB2  H    4.733   4.524  -5.557 1.00 . A A .  35 HIS HB2  1 1 
       16 10210 1 1 35 HIS HB3  H    6.345   3.939  -5.960 1.00 . A A .  35 HIS HB3  1 1 
       16 10211 1 1 35 HIS HD1  H    6.923   1.887  -3.894 1.00 . A A .  35 HIS HD1  1 1 
       16 10212 1 1 35 HIS HD2  H    3.134   2.354  -5.531 1.00 . A A .  35 HIS HD2  1 1 
       16 10213 1 1 35 HIS HE1  H    5.761  -0.315  -3.537 1.00 . A A .  35 HIS HE1  1 1 
       16 10214 1 1 35 HIS N    N    5.225   4.801  -2.893 1.00 . A A .  35 HIS N    1 1 
       16 10215 1 1 35 HIS ND1  N    6.005   1.711  -4.184 1.00 . A A .  35 HIS ND1  1 1 
       16 10216 1 1 35 HIS NE2  N    4.153   0.690  -4.528 1.00 . A A .  35 HIS NE2  1 1 
       16 10217 1 1 35 HIS O    O    7.690   6.481  -4.763 1.00 . A A .  35 HIS O    1 1 
       16 10218 1 1 36 THR C    C    6.903   9.095  -4.038 1.00 . A A .  36 THR C    1 1 
       16 10219 1 1 36 THR CA   C    5.760   8.467  -4.826 1.00 . A A .  36 THR CA   1 1 
       16 10220 1 1 36 THR CB   C    4.487   9.311  -4.623 1.00 . A A .  36 THR CB   1 1 
       16 10221 1 1 36 THR CG2  C    4.701  10.738  -5.106 1.00 . A A .  36 THR CG2  1 1 
       16 10222 1 1 36 THR H    H    4.652   6.793  -4.157 1.00 . A A .  36 THR H    1 1 
       16 10223 1 1 36 THR HA   H    6.011   8.479  -5.877 1.00 . A A .  36 THR HA   1 1 
       16 10224 1 1 36 THR HB   H    4.254   9.335  -3.569 1.00 . A A .  36 THR HB   1 1 
       16 10225 1 1 36 THR HG1  H    3.524   7.773  -5.396 1.00 . A A .  36 THR HG1  1 1 
       16 10226 1 1 36 THR HG21 H    3.753  11.252  -5.140 1.00 . A A .  36 THR HG21 1 1 
       16 10227 1 1 36 THR HG22 H    5.138  10.722  -6.094 1.00 . A A .  36 THR HG22 1 1 
       16 10228 1 1 36 THR HG23 H    5.365  11.252  -4.427 1.00 . A A .  36 THR HG23 1 1 
       16 10229 1 1 36 THR N    N    5.547   7.081  -4.430 1.00 . A A .  36 THR N    1 1 
       16 10230 1 1 36 THR O    O    7.765   9.768  -4.604 1.00 . A A .  36 THR O    1 1 
       16 10231 1 1 36 THR OG1  O    3.391   8.722  -5.332 1.00 . A A .  36 THR OG1  1 1 
       16 10232 1 1 37 ARG C    C    9.281   8.725  -2.115 1.00 . A A .  37 ARG C    1 1 
       16 10233 1 1 37 ARG CA   C    7.944   9.415  -1.861 1.00 . A A .  37 ARG CA   1 1 
       16 10234 1 1 37 ARG CB   C    7.547   9.258  -0.392 1.00 . A A .  37 ARG CB   1 1 
       16 10235 1 1 37 ARG CD   C    6.632  11.523   0.198 1.00 . A A .  37 ARG CD   1 1 
       16 10236 1 1 37 ARG CG   C    6.309  10.051  -0.008 1.00 . A A .  37 ARG CG   1 1 
       16 10237 1 1 37 ARG CZ   C    7.147  13.492  -1.181 1.00 . A A .  37 ARG CZ   1 1 
       16 10238 1 1 37 ARG H    H    6.193   8.326  -2.335 1.00 . A A .  37 ARG H    1 1 
       16 10239 1 1 37 ARG HA   H    8.047  10.466  -2.087 1.00 . A A .  37 ARG HA   1 1 
       16 10240 1 1 37 ARG HB2  H    7.354   8.214  -0.193 1.00 . A A .  37 ARG HB2  1 1 
       16 10241 1 1 37 ARG HB3  H    8.367   9.589   0.227 1.00 . A A .  37 ARG HB3  1 1 
       16 10242 1 1 37 ARG HD2  H    5.873  11.959   0.829 1.00 . A A .  37 ARG HD2  1 1 
       16 10243 1 1 37 ARG HD3  H    7.593  11.602   0.684 1.00 . A A .  37 ARG HD3  1 1 
       16 10244 1 1 37 ARG HE   H    6.339  11.802  -1.865 1.00 . A A .  37 ARG HE   1 1 
       16 10245 1 1 37 ARG HG2  H    5.576   9.962  -0.797 1.00 . A A .  37 ARG HG2  1 1 
       16 10246 1 1 37 ARG HG3  H    5.905   9.648   0.909 1.00 . A A .  37 ARG HG3  1 1 
       16 10247 1 1 37 ARG HH11 H    7.607  13.681   0.777 1.00 . A A .  37 ARG HH11 1 1 
       16 10248 1 1 37 ARG HH12 H    7.966  15.062  -0.206 1.00 . A A .  37 ARG HH12 1 1 
       16 10249 1 1 37 ARG HH21 H    6.806  13.614  -3.169 1.00 . A A .  37 ARG HH21 1 1 
       16 10250 1 1 37 ARG HH22 H    7.509  15.023  -2.450 1.00 . A A .  37 ARG HH22 1 1 
       16 10251 1 1 37 ARG N    N    6.906   8.870  -2.728 1.00 . A A .  37 ARG N    1 1 
       16 10252 1 1 37 ARG NE   N    6.677  12.255  -1.065 1.00 . A A .  37 ARG NE   1 1 
       16 10253 1 1 37 ARG NH1  N    7.611  14.131  -0.115 1.00 . A A .  37 ARG NH1  1 1 
       16 10254 1 1 37 ARG NH2  N    7.155  14.092  -2.364 1.00 . A A .  37 ARG NH2  1 1 
       16 10255 1 1 37 ARG O    O    9.327   7.534  -2.424 1.00 . A A .  37 ARG O    1 1 
       16 10256 1 1 38 GLU C    C   12.311   8.449  -0.886 1.00 . A A .  38 GLU C    1 1 
       16 10257 1 1 38 GLU CA   C   11.704   8.941  -2.197 1.00 . A A .  38 GLU CA   1 1 
       16 10258 1 1 38 GLU CB   C   12.611  10.001  -2.826 1.00 . A A .  38 GLU CB   1 1 
       16 10259 1 1 38 GLU CD   C   13.392  11.051  -4.986 1.00 . A A .  38 GLU CD   1 1 
       16 10260 1 1 38 GLU CG   C   12.280  10.302  -4.278 1.00 . A A .  38 GLU CG   1 1 
       16 10261 1 1 38 GLU H    H   10.266  10.423  -1.733 1.00 . A A .  38 GLU H    1 1 
       16 10262 1 1 38 GLU HA   H   11.619   8.106  -2.876 1.00 . A A .  38 GLU HA   1 1 
       16 10263 1 1 38 GLU HB2  H   12.520  10.916  -2.259 1.00 . A A .  38 GLU HB2  1 1 
       16 10264 1 1 38 GLU HB3  H   13.634   9.658  -2.775 1.00 . A A .  38 GLU HB3  1 1 
       16 10265 1 1 38 GLU HG2  H   12.108   9.371  -4.795 1.00 . A A .  38 GLU HG2  1 1 
       16 10266 1 1 38 GLU HG3  H   11.383  10.903  -4.312 1.00 . A A .  38 GLU HG3  1 1 
       16 10267 1 1 38 GLU N    N   10.367   9.481  -1.982 1.00 . A A .  38 GLU N    1 1 
       16 10268 1 1 38 GLU O    O   12.599   9.239   0.013 1.00 . A A .  38 GLU O    1 1 
       16 10269 1 1 38 GLU OE1  O   13.972  11.972  -4.374 1.00 . A A .  38 GLU OE1  1 1 
       16 10270 1 1 38 GLU OE2  O   13.683  10.714  -6.154 1.00 . A A .  38 GLU OE2  1 1 
       16 10271 1 1 39 LYS C    C   14.474   7.083   0.680 1.00 . A A .  39 LYS C    1 1 
       16 10272 1 1 39 LYS CA   C   13.074   6.539   0.415 1.00 . A A .  39 LYS CA   1 1 
       16 10273 1 1 39 LYS CB   C   13.125   5.016   0.274 1.00 . A A .  39 LYS CB   1 1 
       16 10274 1 1 39 LYS CD   C   11.789   2.895   0.439 1.00 . A A .  39 LYS CD   1 1 
       16 10275 1 1 39 LYS CE   C   12.263   2.058  -0.739 1.00 . A A .  39 LYS CE   1 1 
       16 10276 1 1 39 LYS CG   C   11.760   4.375   0.094 1.00 . A A .  39 LYS CG   1 1 
       16 10277 1 1 39 LYS H    H   12.251   6.559  -1.536 1.00 . A A .  39 LYS H    1 1 
       16 10278 1 1 39 LYS HA   H   12.437   6.793   1.249 1.00 . A A .  39 LYS HA   1 1 
       16 10279 1 1 39 LYS HB2  H   13.733   4.766  -0.583 1.00 . A A .  39 LYS HB2  1 1 
       16 10280 1 1 39 LYS HB3  H   13.581   4.599   1.161 1.00 . A A .  39 LYS HB3  1 1 
       16 10281 1 1 39 LYS HD2  H   12.461   2.741   1.270 1.00 . A A .  39 LYS HD2  1 1 
       16 10282 1 1 39 LYS HD3  H   10.792   2.580   0.716 1.00 . A A .  39 LYS HD3  1 1 
       16 10283 1 1 39 LYS HE2  H   11.646   2.283  -1.595 1.00 . A A .  39 LYS HE2  1 1 
       16 10284 1 1 39 LYS HE3  H   13.289   2.315  -0.956 1.00 . A A .  39 LYS HE3  1 1 
       16 10285 1 1 39 LYS HG2  H   11.052   4.870   0.741 1.00 . A A .  39 LYS HG2  1 1 
