NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
507515 2emv 10224 cing 4-filtered-FRED STAR entry full 738


data_FRED_restraints_with_modified_coordinates_PDB_code_2emv

# This FRED archive file contains, for PDB entry <2emv>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, WF Vranken, C Schulte, J Lin, JR Wedell, CJ Penkett, GW Vuister, 
# G Vriend, JL Markley, and EL Ulrich (2009). The NMR Restraints Grid at BMRB for 
# 5,266 Protein and Nucleic Acid PDB Entries. J Biomol. NMR 45, 389?396.




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.PDB_coordinate_file_version  .
    _Entry.Sf_category                  entry_information
    _Entry.ID                           1
    _Entry.Title                        "Data for entry 1"
    _Entry.NMR_STAR_version             3.1.0.8
    _Entry.Experimental_method          NMR
    _Entry.Details                      .

save_


save_assembly_2emv
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2emv
    _Assembly.Number_of_components  2
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "all other bound"
    _Assembly.Molecular_mass        4643.28

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $Zinc_finger_protein_268 A . 1 1 
       2 . 2 $ZINC_ION                B . 1 1 
    stop_

    loop_
       _PDBX_nonpoly_scheme.Entity_assembly_ID
       _PDBX_nonpoly_scheme.Entity_ID
       _PDBX_nonpoly_scheme.Mon_ID
       _PDBX_nonpoly_scheme.Comp_index_ID
       _PDBX_nonpoly_scheme.Comp_ID
       _PDBX_nonpoly_scheme.Entry_ID
       _PDBX_nonpoly_scheme.Assembly_ID

       2 2 ZN 1 ZN 1 1 
    stop_

save_


save_Zinc_finger_protein_268
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "Zinc finger protein 268"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  GSSGSSGTREKPYECSECGKAFIRNSQLIVHQRTHSGESGPSSG
    _Entity.Number_of_monomers           44

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

        1 GLY . 1 1 
        2 SER . 1 1 
        3 SER . 1 1 
        4 GLY . 1 1 
        5 SER . 1 1 
        6 SER . 1 1 
        7 GLY . 1 1 
        8 THR . 1 1 
        9 ARG . 1 1 
       10 GLU . 1 1 
       11 LYS . 1 1 
       12 PRO . 1 1 
       13 TYR . 1 1 
       14 GLU . 1 1 
       15 CYS . 1 1 
       16 SER . 1 1 
       17 GLU . 1 1 
       18 CYS . 1 1 
       19 GLY . 1 1 
       20 LYS . 1 1 
       21 ALA . 1 1 
       22 PHE . 1 1 
       23 ILE . 1 1 
       24 ARG . 1 1 
       25 ASN . 1 1 
       26 SER . 1 1 
       27 GLN . 1 1 
       28 LEU . 1 1 
       29 ILE . 1 1 
       30 VAL . 1 1 
       31 HIS . 1 1 
       32 GLN . 1 1 
       33 ARG . 1 1 
       34 THR . 1 1 
       35 HIS . 1 1 
       36 SER . 1 1 
       37 GLY . 1 1 
       38 GLU . 1 1 
       39 SER . 1 1 
       40 GLY . 1 1 
       41 PRO . 1 1 
       42 SER . 1 1 
       43 SER . 1 1 
       44 GLY . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       GLY  1  1 1 1 
       SER  2  2 1 1 
       SER  3  3 1 1 
       GLY  4  4 1 1 
       SER  5  5 1 1 
       SER  6  6 1 1 
       GLY  7  7 1 1 
       THR  8  8 1 1 
       ARG  9  9 1 1 
       GLU 10 10 1 1 
       LYS 11 11 1 1 
       PRO 12 12 1 1 
       TYR 13 13 1 1 
       GLU 14 14 1 1 
       CYS 15 15 1 1 
       SER 16 16 1 1 
       GLU 17 17 1 1 
       CYS 18 18 1 1 
       GLY 19 19 1 1 
       LYS 20 20 1 1 
       ALA 21 21 1 1 
       PHE 22 22 1 1 
       ILE 23 23 1 1 
       ARG 24 24 1 1 
       ASN 25 25 1 1 
       SER 26 26 1 1 
       GLN 27 27 1 1 
       LEU 28 28 1 1 
       ILE 29 29 1 1 
       VAL 30 30 1 1 
       HIS 31 31 1 1 
       GLN 32 32 1 1 
       ARG 33 33 1 1 
       THR 34 34 1 1 
       HIS 35 35 1 1 
       SER 36 36 1 1 
       GLY 37 37 1 1 
       GLU 38 38 1 1 
       SER 39 39 1 1 
       GLY 40 40 1 1 
       PRO 41 41 1 1 
       SER 42 42 1 1 
       SER 43 43 1 1 
       GLY 44 44 1 1 
    stop_

save_


save_ZINC_ION
    _Entity.Sf_category  entity
    _Entity.Entry_ID     1
    _Entity.ID           2
    _Entity.Name         "ZINC ION"
    _Entity.Type         non-polymer

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

       1 ZN $ZN 1 2 
    stop_

save_


save_ZN
    _Chem_comp.Sf_category  chem_comp
    _Chem_comp.Entry_ID     1
    _Chem_comp.ID           ZN
    _Chem_comp.Type         non-polymer

save_


save_DYANA/DIANA_distance_constraints_2_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     "general distance"
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

        1 1 . . . 1 1 
        2 1 . . . 1 1 
        3 1 . . . 1 1 
        4 1 . . . 1 1 
        5 1 . . . 1 1 
        6 1 . . . 1 1 
        7 1 . . . 1 1 
        8 1 . . . 1 1 
        9 1 . . . 1 1 
       10 1 . . . 1 1 
       11 1 . . . 1 1 
       12 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

        1 1 1 1 1 15 CYS SG  .  15 CYSS SG  1 1 
        1 1 2 2 2  1 ZN  ZN  . 201 ZN   ZN  1 1 
        2 1 1 1 1 18 CYS SG  .  18 CYSS SG  1 1 
        2 1 2 2 2  1 ZN  ZN  . 201 ZN   ZN  1 1 
        3 1 1 1 1 31 HIS NE2 .  31 HIS  NE2 1 1 
        3 1 2 2 2  1 ZN  ZN  . 201 ZN   ZN  1 1 
        4 1 1 1 1 35 HIS NE2 .  35 HIS  NE2 1 1 
        4 1 2 2 2  1 ZN  ZN  . 201 ZN   ZN  1 1 
        5 1 1 1 1 15 CYS CB  .  15 CYSS CB  1 1 
        5 1 2 2 2  1 ZN  ZN  . 201 ZN   ZN  1 1 
        6 1 1 1 1 18 CYS CB  .  18 CYSS CB  1 1 
        6 1 2 2 2  1 ZN  ZN  . 201 ZN   ZN  1 1 
        7 1 1 1 1 15 CYS SG  .  15 CYSS SG  1 1 
        7 1 2 1 1 18 CYS SG  .  18 CYSS SG  1 1 
        8 1 1 1 1 15 CYS SG  .  15 CYSS SG  1 1 
        8 1 2 1 1 31 HIS NE2 .  31 HIS  NE2 1 1 
        9 1 1 1 1 15 CYS SG  .  15 CYSS SG  1 1 
        9 1 2 1 1 35 HIS NE2 .  35 HIS  NE2 1 1 
       10 1 1 1 1 18 CYS SG  .  18 CYSS SG  1 1 
       10 1 2 1 1 31 HIS NE2 .  31 HIS  NE2 1 1 
       11 1 1 1 1 18 CYS SG  .  18 CYSS SG  1 1 
       11 1 2 1 1 35 HIS NE2 .  35 HIS  NE2 1 1 
       12 1 1 1 1 31 HIS NE2 .  31 HIS  NE2 1 1 
       12 1 2 1 1 35 HIS NE2 .  35 HIS  NE2 1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

        1 1 . . . . . . 2.33 2.37 1 1 
        2 1 . . . . . . 2.33 2.37 1 1 
        3 1 . . . . . . 2.33 2.37 1 1 
        4 1 . . . . . . 2.33 2.37 1 1 
        5 1 . . . . . . 3.25 3.51 1 1 
        6 1 . . . . . . 3.25 3.51 1 1 
        7 1 . . . . . .  3.2  4.0 1 1 
        8 1 . . . . . .  3.2  4.0 1 1 
        9 1 . . . . . .  3.2  4.0 1 1 
       10 1 . . . . . .  3.2  4.0 1 1 
       11 1 . . . . . .  3.2  4.0 1 1 
       12 1 . . . . . .  3.2  4.0 1 1 
    stop_

save_


save_DYANA/DIANA_distance_constraints_4_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  2
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

         1 1 . . . 1 2 
         2 1 . . . 1 2 
         3 1 . . . 1 2 
         4 1 . . . 1 2 
         5 1 . . . 1 2 
         6 1 . . . 1 2 
         7 1 . . . 1 2 
         8 1 . . . 1 2 
         9 1 . . . 1 2 
        10 1 . . . 1 2 
        11 1 . . . 1 2 
        12 1 . . . 1 2 
        13 1 . . . 1 2 
        14 1 . . . 1 2 
        15 1 . . . 1 2 
        16 1 . . . 1 2 
        17 1 . . . 1 2 
        18 1 . . . 1 2 
        19 1 . . . 1 2 
        20 1 . . . 1 2 
        21 1 . . . 1 2 
        22 1 . . . 1 2 
        23 1 . . . 1 2 
        24 1 . . . 1 2 
        25 1 . . . 1 2 
        26 1 . . . 1 2 
        27 1 . . . 1 2 
        28 1 . . . 1 2 
        29 1 . . . 1 2 
        30 1 . . . 1 2 
        31 1 . . . 1 2 
        32 1 . . . 1 2 
        33 1 . . . 1 2 
        34 1 . . . 1 2 
        35 1 . . . 1 2 
        36 1 . . . 1 2 
        37 1 . . . 1 2 
        38 1 . . . 1 2 
        39 1 . . . 1 2 
        40 1 . . . 1 2 
        41 1 . . . 1 2 
        42 1 . . . 1 2 
        43 1 . . . 1 2 
        44 1 . . . 1 2 
        45 1 . . . 1 2 
        46 1 . . . 1 2 
        47 1 . . . 1 2 
        48 1 . . . 1 2 
        49 1 . . . 1 2 
        50 1 . . . 1 2 
        51 1 . . . 1 2 
        52 1 . . . 1 2 
        53 1 . . . 1 2 
        54 1 . . . 1 2 
        55 1 . . . 1 2 
        56 1 . . . 1 2 
        57 1 . . . 1 2 
        58 1 . . . 1 2 
        59 1 . . . 1 2 
        60 1 . . . 1 2 
        61 1 . . . 1 2 
        62 1 . . . 1 2 
        63 1 . . . 1 2 
        64 1 . . . 1 2 
        65 1 . . . 1 2 
        66 1 . . . 1 2 
        67 1 . . . 1 2 
        68 1 . . . 1 2 
        69 1 . . . 1 2 
        70 1 . . . 1 2 
        71 1 . . . 1 2 
        72 1 . . . 1 2 
        73 1 . . . 1 2 
        74 1 . . . 1 2 
        75 1 . . . 1 2 
        76 1 . . . 1 2 
        77 1 . . . 1 2 
        78 1 . . . 1 2 
        79 1 . . . 1 2 
        80 1 . . . 1 2 
        81 1 . . . 1 2 
        82 1 . . . 1 2 
        83 1 . . . 1 2 
        84 1 . . . 1 2 
        85 1 . . . 1 2 
        86 1 . . . 1 2 
        87 1 . . . 1 2 
        88 1 . . . 1 2 
        89 1 . . . 1 2 
        90 1 . . . 1 2 
        91 1 . . . 1 2 
        92 1 . . . 1 2 
        93 1 . . . 1 2 
        94 1 . . . 1 2 
        95 1 . . . 1 2 
        96 1 . . . 1 2 
        97 1 . . . 1 2 
        98 1 . . . 1 2 
        99 1 . . . 1 2 
       100 1 . . . 1 2 
       101 1 . . . 1 2 
       102 1 . . . 1 2 
       103 1 . . . 1 2 
       104 1 . . . 1 2 
       105 1 . . . 1 2 
       106 1 . . . 1 2 
       107 1 . . . 1 2 
       108 1 . . . 1 2 
       109 1 . . . 1 2 
       110 1 . . . 1 2 
       111 1 . . . 1 2 
       112 1 . . . 1 2 
       113 1 . . . 1 2 
       114 1 . . . 1 2 
       115 1 . . . 1 2 
       116 1 . . . 1 2 
       117 1 . . . 1 2 
       118 1 . . . 1 2 
       119 1 . . . 1 2 
       120 1 . . . 1 2 
       121 1 . . . 1 2 
       122 1 . . . 1 2 
       123 1 . . . 1 2 
       124 1 . . . 1 2 
       125 1 . . . 1 2 
       126 1 . . . 1 2 
       127 1 . . . 1 2 
       128 1 . . . 1 2 
       129 1 . . . 1 2 
       130 1 . . . 1 2 
       131 1 . . . 1 2 
       132 1 . . . 1 2 
       133 1 . . . 1 2 
       134 1 . . . 1 2 
       135 1 . . . 1 2 
       136 1 . . . 1 2 
       137 1 . . . 1 2 
       138 1 . . . 1 2 
       139 1 . . . 1 2 
       140 1 . . . 1 2 
       141 1 . . . 1 2 
       142 1 . . . 1 2 
       143 1 . . . 1 2 
       144 1 . . . 1 2 
       145 1 . . . 1 2 
       146 1 . . . 1 2 
       147 1 . . . 1 2 
       148 1 . . . 1 2 
       149 1 . . . 1 2 
       150 1 . . . 1 2 
       151 1 . . . 1 2 
       152 1 . . . 1 2 
       153 1 . . . 1 2 
       154 1 . . . 1 2 
       155 1 . . . 1 2 
       156 1 . . . 1 2 
       157 1 . . . 1 2 
       158 1 . . . 1 2 
       159 1 . . . 1 2 
       160 1 . . . 1 2 
       161 1 . . . 1 2 
       162 1 . . . 1 2 
       163 1 . . . 1 2 
       164 1 . . . 1 2 
       165 1 . . . 1 2 
       166 1 . . . 1 2 
       167 1 . . . 1 2 
       168 1 . . . 1 2 
       169 1 . . . 1 2 
       170 1 . . . 1 2 
       171 1 . . . 1 2 
       172 1 . . . 1 2 
       173 1 . . . 1 2 
       174 1 . . . 1 2 
       175 1 . . . 1 2 
       176 1 . . . 1 2 
       177 1 . . . 1 2 
       178 1 . . . 1 2 
       179 1 . . . 1 2 
       180 1 . . . 1 2 
       181 1 . . . 1 2 
       182 1 . . . 1 2 
       183 1 . . . 1 2 
       184 1 . . . 1 2 
       185 1 . . . 1 2 
       186 1 . . . 1 2 
       187 1 . . . 1 2 
       188 1 . . . 1 2 
       189 1 . . . 1 2 
       190 1 . . . 1 2 
       191 1 . . . 1 2 
       192 1 . . . 1 2 
       193 1 . . . 1 2 
       194 1 . . . 1 2 
       195 1 . . . 1 2 
       196 1 . . . 1 2 
       197 1 . . . 1 2 
       198 1 . . . 1 2 
       199 1 . . . 1 2 
       200 1 . . . 1 2 
       201 1 . . . 1 2 
       202 1 . . . 1 2 
       203 1 . . . 1 2 
       204 1 . . . 1 2 
       205 1 . . . 1 2 
       206 1 . . . 1 2 
       207 1 . . . 1 2 
       208 1 . . . 1 2 
       209 1 . . . 1 2 
       210 1 . . . 1 2 
       211 1 . . . 1 2 
       212 1 . . . 1 2 
       213 1 . . . 1 2 
       214 1 . . . 1 2 
       215 1 . . . 1 2 
       216 1 . . . 1 2 
       217 1 . . . 1 2 
       218 1 . . . 1 2 
       219 1 . . . 1 2 
       220 1 . . . 1 2 
       221 1 . . . 1 2 
       222 1 . . . 1 2 
       223 1 . . . 1 2 
       224 1 . . . 1 2 
       225 1 . . . 1 2 
       226 1 . . . 1 2 
       227 1 . . . 1 2 
       228 1 . . . 1 2 
       229 1 . . . 1 2 
       230 1 . . . 1 2 
       231 1 . . . 1 2 
       232 1 . . . 1 2 
       233 1 . . . 1 2 
       234 1 . . . 1 2 
       235 1 . . . 1 2 
       236 1 . . . 1 2 
       237 1 . . . 1 2 
       238 1 . . . 1 2 
       239 1 . . . 1 2 
       240 1 . . . 1 2 
       241 1 . . . 1 2 
       242 1 . . . 1 2 
       243 1 . . . 1 2 
       244 1 . . . 1 2 
       245 1 . . . 1 2 
       246 1 . . . 1 2 
       247 1 . . . 1 2 
       248 1 . . . 1 2 
       249 1 . . . 1 2 
       250 1 . . . 1 2 
       251 1 . . . 1 2 
       252 1 . . . 1 2 
       253 1 . . . 1 2 
       254 1 . . . 1 2 
       255 1 . . . 1 2 
       256 1 . . . 1 2 
       257 1 . . . 1 2 
       258 1 . . . 1 2 
       259 1 . . . 1 2 
       260 1 . . . 1 2 
       261 1 . . . 1 2 
       262 1 . . . 1 2 
       263 1 . . . 1 2 
       264 1 . . . 1 2 
       265 1 . . . 1 2 
       266 1 . . . 1 2 
       267 1 . . . 1 2 
       268 1 . . . 1 2 
       269 1 . . . 1 2 
       270 1 . . . 1 2 
       271 1 . . . 1 2 
       272 1 . . . 1 2 
       273 1 . . . 1 2 
       274 1 . . . 1 2 
       275 1 . . . 1 2 
       276 1 . . . 1 2 
       277 1 . . . 1 2 
       278 1 . . . 1 2 
       279 1 . . . 1 2 
       280 1 . . . 1 2 
       281 1 . . . 1 2 
       282 1 . . . 1 2 
       283 1 . . . 1 2 
       284 1 . . . 1 2 
       285 1 . . . 1 2 
       286 1 . . . 1 2 
       287 1 . . . 1 2 
       288 1 . . . 1 2 
       289 1 . . . 1 2 
       290 1 . . . 1 2 
       291 1 . . . 1 2 
       292 1 . . . 1 2 
       293 1 . . . 1 2 
       294 1 . . . 1 2 
       295 1 . . . 1 2 
       296 1 . . . 1 2 
       297 1 . . . 1 2 
       298 1 . . . 1 2 
       299 1 . . . 1 2 
       300 1 . . . 1 2 
       301 1 . . . 1 2 
       302 1 . . . 1 2 
       303 1 . . . 1 2 
       304 1 . . . 1 2 
       305 1 . . . 1 2 
       306 1 . . . 1 2 
       307 1 . . . 1 2 
       308 1 . . . 1 2 
       309 1 . . . 1 2 
       310 1 . . . 1 2 
       311 1 . . . 1 2 
       312 1 . . . 1 2 
       313 1 . . . 1 2 
       314 1 . . . 1 2 
       315 1 . . . 1 2 
       316 1 . . . 1 2 
       317 1 . . . 1 2 
       318 1 . . . 1 2 
       319 1 . . . 1 2 
       320 1 . . . 1 2 
       321 1 . . . 1 2 
       322 1 . . . 1 2 
       323 1 . . . 1 2 
       324 1 . . . 1 2 
       325 1 . . . 1 2 
       326 1 . . . 1 2 
       327 1 . . . 1 2 
       328 1 . . . 1 2 
       329 1 . . . 1 2 
       330 1 . . . 1 2 
       331 1 . . . 1 2 
       332 1 . . . 1 2 
       333 1 . . . 1 2 
       334 1 . . . 1 2 
       335 1 . . . 1 2 
       336 1 . . . 1 2 
       337 1 . . . 1 2 
       338 1 . . . 1 2 
       339 1 . . . 1 2 
       340 1 . . . 1 2 
       341 1 . . . 1 2 
       342 1 . . . 1 2 
       343 1 . . . 1 2 
       344 1 . . . 1 2 
       345 1 . . . 1 2 
       346 1 . . . 1 2 
       347 1 . . . 1 2 
       348 1 . . . 1 2 
       349 1 . . . 1 2 
       350 1 . . . 1 2 
       351 1 . . . 1 2 
       352 1 . . . 1 2 
       353 1 . . . 1 2 
       354 1 . . . 1 2 
       355 1 . . . 1 2 
       356 1 . . . 1 2 
       357 1 . . . 1 2 
       358 1 . . . 1 2 
       359 1 . . . 1 2 
       360 1 . . . 1 2 
       361 1 . . . 1 2 
       362 1 . . . 1 2 
       363 1 . . . 1 2 
       364 1 . . . 1 2 
       365 1 . . . 1 2 
       366 1 . . . 1 2 
       367 1 . . . 1 2 
       368 1 . . . 1 2 
       369 1 . . . 1 2 
       370 1 . . . 1 2 
       371 1 . . . 1 2 
       372 1 . . . 1 2 
       373 1 . . . 1 2 
       374 1 . . . 1 2 
       375 1 . . . 1 2 
       376 1 . . . 1 2 
       377 1 . . . 1 2 
       378 1 . . . 1 2 
       379 1 . . . 1 2 
       380 1 . . . 1 2 
       381 1 . . . 1 2 
       382 1 . . . 1 2 
       383 1 . . . 1 2 
       384 1 . . . 1 2 
       385 1 . . . 1 2 
       386 1 . . . 1 2 
       387 1 . . . 1 2 
       388 1 . . . 1 2 
       389 1 . . . 1 2 
       390 1 . . . 1 2 
       391 1 . . . 1 2 
       392 1 . . . 1 2 
       393 1 . . . 1 2 
       394 1 . . . 1 2 
       395 1 . . . 1 2 
       396 1 . . . 1 2 
       397 1 . . . 1 2 
       398 1 . . . 1 2 
       399 1 . . . 1 2 
       400 1 . . . 1 2 
       401 1 . . . 1 2 
       402 1 . . . 1 2 
       403 1 . . . 1 2 
       404 1 . . . 1 2 
       405 1 . . . 1 2 
       406 1 . . . 1 2 
       407 1 . . . 1 2 
       408 1 . . . 1 2 
       409 1 . . . 1 2 
       410 1 . . . 1 2 
       411 1 . . . 1 2 
       412 1 . . . 1 2 
       413 1 . . . 1 2 
       414 1 . . . 1 2 
       415 1 . . . 1 2 
       416 1 . . . 1 2 
       417 1 . . . 1 2 
       418 1 . . . 1 2 
       419 1 . . . 1 2 
       420 1 . . . 1 2 
       421 1 . . . 1 2 
       422 1 . . . 1 2 
       423 1 . . . 1 2 
       424 1 . . . 1 2 
       425 1 . . . 1 2 
       426 1 . . . 1 2 
       427 1 . . . 1 2 
       428 1 . . . 1 2 
       429 1 . . . 1 2 
       430 1 . . . 1 2 
       431 1 . . . 1 2 
       432 1 . . . 1 2 
       433 1 . . . 1 2 
       434 1 . . . 1 2 
       435 1 . . . 1 2 
       436 1 . . . 1 2 
       437 1 . . . 1 2 
       438 1 . . . 1 2 
       439 1 . . . 1 2 
       440 1 . . . 1 2 
       441 1 . . . 1 2 
       442 1 . . . 1 2 
       443 1 . . . 1 2 
       444 1 . . . 1 2 
       445 1 . . . 1 2 
       446 1 . . . 1 2 
       447 1 . . . 1 2 
       448 1 . . . 1 2 
       449 1 . . . 1 2 
       450 1 . . . 1 2 
       451 1 . . . 1 2 
       452 1 . . . 1 2 
       453 1 . . . 1 2 
       454 1 . . . 1 2 
       455 1 . . . 1 2 
       456 1 . . . 1 2 
       457 1 . . . 1 2 
       458 1 . . . 1 2 
       459 1 . . . 1 2 
       460 1 . . . 1 2 
       461 1 . . . 1 2 
       462 1 . . . 1 2 
       463 1 . . . 1 2 
       464 1 . . . 1 2 
       465 1 . . . 1 2 
       466 1 . . . 1 2 
       467 1 . . . 1 2 
       468 1 . . . 1 2 
       469 1 . . . 1 2 
       470 1 . . . 1 2 
       471 1 . . . 1 2 
       472 1 . . . 1 2 
       473 1 . . . 1 2 
       474 1 . . . 1 2 
       475 1 . . . 1 2 
       476 1 . . . 1 2 
       477 1 . . . 1 2 
       478 1 . . . 1 2 
       479 1 . . . 1 2 
       480 1 . . . 1 2 
       481 1 . . . 1 2 
       482 1 . . . 1 2 
       483 1 . . . 1 2 
       484 1 . . . 1 2 
       485 1 . . . 1 2 
       486 1 . . . 1 2 
       487 1 . . . 1 2 
       488 1 . . . 1 2 
       489 1 . . . 1 2 
       490 1 . . . 1 2 
       491 1 . . . 1 2 
       492 1 . . . 1 2 
       493 1 . . . 1 2 
       494 1 . . . 1 2 
       495 1 . . . 1 2 
       496 1 . . . 1 2 
       497 1 . . . 1 2 
       498 1 . . . 1 2 
       499 1 . . . 1 2 
       500 1 . . . 1 2 
       501 1 . . . 1 2 
       502 1 . . . 1 2 
       503 1 . . . 1 2 
       504 1 . . . 1 2 
       505 1 . . . 1 2 
       506 1 . . . 1 2 
       507 1 . . . 1 2 
       508 1 . . . 1 2 
       509 1 . . . 1 2 
       510 1 . . . 1 2 
       511 1 . . . 1 2 
       512 1 . . . 1 2 
       513 1 . . . 1 2 
       514 1 . . . 1 2 
       515 1 . . . 1 2 
       516 1 . . . 1 2 
       517 1 . . . 1 2 
       518 1 . . . 1 2 
       519 1 . . . 1 2 
       520 1 . . . 1 2 
       521 1 . . . 1 2 
       522 1 . . . 1 2 
       523 1 . . . 1 2 
       524 1 . . . 1 2 
       525 1 . . . 1 2 
       526 1 . . . 1 2 
       527 1 . . . 1 2 
       528 1 . . . 1 2 
       529 1 . . . 1 2 
       530 1 . . . 1 2 
       531 1 . . . 1 2 
       532 1 . . . 1 2 
       533 1 . . . 1 2 
       534 1 . . . 1 2 
       535 1 . . . 1 2 
       536 1 . . . 1 2 
       537 1 . . . 1 2 
       538 1 . . . 1 2 
       539 1 . . . 1 2 
       540 1 . . . 1 2 
       541 1 . . . 1 2 
       542 1 . . . 1 2 
       543 1 . . . 1 2 
       544 1 . . . 1 2 
       545 1 . . . 1 2 
       546 1 . . . 1 2 
       547 1 . . . 1 2 
       548 1 . . . 1 2 
       549 1 . . . 1 2 
       550 1 . . . 1 2 
       551 1 . . . 1 2 
       552 1 . . . 1 2 
       553 1 . . . 1 2 
       554 1 . . . 1 2 
       555 1 . . . 1 2 
       556 1 . . . 1 2 
       557 1 . . . 1 2 
       558 1 . . . 1 2 
       559 1 . . . 1 2 
       560 1 . . . 1 2 
       561 1 . . . 1 2 
       562 1 . . . 1 2 
       563 1 . . . 1 2 
       564 1 . . . 1 2 
       565 1 . . . 1 2 
       566 1 . . . 1 2 
       567 1 . . . 1 2 
       568 1 . . . 1 2 
       569 1 . . . 1 2 
       570 1 . . . 1 2 
       571 1 . . . 1 2 
       572 1 . . . 1 2 
       573 1 . . . 1 2 
       574 1 . . . 1 2 
       575 1 . . . 1 2 
       576 1 . . . 1 2 
       577 1 . . . 1 2 
       578 1 . . . 1 2 
       579 1 . . . 1 2 
       580 1 . . . 1 2 
       581 1 . . . 1 2 
       582 1 . . . 1 2 
       583 1 . . . 1 2 
       584 1 . . . 1 2 
       585 1 . . . 1 2 
       586 1 . . . 1 2 
       587 1 . . . 1 2 
       588 1 . . . 1 2 
       589 1 . . . 1 2 
       590 1 . . . 1 2 
       591 1 . . . 1 2 
       592 1 . . . 1 2 
       593 1 . . . 1 2 
       594 1 . . . 1 2 
       595 1 . . . 1 2 
       596 1 . . . 1 2 
       597 1 . . . 1 2 
       598 1 . . . 1 2 
       599 1 . . . 1 2 
       600 1 . . . 1 2 
       601 1 . . . 1 2 
       602 1 . . . 1 2 
       603 1 . . . 1 2 
       604 1 . . . 1 2 
       605 1 . . . 1 2 
       606 1 . . . 1 2 
       607 1 . . . 1 2 
       608 1 . . . 1 2 
       609 1 . . . 1 2 
       610 1 . . . 1 2 
       611 1 . . . 1 2 
       612 1 . . . 1 2 
       613 1 . . . 1 2 
       614 1 . . . 1 2 
       615 1 . . . 1 2 
       616 1 . . . 1 2 
       617 1 . . . 1 2 
       618 1 . . . 1 2 
       619 1 . . . 1 2 
       620 1 . . . 1 2 
       621 1 . . . 1 2 
       622 1 . . . 1 2 
       623 1 . . . 1 2 
       624 1 . . . 1 2 
       625 1 . . . 1 2 
       626 1 . . . 1 2 
       627 1 . . . 1 2 
       628 1 . . . 1 2 
       629 1 . . . 1 2 
       630 1 . . . 1 2 
       631 1 . . . 1 2 
       632 1 . . . 1 2 
       633 1 . . . 1 2 
       634 1 . . . 1 2 
       635 1 . . . 1 2 
       636 1 . . . 1 2 
       637 1 . . . 1 2 
       638 1 . . . 1 2 
       639 1 . . . 1 2 
       640 1 . . . 1 2 
       641 1 . . . 1 2 
       642 1 . . . 1 2 
       643 1 . . . 1 2 
       644 1 . . . 1 2 
       645 1 . . . 1 2 
       646 1 . . . 1 2 
       647 1 . . . 1 2 
       648 1 . . . 1 2 
       649 1 . . . 1 2 
       650 1 . . . 1 2 
       651 1 . . . 1 2 
       652 1 . . . 1 2 
       653 1 . . . 1 2 
       654 1 . . . 1 2 
       655 1 . . . 1 2 
       656 1 . . . 1 2 
       657 1 . . . 1 2 
       658 1 . . . 1 2 
       659 1 . . . 1 2 
       660 1 . . . 1 2 
       661 1 . . . 1 2 
       662 1 . . . 1 2 
       663 1 . . . 1 2 
       664 1 . . . 1 2 
       665 1 . . . 1 2 
       666 1 . . . 1 2 
       667 1 . . . 1 2 
       668 1 . . . 1 2 
       669 1 . . . 1 2 
       670 1 . . . 1 2 
       671 1 . . . 1 2 
       672 1 . . . 1 2 
       673 1 . . . 1 2 
       674 1 . . . 1 2 
       675 1 . . . 1 2 
       676 1 . . . 1 2 
       677 1 . . . 1 2 
       678 1 . . . 1 2 
       679 1 . . . 1 2 
       680 1 . . . 1 2 
       681 1 . . . 1 2 
       682 1 . . . 1 2 
       683 1 . . . 1 2 
       684 1 . . . 1 2 
       685 1 . . . 1 2 
       686 1 . . . 1 2 
       687 1 . . . 1 2 
       688 1 . . . 1 2 
       689 1 . . . 1 2 
       690 1 . . . 1 2 
       691 1 . . . 1 2 
       692 1 . . . 1 2 
       693 1 . . . 1 2 
       694 1 . . . 1 2 
       695 1 . . . 1 2 
       696 1 . . . 1 2 
       697 1 . . . 1 2 
       698 1 . . . 1 2 
       699 1 . . . 1 2 
       700 1 . . . 1 2 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