       16 10286 1 1 39 LYS HG3  H   11.451   4.489  -0.935 1.00 . A A .  39 LYS HG3  1 1 
       16 10287 1 1 39 LYS HZ1  H   12.425   0.052  -1.301 1.00 . A A .  39 LYS HZ1  1 1 
       16 10288 1 1 39 LYS HZ2  H   11.215   0.348  -0.156 1.00 . A A .  39 LYS HZ2  1 1 
       16 10289 1 1 39 LYS HZ3  H   12.840   0.347   0.313 1.00 . A A .  39 LYS HZ3  1 1 
       16 10290 1 1 39 LYS N    N   12.501   7.138  -0.785 1.00 . A A .  39 LYS N    1 1 
       16 10291 1 1 39 LYS NZ   N   12.180   0.599  -0.451 1.00 . A A .  39 LYS NZ   1 1 
       16 10292 1 1 39 LYS O    O   15.245   7.354  -0.240 1.00 . A A .  39 LYS O    1 1 
       16 10293 1 1 40 PRO C    C   17.245   6.762   2.113 1.00 . A A .  40 PRO C    1 1 
       16 10294 1 1 40 PRO CA   C   16.121   7.757   2.383 1.00 . A A .  40 PRO CA   1 1 
       16 10295 1 1 40 PRO CB   C   15.954   7.979   3.889 1.00 . A A .  40 PRO CB   1 1 
       16 10296 1 1 40 PRO CD   C   13.942   6.944   3.117 1.00 . A A .  40 PRO CD   1 1 
       16 10297 1 1 40 PRO CG   C   14.875   7.035   4.293 1.00 . A A .  40 PRO CG   1 1 
       16 10298 1 1 40 PRO HA   H   16.351   8.697   1.903 1.00 . A A .  40 PRO HA   1 1 
       16 10299 1 1 40 PRO HB2  H   16.884   7.757   4.393 1.00 . A A .  40 PRO HB2  1 1 
       16 10300 1 1 40 PRO HB3  H   15.672   9.004   4.077 1.00 . A A .  40 PRO HB3  1 1 
       16 10301 1 1 40 PRO HD2  H   13.530   5.949   3.038 1.00 . A A .  40 PRO HD2  1 1 
       16 10302 1 1 40 PRO HD3  H   13.152   7.675   3.205 1.00 . A A .  40 PRO HD3  1 1 
       16 10303 1 1 40 PRO HG2  H   15.298   6.066   4.512 1.00 . A A .  40 PRO HG2  1 1 
       16 10304 1 1 40 PRO HG3  H   14.353   7.422   5.156 1.00 . A A .  40 PRO HG3  1 1 
       16 10305 1 1 40 PRO N    N   14.812   7.246   1.968 1.00 . A A .  40 PRO N    1 1 
       16 10306 1 1 40 PRO O    O   18.419   7.063   2.329 1.00 . A A .  40 PRO O    1 1 
       16 10307 1 1 41 SER C    C   18.858   5.014   0.297 1.00 . A A .  41 SER C    1 1 
       16 10308 1 1 41 SER CA   C   17.854   4.535   1.342 1.00 . A A .  41 SER CA   1 1 
       16 10309 1 1 41 SER CB   C   17.149   3.271   0.846 1.00 . A A .  41 SER CB   1 1 
       16 10310 1 1 41 SER H    H   15.925   5.397   1.487 1.00 . A A .  41 SER H    1 1 
       16 10311 1 1 41 SER HA   H   18.383   4.307   2.255 1.00 . A A .  41 SER HA   1 1 
       16 10312 1 1 41 SER HB2  H   17.888   2.529   0.585 1.00 . A A .  41 SER HB2  1 1 
       16 10313 1 1 41 SER HB3  H   16.513   2.886   1.630 1.00 . A A .  41 SER HB3  1 1 
       16 10314 1 1 41 SER HG   H   15.427   3.424  -0.076 1.00 . A A .  41 SER HG   1 1 
       16 10315 1 1 41 SER N    N   16.877   5.576   1.638 1.00 . A A .  41 SER N    1 1 
       16 10316 1 1 41 SER O    O   18.659   6.046  -0.344 1.00 . A A .  41 SER O    1 1 
       16 10317 1 1 41 SER OG   O   16.354   3.545  -0.295 1.00 . A A .  41 SER OG   1 1 
       16 10318 1 1 42 GLY C    C   22.012   5.537  -0.249 1.00 . A A .  42 GLY C    1 1 
       16 10319 1 1 42 GLY CA   C   20.958   4.619  -0.835 1.00 . A A .  42 GLY CA   1 1 
       16 10320 1 1 42 GLY H    H   20.043   3.445   0.671 1.00 . A A .  42 GLY H    1 1 
       16 10321 1 1 42 GLY HA2  H   21.436   3.719  -1.192 1.00 . A A .  42 GLY HA2  1 1 
       16 10322 1 1 42 GLY HA3  H   20.486   5.119  -1.668 1.00 . A A .  42 GLY HA3  1 1 
       16 10323 1 1 42 GLY N    N   19.938   4.257   0.132 1.00 . A A .  42 GLY N    1 1 
       16 10324 1 1 42 GLY O    O   21.903   5.998   0.888 1.00 . A A .  42 GLY O    1 1 
       16 10325 1 1 43 PRO C    C   23.739   8.143  -0.495 1.00 . A A .  43 PRO C    1 1 
       16 10326 1 1 43 PRO CA   C   24.164   6.683  -0.607 1.00 . A A .  43 PRO CA   1 1 
       16 10327 1 1 43 PRO CB   C   25.203   6.512  -1.717 1.00 . A A .  43 PRO CB   1 1 
       16 10328 1 1 43 PRO CD   C   23.260   5.299  -2.400 1.00 . A A .  43 PRO CD   1 1 
       16 10329 1 1 43 PRO CG   C   24.414   6.112  -2.916 1.00 . A A .  43 PRO CG   1 1 
       16 10330 1 1 43 PRO HA   H   24.584   6.359   0.334 1.00 . A A .  43 PRO HA   1 1 
       16 10331 1 1 43 PRO HB2  H   25.720   7.448  -1.877 1.00 . A A .  43 PRO HB2  1 1 
       16 10332 1 1 43 PRO HB3  H   25.912   5.747  -1.438 1.00 . A A .  43 PRO HB3  1 1 
       16 10333 1 1 43 PRO HD2  H   22.381   5.465  -3.004 1.00 . A A .  43 PRO HD2  1 1 
       16 10334 1 1 43 PRO HD3  H   23.516   4.250  -2.383 1.00 . A A .  43 PRO HD3  1 1 
       16 10335 1 1 43 PRO HG2  H   24.054   6.991  -3.429 1.00 . A A .  43 PRO HG2  1 1 
       16 10336 1 1 43 PRO HG3  H   25.027   5.516  -3.576 1.00 . A A .  43 PRO HG3  1 1 
       16 10337 1 1 43 PRO N    N   23.064   5.813  -1.034 1.00 . A A .  43 PRO N    1 1 
       16 10338 1 1 43 PRO O    O   24.045   8.815   0.489 1.00 . A A .  43 PRO O    1 1 
       16 10339 1 1 44 SER C    C   21.621  10.251  -2.700 1.00 . A A .  44 SER C    1 1 
       16 10340 1 1 44 SER CA   C   22.566  10.010  -1.528 1.00 . A A .  44 SER CA   1 1 
       16 10341 1 1 44 SER CB   C   23.755  10.969  -1.611 1.00 . A A .  44 SER CB   1 1 
       16 10342 1 1 44 SER H    H   22.818   8.042  -2.267 1.00 . A A .  44 SER H    1 1 
       16 10343 1 1 44 SER HA   H   22.033  10.192  -0.607 1.00 . A A .  44 SER HA   1 1 
       16 10344 1 1 44 SER HB2  H   24.559  10.495  -2.154 1.00 . A A .  44 SER HB2  1 1 
       16 10345 1 1 44 SER HB3  H   23.453  11.868  -2.128 1.00 . A A .  44 SER HB3  1 1 
       16 10346 1 1 44 SER HG   H   25.177  11.400  -0.334 1.00 . A A .  44 SER HG   1 1 
       16 10347 1 1 44 SER N    N   23.031   8.628  -1.510 1.00 . A A .  44 SER N    1 1 
       16 10348 1 1 44 SER O    O   21.949   9.953  -3.848 1.00 . A A .  44 SER O    1 1 
       16 10349 1 1 44 SER OG   O   24.221  11.319  -0.319 1.00 . A A .  44 SER OG   1 1 
       16 10350 1 1 45 SER C    C   19.409  12.559  -3.761 1.00 . A A .  45 SER C    1 1 
       16 10351 1 1 45 SER CA   C   19.447  11.070  -3.430 1.00 . A A .  45 SER CA   1 1 
       16 10352 1 1 45 SER CB   C   18.065  10.602  -2.970 1.00 . A A .  45 SER CB   1 1 
       16 10353 1 1 45 SER H    H   20.240  11.007  -1.467 1.00 . A A .  45 SER H    1 1 
       16 10354 1 1 45 SER HA   H   19.726  10.523  -4.318 1.00 . A A .  45 SER HA   1 1 
       16 10355 1 1 45 SER HB2  H   17.944  10.824  -1.920 1.00 . A A .  45 SER HB2  1 1 
       16 10356 1 1 45 SER HB3  H   17.306  11.121  -3.537 1.00 . A A .  45 SER HB3  1 1 
       16 10357 1 1 45 SER HG   H   18.359   8.734  -2.461 1.00 . A A .  45 SER HG   1 1 
       16 10358 1 1 45 SER N    N   20.444  10.792  -2.402 1.00 . A A .  45 SER N    1 1 
       16 10359 1 1 45 SER O    O   19.677  12.962  -4.892 1.00 . A A .  45 SER O    1 1 
       16 10360 1 1 45 SER OG   O   17.908   9.207  -3.163 1.00 . A A .  45 SER OG   1 1 
       16 10361 1 1 46 GLY C    C   19.782  15.579  -1.920 1.00 . A A .  46 GLY C    1 1 
       16 10362 1 1 46 GLY CA   C   19.006  14.807  -2.968 1.00 . A A .  46 GLY CA   1 1 