         1 1 1 1 1 32 GLN HB3  . 32 GLN  HB3  1 2 
         1 1 2 1 1 32 GLN HE22 . 32 GLN  HE22 1 2 
         2 1 1 1 1 25 ASN HD22 . 25 ASN  HD22 1 2 
         2 1 2 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
         3 1 1 1 1 15 CYS HA   . 15 CYSS HA   1 2 
         3 1 2 1 1 32 GLN HE22 . 32 GLN  HE22 1 2 
         4 1 1 1 1 15 CYS HA   . 15 CYSS HA   1 2 
         4 1 2 1 1 32 GLN HE21 . 32 GLN  HE21 1 2 
         5 1 1 1 1 27 GLN HA   . 27 GLN  HA   1 2 
         5 1 2 1 1 27 GLN HE21 . 27 GLN  HE21 1 2 
         6 1 1 1 1 25 ASN HD21 . 25 ASN  HD21 1 2 
         6 1 2 1 1 26 SER HA   . 26 SER  HA   1 2 
         7 1 1 1 1 25 ASN HD22 . 25 ASN  HD22 1 2 
         7 1 2 1 1 26 SER HA   . 26 SER  HA   1 2 
         8 1 1 1 1 25 ASN HA   . 25 ASN  HA   1 2 
         8 1 2 1 1 25 ASN HD21 . 25 ASN  HD21 1 2 
         9 1 1 1 1 25 ASN HB3  . 25 ASN  HB3  1 2 
         9 1 2 1 1 25 ASN HD21 . 25 ASN  HD21 1 2 
        10 1 1 1 1 25 ASN HB3  . 25 ASN  HB3  1 2 
        10 1 2 1 1 25 ASN HD22 . 25 ASN  HD22 1 2 
        11 1 1 1 1 38 GLU H    . 38 GLU  HN   1 2 
        11 1 2 1 1 38 GLU QG   . 38 GLU  QG   1 2 
        12 1 1 1 1 32 GLN HB3  . 32 GLN  HB3  1 2 
        12 1 2 1 1 32 GLN HE21 . 32 GLN  HE21 1 2 
        13 1 1 1 1 25 ASN HD21 . 25 ASN  HD21 1 2 
        13 1 2 1 1 29 ILE HB   . 29 ILE  HB   1 2 
        14 1 1 1 1 28 LEU HG   . 28 LEU  HG   1 2 
        14 1 2 1 1 32 GLN HE22 . 32 GLN  HE22 1 2 
        15 1 1 1 1 28 LEU HG   . 28 LEU  HG   1 2 
        15 1 2 1 1 32 GLN HE21 . 32 GLN  HE21 1 2 
        16 1 1 1 1 25 ASN HD22 . 25 ASN  HD22 1 2 
        16 1 2 1 1 29 ILE HG13 . 29 ILE  HG13 1 2 
        17 1 1 1 1 25 ASN HD21 . 25 ASN  HD21 1 2 
        17 1 2 1 1 29 ILE HG13 . 29 ILE  HG13 1 2 
        18 1 1 1 1 25 ASN HD22 . 25 ASN  HD22 1 2 
        18 1 2 1 1 29 ILE HG12 . 29 ILE  HG12 1 2 
        19 1 1 1 1 25 ASN HD21 . 25 ASN  HD21 1 2 
        19 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
        20 1 1 1 1 25 ASN HD22 . 25 ASN  HD22 1 2 
        20 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
        21 1 1 1 1 25 ASN HD21 . 25 ASN  HD21 1 2 
        21 1 2 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
        22 1 1 1 1 25 ASN HD21 . 25 ASN  HD21 1 2 
        22 1 2 1 1 29 ILE MD   . 29 ILE  QD1  1 2 
        23 1 1 1 1 25 ASN HD22 . 25 ASN  HD22 1 2 
        23 1 2 1 1 29 ILE MD   . 29 ILE  QD1  1 2 
        24 1 1 1 1 27 GLN HA   . 27 GLN  HA   1 2 
        24 1 2 1 1 27 GLN HE22 . 27 GLN  HE22 1 2 
        25 1 1 1 1 25 ASN HA   . 25 ASN  HA   1 2 
        25 1 2 1 1 25 ASN HD22 . 25 ASN  HD22 1 2 
        26 1 1 1 1 24 ARG QG   . 24 ARG  QG   1 2 
        26 1 2 1 1 27 GLN HE22 . 27 GLN  HE22 1 2 
        27 1 1 1 1 24 ARG QG   . 24 ARG  QG   1 2 
        27 1 2 1 1 27 GLN HE21 . 27 GLN  HE21 1 2 
        28 1 1 1 1 25 ASN HD21 . 25 ASN  HD21 1 2 
        28 1 2 1 1 29 ILE HG12 . 29 ILE  HG12 1 2 
        29 1 1 1 1 23 ILE MD   . 23 ILE  QD1  1 2 
        29 1 2 1 1 27 GLN HE22 . 27 GLN  HE22 1 2 
        30 1 1 1 1 10 GLU H    . 10 GLU  HN   1 2 
        30 1 2 1 1 11 LYS H    . 11 LYS  HN   1 2 
        31 1 1 1 1  9 ARG HA   .  9 ARG  HA   1 2 
        31 1 2 1 1 11 LYS H    . 11 LYS  HN   1 2 
        32 1 1 1 1 11 LYS H    . 11 LYS  HN   1 2 
        32 1 2 1 1 12 PRO QD   . 12 PRO  QD   1 2 
        33 1 1 1 1 10 GLU HG2  . 10 GLU  HG2  1 2 
        33 1 2 1 1 11 LYS H    . 11 LYS  HN   1 2 
        34 1 1 1 1 10 GLU HG3  . 10 GLU  HG3  1 2 
        34 1 2 1 1 11 LYS H    . 11 LYS  HN   1 2 
        35 1 1 1 1 10 GLU HB2  . 10 GLU  HB2  1 2 
        35 1 2 1 1 11 LYS H    . 11 LYS  HN   1 2 
        36 1 1 1 1 11 LYS H    . 11 LYS  HN   1 2 
        36 1 2 1 1 11 LYS HB2  . 11 LYS  HB2  1 2 
        37 1 1 1 1 11 LYS H    . 11 LYS  HN   1 2 
        37 1 2 1 1 11 LYS HB3  . 11 LYS  HB3  1 2 
        38 1 1 1 1 11 LYS H    . 11 LYS  HN   1 2 
        38 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
        39 1 1 1 1 23 ILE MD   . 23 ILE  QD1  1 2 
        39 1 2 1 1 27 GLN HE21 . 27 GLN  HE21 1 2 
        40 1 1 1 1 32 GLN H    . 32 GLN  HN   1 2 
        40 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
        41 1 1 1 1 32 GLN H    . 32 GLN  HN   1 2 
        41 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
        42 1 1 1 1 32 GLN H    . 32 GLN  HN   1 2 
        42 1 2 1 1 32 GLN HA   . 32 GLN  HA   1 2 
        43 1 1 1 1 30 VAL HA   . 30 VAL  HA   1 2 
        43 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
        44 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
        44 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
        45 1 1 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
        45 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
        46 1 1 1 1 32 GLN H    . 32 GLN  HN   1 2 
        46 1 2 1 1 32 GLN HB2  . 32 GLN  HB2  1 2 
        47 1 1 1 1 32 GLN H    . 32 GLN  HN   1 2 
        47 1 2 1 1 32 GLN HB3  . 32 GLN  HB3  1 2 
        48 1 1 1 1 32 GLN H    . 32 GLN  HN   1 2 
        48 1 2 1 1 33 ARG HG3  . 33 ARG  HG3  1 2 
        49 1 1 1 1 28 LEU HG   . 28 LEU  HG   1 2 
        49 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
        50 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
        50 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
        51 1 1 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
        51 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
        52 1 1 1 1 37 GLY H    . 37 GLY  HN   1 2 
        52 1 2 1 1 38 GLU H    . 38 GLU  HN   1 2 
        53 1 1 1 1 39 SER QB   . 39 SER  QB   1 2 
        53 1 2 1 1 40 GLY H    . 40 GLY  HN   1 2 
        54 1 1 1 1 16 SER H    . 16 SER  HN   1 2 
        54 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
        55 1 1 1 1 16 SER H    . 16 SER  HN   1 2 
        55 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
        56 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
        56 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
        57 1 1 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
        57 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        58 1 1 1 1 27 GLN HA   . 27 GLN  HA   1 2 
        58 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        59 1 1 1 1 29 ILE HA   . 29 ILE  HA   1 2 
        59 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        60 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
        60 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        61 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
        61 1 2 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
        62 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
        62 1 2 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
        63 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
        63 1 2 1 1 32 GLN HB2  . 32 GLN  HB2  1 2 
        64 1 1 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
        64 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        65 1 1 1 1 30 VAL HB   . 30 VAL  HB   1 2 
        65 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        66 1 1 1 1 29 ILE HB   . 29 ILE  HB   1 2 
        66 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        67 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
        67 1 2 1 1 34 THR MG   . 34 THR  QG2  1 2 
        68 1 1 1 1 27 GLN H    . 27 GLN  HN   1 2 
        68 1 2 1 1 30 VAL MG2  . 30 VAL  QG2  1 2 
        69 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
        69 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        70 1 1 1 1 30 VAL MG2  . 30 VAL  QG2  1 2 
        70 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        71 1 1 1 1 30 VAL MG1  . 30 VAL  QG1  1 2 
        71 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        72 1 1 1 1 27 GLN H    . 27 GLN  HN   1 2 
        72 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
        73 1 1 1 1 27 GLN H    . 27 GLN  HN   1 2 
        73 1 2 1 1 28 LEU HA   . 28 LEU  HA   1 2 
        74 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
        74 1 2 1 1 27 GLN H    . 27 GLN  HN   1 2 
        75 1 1 1 1 27 GLN H    . 27 GLN  HN   1 2 
        75 1 2 1 1 27 GLN HG3  . 27 GLN  HG3  1 2 
        76 1 1 1 1 27 GLN H    . 27 GLN  HN   1 2 
        76 1 2 1 1 27 GLN HG2  . 27 GLN  HG2  1 2 
        77 1 1 1 1 27 GLN H    . 27 GLN  HN   1 2 
        77 1 2 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
        78 1 1 1 1 27 GLN H    . 27 GLN  HN   1 2 
        78 1 2 1 1 27 GLN HB2  . 27 GLN  HB2  1 2 
        79 1 1 1 1 24 ARG HB2  . 24 ARG  HB2  1 2 
        79 1 2 1 1 27 GLN H    . 27 GLN  HN   1 2 
        80 1 1 1 1 27 GLN H    . 27 GLN  HN   1 2 
        80 1 2 1 1 29 ILE HG13 . 29 ILE  HG13 1 2 
        81 1 1 1 1 27 GLN H    . 27 GLN  HN   1 2 
        81 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
        82 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
        82 1 2 1 1 23 ILE H    . 23 ILE  HN   1 2 
        83 1 1 1 1 29 ILE H    . 29 ILE  HN   1 2 
        83 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
        84 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
        84 1 2 1 1 23 ILE H    . 23 ILE  HN   1 2 
        85 1 1 1 1 25 ASN HD21 . 25 ASN  HD21 1 2 
        85 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
        86 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
        86 1 2 1 1 23 ILE H    . 23 ILE  HN   1 2 
        87 1 1 1 1 23 ILE H    . 23 ILE  HN   1 2 
        87 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
        88 1 1 1 1 12 PRO QD   . 12 PRO  QD   1 2 
        88 1 2 1 1 23 ILE H    . 23 ILE  HN   1 2 
        89 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
        89 1 2 1 1 23 ILE H    . 23 ILE  HN   1 2 
        90 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
        90 1 2 1 1 23 ILE H    . 23 ILE  HN   1 2 
        91 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
        91 1 2 1 1 23 ILE H    . 23 ILE  HN   1 2 
        92 1 1 1 1 23 ILE H    . 23 ILE  HN   1 2 
        92 1 2 1 1 27 GLN HB3  . 27 GLN  HB3  1 2 
        93 1 1 1 1 25 ASN HB3  . 25 ASN  HB3  1 2 
        93 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
        94 1 1 1 1 29 ILE H    . 29 ILE  HN   1 2 
        94 1 2 1 1 32 GLN HB2  . 32 GLN  HB2  1 2 
        95 1 1 1 1 23 ILE H    . 23 ILE  HN   1 2 
        95 1 2 1 1 23 ILE HB   . 23 ILE  HB   1 2 
        96 1 1 1 1 27 GLN HB2  . 27 GLN  HB2  1 2 
        96 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
        97 1 1 1 1 29 ILE H    . 29 ILE  HN   1 2 
        97 1 2 1 1 30 VAL HB   . 30 VAL  HB   1 2 
        98 1 1 1 1 11 LYS QD   . 11 LYS  QD   1 2 
        98 1 2 1 1 23 ILE H    . 23 ILE  HN   1 2 
        99 1 1 1 1 23 ILE H    . 23 ILE  HN   1 2 
        99 1 2 1 1 23 ILE MD   . 23 ILE  QD1  1 2 
       100 1 1 1 1 29 ILE H    . 29 ILE  HN   1 2 
       100 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
       101 1 1 1 1 26 SER HA   . 26 SER  HA   1 2 
       101 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
       102 1 1 1 1 25 ASN HA   . 25 ASN  HA   1 2 
       102 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
       103 1 1 1 1 29 ILE H    . 29 ILE  HN   1 2 
       103 1 2 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
       104 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       104 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
       105 1 1 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       105 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
       106 1 1 1 1 29 ILE H    . 29 ILE  HN   1 2 
       106 1 2 1 1 29 ILE HB   . 29 ILE  HB   1 2 
       107 1 1 1 1 29 ILE H    . 29 ILE  HN   1 2 
       107 1 2 1 1 29 ILE HG13 . 29 ILE  HG13 1 2 
       108 1 1 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       108 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
       109 1 1 1 1 29 ILE H    . 29 ILE  HN   1 2 
       109 1 2 1 1 29 ILE HG12 . 29 ILE  HG12 1 2 
       110 1 1 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       110 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
       111 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       111 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
       112 1 1 1 1 29 ILE H    . 29 ILE  HN   1 2 
       112 1 2 1 1 29 ILE MD   . 29 ILE  QD1  1 2 
       113 1 1 1 1 34 THR H    . 34 THR  HN   1 2 
       113 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       114 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       114 1 2 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       115 1 1 1 1 34 THR H    . 34 THR  HN   1 2 
       115 1 2 1 1 34 THR HB   . 34 THR  HB   1 2 
       116 1 1 1 1 32 GLN HA   . 32 GLN  HA   1 2 
       116 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
       117 1 1 1 1 34 THR H    . 34 THR  HN   1 2 
       117 1 2 1 1 35 HIS HB2  . 35 HIS  HB2  1 2 
       118 1 1 1 1 32 GLN HB3  . 32 GLN  HB3  1 2 
       118 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
       119 1 1 1 1 33 ARG HG2  . 33 ARG  HG2  1 2 
       119 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
       120 1 1 1 1 34 THR H    . 34 THR  HN   1 2 
       120 1 2 1 1 34 THR MG   . 34 THR  QG2  1 2 
       121 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       121 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       122 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       122 1 2 1 1 14 GLU H    . 14 GLU  HN   1 2 
       123 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       123 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       124 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       124 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       125 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       125 1 2 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       126 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       126 1 2 1 1 14 GLU HA   . 14 GLU  HA   1 2 
       127 1 1 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       127 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       128 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       128 1 2 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       129 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       129 1 2 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       130 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       130 1 2 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       131 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       131 1 2 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       132 1 1 1 1 32 GLN HB2  . 32 GLN  HB2  1 2 
       132 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
       133 1 1 1 1 12 PRO HB3  . 12 PRO  HB3  1 2 
       133 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       134 1 1 1 1 12 PRO HG2  . 12 PRO  HG2  1 2 
       134 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       135 1 1 1 1 12 PRO HG3  . 12 PRO  HG3  1 2 
       135 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       136 1 1 1 1 12 PRO HB2  . 12 PRO  HB2  1 2 
       136 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       137 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       137 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       138 1 1 1 1 30 VAL H    . 30 VAL  HN   1 2 
       138 1 2 1 1 31 HIS H    . 31 HIS  HN   1 2 
       139 1 1 1 1 29 ILE HB   . 29 ILE  HB   1 2 
       139 1 2 1 1 30 VAL H    . 30 VAL  HN   1 2 
       140 1 1 1 1 30 VAL H    . 30 VAL  HN   1 2 
       140 1 2 1 1 30 VAL MG2  . 30 VAL  QG2  1 2 
       141 1 1 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
       141 1 2 1 1 30 VAL H    . 30 VAL  HN   1 2 
       142 1 1 1 1 30 VAL H    . 30 VAL  HN   1 2 
       142 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
       143 1 1 1 1 29 ILE H    . 29 ILE  HN   1 2 
       143 1 2 1 1 30 VAL H    . 30 VAL  HN   1 2 
       144 1 1 1 1 13 TYR H    . 13 TYR  HN   1 2 
       144 1 2 1 1 23 ILE HA   . 23 ILE  HA   1 2 
       145 1 1 1 1 27 GLN HA   . 27 GLN  HA   1 2 
       145 1 2 1 1 30 VAL H    . 30 VAL  HN   1 2 
       146 1 1 1 1 30 VAL H    . 30 VAL  HN   1 2 
       146 1 2 1 1 30 VAL HA   . 30 VAL  HA   1 2 
       147 1 1 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       147 1 2 1 1 30 VAL H    . 30 VAL  HN   1 2 
       148 1 1 1 1 32 GLN HB3  . 32 GLN  HB3  1 2 
       148 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
       149 1 1 1 1 30 VAL H    . 30 VAL  HN   1 2 
       149 1 2 1 1 30 VAL HB   . 30 VAL  HB   1 2 
       150 1 1 1 1 29 ILE HG13 . 29 ILE  HG13 1 2 
       150 1 2 1 1 30 VAL H    . 30 VAL  HN   1 2 
       151 1 1 1 1 29 ILE MD   . 29 ILE  QD1  1 2 
       151 1 2 1 1 30 VAL H    . 30 VAL  HN   1 2 
       152 1 1 1 1 34 THR H    . 34 THR  HN   1 2 
       152 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
       153 1 1 1 1 35 HIS H    . 35 HIS  HN   1 2 
       153 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       154 1 1 1 1 32 GLN HA   . 32 GLN  HA   1 2 
       154 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
       155 1 1 1 1 35 HIS H    . 35 HIS  HN   1 2 
       155 1 2 1 1 35 HIS HB3  . 35 HIS  HB3  1 2 
       156 1 1 1 1 35 HIS H    . 35 HIS  HN   1 2 
       156 1 2 1 1 35 HIS HB2  . 35 HIS  HB2  1 2 
       157 1 1 1 1 34 THR MG   . 34 THR  QG2  1 2 
       157 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
       158 1 1 1 1 30 VAL HA   . 30 VAL  HA   1 2 
       158 1 2 1 1 33 ARG H    . 33 ARG  HN   1 2 
       159 1 1 1 1 30 VAL MG2  . 30 VAL  QG2  1 2 
       159 1 2 1 1 33 ARG H    . 33 ARG  HN   1 2 
       160 1 1 1 1 32 GLN H    . 32 GLN  HN   1 2 
       160 1 2 1 1 33 ARG H    . 33 ARG  HN   1 2 
       161 1 1 1 1 33 ARG H    . 33 ARG  HN   1 2 
       161 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
       162 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
       162 1 2 1 1 33 ARG H    . 33 ARG  HN   1 2 
       163 1 1 1 1 33 ARG H    . 33 ARG  HN   1 2 
       163 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
       164 1 1 1 1 33 ARG H    . 33 ARG  HN   1 2 
       164 1 2 1 1 33 ARG HA   . 33 ARG  HA   1 2 
       165 1 1 1 1 32 GLN HA   . 32 GLN  HA   1 2 
       165 1 2 1 1 33 ARG H    . 33 ARG  HN   1 2 
       166 1 1 1 1 32 GLN HB2  . 32 GLN  HB2  1 2 
       166 1 2 1 1 33 ARG H    . 33 ARG  HN   1 2 
       167 1 1 1 1 32 GLN HB3  . 32 GLN  HB3  1 2 
       167 1 2 1 1 33 ARG H    . 33 ARG  HN   1 2 
       168 1 1 1 1 33 ARG H    . 33 ARG  HN   1 2 
       168 1 2 1 1 33 ARG HG3  . 33 ARG  HG3  1 2 
       169 1 1 1 1 33 ARG H    . 33 ARG  HN   1 2 
       169 1 2 1 1 33 ARG HG2  . 33 ARG  HG2  1 2 
       170 1 1 1 1 33 ARG H    . 33 ARG  HN   1 2 
       170 1 2 1 1 34 THR MG   . 34 THR  QG2  1 2 
       171 1 1 1 1 30 VAL MG1  . 30 VAL  QG1  1 2 
       171 1 2 1 1 33 ARG H    . 33 ARG  HN   1 2 
       172 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       172 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       173 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       173 1 2 1 1 19 GLY HA3  . 19 GLY  HA2  1 2 
       174 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       174 1 2 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       175 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       175 1 2 1 1 20 LYS HB3  . 20 LYS  HB3  1 2 
       176 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       176 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       177 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       177 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       178 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       178 1 2 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       179 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       179 1 2 1 1 19 GLY HA2  . 19 GLY  HA1  1 2 
       180 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       180 1 2 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       181 1 1 1 1 14 GLU HG2  . 14 GLU  HG2  1 2 
       181 1 2 1 1 15 CYS H    . 15 CYSS HN   1 2 
       182 1 1 1 1 14 GLU QB   . 14 GLU  QB   1 2 
       182 1 2 1 1 15 CYS H    . 15 CYSS HN   1 2 
       183 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       183 1 2 1 1 20 LYS HB2  . 20 LYS  HB2  1 2 
       184 1 1 1 1 11 LYS HA   . 11 LYS  HA   1 2 
       184 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       185 1 1 1 1 13 TYR HA   . 13 TYR  HA   1 2 
       185 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       186 1 1 1 1 21 ALA H    . 21 ALA  HN   1 2 
       186 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       187 1 1 1 1 22 PHE H    . 22 PHE  HN   1 2 
       187 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       188 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       188 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       189 1 1 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       189 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       190 1 1 1 1 22 PHE H    . 22 PHE  HN   1 2 
       190 1 2 1 1 23 ILE HA   . 23 ILE  HA   1 2 
       191 1 1 1 1 22 PHE H    . 22 PHE  HN   1 2 
       191 1 2 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       192 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       192 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       193 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       193 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       194 1 1 1 1 22 PHE H    . 22 PHE  HN   1 2 
       194 1 2 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       195 1 1 1 1 14 GLU HG3  . 14 GLU  HG3  1 2 
       195 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       196 1 1 1 1 12 PRO HG2  . 12 PRO  HG2  1 2 
       196 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       197 1 1 1 1 14 GLU QB   . 14 GLU  QB   1 2 
       197 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       198 1 1 1 1 11 LYS HB2  . 11 LYS  HB2  1 2 
       198 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       199 1 1 1 1 11 LYS HB3  . 11 LYS  HB3  1 2 
       199 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       200 1 1 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       200 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       201 1 1 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       201 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       202 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       202 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       203 1 1 1 1 14 GLU HA   . 14 GLU  HA   1 2 
       203 1 2 1 1 22 PHE H    . 22 PHE  HN   1 2 
       204 1 1 1 1 38 GLU HB3  . 38 GLU  HB3  1 2 
       204 1 2 1 1 39 SER H    . 39 SER  HN   1 2 
       205 1 1 1 1 38 GLU HB2  . 38 GLU  HB2  1 2 
       205 1 2 1 1 39 SER H    . 39 SER  HN   1 2 
       206 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       206 1 2 1 1 24 ARG H    . 24 ARG  HN   1 2 
       207 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       207 1 2 1 1 24 ARG H    . 24 ARG  HN   1 2 
       208 1 1 1 1 23 ILE MD   . 23 ILE  QD1  1 2 
       208 1 2 1 1 24 ARG H    . 24 ARG  HN   1 2 
       209 1 1 1 1 23 ILE H    . 23 ILE  HN   1 2 
       209 1 2 1 1 24 ARG H    . 24 ARG  HN   1 2 
       210 1 1 1 1 21 ALA H    . 21 ALA  HN   1 2 
       210 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       211 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       211 1 2 1 1 24 ARG H    . 24 ARG  HN   1 2 
       212 1 1 1 1 24 ARG H    . 24 ARG  HN   1 2 
       212 1 2 1 1 27 GLN H    . 27 GLN  HN   1 2 
       213 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       213 1 2 1 1 24 ARG H    . 24 ARG  HN   1 2 
       214 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       214 1 2 1 1 24 ARG H    . 24 ARG  HN   1 2 
       215 1 1 1 1 24 ARG H    . 24 ARG  HN   1 2 
       215 1 2 1 1 27 GLN HG3  . 27 GLN  HG3  1 2 
       216 1 1 1 1 24 ARG H    . 24 ARG  HN   1 2 
       216 1 2 1 1 27 GLN HG2  . 27 GLN  HG2  1 2 
       217 1 1 1 1 23 ILE HB   . 23 ILE  HB   1 2 
       217 1 2 1 1 24 ARG H    . 24 ARG  HN   1 2 
       218 1 1 1 1 24 ARG H    . 24 ARG  HN   1 2 
       218 1 2 1 1 27 GLN HB2  . 27 GLN  HB2  1 2 
       219 1 1 1 1 24 ARG H    . 24 ARG  HN   1 2 
       219 1 2 1 1 24 ARG HB2  . 24 ARG  HB2  1 2 
       220 1 1 1 1 24 ARG H    . 24 ARG  HN   1 2 
       220 1 2 1 1 24 ARG QG   . 24 ARG  QG   1 2 
       221 1 1 1 1 20 LYS HG3  . 20 LYS  HG3  1 2 
       221 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       222 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       222 1 2 1 1 14 GLU H    . 14 GLU  HN   1 2 
       223 1 1 1 1 14 GLU H    . 14 GLU  HN   1 2 
       223 1 2 1 1 15 CYS H    . 15 CYSS HN   1 2 
       224 1 1 1 1 14 GLU H    . 14 GLU  HN   1 2 
       224 1 2 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       225 1 1 1 1 13 TYR HA   . 13 TYR  HA   1 2 
       225 1 2 1 1 14 GLU H    . 14 GLU  HN   1 2 
       226 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       226 1 2 1 1 14 GLU H    . 14 GLU  HN   1 2 
       227 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       227 1 2 1 1 14 GLU H    . 14 GLU  HN   1 2 
       228 1 1 1 1 14 GLU H    . 14 GLU  HN   1 2 
       228 1 2 1 1 14 GLU HG3  . 14 GLU  HG3  1 2 
       229 1 1 1 1 14 GLU H    . 14 GLU  HN   1 2 
       229 1 2 1 1 14 GLU QB   . 14 GLU  QB   1 2 
       230 1 1 1 1 14 GLU H    . 14 GLU  HN   1 2 
       230 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       231 1 1 1 1 14 GLU H    . 14 GLU  HN   1 2 
       231 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       232 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       232 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       233 1 1 1 1 21 ALA H    . 21 ALA  HN   1 2 
       233 1 2 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       234 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       234 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       235 1 1 1 1 21 ALA H    . 21 ALA  HN   1 2 
       235 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       236 1 1 1 1 18 CYS H    . 18 CYSS HN   1 2 
       236 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       237 1 1 1 1 14 GLU HA   . 14 GLU  HA   1 2 
       237 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       238 1 1 1 1 15 CYS HA   . 15 CYSS HA   1 2 
       238 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       239 1 1 1 1 20 LYS HA   . 20 LYS  HA   1 2 
       239 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       240 1 1 1 1 20 LYS HG2  . 20 LYS  HG2  1 2 
       240 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       241 1 1 1 1 21 ALA H    . 21 ALA  HN   1 2 
       241 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       242 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       242 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       243 1 1 1 1 18 CYS H    . 18 CYSS HN   1 2 
       243 1 2 1 1 19 GLY HA2  . 19 GLY  HA1  1 2 
       244 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       244 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       245 1 1 1 1 18 CYS H    . 18 CYSS HN   1 2 
       245 1 2 1 1 18 CYS HB3  . 18 CYSS HB3  1 2 
       246 1 1 1 1 17 GLU HG3  . 17 GLU  HG3  1 2 
       246 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       247 1 1 1 1 17 GLU HG2  . 17 GLU  HG2  1 2 
       247 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       248 1 1 1 1 17 GLU QB   . 17 GLU  QB   1 2 
       248 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       249 1 1 1 1 35 HIS H    . 35 HIS  HN   1 2 
       249 1 2 1 1 36 SER H    . 36 SER  HN   1 2 
       250 1 1 1 1 33 ARG HA   . 33 ARG  HA   1 2 
       250 1 2 1 1 36 SER H    . 36 SER  HN   1 2 
       251 1 1 1 1 35 HIS HB3  . 35 HIS  HB3  1 2 
       251 1 2 1 1 36 SER H    . 36 SER  HN   1 2 
       252 1 1 1 1 35 HIS HB2  . 35 HIS  HB2  1 2 
       252 1 2 1 1 36 SER H    . 36 SER  HN   1 2 
       253 1 1 1 1  8 THR HB   .  8 THR  HB   1 2 
       253 1 2 1 1  9 ARG H    .  9 ARG  HN   1 2 
       254 1 1 1 1  9 ARG H    .  9 ARG  HN   1 2 
       254 1 2 1 1  9 ARG QG   .  9 ARG  QG   1 2 
       255 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       255 1 2 1 1 18 CYS HA   . 18 CYSS HA   1 2 
       256 1 1 1 1 16 SER H    . 16 SER  HN   1 2 
       256 1 2 1 1 17 GLU H    . 17 GLU  HN   1 2 
       257 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       257 1 2 1 1 20 LYS H    . 20 LYS  HN   1 2 
       258 1 1 1 1 19 GLY H    . 19 GLY  HN   1 2 
       258 1 2 1 1 20 LYS H    . 20 LYS  HN   1 2 
       259 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       259 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       260 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       260 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       261 1 1 1 1 18 CYS HA   . 18 CYSS HA   1 2 
       261 1 2 1 1 20 LYS H    . 20 LYS  HN   1 2 
       262 1 1 1 1 15 CYS HA   . 15 CYSS HA   1 2 
       262 1 2 1 1 17 GLU H    . 17 GLU  HN   1 2 
       263 1 1 1 1 15 CYS HA   . 15 CYSS HA   1 2 
       263 1 2 1 1 20 LYS H    . 20 LYS  HN   1 2 
       264 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       264 1 2 1 1 17 GLU HA   . 17 GLU  HA   1 2 
       265 1 1 1 1 16 SER HB2  . 16 SER  HB2  1 2 
       265 1 2 1 1 17 GLU H    . 17 GLU  HN   1 2 
       266 1 1 1 1 16 SER HB3  . 16 SER  HB3  1 2 
       266 1 2 1 1 17 GLU H    . 17 GLU  HN   1 2 
       267 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       267 1 2 1 1 20 LYS HA   . 20 LYS  HA   1 2 
       268 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       268 1 2 1 1 19 GLY HA2  . 19 GLY  HA1  1 2 
       269 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       269 1 2 1 1 17 GLU H    . 17 GLU  HN   1 2 
       270 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       270 1 2 1 1 20 LYS H    . 20 LYS  HN   1 2 
       271 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       271 1 2 1 1 20 LYS H    . 20 LYS  HN   1 2 
       272 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       272 1 2 1 1 17 GLU H    . 17 GLU  HN   1 2 
       273 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       273 1 2 1 1 17 GLU HG3  . 17 GLU  HG3  1 2 
       274 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       274 1 2 1 1 17 GLU HG2  . 17 GLU  HG2  1 2 
       275 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       275 1 2 1 1 17 GLU QB   . 17 GLU  QB   1 2 
       276 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       276 1 2 1 1 20 LYS HB2  . 20 LYS  HB2  1 2 
       277 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       277 1 2 1 1 20 LYS HB3  . 20 LYS  HB3  1 2 
       278 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       278 1 2 1 1 20 LYS HG3  . 20 LYS  HG3  1 2 
       279 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       279 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       280 1 1 1 1 19 GLY H    . 19 GLY  HN   1 2 
       280 1 2 1 1 20 LYS HB3  . 20 LYS  HB3  1 2 
       281 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       281 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       282 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       282 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       283 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
       283 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
       284 1 1 1 1 18 CYS H    . 18 CYSS HN   1 2 
       284 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       285 1 1 1 1 25 ASN HD21 . 25 ASN  HD21 1 2 
       285 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       286 1 1 1 1 27 GLN H    . 27 GLN  HN   1 2 
       286 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       287 1 1 1 1 15 CYS HA   . 15 CYSS HA   1 2 
       287 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       288 1 1 1 1 19 GLY H    . 19 GLY  HN   1 2 
       288 1 2 1 1 19 GLY HA2  . 19 GLY  HA1  1 2 
       289 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
       289 1 2 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       290 1 1 1 1 25 ASN HA   . 25 ASN  HA   1 2 
       290 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       291 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       291 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       292 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       292 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       293 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       293 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       294 1 1 1 1 18 CYS HB3  . 18 CYSS HB3  1 2 
       294 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       295 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       295 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       296 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       296 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       297 1 1 1 1 27 GLN HB3  . 27 GLN  HB3  1 2 
       297 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       298 1 1 1 1 27 GLN HG3  . 27 GLN  HG3  1 2 
       298 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       299 1 1 1 1 27 GLN HG2  . 27 GLN  HG2  1 2 
       299 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       300 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
       300 1 2 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       301 1 1 1 1 27 GLN HB2  . 27 GLN  HB2  1 2 
       301 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       302 1 1 1 1 14 GLU QB   . 14 GLU  QB   1 2 
       302 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       303 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
       303 1 2 1 1 29 ILE HB   . 29 ILE  HB   1 2 
       304 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
       304 1 2 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       305 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
       305 1 2 1 1 29 ILE HG13 . 29 ILE  HG13 1 2 
       306 1 1 1 1 17 GLU QB   . 17 GLU  QB   1 2 
       306 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       307 1 1 1 1 19 GLY H    . 19 GLY  HN   1 2 
       307 1 2 1 1 20 LYS HB2  . 20 LYS  HB2  1 2 
       308 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
       308 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       309 1 1 1 1 19 GLY H    . 19 GLY  HN   1 2 
       309 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       310 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
       310 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       311 1 1 1 1 28 LEU H    . 28 LEU  HN   1 2 
       311 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       312 1 1 1 1  9 ARG HA   .  9 ARG  HA   1 2 
       312 1 2 1 1 10 GLU H    . 10 GLU  HN   1 2 
       313 1 1 1 1 10 GLU H    . 10 GLU  HN   1 2 
       313 1 2 1 1 10 GLU HG2  . 10 GLU  HG2  1 2 
       314 1 1 1 1 10 GLU H    . 10 GLU  HN   1 2 
       314 1 2 1 1 10 GLU HG3  . 10 GLU  HG3  1 2 
       315 1 1 1 1  9 ARG HB2  .  9 ARG  HB2  1 2 
       315 1 2 1 1 10 GLU H    . 10 GLU  HN   1 2 
       316 1 1 1 1  9 ARG HB3  .  9 ARG  HB3  1 2 
       316 1 2 1 1 10 GLU H    . 10 GLU  HN   1 2 
       317 1 1 1 1  9 ARG QG   .  9 ARG  QG   1 2 
       317 1 2 1 1 10 GLU H    . 10 GLU  HN   1 2 
       318 1 1 1 1 10 GLU H    . 10 GLU  HN   1 2 
       318 1 2 1 1 11 LYS HB2  . 11 LYS  HB2  1 2 
       319 1 1 1 1 14 GLU HG2  . 14 GLU  HG2  1 2 
       319 1 2 1 1 19 GLY HA2  . 19 GLY  HA1  1 2 
       320 1 1 1 1 36 SER HA   . 36 SER  HA   1 2 
       320 1 2 1 1 37 GLY QA   . 37 GLY  QA   1 2 
       321 1 1 1 1 22 PHE H    . 22 PHE  HN   1 2 
       321 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       322 1 1 1 1 29 ILE H    . 29 ILE  HN   1 2 
       322 1 2 1 1 30 VAL MG2  . 30 VAL  QG2  1 2 
       323 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       323 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       324 1 1 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       324 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       325 1 1 1 1 14 GLU HA   . 14 GLU  HA   1 2 
       325 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       326 1 1 1 1 15 CYS HA   . 15 CYSS HA   1 2 
       326 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       327 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       327 1 2 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       328 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       328 1 2 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
       329 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       329 1 2 1 1 32 GLN HG2  . 32 GLN  HG2  1 2 
       330 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       330 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       331 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       331 1 2 1 1 32 GLN HB2  . 32 GLN  HB2  1 2 
       332 1 1 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       332 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       333 1 1 1 1 27 GLN HA   . 27 GLN  HA   1 2 
       333 1 2 1 1 30 VAL MG2  . 30 VAL  QG2  1 2 
       334 1 1 1 1 30 VAL HA   . 30 VAL  HA   1 2 
       334 1 2 1 1 30 VAL MG2  . 30 VAL  QG2  1 2 
       335 1 1 1 1 27 GLN HB3  . 27 GLN  HB3  1 2 
       335 1 2 1 1 30 VAL MG2  . 30 VAL  QG2  1 2 
       336 1 1 1 1 29 ILE HB   . 29 ILE  HB   1 2 
       336 1 2 1 1 30 VAL MG2  . 30 VAL  QG2  1 2 
       337 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       337 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       338 1 1 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       338 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       339 1 1 1 1 14 GLU HA   . 14 GLU  HA   1 2 
       339 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       340 1 1 1 1 20 LYS HA   . 20 LYS  HA   1 2 
       340 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       341 1 1 1 1 14 GLU HG3  . 14 GLU  HG3  1 2 
       341 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       342 1 1 1 1 11 LYS HB3  . 11 LYS  HB3  1 2 
       342 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       343 1 1 1 1 14 GLU HG2  . 14 GLU  HG2  1 2 
       343 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       344 1 1 1 1 30 VAL HA   . 30 VAL  HA   1 2 
       344 1 2 1 1 33 ARG HG3  . 33 ARG  HG3  1 2 
       345 1 1 1 1 30 VAL HA   . 30 VAL  HA   1 2 
       345 1 2 1 1 30 VAL MG1  . 30 VAL  QG1  1 2 
       346 1 1 1 1 13 TYR HA   . 13 TYR  HA   1 2 
       346 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       347 1 1 1 1  8 THR HA   .  8 THR  HA   1 2 
       347 1 2 1 1  8 THR MG   .  8 THR  QG2  1 2 
       348 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       348 1 2 1 1 23 ILE HA   . 23 ILE  HA   1 2 