       16 10363 1 1 46 GLY H    H   18.871  12.994  -1.882 1.00 . A A .  46 GLY H    1 1 
       16 10364 1 1 46 GLY HA2  H   19.407  15.040  -3.943 1.00 . A A .  46 GLY HA2  1 1 
       16 10365 1 1 46 GLY HA3  H   17.971  15.116  -2.933 1.00 . A A .  46 GLY HA3  1 1 
       16 10366 1 1 46 GLY N    N   19.074  13.372  -2.764 1.00 . A A .  46 GLY N    1 1 
       16 10367 1 1 46 GLY O    O   20.991  15.383  -1.805 1.00 . A A .  46 GLY O    1 1 
       16 10368 2 2  1 ZN  ZN   ZN   2.714  -0.775  -4.339 1.00 . B A . 181 ZN  ZN   1 1 
       17 10369 1 1  1 GLY C    C   12.005 -22.820  -5.225 1.00 . A A .   1 GLY C    1 1 
       17 10370 1 1  1 GLY CA   C   13.424 -23.341  -5.331 1.00 . A A .   1 GLY CA   1 1 
       17 10371 1 1  1 GLY H1   H   13.935 -21.843  -6.738 1.00 . A A .   1 GLY H1   1 1 
       17 10372 1 1  1 GLY HA2  H   13.411 -24.286  -5.853 1.00 . A A .   1 GLY HA2  1 1 
       17 10373 1 1  1 GLY HA3  H   13.814 -23.497  -4.336 1.00 . A A .   1 GLY HA3  1 1 
       17 10374 1 1  1 GLY N    N   14.300 -22.426  -6.040 1.00 . A A .   1 GLY N    1 1 
       17 10375 1 1  1 GLY O    O   11.078 -23.401  -5.789 1.00 . A A .   1 GLY O    1 1 
       17 10376 1 1  2 SER C    C    9.733 -21.122  -5.622 1.00 . A A .   2 SER C    1 1 
       17 10377 1 1  2 SER CA   C   10.516 -21.123  -4.313 1.00 . A A .   2 SER CA   1 1 
       17 10378 1 1  2 SER CB   C   10.650 -19.694  -3.784 1.00 . A A .   2 SER CB   1 1 
       17 10379 1 1  2 SER H    H   12.612 -21.303  -4.071 1.00 . A A .   2 SER H    1 1 
       17 10380 1 1  2 SER HA   H    9.981 -21.718  -3.588 1.00 . A A .   2 SER HA   1 1 
       17 10381 1 1  2 SER HB2  H    9.680 -19.220  -3.785 1.00 . A A .   2 SER HB2  1 1 
       17 10382 1 1  2 SER HB3  H   11.036 -19.721  -2.775 1.00 . A A .   2 SER HB3  1 1 
       17 10383 1 1  2 SER HG   H   11.507 -18.014  -4.312 1.00 . A A .   2 SER HG   1 1 
       17 10384 1 1  2 SER N    N   11.833 -21.721  -4.497 1.00 . A A .   2 SER N    1 1 
       17 10385 1 1  2 SER O    O   10.307 -20.983  -6.702 1.00 . A A .   2 SER O    1 1 
       17 10386 1 1  2 SER OG   O   11.531 -18.932  -4.591 1.00 . A A .   2 SER OG   1 1 
       17 10387 1 1  3 SER C    C    6.165 -20.764  -6.356 1.00 . A A .   3 SER C    1 1 
       17 10388 1 1  3 SER CA   C    7.554 -21.299  -6.692 1.00 . A A .   3 SER CA   1 1 
       17 10389 1 1  3 SER CB   C    7.445 -22.721  -7.246 1.00 . A A .   3 SER CB   1 1 
       17 10390 1 1  3 SER H    H    8.018 -21.384  -4.628 1.00 . A A .   3 SER H    1 1 
       17 10391 1 1  3 SER HA   H    7.999 -20.663  -7.443 1.00 . A A .   3 SER HA   1 1 
       17 10392 1 1  3 SER HB2  H    6.929 -22.697  -8.194 1.00 . A A .   3 SER HB2  1 1 
       17 10393 1 1  3 SER HB3  H    8.436 -23.127  -7.385 1.00 . A A .   3 SER HB3  1 1 
       17 10394 1 1  3 SER HG   H    7.346 -24.054  -5.814 1.00 . A A .   3 SER HG   1 1 
       17 10395 1 1  3 SER N    N    8.417 -21.278  -5.517 1.00 . A A .   3 SER N    1 1 
       17 10396 1 1  3 SER O    O    5.632 -21.024  -5.278 1.00 . A A .   3 SER O    1 1 
       17 10397 1 1  3 SER OG   O    6.727 -23.561  -6.358 1.00 . A A .   3 SER OG   1 1 
       17 10398 1 1  4 GLY C    C    3.359 -19.621  -8.278 1.00 . A A .   4 GLY C    1 1 
       17 10399 1 1  4 GLY CA   C    4.262 -19.455  -7.072 1.00 . A A .   4 GLY CA   1 1 
       17 10400 1 1  4 GLY H    H    6.056 -19.842  -8.129 1.00 . A A .   4 GLY H    1 1 
       17 10401 1 1  4 GLY HA2  H    3.808 -19.947  -6.225 1.00 . A A .   4 GLY HA2  1 1 
       17 10402 1 1  4 GLY HA3  H    4.362 -18.402  -6.854 1.00 . A A .   4 GLY HA3  1 1 
       17 10403 1 1  4 GLY N    N    5.584 -20.015  -7.288 1.00 . A A .   4 GLY N    1 1 
       17 10404 1 1  4 GLY O    O    3.832 -19.691  -9.412 1.00 . A A .   4 GLY O    1 1 
       17 10405 1 1  5 SER C    C    0.679 -18.495  -9.687 1.00 . A A .   5 SER C    1 1 
       17 10406 1 1  5 SER CA   C    1.082 -19.848  -9.108 1.00 . A A .   5 SER CA   1 1 
       17 10407 1 1  5 SER CB   C   -0.157 -20.585  -8.596 1.00 . A A .   5 SER CB   1 1 
       17 10408 1 1  5 SER H    H    1.738 -19.621  -7.108 1.00 . A A .   5 SER H    1 1 
       17 10409 1 1  5 SER HA   H    1.544 -20.436  -9.887 1.00 . A A .   5 SER HA   1 1 
       17 10410 1 1  5 SER HB2  H    0.137 -21.545  -8.199 1.00 . A A .   5 SER HB2  1 1 
       17 10411 1 1  5 SER HB3  H   -0.624 -20.001  -7.816 1.00 . A A .   5 SER HB3  1 1 
       17 10412 1 1  5 SER HG   H   -1.395 -21.702  -9.624 1.00 . A A .   5 SER HG   1 1 
       17 10413 1 1  5 SER N    N    2.054 -19.684  -8.034 1.00 . A A .   5 SER N    1 1 
       17 10414 1 1  5 SER O    O    0.779 -17.466  -9.018 1.00 . A A .   5 SER O    1 1 
       17 10415 1 1  5 SER OG   O   -1.096 -20.791  -9.638 1.00 . A A .   5 SER OG   1 1 
       17 10416 1 1  6 SER C    C   -1.488 -16.742 -11.007 1.00 . A A .   6 SER C    1 1 
       17 10417 1 1  6 SER CA   C   -0.193 -17.279 -11.607 1.00 . A A .   6 SER CA   1 1 
       17 10418 1 1  6 SER CB   C   -0.377 -17.530 -13.105 1.00 . A A .   6 SER CB   1 1 
       17 10419 1 1  6 SER H    H    0.166 -19.357 -11.417 1.00 . A A .   6 SER H    1 1 
       17 10420 1 1  6 SER HA   H    0.586 -16.544 -11.468 1.00 . A A .   6 SER HA   1 1 
       17 10421 1 1  6 SER HB2  H    0.516 -17.986 -13.504 1.00 . A A .   6 SER HB2  1 1 
       17 10422 1 1  6 SER HB3  H   -1.217 -18.193 -13.255 1.00 . A A .   6 SER HB3  1 1 
       17 10423 1 1  6 SER HG   H   -0.064 -16.280 -14.580 1.00 . A A .   6 SER HG   1 1 
       17 10424 1 1  6 SER N    N    0.222 -18.505 -10.935 1.00 . A A .   6 SER N    1 1 
       17 10425 1 1  6 SER O    O   -1.537 -15.617 -10.512 1.00 . A A .   6 SER O    1 1 
       17 10426 1 1  6 SER OG   O   -0.621 -16.319 -13.799 1.00 . A A .   6 SER OG   1 1 
       17 10427 1 1  7 GLY C    C   -4.869 -16.950 -11.589 1.00 . A A .   7 GLY C    1 1 
       17 10428 1 1  7 GLY CA   C   -3.820 -17.148 -10.512 1.00 . A A .   7 GLY CA   1 1 
       17 10429 1 1  7 GLY H    H   -2.440 -18.444 -11.461 1.00 . A A .   7 GLY H    1 1 
       17 10430 1 1  7 GLY HA2  H   -4.165 -17.904  -9.823 1.00 . A A .   7 GLY HA2  1 1 
       17 10431 1 1  7 GLY HA3  H   -3.692 -16.218  -9.977 1.00 . A A .   7 GLY HA3  1 1 
       17 10432 1 1  7 GLY N    N   -2.538 -17.557 -11.055 1.00 . A A .   7 GLY N    1 1 
       17 10433 1 1  7 GLY O    O   -4.566 -17.026 -12.780 1.00 . A A .   7 GLY O    1 1 
       17 10434 1 1  8 GLU C    C   -7.962 -15.210 -11.785 1.00 . A A .   8 GLU C    1 1 
       17 10435 1 1  8 GLU CA   C   -7.202 -16.493 -12.109 1.00 . A A .   8 GLU CA   1 1 
       17 10436 1 1  8 GLU CB   C   -8.158 -17.687 -12.080 1.00 . A A .   8 GLU CB   1 1 
       17 10437 1 1  8 GLU CD   C   -8.730 -19.803 -13.335 1.00 . A A .   8 GLU CD   1 1 
       17 10438 1 1  8 GLU CG   C   -7.625 -18.912 -12.804 1.00 . A A .   8 GLU CG   1 1 
       17 10439 1 1  8 GLU H    H   -6.284 -16.651 -10.208 1.00 . A A .   8 GLU H    1 1 