       349 1 1 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       349 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       350 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       350 1 2 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       351 1 1 1 1 12 PRO HB3  . 12 PRO  HB3  1 2 
       351 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       352 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       352 1 2 1 1 23 ILE HB   . 23 ILE  HB   1 2 
       353 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       353 1 2 1 1 24 ARG HB3  . 24 ARG  HB3  1 2 
       354 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       354 1 2 1 1 25 ASN HB2  . 25 ASN  HB2  1 2 
       355 1 1 1 1 12 PRO HG3  . 12 PRO  HG3  1 2 
       355 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       356 1 1 1 1 12 PRO HB2  . 12 PRO  HB2  1 2 
       356 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       357 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       357 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       358 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       358 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       359 1 1 1 1 30 VAL HA   . 30 VAL  HA   1 2 
       359 1 2 1 1 33 ARG QD   . 33 ARG  QD   1 2 
       360 1 1 1 1 33 ARG H    . 33 ARG  HN   1 2 
       360 1 2 1 1 33 ARG QD   . 33 ARG  QD   1 2 
       361 1 1 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       361 1 2 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       362 1 1 1 1 33 ARG HA   . 33 ARG  HA   1 2 
       362 1 2 1 1 33 ARG QD   . 33 ARG  QD   1 2 
       363 1 1 1 1 33 ARG HB3  . 33 ARG  HB3  1 2 
       363 1 2 1 1 33 ARG QD   . 33 ARG  QD   1 2 
       364 1 1 1 1 30 VAL MG2  . 30 VAL  QG2  1 2 
       364 1 2 1 1 33 ARG QD   . 33 ARG  QD   1 2 
       365 1 1 1 1 30 VAL H    . 30 VAL  HN   1 2 
       365 1 2 1 1 30 VAL MG1  . 30 VAL  QG1  1 2 
       366 1 1 1 1 30 VAL MG1  . 30 VAL  QG1  1 2 
       366 1 2 1 1 33 ARG QD   . 33 ARG  QD   1 2 
       367 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       367 1 2 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       368 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       368 1 2 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       369 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       369 1 2 1 1 27 GLN HB3  . 27 GLN  HB3  1 2 
       370 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       370 1 2 1 1 27 GLN HB2  . 27 GLN  HB2  1 2 
       371 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       371 1 2 1 1 27 GLN HB2  . 27 GLN  HB2  1 2 
       372 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       372 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       373 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       373 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       374 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       374 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       375 1 1 1 1  9 ARG HA   .  9 ARG  HA   1 2 
       375 1 2 1 1  9 ARG QD   .  9 ARG  QD   1 2 
       376 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       376 1 2 1 1 24 ARG H    . 24 ARG  HN   1 2 
       377 1 1 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       377 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       378 1 1 1 1 14 GLU HA   . 14 GLU  HA   1 2 
       378 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       379 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       379 1 2 1 1 27 GLN HA   . 27 GLN  HA   1 2 
       380 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       380 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       381 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       381 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       382 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       382 1 2 1 1 27 GLN HB3  . 27 GLN  HB3  1 2 
       383 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       383 1 2 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       384 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       384 1 2 1 1 27 GLN HB2  . 27 GLN  HB2  1 2 
       385 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       385 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       386 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       386 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       387 1 1 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       387 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
       388 1 1 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       388 1 2 1 1 29 ILE HG13 . 29 ILE  HG13 1 2 
       389 1 1 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       389 1 2 1 1 29 ILE HG12 . 29 ILE  HG12 1 2 
       390 1 1 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       390 1 2 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
       391 1 1 1 1 11 LYS H    . 11 LYS  HN   1 2 
       391 1 2 1 1 11 LYS QE   . 11 LYS  QE   1 2 
       392 1 1 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       392 1 2 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       393 1 1 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       393 1 2 1 1 32 GLN HB3  . 32 GLN  HB3  1 2 
       394 1 1 1 1 11 LYS QE   . 11 LYS  QE   1 2 
       394 1 2 1 1 11 LYS HG2  . 11 LYS  HG2  1 2 
       395 1 1 1 1 11 LYS QE   . 11 LYS  QE   1 2 
       395 1 2 1 1 11 LYS HG3  . 11 LYS  HG3  1 2 
       396 1 1 1 1 11 LYS QE   . 11 LYS  QE   1 2 
       396 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       397 1 1 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       397 1 2 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       398 1 1 1 1 34 THR HA   . 34 THR  HA   1 2 
       398 1 2 1 1 34 THR MG   . 34 THR  QG2  1 2 
       399 1 1 1 1 22 PHE H    . 22 PHE  HN   1 2 
       399 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       400 1 1 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       400 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       401 1 1 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       401 1 2 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       402 1 1 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       402 1 2 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
       403 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       403 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       404 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       404 1 2 1 1 23 ILE HA   . 23 ILE  HA   1 2 
       405 1 1 1 1 12 PRO HG2  . 12 PRO  HG2  1 2 
       405 1 2 1 1 23 ILE HA   . 23 ILE  HA   1 2 
       406 1 1 1 1 23 ILE HA   . 23 ILE  HA   1 2 
       406 1 2 1 1 23 ILE HG12 . 23 ILE  HG12 1 2 
       407 1 1 1 1 20 LYS HB3  . 20 LYS  HB3  1 2 
       407 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       408 1 1 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       408 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       409 1 1 1 1 23 ILE H    . 23 ILE  HN   1 2 
       409 1 2 1 1 23 ILE MG   . 23 ILE  QG2  1 2 
       410 1 1 1 1 23 ILE MG   . 23 ILE  QG2  1 2 
       410 1 2 1 1 24 ARG H    . 24 ARG  HN   1 2 
       411 1 1 1 1 11 LYS HA   . 11 LYS  HA   1 2 
       411 1 2 1 1 23 ILE MG   . 23 ILE  QG2  1 2 
       412 1 1 1 1 23 ILE HA   . 23 ILE  HA   1 2 
       412 1 2 1 1 23 ILE MG   . 23 ILE  QG2  1 2 
       413 1 1 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       413 1 2 1 1 23 ILE MG   . 23 ILE  QG2  1 2 
       414 1 1 1 1 23 ILE HG12 . 23 ILE  HG12 1 2 
       414 1 2 1 1 23 ILE MG   . 23 ILE  QG2  1 2 
       415 1 1 1 1 23 ILE HG13 . 23 ILE  HG13 1 2 
       415 1 2 1 1 23 ILE MG   . 23 ILE  QG2  1 2 
       416 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       416 1 2 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       417 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       417 1 2 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       418 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       418 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       419 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       419 1 2 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       420 1 1 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       420 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       421 1 1 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       421 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       422 1 1 1 1 29 ILE H    . 29 ILE  HN   1 2 
       422 1 2 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
       423 1 1 1 1 26 SER HA   . 26 SER  HA   1 2 
       423 1 2 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
       424 1 1 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
       424 1 2 1 1 30 VAL HA   . 30 VAL  HA   1 2 
       425 1 1 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
       425 1 2 1 1 33 ARG QD   . 33 ARG  QD   1 2 
       426 1 1 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
       426 1 2 1 1 32 GLN HB2  . 32 GLN  HB2  1 2 
       427 1 1 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
       427 1 2 1 1 32 GLN HB3  . 32 GLN  HB3  1 2 
       428 1 1 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
       428 1 2 1 1 33 ARG HG3  . 33 ARG  HG3  1 2 
       429 1 1 1 1 29 ILE HG13 . 29 ILE  HG13 1 2 
       429 1 2 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
       430 1 1 1 1 29 ILE HG12 . 29 ILE  HG12 1 2 
       430 1 2 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
       431 1 1 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
       431 1 2 1 1 30 VAL MG2  . 30 VAL  QG2  1 2 
       432 1 1 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       432 1 2 1 1 31 HIS HE1  . 31 HIS  HE1  1 2 
       433 1 1 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       433 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       434 1 1 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       434 1 2 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
       435 1 1 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       435 1 2 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
       436 1 1 1 1 20 LYS HD3  . 20 LYS  HD3  1 2 
       436 1 2 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       437 1 1 1 1 20 LYS HB3  . 20 LYS  HB3  1 2 
       437 1 2 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       438 1 1 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       438 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       439 1 1 1 1 23 ILE HB   . 23 ILE  HB   1 2 
       439 1 2 1 1 24 ARG QG   . 24 ARG  QG   1 2 
       440 1 1 1 1 26 SER HA   . 26 SER  HA   1 2 
       440 1 2 1 1 30 VAL MG2  . 30 VAL  QG2  1 2 
       441 1 1 1 1 26 SER HA   . 26 SER  HA   1 2 
       441 1 2 1 1 30 VAL H    . 30 VAL  HN   1 2 
       442 1 1 1 1 25 ASN HB3  . 25 ASN  HB3  1 2 
       442 1 2 1 1 26 SER HA   . 26 SER  HA   1 2 
       443 1 1 1 1 26 SER HA   . 26 SER  HA   1 2 
       443 1 2 1 1 29 ILE HB   . 29 ILE  HB   1 2 
       444 1 1 1 1 26 SER HA   . 26 SER  HA   1 2 
       444 1 2 1 1 29 ILE HG13 . 29 ILE  HG13 1 2 
       445 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       445 1 2 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       446 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       446 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       447 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       447 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       448 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       448 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       449 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       449 1 2 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       450 1 1 1 1 15 CYS H    . 15 CYSS HN   1 2 
       450 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       451 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       451 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
       452 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       452 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       453 1 1 1 1 31 HIS H    . 31 HIS  HN   1 2 
       453 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       454 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       454 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       455 1 1 1 1 15 CYS HA   . 15 CYSS HA   1 2 
       455 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       456 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       456 1 2 1 1 32 GLN HA   . 32 GLN  HA   1 2 
       457 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       457 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       458 1 1 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
       458 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       459 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       459 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       460 1 1 1 1 31 HIS HE1  . 31 HIS  HE1  1 2 
       460 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       461 1 1 1 1 32 GLN HA   . 32 GLN  HA   1 2 
       461 1 2 1 1 36 SER H    . 36 SER  HN   1 2 
       462 1 1 1 1 32 GLN HA   . 32 GLN  HA   1 2 
       462 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       463 1 1 1 1 31 HIS HA   . 31 HIS  HA   1 2 
       463 1 2 1 1 32 GLN HA   . 32 GLN  HA   1 2 
       464 1 1 1 1 32 GLN HA   . 32 GLN  HA   1 2 
       464 1 2 1 1 33 ARG HA   . 33 ARG  HA   1 2 
       465 1 1 1 1 35 HIS HB3  . 35 HIS  HB3  1 2 
       465 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       466 1 1 1 1 35 HIS HB2  . 35 HIS  HB2  1 2 
       466 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       467 1 1 1 1 32 GLN HA   . 32 GLN  HA   1 2 
       467 1 2 1 1 35 HIS HB2  . 35 HIS  HB2  1 2 
       468 1 1 1 1 32 GLN HB3  . 32 GLN  HB3  1 2 
       468 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       469 1 1 1 1 17 GLU QB   . 17 GLU  QB   1 2 
       469 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       470 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       470 1 2 1 1 32 GLN HA   . 32 GLN  HA   1 2 
       471 1 1 1 1 31 HIS HA   . 31 HIS  HA   1 2 
       471 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
       472 1 1 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       472 1 2 1 1 31 HIS HA   . 31 HIS  HA   1 2 
       473 1 1 1 1 31 HIS HA   . 31 HIS  HA   1 2 
       473 1 2 1 1 34 THR MG   . 34 THR  QG2  1 2 
       474 1 1 1 1 30 VAL MG1  . 30 VAL  QG1  1 2 
       474 1 2 1 1 31 HIS HA   . 31 HIS  HA   1 2 
       475 1 1 1 1 14 GLU HG3  . 14 GLU  HG3  1 2 
       475 1 2 1 1 15 CYS H    . 15 CYSS HN   1 2 
       476 1 1 1 1 14 GLU H    . 14 GLU  HN   1 2 
       476 1 2 1 1 14 GLU HG2  . 14 GLU  HG2  1 2 
       477 1 1 1 1 14 GLU HG3  . 14 GLU  HG3  1 2 
       477 1 2 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       478 1 1 1 1 14 GLU HG3  . 14 GLU  HG3  1 2 
       478 1 2 1 1 19 GLY HA2  . 19 GLY  HA1  1 2 
       479 1 1 1 1 14 GLU HG2  . 14 GLU  HG2  1 2 
       479 1 2 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       480 1 1 1 1 33 ARG HA   . 33 ARG  HA   1 2 
       480 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
       481 1 1 1 1 33 ARG HA   . 33 ARG  HA   1 2 
       481 1 2 1 1 33 ARG HG2  . 33 ARG  HG2  1 2 
       482 1 1 1 1 17 GLU HA   . 17 GLU  HA   1 2 
       482 1 2 1 1 18 CYS HA   . 18 CYSS HA   1 2 
       483 1 1 1 1 18 CYS HA   . 18 CYSS HA   1 2 
       483 1 2 1 1 19 GLY HA3  . 19 GLY  HA2  1 2 
       484 1 1 1 1 17 GLU QB   . 17 GLU  QB   1 2 
       484 1 2 1 1 18 CYS HA   . 18 CYSS HA   1 2 
       485 1 1 1 1 23 ILE HA   . 23 ILE  HA   1 2 
       485 1 2 1 1 23 ILE MD   . 23 ILE  QD1  1 2 
       486 1 1 1 1 11 LYS QE   . 11 LYS  QE   1 2 
       486 1 2 1 1 23 ILE MD   . 23 ILE  QD1  1 2 
       487 1 1 1 1 23 ILE HB   . 23 ILE  HB   1 2 
       487 1 2 1 1 23 ILE MD   . 23 ILE  QD1  1 2 
       488 1 1 1 1 17 GLU HA   . 17 GLU  HA   1 2 
       488 1 2 1 1 17 GLU HG3  . 17 GLU  HG3  1 2 
       489 1 1 1 1 17 GLU HA   . 17 GLU  HA   1 2 
       489 1 2 1 1 17 GLU HG2  . 17 GLU  HG2  1 2 
       490 1 1 1 1 20 LYS HA   . 20 LYS  HA   1 2 
       490 1 2 1 1 20 LYS HG2  . 20 LYS  HG2  1 2 
       491 1 1 1 1 20 LYS HA   . 20 LYS  HA   1 2 
       491 1 2 1 1 20 LYS HG3  . 20 LYS  HG3  1 2 
       492 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       492 1 2 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       493 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       493 1 2 1 1 32 GLN HG2  . 32 GLN  HG2  1 2 
       494 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       494 1 2 1 1 32 GLN HG3  . 32 GLN  HG3  1 2 
       495 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       495 1 2 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       496 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       496 1 2 1 1 31 HIS HB3  . 31 HIS  HB3  1 2 
       497 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       497 1 2 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       498 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       498 1 2 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       499 1 1 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       499 1 2 1 1 32 GLN HG3  . 32 GLN  HG3  1 2 
       500 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       500 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       501 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       501 1 2 1 1 32 GLN HG3  . 32 GLN  HG3  1 2 
       502 1 1 1 1 27 GLN HA   . 27 GLN  HA   1 2 
       502 1 2 1 1 30 VAL MG1  . 30 VAL  QG1  1 2 
       503 1 1 1 1 26 SER HA   . 26 SER  HA   1 2 
       503 1 2 1 1 29 ILE MD   . 29 ILE  QD1  1 2 
       504 1 1 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       504 1 2 1 1 29 ILE MD   . 29 ILE  QD1  1 2 
       505 1 1 1 1 25 ASN HB3  . 25 ASN  HB3  1 2 
       505 1 2 1 1 29 ILE MD   . 29 ILE  QD1  1 2 
       506 1 1 1 1 25 ASN HB2  . 25 ASN  HB2  1 2 
       506 1 2 1 1 29 ILE MD   . 29 ILE  QD1  1 2 
       507 1 1 1 1 29 ILE HB   . 29 ILE  HB   1 2 
       507 1 2 1 1 29 ILE MD   . 29 ILE  QD1  1 2 
       508 1 1 1 1 29 ILE MD   . 29 ILE  QD1  1 2 
       508 1 2 1 1 30 VAL MG2  . 30 VAL  QG2  1 2 
       509 1 1 1 1 29 ILE MD   . 29 ILE  QD1  1 2 
       509 1 2 1 1 29 ILE MG   . 29 ILE  QG2  1 2 
       510 1 1 1 1 27 GLN HA   . 27 GLN  HA   1 2 
       510 1 2 1 1 27 GLN HG2  . 27 GLN  HG2  1 2 
       511 1 1 1 1 27 GLN HA   . 27 GLN  HA   1 2 
       511 1 2 1 1 27 GLN HG3  . 27 GLN  HG3  1 2 
       512 1 1 1 1 24 ARG HB2  . 24 ARG  HB2  1 2 
       512 1 2 1 1 27 GLN HG2  . 27 GLN  HG2  1 2 
       513 1 1 1 1  9 ARG HA   .  9 ARG  HA   1 2 
       513 1 2 1 1  9 ARG QG   .  9 ARG  QG   1 2 
       514 1 1 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       514 1 2 1 1 25 ASN HA   . 25 ASN  HA   1 2 
       515 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       515 1 2 1 1 25 ASN HA   . 25 ASN  HA   1 2 
       516 1 1 1 1 25 ASN HA   . 25 ASN  HA   1 2 
       516 1 2 1 1 27 GLN H    . 27 GLN  HN   1 2 
       517 1 1 1 1 13 TYR HB3  . 13 TYR  HB3  1 2 
       517 1 2 1 1 25 ASN HA   . 25 ASN  HA   1 2 
       518 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       518 1 2 1 1 20 LYS HB3  . 20 LYS  HB3  1 2 
       519 1 1 1 1 13 TYR HB2  . 13 TYR  HB2  1 2 
       519 1 2 1 1 25 ASN HA   . 25 ASN  HA   1 2 
       520 1 1 1 1 25 ASN HA   . 25 ASN  HA   1 2 
       520 1 2 1 1 28 LEU HB3  . 28 LEU  HB3  1 2 
       521 1 1 1 1 25 ASN HA   . 25 ASN  HA   1 2 
       521 1 2 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       522 1 1 1 1 25 ASN HA   . 25 ASN  HA   1 2 
       522 1 2 1 1 28 LEU HB2  . 28 LEU  HB2  1 2 
       523 1 1 1 1 25 ASN HA   . 25 ASN  HA   1 2 
       523 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       524 1 1 1 1 20 LYS HB2  . 20 LYS  HB2  1 2 
       524 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       525 1 1 1 1 20 LYS HB3  . 20 LYS  HB3  1 2 
       525 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       526 1 1 1 1 20 LYS HB2  . 20 LYS  HB2  1 2 
       526 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       527 1 1 1 1 20 LYS HB2  . 20 LYS  HB2  1 2 
       527 1 2 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       528 1 1 1 1 24 ARG HB3  . 24 ARG  HB3  1 2 
       528 1 2 1 1 27 GLN H    . 27 GLN  HN   1 2 
       529 1 1 1 1 24 ARG HB3  . 24 ARG  HB3  1 2 
       529 1 2 1 1 27 GLN HG3  . 27 GLN  HG3  1 2 
       530 1 1 1 1 24 ARG HB2  . 24 ARG  HB2  1 2 
       530 1 2 1 1 27 GLN HG3  . 27 GLN  HG3  1 2 
       531 1 1 1 1 24 ARG HB3  . 24 ARG  HB3  1 2 
       531 1 2 1 1 27 GLN HG2  . 27 GLN  HG2  1 2 
       532 1 1 1 1 11 LYS HB3  . 11 LYS  HB3  1 2 
       532 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       533 1 1 1 1 14 GLU QB   . 14 GLU  QB   1 2 
       533 1 2 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       534 1 1 1 1 13 TYR HA   . 13 TYR  HA   1 2 
       534 1 2 1 1 14 GLU QB   . 14 GLU  QB   1 2 
       535 1 1 1 1 14 GLU QB   . 14 GLU  QB   1 2 
       535 1 2 1 1 15 CYS HA   . 15 CYSS HA   1 2 
       536 1 1 1 1 14 GLU QB   . 14 GLU  QB   1 2 
       536 1 2 1 1 19 GLY HA2  . 19 GLY  HA1  1 2 
       537 1 1 1 1 14 GLU QB   . 14 GLU  QB   1 2 
       537 1 2 1 1 14 GLU HG2  . 14 GLU  HG2  1 2 
       538 1 1 1 1 14 GLU QB   . 14 GLU  QB   1 2 
       538 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       539 1 1 1 1 11 LYS HB2  . 11 LYS  HB2  1 2 
       539 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       540 1 1 1 1 18 CYS HB2  . 18 CYSS HB2  1 2 
       540 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       541 1 1 1 1 18 CYS HB2  . 18 CYSS HB2  1 2 
       541 1 2 1 1 20 LYS H    . 20 LYS  HN   1 2 
       542 1 1 1 1 17 GLU QB   . 17 GLU  QB   1 2 
       542 1 2 1 1 18 CYS HB2  . 18 CYSS HB2  1 2 
       543 1 1 1 1 18 CYS HB2  . 18 CYSS HB2  1 2 
       543 1 2 1 1 20 LYS HB2  . 20 LYS  HB2  1 2 
       544 1 1 1 1 17 GLU QB   . 17 GLU  QB   1 2 
       544 1 2 1 1 18 CYS HB3  . 18 CYSS HB3  1 2 
       545 1 1 1 1 12 PRO HB2  . 12 PRO  HB2  1 2 
       545 1 2 1 1 13 TYR HA   . 13 TYR  HA   1 2 
       546 1 1 1 1 27 GLN HA   . 27 GLN  HA   1 2 
       546 1 2 1 1 30 VAL HB   . 30 VAL  HB   1 2 
       547 1 1 1 1 11 LYS HA   . 11 LYS  HA   1 2 
       547 1 2 1 1 23 ILE HA   . 23 ILE  HA   1 2 
       548 1 1 1 1 10 GLU HB3  . 10 GLU  HB3  1 2 
       548 1 2 1 1 11 LYS H    . 11 LYS  HN   1 2 
       549 1 1 1 1 33 ARG HB2  . 33 ARG  HB2  1 2 
       549 1 2 1 1 33 ARG QD   . 33 ARG  QD   1 2 
       550 1 1 1 1 33 ARG H    . 33 ARG  HN   1 2 
       550 1 2 1 1 33 ARG HB2  . 33 ARG  HB2  1 2 
       551 1 1 1 1 33 ARG H    . 33 ARG  HN   1 2 
       551 1 2 1 1 33 ARG HB3  . 33 ARG  HB3  1 2 
       552 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       552 1 2 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       553 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       553 1 2 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       554 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       554 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       555 1 1 1 1 14 GLU HA   . 14 GLU  HA   1 2 
       555 1 2 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       556 1 1 1 1 14 GLU HA   . 14 GLU  HA   1 2 
       556 1 2 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       557 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       557 1 2 1 1 19 GLY HA2  . 19 GLY  HA1  1 2 
       558 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       558 1 2 1 1 20 LYS HB2  . 20 LYS  HB2  1 2 
       559 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       559 1 2 1 1 20 LYS HB2  . 20 LYS  HB2  1 2 
       560 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       560 1 2 1 1 20 LYS HB3  . 20 LYS  HB3  1 2 
       561 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       561 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       562 1 1 1 1 15 CYS HB2  . 15 CYSS HB2  1 2 
       562 1 2 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       563 1 1 1 1 15 CYS HB3  . 15 CYSS HB3  1 2 
       563 1 2 1 1 17 GLU QB   . 17 GLU  QB   1 2 
       564 1 1 1 1 11 LYS HA   . 11 LYS  HA   1 2 
       564 1 2 1 1 11 LYS QD   . 11 LYS  QD   1 2 
       565 1 1 1 1 11 LYS QD   . 11 LYS  QD   1 2 
       565 1 2 1 1 21 ALA MB   . 21 ALA  QB   1 2 
       566 1 1 1 1 20 LYS HD2  . 20 LYS  HD2  1 2 
       566 1 2 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       567 1 1 1 1 24 ARG H    . 24 ARG  HN   1 2 
       567 1 2 1 1 27 GLN HB3  . 27 GLN  HB3  1 2 
       568 1 1 1 1 27 GLN H    . 27 GLN  HN   1 2 
       568 1 2 1 1 27 GLN HB3  . 27 GLN  HB3  1 2 
       569 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       569 1 2 1 1 27 GLN HB3  . 27 GLN  HB3  1 2 
       570 1 1 1 1 24 ARG HB2  . 24 ARG  HB2  1 2 
       570 1 2 1 1 27 GLN HB3  . 27 GLN  HB3  1 2 
       571 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       571 1 2 1 1 25 ASN HD22 . 25 ASN  HD22 1 2 
       572 1 1 1 1 13 TYR HA   . 13 TYR  HA   1 2 
       572 1 2 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       573 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       573 1 2 1 1 23 ILE HA   . 23 ILE  HA   1 2 
       574 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       574 1 2 1 1 25 ASN HB3  . 25 ASN  HB3  1 2 
       575 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       575 1 2 1 1 25 ASN HB2  . 25 ASN  HB2  1 2 
       576 1 1 1 1 12 PRO HG3  . 12 PRO  HG3  1 2 
       576 1 2 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       577 1 1 1 1 17 GLU QB   . 17 GLU  QB   1 2 
       577 1 2 1 1 35 HIS HB3  . 35 HIS  HB3  1 2 
       578 1 1 1 1 12 PRO HB2  . 12 PRO  HB2  1 2 
       578 1 2 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       579 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       579 1 2 1 1 23 ILE MG   . 23 ILE  QG2  1 2 
       580 1 1 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       580 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       581 1 1 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
       581 1 2 1 1 32 GLN H    . 32 GLN  HN   1 2 
       582 1 1 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       582 1 2 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
       583 1 1 1 1 26 SER HA   . 26 SER  HA   1 2 
       583 1 2 1 1 29 ILE HG12 . 29 ILE  HG12 1 2 
       584 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       584 1 2 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
       585 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       585 1 2 1 1 31 HIS HB2  . 31 HIS  HB2  1 2 
       586 1 1 1 1 23 ILE HA   . 23 ILE  HA   1 2 
       586 1 2 1 1 23 ILE HG13 . 23 ILE  HG13 1 2 
       587 1 1 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       587 1 2 1 1 32 GLN HB2  . 32 GLN  HB2  1 2 
       588 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       588 1 2 1 1 32 GLN HB3  . 32 GLN  HB3  1 2 
       589 1 1 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       589 1 2 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       590 1 1 1 1 18 CYS HA   . 18 CYSS HA   1 2 
       590 1 2 1 1 35 HIS HE1  . 35 HIS  HE1  1 2 
       591 1 1 1 1 14 GLU HA   . 14 GLU  HA   1 2 
       591 1 2 1 1 21 ALA HA   . 21 ALA  HA   1 2 
       592 1 1 1 1 11 LYS HA   . 11 LYS  HA   1 2 
       592 1 2 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       593 1 1 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       593 1 2 1 1 23 ILE HA   . 23 ILE  HA   1 2 
       594 1 1 1 1 18 CYS HB2  . 18 CYSS HB2  1 2 
       594 1 2 1 1 35 HIS HE1  . 35 HIS  HE1  1 2 
       595 1 1 1 1 18 CYS HB3  . 18 CYSS HB3  1 2 
       595 1 2 1 1 35 HIS HE1  . 35 HIS  HE1  1 2 
       596 1 1 1 1 11 LYS HB2  . 11 LYS  HB2  1 2 
       596 1 2 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       597 1 1 1 1 11 LYS HB3  . 11 LYS  HB3  1 2 
       597 1 2 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       598 1 1 1 1 11 LYS HG3  . 11 LYS  HG3  1 2 
       598 1 2 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       599 1 1 1 1 33 ARG HA   . 33 ARG  HA   1 2 
       599 1 2 1 1 33 ARG HG3  . 33 ARG  HG3  1 2 
       600 1 1 1 1 30 VAL HA   . 30 VAL  HA   1 2 
       600 1 2 1 1 33 ARG HG2  . 33 ARG  HG2  1 2 
       601 1 1 1 1 31 HIS HE1  . 31 HIS  HE1  1 2 
       601 1 2 1 1 34 THR MG   . 34 THR  QG2  1 2 
       602 1 1 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       602 1 2 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       603 1 1 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       603 1 2 1 1 32 GLN HG2  . 32 GLN  HG2  1 2 
       604 1 1 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       604 1 2 1 1 29 ILE H    . 29 ILE  HN   1 2 
       605 1 1 1 1 24 ARG QG   . 24 ARG  QG   1 2 
       605 1 2 1 1 27 GLN H    . 27 GLN  HN   1 2 
       606 1 1 1 1 40 GLY HA2  . 40 GLY  HA1  1 2 
       606 1 2 1 1 41 PRO QD   . 41 PRO  QD   1 2 
       607 1 1 1 1 40 GLY HA3  . 40 GLY  HA2  1 2 
       607 1 2 1 1 41 PRO QD   . 41 PRO  QD   1 2 
       608 1 1 1 1 24 ARG QG   . 24 ARG  QG   1 2 
       608 1 2 1 1 27 GLN HG3  . 27 GLN  HG3  1 2 
       609 1 1 1 1 24 ARG QG   . 24 ARG  QG   1 2 
       609 1 2 1 1 27 GLN HG2  . 27 GLN  HG2  1 2 
       610 1 1 1 1 23 ILE MG   . 23 ILE  QG2  1 2 
       610 1 2 1 1 24 ARG QG   . 24 ARG  QG   1 2 
       611 1 1 1 1 12 PRO HG2  . 12 PRO  HG2  1 2 
       611 1 2 1 1 13 TYR QD   . 13 TYR  QD   1 2 
       612 1 1 1 1 12 PRO HG2  . 12 PRO  HG2  1 2 
       612 1 2 1 1 13 TYR QE   . 13 TYR  QE   1 2 
       613 1 1 1 1 11 LYS HA   . 11 LYS  HA   1 2 
       613 1 2 1 1 12 PRO HG2  . 12 PRO  HG2  1 2 
       614 1 1 1 1 12 PRO HG2  . 12 PRO  HG2  1 2 
       614 1 2 1 1 13 TYR HA   . 13 TYR  HA   1 2 
       615 1 1 1 1 11 LYS HA   . 11 LYS  HA   1 2 
       615 1 2 1 1 12 PRO HG3  . 12 PRO  HG3  1 2 
       616 1 1 1 1 12 PRO HG3  . 12 PRO  HG3  1 2 
       616 1 2 1 1 23 ILE HA   . 23 ILE  HA   1 2 
       617 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       617 1 2 1 1 20 LYS HG2  . 20 LYS  HG2  1 2 
       618 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       618 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       619 1 1 1 1 13 TYR HA   . 13 TYR  HA   1 2 
       619 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       620 1 1 1 1 15 CYS HA   . 15 CYSS HA   1 2 
       620 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       621 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       621 1 2 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       622 1 1 1 1 11 LYS HA   . 11 LYS  HA   1 2 
       622 1 2 1 1 11 LYS HG3  . 11 LYS  HG3  1 2 
       623 1 1 1 1 11 LYS HA   . 11 LYS  HA   1 2 
       623 1 2 1 1 11 LYS HG2  . 11 LYS  HG2  1 2 
       624 1 1 1 1 11 LYS HG2  . 11 LYS  HG2  1 2 
       624 1 2 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       625 1 1 1 1 34 THR HB   . 34 THR  HB   1 2 
       625 1 2 1 1 35 HIS H    . 35 HIS  HN   1 2 
       626 1 1 1 1 34 THR HA   . 34 THR  HA   1 2 
       626 1 2 1 1 34 THR HB   . 34 THR  HB   1 2 
       627 1 1 1 1  9 ARG QB   .  9 ARG  QB   1 2 
       627 1 2 1 1 10 GLU H    . 10 GLU  HN   1 2 
       628 1 1 1 1  9 ARG QB   .  9 ARG  QB   1 2 
       628 1 2 1 1 11 LYS H    . 11 LYS  HN   1 2 
       629 1 1 1 1 10 GLU H    . 10 GLU  HN   1 2 
       629 1 2 1 1 10 GLU QB   . 10 GLU  QB   1 2 
       630 1 1 1 1 10 GLU H    . 10 GLU  HN   1 2 
       630 1 2 1 1 10 GLU QG   . 10 GLU  QG   1 2 
       631 1 1 1 1 10 GLU QB   . 10 GLU  QB   1 2 
       631 1 2 1 1 11 LYS H    . 11 LYS  HN   1 2 
       632 1 1 1 1 11 LYS H    . 11 LYS  HN   1 2 
       632 1 2 1 1 11 LYS QG   . 11 LYS  QG   1 2 
       633 1 1 1 1 11 LYS HA   . 11 LYS  HA   1 2 
       633 1 2 1 1 11 LYS QG   . 11 LYS  QG   1 2 
       634 1 1 1 1 11 LYS QG   . 11 LYS  QG   1 2 
       634 1 2 1 1 12 PRO HG2  . 12 PRO  HG2  1 2 
       635 1 1 1 1 11 LYS QG   . 11 LYS  QG   1 2 
       635 1 2 1 1 12 PRO HG3  . 12 PRO  HG3  1 2 
       636 1 1 1 1 11 LYS QG   . 11 LYS  QG   1 2 
       636 1 2 1 1 12 PRO QD   . 12 PRO  QD   1 2 
       637 1 1 1 1 11 LYS QG   . 11 LYS  QG   1 2 
       637 1 2 1 1 13 TYR H    . 13 TYR  HN   1 2 
       638 1 1 1 1 11 LYS QG   . 11 LYS  QG   1 2 
       638 1 2 1 1 23 ILE H    . 23 ILE  HN   1 2 
       639 1 1 1 1 11 LYS QG   . 11 LYS  QG   1 2 
       639 1 2 1 1 23 ILE HA   . 23 ILE  HA   1 2 
       640 1 1 1 1 11 LYS QG   . 11 LYS  QG   1 2 
       640 1 2 1 1 23 ILE QG   . 23 ILE  QG1  1 2 
       641 1 1 1 1 15 CYS HA   . 15 CYSS HA   1 2 
       641 1 2 1 1 32 GLN QE   . 32 GLN  QE2  1 2 
       642 1 1 1 1 16 SER QB   . 16 SER  QB   1 2 
       642 1 2 1 1 17 GLU H    . 17 GLU  HN   1 2 
       643 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       643 1 2 1 1 17 GLU QG   . 17 GLU  QG   1 2 
       644 1 1 1 1 17 GLU H    . 17 GLU  HN   1 2 
       644 1 2 1 1 32 GLN QE   . 32 GLN  QE2  1 2 
       645 1 1 1 1 17 GLU QG   . 17 GLU  QG   1 2 
       645 1 2 1 1 18 CYS H    . 18 CYSS HN   1 2 
       646 1 1 1 1 17 GLU QG   . 17 GLU  QG   1 2 
       646 1 2 1 1 19 GLY H    . 19 GLY  HN   1 2 
       647 1 1 1 1 17 GLU QG   . 17 GLU  QG   1 2 
       647 1 2 1 1 35 HIS HB3  . 35 HIS  HB3  1 2 
       648 1 1 1 1 17 GLU QG   . 17 GLU  QG   1 2 
       648 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       649 1 1 1 1 20 LYS H    . 20 LYS  HN   1 2 
       649 1 2 1 1 20 LYS QG   . 20 LYS  QG   1 2 
       650 1 1 1 1 20 LYS QG   . 20 LYS  QG   1 2 
       650 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       651 1 1 1 1 20 LYS QG   . 20 LYS  QG   1 2 
       651 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       652 1 1 1 1 20 LYS QG   . 20 LYS  QG   1 2 
       652 1 2 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       653 1 1 1 1 20 LYS QD   . 20 LYS  QD   1 2 
       653 1 2 1 1 22 PHE QE   . 22 PHE  QE   1 2 
       654 1 1 1 1 20 LYS QD   . 20 LYS  QD   1 2 
       654 1 2 1 1 22 PHE HZ   . 22 PHE  HZ   1 2 
       655 1 1 1 1 20 LYS QE   . 20 LYS  QE   1 2 
       655 1 2 1 1 21 ALA H    . 21 ALA  HN   1 2 
       656 1 1 1 1 20 LYS QE   . 20 LYS  QE   1 2 
       656 1 2 1 1 31 HIS HE1  . 31 HIS  HE1  1 2 
       657 1 1 1 1 22 PHE HB2  . 22 PHE  HB2  1 2 
       657 1 2 1 1 27 GLN QG   . 27 GLN  QG   1 2 
       658 1 1 1 1 22 PHE HB3  . 22 PHE  HB3  1 2 
       658 1 2 1 1 27 GLN QG   . 27 GLN  QG   1 2 
       659 1 1 1 1 22 PHE QD   . 22 PHE  QD   1 2 
       659 1 2 1 1 27 GLN QG   . 27 GLN  QG   1 2 
       660 1 1 1 1 23 ILE H    . 23 ILE  HN   1 2 
       660 1 2 1 1 23 ILE QG   . 23 ILE  QG1  1 2 
       661 1 1 1 1 23 ILE H    . 23 ILE  HN   1 2 
       661 1 2 1 1 27 GLN QG   . 27 GLN  QG   1 2 
       662 1 1 1 1 23 ILE QG   . 23 ILE  QG1  1 2 
       662 1 2 1 1 23 ILE MG   . 23 ILE  QG2  1 2 
       663 1 1 1 1 23 ILE MG   . 23 ILE  QG2  1 2 
       663 1 2 1 1 24 ARG QD   . 24 ARG  QD   1 2 
       664 1 1 1 1 23 ILE QG   . 23 ILE  QG1  1 2 
       664 1 2 1 1 24 ARG H    . 24 ARG  HN   1 2 
       665 1 1 1 1 23 ILE MD   . 23 ILE  QD1  1 2 
       665 1 2 1 1 27 GLN QE   . 27 GLN  QE2  1 2 
       666 1 1 1 1 24 ARG H    . 24 ARG  HN   1 2 
       666 1 2 1 1 27 GLN QG   . 27 GLN  QG   1 2 
       667 1 1 1 1 24 ARG HB2  . 24 ARG  HB2  1 2 
       667 1 2 1 1 27 GLN QG   . 27 GLN  QG   1 2 
       668 1 1 1 1 24 ARG HB3  . 24 ARG  HB3  1 2 
       668 1 2 1 1 24 ARG QD   . 24 ARG  QD   1 2 
       669 1 1 1 1 24 ARG QG   . 24 ARG  QG   1 2 
       669 1 2 1 1 27 GLN QG   . 27 GLN  QG   1 2 
       670 1 1 1 1 24 ARG QG   . 24 ARG  QG   1 2 
       670 1 2 1 1 27 GLN QE   . 27 GLN  QE2  1 2 
       671 1 1 1 1 27 GLN H    . 27 GLN  HN   1 2 
       671 1 2 1 1 27 GLN QG   . 27 GLN  QG   1 2 
       672 1 1 1 1 27 GLN HA   . 27 GLN  HA   1 2 
       672 1 2 1 1 27 GLN QG   . 27 GLN  QG   1 2 
       673 1 1 1 1 27 GLN HA   . 27 GLN  HA   1 2 
       673 1 2 1 1 27 GLN QE   . 27 GLN  QE2  1 2 
       674 1 1 1 1 27 GLN HB2  . 27 GLN  HB2  1 2 
       674 1 2 1 1 27 GLN QE   . 27 GLN  QE2  1 2 
       675 1 1 1 1 27 GLN HB3  . 27 GLN  HB3  1 2 
       675 1 2 1 1 27 GLN QE   . 27 GLN  QE2  1 2 
       676 1 1 1 1 27 GLN QG   . 27 GLN  QG   1 2 
       676 1 2 1 1 28 LEU H    . 28 LEU  HN   1 2 
       677 1 1 1 1 27 GLN QG   . 27 GLN  QG   1 2 
       677 1 2 1 1 30 VAL MG2  . 30 VAL  QG2  1 2 
       678 1 1 1 1 28 LEU HA   . 28 LEU  HA   1 2 
       678 1 2 1 1 32 GLN QG   . 32 GLN  QG   1 2 
       679 1 1 1 1 28 LEU HG   . 28 LEU  HG   1 2 
       679 1 2 1 1 32 GLN QG   . 32 GLN  QG   1 2 
       680 1 1 1 1 28 LEU MD1  . 28 LEU  QD1  1 2 
       680 1 2 1 1 32 GLN QE   . 32 GLN  QE2  1 2 
       681 1 1 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       681 1 2 1 1 32 GLN QG   . 32 GLN  QG   1 2 
       682 1 1 1 1 28 LEU MD2  . 28 LEU  QD2  1 2 
       682 1 2 1 1 32 GLN QE   . 32 GLN  QE2  1 2 
       683 1 1 1 1 29 ILE H    . 29 ILE  HN   1 2 
       683 1 2 1 1 32 GLN QG   . 32 GLN  QG   1 2 
       684 1 1 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       684 1 2 1 1 32 GLN QG   . 32 GLN  QG   1 2 
       685 1 1 1 1 29 ILE HA   . 29 ILE  HA   1 2 
       685 1 2 1 1 32 GLN QE   . 32 GLN  QE2  1 2 
       686 1 1 1 1 30 VAL HA   . 30 VAL  HA   1 2 
       686 1 2 1 1 33 ARG QB   . 33 ARG  QB   1 2 
       687 1 1 1 1 31 HIS HD2  . 31 HIS  HD2  1 2 
       687 1 2 1 1 32 GLN QE   . 32 GLN  QE2  1 2 
       688 1 1 1 1 32 GLN H    . 32 GLN  HN   1 2 
       688 1 2 1 1 32 GLN QG   . 32 GLN  QG   1 2 
       689 1 1 1 1 32 GLN HA   . 32 GLN  HA   1 2 
       689 1 2 1 1 32 GLN QG   . 32 GLN  QG   1 2 
       690 1 1 1 1 32 GLN HA   . 32 GLN  HA   1 2 
       690 1 2 1 1 32 GLN QE   . 32 GLN  QE2  1 2 
       691 1 1 1 1 32 GLN HB3  . 32 GLN  HB3  1 2 
       691 1 2 1 1 32 GLN QE   . 32 GLN  QE2  1 2 
       692 1 1 1 1 32 GLN QE   . 32 GLN  QE2  1 2 
       692 1 2 1 1 32 GLN QG   . 32 GLN  QG   1 2 
       693 1 1 1 1 32 GLN QG   . 32 GLN  QG   1 2 
       693 1 2 1 1 33 ARG H    . 33 ARG  HN   1 2 
       694 1 1 1 1 32 GLN QG   . 32 GLN  QG   1 2 
       694 1 2 1 1 35 HIS HD2  . 35 HIS  HD2  1 2 
       695 1 1 1 1 33 ARG H    . 33 ARG  HN   1 2 
       695 1 2 1 1 33 ARG QB   . 33 ARG  QB   1 2 
       696 1 1 1 1 33 ARG HA   . 33 ARG  HA   1 2 
       696 1 2 1 1 36 SER QB   . 36 SER  QB   1 2 
       697 1 1 1 1 33 ARG QB   . 33 ARG  QB   1 2 
       697 1 2 1 1 33 ARG QD   . 33 ARG  QD   1 2 
       698 1 1 1 1 33 ARG QB   . 33 ARG  QB   1 2 
       698 1 2 1 1 34 THR H    . 34 THR  HN   1 2 
       699 1 1 1 1 38 GLU H    . 38 GLU  HN   1 2 
       699 1 2 1 1 38 GLU QB   . 38 GLU  QB   1 2 
       700 1 1 1 1 40 GLY QA   . 40 GLY  QA   1 2 
       700 1 2 1 1 41 PRO QD   . 41 PRO  QD   1 2 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