       17 10440 1 1  8 GLU HA   H   -6.779 -16.406 -13.099 1.00 . A A .   8 GLU HA   1 1 
       17 10441 1 1  8 GLU HB2  H   -8.349 -17.956 -11.052 1.00 . A A .   8 GLU HB2  1 1 
       17 10442 1 1  8 GLU HB3  H   -9.089 -17.398 -12.545 1.00 . A A .   8 GLU HB3  1 1 
       17 10443 1 1  8 GLU HG2  H   -7.015 -18.587 -13.634 1.00 . A A .   8 GLU HG2  1 1 
       17 10444 1 1  8 GLU HG3  H   -7.019 -19.485 -12.117 1.00 . A A .   8 GLU HG3  1 1 
       17 10445 1 1  8 GLU N    N   -6.105 -16.699 -11.171 1.00 . A A .   8 GLU N    1 1 
       17 10446 1 1  8 GLU O    O   -8.236 -14.398 -12.668 1.00 . A A .   8 GLU O    1 1 
       17 10447 1 1  8 GLU OE1  O   -9.778 -19.911 -12.664 1.00 . A A .   8 GLU OE1  1 1 
       17 10448 1 1  8 GLU OE2  O   -8.548 -20.393 -14.421 1.00 . A A .   8 GLU OE2  1 1 
       17 10449 1 1  9 GLY C    C   -8.155 -12.611 -10.080 1.00 . A A .   9 GLY C    1 1 
       17 10450 1 1  9 GLY CA   C   -9.026 -13.851 -10.092 1.00 . A A .   9 GLY CA   1 1 
       17 10451 1 1  9 GLY H    H   -8.055 -15.717  -9.851 1.00 . A A .   9 GLY H    1 1 
       17 10452 1 1  9 GLY HA2  H   -9.853 -13.691 -10.768 1.00 . A A .   9 GLY HA2  1 1 
       17 10453 1 1  9 GLY HA3  H   -9.414 -14.014  -9.097 1.00 . A A .   9 GLY HA3  1 1 
       17 10454 1 1  9 GLY N    N   -8.300 -15.036 -10.511 1.00 . A A .   9 GLY N    1 1 
       17 10455 1 1  9 GLY O    O   -7.855 -12.065  -9.019 1.00 . A A .   9 GLY O    1 1 
       17 10456 1 1 10 GLU C    C   -7.747  -9.722 -11.527 1.00 . A A .  10 GLU C    1 1 
       17 10457 1 1 10 GLU CA   C   -6.900 -10.984 -11.385 1.00 . A A .  10 GLU CA   1 1 
       17 10458 1 1 10 GLU CB   C   -5.962 -11.120 -12.586 1.00 . A A .  10 GLU CB   1 1 
       17 10459 1 1 10 GLU CD   C   -3.746 -10.406 -13.567 1.00 . A A .  10 GLU CD   1 1 
       17 10460 1 1 10 GLU CG   C   -4.900 -10.036 -12.655 1.00 . A A .  10 GLU CG   1 1 
       17 10461 1 1 10 GLU H    H   -8.017 -12.644 -12.075 1.00 . A A .  10 GLU H    1 1 
       17 10462 1 1 10 GLU HA   H   -6.309 -10.906 -10.485 1.00 . A A .  10 GLU HA   1 1 
       17 10463 1 1 10 GLU HB2  H   -5.466 -12.078 -12.533 1.00 . A A .  10 GLU HB2  1 1 
       17 10464 1 1 10 GLU HB3  H   -6.549 -11.078 -13.491 1.00 . A A .  10 GLU HB3  1 1 
       17 10465 1 1 10 GLU HG2  H   -5.353  -9.128 -13.024 1.00 . A A .  10 GLU HG2  1 1 
       17 10466 1 1 10 GLU HG3  H   -4.513  -9.864 -11.661 1.00 . A A .  10 GLU HG3  1 1 
       17 10467 1 1 10 GLU N    N   -7.745 -12.166 -11.264 1.00 . A A .  10 GLU N    1 1 
       17 10468 1 1 10 GLU O    O   -8.503  -9.573 -12.488 1.00 . A A .  10 GLU O    1 1 
       17 10469 1 1 10 GLU OE1  O   -3.998 -11.040 -14.613 1.00 . A A .  10 GLU OE1  1 1 
       17 10470 1 1 10 GLU OE2  O   -2.593 -10.062 -13.235 1.00 . A A .  10 GLU OE2  1 1 
       17 10471 1 1 11 LYS C    C   -7.716  -6.553 -11.518 1.00 . A A .  11 LYS C    1 1 
       17 10472 1 1 11 LYS CA   C   -8.366  -7.566 -10.581 1.00 . A A .  11 LYS CA   1 1 
       17 10473 1 1 11 LYS CB   C   -8.459  -6.984  -9.168 1.00 . A A .  11 LYS CB   1 1 
       17 10474 1 1 11 LYS CD   C   -9.880  -7.032  -7.098 1.00 . A A .  11 LYS CD   1 1 
       17 10475 1 1 11 LYS CE   C  -11.254  -6.525  -7.507 1.00 . A A .  11 LYS CE   1 1 
       17 10476 1 1 11 LYS CG   C   -9.239  -7.857  -8.201 1.00 . A A .  11 LYS CG   1 1 
       17 10477 1 1 11 LYS H    H   -6.996  -8.992  -9.824 1.00 . A A .  11 LYS H    1 1 
       17 10478 1 1 11 LYS HA   H   -9.361  -7.782 -10.938 1.00 . A A .  11 LYS HA   1 1 
       17 10479 1 1 11 LYS HB2  H   -7.459  -6.856  -8.779 1.00 . A A .  11 LYS HB2  1 1 
       17 10480 1 1 11 LYS HB3  H   -8.942  -6.020  -9.221 1.00 . A A .  11 LYS HB3  1 1 
       17 10481 1 1 11 LYS HD2  H   -9.983  -7.645  -6.215 1.00 . A A .  11 LYS HD2  1 1 
       17 10482 1 1 11 LYS HD3  H   -9.244  -6.185  -6.878 1.00 . A A .  11 LYS HD3  1 1 
       17 10483 1 1 11 LYS HE2  H  -11.604  -5.828  -6.761 1.00 . A A .  11 LYS HE2  1 1 
       17 10484 1 1 11 LYS HE3  H  -11.169  -6.020  -8.458 1.00 . A A .  11 LYS HE3  1 1 
       17 10485 1 1 11 LYS HG2  H  -10.015  -8.376  -8.744 1.00 . A A .  11 LYS HG2  1 1 
       17 10486 1 1 11 LYS HG3  H   -8.566  -8.576  -7.756 1.00 . A A .  11 LYS HG3  1 1 
       17 10487 1 1 11 LYS HZ1  H  -12.897  -7.622  -6.828 1.00 . A A .  11 LYS HZ1  1 1 
       17 10488 1 1 11 LYS HZ2  H  -11.746  -8.550  -7.651 1.00 . A A .  11 LYS HZ2  1 1 
       17 10489 1 1 11 LYS HZ3  H  -12.783  -7.531  -8.514 1.00 . A A .  11 LYS HZ3  1 1 
       17 10490 1 1 11 LYS N    N   -7.615  -8.816 -10.564 1.00 . A A .  11 LYS N    1 1 
       17 10491 1 1 11 LYS NZ   N  -12.239  -7.634  -7.634 1.00 . A A .  11 LYS NZ   1 1 
       17 10492 1 1 11 LYS O    O   -6.511  -6.588 -11.769 1.00 . A A .  11 LYS O    1 1 
       17 10493 1 1 12 PRO C    C   -7.177  -3.555 -12.262 1.00 . A A .  12 PRO C    1 1 
       17 10494 1 1 12 PRO CA   C   -8.055  -4.587 -12.963 1.00 . A A .  12 PRO CA   1 1 
       17 10495 1 1 12 PRO CB   C   -9.348  -3.938 -13.463 1.00 . A A .  12 PRO CB   1 1 
       17 10496 1 1 12 PRO CD   C   -9.977  -5.527 -11.792 1.00 . A A .  12 PRO CD   1 1 
       17 10497 1 1 12 PRO CG   C  -10.343  -4.194 -12.384 1.00 . A A .  12 PRO CG   1 1 
       17 10498 1 1 12 PRO HA   H   -7.516  -5.009 -13.798 1.00 . A A .  12 PRO HA   1 1 
       17 10499 1 1 12 PRO HB2  H   -9.188  -2.879 -13.611 1.00 . A A .  12 PRO HB2  1 1 
       17 10500 1 1 12 PRO HB3  H   -9.648  -4.395 -14.393 1.00 . A A .  12 PRO HB3  1 1 
       17 10501 1 1 12 PRO HD2  H  -10.183  -5.539 -10.732 1.00 . A A .  12 PRO HD2  1 1 
       17 10502 1 1 12 PRO HD3  H  -10.512  -6.322 -12.291 1.00 . A A .  12 PRO HD3  1 1 
       17 10503 1 1 12 PRO HG2  H  -10.279  -3.421 -11.634 1.00 . A A .  12 PRO HG2  1 1 
       17 10504 1 1 12 PRO HG3  H  -11.337  -4.231 -12.803 1.00 . A A .  12 PRO HG3  1 1 
       17 10505 1 1 12 PRO N    N   -8.530  -5.628 -12.047 1.00 . A A .  12 PRO N    1 1 
       17 10506 1 1 12 PRO O    O   -6.715  -2.596 -12.881 1.00 . A A .  12 PRO O    1 1 
       17 10507 1 1 13 TYR C    C   -5.026  -3.597  -9.450 1.00 . A A .  13 TYR C    1 1 
       17 10508 1 1 13 TYR CA   C   -6.131  -2.844 -10.184 1.00 . A A .  13 TYR CA   1 1 
       17 10509 1 1 13 TYR CB   C   -6.997  -2.081  -9.181 1.00 . A A .  13 TYR CB   1 1 
       17 10510 1 1 13 TYR CD1  C   -8.029  -0.358 -10.711 1.00 . A A .  13 TYR CD1  1 1 
       17 10511 1 1 13 TYR CD2  C   -9.486  -1.800  -9.496 1.00 . A A .  13 TYR CD2  1 1 
       17 10512 1 1 13 TYR CE1  C   -9.119   0.267 -11.286 1.00 . A A .  13 TYR CE1  1 1 
       17 10513 1 1 13 TYR CE2  C  -10.582  -1.181 -10.066 1.00 . A A .  13 TYR CE2  1 1 
       17 10514 1 1 13 TYR CG   C   -8.193  -1.400  -9.807 1.00 . A A .  13 TYR CG   1 1 
       17 10515 1 1 13 TYR CZ   C  -10.393  -0.148 -10.960 1.00 . A A .  13 TYR CZ   1 1 