         1 1 . . . . . . . 4.75 1 2 
         2 1 . . . . . . . 4.99 1 2 
         3 1 . . . . . . .  4.6 1 2 
         4 1 . . . . . . .  4.6 1 2 
         5 1 . . . . . . .  5.5 1 2 
         6 1 . . . . . . . 4.78 1 2 
         7 1 . . . . . . .  5.5 1 2 
         8 1 . . . . . . . 4.34 1 2 
         9 1 . . . . . . . 3.24 1 2 
        10 1 . . . . . . .  3.9 1 2 
        11 1 . . . . . . . 4.16 1 2 
        12 1 . . . . . . . 4.75 1 2 
        13 1 . . . . . . . 5.07 1 2 
        14 1 . . . . . . . 4.53 1 2 
        15 1 . . . . . . . 4.53 1 2 
        16 1 . . . . . . . 4.32 1 2 
        17 1 . . . . . . . 4.32 1 2 
        18 1 . . . . . . .  4.6 1 2 
        19 1 . . . . . . . 4.74 1 2 
        20 1 . . . . . . . 4.52 1 2 
        21 1 . . . . . . . 5.29 1 2 
        22 1 . . . . . . .  3.6 1 2 
        23 1 . . . . . . . 3.58 1 2 
        24 1 . . . . . . .  5.5 1 2 
        25 1 . . . . . . . 4.74 1 2 
        26 1 . . . . . . . 4.89 1 2 
        27 1 . . . . . . . 4.89 1 2 
        28 1 . . . . . . . 4.83 1 2 
        29 1 . . . . . . . 5.27 1 2 
        30 1 . . . . . . . 3.82 1 2 
        31 1 . . . . . . . 4.07 1 2 
        32 1 . . . . . . . 4.49 1 2 
        33 1 . . . . . . .  5.5 1 2 
        34 1 . . . . . . .  5.5 1 2 
        35 1 . . . . . . . 4.69 1 2 
        36 1 . . . . . . . 2.98 1 2 
        37 1 . . . . . . . 3.64 1 2 
        38 1 . . . . . . .  3.7 1 2 
        39 1 . . . . . . . 5.27 1 2 
        40 1 . . . . . . . 4.45 1 2 
        41 1 . . . . . . . 5.23 1 2 
        42 1 . . . . . . . 2.93 1 2 
        43 1 . . . . . . . 4.55 1 2 
        44 1 . . . . . . . 4.63 1 2 
        45 1 . . . . . . . 3.14 1 2 
        46 1 . . . . . . . 2.86 1 2 
        47 1 . . . . . . . 3.65 1 2 
        48 1 . . . . . . . 4.24 1 2 
        49 1 . . . . . . . 4.64 1 2 
        50 1 . . . . . . . 3.89 1 2 
        51 1 . . . . . . . 4.75 1 2 
        52 1 . . . . . . .  5.2 1 2 
        53 1 . . . . . . . 4.99 1 2 
        54 1 . . . . . . .  5.5 1 2 
        55 1 . . . . . . .  5.5 1 2 
        56 1 . . . . . . . 3.03 1 2 
        57 1 . . . . . . . 5.07 1 2 
        58 1 . . . . . . . 4.98 1 2 
        59 1 . . . . . . . 4.71 1 2 
        60 1 . . . . . . . 3.58 1 2 
        61 1 . . . . . . . 2.67 1 2 
        62 1 . . . . . . . 2.79 1 2 
        63 1 . . . . . . . 4.79 1 2 
        64 1 . . . . . . .  5.5 1 2 
        65 1 . . . . . . . 2.94 1 2 
        66 1 . . . . . . . 4.96 1 2 
        67 1 . . . . . . . 5.45 1 2 
        68 1 . . . . . . . 4.95 1 2 
        69 1 . . . . . . . 4.51 1 2 
        70 1 . . . . . . . 4.75 1 2 
        71 1 . . . . . . . 3.68 1 2 
        72 1 . . . . . . . 4.39 1 2 
        73 1 . . . . . . . 5.32 1 2 
        74 1 . . . . . . . 5.28 1 2 
        75 1 . . . . . . . 3.47 1 2 
        76 1 . . . . . . . 3.47 1 2 
        77 1 . . . . . . . 4.84 1 2 
        78 1 . . . . . . . 3.07 1 2 
        79 1 . . . . . . . 3.24 1 2 
        80 1 . . . . . . .  5.5 1 2 
        81 1 . . . . . . . 5.46 1 2 
        82 1 . . . . . . .  5.5 1 2 
        83 1 . . . . . . . 4.44 1 2 
        84 1 . . . . . . . 4.21 1 2 
        85 1 . . . . . . .  3.2 1 2 
        86 1 . . . . . . . 5.09 1 2 
        87 1 . . . . . . .  5.5 1 2 
        88 1 . . . . . . . 4.88 1 2 
        89 1 . . . . . . . 3.16 1 2 
        90 1 . . . . . . . 4.75 1 2 
        91 1 . . . . . . . 3.79 1 2 
        92 1 . . . . . . . 5.44 1 2 
        93 1 . . . . . . .  5.5 1 2 
        94 1 . . . . . . .  5.5 1 2 
        95 1 . . . . . . . 2.94 1 2 
        96 1 . . . . . . . 5.49 1 2 
        97 1 . . . . . . . 5.25 1 2 
        98 1 . . . . . . . 4.92 1 2 
        99 1 . . . . . . . 3.97 1 2 
       100 1 . . . . . . . 4.79 1 2 
       101 1 . . . . . . . 4.09 1 2 
       102 1 . . . . . . . 4.19 1 2 
       103 1 . . . . . . .  5.4 1 2 
       104 1 . . . . . . .  5.5 1 2 
       105 1 . . . . . . . 3.03 1 2 
       106 1 . . . . . . . 2.69 1 2 
       107 1 . . . . . . . 2.86 1 2 
       108 1 . . . . . . . 3.95 1 2 
       109 1 . . . . . . . 3.51 1 2 
       110 1 . . . . . . . 4.22 1 2 
       111 1 . . . . . . . 4.61 1 2 
       112 1 . . . . . . . 3.59 1 2 
       113 1 . . . . . . . 5.22 1 2 
       114 1 . . . . . . . 5.21 1 2 
       115 1 . . . . . . . 3.72 1 2 
       116 1 . . . . . . . 4.21 1 2 
       117 1 . . . . . . . 4.55 1 2 
       118 1 . . . . . . .  5.5 1 2 
       119 1 . . . . . . .  5.0 1 2 
       120 1 . . . . . . .  2.8 1 2 
       121 1 . . . . . . . 3.57 1 2 
       122 1 . . . . . . . 4.72 1 2 
       123 1 . . . . . . . 5.45 1 2 
       124 1 . . . . . . . 3.01 1 2 
       125 1 . . . . . . .  4.6 1 2 
       126 1 . . . . . . .  5.5 1 2 
       127 1 . . . . . . . 3.34 1 2 
       128 1 . . . . . . .  5.5 1 2 
       129 1 . . . . . . . 3.88 1 2 
       130 1 . . . . . . . 2.89 1 2 
       131 1 . . . . . . . 4.61 1 2 
       132 1 . . . . . . . 5.49 1 2 
       133 1 . . . . . . . 4.13 1 2 
       134 1 . . . . . . . 4.14 1 2 
       135 1 . . . . . . . 3.89 1 2 
       136 1 . . . . . . . 3.48 1 2 
       137 1 . . . . . . . 5.49 1 2 
       138 1 . . . . . . . 2.94 1 2 
       139 1 . . . . . . . 2.97 1 2 
       140 1 . . . . . . . 2.67 1 2 
       141 1 . . . . . . . 3.28 1 2 
       142 1 . . . . . . . 4.35 1 2 
       143 1 . . . . . . . 3.23 1 2 
       144 1 . . . . . . .  5.5 1 2 
       145 1 . . . . . . . 3.98 1 2 
       146 1 . . . . . . . 2.91 1 2 
       147 1 . . . . . . .  5.5 1 2 
       148 1 . . . . . . .  5.5 1 2 
       149 1 . . . . . . . 2.67 1 2 
       150 1 . . . . . . . 4.44 1 2 
       151 1 . . . . . . . 4.51 1 2 
       152 1 . . . . . . . 2.79 1 2 
       153 1 . . . . . . . 3.59 1 2 
       154 1 . . . . . . . 3.25 1 2 
       155 1 . . . . . . . 3.62 1 2 
       156 1 . . . . . . . 2.86 1 2 
       157 1 . . . . . . . 3.84 1 2 
       158 1 . . . . . . . 3.87 1 2 
       159 1 . . . . . . .  5.5 1 2 
       160 1 . . . . . . . 2.97 1 2 
       161 1 . . . . . . . 2.94 1 2 
       162 1 . . . . . . . 4.21 1 2 
       163 1 . . . . . . . 4.28 1 2 
       164 1 . . . . . . . 2.88 1 2 
       165 1 . . . . . . .  3.5 1 2 
       166 1 . . . . . . . 3.51 1 2 
       167 1 . . . . . . . 4.22 1 2 
       168 1 . . . . . . . 2.58 1 2 
       169 1 . . . . . . . 3.19 1 2 
       170 1 . . . . . . . 4.07 1 2 
       171 1 . . . . . . . 4.62 1 2 
       172 1 . . . . . . . 3.95 1 2 
       173 1 . . . . . . . 5.04 1 2 
       174 1 . . . . . . . 2.85 1 2 
       175 1 . . . . . . . 3.78 1 2 
       176 1 . . . . . . .  3.6 1 2 
       177 1 . . . . . . . 4.19 1 2 
       178 1 . . . . . . . 3.73 1 2 
       179 1 . . . . . . . 4.38 1 2 
       180 1 . . . . . . . 2.77 1 2 
       181 1 . . . . . . . 3.79 1 2 
       182 1 . . . . . . . 3.34 1 2 
       183 1 . . . . . . . 4.59 1 2 
       184 1 . . . . . . . 5.24 1 2 
       185 1 . . . . . . .  5.5 1 2 
       186 1 . . . . . . . 4.59 1 2 
       187 1 . . . . . . . 3.06 1 2 
       188 1 . . . . . . .  4.6 1 2 
       189 1 . . . . . . . 2.52 1 2 
       190 1 . . . . . . . 4.95 1 2 
       191 1 . . . . . . .  4.1 1 2 
       192 1 . . . . . . . 4.55 1 2 
       193 1 . . . . . . . 3.57 1 2 
       194 1 . . . . . . . 3.04 1 2 
       195 1 . . . . . . . 4.21 1 2 
       196 1 . . . . . . .  5.5 1 2 
       197 1 . . . . . . .  5.5 1 2 
       198 1 . . . . . . . 4.39 1 2 
       199 1 . . . . . . . 3.87 1 2 
       200 1 . . . . . . . 2.94 1 2 
       201 1 . . . . . . . 5.18 1 2 
       202 1 . . . . . . . 5.26 1 2 
       203 1 . . . . . . . 5.01 1 2 
       204 1 . . . . . . . 5.25 1 2 
       205 1 . . . . . . . 5.25 1 2 
       206 1 . . . . . . .  4.4 1 2 
       207 1 . . . . . . . 4.74 1 2 
       208 1 . . . . . . . 4.66 1 2 
       209 1 . . . . . . . 2.96 1 2 
       210 1 . . . . . . . 4.33 1 2 
       211 1 . . . . . . . 4.05 1 2 
       212 1 . . . . . . . 4.23 1 2 
       213 1 . . . . . . . 3.08 1 2 
       214 1 . . . . . . . 3.88 1 2 
       215 1 . . . . . . . 4.04 1 2 
       216 1 . . . . . . . 4.04 1 2 
       217 1 . . . . . . . 3.23 1 2 
       218 1 . . . . . . . 3.63 1 2 
       219 1 . . . . . . . 3.11 1 2 
       220 1 . . . . . . . 3.37 1 2 
       221 1 . . . . . . .  3.5 1 2 
       222 1 . . . . . . . 4.18 1 2 
       223 1 . . . . . . . 4.47 1 2 
       224 1 . . . . . . . 4.72 1 2 
       225 1 . . . . . . .  2.5 1 2 
       226 1 . . . . . . . 3.66 1 2 
       227 1 . . . . . . . 4.23 1 2 
       228 1 . . . . . . . 4.14 1 2 
       229 1 . . . . . . . 2.83 1 2 
       230 1 . . . . . . .  5.5 1 2 
       231 1 . . . . . . . 3.41 1 2 
       232 1 . . . . . . . 4.84 1 2 
       233 1 . . . . . . . 5.19 1 2 
       234 1 . . . . . . .  5.4 1 2 
       235 1 . . . . . . . 4.68 1 2 
       236 1 . . . . . . . 4.96 1 2 
       237 1 . . . . . . . 4.47 1 2 
       238 1 . . . . . . . 4.75 1 2 
       239 1 . . . . . . .  2.7 1 2 
       240 1 . . . . . . .  3.5 1 2 
       241 1 . . . . . . . 2.75 1 2 
       242 1 . . . . . . . 2.76 1 2 
       243 1 . . . . . . . 4.42 1 2 
       244 1 . . . . . . . 3.09 1 2 
       245 1 . . . . . . .  3.3 1 2 
       246 1 . . . . . . . 4.54 1 2 
       247 1 . . . . . . . 4.54 1 2 
       248 1 . . . . . . . 2.83 1 2 
       249 1 . . . . . . . 3.52 1 2 
       250 1 . . . . . . . 4.56 1 2 
       251 1 . . . . . . . 4.42 1 2 
       252 1 . . . . . . . 4.26 1 2 
       253 1 . . . . . . . 4.66 1 2 
       254 1 . . . . . . . 4.76 1 2 
       255 1 . . . . . . . 5.29 1 2 
       256 1 . . . . . . .  4.0 1 2 
       257 1 . . . . . . . 3.82 1 2 
       258 1 . . . . . . . 3.28 1 2 
       259 1 . . . . . . . 4.67 1 2 
       260 1 . . . . . . . 5.49 1 2 
       261 1 . . . . . . . 4.86 1 2 
       262 1 . . . . . . . 3.87 1 2 
       263 1 . . . . . . . 4.92 1 2 
       264 1 . . . . . . . 2.93 1 2 
       265 1 . . . . . . . 4.98 1 2 
       266 1 . . . . . . . 4.98 1 2 
       267 1 . . . . . . . 2.93 1 2 
       268 1 . . . . . . . 5.05 1 2 
       269 1 . . . . . . . 4.03 1 2 
       270 1 . . . . . . . 2.97 1 2 
       271 1 . . . . . . . 3.41 1 2 
       272 1 . . . . . . . 4.47 1 2 
       273 1 . . . . . . .  3.7 1 2 
       274 1 . . . . . . .  3.7 1 2 
       275 1 . . . . . . . 2.76 1 2 
       276 1 . . . . . . . 2.66 1 2 
       277 1 . . . . . . . 3.13 1 2 
       278 1 . . . . . . . 4.67 1 2 
       279 1 . . . . . . . 4.74 1 2 
       280 1 . . . . . . . 4.93 1 2 
       281 1 . . . . . . . 4.13 1 2 
       282 1 . . . . . . . 3.57 1 2 
       283 1 . . . . . . . 2.91 1 2 
       284 1 . . . . . . . 2.51 1 2 
       285 1 . . . . . . . 3.93 1 2 
       286 1 . . . . . . . 2.83 1 2 
       287 1 . . . . . . . 4.73 1 2 
       288 1 . . . . . . . 2.59 1 2 
       289 1 . . . . . . . 5.48 1 2 
       290 1 . . . . . . . 3.32 1 2 
       291 1 . . . . . . . 3.11 1 2 
       292 1 . . . . . . . 4.68 1 2 
       293 1 . . . . . . . 4.38 1 2 
       294 1 . . . . . . . 4.75 1 2 
       295 1 . . . . . . . 4.85 1 2 
       296 1 . . . . . . . 3.94 1 2 
       297 1 . . . . . . . 4.03 1 2 
       298 1 . . . . . . . 4.64 1 2 
       299 1 . . . . . . . 4.64 1 2 
       300 1 . . . . . . .  2.8 1 2 
       301 1 . . . . . . . 3.54 1 2 
       302 1 . . . . . . . 5.45 1 2 
       303 1 . . . . . . . 4.99 1 2 
       304 1 . . . . . . . 4.79 1 2 
       305 1 . . . . . . . 5.14 1 2 
       306 1 . . . . . . . 4.52 1 2 
       307 1 . . . . . . . 4.78 1 2 
       308 1 . . . . . . . 2.95 1 2 
       309 1 . . . . . . .  5.5 1 2 
       310 1 . . . . . . . 4.59 1 2 
       311 1 . . . . . . . 4.92 1 2 
       312 1 . . . . . . . 3.38 1 2 
       313 1 . . . . . . . 5.24 1 2 
       314 1 . . . . . . . 5.24 1 2 
       315 1 . . . . . . . 5.06 1 2 
       316 1 . . . . . . . 5.06 1 2 
       317 1 . . . . . . . 5.18 1 2 
       318 1 . . . . . . .  5.5 1 2 
       319 1 . . . . . . . 4.71 1 2 
       320 1 . . . . . . . 4.74 1 2 
       321 1 . . . . . . . 5.29 1 2 
       322 1 . . . . . . . 5.47 1 2 
       323 1 . . . . . . . 3.38 1 2 
       324 1 . . . . . . .  5.1 1 2 
       325 1 . . . . . . . 4.51 1 2 
       326 1 . . . . . . . 3.32 1 2 
       327 1 . . . . . . . 4.86 1 2 
       328 1 . . . . . . . 4.07 1 2 
       329 1 . . . . . . . 3.84 1 2 
       330 1 . . . . . . . 4.82 1 2 
       331 1 . . . . . . . 4.61 1 2 
       332 1 . . . . . . . 3.58 1 2 
       333 1 . . . . . . . 3.69 1 2 
       334 1 . . . . . . . 3.05 1 2 
       335 1 . . . . . . .  5.5 1 2 
       336 1 . . . . . . . 4.26 1 2 
       337 1 . . . . . . . 4.92 1 2 
       338 1 . . . . . . . 4.76 1 2 
       339 1 . . . . . . . 3.72 1 2 
       340 1 . . . . . . . 4.03 1 2 
       341 1 . . . . . . . 3.91 1 2 
       342 1 . . . . . . . 3.84 1 2 
       343 1 . . . . . . . 3.95 1 2 
       344 1 . . . . . . . 3.34 1 2 
       345 1 . . . . . . . 3.27 1 2 
       346 1 . . . . . . . 3.44 1 2 
       347 1 . . . . . . . 3.69 1 2 
       348 1 . . . . . . . 4.08 1 2 
       349 1 . . . . . . . 3.85 1 2 
       350 1 . . . . . . . 4.66 1 2 
       351 1 . . . . . . .  5.5 1 2 
       352 1 . . . . . . .  5.5 1 2 
       353 1 . . . . . . .  5.5 1 2 
       354 1 . . . . . . . 4.58 1 2 
       355 1 . . . . . . . 4.11 1 2 
       356 1 . . . . . . . 4.71 1 2 
       357 1 . . . . . . . 4.88 1 2 
       358 1 . . . . . . . 3.62 1 2 
       359 1 . . . . . . . 3.85 1 2 
       360 1 . . . . . . . 4.42 1 2 
       361 1 . . . . . . . 5.08 1 2 
       362 1 . . . . . . . 4.19 1 2 
       363 1 . . . . . . .  3.8 1 2 
       364 1 . . . . . . . 4.58 1 2 
       365 1 . . . . . . . 4.01 1 2 
       366 1 . . . . . . . 4.26 1 2 
       367 1 . . . . . . . 4.36 1 2 
       368 1 . . . . . . .  3.9 1 2 
       369 1 . . . . . . . 3.77 1 2 
       370 1 . . . . . . . 3.99 1 2 
       371 1 . . . . . . . 4.46 1 2 
       372 1 . . . . . . .  4.6 1 2 
       373 1 . . . . . . .  4.2 1 2 
       374 1 . . . . . . . 4.76 1 2 
       375 1 . . . . . . . 4.24 1 2 
       376 1 . . . . . . . 5.42 1 2 
       377 1 . . . . . . . 3.81 1 2 
       378 1 . . . . . . . 4.56 1 2 
       379 1 . . . . . . . 4.93 1 2 
       380 1 . . . . . . . 4.81 1 2 
       381 1 . . . . . . . 4.06 1 2 
       382 1 . . . . . . . 3.78 1 2 
       383 1 . . . . . . . 4.46 1 2 
       384 1 . . . . . . . 3.55 1 2 
       385 1 . . . . . . . 3.76 1 2 
       386 1 . . . . . . .  3.3 1 2 
       387 1 . . . . . . .  4.2 1 2 
       388 1 . . . . . . . 3.52 1 2 
       389 1 . . . . . . . 3.47 1 2 
       390 1 . . . . . . . 3.24 1 2 
       391 1 . . . . . . . 5.33 1 2 
       392 1 . . . . . . . 4.76 1 2 
       393 1 . . . . . . . 5.05 1 2 
       394 1 . . . . . . . 3.84 1 2 
       395 1 . . . . . . . 3.84 1 2 
       396 1 . . . . . . . 4.23 1 2 
       397 1 . . . . . . . 4.75 1 2 
       398 1 . . . . . . . 3.31 1 2 
       399 1 . . . . . . . 4.95 1 2 
       400 1 . . . . . . . 3.66 1 2 
       401 1 . . . . . . .  4.5 1 2 
       402 1 . . . . . . . 4.49 1 2 
       403 1 . . . . . . . 3.82 1 2 
       404 1 . . . . . . . 4.93 1 2 
       405 1 . . . . . . . 4.58 1 2 
       406 1 . . . . . . .  4.1 1 2 
       407 1 . . . . . . . 4.06 1 2 
       408 1 . . . . . . . 3.64 1 2 
       409 1 . . . . . . . 3.97 1 2 
       410 1 . . . . . . . 4.13 1 2 
       411 1 . . . . . . . 4.96 1 2 
       412 1 . . . . . . . 3.37 1 2 
       413 1 . . . . . . . 4.68 1 2 
       414 1 . . . . . . . 3.54 1 2 
       415 1 . . . . . . . 3.54 1 2 
       416 1 . . . . . . . 4.27 1 2 
       417 1 . . . . . . . 4.46 1 2 
       418 1 . . . . . . . 4.21 1 2 
       419 1 . . . . . . . 4.77 1 2 
       420 1 . . . . . . . 3.32 1 2 
       421 1 . . . . . . . 3.51 1 2 
       422 1 . . . . . . . 3.85 1 2 
       423 1 . . . . . . . 4.47 1 2 
       424 1 . . . . . . . 4.25 1 2 
       425 1 . . . . . . . 4.81 1 2 
       426 1 . . . . . . . 4.92 1 2 
       427 1 . . . . . . . 5.06 1 2 
       428 1 . . . . . . . 4.41 1 2 
       429 1 . . . . . . . 3.47 1 2 
       430 1 . . . . . . . 3.32 1 2 
       431 1 . . . . . . . 4.07 1 2 
       432 1 . . . . . . . 4.88 1 2 
       433 1 . . . . . . . 4.72 1 2 
       434 1 . . . . . . . 4.41 1 2 
       435 1 . . . . . . . 3.92 1 2 
       436 1 . . . . . . . 4.63 1 2 
       437 1 . . . . . . . 4.18 1 2 
       438 1 . . . . . . . 4.65 1 2 
       439 1 . . . . . . . 3.99 1 2 
       440 1 . . . . . . . 4.55 1 2 
       441 1 . . . . . . . 5.46 1 2 
       442 1 . . . . . . .  5.1 1 2 
       443 1 . . . . . . .  3.5 1 2 
       444 1 . . . . . . . 4.49 1 2 
       445 1 . . . . . . . 4.25 1 2 
       446 1 . . . . . . . 4.02 1 2 
       447 1 . . . . . . . 3.34 1 2 
       448 1 . . . . . . . 3.71 1 2 
       449 1 . . . . . . . 4.95 1 2 
       450 1 . . . . . . . 5.27 1 2 
       451 1 . . . . . . . 4.46 1 2 
       452 1 . . . . . . .  5.5 1 2 
       453 1 . . . . . . .  5.5 1 2 
       454 1 . . . . . . . 4.22 1 2 
       455 1 . . . . . . . 4.91 1 2 
       456 1 . . . . . . . 3.94 1 2 
       457 1 . . . . . . . 4.81 1 2 
       458 1 . . . . . . . 3.89 1 2 
       459 1 . . . . . . .  3.3 1 2 
       460 1 . . . . . . . 5.42 1 2 
       461 1 . . . . . . . 5.25 1 2 
       462 1 . . . . . . . 3.29 1 2 
       463 1 . . . . . . . 5.34 1 2 
       464 1 . . . . . . .  5.5 1 2 
       465 1 . . . . . . . 3.93 1 2 
       466 1 . . . . . . . 3.54 1 2 
       467 1 . . . . . . .  4.5 1 2 
       468 1 . . . . . . . 5.26 1 2 
       469 1 . . . . . . .  3.9 1 2 
       470 1 . . . . . . . 4.81 1 2 
       471 1 . . . . . . . 4.58 1 2 
       472 1 . . . . . . . 5.04 1 2 
       473 1 . . . . . . . 3.56 1 2 
       474 1 . . . . . . . 4.33 1 2 
       475 1 . . . . . . . 4.73 1 2 
       476 1 . . . . . . . 5.07 1 2 
       477 1 . . . . . . . 5.09 1 2 
       478 1 . . . . . . .  5.5 1 2 
       479 1 . . . . . . . 5.09 1 2 
       480 1 . . . . . . . 4.79 1 2 
       481 1 . . . . . . .  3.5 1 2 
       482 1 . . . . . . . 5.02 1 2 
       483 1 . . . . . . . 5.38 1 2 
       484 1 . . . . . . .  4.9 1 2 
       485 1 . . . . . . .  4.0 1 2 
       486 1 . . . . . . . 4.72 1 2 
       487 1 . . . . . . . 3.48 1 2 
       488 1 . . . . . . . 4.13 1 2 
       489 1 . . . . . . . 4.13 1 2 
       490 1 . . . . . . . 3.79 1 2 
       491 1 . . . . . . . 3.79 1 2 
       492 1 . . . . . . . 3.95 1 2 
       493 1 . . . . . . . 4.53 1 2 
       494 1 . . . . . . . 4.53 1 2 
       495 1 . . . . . . . 4.88 1 2 
       496 1 . . . . . . . 3.42 1 2 
       497 1 . . . . . . . 4.86 1 2 
       498 1 . . . . . . . 4.03 1 2 
       499 1 . . . . . . . 4.29 1 2 
       500 1 . . . . . . . 3.13 1 2 
       501 1 . . . . . . . 3.84 1 2 
       502 1 . . . . . . . 4.71 1 2 
       503 1 . . . . . . . 3.56 1 2 
       504 1 . . . . . . . 4.04 1 2 
       505 1 . . . . . . . 4.76 1 2 
       506 1 . . . . . . . 5.01 1 2 
       507 1 . . . . . . . 3.43 1 2 
       508 1 . . . . . . .  4.7 1 2 
       509 1 . . . . . . . 2.98 1 2 
       510 1 . . . . . . . 3.87 1 2 
       511 1 . . . . . . . 3.87 1 2 
       512 1 . . . . . . . 4.24 1 2 
       513 1 . . . . . . . 3.74 1 2 
       514 1 . . . . . . . 4.12 1 2 
       515 1 . . . . . . . 4.13 1 2 
       516 1 . . . . . . . 4.92 1 2 
       517 1 . . . . . . . 4.27 1 2 
       518 1 . . . . . . . 4.74 1 2 
       519 1 . . . . . . . 4.45 1 2 
       520 1 . . . . . . . 3.47 1 2 
       521 1 . . . . . . . 5.06 1 2 
       522 1 . . . . . . . 3.94 1 2 
       523 1 . . . . . . . 3.99 1 2 
       524 1 . . . . . . . 4.44 1 2 
       525 1 . . . . . . . 3.94 1 2 
       526 1 . . . . . . . 4.41 1 2 
       527 1 . . . . . . . 4.78 1 2 
       528 1 . . . . . . . 4.34 1 2 
       529 1 . . . . . . . 4.83 1 2 
       530 1 . . . . . . . 4.24 1 2 
       531 1 . . . . . . . 4.83 1 2 
       532 1 . . . . . . . 5.07 1 2 
       533 1 . . . . . . . 4.56 1 2 
       534 1 . . . . . . . 4.73 1 2 
       535 1 . . . . . . .  5.2 1 2 
       536 1 . . . . . . . 4.86 1 2 
       537 1 . . . . . . . 2.77 1 2 
       538 1 . . . . . . . 4.64 1 2 
       539 1 . . . . . . . 3.45 1 2 
       540 1 . . . . . . . 4.83 1 2 
       541 1 . . . . . . . 4.31 1 2 
       542 1 . . . . . . . 5.27 1 2 
       543 1 . . . . . . .  5.5 1 2 
       544 1 . . . . . . . 4.42 1 2 
       545 1 . . . . . . . 5.06 1 2 
       546 1 . . . . . . . 3.69 1 2 
       547 1 . . . . . . . 4.15 1 2 
       548 1 . . . . . . . 4.69 1 2 
       549 1 . . . . . . .  3.8 1 2 
       550 1 . . . . . . . 3.83 1 2 
       551 1 . . . . . . . 3.83 1 2 
       552 1 . . . . . . . 4.87 1 2 
       553 1 . . . . . . . 3.94 1 2 
       554 1 . . . . . . . 4.36 1 2 
       555 1 . . . . . . . 4.62 1 2 
       556 1 . . . . . . . 5.11 1 2 
       557 1 . . . . . . . 4.77 1 2 
       558 1 . . . . . . . 4.35 1 2 
       559 1 . . . . . . . 4.58 1 2 
       560 1 . . . . . . . 4.71 1 2 
       561 1 . . . . . . .  3.9 1 2 
       562 1 . . . . . . . 3.45 1 2 
       563 1 . . . . . . . 5.14 1 2 
       564 1 . . . . . . .  4.7 1 2 
       565 1 . . . . . . . 3.97 1 2 
       566 1 . . . . . . . 4.63 1 2 
       567 1 . . . . . . . 4.51 1 2 
       568 1 . . . . . . . 3.88 1 2 
       569 1 . . . . . . . 4.99 1 2 
       570 1 . . . . . . . 4.99 1 2 
       571 1 . . . . . . . 4.69 1 2 
       572 1 . . . . . . . 4.88 1 2 
       573 1 . . . . . . . 4.79 1 2 
       574 1 . . . . . . . 4.61 1 2 
       575 1 . . . . . . . 3.98 1 2 
       576 1 . . . . . . . 4.11 1 2 
       577 1 . . . . . . .  5.1 1 2 
       578 1 . . . . . . . 4.79 1 2 
       579 1 . . . . . . . 4.84 1 2 
       580 1 . . . . . . . 5.35 1 2 
       581 1 . . . . . . . 4.25 1 2 
       582 1 . . . . . . . 4.23 1 2 
       583 1 . . . . . . . 5.13 1 2 
       584 1 . . . . . . .  3.9 1 2 
       585 1 . . . . . . . 4.49 1 2 
       586 1 . . . . . . .  4.1 1 2 
       587 1 . . . . . . . 3.58 1 2 
       588 1 . . . . . . . 4.99 1 2 
       589 1 . . . . . . . 4.74 1 2 
       590 1 . . . . . . . 4.62 1 2 
       591 1 . . . . . . . 3.34 1 2 
       592 1 . . . . . . . 2.88 1 2 
       593 1 . . . . . . . 3.43 1 2 
       594 1 . . . . . . . 4.65 1 2 
       595 1 . . . . . . . 3.31 1 2 
       596 1 . . . . . . . 4.34 1 2 
       597 1 . . . . . . . 4.04 1 2 
       598 1 . . . . . . . 4.96 1 2 
       599 1 . . . . . . . 4.07 1 2 
       600 1 . . . . . . . 4.83 1 2 
       601 1 . . . . . . . 4.57 1 2 
       602 1 . . . . . . . 4.52 1 2 
       603 1 . . . . . . . 4.29 1 2 
       604 1 . . . . . . . 4.83 1 2 
       605 1 . . . . . . . 5.05 1 2 
       606 1 . . . . . . . 3.56 1 2 
       607 1 . . . . . . . 3.56 1 2 
       608 1 . . . . . . . 4.61 1 2 
       609 1 . . . . . . . 4.61 1 2 
       610 1 . . . . . . . 3.66 1 2 
       611 1 . . . . . . . 4.98 1 2 
       612 1 . . . . . . . 5.05 1 2 
       613 1 . . . . . . . 4.94 1 2 
       614 1 . . . . . . . 5.32 1 2 
       615 1 . . . . . . . 4.76 1 2 
       616 1 . . . . . . . 5.13 1 2 
       617 1 . . . . . . . 4.67 1 2 
       618 1 . . . . . . . 4.58 1 2 
       619 1 . . . . . . . 4.22 1 2 
       620 1 . . . . . . . 4.43 1 2 
       621 1 . . . . . . . 4.47 1 2 
       622 1 . . . . . . . 4.11 1 2 
       623 1 . . . . . . . 4.11 1 2 
       624 1 . . . . . . . 4.96 1 2 
       625 1 . . . . . . . 4.82 1 2 
       626 1 . . . . . . . 3.02 1 2 
       627 1 . . . . . . .  4.4 1 2 
       628 1 . . . . . . . 4.23 1 2 
       629 1 . . . . . . . 3.54 1 2 
       630 1 . . . . . . . 4.52 1 2 
       631 1 . . . . . . .  3.9 1 2 
       632 1 . . . . . . . 4.19 1 2 
       633 1 . . . . . . . 3.57 1 2 
       634 1 . . . . . . . 4.89 1 2 
       635 1 . . . . . . .  5.2 1 2 
       636 1 . . . . . . .  4.1 1 2 
       637 1 . . . . . . . 4.89 1 2 
       638 1 . . . . . . . 4.16 1 2 
       639 1 . . . . . . . 4.44 1 2 
       640 1 . . . . . . . 4.34 1 2 
       641 1 . . . . . . . 3.87 1 2 
       642 1 . . . . . . . 4.27 1 2 
       643 1 . . . . . . . 3.17 1 2 
       644 1 . . . . . . . 4.92 1 2 
       645 1 . . . . . . . 3.92 1 2 
       646 1 . . . . . . . 5.34 1 2 
       647 1 . . . . . . . 4.92 1 2 
       648 1 . . . . . . . 4.81 1 2 
       649 1 . . . . . . . 4.06 1 2 
       650 1 . . . . . . . 2.96 1 2 
       651 1 . . . . . . .  4.3 1 2 
       652 1 . . . . . . .  4.4 1 2 
       653 1 . . . . . . . 4.44 1 2 
       654 1 . . . . . . . 3.83 1 2 
       655 1 . . . . . . .  5.3 1 2 
       656 1 . . . . . . . 5.34 1 2 
       657 1 . . . . . . . 5.34 1 2 
       658 1 . . . . . . .  4.1 1 2 
       659 1 . . . . . . . 4.75 1 2 
       660 1 . . . . . . . 3.07 1 2 
       661 1 . . . . . . . 5.34 1 2 
       662 1 . . . . . . . 3.03 1 2 
       663 1 . . . . . . . 4.81 1 2 
       664 1 . . . . . . . 5.31 1 2 
       665 1 . . . . . . . 4.57 1 2 
       666 1 . . . . . . . 3.44 1 2 
       667 1 . . . . . . . 3.59 1 2 
       668 1 . . . . . . . 3.71 1 2 
       669 1 . . . . . . . 3.97 1 2 
       670 1 . . . . . . . 4.25 1 2 
       671 1 . . . . . . . 2.73 1 2 
       672 1 . . . . . . . 3.36 1 2 
       673 1 . . . . . . . 4.81 1 2 
       674 1 . . . . . . . 4.26 1 2 
       675 1 . . . . . . . 3.58 1 2 
       676 1 . . . . . . . 4.02 1 2 
       677 1 . . . . . . . 5.34 1 2 
       678 1 . . . . . . .  4.5 1 2 
       679 1 . . . . . . . 3.71 1 2 
       680 1 . . . . . . .  3.5 1 2 
       681 1 . . . . . . . 4.16 1 2 
       682 1 . . . . . . . 3.85 1 2 
       683 1 . . . . . . . 4.52 1 2 
       684 1 . . . . . . . 3.95 1 2 
       685 1 . . . . . . . 5.34 1 2 
       686 1 . . . . . . . 4.92 1 2 
       687 1 . . . . . . . 5.34 1 2 
       688 1 . . . . . . . 2.84 1 2 
       689 1 . . . . . . . 3.26 1 2 
       690 1 . . . . . . . 4.28 1 2 
       691 1 . . . . . . . 4.16 1 2 
       692 1 . . . . . . . 2.89 1 2 
       693 1 . . . . . . . 4.68 1 2 
       694 1 . . . . . . . 4.09 1 2 
       695 1 . . . . . . . 3.35 1 2 
       696 1 . . . . . . . 4.52 1 2 
       697 1 . . . . . . . 3.14 1 2 
       698 1 . . . . . . . 3.81 1 2 
       699 1 . . . . . . . 3.51 1 2 
       700 1 . . . . . . . 3.11 1 2 
    stop_