       17 10516 1 1 13 TYR H    H   -7.347  -4.540 -10.531 1.00 . A A .  13 TYR H    1 1 
       17 10517 1 1 13 TYR HA   H   -5.678  -2.137 -10.864 1.00 . A A .  13 TYR HA   1 1 
       17 10518 1 1 13 TYR HB2  H   -7.362  -2.769  -8.434 1.00 . A A .  13 TYR HB2  1 1 
       17 10519 1 1 13 TYR HB3  H   -6.396  -1.322  -8.701 1.00 . A A .  13 TYR HB3  1 1 
       17 10520 1 1 13 TYR HD1  H   -7.029  -0.035 -10.965 1.00 . A A .  13 TYR HD1  1 1 
       17 10521 1 1 13 TYR HD2  H   -9.631  -2.609  -8.795 1.00 . A A .  13 TYR HD2  1 1 
       17 10522 1 1 13 TYR HE1  H   -8.971   1.076 -11.986 1.00 . A A .  13 TYR HE1  1 1 
       17 10523 1 1 13 TYR HE2  H  -11.580  -1.506  -9.812 1.00 . A A .  13 TYR HE2  1 1 
       17 10524 1 1 13 TYR HH   H  -11.667   0.070 -12.383 1.00 . A A .  13 TYR HH   1 1 
       17 10525 1 1 13 TYR N    N   -6.952  -3.758 -10.969 1.00 . A A .  13 TYR N    1 1 
       17 10526 1 1 13 TYR O    O   -5.238  -4.119  -8.356 1.00 . A A .  13 TYR O    1 1 
       17 10527 1 1 13 TYR OH   O  -11.481   0.471 -11.531 1.00 . A A .  13 TYR OH   1 1 
       17 10528 1 1 14 GLN C    C   -1.472  -3.445  -9.461 1.00 . A A .  14 GLN C    1 1 
       17 10529 1 1 14 GLN CA   C   -2.708  -4.339  -9.466 1.00 . A A .  14 GLN CA   1 1 
       17 10530 1 1 14 GLN CB   C   -2.414  -5.632 -10.228 1.00 . A A .  14 GLN CB   1 1 
       17 10531 1 1 14 GLN CD   C   -0.859  -7.602 -10.523 1.00 . A A .  14 GLN CD   1 1 
       17 10532 1 1 14 GLN CG   C   -1.258  -6.431  -9.647 1.00 . A A .  14 GLN CG   1 1 
       17 10533 1 1 14 GLN H    H   -3.740  -3.214 -10.932 1.00 . A A .  14 GLN H    1 1 
       17 10534 1 1 14 GLN HA   H   -2.965  -4.583  -8.447 1.00 . A A .  14 GLN HA   1 1 
       17 10535 1 1 14 GLN HB2  H   -3.296  -6.254 -10.213 1.00 . A A .  14 GLN HB2  1 1 
       17 10536 1 1 14 GLN HB3  H   -2.173  -5.386 -11.252 1.00 . A A .  14 GLN HB3  1 1 
       17 10537 1 1 14 GLN HE21 H    0.759  -6.622 -11.137 1.00 . A A .  14 GLN HE21 1 1 
       17 10538 1 1 14 GLN HE22 H    0.542  -8.203 -11.799 1.00 . A A .  14 GLN HE22 1 1 
       17 10539 1 1 14 GLN HG2  H   -0.405  -5.778  -9.536 1.00 . A A .  14 GLN HG2  1 1 
       17 10540 1 1 14 GLN HG3  H   -1.550  -6.808  -8.678 1.00 . A A .  14 GLN HG3  1 1 
       17 10541 1 1 14 GLN N    N   -3.847  -3.649 -10.061 1.00 . A A .  14 GLN N    1 1 
       17 10542 1 1 14 GLN NE2  N    0.260  -7.462 -11.225 1.00 . A A .  14 GLN NE2  1 1 
       17 10543 1 1 14 GLN O    O   -0.888  -3.170 -10.510 1.00 . A A .  14 GLN O    1 1 
       17 10544 1 1 14 GLN OE1  O   -1.548  -8.621 -10.569 1.00 . A A .  14 GLN OE1  1 1 
       17 10545 1 1 15 CYS C    C    1.266  -2.672  -8.935 1.00 . A A .  15 CYS C    1 1 
       17 10546 1 1 15 CYS CA   C    0.086  -2.130  -8.132 1.00 . A A .  15 CYS CA   1 1 
       17 10547 1 1 15 CYS CB   C    0.474  -2.001  -6.658 1.00 . A A .  15 CYS CB   1 1 
       17 10548 1 1 15 CYS H    H   -1.587  -3.248  -7.474 1.00 . A A .  15 CYS H    1 1 
       17 10549 1 1 15 CYS HA   H   -0.175  -1.155  -8.513 1.00 . A A .  15 CYS HA   1 1 
       17 10550 1 1 15 CYS HB2  H   -0.375  -1.634  -6.101 1.00 . A A .  15 CYS HB2  1 1 
       17 10551 1 1 15 CYS HB3  H    0.752  -2.974  -6.280 1.00 . A A .  15 CYS HB3  1 1 
       17 10552 1 1 15 CYS N    N   -1.080  -2.994  -8.275 1.00 . A A .  15 CYS N    1 1 
       17 10553 1 1 15 CYS O    O    1.822  -3.721  -8.610 1.00 . A A .  15 CYS O    1 1 
       17 10554 1 1 15 CYS SG   S    1.868  -0.868  -6.352 1.00 . A A .  15 CYS SG   1 1 
       17 10555 1 1 16 SER C    C    4.072  -1.794 -10.315 1.00 . A A .  16 SER C    1 1 
       17 10556 1 1 16 SER CA   C    2.753  -2.357 -10.836 1.00 . A A .  16 SER CA   1 1 
       17 10557 1 1 16 SER CB   C    2.519  -1.892 -12.274 1.00 . A A .  16 SER CB   1 1 
       17 10558 1 1 16 SER H    H    1.159  -1.121 -10.192 1.00 . A A .  16 SER H    1 1 
       17 10559 1 1 16 SER HA   H    2.804  -3.436 -10.819 1.00 . A A .  16 SER HA   1 1 
       17 10560 1 1 16 SER HB2  H    1.491  -2.077 -12.547 1.00 . A A .  16 SER HB2  1 1 
       17 10561 1 1 16 SER HB3  H    2.726  -0.834 -12.345 1.00 . A A .  16 SER HB3  1 1 
       17 10562 1 1 16 SER HG   H    3.608  -3.433 -12.801 1.00 . A A .  16 SER HG   1 1 
       17 10563 1 1 16 SER N    N    1.642  -1.948  -9.984 1.00 . A A .  16 SER N    1 1 
       17 10564 1 1 16 SER O    O    4.912  -1.336 -11.090 1.00 . A A .  16 SER O    1 1 
       17 10565 1 1 16 SER OG   O    3.363  -2.585 -13.178 1.00 . A A .  16 SER OG   1 1 
       17 10566 1 1 17 GLU C    C    6.031  -2.340  -7.386 1.00 . A A .  17 GLU C    1 1 
       17 10567 1 1 17 GLU CA   C    5.463  -1.325  -8.373 1.00 . A A .  17 GLU CA   1 1 
       17 10568 1 1 17 GLU CB   C    5.181  -0.003  -7.657 1.00 . A A .  17 GLU CB   1 1 
       17 10569 1 1 17 GLU CD   C    6.578   1.478  -9.152 1.00 . A A .  17 GLU CD   1 1 
       17 10570 1 1 17 GLU CG   C    5.202   1.205  -8.578 1.00 . A A .  17 GLU CG   1 1 
       17 10571 1 1 17 GLU H    H    3.540  -2.210  -8.433 1.00 . A A .  17 GLU H    1 1 
       17 10572 1 1 17 GLU HA   H    6.189  -1.154  -9.153 1.00 . A A .  17 GLU HA   1 1 
       17 10573 1 1 17 GLU HB2  H    4.208  -0.059  -7.192 1.00 . A A .  17 GLU HB2  1 1 
       17 10574 1 1 17 GLU HB3  H    5.928   0.143  -6.891 1.00 . A A .  17 GLU HB3  1 1 
       17 10575 1 1 17 GLU HG2  H    4.517   1.031  -9.395 1.00 . A A .  17 GLU HG2  1 1 
       17 10576 1 1 17 GLU HG3  H    4.881   2.073  -8.020 1.00 . A A .  17 GLU HG3  1 1 
       17 10577 1 1 17 GLU N    N    4.246  -1.832  -8.998 1.00 . A A .  17 GLU N    1 1 
       17 10578 1 1 17 GLU O    O    7.226  -2.638  -7.404 1.00 . A A .  17 GLU O    1 1 
       17 10579 1 1 17 GLU OE1  O    7.576   1.071  -8.521 1.00 . A A .  17 GLU OE1  1 1 
       17 10580 1 1 17 GLU OE2  O    6.658   2.100 -10.232 1.00 . A A .  17 GLU OE2  1 1 
       17 10581 1 1 18 CYS C    C    4.882  -5.185  -5.758 1.00 . A A .  18 CYS C    1 1 
       17 10582 1 1 18 CYS CA   C    5.582  -3.849  -5.530 1.00 . A A .  18 CYS CA   1 1 
       17 10583 1 1 18 CYS CB   C    5.277  -3.336  -4.121 1.00 . A A .  18 CYS CB   1 1 
       17 10584 1 1 18 CYS H    H    4.227  -2.590  -6.561 1.00 . A A .  18 CYS H    1 1 
       17 10585 1 1 18 CYS HA   H    6.647  -3.992  -5.628 1.00 . A A .  18 CYS HA   1 1 
       17 10586 1 1 18 CYS HB2  H    5.640  -4.052  -3.399 1.00 . A A .  18 CYS HB2  1 1 
       17 10587 1 1 18 CYS HB3  H    5.784  -2.394  -3.971 1.00 . A A .  18 CYS HB3  1 1 
       17 10588 1 1 18 CYS N    N    5.168  -2.868  -6.526 1.00 . A A .  18 CYS N    1 1 
       17 10589 1 1 18 CYS O    O    5.507  -6.243  -5.700 1.00 . A A .  18 CYS O    1 1 
       17 10590 1 1 18 CYS SG   S    3.505  -3.070  -3.793 1.00 . A A .  18 CYS SG   1 1 
       17 10591 1 1 19 GLY C    C    1.750  -6.566  -5.200 1.00 . A A .  19 GLY C    1 1 
       17 10592 1 1 19 GLY CA   C    2.816  -6.340  -6.253 1.00 . A A .  19 GLY CA   1 1 
       17 10593 1 1 19 GLY H    H    3.134  -4.256  -6.054 1.00 . A A .  19 GLY H    1 1 
       17 10594 1 1 19 GLY HA2  H    2.342  -6.273  -7.221 1.00 . A A .  19 GLY HA2  1 1 
       17 10595 1 1 19 GLY HA3  H    3.491  -7.183  -6.252 1.00 . A A .  19 GLY HA3  1 1 
       17 10596 1 1 19 GLY N    N    3.580  -5.128  -6.020 1.00 . A A .  19 GLY N    1 1 
       17 10597 1 1 19 GLY O    O    1.776  -7.568  -4.484 1.00 . A A .  19 GLY O    1 1 
       17 10598 1 1 20 LYS C    C   -1.620  -5.463  -4.782 1.00 . A A .  20 LYS C    1 1 
       17 10599 1 1 20 LYS CA   C   -0.270  -5.733  -4.127 1.00 . A A .  20 LYS CA   1 1 
       17 10600 1 1 20 LYS CB   C   -0.042  -4.746  -2.979 1.00 . A A .  20 LYS CB   1 1 
       17 10601 1 1 20 LYS CD   C    0.757  -4.421  -0.620 1.00 . A A .  20 LYS CD   1 1 
       17 10602 1 1 20 LYS CE   C   -0.520  -4.640   0.177 1.00 . A A .  20 LYS CE   1 1 
       17 10603 1 1 20 LYS CG   C    0.804  -5.310  -1.851 1.00 . A A .  20 LYS CG   1 1 
       17 10604 1 1 20 LYS H    H    0.844  -4.856  -5.699 1.00 . A A .  20 LYS H    1 1 
       17 10605 1 1 20 LYS HA   H   -0.268  -6.737  -3.732 1.00 . A A .  20 LYS HA   1 1 
       17 10606 1 1 20 LYS HB2  H    0.452  -3.868  -3.367 1.00 . A A .  20 LYS HB2  1 1 
       17 10607 1 1 20 LYS HB3  H   -1.001  -4.459  -2.572 1.00 . A A .  20 LYS HB3  1 1 
       17 10608 1 1 20 LYS HD2  H    1.604  -4.648   0.010 1.00 . A A .  20 LYS HD2  1 1 
       17 10609 1 1 20 LYS HD3  H    0.804  -3.387  -0.931 1.00 . A A .  20 LYS HD3  1 1 
       17 10610 1 1 20 LYS HE2  H   -0.536  -3.947   1.004 1.00 . A A .  20 LYS HE2  1 1 
       17 10611 1 1 20 LYS HE3  H   -1.367  -4.452  -0.466 1.00 . A A .  20 LYS HE3  1 1 
       17 10612 1 1 20 LYS HG2  H    0.433  -6.290  -1.589 1.00 . A A .  20 LYS HG2  1 1 
       17 10613 1 1 20 LYS HG3  H    1.829  -5.390  -2.187 1.00 . A A .  20 LYS HG3  1 1 
       17 10614 1 1 20 LYS HZ1  H    0.328  -6.474   0.709 1.00 . A A .  20 LYS HZ1  1 1 
       17 10615 1 1 20 LYS HZ2  H   -1.251  -6.595   0.112 1.00 . A A .  20 LYS HZ2  1 1 
       17 10616 1 1 20 LYS HZ3  H   -0.982  -6.017   1.678 1.00 . A A .  20 LYS HZ3  1 1 
       17 10617 1 1 20 LYS N    N    0.810  -5.632  -5.101 1.00 . A A .  20 LYS N    1 1 
       17 10618 1 1 20 LYS NZ   N   -0.612  -6.029   0.706 1.00 . A A .  20 LYS NZ   1 1 
       17 10619 1 1 20 LYS O    O   -1.836  -4.403  -5.370 1.00 . A A .  20 LYS O    1 1 
       17 10620 1 1 21 SER C    C   -4.881  -5.906  -4.199 1.00 . A A .  21 SER C    1 1 
       17 10621 1 1 21 SER CA   C   -3.857  -6.297  -5.260 1.00 . A A .  21 SER CA   1 1 
       17 10622 1 1 21 SER CB   C   -4.275  -7.607  -5.930 1.00 . A A .  21 SER CB   1 1 
       17 10623 1 1 21 SER H    H   -2.296  -7.251  -4.195 1.00 . A A .  21 SER H    1 1 
       17 10624 1 1 21 SER HA   H   -3.815  -5.518  -6.007 1.00 . A A .  21 SER HA   1 1 
       17 10625 1 1 21 SER HB2  H   -5.286  -7.514  -6.298 1.00 . A A .  21 SER HB2  1 1 
       17 10626 1 1 21 SER HB3  H   -3.609  -7.815  -6.756 1.00 . A A .  21 SER HB3  1 1 
       17 10627 1 1 21 SER HG   H   -4.467  -9.500  -5.464 1.00 . A A .  21 SER HG   1 1 
       17 10628 1 1 21 SER N    N   -2.528  -6.429  -4.676 1.00 . A A .  21 SER N    1 1 
       17 10629 1 1 21 SER O    O   -5.153  -6.669  -3.272 1.00 . A A .  21 SER O    1 1 
       17 10630 1 1 21 SER OG   O   -4.220  -8.688  -5.016 1.00 . A A .  21 SER OG   1 1 
       17 10631 1 1 22 PHE C    C   -7.847  -4.357  -3.963 1.00 . A A .  22 PHE C    1 1 
       17 10632 1 1 22 PHE CA   C   -6.438  -4.216  -3.396 1.00 . A A .  22 PHE CA   1 1 
       17 10633 1 1 22 PHE CB   C   -6.159  -2.752  -3.050 1.00 . A A .  22 PHE CB   1 1 
       17 10634 1 1 22 PHE CD1  C   -3.705  -2.484  -3.500 1.00 . A A .  22 PHE CD1  1 1 
       17 10635 1 1 22 PHE CD2  C   -4.473  -2.285  -1.251 1.00 . A A .  22 PHE CD2  1 1 
       17 10636 1 1 22 PHE CE1  C   -2.408  -2.254  -3.081 1.00 . A A .  22 PHE CE1  1 1 
       17 10637 1 1 22 PHE CE2  C   -3.178  -2.054  -0.826 1.00 . A A .  22 PHE CE2  1 1 
       17 10638 1 1 22 PHE CG   C   -4.751  -2.502  -2.591 1.00 . A A .  22 PHE CG   1 1 
       17 10639 1 1 22 PHE CZ   C   -2.144  -2.040  -1.742 1.00 . A A .  22 PHE CZ   1 1 
       17 10640 1 1 22 PHE H    H   -5.186  -4.148  -5.102 1.00 . A A .  22 PHE H    1 1 
       17 10641 1 1 22 PHE HA   H   -6.363  -4.810  -2.498 1.00 . A A .  22 PHE HA   1 1 
       17 10642 1 1 22 PHE HB2  H   -6.336  -2.143  -3.924 1.00 . A A .  22 PHE HB2  1 1 
       17 10643 1 1 22 PHE HB3  H   -6.827  -2.443  -2.260 1.00 . A A .  22 PHE HB3  1 1 
       17 10644 1 1 22 PHE HD1  H   -3.910  -2.652  -4.548 1.00 . A A .  22 PHE HD1  1 1 
       17 10645 1 1 22 PHE HD2  H   -5.280  -2.297  -0.533 1.00 . A A .  22 PHE HD2  1 1 
       17 10646 1 1 22 PHE HE1  H   -1.602  -2.244  -3.800 1.00 . A A .  22 PHE HE1  1 1 
       17 10647 1 1 22 PHE HE2  H   -2.975  -1.887   0.221 1.00 . A A .  22 PHE HE2  1 1 
       17 10648 1 1 22 PHE HZ   H   -1.132  -1.859  -1.413 1.00 . A A .  22 PHE HZ   1 1 
       17 10649 1 1 22 PHE N    N   -5.444  -4.711  -4.342 1.00 . A A .  22 PHE N    1 1 
       17 10650 1 1 22 PHE O    O   -8.028  -4.527  -5.169 1.00 . A A .  22 PHE O    1 1 
       17 10651 1 1 23 SER C    C  -10.874  -3.035  -3.673 1.00 . A A .  23 SER C    1 1 
       17 10652 1 1 23 SER CA   C  -10.236  -4.410  -3.496 1.00 . A A .  23 SER CA   1 1 
       17 10653 1 1 23 SER CB   C  -11.023  -5.223  -2.467 1.00 . A A .  23 SER CB   1 1 
       17 10654 1 1 23 SER H    H   -8.634  -4.149  -2.137 1.00 . A A .  23 SER H    1 1 
       17 10655 1 1 23 SER HA   H  -10.256  -4.928  -4.444 1.00 . A A .  23 SER HA   1 1 
       17 10656 1 1 23 SER HB2  H  -10.699  -4.951  -1.474 1.00 . A A .  23 SER HB2  1 1 
       17 10657 1 1 23 SER HB3  H  -12.077  -5.008  -2.573 1.00 . A A .  23 SER HB3  1 1 
       17 10658 1 1 23 SER HG   H  -11.658  -7.037  -2.843 1.00 . A A .  23 SER HG   1 1 
       17 10659 1 1 23 SER N    N   -8.842  -4.286  -3.085 1.00 . A A .  23 SER N    1 1 
       17 10660 1 1 23 SER O    O  -12.003  -2.803  -3.242 1.00 . A A .  23 SER O    1 1 
       17 10661 1 1 23 SER OG   O  -10.819  -6.613  -2.650 1.00 . A A .  23 SER OG   1 1 
       17 10662 1 1 24 GLY C    C   -9.612   0.137  -5.135 1.00 . A A .  24 GLY C    1 1 
       17 10663 1 1 24 GLY CA   C  -10.652  -0.786  -4.532 1.00 . A A .  24 GLY CA   1 1 
       17 10664 1 1 24 GLY H    H   -9.248  -2.368  -4.631 1.00 . A A .  24 GLY H    1 1 
       17 10665 1 1 24 GLY HA2  H  -11.499  -0.842  -5.200 1.00 . A A .  24 GLY HA2  1 1 
       17 10666 1 1 24 GLY HA3  H  -10.977  -0.376  -3.588 1.00 . A A .  24 GLY HA3  1 1 
       17 10667 1 1 24 GLY N    N  -10.142  -2.127  -4.310 1.00 . A A .  24 GLY N    1 1 
       17 10668 1 1 24 GLY O    O   -8.516   0.286  -4.593 1.00 . A A .  24 GLY O    1 1 
       17 10669 1 1 25 SER C    C   -8.712   2.868  -6.056 1.00 . A A .  25 SER C    1 1 