save_


save_DYANA/DIANA_dihedral_5
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

        1 CHI1 1 1 15 CYS N 1 1 15 CYS CA 1 1 15 CYS CB 1 1 15 CYS SG     150.0      210.0 . 15 CYSS . . 15 CYSS . . 15 CYSS . . 15 CYSS . 1 1 
        2 CHI1 1 1 18 CYS N 1 1 18 CYS CA 1 1 18 CYS CB 1 1 18 CYS SG      30.0   89.99999 . 18 CYSS . . 18 CYSS . . 18 CYSS . . 18 CYSS . 1 1 
        3 CHI1 1 1 31 HIS N 1 1 31 HIS CA 1 1 31 HIS CB 1 1 31 HIS CG     150.0      210.0 . 31 HIS  . . 31 HIS  . . 31 HIS  . . 31 HIS  . 1 1 
        4 CHI1 1 1 35 HIS N 1 1 35 HIS CA 1 1 35 HIS CB 1 1 35 HIS CG -89.99999      -30.0 . 35 HIS  . . 35 HIS  . . 35 HIS  . . 35 HIS  . 1 1 
        5 PHI  1 1 24 ARG C 1 1 25 ASN N  1 1 25 ASN CA 1 1 25 ASN C      -92.0      -32.0 . 25 ASN  . . 25 ASN  . . 25 ASN  . . 25 ASN  . 1 1 
        6 PSI  1 1 25 ASN N 1 1 25 ASN CA 1 1 25 ASN C  1 1 26 SER N      -65.0       -5.0 . 25 ASN  . . 25 ASN  . . 25 ASN  . . 25 ASN  . 1 1 
        7 PHI  1 1 25 ASN C 1 1 26 SER N  1 1 26 SER CA 1 1 26 SER C      -92.0      -32.0 . 26 SER  . . 26 SER  . . 26 SER  . . 26 SER  . 1 1 
        8 PSI  1 1 26 SER N 1 1 26 SER CA 1 1 26 SER C  1 1 27 GLN N      -72.0 -11.999999 . 26 SER  . . 26 SER  . . 26 SER  . . 26 SER  . 1 1 
        9 PHI  1 1 26 SER C 1 1 27 GLN N  1 1 27 GLN CA 1 1 27 GLN C      -94.0      -34.0 . 27 GLN  . . 27 GLN  . . 27 GLN  . . 27 GLN  . 1 1 
       10 PSI  1 1 27 GLN N 1 1 27 GLN CA 1 1 27 GLN C  1 1 28 LEU N      -73.0      -13.0 . 27 GLN  . . 27 GLN  . . 27 GLN  . . 27 GLN  . 1 1 
       11 PHI  1 1 27 GLN C 1 1 28 LEU N  1 1 28 LEU CA 1 1 28 LEU C      -95.0      -35.0 . 28 LEU  . . 28 LEU  . . 28 LEU  . . 28 LEU  . 1 1 
       12 PSI  1 1 28 LEU N 1 1 28 LEU CA 1 1 28 LEU C  1 1 29 ILE N      -70.0      -10.0 . 28 LEU  . . 28 LEU  . . 28 LEU  . . 28 LEU  . 1 1 
       13 PHI  1 1 28 LEU C 1 1 29 ILE N  1 1 29 ILE CA 1 1 29 ILE C  -89.99999      -30.0 . 29 ILE  . . 29 ILE  . . 29 ILE  . . 29 ILE  . 1 1 
       14 PSI  1 1 29 ILE N 1 1 29 ILE CA 1 1 29 ILE C  1 1 30 VAL N      -71.0      -11.0 . 29 ILE  . . 29 ILE  . . 29 ILE  . . 29 ILE  . 1 1 
       15 PHI  1 1 29 ILE C 1 1 30 VAL N  1 1 30 VAL CA 1 1 30 VAL C      -95.0      -35.0 . 30 VAL  . . 30 VAL  . . 30 VAL  . . 30 VAL  . 1 1 
       16 PSI  1 1 30 VAL N 1 1 30 VAL CA 1 1 30 VAL C  1 1 31 HIS N      -73.0      -13.0 . 30 VAL  . . 30 VAL  . . 30 VAL  . . 30 VAL  . 1 1 
       17 PHI  1 1 30 VAL C 1 1 31 HIS N  1 1 31 HIS CA 1 1 31 HIS C      -94.0      -34.0 . 31 HIS  . . 31 HIS  . . 31 HIS  . . 31 HIS  . 1 1 
       18 PSI  1 1 31 HIS N 1 1 31 HIS CA 1 1 31 HIS C  1 1 32 GLN N      -69.0       -9.0 . 31 HIS  . . 31 HIS  . . 31 HIS  . . 31 HIS  . 1 1 
       19 PHI  1 1 31 HIS C 1 1 32 GLN N  1 1 32 GLN CA 1 1 32 GLN C      -93.0      -33.0 . 32 GLN  . . 32 GLN  . . 32 GLN  . . 32 GLN  . 1 1 
       20 PSI  1 1 32 GLN N 1 1 32 GLN CA 1 1 32 GLN C  1 1 33 ARG N      -69.0       -9.0 . 32 GLN  . . 32 GLN  . . 32 GLN  . . 32 GLN  . 1 1 
       21 PHI  1 1 32 GLN C 1 1 33 ARG N  1 1 33 ARG CA 1 1 33 ARG C  -95.99999      -36.0 . 33 ARG  . . 33 ARG  . . 33 ARG  . . 33 ARG  . 1 1 
       22 PSI  1 1 33 ARG N 1 1 33 ARG CA 1 1 33 ARG C  1 1 34 THR N      -65.0       -5.0 . 33 ARG  . . 33 ARG  . . 33 ARG  . . 33 ARG  . 1 1 
       23 PHI  1 1 33 ARG C 1 1 34 THR N  1 1 34 THR CA 1 1 34 THR C  -95.99999      -36.0 . 34 THR  . . 34 THR  . . 34 THR  . . 34 THR  . 1 1 
       24 PSI  1 1 34 THR N 1 1 34 THR CA 1 1 34 THR C  1 1 35 HIS N      -63.0 -2.9999998 . 34 THR  . . 34 THR  . . 34 THR  . . 34 THR  . 1 1 
       25 PHI  1 1 34 THR C 1 1 35 HIS N  1 1 35 HIS CA 1 1 35 HIS C     -123.0      -63.0 . 35 HIS  . . 35 HIS  . . 35 HIS  . . 35 HIS  . 1 1 
       26 PSI  1 1 35 HIS N 1 1 35 HIS CA 1 1 35 HIS C  1 1 36 SER N      -41.0       19.0 . 35 HIS  . . 35 HIS  . . 35 HIS  . . 35 HIS  . 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1  1 GLY C    C   21.620  11.208  -7.519 1.00 . A A .   1 GLY C    1 1 
        1     2 1 1  1 GLY CA   C   20.272  10.908  -8.144 1.00 . A A .   1 GLY CA   1 1 
        1     3 1 1  1 GLY H1   H   20.190  12.644  -9.353 1.00 . A A .   1 GLY H1   1 1 
        1     4 1 1  1 GLY HA2  H   19.610  10.526  -7.381 1.00 . A A .   1 GLY HA2  1 1 
        1     5 1 1  1 GLY HA3  H   20.402  10.152  -8.905 1.00 . A A .   1 GLY HA3  1 1 
        1     6 1 1  1 GLY N    N   19.665  12.080  -8.747 1.00 . A A .   1 GLY N    1 1 
        1     7 1 1  1 GLY O    O   22.661  10.850  -8.070 1.00 . A A .   1 GLY O    1 1 
        1     8 1 1  2 SER C    C   23.854  11.095  -5.763 1.00 . A A .   2 SER C    1 1 
        1     9 1 1  2 SER CA   C   22.832  12.224  -5.669 1.00 . A A .   2 SER CA   1 1 
        1    10 1 1  2 SER CB   C   22.538  12.541  -4.201 1.00 . A A .   2 SER CB   1 1 
        1    11 1 1  2 SER H    H   20.740  12.128  -5.977 1.00 . A A .   2 SER H    1 1 
        1    12 1 1  2 SER HA   H   23.241  13.104  -6.143 1.00 . A A .   2 SER HA   1 1 
        1    13 1 1  2 SER HB2  H   21.825  13.349  -4.145 1.00 . A A .   2 SER HB2  1 1 
        1    14 1 1  2 SER HB3  H   22.127  11.664  -3.722 1.00 . A A .   2 SER HB3  1 1 
        1    15 1 1  2 SER HG   H   23.502  13.150  -2.608 1.00 . A A .   2 SER HG   1 1 
        1    16 1 1  2 SER N    N   21.602  11.870  -6.366 1.00 . A A .   2 SER N    1 1 
        1    17 1 1  2 SER O    O   23.494   9.929  -5.924 1.00 . A A .   2 SER O    1 1 
        1    18 1 1  2 SER OG   O   23.718  12.925  -3.516 1.00 . A A .   2 SER OG   1 1 
        1    19 1 1  3 SER C    C   25.961   9.317  -4.768 1.00 . A A .   3 SER C    1 1 
        1    20 1 1  3 SER CA   C   26.206  10.469  -5.738 1.00 . A A .   3 SER CA   1 1 
        1    21 1 1  3 SER CB   C   27.552  11.131  -5.432 1.00 . A A .   3 SER CB   1 1 
        1    22 1 1  3 SER H    H   25.354  12.397  -5.533 1.00 . A A .   3 SER H    1 1 
        1    23 1 1  3 SER HA   H   26.227  10.079  -6.744 1.00 . A A .   3 SER HA   1 1 
        1    24 1 1  3 SER HB2  H   28.320  10.374  -5.388 1.00 . A A .   3 SER HB2  1 1 
        1    25 1 1  3 SER HB3  H   27.788  11.838  -6.214 1.00 . A A .   3 SER HB3  1 1 
        1    26 1 1  3 SER HG   H   27.146  12.694  -4.323 1.00 . A A .   3 SER HG   1 1 
        1    27 1 1  3 SER N    N   25.131  11.451  -5.661 1.00 . A A .   3 SER N    1 1 
        1    28 1 1  3 SER O    O   25.925   9.511  -3.553 1.00 . A A .   3 SER O    1 1 
        1    29 1 1  3 SER OG   O   27.513  11.816  -4.193 1.00 . A A .   3 SER OG   1 1 
        1    30 1 1  4 GLY C    C   24.589   5.972  -5.125 1.00 . A A .   4 GLY C    1 1 
        1    31 1 1  4 GLY CA   C   25.553   6.951  -4.484 1.00 . A A .   4 GLY CA   1 1 
        1    32 1 1  4 GLY H    H   25.832   8.023  -6.289 1.00 . A A .   4 GLY H    1 1 
        1    33 1 1  4 GLY HA2  H   26.493   6.450  -4.306 1.00 . A A .   4 GLY HA2  1 1 
        1    34 1 1  4 GLY HA3  H   25.144   7.275  -3.539 1.00 . A A .   4 GLY HA3  1 1 
        1    35 1 1  4 GLY N    N   25.793   8.117  -5.314 1.00 . A A .   4 GLY N    1 1 
        1    36 1 1  4 GLY O    O   24.812   4.762  -5.097 1.00 . A A .   4 GLY O    1 1 
        1    37 1 1  5 SER C    C   22.255   4.391  -5.537 1.00 . A A .   5 SER C    1 1 
        1    38 1 1  5 SER CA   C   22.507   5.660  -6.347 1.00 . A A .   5 SER CA   1 1 
        1    39 1 1  5 SER CB   C   22.951   5.294  -7.764 1.00 . A A .   5 SER CB   1 1 
        1    40 1 1  5 SER H    H   23.390   7.469  -5.691 1.00 . A A .   5 SER H    1 1 
        1    41 1 1  5 SER HA   H   21.589   6.226  -6.401 1.00 . A A .   5 SER HA   1 1 
        1    42 1 1  5 SER HB2  H   22.187   4.694  -8.234 1.00 . A A .   5 SER HB2  1 1 
        1    43 1 1  5 SER HB3  H   23.101   6.198  -8.336 1.00 . A A .   5 SER HB3  1 1 
        1    44 1 1  5 SER HG   H   24.843   5.074  -7.308 1.00 . A A .   5 SER HG   1 1 
        1    45 1 1  5 SER N    N   23.512   6.496  -5.702 1.00 . A A .   5 SER N    1 1 
        1    46 1 1  5 SER O    O   22.189   3.293  -6.088 1.00 . A A .   5 SER O    1 1 
        1    47 1 1  5 SER OG   O   24.162   4.558  -7.745 1.00 . A A .   5 SER OG   1 1 
        1    48 1 1  6 SER C    C   20.403   3.015  -3.362 1.00 . A A .   6 SER C    1 1 
        1    49 1 1  6 SER CA   C   21.873   3.421  -3.337 1.00 . A A .   6 SER CA   1 1 
        1    50 1 1  6 SER CB   C   22.294   3.768  -1.908 1.00 . A A .   6 SER CB   1 1 
        1    51 1 1  6 SER H    H   22.177   5.454  -3.845 1.00 . A A .   6 SER H    1 1 
        1    52 1 1  6 SER HA   H   22.470   2.592  -3.688 1.00 . A A .   6 SER HA   1 1 
        1    53 1 1  6 SER HB2  H   22.102   2.924  -1.264 1.00 . A A .   6 SER HB2  1 1 
        1    54 1 1  6 SER HB3  H   23.349   4.000  -1.893 1.00 . A A .   6 SER HB3  1 1 
        1    55 1 1  6 SER HG   H   21.986   5.209  -0.617 1.00 . A A .   6 SER HG   1 1 
        1    56 1 1  6 SER N    N   22.114   4.552  -4.225 1.00 . A A .   6 SER N    1 1 
        1    57 1 1  6 SER O    O   19.617   3.432  -2.513 1.00 . A A .   6 SER O    1 1 
        1    58 1 1  6 SER OG   O   21.573   4.887  -1.422 1.00 . A A .   6 SER OG   1 1 
        1    59 1 1  7 GLY C    C   18.563   0.277  -4.825 1.00 . A A .   7 GLY C    1 1 
        1    60 1 1  7 GLY CA   C   18.663   1.746  -4.463 1.00 . A A .   7 GLY CA   1 1 
        1    61 1 1  7 GLY H    H   20.708   1.895  -4.994 1.00 . A A .   7 GLY H    1 1 
        1    62 1 1  7 GLY HA2  H   18.160   1.909  -3.522 1.00 . A A .   7 GLY HA2  1 1 
        1    63 1 1  7 GLY HA3  H   18.171   2.328  -5.229 1.00 . A A .   7 GLY HA3  1 1 
        1    64 1 1  7 GLY N    N   20.038   2.196  -4.344 1.00 . A A .   7 GLY N    1 1 
        1    65 1 1  7 GLY O    O   18.934  -0.126  -5.928 1.00 . A A .   7 GLY O    1 1 
        1    66 1 1  8 THR C    C   16.493  -2.421  -3.823 1.00 . A A .   8 THR C    1 1 
        1    67 1 1  8 THR CA   C   17.915  -1.960  -4.118 1.00 . A A .   8 THR CA   1 1 
        1    68 1 1  8 THR CB   C   18.896  -2.768  -3.247 1.00 . A A .   8 THR CB   1 1 
        1    69 1 1  8 THR CG2  C   20.326  -2.592  -3.736 1.00 . A A .   8 THR CG2  1 1 
        1    70 1 1  8 THR H    H   17.782  -0.147  -3.034 1.00 . A A .   8 THR H    1 1 
        1    71 1 1  8 THR HA   H   18.141  -2.159  -5.156 1.00 . A A .   8 THR HA   1 1 
        1    72 1 1  8 THR HB   H   18.634  -3.814  -3.313 1.00 . A A .   8 THR HB   1 1 
        1    73 1 1  8 THR HG1  H   18.327  -3.013  -1.375 1.00 . A A .   8 THR HG1  1 1 
        1    74 1 1  8 THR HG21 H   20.910  -2.105  -2.971 1.00 . A A .   8 THR HG21 1 1 
        1    75 1 1  8 THR HG22 H   20.328  -1.987  -4.631 1.00 . A A .   8 THR HG22 1 1 
        1    76 1 1  8 THR HG23 H   20.753  -3.560  -3.955 1.00 . A A .   8 THR HG23 1 1 
        1    77 1 1  8 THR N    N   18.061  -0.527  -3.893 1.00 . A A .   8 THR N    1 1 
        1    78 1 1  8 THR O    O   15.999  -2.266  -2.706 1.00 . A A .   8 THR O    1 1 
        1    79 1 1  8 THR OG1  O   18.799  -2.347  -1.882 1.00 . A A .   8 THR OG1  1 1 
        1    80 1 1  9 ARG C    C   14.451  -4.840  -4.002 1.00 . A A .   9 ARG C    1 1 
        1    81 1 1  9 ARG CA   C   14.472  -3.473  -4.679 1.00 . A A .   9 ARG CA   1 1 
        1    82 1 1  9 ARG CB   C   13.784  -3.558  -6.043 1.00 . A A .   9 ARG CB   1 1 
        1    83 1 1  9 ARG CD   C   12.930  -2.349  -8.074 1.00 . A A .   9 ARG CD   1 1 
        1    84 1 1  9 ARG CG   C   13.578  -2.206  -6.706 1.00 . A A .   9 ARG CG   1 1 
        1    85 1 1  9 ARG CZ   C   11.569  -1.000  -9.614 1.00 . A A .   9 ARG CZ   1 1 
        1    86 1 1  9 ARG H    H   16.286  -3.086  -5.698 1.00 . A A .   9 ARG H    1 1 
        1    87 1 1  9 ARG HA   H   13.938  -2.769  -4.059 1.00 . A A .   9 ARG HA   1 1 
        1    88 1 1  9 ARG HB2  H   14.386  -4.168  -6.700 1.00 . A A .   9 ARG HB2  1 1 
        1    89 1 1  9 ARG HB3  H   12.818  -4.023  -5.917 1.00 . A A .   9 ARG HB3  1 1 
        1    90 1 1  9 ARG HD2  H   13.684  -2.649  -8.786 1.00 . A A .   9 ARG HD2  1 1 
        1    91 1 1  9 ARG HD3  H   12.166  -3.110  -8.017 1.00 . A A .   9 ARG HD3  1 1 
        1    92 1 1  9 ARG HE   H   12.486  -0.296  -7.989 1.00 . A A .   9 ARG HE   1 1 
        1    93 1 1  9 ARG HG2  H   12.940  -1.601  -6.079 1.00 . A A .   9 ARG HG2  1 1 
        1    94 1 1  9 ARG HG3  H   14.537  -1.722  -6.820 1.00 . A A .   9 ARG HG3  1 1 
        1    95 1 1  9 ARG HH11 H   11.718  -2.955 -10.101 1.00 . A A .   9 ARG HH11 1 1 
        1    96 1 1  9 ARG HH12 H   10.761  -1.994 -11.178 1.00 . A A .   9 ARG HH12 1 1 
        1    97 1 1  9 ARG HH21 H   11.228   0.981  -9.400 1.00 . A A .   9 ARG HH21 1 1 
        1    98 1 1  9 ARG HH22 H   10.484   0.245 -10.780 1.00 . A A .   9 ARG HH22 1 1 
        1    99 1 1  9 ARG N    N   15.839  -2.990  -4.831 1.00 . A A .   9 ARG N    1 1 
        1   100 1 1  9 ARG NE   N   12.323  -1.100  -8.525 1.00 . A A .   9 ARG NE   1 1 
        1   101 1 1  9 ARG NH1  N   11.330  -2.071 -10.359 1.00 . A A .   9 ARG NH1  1 1 
        1   102 1 1  9 ARG NH2  N   11.051   0.172  -9.960 1.00 . A A .   9 ARG NH2  1 1 
        1   103 1 1  9 ARG O    O   14.240  -5.863  -4.653 1.00 . A A .   9 ARG O    1 1 
        1   104 1 1 10 GLU C    C   13.275  -6.677  -1.826 1.00 . A A .  10 GLU C    1 1 
        1   105 1 1 10 GLU CA   C   14.680  -6.091  -1.926 1.00 . A A .  10 GLU CA   1 1 
        1   106 1 1 10 GLU CB   C   15.245  -5.849  -0.525 1.00 . A A .  10 GLU CB   1 1 
        1   107 1 1 10 GLU CD   C   17.316  -5.823   0.922 1.00 . A A .  10 GLU CD   1 1 
        1   108 1 1 10 GLU CG   C   16.762  -5.756  -0.487 1.00 . A A .  10 GLU CG   1 1 
        1   109 1 1 10 GLU H    H   14.835  -4.001  -2.227 1.00 . A A .  10 GLU H    1 1 
        1   110 1 1 10 GLU HA   H   15.315  -6.795  -2.443 1.00 . A A .  10 GLU HA   1 1 
        1   111 1 1 10 GLU HB2  H   14.839  -4.926  -0.140 1.00 . A A .  10 GLU HB2  1 1 
        1   112 1 1 10 GLU HB3  H   14.940  -6.662   0.118 1.00 . A A .  10 GLU HB3  1 1 
        1   113 1 1 10 GLU HG2  H   17.174  -6.574  -1.059 1.00 . A A .  10 GLU HG2  1 1 
        1   114 1 1 10 GLU HG3  H   17.063  -4.820  -0.933 1.00 . A A .  10 GLU HG3  1 1 
        1   115 1 1 10 GLU N    N   14.673  -4.849  -2.691 1.00 . A A .  10 GLU N    1 1 
        1   116 1 1 10 GLU O    O   13.090  -7.892  -1.894 1.00 . A A .  10 GLU O    1 1 
        1   117 1 1 10 GLU OE1  O   16.705  -6.511   1.767 1.00 . A A .  10 GLU OE1  1 1 
        1   118 1 1 10 GLU OE2  O   18.359  -5.188   1.181 1.00 . A A .  10 GLU OE2  1 1 
        1   119 1 1 11 LYS C    C   10.219  -6.231  -2.920 1.00 . A A .  11 LYS C    1 1 
        1   120 1 1 11 LYS CA   C   10.897  -6.232  -1.554 1.00 . A A .  11 LYS CA   1 1 
        1   121 1 1 11 LYS CB   C   10.134  -5.318  -0.593 1.00 . A A .  11 LYS CB   1 1 
        1   122 1 1 11 LYS CD   C   11.436  -5.439   1.552 1.00 . A A .  11 LYS CD   1 1 
        1   123 1 1 11 LYS CE   C   11.305  -5.576   3.061 1.00 . A A .  11 LYS CE   1 1 
        1   124 1 1 11 LYS CG   C   10.141  -5.805   0.845 1.00 . A A .  11 LYS CG   1 1 
        1   125 1 1 11 LYS H    H   12.497  -4.847  -1.617 1.00 . A A .  11 LYS H    1 1 
        1   126 1 1 11 LYS HA   H   10.890  -7.238  -1.163 1.00 . A A .  11 LYS HA   1 1 
        1   127 1 1 11 LYS HB2  H   10.581  -4.334  -0.620 1.00 . A A .  11 LYS HB2  1 1 
        1   128 1 1 11 LYS HB3  H    9.107  -5.246  -0.922 1.00 . A A .  11 LYS HB3  1 1 
        1   129 1 1 11 LYS HD2  H   12.221  -6.095   1.209 1.00 . A A .  11 LYS HD2  1 1 
        1   130 1 1 11 LYS HD3  H   11.689  -4.416   1.313 1.00 . A A .  11 LYS HD3  1 1 
        1   131 1 1 11 LYS HE2  H   10.414  -5.058   3.381 1.00 . A A .  11 LYS HE2  1 1 
        1   132 1 1 11 LYS HE3  H   11.219  -6.624   3.308 1.00 . A A .  11 LYS HE3  1 1 
        1   133 1 1 11 LYS HG2  H    9.315  -5.353   1.374 1.00 . A A .  11 LYS HG2  1 1 
        1   134 1 1 11 LYS HG3  H   10.030  -6.881   0.852 1.00 . A A .  11 LYS HG3  1 1 
        1   135 1 1 11 LYS HZ1  H   12.514  -3.975   3.640 1.00 . A A .  11 LYS HZ1  1 1 
        1   136 1 1 11 LYS HZ2  H   13.359  -5.421   3.405 1.00 . A A .  11 LYS HZ2  1 1 
        1   137 1 1 11 LYS HZ3  H   12.415  -5.209   4.792 1.00 . A A .  11 LYS HZ3  1 1 
        1   138 1 1 11 LYS N    N   12.287  -5.804  -1.663 1.00 . A A .  11 LYS N    1 1 
        1   139 1 1 11 LYS NZ   N   12.481  -5.005   3.774 1.00 . A A .  11 LYS NZ   1 1 
        1   140 1 1 11 LYS O    O   10.427  -5.339  -3.743 1.00 . A A .  11 LYS O    1 1 
        1   141 1 1 12 PRO C    C    7.569  -6.335  -4.594 1.00 . A A .  12 PRO C    1 1 
        1   142 1 1 12 PRO CA   C    8.658  -7.390  -4.434 1.00 . A A .  12 PRO CA   1 1 
        1   143 1 1 12 PRO CB   C    8.038  -8.787  -4.336 1.00 . A A .  12 PRO CB   1 1 
        1   144 1 1 12 PRO CD   C    9.089  -8.351  -2.234 1.00 . A A .  12 PRO CD   1 1 
        1   145 1 1 12 PRO CG   C    7.921  -9.048  -2.874 1.00 . A A .  12 PRO CG   1 1 
        1   146 1 1 12 PRO HA   H    9.325  -7.349  -5.282 1.00 . A A .  12 PRO HA   1 1 
        1   147 1 1 12 PRO HB2  H    7.071  -8.789  -4.818 1.00 . A A .  12 PRO HB2  1 1 
        1   148 1 1 12 PRO HB3  H    8.686  -9.506  -4.814 1.00 . A A .  12 PRO HB3  1 1 
        1   149 1 1 12 PRO HD2  H    8.814  -7.967  -1.263 1.00 . A A .  12 PRO HD2  1 1 
        1   150 1 1 12 PRO HD3  H    9.931  -9.023  -2.151 1.00 . A A .  12 PRO HD3  1 1 
        1   151 1 1 12 PRO HG2  H    6.992  -8.642  -2.502 1.00 . A A .  12 PRO HG2  1 1 
        1   152 1 1 12 PRO HG3  H    7.970 -10.110  -2.686 1.00 . A A .  12 PRO HG3  1 1 
        1   153 1 1 12 PRO N    N    9.385  -7.252  -3.169 1.00 . A A .  12 PRO N    1 1 
        1   154 1 1 12 PRO O    O    7.497  -5.654  -5.617 1.00 . A A .  12 PRO O    1 1 
        1   155 1 1 13 TYR C    C    6.172  -3.812  -3.449 1.00 . A A .  13 TYR C    1 1 
        1   156 1 1 13 TYR CA   C    5.637  -5.232  -3.607 1.00 . A A .  13 TYR CA   1 1 
        1   157 1 1 13 TYR CB   C    4.625  -5.534  -2.501 1.00 . A A .  13 TYR CB   1 1 
        1   158 1 1 13 TYR CD1  C    2.896  -7.108  -3.456 1.00 . A A .  13 TYR CD1  1 1 
        1   159 1 1 13 TYR CD2  C    4.475  -7.982  -1.898 1.00 . A A .  13 TYR CD2  1 1 
        1   160 1 1 13 TYR CE1  C    2.310  -8.354  -3.568 1.00 . A A .  13 TYR CE1  1 1 
        1   161 1 1 13 TYR CE2  C    3.895  -9.231  -2.004 1.00 . A A .  13 TYR CE2  1 1 
        1   162 1 1 13 TYR CG   C    3.987  -6.900  -2.620 1.00 . A A .  13 TYR CG   1 1 
        1   163 1 1 13 TYR CZ   C    2.813  -9.412  -2.840 1.00 . A A .  13 TYR CZ   1 1 
        1   164 1 1 13 TYR H    H    6.832  -6.775  -2.789 1.00 . A A .  13 TYR H    1 1 
        1   165 1 1 13 TYR HA   H    5.144  -5.315  -4.564 1.00 . A A .  13 TYR HA   1 1 
        1   166 1 1 13 TYR HB2  H    5.122  -5.484  -1.544 1.00 . A A .  13 TYR HB2  1 1 
        1   167 1 1 13 TYR HB3  H    3.837  -4.796  -2.531 1.00 . A A .  13 TYR HB3  1 1 
        1   168 1 1 13 TYR HD1  H    2.505  -6.277  -4.025 1.00 . A A .  13 TYR HD1  1 1 
        1   169 1 1 13 TYR HD2  H    5.322  -7.837  -1.244 1.00 . A A .  13 TYR HD2  1 1 
        1   170 1 1 13 TYR HE1  H    1.463  -8.495  -4.222 1.00 . A A .  13 TYR HE1  1 1 
        1   171 1 1 13 TYR HE2  H    4.288 -10.061  -1.435 1.00 . A A .  13 TYR HE2  1 1 
        1   172 1 1 13 TYR HH   H    2.414 -11.017  -3.820 1.00 . A A .  13 TYR HH   1 1 
        1   173 1 1 13 TYR N    N    6.724  -6.204  -3.577 1.00 . A A .  13 TYR N    1 1 
        1   174 1 1 13 TYR O    O    6.883  -3.509  -2.491 1.00 . A A .  13 TYR O    1 1 
        1   175 1 1 13 TYR OH   O    2.232 -10.655  -2.950 1.00 . A A .  13 TYR OH   1 1 
        1   176 1 1 14 GLU C    C    5.082  -0.604  -4.481 1.00 . A A .  14 GLU C    1 1 
        1   177 1 1 14 GLU CA   C    6.267  -1.558  -4.361 1.00 . A A .  14 GLU CA   1 1 
        1   178 1 1 14 GLU CB   C    7.267  -1.292  -5.489 1.00 . A A .  14 GLU CB   1 1 
        1   179 1 1 14 GLU CD   C    9.602  -1.941  -6.201 1.00 . A A .  14 GLU CD   1 1 
        1   180 1 1 14 GLU CG   C    8.717  -1.457  -5.068 1.00 . A A .  14 GLU CG   1 1 
        1   181 1 1 14 GLU H    H    5.254  -3.249  -5.133 1.00 . A A .  14 GLU H    1 1 
        1   182 1 1 14 GLU HA   H    6.755  -1.389  -3.413 1.00 . A A .  14 GLU HA   1 1 
        1   183 1 1 14 GLU HB2  H    7.068  -1.977  -6.300 1.00 . A A .  14 GLU HB2  1 1 
        1   184 1 1 14 GLU HB3  H    7.130  -0.281  -5.843 1.00 . A A .  14 GLU HB3  1 1 
        1   185 1 1 14 GLU HG2  H    9.090  -0.504  -4.724 1.00 . A A .  14 GLU HG2  1 1 
        1   186 1 1 14 GLU HG3  H    8.766  -2.174  -4.262 1.00 . A A .  14 GLU HG3  1 1 
        1   187 1 1 14 GLU N    N    5.823  -2.946  -4.395 1.00 . A A .  14 GLU N    1 1 
        1   188 1 1 14 GLU O    O    4.104  -0.895  -5.170 1.00 . A A .  14 GLU O    1 1 
        1   189 1 1 14 GLU OE1  O    9.557  -1.331  -7.290 1.00 . A A .  14 GLU OE1  1 1 
        1   190 1 1 14 GLU OE2  O   10.337  -2.930  -5.999 1.00 . A A .  14 GLU OE2  1 1 
        1   191 1 1 15 CYS C    C    4.169   2.350  -5.123 1.00 . A A .  15 CYS C    1 1 
        1   192 1 1 15 CYS CA   C    4.115   1.533  -3.835 1.00 . A A .  15 CYS CA   1 1 
        1   193 1 1 15 CYS CB   C    4.225   2.462  -2.624 1.00 . A A .  15 CYS CB   1 1 
        1   194 1 1 15 CYS H    H    5.983   0.711  -3.274 1.00 . A A .  15 CYS H    1 1 
        1   195 1 1 15 CYS HA   H    3.170   1.013  -3.793 1.00 . A A .  15 CYS HA   1 1 
        1   196 1 1 15 CYS HB2  H    4.354   1.865  -1.733 1.00 . A A .  15 CYS HB2  1 1 
        1   197 1 1 15 CYS HB3  H    5.086   3.103  -2.749 1.00 . A A .  15 CYS HB3  1 1 
        1   198 1 1 15 CYS N    N    5.177   0.536  -3.806 1.00 . A A .  15 CYS N    1 1 
        1   199 1 1 15 CYS O    O    5.156   3.033  -5.395 1.00 . A A .  15 CYS O    1 1 
        1   200 1 1 15 CYS SG   S    2.771   3.529  -2.369 1.00 . A A .  15 CYS SG   1 1 
        1   201 1 1 16 SER C    C    2.860   4.499  -6.925 1.00 . A A .  16 SER C    1 1 
        1   202 1 1 16 SER CA   C    3.029   3.003  -7.172 1.00 . A A .  16 SER CA   1 1 
        1   203 1 1 16 SER CB   C    1.869   2.480  -8.021 1.00 . A A .  16 SER CB   1 1 
        1   204 1 1 16 SER H    H    2.346   1.712  -5.638 1.00 . A A .  16 SER H    1 1 
        1   205 1 1 16 SER HA   H    3.955   2.839  -7.703 1.00 . A A .  16 SER HA   1 1 
        1   206 1 1 16 SER HB2  H    1.994   1.420  -8.185 1.00 . A A .  16 SER HB2  1 1 
        1   207 1 1 16 SER HB3  H    0.938   2.656  -7.501 1.00 . A A .  16 SER HB3  1 1 
        1   208 1 1 16 SER HG   H    2.160   2.547  -9.957 1.00 . A A .  16 SER HG   1 1 
        1   209 1 1 16 SER N    N    3.102   2.274  -5.911 1.00 . A A .  16 SER N    1 1 
        1   210 1 1 16 SER O    O    2.825   5.293  -7.865 1.00 . A A .  16 SER O    1 1 
        1   211 1 1 16 SER OG   O    1.821   3.134  -9.277 1.00 . A A .  16 SER OG   1 1 
        1   212 1 1 17 GLU C    C    3.943   6.942  -5.057 1.00 . A A .  17 GLU C    1 1 
        1   213 1 1 17 GLU CA   C    2.589   6.276  -5.285 1.00 . A A .  17 GLU CA   1 1 
        1   214 1 1 17 GLU CB   C    1.731   6.395  -4.024 1.00 . A A .  17 GLU CB   1 1 
        1   215 1 1 17 GLU CD   C   -0.631   6.588  -4.897 1.00 . A A .  17 GLU CD   1 1 
        1   216 1 1 17 GLU CG   C    0.370   5.730  -4.149 1.00 . A A .  17 GLU CG   1 1 
        1   217 1 1 17 GLU H    H    2.790   4.195  -4.950 1.00 . A A .  17 GLU H    1 1 
        1   218 1 1 17 GLU HA   H    2.088   6.776  -6.099 1.00 . A A .  17 GLU HA   1 1 
        1   219 1 1 17 GLU HB2  H    2.258   5.937  -3.199 1.00 . A A .  17 GLU HB2  1 1 
        1   220 1 1 17 GLU HB3  H    1.578   7.441  -3.805 1.00 . A A .  17 GLU HB3  1 1 
        1   221 1 1 17 GLU HG2  H    0.487   4.796  -4.678 1.00 . A A .  17 GLU HG2  1 1 
        1   222 1 1 17 GLU HG3  H   -0.013   5.536  -3.158 1.00 . A A .  17 GLU HG3  1 1 
        1   223 1 1 17 GLU N    N    2.755   4.875  -5.655 1.00 . A A .  17 GLU N    1 1 
        1   224 1 1 17 GLU O    O    4.276   7.934  -5.706 1.00 . A A .  17 GLU O    1 1 
        1   225 1 1 17 GLU OE1  O   -0.198   7.460  -5.679 1.00 . A A .  17 GLU OE1  1 1 
        1   226 1 1 17 GLU OE2  O   -1.848   6.388  -4.701 1.00 . A A .  17 GLU OE2  1 1 
        1   227 1 1 18 CYS C    C    7.138   5.994  -4.299 1.00 . A A .  18 CYS C    1 1 
        1   228 1 1 18 CYS CA   C    6.036   6.931  -3.814 1.00 . A A .  18 CYS CA   1 1 
        1   229 1 1 18 CYS CB   C    6.169   7.156  -2.306 1.00 . A A .  18 CYS CB   1 1 
        1   230 1 1 18 CYS H    H    4.398   5.600  -3.645 1.00 . A A .  18 CYS H    1 1 
        1   231 1 1 18 CYS HA   H    6.136   7.878  -4.321 1.00 . A A .  18 CYS HA   1 1 
        1   232 1 1 18 CYS HB2  H    7.159   7.531  -2.093 1.00 . A A .  18 CYS HB2  1 1 
        1   233 1 1 18 CYS HB3  H    5.438   7.886  -1.993 1.00 . A A .  18 CYS HB3  1 1 
        1   234 1 1 18 CYS N    N    4.719   6.391  -4.130 1.00 . A A .  18 CYS N    1 1 
        1   235 1 1 18 CYS O    O    8.170   6.440  -4.799 1.00 . A A .  18 CYS O    1 1 
        1   236 1 1 18 CYS SG   S    5.919   5.654  -1.305 1.00 . A A .  18 CYS SG   1 1 
        1   237 1 1 19 GLY C    C    8.349   2.816  -3.441 1.00 . A A .  19 GLY C    1 1 
        1   238 1 1 19 GLY CA   C    7.894   3.714  -4.574 1.00 . A A .  19 GLY CA   1 1 
        1   239 1 1 19 GLY H    H    6.070   4.395  -3.741 1.00 . A A .  19 GLY H    1 1 
        1   240 1 1 19 GLY HA2  H    7.462   3.102  -5.353 1.00 . A A .  19 GLY HA2  1 1 
        1   241 1 1 19 GLY HA3  H    8.753   4.233  -4.974 1.00 . A A .  19 GLY HA3  1 1 
        1   242 1 1 19 GLY N    N    6.911   4.693  -4.147 1.00 . A A .  19 GLY N    1 1 
        1   243 1 1 19 GLY O    O    9.289   2.036  -3.595 1.00 . A A .  19 GLY O    1 1 
        1   244 1 1 20 LYS C    C    8.138   0.645  -1.505 1.00 . A A .  20 LYS C    1 1 
        1   245 1 1 20 LYS CA   C    8.023   2.119  -1.131 1.00 . A A .  20 LYS CA   1 1 
        1   246 1 1 20 LYS CB   C    6.969   2.298  -0.036 1.00 . A A .  20 LYS CB   1 1 
        1   247 1 1 20 LYS CD   C    6.786   2.797   2.419 1.00 . A A .  20 LYS CD   1 1 
        1   248 1 1 20 LYS CE   C    6.798   2.102   3.772 1.00 . A A .  20 LYS CE   1 1 
        1   249 1 1 20 LYS CG   C    7.474   1.958   1.355 1.00 . A A .  20 LYS CG   1 1 
        1   250 1 1 20 LYS H    H    6.942   3.567  -2.235 1.00 . A A .  20 LYS H    1 1 
        1   251 1 1 20 LYS HA   H    8.977   2.460  -0.759 1.00 . A A .  20 LYS HA   1 1 
        1   252 1 1 20 LYS HB2  H    6.638   3.326  -0.035 1.00 . A A .  20 LYS HB2  1 1 
        1   253 1 1 20 LYS HB3  H    6.126   1.658  -0.257 1.00 . A A .  20 LYS HB3  1 1 
        1   254 1 1 20 LYS HD2  H    7.301   3.742   2.508 1.00 . A A .  20 LYS HD2  1 1 
        1   255 1 1 20 LYS HD3  H    5.762   2.971   2.121 1.00 . A A .  20 LYS HD3  1 1 
        1   256 1 1 20 LYS HE2  H    6.015   2.522   4.384 1.00 . A A .  20 LYS HE2  1 1 
        1   257 1 1 20 LYS HE3  H    6.611   1.049   3.622 1.00 . A A .  20 LYS HE3  1 1 
        1   258 1 1 20 LYS HG2  H    7.279   0.914   1.554 1.00 . A A .  20 LYS HG2  1 1 
        1   259 1 1 20 LYS HG3  H    8.538   2.141   1.397 1.00 . A A .  20 LYS HG3  1 1 
        1   260 1 1 20 LYS HZ1  H    8.800   2.695   3.828 1.00 . A A .  20 LYS HZ1  1 1 
        1   261 1 1 20 LYS HZ2  H    8.459   1.343   4.786 1.00 . A A .  20 LYS HZ2  1 1 
        1   262 1 1 20 LYS HZ3  H    7.988   2.884   5.300 1.00 . A A .  20 LYS HZ3  1 1 
        1   263 1 1 20 LYS N    N    7.682   2.927  -2.297 1.00 . A A .  20 LYS N    1 1 
        1   264 1 1 20 LYS NZ   N    8.102   2.268   4.470 1.00 . A A .  20 LYS NZ   1 1 
        1   265 1 1 20 LYS O    O    7.963   0.274  -2.665 1.00 . A A .  20 LYS O    1 1 
        1   266 1 1 21 ALA C    C    7.905  -2.421   0.380 1.00 . A A .  21 ALA C    1 1 
        1   267 1 1 21 ALA CA   C    8.567  -1.625  -0.740 1.00 . A A .  21 ALA CA   1 1 
        1   268 1 1 21 ALA CB   C   10.035  -2.004  -0.863 1.00 . A A .  21 ALA CB   1 1 
        1   269 1 1 21 ALA H    H    8.560   0.165   0.389 1.00 . A A .  21 ALA H    1 1 
        1   270 1 1 21 ALA HA   H    8.079  -1.863  -1.674 1.00 . A A .  21 ALA HA   1 1 
        1   271 1 1 21 ALA HB1  H   10.364  -2.469   0.054 1.00 . A A .  21 ALA HB1  1 1 
        1   272 1 1 21 ALA HB2  H   10.160  -2.696  -1.683 1.00 . A A .  21 ALA HB2  1 1 
        1   273 1 1 21 ALA HB3  H   10.622  -1.116  -1.047 1.00 . A A .  21 ALA HB3  1 1 
        1   274 1 1 21 ALA N    N    8.432  -0.191  -0.515 1.00 . A A .  21 ALA N    1 1 