       17 10670 1 1 25 SER CA   C   -9.039   1.668  -6.939 1.00 . A A .  25 SER CA   1 1 
       17 10671 1 1 25 SER CB   C   -9.646   2.142  -8.260 1.00 . A A .  25 SER CB   1 1 
       17 10672 1 1 25 SER H    H  -10.842   0.598  -6.642 1.00 . A A .  25 SER H    1 1 
       17 10673 1 1 25 SER HA   H   -8.127   1.128  -7.145 1.00 . A A .  25 SER HA   1 1 
       17 10674 1 1 25 SER HB2  H   -8.891   2.653  -8.838 1.00 . A A .  25 SER HB2  1 1 
       17 10675 1 1 25 SER HB3  H  -10.007   1.288  -8.815 1.00 . A A .  25 SER HB3  1 1 
       17 10676 1 1 25 SER HG   H  -10.486   3.910  -8.336 1.00 . A A .  25 SER HG   1 1 
       17 10677 1 1 25 SER N    N   -9.954   0.758  -6.259 1.00 . A A .  25 SER N    1 1 
       17 10678 1 1 25 SER O    O   -7.554   3.273  -5.944 1.00 . A A .  25 SER O    1 1 
       17 10679 1 1 25 SER OG   O  -10.727   3.031  -8.035 1.00 . A A .  25 SER OG   1 1 
       17 10680 1 1 26 TYR C    C   -8.459   4.338  -3.539 1.00 . A A .  26 TYR C    1 1 
       17 10681 1 1 26 TYR CA   C   -9.563   4.590  -4.562 1.00 . A A .  26 TYR CA   1 1 
       17 10682 1 1 26 TYR CB   C  -10.873   4.919  -3.844 1.00 . A A .  26 TYR CB   1 1 
       17 10683 1 1 26 TYR CD1  C  -10.036   6.367  -1.952 1.00 . A A .  26 TYR CD1  1 1 
       17 10684 1 1 26 TYR CD2  C  -11.595   7.312  -3.488 1.00 . A A .  26 TYR CD2  1 1 
       17 10685 1 1 26 TYR CE1  C   -9.998   7.557  -1.251 1.00 . A A .  26 TYR CE1  1 1 
       17 10686 1 1 26 TYR CE2  C  -11.562   8.506  -2.794 1.00 . A A .  26 TYR CE2  1 1 
       17 10687 1 1 26 TYR CG   C  -10.834   6.223  -3.080 1.00 . A A .  26 TYR CG   1 1 
       17 10688 1 1 26 TYR CZ   C  -10.763   8.623  -1.676 1.00 . A A .  26 TYR CZ   1 1 
       17 10689 1 1 26 TYR H    H  -10.638   3.066  -5.562 1.00 . A A .  26 TYR H    1 1 
       17 10690 1 1 26 TYR HA   H   -9.281   5.430  -5.179 1.00 . A A .  26 TYR HA   1 1 
       17 10691 1 1 26 TYR HB2  H  -11.667   4.984  -4.571 1.00 . A A .  26 TYR HB2  1 1 
       17 10692 1 1 26 TYR HB3  H  -11.098   4.129  -3.142 1.00 . A A .  26 TYR HB3  1 1 
       17 10693 1 1 26 TYR HD1  H   -9.438   5.530  -1.622 1.00 . A A .  26 TYR HD1  1 1 
       17 10694 1 1 26 TYR HD2  H  -12.220   7.217  -4.364 1.00 . A A .  26 TYR HD2  1 1 
       17 10695 1 1 26 TYR HE1  H   -9.372   7.649  -0.376 1.00 . A A .  26 TYR HE1  1 1 
       17 10696 1 1 26 TYR HE2  H  -12.161   9.342  -3.126 1.00 . A A .  26 TYR HE2  1 1 
       17 10697 1 1 26 TYR HH   H  -11.039   9.666  -0.085 1.00 . A A .  26 TYR HH   1 1 
       17 10698 1 1 26 TYR N    N   -9.739   3.434  -5.433 1.00 . A A .  26 TYR N    1 1 
       17 10699 1 1 26 TYR O    O   -7.701   5.244  -3.191 1.00 . A A .  26 TYR O    1 1 
       17 10700 1 1 26 TYR OH   O  -10.727   9.811  -0.981 1.00 . A A .  26 TYR OH   1 1 
       17 10701 1 1 27 ARG C    C   -6.007   2.522  -2.745 1.00 . A A .  27 ARG C    1 1 
       17 10702 1 1 27 ARG CA   C   -7.364   2.728  -2.079 1.00 . A A .  27 ARG CA   1 1 
       17 10703 1 1 27 ARG CB   C   -7.782   1.453  -1.344 1.00 . A A .  27 ARG CB   1 1 
       17 10704 1 1 27 ARG CD   C   -8.650   0.573   0.844 1.00 . A A .  27 ARG CD   1 1 
       17 10705 1 1 27 ARG CG   C   -8.713   1.705  -0.169 1.00 . A A .  27 ARG CG   1 1 
       17 10706 1 1 27 ARG CZ   C   -9.471  -1.734   1.062 1.00 . A A .  27 ARG CZ   1 1 
       17 10707 1 1 27 ARG H    H   -9.007   2.422  -3.378 1.00 . A A .  27 ARG H    1 1 
       17 10708 1 1 27 ARG HA   H   -7.282   3.534  -1.365 1.00 . A A .  27 ARG HA   1 1 
       17 10709 1 1 27 ARG HB2  H   -8.287   0.799  -2.040 1.00 . A A .  27 ARG HB2  1 1 
       17 10710 1 1 27 ARG HB3  H   -6.897   0.958  -0.974 1.00 . A A .  27 ARG HB3  1 1 
       17 10711 1 1 27 ARG HD2  H   -7.630   0.225   0.913 1.00 . A A .  27 ARG HD2  1 1 
       17 10712 1 1 27 ARG HD3  H   -8.967   0.950   1.805 1.00 . A A .  27 ARG HD3  1 1 
       17 10713 1 1 27 ARG HE   H  -10.142  -0.406  -0.266 1.00 . A A .  27 ARG HE   1 1 
       17 10714 1 1 27 ARG HG2  H   -8.423   2.625   0.317 1.00 . A A .  27 ARG HG2  1 1 
       17 10715 1 1 27 ARG HG3  H   -9.725   1.793  -0.536 1.00 . A A .  27 ARG HG3  1 1 
       17 10716 1 1 27 ARG HH11 H   -8.010  -1.225   2.361 1.00 . A A .  27 ARG HH11 1 1 
       17 10717 1 1 27 ARG HH12 H   -8.598  -2.849   2.505 1.00 . A A .  27 ARG HH12 1 1 
       17 10718 1 1 27 ARG HH21 H  -10.925  -2.541  -0.087 1.00 . A A .  27 ARG HH21 1 1 
       17 10719 1 1 27 ARG HH22 H  -10.255  -3.596   1.111 1.00 . A A .  27 ARG HH22 1 1 
       17 10720 1 1 27 ARG N    N   -8.374   3.101  -3.062 1.00 . A A .  27 ARG N    1 1 
       17 10721 1 1 27 ARG NE   N   -9.508  -0.547   0.467 1.00 . A A .  27 ARG NE   1 1 
       17 10722 1 1 27 ARG NH1  N   -8.623  -1.954   2.057 1.00 . A A .  27 ARG NH1  1 1 
       17 10723 1 1 27 ARG NH2  N  -10.284  -2.704   0.663 1.00 . A A .  27 ARG NH2  1 1 
       17 10724 1 1 27 ARG O    O   -4.971   2.908  -2.202 1.00 . A A .  27 ARG O    1 1 
       17 10725 1 1 28 LEU C    C   -3.897   2.887  -4.686 1.00 . A A .  28 LEU C    1 1 
       17 10726 1 1 28 LEU CA   C   -4.790   1.651  -4.666 1.00 . A A .  28 LEU CA   1 1 
       17 10727 1 1 28 LEU CB   C   -5.115   1.220  -6.097 1.00 . A A .  28 LEU CB   1 1 
       17 10728 1 1 28 LEU CD1  C   -3.664  -0.697  -6.807 1.00 . A A .  28 LEU CD1  1 1 
       17 10729 1 1 28 LEU CD2  C   -4.166   1.152  -8.416 1.00 . A A .  28 LEU CD2  1 1 
       17 10730 1 1 28 LEU CG   C   -3.925   0.794  -6.956 1.00 . A A .  28 LEU CG   1 1 
       17 10731 1 1 28 LEU H    H   -6.876   1.625  -4.307 1.00 . A A .  28 LEU H    1 1 
       17 10732 1 1 28 LEU HA   H   -4.265   0.850  -4.167 1.00 . A A .  28 LEU HA   1 1 
       17 10733 1 1 28 LEU HB2  H   -5.799   0.386  -6.043 1.00 . A A .  28 LEU HB2  1 1 
       17 10734 1 1 28 LEU HB3  H   -5.601   2.050  -6.590 1.00 . A A .  28 LEU HB3  1 1 
       17 10735 1 1 28 LEU HD11 H   -4.286  -1.242  -7.501 1.00 . A A .  28 LEU HD11 1 1 
       17 10736 1 1 28 LEU HD12 H   -3.895  -1.003  -5.798 1.00 . A A .  28 LEU HD12 1 1 
       17 10737 1 1 28 LEU HD13 H   -2.624  -0.903  -7.017 1.00 . A A .  28 LEU HD13 1 1 
       17 10738 1 1 28 LEU HD21 H   -5.168   1.535  -8.532 1.00 . A A .  28 LEU HD21 1 1 
       17 10739 1 1 28 LEU HD22 H   -4.044   0.270  -9.027 1.00 . A A .  28 LEU HD22 1 1 
       17 10740 1 1 28 LEU HD23 H   -3.454   1.904  -8.724 1.00 . A A .  28 LEU HD23 1 1 
       17 10741 1 1 28 LEU HG   H   -3.041   1.322  -6.623 1.00 . A A .  28 LEU HG   1 1 
       17 10742 1 1 28 LEU N    N   -6.020   1.910  -3.925 1.00 . A A .  28 LEU N    1 1 
       17 10743 1 1 28 LEU O    O   -2.806   2.888  -4.114 1.00 . A A .  28 LEU O    1 1 
       17 10744 1 1 29 THR C    C   -2.983   5.548  -4.101 1.00 . A A .  29 THR C    1 1 
       17 10745 1 1 29 THR CA   C   -3.611   5.183  -5.442 1.00 . A A .  29 THR CA   1 1 
       17 10746 1 1 29 THR CB   C   -4.503   6.348  -5.912 1.00 . A A .  29 THR CB   1 1 
       17 10747 1 1 29 THR CG2  C   -5.769   6.434  -5.073 1.00 . A A .  29 THR CG2  1 1 
       17 10748 1 1 29 THR H    H   -5.243   3.878  -5.783 1.00 . A A .  29 THR H    1 1 
       17 10749 1 1 29 THR HA   H   -2.826   5.042  -6.170 1.00 . A A .  29 THR HA   1 1 
       17 10750 1 1 29 THR HB   H   -4.782   6.175  -6.942 1.00 . A A .  29 THR HB   1 1 
       17 10751 1 1 29 THR HG1  H   -3.940   7.986  -4.968 1.00 . A A .  29 THR HG1  1 1 
       17 10752 1 1 29 THR HG21 H   -6.568   6.845  -5.670 1.00 . A A .  29 THR HG21 1 1 
       17 10753 1 1 29 THR HG22 H   -5.592   7.072  -4.219 1.00 . A A .  29 THR HG22 1 1 
       17 10754 1 1 29 THR HG23 H   -6.043   5.446  -4.734 1.00 . A A .  29 THR HG23 1 1 
       17 10755 1 1 29 THR N    N   -4.367   3.941  -5.347 1.00 . A A .  29 THR N    1 1 
       17 10756 1 1 29 THR O    O   -1.769   5.722  -4.002 1.00 . A A .  29 THR O    1 1 
       17 10757 1 1 29 THR OG1  O   -3.782   7.583  -5.825 1.00 . A A .  29 THR OG1  1 1 
       17 10758 1 1 30 GLN C    C   -2.112   5.185  -1.370 1.00 . A A .  30 GLN C    1 1 
       17 10759 1 1 30 GLN CA   C   -3.343   6.006  -1.739 1.00 . A A .  30 GLN CA   1 1 
       17 10760 1 1 30 GLN CB   C   -4.449   5.780  -0.706 1.00 . A A .  30 GLN CB   1 1 
       17 10761 1 1 30 GLN CD   C   -6.395   6.771   0.564 1.00 . A A .  30 GLN CD   1 1 
       17 10762 1 1 30 GLN CG   C   -5.394   6.961  -0.558 1.00 . A A .  30 GLN CG   1 1 
       17 10763 1 1 30 GLN H    H   -4.776   5.511  -3.216 1.00 . A A .  30 GLN H    1 1 
       17 10764 1 1 30 GLN HA   H   -3.075   7.052  -1.742 1.00 . A A .  30 GLN HA   1 1 
       17 10765 1 1 30 GLN HB2  H   -5.029   4.918  -1.001 1.00 . A A .  30 GLN HB2  1 1 
       17 10766 1 1 30 GLN HB3  H   -3.995   5.587   0.254 1.00 . A A .  30 GLN HB3  1 1 
       17 10767 1 1 30 GLN HE21 H   -5.004   7.216   1.914 1.00 . A A .  30 GLN HE21 1 1 
       17 10768 1 1 30 GLN HE22 H   -6.571   6.848   2.543 1.00 . A A .  30 GLN HE22 1 1 
       17 10769 1 1 30 GLN HG2  H   -4.812   7.848  -0.353 1.00 . A A .  30 GLN HG2  1 1 
       17 10770 1 1 30 GLN HG3  H   -5.934   7.093  -1.484 1.00 . A A .  30 GLN HG3  1 1 
       17 10771 1 1 30 GLN N    N   -3.818   5.662  -3.073 1.00 . A A .  30 GLN N    1 1 
       17 10772 1 1 30 GLN NE2  N   -5.945   6.963   1.799 1.00 . A A .  30 GLN NE2  1 1 
       17 10773 1 1 30 GLN O    O   -1.207   5.673  -0.693 1.00 . A A .  30 GLN O    1 1 
       17 10774 1 1 30 GLN OE1  O   -7.560   6.453   0.325 1.00 . A A .  30 GLN OE1  1 1 
       17 10775 1 1 31 HIS C    C    0.194   3.309  -2.497 1.00 . A A .  31 HIS C    1 1 
       17 10776 1 1 31 HIS CA   C   -0.963   3.045  -1.539 1.00 . A A .  31 HIS CA   1 1 
       17 10777 1 1 31 HIS CB   C   -1.404   1.585  -1.643 1.00 . A A .  31 HIS CB   1 1 
       17 10778 1 1 31 HIS CD2  C    0.122   0.132  -3.155 1.00 . A A .  31 HIS CD2  1 1 
       17 10779 1 1 31 HIS CE1  C    1.439  -0.675  -1.600 1.00 . A A .  31 HIS CE1  1 1 
       17 10780 1 1 31 HIS CG   C   -0.287   0.643  -1.971 1.00 . A A .  31 HIS CG   1 1 
       17 10781 1 1 31 HIS H    H   -2.835   3.603  -2.356 1.00 . A A .  31 HIS H    1 1 
       17 10782 1 1 31 HIS HA   H   -0.630   3.240  -0.531 1.00 . A A .  31 HIS HA   1 1 
       17 10783 1 1 31 HIS HB2  H   -1.832   1.277  -0.701 1.00 . A A .  31 HIS HB2  1 1 
       17 10784 1 1 31 HIS HB3  H   -2.152   1.496  -2.419 1.00 . A A .  31 HIS HB3  1 1 
       17 10785 1 1 31 HIS HD1  H    0.519   0.299  -0.054 1.00 . A A .  31 HIS HD1  1 1 
       17 10786 1 1 31 HIS HD2  H   -0.315   0.329  -4.124 1.00 . A A .  31 HIS HD2  1 1 
       17 10787 1 1 31 HIS HE1  H    2.224  -1.223  -1.101 1.00 . A A .  31 HIS HE1  1 1 
       17 10788 1 1 31 HIS N    N   -2.084   3.935  -1.821 1.00 . A A .  31 HIS N    1 1 
       17 10789 1 1 31 HIS ND1  N    0.558   0.117  -1.016 1.00 . A A .  31 HIS ND1  1 1 
       17 10790 1 1 31 HIS NE2  N    1.196  -0.684  -2.898 1.00 . A A .  31 HIS NE2  1 1 
       17 10791 1 1 31 HIS O    O    1.349   3.017  -2.187 1.00 . A A .  31 HIS O    1 1 
       17 10792 1 1 32 TRP C    C    1.765   5.331  -4.223 1.00 . A A .  32 TRP C    1 1 
       17 10793 1 1 32 TRP CA   C    0.891   4.164  -4.667 1.00 . A A .  32 TRP CA   1 1 
       17 10794 1 1 32 TRP CB   C    0.229   4.486  -6.008 1.00 . A A .  32 TRP CB   1 1 
       17 10795 1 1 32 TRP CD1  C   -0.774   2.169  -6.445 1.00 . A A .  32 TRP CD1  1 1 
       17 10796 1 1 32 TRP CD2  C    0.343   3.031  -8.184 1.00 . A A .  32 TRP CD2  1 1 
       17 10797 1 1 32 TRP CE2  C   -0.154   1.765  -8.552 1.00 . A A .  32 TRP CE2  1 1 
       17 10798 1 1 32 TRP CE3  C    1.079   3.764  -9.119 1.00 . A A .  32 TRP CE3  1 1 
       17 10799 1 1 32 TRP CG   C   -0.065   3.270  -6.832 1.00 . A A .  32 TRP CG   1 1 
       17 10800 1 1 32 TRP CH2  C    0.787   1.958 -10.710 1.00 . A A .  32 TRP CH2  1 1 
       17 10801 1 1 32 TRP CZ2  C    0.063   1.219  -9.814 1.00 . A A .  32 TRP CZ2  1 1 
       17 10802 1 1 32 TRP CZ3  C    1.293   3.220 -10.371 1.00 . A A .  32 TRP CZ3  1 1 
       17 10803 1 1 32 TRP H    H   -1.062   4.072  -3.852 1.00 . A A .  32 TRP H    1 1 
       17 10804 1 1 32 TRP HA   H    1.512   3.288  -4.783 1.00 . A A .  32 TRP HA   1 1 
       17 10805 1 1 32 TRP HB2  H   -0.703   5.001  -5.828 1.00 . A A .  32 TRP HB2  1 1 
       17 10806 1 1 32 TRP HB3  H    0.886   5.126  -6.579 1.00 . A A .  32 TRP HB3  1 1 
       17 10807 1 1 32 TRP HD1  H   -1.217   2.044  -5.469 1.00 . A A .  32 TRP HD1  1 1 
       17 10808 1 1 32 TRP HE1  H   -1.284   0.391  -7.441 1.00 . A A .  32 TRP HE1  1 1 
       17 10809 1 1 32 TRP HE3  H    1.477   4.738  -8.877 1.00 . A A .  32 TRP HE3  1 1 
       17 10810 1 1 32 TRP HH2  H    0.979   1.573 -11.699 1.00 . A A .  32 TRP HH2  1 1 
       17 10811 1 1 32 TRP HZ2  H   -0.321   0.248 -10.090 1.00 . A A .  32 TRP HZ2  1 1 
       17 10812 1 1 32 TRP HZ3  H    1.860   3.771 -11.107 1.00 . A A .  32 TRP HZ3  1 1 
       17 10813 1 1 32 TRP N    N   -0.123   3.862  -3.663 1.00 . A A .  32 TRP N    1 1 
       17 10814 1 1 32 TRP NE1  N   -0.831   1.260  -7.474 1.00 . A A .  32 TRP NE1  1 1 
       17 10815 1 1 32 TRP O    O    2.978   5.326  -4.436 1.00 . A A .  32 TRP O    1 1 
       17 10816 1 1 33 ILE C    C    3.047   7.104  -2.255 1.00 . A A .  33 ILE C    1 1 
       17 10817 1 1 33 ILE CA   C    1.866   7.504  -3.132 1.00 . A A .  33 ILE CA   1 1 
       17 10818 1 1 33 ILE CB   C    0.946   8.448  -2.336 1.00 . A A .  33 ILE CB   1 1 
       17 10819 1 1 33 ILE CD1  C   -1.360   8.311  -3.405 1.00 . A A .  33 ILE CD1  1 1 
       17 10820 1 1 33 ILE CG1  C   -0.078   9.102  -3.266 1.00 . A A .  33 ILE CG1  1 1 
       17 10821 1 1 33 ILE CG2  C    1.768   9.507  -1.617 1.00 . A A .  33 ILE CG2  1 1 
       17 10822 1 1 33 ILE H    H    0.174   6.276  -3.466 1.00 . A A .  33 ILE H    1 1 
       17 10823 1 1