        1   275 1 1 21 ALA O    O    7.760  -1.932   1.501 1.00 . A A .  21 ALA O    1 1 
        1   276 1 1 22 PHE C    C    7.072  -5.983   0.706 1.00 . A A .  22 PHE C    1 1 
        1   277 1 1 22 PHE CA   C    6.854  -4.512   1.048 1.00 . A A .  22 PHE CA   1 1 
        1   278 1 1 22 PHE CB   C    5.356  -4.208   1.114 1.00 . A A .  22 PHE CB   1 1 
        1   279 1 1 22 PHE CD1  C    5.127  -1.895   0.170 1.00 . A A .  22 PHE CD1  1 1 
        1   280 1 1 22 PHE CD2  C    4.675  -2.222   2.488 1.00 . A A .  22 PHE CD2  1 1 
        1   281 1 1 22 PHE CE1  C    4.842  -0.549   0.301 1.00 . A A .  22 PHE CE1  1 1 
        1   282 1 1 22 PHE CE2  C    4.389  -0.877   2.625 1.00 . A A .  22 PHE CE2  1 1 
        1   283 1 1 22 PHE CG   C    5.046  -2.746   1.260 1.00 . A A .  22 PHE CG   1 1 
        1   284 1 1 22 PHE CZ   C    4.474  -0.039   1.530 1.00 . A A .  22 PHE CZ   1 1 
        1   285 1 1 22 PHE H    H    7.646  -3.982  -0.842 1.00 . A A .  22 PHE H    1 1 
        1   286 1 1 22 PHE HA   H    7.296  -4.310   2.012 1.00 . A A .  22 PHE HA   1 1 
        1   287 1 1 22 PHE HB2  H    4.885  -4.558   0.208 1.00 . A A .  22 PHE HB2  1 1 
        1   288 1 1 22 PHE HB3  H    4.928  -4.725   1.960 1.00 . A A .  22 PHE HB3  1 1 
        1   289 1 1 22 PHE HD1  H    5.415  -2.293  -0.793 1.00 . A A .  22 PHE HD1  1 1 
        1   290 1 1 22 PHE HD2  H    4.610  -2.876   3.346 1.00 . A A .  22 PHE HD2  1 1 
        1   291 1 1 22 PHE HE1  H    4.910   0.104  -0.558 1.00 . A A .  22 PHE HE1  1 1 
        1   292 1 1 22 PHE HE2  H    4.102  -0.480   3.587 1.00 . A A .  22 PHE HE2  1 1 
        1   293 1 1 22 PHE HZ   H    4.251   1.012   1.634 1.00 . A A .  22 PHE HZ   1 1 
        1   294 1 1 22 PHE N    N    7.503  -3.649   0.069 1.00 . A A .  22 PHE N    1 1 
        1   295 1 1 22 PHE O    O    7.259  -6.339  -0.458 1.00 . A A .  22 PHE O    1 1 
        1   296 1 1 23 ILE C    C    5.952  -8.936   1.071 1.00 . A A .  23 ILE C    1 1 
        1   297 1 1 23 ILE CA   C    7.240  -8.264   1.535 1.00 . A A .  23 ILE CA   1 1 
        1   298 1 1 23 ILE CB   C    7.724  -8.945   2.829 1.00 . A A .  23 ILE CB   1 1 
        1   299 1 1 23 ILE CD1  C    9.253  -8.453   4.803 1.00 . A A .  23 ILE CD1  1 1 
        1   300 1 1 23 ILE CG1  C    9.023  -8.301   3.316 1.00 . A A .  23 ILE CG1  1 1 
        1   301 1 1 23 ILE CG2  C    7.919 -10.437   2.601 1.00 . A A .  23 ILE CG2  1 1 
        1   302 1 1 23 ILE H    H    6.892  -6.488   2.632 1.00 . A A .  23 ILE H    1 1 
        1   303 1 1 23 ILE HA   H    7.997  -8.398   0.777 1.00 . A A .  23 ILE HA   1 1 
        1   304 1 1 23 ILE HB   H    6.962  -8.817   3.583 1.00 . A A .  23 ILE HB   1 1 
        1   305 1 1 23 ILE HD11 H    9.922  -7.675   5.145 1.00 . A A .  23 ILE HD11 1 1 
        1   306 1 1 23 ILE HD12 H    8.311  -8.370   5.324 1.00 . A A .  23 ILE HD12 1 1 
        1   307 1 1 23 ILE HD13 H    9.693  -9.418   5.003 1.00 . A A .  23 ILE HD13 1 1 
        1   308 1 1 23 ILE HG12 H    9.857  -8.755   2.804 1.00 . A A .  23 ILE HG12 1 1 
        1   309 1 1 23 ILE HG13 H    8.999  -7.244   3.089 1.00 . A A .  23 ILE HG13 1 1 
        1   310 1 1 23 ILE HG21 H    7.033 -10.849   2.140 1.00 . A A .  23 ILE HG21 1 1 
        1   311 1 1 23 ILE HG22 H    8.767 -10.593   1.953 1.00 . A A .  23 ILE HG22 1 1 
        1   312 1 1 23 ILE HG23 H    8.093 -10.926   3.548 1.00 . A A .  23 ILE HG23 1 1 
        1   313 1 1 23 ILE N    N    7.046  -6.832   1.728 1.00 . A A .  23 ILE N    1 1 
        1   314 1 1 23 ILE O    O    5.976  -9.827   0.223 1.00 . A A .  23 ILE O    1 1 
        1   315 1 1 24 ARG C    C    2.563  -7.957   0.850 1.00 . A A .  24 ARG C    1 1 
        1   316 1 1 24 ARG CA   C    3.530  -9.058   1.275 1.00 . A A .  24 ARG CA   1 1 
        1   317 1 1 24 ARG CB   C    2.945  -9.838   2.454 1.00 . A A .  24 ARG CB   1 1 
        1   318 1 1 24 ARG CD   C    4.160 -12.025   2.214 1.00 . A A .  24 ARG CD   1 1 
        1   319 1 1 24 ARG CG   C    3.929 -10.806   3.092 1.00 . A A .  24 ARG CG   1 1 
        1   320 1 1 24 ARG CZ   C    2.954 -14.111   1.726 1.00 . A A .  24 ARG CZ   1 1 
        1   321 1 1 24 ARG H    H    4.874  -7.786   2.302 1.00 . A A .  24 ARG H    1 1 
        1   322 1 1 24 ARG HA   H    3.676  -9.733   0.445 1.00 . A A .  24 ARG HA   1 1 
        1   323 1 1 24 ARG HB2  H    2.622  -9.138   3.210 1.00 . A A .  24 ARG HB2  1 1 
        1   324 1 1 24 ARG HB3  H    2.092 -10.402   2.109 1.00 . A A .  24 ARG HB3  1 1 
        1   325 1 1 24 ARG HD2  H    4.490 -11.694   1.240 1.00 . A A .  24 ARG HD2  1 1 
        1   326 1 1 24 ARG HD3  H    4.928 -12.636   2.665 1.00 . A A .  24 ARG HD3  1 1 
        1   327 1 1 24 ARG HE   H    2.089 -12.379   2.205 1.00 . A A .  24 ARG HE   1 1 
        1   328 1 1 24 ARG HG2  H    4.871 -10.300   3.242 1.00 . A A .  24 ARG HG2  1 1 
        1   329 1 1 24 ARG HG3  H    3.536 -11.128   4.045 1.00 . A A .  24 ARG HG3  1 1 
        1   330 1 1 24 ARG HH11 H    4.966 -14.246   1.612 1.00 . A A .  24 ARG HH11 1 1 
        1   331 1 1 24 ARG HH12 H    4.104 -15.710   1.270 1.00 . A A .  24 ARG HH12 1 1 
        1   332 1 1 24 ARG HH21 H    0.942 -14.300   1.758 1.00 . A A .  24 ARG HH21 1 1 
        1   333 1 1 24 ARG HH22 H    1.815 -15.739   1.353 1.00 . A A .  24 ARG HH22 1 1 
        1   334 1 1 24 ARG N    N    4.829  -8.500   1.632 1.00 . A A .  24 ARG N    1 1 
        1   335 1 1 24 ARG NE   N    2.948 -12.825   2.057 1.00 . A A .  24 ARG NE   1 1 
        1   336 1 1 24 ARG NH1  N    4.102 -14.740   1.518 1.00 . A A .  24 ARG NH1  1 1 
        1   337 1 1 24 ARG NH2  N    1.809 -14.771   1.602 1.00 . A A .  24 ARG NH2  1 1 
        1   338 1 1 24 ARG O    O    2.556  -6.869   1.423 1.00 . A A .  24 ARG O    1 1 
        1   339 1 1 25 ASN C    C    0.034  -6.612   0.488 1.00 . A A .  25 ASN C    1 1 
        1   340 1 1 25 ASN CA   C    0.778  -7.284  -0.662 1.00 . A A .  25 ASN CA   1 1 
        1   341 1 1 25 ASN CB   C   -0.219  -7.972  -1.597 1.00 . A A .  25 ASN CB   1 1 
        1   342 1 1 25 ASN CG   C   -0.789  -7.023  -2.633 1.00 . A A .  25 ASN CG   1 1 
        1   343 1 1 25 ASN H    H    1.801  -9.135  -0.576 1.00 . A A .  25 ASN H    1 1 
        1   344 1 1 25 ASN HA   H    1.317  -6.531  -1.216 1.00 . A A .  25 ASN HA   1 1 
        1   345 1 1 25 ASN HB2  H    0.278  -8.780  -2.112 1.00 . A A .  25 ASN HB2  1 1 
        1   346 1 1 25 ASN HB3  H   -1.035  -8.371  -1.013 1.00 . A A .  25 ASN HB3  1 1 
        1   347 1 1 25 ASN HD21 H   -0.865  -5.560  -1.288 1.00 . A A .  25 ASN HD21 1 1 
        1   348 1 1 25 ASN HD22 H   -1.421  -5.153  -2.872 1.00 . A A .  25 ASN HD22 1 1 
        1   349 1 1 25 ASN N    N    1.748  -8.249  -0.159 1.00 . A A .  25 ASN N    1 1 
        1   350 1 1 25 ASN ND2  N   -1.051  -5.787  -2.223 1.00 . A A .  25 ASN ND2  1 1 
        1   351 1 1 25 ASN O    O    0.052  -5.388   0.621 1.00 . A A .  25 ASN O    1 1 
        1   352 1 1 25 ASN OD1  O   -0.992  -7.397  -3.788 1.00 . A A .  25 ASN OD1  1 1 
        1   353 1 1 26 SER C    C   -0.623  -5.757   3.125 1.00 . A A .  26 SER C    1 1 
        1   354 1 1 26 SER CA   C   -1.372  -6.904   2.453 1.00 . A A .  26 SER CA   1 1 
        1   355 1 1 26 SER CB   C   -1.636  -8.019   3.467 1.00 . A A .  26 SER CB   1 1 
        1   356 1 1 26 SER H    H   -0.596  -8.387   1.158 1.00 . A A .  26 SER H    1 1 
        1   357 1 1 26 SER HA   H   -2.317  -6.534   2.084 1.00 . A A .  26 SER HA   1 1 
        1   358 1 1 26 SER HB2  H   -0.803  -8.706   3.467 1.00 . A A .  26 SER HB2  1 1 
        1   359 1 1 26 SER HB3  H   -1.747  -7.588   4.451 1.00 . A A .  26 SER HB3  1 1 
        1   360 1 1 26 SER HG   H   -3.031  -9.337   3.858 1.00 . A A .  26 SER HG   1 1 
        1   361 1 1 26 SER N    N   -0.619  -7.420   1.316 1.00 . A A .  26 SER N    1 1 
        1   362 1 1 26 SER O    O   -1.225  -4.765   3.534 1.00 . A A .  26 SER O    1 1 
        1   363 1 1 26 SER OG   O   -2.817  -8.733   3.144 1.00 . A A .  26 SER OG   1 1 
        1   364 1 1 27 GLN C    C    1.506  -3.591   3.043 1.00 . A A .  27 GLN C    1 1 
        1   365 1 1 27 GLN CA   C    1.525  -4.880   3.858 1.00 . A A .  27 GLN CA   1 1 
        1   366 1 1 27 GLN CB   C    2.963  -5.382   4.006 1.00 . A A .  27 GLN CB   1 1 
        1   367 1 1 27 GLN CD   C    3.214  -6.566   6.224 1.00 . A A .  27 GLN CD   1 1 
        1   368 1 1 27 GLN CG   C    3.070  -6.719   4.722 1.00 . A A .  27 GLN CG   1 1 
        1   369 1 1 27 GLN H    H    1.115  -6.717   2.890 1.00 . A A .  27 GLN H    1 1 
        1   370 1 1 27 GLN HA   H    1.122  -4.677   4.839 1.00 . A A .  27 GLN HA   1 1 
        1   371 1 1 27 GLN HB2  H    3.397  -5.489   3.024 1.00 . A A .  27 GLN HB2  1 1 
        1   372 1 1 27 GLN HB3  H    3.530  -4.653   4.565 1.00 . A A .  27 GLN HB3  1 1 
        1   373 1 1 27 GLN HE21 H    4.623  -7.969   6.256 1.00 . A A .  27 GLN HE21 1 1 
        1   374 1 1 27 GLN HE22 H    4.225  -7.269   7.784 1.00 . A A .  27 GLN HE22 1 1 
        1   375 1 1 27 GLN HG2  H    2.179  -7.294   4.519 1.00 . A A .  27 GLN HG2  1 1 
        1   376 1 1 27 GLN HG3  H    3.932  -7.247   4.344 1.00 . A A .  27 GLN HG3  1 1 
        1   377 1 1 27 GLN N    N    0.694  -5.903   3.235 1.00 . A A .  27 GLN N    1 1 
        1   378 1 1 27 GLN NE2  N    4.110  -7.347   6.815 1.00 . A A .  27 GLN NE2  1 1 
        1   379 1 1 27 GLN O    O    1.313  -2.503   3.587 1.00 . A A .  27 GLN O    1 1 
        1   380 1 1 27 GLN OE1  O    2.527  -5.756   6.846 1.00 . A A .  27 GLN OE1  1 1 
        1   381 1 1 28 LEU C    C    0.381  -1.824   0.907 1.00 . A A .  28 LEU C    1 1 
        1   382 1 1 28 LEU CA   C    1.712  -2.566   0.845 1.00 . A A .  28 LEU CA   1 1 
        1   383 1 1 28 LEU CB   C    1.997  -3.007  -0.591 1.00 . A A .  28 LEU CB   1 1 
        1   384 1 1 28 LEU CD1  C    2.298  -0.746  -1.631 1.00 . A A .  28 LEU CD1  1 1 
        1   385 1 1 28 LEU CD2  C    1.681  -2.704  -3.060 1.00 . A A .  28 LEU CD2  1 1 
        1   386 1 1 28 LEU CG   C    1.527  -2.055  -1.692 1.00 . A A .  28 LEU CG   1 1 
        1   387 1 1 28 LEU H    H    1.854  -4.613   1.361 1.00 . A A .  28 LEU H    1 1 
        1   388 1 1 28 LEU HA   H    2.497  -1.900   1.171 1.00 . A A .  28 LEU HA   1 1 
        1   389 1 1 28 LEU HB2  H    3.064  -3.129  -0.694 1.00 . A A .  28 LEU HB2  1 1 
        1   390 1 1 28 LEU HB3  H    1.511  -3.960  -0.747 1.00 . A A .  28 LEU HB3  1 1 
        1   391 1 1 28 LEU HD11 H    2.184  -0.218  -2.565 1.00 . A A .  28 LEU HD11 1 1 
        1   392 1 1 28 LEU HD12 H    3.344  -0.952  -1.458 1.00 . A A .  28 LEU HD12 1 1 
        1   393 1 1 28 LEU HD13 H    1.913  -0.139  -0.824 1.00 . A A .  28 LEU HD13 1 1 
        1   394 1 1 28 LEU HD21 H    0.707  -2.839  -3.506 1.00 . A A .  28 LEU HD21 1 1 
        1   395 1 1 28 LEU HD22 H    2.164  -3.663  -2.950 1.00 . A A .  28 LEU HD22 1 1 
        1   396 1 1 28 LEU HD23 H    2.282  -2.068  -3.694 1.00 . A A .  28 LEU HD23 1 1 
        1   397 1 1 28 LEU HG   H    0.479  -1.832  -1.542 1.00 . A A .  28 LEU HG   1 1 
        1   398 1 1 28 LEU N    N    1.706  -3.721   1.736 1.00 . A A .  28 LEU N    1 1 
        1   399 1 1 28 LEU O    O    0.340  -0.624   1.180 1.00 . A A .  28 LEU O    1 1 
        1   400 1 1 29 ILE C    C   -2.201  -1.026   1.880 1.00 . A A .  29 ILE C    1 1 
        1   401 1 1 29 ILE CA   C   -2.038  -1.957   0.683 1.00 . A A .  29 ILE CA   1 1 
        1   402 1 1 29 ILE CB   C   -3.132  -3.040   0.737 1.00 . A A .  29 ILE CB   1 1 
        1   403 1 1 29 ILE CD1  C   -3.849  -5.214  -0.375 1.00 . A A .  29 ILE CD1  1 1 
        1   404 1 1 29 ILE CG1  C   -3.062  -3.929  -0.506 1.00 . A A .  29 ILE CG1  1 1 
        1   405 1 1 29 ILE CG2  C   -4.506  -2.400   0.861 1.00 . A A .  29 ILE CG2  1 1 
        1   406 1 1 29 ILE H    H   -0.608  -3.498   0.442 1.00 . A A .  29 ILE H    1 1 
        1   407 1 1 29 ILE HA   H   -2.170  -1.386  -0.224 1.00 . A A .  29 ILE HA   1 1 
        1   408 1 1 29 ILE HB   H   -2.963  -3.646   1.614 1.00 . A A .  29 ILE HB   1 1 
        1   409 1 1 29 ILE HD11 H   -3.759  -5.590   0.634 1.00 . A A .  29 ILE HD11 1 1 
        1   410 1 1 29 ILE HD12 H   -4.889  -5.023  -0.596 1.00 . A A .  29 ILE HD12 1 1 
        1   411 1 1 29 ILE HD13 H   -3.462  -5.946  -1.067 1.00 . A A .  29 ILE HD13 1 1 
        1   412 1 1 29 ILE HG12 H   -3.453  -3.386  -1.352 1.00 . A A .  29 ILE HG12 1 1 
        1   413 1 1 29 ILE HG13 H   -2.030  -4.189  -0.696 1.00 . A A .  29 ILE HG13 1 1 
        1   414 1 1 29 ILE HG21 H   -4.412  -1.327   0.780 1.00 . A A .  29 ILE HG21 1 1 
        1   415 1 1 29 ILE HG22 H   -5.145  -2.764   0.070 1.00 . A A .  29 ILE HG22 1 1 
        1   416 1 1 29 ILE HG23 H   -4.937  -2.652   1.818 1.00 . A A .  29 ILE HG23 1 1 
        1   417 1 1 29 ILE N    N   -0.705  -2.546   0.653 1.00 . A A .  29 ILE N    1 1 
        1   418 1 1 29 ILE O    O   -2.602   0.128   1.732 1.00 . A A .  29 ILE O    1 1 
        1   419 1 1 30 VAL C    C   -1.316   0.608   4.132 1.00 . A A .  30 VAL C    1 1 
        1   420 1 1 30 VAL CA   C   -1.993  -0.749   4.289 1.00 . A A .  30 VAL CA   1 1 
        1   421 1 1 30 VAL CB   C   -1.367  -1.487   5.488 1.00 . A A .  30 VAL CB   1 1 
        1   422 1 1 30 VAL CG1  C   -1.452  -0.633   6.744 1.00 . A A .  30 VAL CG1  1 1 
        1   423 1 1 30 VAL CG2  C   -2.046  -2.831   5.699 1.00 . A A .  30 VAL CG2  1 1 
        1   424 1 1 30 VAL H    H   -1.570  -2.462   3.120 1.00 . A A .  30 VAL H    1 1 
        1   425 1 1 30 VAL HA   H   -3.042  -0.595   4.496 1.00 . A A .  30 VAL HA   1 1 
        1   426 1 1 30 VAL HB   H   -0.324  -1.664   5.271 1.00 . A A .  30 VAL HB   1 1 
        1   427 1 1 30 VAL HG11 H   -0.584  -0.813   7.361 1.00 . A A .  30 VAL HG11 1 1 
        1   428 1 1 30 VAL HG12 H   -1.491   0.410   6.469 1.00 . A A .  30 VAL HG12 1 1 
        1   429 1 1 30 VAL HG13 H   -2.344  -0.894   7.296 1.00 . A A .  30 VAL HG13 1 1 
        1   430 1 1 30 VAL HG21 H   -2.772  -2.996   4.917 1.00 . A A .  30 VAL HG21 1 1 
        1   431 1 1 30 VAL HG22 H   -1.305  -3.616   5.675 1.00 . A A .  30 VAL HG22 1 1 
        1   432 1 1 30 VAL HG23 H   -2.544  -2.837   6.658 1.00 . A A .  30 VAL HG23 1 1 
        1   433 1 1 30 VAL N    N   -1.885  -1.535   3.066 1.00 . A A .  30 VAL N    1 1 
        1   434 1 1 30 VAL O    O   -1.801   1.619   4.640 1.00 . A A .  30 VAL O    1 1 
        1   435 1 1 31 HIS C    C   -0.112   2.702   2.115 1.00 . A A .  31 HIS C    1 1 
        1   436 1 1 31 HIS CA   C    0.553   1.857   3.197 1.00 . A A .  31 HIS CA   1 1 
        1   437 1 1 31 HIS CB   C    1.996   1.542   2.800 1.00 . A A .  31 HIS CB   1 1 
        1   438 1 1 31 HIS CD2  C    3.104   3.215   1.157 1.00 . A A .  31 HIS CD2  1 1 
        1   439 1 1 31 HIS CE1  C    3.963   4.591   2.632 1.00 . A A .  31 HIS CE1  1 1 
        1   440 1 1 31 HIS CG   C    2.780   2.749   2.386 1.00 . A A .  31 HIS CG   1 1 
        1   441 1 1 31 HIS H    H    0.146  -0.215   3.044 1.00 . A A .  31 HIS H    1 1 
        1   442 1 1 31 HIS HA   H    0.557   2.416   4.121 1.00 . A A .  31 HIS HA   1 1 
        1   443 1 1 31 HIS HB2  H    2.503   1.090   3.640 1.00 . A A .  31 HIS HB2  1 1 
        1   444 1 1 31 HIS HB3  H    1.991   0.848   1.973 1.00 . A A .  31 HIS HB3  1 1 
        1   445 1 1 31 HIS HD1  H    3.273   3.568   4.263 1.00 . A A .  31 HIS HD1  1 1 
        1   446 1 1 31 HIS HD2  H    2.834   2.769   0.210 1.00 . A A .  31 HIS HD2  1 1 
        1   447 1 1 31 HIS HE1  H    4.489   5.422   3.077 1.00 . A A .  31 HIS HE1  1 1 
        1   448 1 1 31 HIS N    N   -0.191   0.623   3.423 1.00 . A A .  31 HIS N    1 1 
        1   449 1 1 31 HIS ND1  N    3.334   3.633   3.288 1.00 . A A .  31 HIS ND1  1 1 
        1   450 1 1 31 HIS NE2  N    3.839   4.361   1.337 1.00 . A A .  31 HIS NE2  1 1 
        1   451 1 1 31 HIS O    O    0.100   3.912   2.043 1.00 . A A .  31 HIS O    1 1 
        1   452 1 1 32 GLN C    C   -2.900   3.384   0.700 1.00 . A A .  32 GLN C    1 1 
        1   453 1 1 32 GLN CA   C   -1.608   2.748   0.197 1.00 . A A .  32 GLN CA   1 1 
        1   454 1 1 32 GLN CB   C   -1.915   1.779  -0.946 1.00 . A A .  32 GLN CB   1 1 
        1   455 1 1 32 GLN CD   C   -0.972   0.569  -2.954 1.00 . A A .  32 GLN CD   1 1 
        1   456 1 1 32 GLN CG   C   -0.672   1.216  -1.616 1.00 . A A .  32 GLN CG   1 1 
        1   457 1 1 32 GLN H    H   -1.042   1.091   1.385 1.00 . A A .  32 GLN H    1 1 
        1   458 1 1 32 GLN HA   H   -0.957   3.527  -0.169 1.00 . A A .  32 GLN HA   1 1 
        1   459 1 1 32 GLN HB2  H   -2.493   0.954  -0.557 1.00 . A A .  32 GLN HB2  1 1 
        1   460 1 1 32 GLN HB3  H   -2.497   2.296  -1.694 1.00 . A A .  32 GLN HB3  1 1 
        1   461 1 1 32 GLN HE21 H    0.058   1.985  -3.897 1.00 . A A .  32 GLN HE21 1 1 
        1   462 1 1 32 GLN HE22 H   -0.649   0.773  -4.905 1.00 . A A .  32 GLN HE22 1 1 
        1   463 1 1 32 GLN HG2  H    0.033   2.019  -1.772 1.00 . A A .  32 GLN HG2  1 1 
        1   464 1 1 32 GLN HG3  H   -0.232   0.475  -0.965 1.00 . A A .  32 GLN HG3  1 1 
        1   465 1 1 32 GLN N    N   -0.914   2.056   1.276 1.00 . A A .  32 GLN N    1 1 
        1   466 1 1 32 GLN NE2  N   -0.471   1.170  -4.027 1.00 . A A .  32 GLN NE2  1 1 
        1   467 1 1 32 GLN O    O   -3.418   4.323   0.095 1.00 . A A .  32 GLN O    1 1 
        1   468 1 1 32 GLN OE1  O   -1.647  -0.458  -3.022 1.00 . A A .  32 GLN OE1  1 1 
        1   469 1 1 33 ARG C    C   -4.577   4.898   2.560 1.00 . A A .  33 ARG C    1 1 
        1   470 1 1 33 ARG CA   C   -4.647   3.382   2.394 1.00 . A A .  33 ARG CA   1 1 
        1   471 1 1 33 ARG CB   C   -4.911   2.722   3.748 1.00 . A A .  33 ARG CB   1 1 
        1   472 1 1 33 ARG CD   C   -5.941   0.747   4.912 1.00 . A A .  33 ARG CD   1 1 
        1   473 1 1 33 ARG CG   C   -5.258   1.245   3.649 1.00 . A A .  33 ARG CG   1 1 
        1   474 1 1 33 ARG CZ   C   -5.266   0.332   7.239 1.00 . A A .  33 ARG CZ   1 1 
        1   475 1 1 33 ARG H    H   -2.956   2.119   2.248 1.00 . A A .  33 ARG H    1 1 
        1   476 1 1 33 ARG HA   H   -5.458   3.143   1.723 1.00 . A A .  33 ARG HA   1 1 
        1   477 1 1 33 ARG HB2  H   -4.028   2.821   4.363 1.00 . A A .  33 ARG HB2  1 1 
        1   478 1 1 33 ARG HB3  H   -5.733   3.230   4.229 1.00 . A A .  33 ARG HB3  1 1 
        1   479 1 1 33 ARG HD2  H   -6.897   1.241   5.007 1.00 . A A .  33 ARG HD2  1 1 
        1   480 1 1 33 ARG HD3  H   -6.094  -0.319   4.826 1.00 . A A .  33 ARG HD3  1 1 
        1   481 1 1 33 ARG HE   H   -4.493   1.745   6.063 1.00 . A A .  33 ARG HE   1 1 
        1   482 1 1 33 ARG HG2  H   -5.923   1.097   2.811 1.00 . A A .  33 ARG HG2  1 1 
        1   483 1 1 33 ARG HG3  H   -4.349   0.682   3.494 1.00 . A A .  33 ARG HG3  1 1 
        1   484 1 1 33 ARG HH11 H   -6.714  -0.892   6.544 1.00 . A A .  33 ARG HH11 1 1 
        1   485 1 1 33 ARG HH12 H   -6.229  -1.174   8.183 1.00 . A A .  33 ARG HH12 1 1 
        1   486 1 1 33 ARG HH21 H   -3.845   1.384   8.220 1.00 . A A .  33 ARG HH21 1 1 
        1   487 1 1 33 ARG HH22 H   -4.597   0.122   9.135 1.00 . A A .  33 ARG HH22 1 1 
        1   488 1 1 33 ARG N    N   -3.415   2.866   1.811 1.00 . A A .  33 ARG N    1 1 
        1   489 1 1 33 ARG NE   N   -5.147   1.017   6.107 1.00 . A A .  33 ARG NE   1 1 
        1   490 1 1 33 ARG NH1  N   -6.142  -0.659   7.330 1.00 . A A .  33 ARG NH1  1 1 
        1   491 1 1 33 ARG NH2  N   -4.507   0.638   8.284 1.00 . A A .  33 ARG NH2  1 1 
        1   492 1 1 33 ARG O    O   -5.553   5.607   2.314 1.00 . A A .  33 ARG O    1 1 
        1   493 1 1 34 THR C    C   -3.061   7.544   1.851 1.00 . A A .  34 THR C    1 1 
        1   494 1 1 34 THR CA   C   -3.218   6.818   3.182 1.00 . A A .  34 THR CA   1 1 
        1   495 1 1 34 THR CB   C   -1.979   7.097   4.054 1.00 . A A .  34 THR CB   1 1 
        1   496 1 1 34 THR CG2  C   -0.711   6.619   3.363 1.00 . A A .  34 THR CG2  1 1 
        1   497 1 1 34 THR H    H   -2.674   4.773   3.161 1.00 . A A .  34 THR H    1 1 
        1   498 1 1 34 THR HA   H   -4.087   7.207   3.693 1.00 . A A .  34 THR HA   1 1 
        1   499 1 1 34 THR HB   H   -2.086   6.562   4.987 1.00 . A A .  34 THR HB   1 1 
        1   500 1 1 34 THR HG1  H   -0.954   8.745   4.403 1.00 . A A .  34 THR HG1  1 1 
        1   501 1 1 34 THR HG21 H   -0.743   5.545   3.256 1.00 . A A .  34 THR HG21 1 1 
        1   502 1 1 34 THR HG22 H    0.148   6.897   3.954 1.00 . A A .  34 THR HG22 1 1 
        1   503 1 1 34 THR HG23 H   -0.640   7.076   2.387 1.00 . A A .  34 THR HG23 1 1 
        1   504 1 1 34 THR N    N   -3.415   5.389   2.981 1.00 . A A .  34 THR N    1 1 
        1   505 1 1 34 THR O    O   -3.569   8.652   1.673 1.00 . A A .  34 THR O    1 1 
        1   506 1 1 34 THR OG1  O   -1.879   8.499   4.329 1.00 . A A .  34 THR OG1  1 1 
        1   507 1 1 35 HIS C    C   -3.456   7.680  -1.144 1.00 . A A .  35 HIS C    1 1 
        1   508 1 1 35 HIS CA   C   -2.135   7.499  -0.400 1.00 . A A .  35 HIS CA   1 1 
        1   509 1 1 35 HIS CB   C   -1.191   6.621  -1.221 1.00 . A A .  35 HIS CB   1 1 
        1   510 1 1 35 HIS CD2  C    1.266   6.308  -0.449 1.00 . A A .  35 HIS CD2  1 1 
        1   511 1 1 35 HIS CE1  C    2.090   8.180  -1.238 1.00 . A A .  35 HIS CE1  1 1 
        1   512 1 1 35 HIS CG   C    0.255   6.975  -1.053 1.00 . A A .  35 HIS CG   1 1 
        1   513 1 1 35 HIS H    H   -1.978   6.032   1.118 1.00 . A A .  35 HIS H    1 1 
        1   514 1 1 35 HIS HA   H   -1.681   8.468  -0.260 1.00 . A A .  35 HIS HA   1 1 
        1   515 1 1 35 HIS HB2  H   -1.316   5.591  -0.920 1.00 . A A .  35 HIS HB2  1 1 
        1   516 1 1 35 HIS HB3  H   -1.438   6.718  -2.268 1.00 . A A .  35 HIS HB3  1 1 
        1   517 1 1 35 HIS HD1  H    0.322   8.843  -2.026 1.00 . A A .  35 HIS HD1  1 1 
        1   518 1 1 35 HIS HD2  H    1.197   5.348   0.043 1.00 . A A .  35 HIS HD2  1 1 
        1   519 1 1 35 HIS HE1  H    2.776   8.975  -1.491 1.00 . A A .  35 HIS HE1  1 1 
        1   520 1 1 35 HIS N    N   -2.357   6.913   0.917 1.00 . A A .  35 HIS N    1 1 
        1   521 1 1 35 HIS ND1  N    0.804   8.144  -1.536 1.00 . A A .  35 HIS ND1  1 1 
        1   522 1 1 35 HIS NE2  N    2.396   7.077  -0.578 1.00 . A A .  35 HIS NE2  1 1 
        1   523 1 1 35 HIS O    O   -3.649   8.667  -1.853 1.00 . A A .  35 HIS O    1 1 
        1   524 1 1 36 SER C    C   -6.193   8.200  -1.675 1.00 . A A .  36 SER C    1 1 
        1   525 1 1 36 SER CA   C   -5.659   6.771  -1.635 1.00 . A A .  36 SER CA   1 1 
        1   526 1 1 36 SER CB   C   -6.657   5.863  -0.913 1.00 . A A .  36 SER CB   1 1 
        1   527 1 1 36 SER H    H   -4.146   5.958  -0.398 1.00 . A A .  36 SER H    1 1 
        1   528 1 1 36 SER HA   H   -5.532   6.418  -2.648 1.00 . A A .  36 SER HA   1 1 
        1   529 1 1 36 SER HB2  H   -6.860   6.264   0.068 1.00 . A A .  36 SER HB2  1 1 
        1   530 1 1 36 SER HB3  H   -7.574   5.817  -1.482 1.00 . A A .  36 SER HB3  1 1 
        1   531 1 1 36 SER HG   H   -6.848   3.954  -0.516 1.00 . A A .  36 SER HG   1 1 
        1   532 1 1 36 SER N    N   -4.360   6.720  -0.976 1.00 . A A .  36 SER N    1 1 
        1   533 1 1 36 SER O    O   -6.123   8.929  -0.686 1.00 . A A .  36 SER O    1 1 
        1   534 1 1 36 SER OG   O   -6.141   4.550  -0.772 1.00 . A A .  36 SER OG   1 1 
        1   535 1 1 37 GLY C    C   -7.631  10.255  -4.412 1.00 . A A .  37 GLY C    1 1 
        1   536 1 1 37 GLY CA   C   -7.264   9.934  -2.977 1.00 . A A .  37 GLY CA   1 1 
        1   537 1 1 37 GLY H    H   -6.755   7.970  -3.583 1.00 . A A .  37 GLY H    1 1 
        1   538 1 1 37 GLY HA2  H   -8.146  10.027  -2.361 1.00 . A A .  37 GLY HA2  1 1 
        1   539 1 1 37 GLY HA3  H   -6.524  10.645  -2.639 1.00 . A A .  37 GLY HA3  1 1 
        1   540 1 1 37 GLY N    N   -6.726   8.594  -2.828 1.00 . A A .  37 GLY N    1 1 
        1   541 1 1 37 GLY O    O   -7.562   9.390  -5.285 1.00 . A A .  37 GLY O    1 1 
        1   542 1 1 38 GLU C    C   -7.537  13.095  -6.461 1.00 . A A .  38 GLU C    1 1 
        1   543 1 1 38 GLU CA   C   -8.408  11.932  -5.995 1.00 . A A .  38 GLU CA   1 1 
        1   544 1 1 38 GLU CB   C   -9.882  12.341  -6.022 1.00 . A A .  38 GLU CB   1 1 
        1   545 1 1 38 GLU CD   C  -12.279  11.549  -5.931 1.00 . A A .  38 GLU CD   1 1 
        1   546 1 1 38 GLU CG   C  -10.835  11.170  -6.198 1.00 . A A .  38 GLU CG   1 1 
        1   547 1 1 38 GLU H    H   -8.060  12.145  -3.918 1.00 . A A .  38 GLU H    1 1 
        1   548 1 1 38 GLU HA   H   -8.263  11.099  -6.666 1.00 . A A .  38 GLU HA   1 1 
        1   549 1 1 38 GLU HB2  H  -10.122  12.838  -5.094 1.00 . A A .  38 GLU HB2  1 1 
        1   550 1 1 38 GLU HB3  H  -10.037  13.030  -6.839 1.00 . A A .  38 GLU HB3  1 1 
        1   551 1 1 38 GLU HG2  H  -10.756  10.808  -7.212 1.00 . A A .  38 GLU HG2  1 1 
        1   552 1 1 38 GLU HG3  H  -10.551  10.385  -5.513 1.00 . A A .  38 GLU HG3  1 1 
        1   553 1 1 38 GLU N    N   -8.025  11.501  -4.656 1.00 . A A .  38 GLU N    1 1 
        1   554 1 1 38 GLU O    O   -7.945  14.255  -6.395 1.00 . A A .  38 GLU O    1 1 
        1   555 1 1 38 GLU OE1  O  -12.808  12.419  -6.653 1.00 . A A .  38 GLU OE1  1 1 
        1   556 1 1 38 GLU OE2  O  -12.880  10.973  -5.000 1.00 . A A .  38 GLU OE2  1 1 
        1   557 1 1 39 SER C    C   -5.346  13.809  -8.931 1.00 . A A .  39 SER C    1 1 
        1   558 1 1 39 SER CA   C   -5.406  13.795  -7.407 1.00 . A A .  39 SER CA   1 1 
        1   559 1 1 39 SER CB   C   -4.010  13.546  -6.832 1.00 . A A .  39 SER CB   1 1 
        1   560 1 1 39 SER H    H   -6.069  11.834  -6.961 1.00 . A A .  39 SER H    1 1 
        1   561 1 1 39 SER HA   H   -5.762  14.754  -7.063 1.00 . A A .  39 SER HA   1 1 
        1   562 1 1 39 SER HB2  H   -3.805  12.487  -6.837 1.00 . A A .  39 SER HB2  1 1 
        1   563 1 1 39 SER HB3  H   -3.277  14.058  -7.440 1.00 . A A .  39 SER HB3  1 1 
        1   564 1 1 39 SER HG   H   -3.018  13.897  -5.180 1.00 . A A .  39 SER HG   1 1 
        1   565 1 1 39 SER N    N   -6.336  12.776  -6.933 1.00 . A A .  39 SER N    1 1 
        1   566 1 1 39 SER O    O   -5.618  12.802  -9.584 1.00 . A A .  39 SER O    1 1 
        1   567 1 1 39 SER OG   O   -3.913  14.025  -5.502 1.00 . A A .  39 SER OG   1 1 
        1   568 1 1 40 GLY C    C   -6.161  14.626 -11.636 1.00 . A A .  40 GLY C    1 1 
        1   569 1 1 40 GLY CA   C   -4.898  15.085 -10.935 1.00 . A A .  40 GLY CA   1 1 
        1   570 1 1 40 GLY H    H   -4.782  15.730  -8.922 1.00 . A A .  40 GLY H    1 1 
        1   571 1 1 40 GLY HA2  H   -4.716  16.120 -11.185 1.00 . A A .  40 GLY HA2  1 1 
        1   572 1 1 40 GLY HA3  H   -4.069  14.489 -11.286 1.00 . A A .  40 GLY HA3  1 1 
        1   573 1 1 40 GLY N    N   -4.987  14.960  -9.492 1.00 . A A .  40 GLY N    1 1 
        1   574 1 1 40 GLY O    O   -6.288  13.470 -12.040 1.00 . A A .  40 GLY O    1 1 
        1   575 1 1 41 PRO C    C   -8.245  15.026 -13.945 1.00 . A A .  41 PRO C    1 1 
        1   576 1 1 41 PRO CA   C   -8.403  15.252 -12.445 1.00 . A A .  41 PRO CA   1 1 
        1   577 1 1 41 PRO CB   C   -9.236  16.508 -12.178 1.00 . A A .  41 PRO CB   1 1 
        1   578 1 1 41 PRO CD   C   -7.043  16.944 -11.333 1.00 . A A .  41 PRO CD   1 1 
        1   579 1 1 41 PRO CG   C   -8.234  17.593 -11.982 1.00 . A A .  41 PRO CG   1 1 
        1   580 1 1 41 PRO HA   H   -8.889  14.395 -12.002 1.00 . A A .  41 PRO HA   1 1 
        1   581 1 1 41 PRO HB2  H   -9.874  16.707 -13.028 1.00 . A A .  41 PRO HB2  1 1 
        1   582 1 1 41 PRO HB3  H   -9.839  16.363 -11.295 1.00 . A A .  41 PRO HB3  1 1 
        1   583 1 1 41 PRO HD2  H   -6.129  17.407 -11.673 1.00 . A A .  41 PRO HD2  1 1 
        1   584 1 1 41 PRO HD3  H   -7.121  17.002 -10.257 1.00 . A A .  41 PRO HD3  1 1 
        1   585 1 1 41 PRO HG2  H   -7.958  18.015 -12.936 1.00 . A A .  41 PRO HG2  1 1 
        1   586 1 1 41 PRO HG3  H   -8.642  18.356 -11.336 1.00 . A A .  41 PRO HG3  1 1 
        1   587 1 1 41 PRO N    N   -7.126  15.546 -11.789 1.00 . A A .  41 PRO N    1 1 
        1   588 1 1 41 PRO O    O   -7.149  15.152 -14.490 1.00 . A A .  41 PRO O    1 1 
        1   589 1 1 42 SER C    C   -8.623  13.133 -16.363 1.00 . A A .  42 SER C    1 1 
        1   590 1 1 42 SER CA   C   -9.332  14.446 -16.045 1.00 . A A .  42 SER CA   1 1 
        1   591 1 1 42 SER CB   C   -8.642  15.601 -16.774 1.00 . A A .  42 SER CB   1 1 
        1   592 1 1 42 SER H    H  -10.193  14.608 -14.117 1.00 . A A .  42 SER H    1 1 
        1   593 1 1 42 SER HA   H  -10.356  14.380 -16.381 1.00 . A A .  42 SER HA   1 1 
        1   594 1 1 42 SER HB2  H   -8.994  16.539 -16.372 1.00 . A A .  42 SER HB2  1 1 
        1   595 1 1 42 SER HB3  H   -7.574  15.526 -16.630 1.00 . A A .  42 SER HB3  1 1 
        1   596 1 1 42 SER HG   H   -9.528  16.275 -18.386 1.00 . A A .  42 SER HG   1 1 
        1   597 1 1 42 SER N    N   -9.348  14.693 -14.608 1.00 . A A .  42 SER N    1 1 
        1   598 1 1 42 SER O    O   -7.860  13.044 -17.324 1.00 . A A .  42 SER O    1 1 
        1   599 1 1 42 SER OG   O   -8.920  15.566 -18.163 1.00 . A A .  42 SER OG   1 1 
        1   600 1 1 43 SER C    C   -9.050   9.980 -16.749 1.00 . A A .  43 SER C    1 1 
        1   601 1 1 43 SER CA   C   -8.264  10.808 -15.737 1.00 . A A .  43 SER CA   1 1 
        1   602 1 1 43 SER CB   C   -8.181  10.061 -14.404 1.00 . A A .  43 SER CB   1 1 
        1   603 1 1 43 SER H    H   -9.498  12.250 -14.797 1.00 . A A .  43 SER H    1 1 
        1   604 1 1 43 SER HA   H   -7.265  10.964 -16.115 1.00 . A A .  43 SER HA   1 1 
        1   605 1 1 43 SER HB2  H   -7.935  10.759 -13.618 1.00 . A A .  43 SER HB2  1 1 
        1   606 1 1 43 SER HB3  H   -9.136   9.602 -14.192 1.00 . A A .  43 SER HB3  1 1 
        1   607 1 1 43 SER HG   H   -7.365   8.458 -15.180 1.00 . A A .  43 SER HG   1 1 
        1   608 1 1 43 SER N    N   -8.880  12.116 -15.546 1.00 . A A .  43 SER N    1 1 
        1   609 1 1 43 SER O    O  -10.241  10.204 -16.961 1.00 . A A .  43 SER O    1 1 
        1   610 1 1 43 SER OG   O   -7.188   9.052 -14.447 1.00 . A A .  43 SER OG   1 1 
        1   611 1 1 44 GLY C    C   -9.065   6.719 -17.929 1.00 . A A .  44 GLY C    1 1 
        1   612 1 1 44 GLY CA   C   -9.022   8.173 -18.355 1.00 . A A .  44 GLY CA   1 1 
        1   613 1 1 44 GLY H    H   -7.424   8.887 -17.163 1.00 . A A .  44 GLY H    1 1 
        1   614 1 1 44 GLY HA2  H  -10.032   8.523 -18.506 1.00 . A A .  44 GLY HA2  1 1 
        1   615 1 1 44 GLY HA3  H   -8.484   8.246 -19.289 1.00 . A A .  44 GLY HA3  1 1 
        1   616 1 1 44 GLY N    N   -8.373   9.021 -17.372 1.00 . A A .  44 GLY N    1 1 
        1   617 1 1 44 GLY O    O   -8.886   5.842 -18.772 1.00 . A A .  44 GLY O    1 1 
        1   618 2 2  1 ZN  ZN   ZN   3.664   5.150  -0.888 1.00 . B A . 201 ZN  ZN   1 1 
        2   619 1 1  1 GLY C    C   24.523  13.298  -7.034 1.00 . A A .   1 GLY C    1 1 
        2   620 1 1  1 GLY CA   C   25.456  14.237  -6.297 1.00 . A A .   1 GLY CA   1 1 
        2   621 1 1  1 GLY H1   H   25.741  15.404  -8.041 1.00 . A A .   1 GLY H1   1 1 
        2   622 1 1  1 GLY HA2  H   26.379  13.718  -6.084 1.00 . A A .   1 GLY HA2  1 1 
        2   623 1 1  1 GLY HA3  H   24.994  14.527  -5.365 1.00 . A A .   1 GLY HA3  1 1 
        2   624 1 1  1 GLY N    N   25.757  15.434  -7.062 1.00 . A A .   1 GLY N    1 1 
        2   625 1 1  1 GLY O    O   24.510  13.263  -8.265 1.00 . A A .   1 GLY O    1 1 
        2   626 1 1  2 SER C    C   21.421  12.212  -7.028 1.00 . A A .   2 SER C    1 1 
        2   627 1 1  2 SER CA   C   22.802  11.584  -6.871 1.00 . A A .   2 SER CA   1 1 
        2   628 1 1  2 SER CB   C   22.707  10.325  -6.007 1.00 . A A .   2 SER CB   1 1 
        2   629 1 1  2 SER H    H   23.796  12.606  -5.305 1.00 . A A .   2 SER H    1 1 
        2   630 1 1  2 SER HA   H   23.175  11.313  -7.847 1.00 . A A .   2 SER HA   1 1 
        2   631 1 1  2 SER HB2  H   21.934   9.681  -6.397 1.00 . A A .   2 SER HB2  1 1 
        2   632 1 1  2 SER HB3  H   23.654   9.804  -6.029 1.00 . A A .   2 SER HB3  1 1 
        2   633 1 1  2 SER HG   H   21.688  10.081  -4.352 1.00 . A A .   2 SER HG   1 1 
        2   634 1 1  2 SER N    N   23.740  12.533  -6.281 1.00 . A A .   2 SER N    1 1 
        2   635 1 1  2 SER O    O   21.100  13.204  -6.375 1.00 . A A .   2 SER O    1 1 
        2   636 1 1  2 SER OG   O   22.396  10.650  -4.663 1.00 . A A .   2 SER OG   1 1 
        2   637 1 1  3 SER C    C   18.300  11.670  -7.054 1.00 . A A .   3 SER C    1 1 
        2   638 1 1  3 SER CA   C   19.261  12.128  -8.147 1.00 . A A .   3 SER CA   1 1 
        2   639 1 1  3 SER CB   C   18.760  11.655  -9.513 1.00 . A A .   3 SER CB   1 1 
        2   640 1 1  3 SER H    H   20.921  10.836  -8.391 1.00 . A A .   3 SER H    1 1 
        2   641 1 1  3 SER HA   H   19.304  13.207  -8.143 1.00 . A A .   3 SER HA   1 1 
        2   642 1 1  3 SER HB2  H   19.517  11.847 -10.258 1.00 . A A .   3 SER HB2  1 1 
        2   643 1 1  3 SER HB3  H   18.556  10.595  -9.472 1.00 . A A .   3 SER HB3  1 1 
        2   644 1 1  3 SER HG   H   17.745  12.885 -10.652 1.00 . A A .   3 SER HG   1 1 
        2   645 1 1  3 SER N    N   20.607  11.625  -7.900 1.00 . A A .   3 SER N    1 1 
        2   646 1 1  3 SER O    O   18.353  10.525  -6.606 1.00 . A A .   3 SER O    1 1 
        2   647 1 1  3 SER OG   O   17.573  12.335  -9.884 1.00 . A A .   3 SER OG   1 1 
        2   648 1 1  4 GLY C    C   15.539  11.110  -5.995 1.00 . A A .   4 GLY C    1 1 
        2   649 1 1  4 GLY CA   C   16.461  12.244  -5.593 1.00 . A A .   4 GLY CA   1 1 
        2   650 1 1  4 GLY H    H   17.426  13.470  -7.024 1.00 . A A .   4 GLY H    1 1 
        2   651 1 1  4 GLY HA2  H   16.996  11.959  -4.699 1.00 . A A .   4 GLY HA2  1 1 
        2   652 1 1  4 GLY HA3  H   15.865  13.119  -5.379 1.00 . A A .   4 GLY HA3  1 1 
        2   653 1 1  4 GLY N    N   17.422  12.573  -6.630 1.00 . A A .   4 GLY N    1 1 
        2   654 1 1  4 GLY O    O   14.481  11.340  -6.581 1.00 . A A .   4 GLY O    1 1 
        2   655 1 1  5 SER C    C   14.818   7.896  -4.771 1.00 . A A .   5 SER C    1 1 
        2   656 1 1  5 SER CA   C   15.146   8.708  -6.020 1.00 . A A .   5 SER CA   1 1 
        2   657 1 1  5 SER CB   C   15.892   7.834  -7.029 1.00 . A A .   5 SER CB   1 1 
        2   658 1 1  5 SER H    H   16.795   9.764  -5.215 1.00 . A A .   5 SER H    1 1 
        2   659 1 1  5 SER HA   H   14.223   9.050  -6.466 1.00 . A A .   5 SER HA   1 1 
        2   660 1 1  5 SER HB2  H   16.371   8.464  -7.763 1.00 . A A .   5 SER HB2  1 1 
        2   661 1 1  5 SER HB3  H   16.640   7.251  -6.512 1.00 . A A .   5 SER HB3  1 1 
        2   662 1 1  5 SER HG   H   14.966   6.118  -7.220 1.00 . A A .   5 SER HG   1 1 
        2   663 1 1  5 SER N    N   15.941   9.883  -5.682 1.00 . A A .   5 SER N    1 1 
        2   664 1 1  5 SER O    O   15.632   7.793  -3.853 1.00 . A A .   5 SER O    1 1 
        2   665 1 1  5 SER OG   O   15.005   6.951  -7.694 1.00 . A A .   5 SER OG   1 1 
        2   666 1 1  6 SER C    C   12.573   5.203  -4.072 1.00 . A A .   6 SER C    1 1 
        2   667 1 1  6 SER CA   C   13.181   6.522  -3.606 1.00 . A A .   6 SER CA   1 1 
        2   668 1 1  6 SER CB   C   12.161   7.300  -2.772 1.00 . A A .   6 SER CB   1 1 
        2   669 1 1  6 SER H    H   13.015   7.442  -5.506 1.00 . A A .   6 SER H    1 1 
        2   670 1 1  6 SER HA   H   14.046   6.311  -2.996 1.00 . A A .   6 SER HA   1 1 
        2   671 1 1  6 SER HB2  H   11.527   7.876  -3.428 1.00 . A A .   6 SER HB2  1 1 
        2   672 1 1  6 SER HB3  H   11.557   6.604  -2.207 1.00 . A A .   6 SER HB3  1 1 
        2   673 1 1  6 SER HG   H   12.339   9.020  -1.852 1.00 . A A .   6 SER HG   1 1 
        2   674 1 1  6 SER N    N   13.619   7.322  -4.744 1.00 . A A .   6 SER N    1 1 
        2   675 1 1  6 SER O    O   11.689   5.181  -4.927 1.00 . A A .   6 SER O    1 1 
        2   676 1 1  6 SER OG   O   12.806   8.182  -1.870 1.00 . A A .   6 SER OG   1 1 
        2   677 1 1  7 GLY C    C   13.660   1.784  -4.094 1.00 . A A .   7 GLY C    1 1 
        2   678 1 1  7 GLY CA   C   12.550   2.793  -3.871 1.00 . A A .   7 GLY CA   1 1 
        2   679 1 1  7 GLY H    H   13.762   4.180  -2.826 1.00 . A A .   7 GLY H    1 1 
        2   680 1 1  7 GLY HA2  H   11.904   2.434  -3.084 1.00 . A A .   7 GLY HA2  1 1 
        2   681 1 1  7 GLY HA3  H   11.976   2.885  -4.781 1.00 . A A .   7 GLY HA3  1 1 
        2   682 1 1  7 GLY N    N   13.056   4.102  -3.502 1.00 . A A .   7 GLY N    1 1 
        2   683 1 1  7 GLY O    O   13.778   1.207  -5.175 1.00 . A A .   7 GLY O    1 1 
        2   684 1 1  8 THR C    C   15.546  -0.376  -2.010 1.00 . A A .   8 THR C    1 1 
        2   685 1 1  8 THR CA   C   15.586   0.628  -3.157 1.00 . A A .   8 THR CA   1 1 
        2   686 1 1  8 THR CB   C   16.944   1.353  -3.143 1.00 . A A .   8 THR CB   1 1 
        2   687 1 1  8 THR CG2  C   18.090   0.359  -3.253 1.00 . A A .   8 THR CG2  1 1 
        2   688 1 1  8 THR H    H   14.333   2.061  -2.232 1.00 . A A .   8 THR H    1 1 
        2   689 1 1  8 THR HA   H   15.495   0.095  -4.092 1.00 . A A .   8 THR HA   1 1 
        2   690 1 1  8 THR HB   H   17.040   1.888  -2.208 1.00 . A A .   8 THR HB   1 1 
        2   691 1 1  8 THR HG1  H   17.309   3.140  -3.895 1.00 . A A .   8 THR HG1  1 1 
        2   692 1 1  8 THR HG21 H   17.719  -0.574  -3.651 1.00 . A A .   8 THR HG21 1 1 
        2   693 1 1  8 THR HG22 H   18.515   0.189  -2.275 1.00 . A A .   8 THR HG22 1 1 
        2   694 1 1  8 THR HG23 H   18.848   0.755  -3.912 1.00 . A A .   8 THR HG23 1 1 
        2   695 1 1  8 THR N    N   14.478   1.571  -3.068 1.00 . A A .   8 THR N    1 1 
        2   696 1 1  8 THR O    O   16.120  -0.140  -0.946 1.00 . A A .   8 THR O    1 1 
        2   697 1 1  8 THR OG1  O   17.012   2.289  -4.225 1.00 . A A .   8 THR OG1  1 1 
        2   698 1 1  9 ARG C    C   14.571  -3.907  -1.862 1.00 . A A .   9 ARG C    1 1 
        2   699 1 1  9 ARG CA   C   14.754  -2.536  -1.218 1.00 . A A .   9 ARG CA   1 1 
        2   700 1 1  9 ARG CB   C   13.580  -2.239  -0.283 1.00 . A A .   9 ARG CB   1 1 
        2   701 1 1  9 ARG CD   C   14.825  -1.996   1.887 1.00 . A A .   9 ARG CD   1 1 
        2   702 1 1  9 ARG CG   C   13.935  -1.307   0.864 1.00 . A A .   9 ARG CG   1 1 
        2   703 1 1  9 ARG CZ   C   16.148  -1.367   3.861 1.00 . A A .   9 ARG CZ   1 1 
        2   704 1 1  9 ARG H    H   14.432  -1.627  -3.102 1.00 . A A .   9 ARG H    1 1 
        2   705 1 1  9 ARG HA   H   15.668  -2.540  -0.643 1.00 . A A .   9 ARG HA   1 1 
        2   706 1 1  9 ARG HB2  H   12.785  -1.783  -0.855 1.00 . A A .   9 ARG HB2  1 1 
        2   707 1 1  9 ARG HB3  H   13.224  -3.169   0.135 1.00 . A A .   9 ARG HB3  1 1 
        2   708 1 1  9 ARG HD2  H   14.301  -2.854   2.280 1.00 . A A .   9 ARG HD2  1 1 
        2   709 1 1  9 ARG HD3  H   15.730  -2.321   1.396 1.00 . A A .   9 ARG HD3  1 1 
        2   710 1 1  9 ARG HE   H   14.662  -0.281   3.091 1.00 . A A .   9 ARG HE   1 1 
        2   711 1 1  9 ARG HG2  H   14.459  -0.448   0.469 1.00 . A A .   9 ARG HG2  1 1 
        2   712 1 1  9 ARG HG3  H   13.026  -0.985   1.349 1.00 . A A .   9 ARG HG3  1 1 
        2   713 1 1  9 ARG HH11 H   16.668  -3.126   3.015 1.00 . A A .   9 ARG HH11 1 1 
        2   714 1 1  9 ARG HH12 H   17.593  -2.670   4.407 1.00 . A A .   9 ARG HH12 1 1 
        2   715 1 1  9 ARG HH21 H   15.873   0.330   4.925 1.00 . A A .   9 ARG HH21 1 1 
        2   716 1 1  9 ARG HH22 H   17.139  -0.705   5.493 1.00 . A A .   9 ARG HH22 1 1 
        2   717 1 1  9 ARG N    N   14.868  -1.496  -2.234 1.00 . A A .   9 ARG N    1 1 
        2   718 1 1  9 ARG NE   N   15.176  -1.109   2.992 1.00 . A A .   9 ARG NE   1 1 
        2   719 1 1  9 ARG NH1  N   16.861  -2.479   3.752 1.00 . A A .   9 ARG NH1  1 1 
        2   720 1 1  9 ARG NH2  N   16.408  -0.510   4.840 1.00 . A A .   9 ARG NH2  1 1 
        2   721 1 1  9 ARG O    O   14.181  -4.010  -3.024 1.00 . A A .   9 ARG O    1 1 
        2   722 1 1 10 GLU C    C   13.288  -6.817  -1.448 1.00 . A A .  10 GLU C    1 1 
        2   723 1 1 10 GLU CA   C   14.723  -6.321  -1.595 1.00 . A A .  10 GLU CA   1 1 
        2   724 1 1 10 GLU CB   C   15.676  -7.255  -0.846 1.00 . A A .  10 GLU CB   1 1 
        2   725 1 1 10 GLU CD   C   17.952  -8.348  -0.912 1.00 . A A .  10 GLU CD   1 1 
        2   726 1 1 10 GLU CG   C   17.122  -7.140  -1.298 1.00 . A A .  10 GLU CG   1 1 
        2   727 1 1 10 GLU H    H   15.162  -4.811  -0.178 1.00 . A A .  10 GLU H    1 1 
        2   728 1 1 10 GLU HA   H   14.985  -6.320  -2.642 1.00 . A A .  10 GLU HA   1 1 
        2   729 1 1 10 GLU HB2  H   15.630  -7.027   0.209 1.00 . A A .  10 GLU HB2  1 1 
        2   730 1 1 10 GLU HB3  H   15.354  -8.275  -0.998 1.00 . A A .  10 GLU HB3  1 1 
        2   731 1 1 10 GLU HG2  H   17.143  -7.036  -2.372 1.00 . A A .  10 GLU HG2  1 1 
        2   732 1 1 10 GLU HG3  H   17.558  -6.262  -0.844 1.00 . A A .  10 GLU HG3  1 1 
        2   733 1 1 10 GLU N    N   14.855  -4.957  -1.097 1.00 . A A .  10 GLU N    1 1 
        2   734 1 1 10 GLU O    O   13.048  -8.005  -1.232 1.00 . A A .  10 GLU O    1 1 
        2   735 1 1 10 GLU OE1  O   17.797  -9.405  -1.559 1.00 . A A .  10 GLU OE1  1 1 
        2   736 1 1 10 GLU OE2  O   18.757  -8.238   0.036 1.00 . A A .  10 GLU OE2  1 1 
        2   737 1 1 11 LYS C    C   10.265  -6.318  -2.822 1.00 . A A .  11 LYS C    1 1 
        2   738 1 1 11 LYS CA   C   10.923  -6.239  -1.448 1.00 . A A .  11 LYS CA   1 1 
        2   739 1 1 11 LYS CB   C   10.198  -5.206  -0.583 1.00 . A A .  11 LYS CB   1 1 
        2   740 1 1 11 LYS CD   C   11.525  -5.431   1.538 1.00 . A A .  11 LYS CD   1 1 
        2   741 1 1 11 LYS CE   C   11.411  -5.058   3.008 1.00 . A A .  11 LYS CE   1 1 
        2   742 1 1 11 LYS CG   C   10.157  -5.570   0.892 1.00 . A A .  11 LYS CG   1 1 
        2   743 1 1 11 LYS H    H   12.589  -4.967  -1.739 1.00 . A A .  11 LYS H    1 1 
        2   744 1 1 11 LYS HA   H   10.854  -7.206  -0.974 1.00 . A A .  11 LYS HA   1 1 
        2   745 1 1 11 LYS HB2  H   10.699  -4.255  -0.684 1.00 . A A .  11 LYS HB2  1 1 
        2   746 1 1 11 LYS HB3  H    9.182  -5.108  -0.936 1.00 . A A .  11 LYS HB3  1 1 
        2   747 1 1 11 LYS HD2  H   12.049  -6.372   1.457 1.00 . A A .  11 LYS HD2  1 1 
        2   748 1 1 11 LYS HD3  H   12.081  -4.661   1.022 1.00 . A A .  11 LYS HD3  1 1 
        2   749 1 1 11 LYS HE2  H   12.305  -4.529   3.302 1.00 . A A .  11 LYS HE2  1 1 
        2   750 1 1 11 LYS HE3  H   10.554  -4.414   3.137 1.00 . A A .  11 LYS HE3  1 1 
        2   751 1 1 11 LYS HG2  H    9.464  -4.912   1.396 1.00 . A A .  11 LYS HG2  1 1 
        2   752 1 1 11 LYS HG3  H    9.823  -6.593   0.992 1.00 . A A .  11 LYS HG3  1 1 
        2   753 1 1 11 LYS HZ1  H   10.326  -6.236   4.349 1.00 . A A .  11 LYS HZ1  1 1 
        2   754 1 1 11 LYS HZ2  H   11.999  -6.279   4.598 1.00 . A A .  11 LYS HZ2  1 1 
        2   755 1 1 11 LYS HZ3  H   11.315  -7.123   3.302 1.00 . A A .  11 LYS HZ3  1 1 
        2   756 1 1 11 LYS N    N   12.335  -5.898  -1.567 1.00 . A A .  11 LYS N    1 1 
        2   757 1 1 11 LYS NZ   N   11.251  -6.258   3.875 1.00 . A A .  11 LYS NZ   1 1 
        2   758 1 1 11 LYS O    O   10.492  -5.479  -3.695 1.00 . A A .  11 LYS O    1 1 
        2   759 1 1 12 PRO C    C    7.641  -6.509  -4.528 1.00 . A A .  12 PRO C    1 1 
        2   760 1 1 12 PRO CA   C    8.720  -7.558  -4.287 1.00 . A A .  12 PRO CA   1 1 
        2   761 1 1 12 PRO CB   C    8.090  -8.943  -4.114 1.00 . A A .  12 PRO CB   1 1 
        2   762 1 1 12 PRO CD   C    9.111  -8.385  -2.026 1.00 . A A .  12 PRO CD   1 1 
        2   763 1 1 12 PRO CG   C    7.948  -9.113  -2.641 1.00 . A A .  12 PRO CG   1 1 
        2   764 1 1 12 PRO HA   H    9.401  -7.573  -5.126 1.00 . A A .  12 PRO HA   1 1 
        2   765 1 1 12 PRO HB2  H    7.130  -8.969  -4.610 1.00 . A A .  12 PRO HB2  1 1 
        2   766 1 1 12 PRO HB3  H    8.740  -9.693  -4.538 1.00 . A A .  12 PRO HB3  1 1 
        2   767 1 1 12 PRO HD2  H    8.824  -7.942  -1.085 1.00 . A A .  12 PRO HD2  1 1 
        2   768 1 1 12 PRO HD3  H    9.947  -9.056  -1.890 1.00 . A A .  12 PRO HD3  1 1 
        2   769 1 1 12 PRO HG2  H    7.017  -8.681  -2.309 1.00 . A A .  12 PRO HG2  1 1 
        2   770 1 1 12 PRO HG3  H    7.988 -10.163  -2.388 1.00 . A A .  12 PRO HG3  1 1 
        2   771 1 1 12 PRO N    N    9.429  -7.348  -3.021 1.00 . A A .  12 PRO N    1 1 
        2   772 1 1 12 PRO O    O    7.584  -5.896  -5.595 1.00 . A A .  12 PRO O    1 1 
        2   773 1 1 13 TYR C    C    6.244  -3.907  -3.511 1.00 . A A .  13 TYR C    1 1 
        2   774 1 1 13 TYR CA   C    5.707  -5.330  -3.637 1.00 . A A .  13 TYR CA   1 1 
        2   775 1 1 13 TYR CB   C    4.653  -5.587  -2.559 1.00 . A A .  13 TYR CB   1 1 
        2   776 1 1 13 TYR CD1  C    2.952  -7.225  -3.452 1.00 . A A .  13 TYR CD1  1 1 
        2   777 1 1 13 TYR CD2  C    4.550  -8.013  -1.868 1.00 . A A .  13 TYR CD2  1 1 
        2   778 1 1 13 TYR CE1  C    2.389  -8.485  -3.518 1.00 . A A .  13 TYR CE1  1 1 
        2   779 1 1 13 TYR CE2  C    3.993  -9.276  -1.928 1.00 . A A .  13 TYR CE2  1 1 
        2   780 1 1 13 TYR CG   C    4.040  -6.967  -2.628 1.00 . A A .  13 TYR CG   1 1 
        2   781 1 1 13 TYR CZ   C    2.913  -9.507  -2.754 1.00 . A A .  13 TYR CZ   1 1 
        2   782 1 1 13 TYR H    H    6.883  -6.824  -2.706 1.00 . A A .  13 TYR H    1 1 
        2   783 1 1 13 TYR HA   H    5.250  -5.445  -4.609 1.00 . A A .  13 TYR HA   1 1 
        2   784 1 1 13 TYR HB2  H    5.108  -5.474  -1.586 1.00 . A A .  13 TYR HB2  1 1 
        2   785 1 1 13 TYR HB3  H    3.857  -4.864  -2.664 1.00 . A A .  13 TYR HB3  1 1 
        2   786 1 1 13 TYR HD1  H    2.545  -6.422  -4.049 1.00 . A A .  13 TYR HD1  1 1 
        2   787 1 1 13 TYR HD2  H    5.396  -7.829  -1.222 1.00 . A A .  13 TYR HD2  1 1 
        2   788 1 1 13 TYR HE1  H    1.543  -8.666  -4.164 1.00 . A A .  13 TYR HE1  1 1 
        2   789 1 1 13 TYR HE2  H    4.403 -10.077  -1.330 1.00 . A A .  13 TYR HE2  1 1 
        2   790 1 1 13 TYR HH   H    1.591 -10.745  -3.398 1.00 . A A .  13 TYR HH   1 1 
        2   791 1 1 13 TYR N    N    6.787  -6.305  -3.532 1.00 . A A .  13 TYR N    1 1 
        2   792 1 1 13 TYR O    O    7.065  -3.618  -2.641 1.00 . A A .  13 TYR O    1 1 
        2   793 1 1 13 TYR OH   O    2.355 -10.763  -2.817 1.00 . A A .  13 TYR OH   1 1 
        2   794 1 1 14 GLU C    C    5.015  -0.691  -4.536 1.00 . A A .  14 GLU C    1 1 
        2   795 1 1 14 GLU CA   C    6.206  -1.632  -4.373 1.00 . A A .  14 GLU CA   1 1 
        2   796 1 1 14 GLU CB   C    7.225  -1.381  -5.487 1.00 . A A .  14 GLU CB   1 1 
        2   797 1 1 14 GLU CD   C    9.578  -2.025  -6.139 1.00 . A A .  14 GLU CD   1 1 
        2   798 1 1 14 GLU CG   C    8.668  -1.525  -5.034 1.00 . A A .  14 GLU CG   1 1 
        2   799 1 1 14 GLU H    H    5.120  -3.316  -5.056 1.00 . A A .  14 GLU H    1 1 
        2   800 1 1 14 GLU HA   H    6.673  -1.439  -3.420 1.00 . A A .  14 GLU HA   1 1 
        2   801 1 1 14 GLU HB2  H    7.047  -2.085  -6.286 1.00 . A A .  14 GLU HB2  1 1 
        2   802 1 1 14 GLU HB3  H    7.086  -0.379  -5.865 1.00 . A A .  14 GLU HB3  1 1 
        2   803 1 1 14 GLU HG2  H    9.026  -0.561  -4.703 1.00 . A A .  14 GLU HG2  1 1 
        2   804 1 1 14 GLU HG3  H    8.706  -2.224  -4.212 1.00 . A A .  14 GLU HG3  1 1 
        2   805 1 1 14 GLU N    N    5.773  -3.024  -4.386 1.00 . A A .  14 GLU N    1 1 
        2   806 1 1 14 GLU O    O    4.065  -0.993  -5.259 1.00 . A A .  14 GLU O    1 1 
        2   807 1 1 14 GLU OE1  O    9.900  -1.231  -7.047 1.00 . A A .  14 GLU OE1  1 1 
        2   808 1 1 14 GLU OE2  O    9.969  -3.211  -6.095 1.00 . A A .  14 GLU OE2  1 1 
        2   809 1 1 15 CYS C    C    4.064   2.218  -5.237 1.00 . A A .  15 CYS C    1 1 
        2   810 1 1 15 CYS CA   C    4.002   1.437  -3.928 1.00 . A A .  15 CYS CA   1 1 
        2   811 1 1 15 CYS CB   C    4.091   2.400  -2.742 1.00 . A A .  15 CYS CB   1 1 
        2   812 1 1 15 CYS H    H    5.859   0.636  -3.300 1.00 . A A .  15 CYS H    1 1 
        2   813 1 1 15 CYS HA   H    3.062   0.909  -3.881 1.00 . A A .  15 CYS HA   1 1 
        2   814 1 1 15 CYS HB2  H    4.190   1.828  -1.831 1.00 . A A .  15 CYS HB2  1 1 
        2   815 1 1 15 CYS HB3  H    4.961   3.028  -2.863 1.00 . A A .  15 CYS HB3  1 1 
        2   816 1 1 15 CYS N    N    5.074   0.451  -3.860 1.00 . A A .  15 CYS N    1 1 
        2   817 1 1 15 CYS O    O    5.114   2.739  -5.613 1.00 . A A .  15 CYS O    1 1 
        2   818 1 1 15 CYS SG   S    2.642   3.488  -2.557 1.00 . A A .  15 CYS SG   1 1 
        2   819 1 1 16 SER C    C    2.651   4.503  -6.968 1.00 . A A .  16 SER C    1 1 
        2   820 1 1 16 SER CA   C    2.855   3.009  -7.197 1.00 . A A .  16 SER CA   1 1 
        2   821 1 1 16 SER CB   C    1.716   2.452  -8.052 1.00 . A A .  16 SER CB   1 1 
        2   822 1 1 16 SER H    H    2.126   1.858  -5.575 1.00 . A A .  16 SER H    1 1 
        2   823 1 1 16 SER HA   H    3.790   2.860  -7.716 1.00 . A A .  16 SER HA   1 1 
        2   824 1 1 16 SER HB2  H    1.804   2.835  -9.058 1.00 . A A .  16 SER HB2  1 1 
        2   825 1 1 16 SER HB3  H    1.777   1.373  -8.071 1.00 . A A .  16 SER HB3  1 1 
        2   826 1 1 16 SER HG   H   -0.243   2.452  -8.071 1.00 . A A .  16 SER HG   1 1 
        2   827 1 1 16 SER N    N    2.930   2.295  -5.927 1.00 . A A .  16 SER N    1 1 
        2   828 1 1 16 SER O    O    2.505   5.272  -7.917 1.00 . A A .  16 SER O    1 1 
        2   829 1 1 16 SER OG   O    0.454   2.828  -7.529 1.00 . A A .  16 SER OG   1 1 
        2   830 1 1 17 GLU C    C    3.794   6.973  -5.036 1.00 . A A .  17 GLU C    1 1 
        2   831 1 1 17 GLU CA   C    2.457   6.308  -5.347 1.00 . A A .  17 GLU CA   1 1 
        2   832 1 1 17 GLU CB   C    1.520   6.433  -4.144 1.00 . A A .  17 GLU CB   1 1 
        2   833 1 1 17 GLU CD   C   -0.835   6.564  -5.046 1.00 . A A .  17 GLU CD   1 1 
        2   834 1 1 17 GLU CG   C    0.194   5.714  -4.327 1.00 . A A .  17 GLU CG   1 1 
        2   835 1 1 17 GLU H    H    2.766   4.245  -4.988 1.00 . A A .  17 GLU H    1 1 
        2   836 1 1 17 GLU HA   H    2.009   6.807  -6.193 1.00 . A A .  17 GLU HA   1 1 
        2   837 1 1 17 GLU HB2  H    2.013   6.022  -3.275 1.00 . A A .  17 GLU HB2  1 1 
        2   838 1 1 17 GLU HB3  H    1.317   7.479  -3.969 1.00 . A A .  17 GLU HB3  1 1 
        2   839 1 1 17 GLU HG2  H    0.363   4.816  -4.903 1.00 . A A .  17 GLU HG2  1 1 
        2   840 1 1 17 GLU HG3  H   -0.195   5.449  -3.355 1.00 . A A .  17 GLU HG3  1 1 
        2   841 1 1 17 GLU N    N    2.644   4.906  -5.701 1.00 . A A .  17 GLU N    1 1 
        2   842 1 1 17 GLU O    O    4.090   8.062  -5.531 1.00 . A A .  17 GLU O    1 1 
        2   843 1 1 17 GLU OE1  O   -0.561   6.987  -6.189 1.00 . A A .  17 GLU OE1  1 1 
        2   844 1 1 17 GLU OE2  O   -1.915   6.806  -4.467 1.00 . A A .  17 GLU OE2  1 1 
        2   845 1 1 18 CYS C    C    7.023   5.910  -4.301 1.00 . A A .  18 CYS C    1 1 
        2   846 1 1 18 CYS CA   C    5.905   6.838  -3.832 1.00 . A A .  18 CYS CA   1 1 
        2   847 1 1 18 CYS CB   C    5.983   7.022  -2.315 1.00 . A A .  18 CYS CB   1 1 
        2   848 1 1 18 CYS H    H    4.308   5.449  -3.848 1.00 . A A .  18 CYS H    1 1 
        2   849 1 1 18 CYS HA   H    6.028   7.798  -4.309 1.00 . A A .  18 CYS HA   1 1 
        2   850 1 1 18 CYS HB2  H    6.963   7.397  -2.055 1.00 . A A .  18 CYS HB2  1 1 
        2   851 1 1 18 CYS HB3  H    5.236   7.738  -2.008 1.00 . A A .  18 CYS HB3  1 1 
        2   852 1 1 18 CYS N    N    4.600   6.312  -4.211 1.00 . A A .  18 CYS N    1 1 
        2   853 1 1 18 CYS O    O    8.093   6.364  -4.702 1.00 . A A .  18 CYS O    1 1 
        2   854 1 1 18 CYS SG   S    5.708   5.491  -1.365 1.00 . A A .  18 CYS SG   1 1 
        2   855 1 1 19 GLY C    C    8.243   2.769  -3.524 1.00 . A A .  19 GLY C    1 1 
        2   856 1 1 19 GLY CA   C    7.756   3.636  -4.669 1.00 . A A .  19 GLY CA   1 1 
        2   857 1 1 19 GLY H    H    5.892   4.303  -3.918 1.00 . A A .  19 GLY H    1 1 
        2   858 1 1 19 GLY HA2  H    7.324   3.002  -5.428 1.00 . A A .  19 GLY HA2  1 1 
        2   859 1 1 19 GLY HA3  H    8.601   4.161  -5.091 1.00 . A A .  19 GLY HA3  1 1 
        2   860 1 1 19 GLY N    N    6.764   4.607  -4.247 1.00 . A A .  19 GLY N    1 1 
        2   861 1 1 19 GLY O    O    9.222   2.035  -3.663 1.00 . A A .  19 GLY O    1 1 
        2   862 1 1 20 LYS C    C    8.097   0.599  -1.571 1.00 . A A .  20 LYS C    1 1 
        2   863 1 1 20 LYS CA   C    7.927   2.072  -1.213 1.00 . A A .  20 LYS CA   1 1 
        2   864 1 1 20 LYS CB   C    6.865   2.223  -0.122 1.00 . A A .  20 LYS CB   1 1 
        2   865 1 1 20 LYS CD   C    6.621   2.902   2.284 1.00 . A A .  20 LYS CD   1 1 
        2   866 1 1 20 LYS CE   C    6.822   2.403   3.707 1.00 . A A .  20 LYS CE   1 1 
        2   867 1 1 20 LYS CG   C    7.414   2.074   1.286 1.00 . A A .  20 LYS CG   1 1 
        2   868 1 1 20 LYS H    H    6.788   3.457  -2.338 1.00 . A A .  20 LYS H    1 1 
        2   869 1 1 20 LYS HA   H    8.867   2.451  -0.843 1.00 . A A .  20 LYS HA   1 1 
        2   870 1 1 20 LYS HB2  H    6.413   3.201  -0.209 1.00 . A A .  20 LYS HB2  1 1 
        2   871 1 1 20 LYS HB3  H    6.104   1.470  -0.270 1.00 . A A .  20 LYS HB3  1 1 
        2   872 1 1 20 LYS HD2  H    6.948   3.930   2.226 1.00 . A A .  20 LYS HD2  1 1 
        2   873 1 1 20 LYS HD3  H    5.571   2.841   2.036 1.00 . A A .  20 LYS HD3  1 1 
        2   874 1 1 20 LYS HE2  H    5.984   2.720   4.308 1.00 . A A .  20 LYS HE2  1 1 
        2   875 1 1 20 LYS HE3  H    6.866   1.324   3.692 1.00 . A A .  20 LYS HE3  1 1 
        2   876 1 1 20 LYS HG2  H    7.362   1.035   1.575 1.00 . A A .  20 LYS HG2  1 1 
        2   877 1 1 20 LYS HG3  H    8.444   2.402   1.298 1.00 . A A .  20 LYS HG3  1 1 
        2   878 1 1 20 LYS HZ1  H    7.877   3.788   4.862 1.00 . A A .  20 LYS HZ1  1 1 
        2   879 1 1 20 LYS HZ2  H    8.760   3.167   3.559 1.00 . A A .  20 LYS HZ2  1 1 
        2   880 1 1 20 LYS HZ3  H    8.502   2.218   4.934 1.00 . A A .  20 LYS HZ3  1 1 
        2   881 1 1 20 LYS N    N    7.559   2.854  -2.388 1.00 . A A .  20 LYS N    1 1 
        2   882 1 1 20 LYS NZ   N    8.078   2.931   4.308 1.00 . A A .  20 LYS NZ   1 1 
        2   883 1 1 20 LYS O    O    7.958   0.213  -2.731 1.00 . A A .  20 LYS O    1 1 
        2   884 1 1 21 ALA C    C    8.038  -2.451   0.401 1.00 . A A .  21 ALA C    1 1 
        2   885 1 1 21 ALA CA   C    8.582  -1.649  -0.777 1.00 . A A .  21 ALA CA   1 1 
        2   886 1 1 21 ALA CB   C   10.054  -1.964  -0.998 1.00 . A A .  21 ALA CB   1 1 
        2   887 1 1 21 ALA H    H    8.494   0.149   0.336 1.00 . A A .  21 ALA H    1 1 
        2   888 1 1 21 ALA HA   H    8.041  -1.928  -1.669 1.00 . A A .  21 ALA HA   1 1 
        2   889 1 1 21 ALA HB1  H   10.578  -1.059  -1.267 1.00 . A A .  21 ALA HB1  1 1 
        2   890 1 1 21 ALA HB2  H   10.475  -2.368  -0.089 1.00 . A A .  21 ALA HB2  1 1 
        2   891 1 1 21 ALA HB3  H   10.151  -2.688  -1.793 1.00 . A A .  21 ALA HB3  1 1 
        2   892 1 1 21 ALA N    N    8.397  -0.218  -0.567 1.00 . A A .  21 ALA N    1 1 
        2   893 1 1 21 ALA O    O    8.101  -2.008   1.548 1.00 . A A .  21 ALA O    1 1 
        2   894 1 1 22 PHE C    C    7.184  -5.966   0.813 1.00 . A A .  22 PHE C    1 1 
        2   895 1 1 22 PHE CA   C    6.948  -4.496   1.146 1.00 . A A .  22 PHE CA   1 1 
        2   896 1 1 22 PHE CB   C    5.450  -4.232   1.309 1.00 . A A .  22 PHE CB   1 1 
        2   897 1 1 22 PHE CD1  C    5.012  -1.852   0.643 1.00 . A A .  22 PHE CD1  1 1 
        2   898 1 1 22 PHE CD2  C    4.935  -2.414   2.960 1.00 . A A .  22 PHE CD2  1 1 
        2   899 1 1 22 PHE CE1  C    4.713  -0.538   0.948 1.00 . A A .  22 PHE CE1  1 1 
        2   900 1 1 22 PHE CE2  C    4.635  -1.101   3.270 1.00 . A A .  22 PHE CE2  1 1 
        2   901 1 1 22 PHE CG   C    5.126  -2.804   1.644 1.00 . A A .  22 PHE CG   1 1 
        2   902 1 1 22 PHE CZ   C    4.526  -0.161   2.264 1.00 . A A .  22 PHE CZ   1 1 
        2   903 1 1 22 PHE H    H    7.483  -3.931  -0.823 1.00 . A A .  22 PHE H    1 1 
        2   904 1 1 22 PHE HA   H    7.449  -4.264   2.073 1.00 . A A .  22 PHE HA   1 1 
        2   905 1 1 22 PHE HB2  H    4.946  -4.478   0.387 1.00 . A A .  22 PHE HB2  1 1 
        2   906 1 1 22 PHE HB3  H    5.066  -4.856   2.102 1.00 . A A .  22 PHE HB3  1 1 
        2   907 1 1 22 PHE HD1  H    5.159  -2.146  -0.387 1.00 . A A .  22 PHE HD1  1 1 
        2   908 1 1 22 PHE HD2  H    5.021  -3.147   3.748 1.00 . A A .  22 PHE HD2  1 1 
        2   909 1 1 22 PHE HE1  H    4.628   0.194   0.158 1.00 . A A .  22 PHE HE1  1 1 
        2   910 1 1 22 PHE HE2  H    4.489  -0.809   4.300 1.00 . A A .  22 PHE HE2  1 1 
        2   911 1 1 22 PHE HZ   H    4.292   0.865   2.504 1.00 . A A .  22 PHE HZ   1 1 
        2   912 1 1 22 PHE N    N    7.504  -3.633   0.111 1.00 . A A .  22 PHE N    1 1 
        2   913 1 1 22 PHE O    O    7.454  -6.317  -0.336 1.00 . A A .  22 PHE O    1 1 
        2   914 1 1 23 ILE C    C    5.995  -8.934   1.190 1.00 . A A .  23 ILE C    1 1 
        2   915 1 1 23 ILE CA   C    7.282  -8.251   1.641 1.00 . A A .  23 ILE CA   1 1 
        2   916 1 1 23 ILE CB   C    7.778  -8.922   2.936 1.00 . A A .  23 ILE CB   1 1 
        2   917 1 1 23 ILE CD1  C    9.440  -8.588   4.835 1.00 . A A .  23 ILE CD1  1 1 
        2   918 1 1 23 ILE CG1  C    9.092  -8.285   3.394 1.00 . A A .  23 ILE CG1  1 1 
        2   919 1 1 23 ILE CG2  C    7.954 -10.418   2.723 1.00 . A A .  23 ILE CG2  1 1 
        2   920 1 1 23 ILE H    H    6.863  -6.479   2.718 1.00 . A A .  23 ILE H    1 1 
        2   921 1 1 23 ILE HA   H    8.035  -8.386   0.878 1.00 . A A .  23 ILE HA   1 1 
        2   922 1 1 23 ILE HB   H    7.030  -8.777   3.700 1.00 . A A .  23 ILE HB   1 1 
        2   923 1 1 23 ILE HD11 H   10.258  -7.955   5.148 1.00 . A A .  23 ILE HD11 1 1 
        2   924 1 1 23 ILE HD12 H    8.580  -8.399   5.461 1.00 . A A .  23 ILE HD12 1 1 
        2   925 1 1 23 ILE HD13 H    9.731  -9.623   4.925 1.00 . A A .  23 ILE HD13 1 1 
        2   926 1 1 23 ILE HG12 H    9.897  -8.650   2.776 1.00 . A A .  23 ILE HG12 1 1 
        2   927 1 1 23 ILE HG13 H    9.019  -7.212   3.288 1.00 . A A .  23 ILE HG13 1 1 
        2   928 1 1 23 ILE HG21 H    8.562 -10.825   3.518 1.00 . A A .  23 ILE HG21 1 1 
        2   929 1 1 23 ILE HG22 H    6.987 -10.898   2.728 1.00 . A A .  23 ILE HG22 1 1 
        2   930 1 1 23 ILE HG23 H    8.439 -10.593   1.774 1.00 . A A .  23 ILE HG23 1 1 
        2   931 1 1 23 ILE N    N    7.080  -6.820   1.826 1.00 . A A .  23 ILE N    1 1 
        2   932 1 1 23 ILE O    O    6.019  -9.831   0.347 1.00 . A A .  23 ILE O    1 1 
        2   933 1 1 24 ARG C    C    2.614  -7.984   0.938 1.00 . A A .  24 ARG C    1 1 
        2   934 1 1 24 ARG CA   C    3.575  -9.070   1.411 1.00 . A A .  24 ARG CA   1 1 
        2   935 1 1 24 ARG CB   C    2.980  -9.804   2.614 1.00 . A A .  24 ARG CB   1 1 
        2   936 1 1 24 ARG CD   C    3.124 -11.887   4.013 1.00 . A A .  24 ARG CD   1 1 
        2   937 1 1 24 ARG CG   C    3.899 -10.866   3.194 1.00 . A A .  24 ARG CG   1 1 
        2   938 1 1 24 ARG CZ   C    4.534 -13.893   4.193 1.00 . A A .  24 ARG CZ   1 1 
        2   939 1 1 24 ARG H    H    4.918  -7.783   2.421 1.00 . A A .  24 ARG H    1 1 
        2   940 1 1 24 ARG HA   H    3.725  -9.776   0.608 1.00 . A A .  24 ARG HA   1 1 
        2   941 1 1 24 ARG HB2  H    2.764  -9.084   3.389 1.00 . A A .  24 ARG HB2  1 1 
        2   942 1 1 24 ARG HB3  H    2.061 -10.281   2.310 1.00 . A A .  24 ARG HB3  1 1 
        2   943 1 1 24 ARG HD2  H    2.506 -11.362   4.726 1.00 . A A .  24 ARG HD2  1 1 
        2   944 1 1 24 ARG HD3  H    2.497 -12.460   3.347 1.00 . A A .  24 ARG HD3  1 1 
        2   945 1 1 24 ARG HE   H    4.224 -12.582   5.664 1.00 . A A .  24 ARG HE   1 1 
        2   946 1 1 24 ARG HG2  H    4.401 -11.376   2.385 1.00 . A A .  24 ARG HG2  1 1 
        2   947 1 1 24 ARG HG3  H    4.630 -10.388   3.830 1.00 . A A .  24 ARG HG3  1 1 
        2   948 1 1 24 ARG HH11 H    3.663 -13.625   2.390 1.00 . A A .  24 ARG HH11 1 1 
        2   949 1 1 24 ARG HH12 H    4.659 -15.036   2.531 1.00 . A A .  24 ARG HH12 1 1 
        2   950 1 1 24 ARG HH21 H    5.538 -14.436   5.861 1.00 . A A .  24 ARG HH21 1 1 
        2   951 1 1 24 ARG HH22 H    5.725 -15.496   4.506 1.00 . A A .  24 ARG HH22 1 1 
        2   952 1 1 24 ARG N    N    4.873  -8.501   1.755 1.00 . A A .  24 ARG N    1 1 
        2   953 1 1 24 ARG NE   N    4.010 -12.798   4.733 1.00 . A A .  24 ARG NE   1 1 
        2   954 1 1 24 ARG NH1  N    4.263 -14.211   2.935 1.00 . A A .  24 ARG NH1  1 1 
        2   955 1 1 24 ARG NH2  N    5.331 -14.672   4.913 1.00 . A A .  24 ARG NH2  1 1 
        2   956 1 1 24 ARG O    O    2.578  -6.887   1.495 1.00 . A A .  24 ARG O    1 1 
        2   957 1 1 25 ASN C    C    0.076  -6.676   0.472 1.00 . A A .  25 ASN C    1 1 
        2   958 1 1 25 ASN CA   C    0.874  -7.347  -0.642 1.00 . A A .  25 ASN CA   1 1 
        2   959 1 1 25 ASN CB   C   -0.076  -8.053  -1.611 1.00 . A A .  25 ASN CB   1 1 
        2   960 1 1 25 ASN CG   C   -0.612  -7.119  -2.679 1.00 . A A .  25 ASN CG   1 1 
        2   961 1 1 25 ASN H    H    1.910  -9.187  -0.495 1.00 . A A .  25 ASN H    1 1 
        2   962 1 1 25 ASN HA   H    1.426  -6.591  -1.179 1.00 . A A .  25 ASN HA   1 1 
        2   963 1 1 25 ASN HB2  H    0.451  -8.861  -2.098 1.00 . A A .  25 ASN HB2  1 1 
        2   964 1 1 25 ASN HB3  H   -0.911  -8.456  -1.058 1.00 . A A .  25 ASN HB3  1 1 
        2   965 1 1 25 ASN HD21 H   -0.747  -5.642  -1.354 1.00 . A A .  25 ASN HD21 1 1 
        2   966 1 1 25 ASN HD22 H   -1.244  -5.257  -2.963 1.00 . A A .  25 ASN HD22 1 1 
        2   967 1 1 25 ASN N    N    1.836  -8.297  -0.093 1.00 . A A .  25 ASN N    1 1 
        2   968 1 1 25 ASN ND2  N   -0.896  -5.881  -2.293 1.00 . A A .  25 ASN ND2  1 1 
        2   969 1 1 25 ASN O    O    0.026  -5.449   0.561 1.00 . A A .  25 ASN O    1 1 
        2   970 1 1 25 ASN OD1  O   -0.767  -7.507  -3.837 1.00 . A A .  25 ASN OD1  1 1 
        2   971 1 1 26 SER C    C   -0.616  -5.839   3.139 1.00 . A A .  26 SER C    1 1 
        2   972 1 1 26 SER CA   C   -1.343  -6.975   2.427 1.00 . A A .  26 SER CA   1 1 
        2   973 1 1 26 SER CB   C   -1.658  -8.095   3.420 1.00 . A A .  26 SER CB   1 1 
        2   974 1 1 26 SER H    H   -0.466  -8.459   1.197 1.00 . A A .  26 SER H    1 1 
        2   975 1 1 26 SER HA   H   -2.268  -6.595   2.020 1.00 . A A .  26 SER HA   1 1 
        2   976 1 1 26 SER HB2  H   -2.168  -7.681   4.276 1.00 . A A .  26 SER HB2  1 1 
        2   977 1 1 26 SER HB3  H   -2.293  -8.828   2.942 1.00 . A A .  26 SER HB3  1 1 
        2   978 1 1 26 SER HG   H    0.215  -8.624   3.200 1.00 . A A .  26 SER HG   1 1 
        2   979 1 1 26 SER N    N   -0.545  -7.489   1.320 1.00 . A A .  26 SER N    1 1 
        2   980 1 1 26 SER O    O   -1.241  -4.896   3.625 1.00 . A A .  26 SER O    1 1 
        2   981 1 1 26 SER OG   O   -0.473  -8.736   3.860 1.00 . A A .  26 SER OG   1 1 
        2   982 1 1 27 GLN C    C    1.482  -3.607   3.070 1.00 . A A .  27 GLN C    1 1 
        2   983 1 1 27 GLN CA   C    1.521  -4.917   3.850 1.00 . A A .  27 GLN CA   1 1 
        2   984 1 1 27 GLN CB   C    2.966  -5.399   3.989 1.00 . A A .  27 GLN CB   1 1 
        2   985 1 1 27 GLN CD   C    3.237  -6.604   6.194 1.00 . A A .  27 GLN CD   1 1 
        2   986 1 1 27 GLN CG   C    3.095  -6.742   4.691 1.00 . A A .  27 GLN CG   1 1 
        2   987 1 1 27 GLN H    H    1.149  -6.711   2.791 1.00 . A A .  27 GLN H    1 1 
        2   988 1 1 27 GLN HA   H    1.112  -4.748   4.835 1.00 . A A .  27 GLN HA   1 1 
        2   989 1 1 27 GLN HB2  H    3.400  -5.488   3.004 1.00 . A A .  27 GLN HB2  1 1 
        2   990 1 1 27 GLN HB3  H    3.524  -4.667   4.554 1.00 . A A .  27 GLN HB3  1 1 
        2   991 1 1 27 GLN HE21 H    4.683  -7.968   6.207 1.00 . A A .  27 GLN HE21 1 1 
        2   992 1 1 27 GLN HE22 H    4.268  -7.298   7.745 1.00 . A A .  27 GLN HE22 1 1 
        2   993 1 1 27 GLN HG2  H    2.214  -7.329   4.480 1.00 . A A .  27 GLN HG2  1 1 
        2   994 1 1 27 GLN HG3  H    3.967  -7.251   4.307 1.00 . A A .  27 GLN HG3  1 1 
        2   995 1 1 27 GLN N    N    0.708  -5.936   3.197 1.00 . A A .  27 GLN N    1 1 
        2   996 1 1 27 GLN NE2  N    4.154  -7.367   6.775 1.00 . A A .  27 GLN NE2  1 1 
        2   997 1 1 27 GLN O    O    1.255  -2.539   3.641 1.00 . A A .  27 GLN O    1 1 
        2   998 1 1 27 GLN OE1  O    2.529  -5.819   6.826 1.00 . A A .  27 GLN OE1  1 1 
        2   999 1 1 28 LEU C    C    0.337  -1.826   0.941 1.00 . A A .  28 LEU C    1 1 
        2  1000 1 1 28 LEU CA   C    1.697  -2.517   0.905 1.00 . A A .  28 LEU CA   1 1 
        2  1001 1 1 28 LEU CB   C    2.045  -2.906  -0.533 1.00 . A A .  28 LEU CB   1 1 
        2  1002 1 1 28 LEU CD1  C    2.474  -0.573  -1.343 1.00 . A A .  28 LEU CD1  1 1 
        2  1003 1 1 28 LEU CD2  C    2.054  -2.409  -2.990 1.00 . A A .  28 LEU CD2  1 1 
        2  1004 1 1 28 LEU CG   C    1.721  -1.868  -1.608 1.00 . A A .  28 LEU CG   1 1 
        2  1005 1 1 28 LEU H    H    1.881  -4.574   1.367 1.00 . A A .  28 LEU H    1 1 
        2  1006 1 1 28 LEU HA   H    2.445  -1.831   1.274 1.00 . A A .  28 LEU HA   1 1 
        2  1007 1 1 28 LEU HB2  H    3.105  -3.105  -0.574 1.00 . A A .  28 LEU HB2  1 1 
        2  1008 1 1 28 LEU HB3  H    1.502  -3.810  -0.770 1.00 . A A .  28 LEU HB3  1 1 
        2  1009 1 1 28 LEU HD11 H    2.063  -0.090  -0.470 1.00 . A A .  28 LEU HD11 1 1 
        2  1010 1 1 28 LEU HD12 H    2.376   0.081  -2.197 1.00 . A A .  28 LEU HD12 1 1 
        2  1011 1 1 28 LEU HD13 H    3.519  -0.793  -1.177 1.00 . A A .  28 LEU HD13 1 1 
        2  1012 1 1 28 LEU HD21 H    1.827  -3.463  -3.029 1.00 . A A .  28 LEU HD21 1 1 
        2  1013 1 1 28 LEU HD22 H    3.105  -2.259  -3.191 1.00 . A A .  28 LEU HD22 1 1 
        2  1014 1 1 28 LEU HD23 H    1.468  -1.886  -3.732 1.00 . A A .  28 LEU HD23 1 1 
        2  1015 1 1 28 LEU HG   H    0.662  -1.649  -1.580 1.00 . A A .  28 LEU HG   1 1 
        2  1016 1 1 28 LEU N    N    1.706  -3.695   1.764 1.00 . A A .  28 LEU N    1 1 
        2  1017 1 1 28 LEU O    O    0.238  -0.647   1.281 1.00 . A A .  28 LEU O    1 1 
        2  1018 1 1 29 ILE C    C   -2.276  -1.076   1.758 1.00 . A A .  29 ILE C    1 1 
        2  1019 1 1 29 ILE CA   C   -2.061  -2.030   0.588 1.00 . A A .  29 ILE CA   1 1 
        2  1020 1 1 29 ILE CB   C   -3.115  -3.151   0.654 1.00 . A A .  29 ILE CB   1 1 
        2  1021 1 1 29 ILE CD1  C   -3.837  -5.313  -0.478 1.00 . A A .  29 ILE CD1  1 1 
        2  1022 1 1 29 ILE CG1  C   -3.015  -4.048  -0.582 1.00 . A A .  29 ILE CG1  1 1 
        2  1023 1 1 29 ILE CG2  C   -4.511  -2.560   0.774 1.00 . A A .  29 ILE CG2  1 1 
        2  1024 1 1 29 ILE H    H   -0.564  -3.503   0.330 1.00 . A A .  29 ILE H    1 1 
        2  1025 1 1 29 ILE HA   H   -2.201  -1.486  -0.336 1.00 . A A .  29 ILE HA   1 1 
        2  1026 1 1 29 ILE HB   H   -2.923  -3.743   1.536 1.00 . A A .  29 ILE HB   1 1 
        2  1027 1 1 29 ILE HD11 H   -3.682  -5.765   0.491 1.00 . A A .  29 ILE HD11 1 1 
        2  1028 1 1 29 ILE HD12 H   -4.884  -5.074  -0.598 1.00 . A A .  29 ILE HD12 1 1 
        2  1029 1 1 29 ILE HD13 H   -3.534  -6.005  -1.250 1.00 . A A .  29 ILE HD13 1 1 
        2  1030 1 1 29 ILE HG12 H   -3.357  -3.500  -1.445 1.00 . A A .  29 ILE HG12 1 1 
        2  1031 1 1 29 ILE HG13 H   -1.983  -4.333  -0.727 1.00 . A A .  29 ILE HG13 1 1 
        2  1032 1 1 29 ILE HG21 H   -4.977  -2.918   1.680 1.00 . A A .  29 ILE HG21 1 1 
        2  1033 1 1 29 ILE HG22 H   -4.444  -1.483   0.807 1.00 . A A .  29 ILE HG22 1 1 
        2  1034 1 1 29 ILE HG23 H   -5.104  -2.858  -0.077 1.00 . A A .  29 ILE HG23 1 1 
        2  1035 1 1 29 ILE N    N   -0.707  -2.569   0.591 1.00 . A A .  29 ILE N    1 1 
        2  1036 1 1 29 ILE O    O   -2.756   0.043   1.581 1.00 . A A .  29 ILE O    1 1 
        2  1037 1 1 30 VAL C    C   -1.373   0.636   3.995 1.00 . A A .  30 VAL C    1 1 
        2  1038 1 1 30 VAL CA   C   -2.065  -0.713   4.156 1.00 . A A .  30 VAL CA   1 1 
        2  1039 1 1 30 VAL CB   C   -1.491  -1.427   5.394 1.00 . A A .  30 VAL CB   1 1 
        2  1040 1 1 30 VAL CG1  C   -1.506  -0.501   6.600 1.00 . A A .  30 VAL CG1  1 1 
        2  1041 1 1 30 VAL CG2  C   -2.270  -2.702   5.681 1.00 . A A .  30 VAL CG2  1 1 
        2  1042 1 1 30 VAL H    H   -1.538  -2.428   3.033 1.00 . A A .  30 VAL H    1 1 
        2  1043 1 1 30 VAL HA   H   -3.120  -0.548   4.318 1.00 . A A .  30 VAL HA   1 1 
        2  1044 1 1 30 VAL HB   H   -0.466  -1.696   5.186 1.00 . A A .  30 VAL HB   1 1 
        2  1045 1 1 30 VAL HG11 H   -2.335   0.187   6.515 1.00 . A A .  30 VAL HG11 1 1 
        2  1046 1 1 30 VAL HG12 H   -1.611  -1.085   7.502 1.00 . A A .  30 VAL HG12 1 1 
        2  1047 1 1 30 VAL HG13 H   -0.581   0.056   6.637 1.00 . A A .  30 VAL HG13 1 1 
        2  1048 1 1 30 VAL HG21 H   -2.430  -2.795   6.745 1.00 . A A .  30 VAL HG21 1 1 
        2  1049 1 1 30 VAL HG22 H   -3.223  -2.662   5.175 1.00 . A A .  30 VAL HG22 1 1 
        2  1050 1 1 30 VAL HG23 H   -1.710  -3.555   5.326 1.00 . A A .  30 VAL HG23 1 1 
        2  1051 1 1 30 VAL N    N   -1.915  -1.527   2.955 1.00 . A A .  30 VAL N    1 1 
        2  1052 1 1 30 VAL O    O   -1.884   1.665   4.438 1.00 . A A .  30 VAL O    1 1 
        2  1053 1 1 31 HIS C    C   -0.106   2.716   2.071 1.00 . A A .  31 HIS C    1 1 
        2  1054 1 1 31 HIS CA   C    0.556   1.848   3.137 1.00 . A A .  31 HIS CA   1 1 
        2  1055 1 1 31 HIS CB   C    1.989   1.513   2.721 1.00 . A A .  31 HIS CB   1 1 
        2  1056 1 1 31 HIS CD2  C    3.050   3.143   1.005 1.00 . A A .  31 HIS CD2  1 1 
        2  1057 1 1 31 HIS CE1  C    3.984   4.534   2.419 1.00 . A A .  31 HIS CE1  1 1 
        2  1058 1 1 31 HIS CG   C    2.770   2.702   2.254 1.00 . A A .  31 HIS CG   1 1 
        2  1059 1 1 31 HIS H    H    0.149  -0.227   3.028 1.00 . A A .  31 HIS H    1 1 
        2  1060 1 1 31 HIS HA   H    0.580   2.396   4.066 1.00 . A A .  31 HIS HA   1 1 
        2  1061 1 1 31 HIS HB2  H    2.510   1.084   3.563 1.00 . A A .  31 HIS HB2  1 1 
        2  1062 1 1 31 HIS HB3  H    1.964   0.794   1.914 1.00 . A A .  31 HIS HB3  1 1 
        2  1063 1 1 31 HIS HD1  H    3.348   3.548   4.095 1.00 . A A .  31 HIS HD1  1 1 
        2  1064 1 1 31 HIS HD2  H    2.738   2.684   0.077 1.00 . A A .  31 HIS HD2  1 1 
        2  1065 1 1 31 HIS HE1  H    4.538   5.365   2.828 1.00 . A A .  31 HIS HE1  1 1 
        2  1066 1 1 31 HIS N    N   -0.207   0.625   3.358 1.00 . A A .  31 HIS N    1 1 
        2  1067 1 1 31 HIS ND1  N    3.370   3.595   3.117 1.00 . A A .  31 HIS ND1  1 1 
        2  1068 1 1 31 HIS NE2  N    3.805   4.282   1.134 1.00 . A A .  31 HIS NE2  1 1 
        2  1069 1 1 31 HIS O    O    0.144   3.919   1.994 1.00 . A A .  31 HIS O    1 1 
        2  1070 1 1 32 GLN C    C   -2.904   3.493   0.725 1.00 . A A .  32 GLN C    1 1 
        2  1071 1 1 32 GLN CA   C   -1.647   2.815   0.190 1.00 . A A .  32 GLN CA   1 1 
        2  1072 1 1 32 GLN CB   C   -2.013   1.858  -0.945 1.00 . A A .  32 GLN CB   1 1 
        2  1073 1 1 32 GLN CD   C   -1.189   0.504  -2.913 1.00 . A A .  32 GLN CD   1 1 
        2  1074 1 1 32 GLN CG   C   -0.806   1.288  -1.673 1.00 . A A .  32 GLN CG   1 1 
        2  1075 1 1 32 GLN H    H   -1.109   1.138   1.364 1.00 . A A .  32 GLN H    1 1 
        2  1076 1 1 32 GLN HA   H   -0.979   3.573  -0.191 1.00 . A A .  32 GLN HA   1 1 
        2  1077 1 1 32 GLN HB2  H   -2.582   1.036  -0.538 1.00 . A A .  32 GLN HB2  1 1 
        2  1078 1 1 32 GLN HB3  H   -2.622   2.387  -1.664 1.00 . A A .  32 GLN HB3  1 1 
        2  1079 1 1 32 GLN HE21 H   -0.141   1.749  -4.054 1.00 . A A .  32 GLN HE21 1 1 
        2  1080 1 1 32 GLN HE22 H   -0.939   0.462  -4.884 1.00 . A A .  32 GLN HE22 1 1 
        2  1081 1 1 32 GLN HG2  H   -0.161   2.103  -1.967 1.00 . A A .  32 GLN HG2  1 1 
        2  1082 1 1 32 GLN HG3  H   -0.273   0.633  -1.000 1.00 . A A .  32 GLN HG3  1 1 
        2  1083 1 1 32 GLN N    N   -0.951   2.098   1.252 1.00 . A A .  32 GLN N    1 1 
        2  1084 1 1 32 GLN NE2  N   -0.709   0.950  -4.068 1.00 . A A .  32 GLN NE2  1 1 
        2  1085 1 1 32 GLN O    O   -3.368   4.489   0.170 1.00 . A A .  32 GLN O    1 1 
        2  1086 1 1 32 GLN OE1  O   -1.908  -0.492  -2.833 1.00 . A A .  32 GLN OE1  1 1 
        2  1087 1 1 33 ARG C    C   -4.535   5.007   2.591 1.00 . A A .  33 ARG C    1 1 
        2  1088 1 1 33 ARG CA   C   -4.657   3.496   2.414 1.00 . A A .  33 ARG CA   1 1 
        2  1089 1 1 33 ARG CB   C   -4.920   2.833   3.767 1.00 . A A .  33 ARG CB   1 1 
        2  1090 1 1 33 ARG CD   C   -5.434   0.728   5.040 1.00 . A A .  33 ARG CD   1 1 
        2  1091 1 1 33 ARG CG   C   -5.114   1.328   3.680 1.00 . A A .  33 ARG CG   1 1 
        2  1092 1 1 33 ARG CZ   C   -7.205  -0.943   4.696 1.00 . A A .  33 ARG CZ   1 1 
        2  1093 1 1 33 ARG H    H   -3.036   2.151   2.202 1.00 . A A .  33 ARG H    1 1 
        2  1094 1 1 33 ARG HA   H   -5.486   3.289   1.754 1.00 . A A .  33 ARG HA   1 1 
        2  1095 1 1 33 ARG HB2  H   -4.082   3.028   4.419 1.00 . A A .  33 ARG HB2  1 1 
        2  1096 1 1 33 ARG HB3  H   -5.810   3.264   4.199 1.00 . A A .  33 ARG HB3  1 1 
        2  1097 1 1 33 ARG HD2  H   -4.536   0.726   5.639 1.00 . A A .  33 ARG HD2  1 1 
        2  1098 1 1 33 ARG HD3  H   -6.185   1.338   5.519 1.00 . A A .  33 ARG HD3  1 1 
        2  1099 1 1 33 ARG HE   H   -5.287  -1.369   5.038 1.00 . A A .  33 ARG HE   1 1 
        2  1100 1 1 33 ARG HG2  H   -5.930   1.117   3.004 1.00 . A A .  33 ARG HG2  1 1 
        2  1101 1 1 33 ARG HG3  H   -4.207   0.879   3.302 1.00 . A A .  33 ARG HG3  1 1 
        2  1102 1 1 33 ARG HH11 H   -7.821   0.979   4.609 1.00 . A A .  33 ARG HH11 1 1 
        2  1103 1 1 33 ARG HH12 H   -9.059  -0.208   4.368 1.00 . A A .  33 ARG HH12 1 1 
        2  1104 1 1 33 ARG HH21 H   -6.908  -2.942   4.722 1.00 . A A .  33 ARG HH21 1 1 
        2  1105 1 1 33 ARG HH22 H   -8.539  -2.439   4.433 1.00 . A A .  33 ARG HH22 1 1 
        2  1106 1 1 33 ARG N    N   -3.452   2.945   1.805 1.00 . A A .  33 ARG N    1 1 
        2  1107 1 1 33 ARG NE   N   -5.933  -0.641   4.930 1.00 . A A .  33 ARG NE   1 1 
        2  1108 1 1 33 ARG NH1  N   -8.102   0.022   4.546 1.00 . A A .  33 ARG NH1  1 1 
        2  1109 1 1 33 ARG NH2  N   -7.582  -2.212   4.610 1.00 . A A .  33 ARG NH2  1 1 
        2  1110 1 1 33 ARG O    O   -5.469   5.755   2.303 1.00 . A A .  33 ARG O    1 1 
        2  1111 1 1 34 THR C    C   -3.044   7.622   1.963 1.00 . A A .  34 THR C    1 1 
        2  1112 1 1 34 THR CA   C   -3.131   6.870   3.286 1.00 . A A .  34 THR CA   1 1 
        2  1113 1 1 34 THR CB   C   -1.832   7.101   4.081 1.00 . A A .  34 THR CB   1 1 
        2  1114 1 1 34 THR CG2  C   -0.628   6.570   3.317 1.00 . A A .  34 THR CG2  1 1 
        2  1115 1 1 34 THR H    H   -2.669   4.804   3.279 1.00 . A A .  34 THR H    1 1 
        2  1116 1 1 34 THR HA   H   -3.955   7.266   3.861 1.00 . A A .  34 THR HA   1 1 
        2  1117 1 1 34 THR HB   H   -1.904   6.573   5.021 1.00 . A A .  34 THR HB   1 1 
        2  1118 1 1 34 THR HG1  H   -0.752   8.664   4.609 1.00 . A A .  34 THR HG1  1 1 
        2  1119 1 1 34 THR HG21 H    0.161   6.327   4.012 1.00 . A A .  34 THR HG21 1 1 
        2  1120 1 1 34 THR HG22 H   -0.279   7.324   2.626 1.00 . A A .  34 THR HG22 1 1 
        2  1121 1 1 34 THR HG23 H   -0.912   5.683   2.770 1.00 . A A .  34 THR HG23 1 1 
        2  1122 1 1 34 THR N    N   -3.375   5.450   3.068 1.00 . A A .  34 THR N    1 1 
        2  1123 1 1 34 THR O    O   -3.524   8.750   1.846 1.00 . A A .  34 THR O    1 1 
        2  1124 1 1 34 THR OG1  O   -1.659   8.498   4.342 1.00 . A A .  34 THR OG1  1 1 
        2  1125 1 1 35 HIS C    C   -3.643   7.833  -0.996 1.00 . A A .  35 HIS C    1 1 
        2  1126 1 1 35 HIS CA   C   -2.282   7.600  -0.349 1.00 . A A .  35 HIS CA   1 1 
        2  1127 1 1 35 HIS CB   C   -1.420   6.715  -1.250 1.00 . A A .  35 HIS CB   1 1 
        2  1128 1 1 35 HIS CD2  C    1.070   6.324  -0.640 1.00 . A A .  35 HIS CD2  1 1 
        2  1129 1 1 35 HIS CE1  C    1.898   8.178  -1.468 1.00 . A A .  35 HIS CE1  1 1 
        2  1130 1 1 35 HIS CG   C    0.043   7.026  -1.173 1.00 . A A .  35 HIS CG   1 1 
        2  1131 1 1 35 HIS H    H   -2.068   6.093   1.122 1.00 . A A .  35 HIS H    1 1 
        2  1132 1 1 35 HIS HA   H   -1.791   8.553  -0.220 1.00 . A A .  35 HIS HA   1 1 
        2  1133 1 1 35 HIS HB2  H   -1.555   5.683  -0.965 1.00 . A A .  35 HIS HB2  1 1 
        2  1134 1 1 35 HIS HB3  H   -1.734   6.844  -2.276 1.00 . A A .  35 HIS HB3  1 1 
        2  1135 1 1 35 HIS HD1  H    0.104   8.899  -2.136 1.00 . A A .  35 HIS HD1  1 1 
        2  1136 1 1 35 HIS HD2  H    1.005   5.362  -0.151 1.00 . A A .  35 HIS HD2  1 1 
        2  1137 1 1 35 HIS HE1  H    2.590   8.954  -1.758 1.00 . A A .  35 HIS HE1  1 1 
        2  1138 1 1 35 HIS N    N   -2.430   6.990   0.968 1.00 . A A .  35 HIS N    1 1 
        2  1139 1 1 35 HIS ND1  N    0.595   8.183  -1.683 1.00 . A A .  35 HIS ND1  1 1 
        2  1140 1 1 35 HIS NE2  N    2.212   7.061  -0.836 1.00 . A A .  35 HIS NE2  1 1 
        2  1141 1 1 35 HIS O    O   -3.868   8.857  -1.642 1.00 . A A .  35 HIS O    1 1 
        2  1142 1 1 36 SER C    C   -6.382   8.418  -1.367 1.00 . A A .  36 SER C    1 1 
        2  1143 1 1 36 SER CA   C   -5.887   6.975  -1.390 1.00 . A A .  36 SER CA   1 1 
        2  1144 1 1 36 SER CB   C   -6.860   6.078  -0.622 1.00 . A A .  36 SER CB   1 1 
        2  1145 1 1 36 SER H    H   -4.310   6.084  -0.295 1.00 . A A .  36 SER H    1 1 
        2  1146 1 1 36 SER HA   H   -5.836   6.641  -2.415 1.00 . A A .  36 SER HA   1 1 
        2  1147 1 1 36 SER HB2  H   -6.815   6.320   0.429 1.00 . A A .  36 SER HB2  1 1 
        2  1148 1 1 36 SER HB3  H   -7.863   6.244  -0.987 1.00 . A A .  36 SER HB3  1 1 
        2  1149 1 1 36 SER HG   H   -5.626   4.632  -1.097 1.00 . A A .  36 SER HG   1 1 
        2  1150 1 1 36 SER N    N   -4.549   6.876  -0.819 1.00 . A A .  36 SER N    1 1 
        2  1151 1 1 36 SER O    O   -6.885   8.929  -2.366 1.00 . A A .  36 SER O    1 1 
        2  1152 1 1 36 SER OG   O   -6.532   4.710  -0.790 1.00 . A A .  36 SER OG   1 1 
        2  1153 1 1 37 GLY C    C   -6.154  11.330  -1.202 1.00 . A A .  37 GLY C    1 1 
        2  1154 1 1 37 GLY CA   C   -6.672  10.447  -0.084 1.00 . A A .  37 GLY CA   1 1 
        2  1155 1 1 37 GLY H    H   -5.827   8.611   0.547 1.00 . A A .  37 GLY H    1 1 
        2  1156 1 1 37 GLY HA2  H   -7.751  10.473  -0.089 1.00 . A A .  37 GLY HA2  1 1 
        2  1157 1 1 37 GLY HA3  H   -6.317  10.835   0.859 1.00 . A A .  37 GLY HA3  1 1 
        2  1158 1 1 37 GLY N    N   -6.235   9.070  -0.217 1.00 . A A .  37 GLY N    1 1 
        2  1159 1 1 37 GLY O    O   -6.775  11.432  -2.259 1.00 . A A .  37 GLY O    1 1 
        2  1160 1 1 38 GLU C    C   -3.942  12.058  -3.178 1.00 . A A .  38 GLU C    1 1 
        2  1161 1 1 38 GLU CA   C   -4.414  12.852  -1.963 1.00 . A A .  38 GLU CA   1 1 
        2  1162 1 1 38 GLU CB   C   -3.239  13.621  -1.355 1.00 . A A .  38 GLU CB   1 1 
        2  1163 1 1 38 GLU CD   C   -4.053  14.366   0.918 1.00 . A A .  38 GLU CD   1 1 
        2  1164 1 1 38 GLU CG   C   -3.664  14.792  -0.485 1.00 . A A .  38 GLU CG   1 1 
        2  1165 1 1 38 GLU H    H   -4.564  11.849  -0.105 1.00 . A A .  38 GLU H    1 1 
        2  1166 1 1 38 GLU HA   H   -5.168  13.556  -2.280 1.00 . A A .  38 GLU HA   1 1 
        2  1167 1 1 38 GLU HB2  H   -2.654  12.944  -0.751 1.00 . A A .  38 GLU HB2  1 1 
        2  1168 1 1 38 GLU HB3  H   -2.621  14.001  -2.155 1.00 . A A .  38 GLU HB3  1 1 
        2  1169 1 1 38 GLU HG2  H   -2.843  15.491  -0.417 1.00 . A A .  38 GLU HG2  1 1 
        2  1170 1 1 38 GLU HG3  H   -4.511  15.278  -0.945 1.00 . A A .  38 GLU HG3  1 1 
        2  1171 1 1 38 GLU N    N   -5.013  11.971  -0.968 1.00 . A A .  38 GLU N    1 1 
        2  1172 1 1 38 GLU O    O   -3.718  10.851  -3.095 1.00 . A A .  38 GLU O    1 1 
        2  1173 1 1 38 GLU OE1  O   -3.157  13.947   1.680 1.00 . A A .  38 GLU OE1  1 1 
        2  1174 1 1 38 GLU OE2  O   -5.253  14.452   1.252 1.00 . A A .  38 GLU OE2  1 1 
        2  1175 1 1 39 SER C    C   -2.996  13.148  -6.595 1.00 . A A .  39 SER C    1 1 
        2  1176 1 1 39 SER CA   C   -3.352  12.106  -5.539 1.00 . A A .  39 SER CA   1 1 
        2  1177 1 1 39 SER CB   C   -4.442  11.174  -6.073 1.00 . A A .  39 SER CB   1 1 
        2  1178 1 1 39 SER H    H   -3.987  13.707  -4.308 1.00 . A A .  39 SER H    1 1 
        2  1179 1 1 39 SER HA   H   -2.471  11.524  -5.314 1.00 . A A .  39 SER HA   1 1 
        2  1180 1 1 39 SER HB2  H   -4.612  10.379  -5.363 1.00 . A A .  39 SER HB2  1 1 
        2  1181 1 1 39 SER HB3  H   -5.355  11.735  -6.211 1.00 . A A .  39 SER HB3  1 1 
        2  1182 1 1 39 SER HG   H   -4.848  10.411  -7.831 1.00 . A A .  39 SER HG   1 1 
        2  1183 1 1 39 SER N    N   -3.793  12.746  -4.306 1.00 . A A .  39 SER N    1 1 
        2  1184 1 1 39 SER O    O   -3.381  14.312  -6.489 1.00 . A A .  39 SER O    1 1 
        2  1185 1 1 39 SER OG   O   -4.063  10.605  -7.314 1.00 . A A .  39 SER OG   1 1 
        2  1186 1 1 40 GLY C    C   -1.283  12.902  -9.874 1.00 . A A .  40 GLY C    1 1 
        2  1187 1 1 40 GLY CA   C   -1.861  13.628  -8.676 1.00 . A A .  40 GLY CA   1 1 
        2  1188 1 1 40 GLY H    H   -1.980  11.781  -7.647 1.00 . A A .  40 GLY H    1 1 
        2  1189 1 1 40 GLY HA2  H   -2.725  14.193  -8.993 1.00 . A A .  40 GLY HA2  1 1 
        2  1190 1 1 40 GLY HA3  H   -1.118  14.311  -8.291 1.00 . A A .  40 GLY HA3  1 1 
        2  1191 1 1 40 GLY N    N   -2.258  12.721  -7.615 1.00 . A A .  40 GLY N    1 1 
        2  1192 1 1 40 GLY O    O   -1.466  11.696 -10.044 1.00 . A A .  40 GLY O    1 1 
        2  1193 1 1 41 PRO C    C    1.220  12.159 -11.611 1.00 . A A .  41 PRO C    1 1 
        2  1194 1 1 41 PRO CA   C    0.052  13.084 -11.937 1.00 . A A .  41 PRO CA   1 1 
        2  1195 1 1 41 PRO CB   C    0.545  14.322 -12.690 1.00 . A A .  41 PRO CB   1 1 
        2  1196 1 1 41 PRO CD   C   -0.309  15.087 -10.593 1.00 . A A .  41 PRO CD   1 1 
        2  1197 1 1 41 PRO CG   C    0.742  15.354 -11.635 1.00 . A A .  41 PRO CG   1 1 
        2  1198 1 1 41 PRO HA   H   -0.667  12.554 -12.543 1.00 . A A .  41 PRO HA   1 1 
        2  1199 1 1 41 PRO HB2  H    1.472  14.092 -13.197 1.00 . A A .  41 PRO HB2  1 1 
        2  1200 1 1 41 PRO HB3  H   -0.199  14.630 -13.410 1.00 . A A .  41 PRO HB3  1 1 
        2  1201 1 1 41 PRO HD2  H    0.069  15.317  -9.608 1.00 . A A .  41 PRO HD2  1 1 
        2  1202 1 1 41 PRO HD3  H   -1.201  15.660 -10.800 1.00 . A A .  41 PRO HD3  1 1 
        2  1203 1 1 41 PRO HG2  H    1.728  15.259 -11.206 1.00 . A A .  41 PRO HG2  1 1 
        2  1204 1 1 41 PRO HG3  H    0.608  16.340 -12.056 1.00 . A A .  41 PRO HG3  1 1 
        2  1205 1 1 41 PRO N    N   -0.568  13.644 -10.732 1.00 . A A .  41 PRO N    1 1 
        2  1206 1 1 41 PRO O    O    1.820  12.254 -10.540 1.00 . A A .  41 PRO O    1 1 
        2  1207 1 1 42 SER C    C    3.977  11.037 -12.362 1.00 . A A .  42 SER C    1 1 
        2  1208 1 1 42 SER CA   C    2.631  10.319 -12.351 1.00 . A A .  42 SER CA   1 1 
        2  1209 1 1 42 SER CB   C    2.603   9.247 -13.442 1.00 . A A .  42 SER CB   1 1 
        2  1210 1 1 42 SER H    H    1.021  11.237 -13.374 1.00 . A A .  42 SER H    1 1 
        2  1211 1 1 42 SER HA   H    2.497   9.845 -11.389 1.00 . A A .  42 SER HA   1 1 
        2  1212 1 1 42 SER HB2  H    2.664   9.720 -14.410 1.00 . A A .  42 SER HB2  1 1 
        2  1213 1 1 42 SER HB3  H    3.446   8.583 -13.312 1.00 . A A .  42 SER HB3  1 1 
        2  1214 1 1 42 SER HG   H    0.723   8.925 -13.889 1.00 . A A .  42 SER HG   1 1 
        2  1215 1 1 42 SER N    N    1.537  11.264 -12.541 1.00 . A A .  42 SER N    1 1 
        2  1216 1 1 42 SER O    O    4.432  11.510 -13.404 1.00 . A A .  42 SER O    1 1 
        2  1217 1 1 42 SER OG   O    1.409   8.487 -13.379 1.00 . A A .  42 SER OG   1 1 
        2  1218 1 1 43 SER C    C    7.030  10.755 -10.970 1.00 . A A .  43 SER C    1 1 
        2  1219 1 1 43 SER CA   C    5.902  11.777 -11.069 1.00 . A A .  43 SER CA   1 1 
        2  1220 1 1 43 SER CB   C    5.914  12.687  -9.840 1.00 . A A .  43 SER CB   1 1 
        2  1221 1 1 43 SER H    H    4.196  10.717 -10.401 1.00 . A A .  43 SER H    1 1 
        2  1222 1 1 43 SER HA   H    6.054  12.378 -11.953 1.00 . A A .  43 SER HA   1 1 
        2  1223 1 1 43 SER HB2  H    5.456  12.172  -9.009 1.00 . A A .  43 SER HB2  1 1 
        2  1224 1 1 43 SER HB3  H    6.935  12.936  -9.589 1.00 . A A .  43 SER HB3  1 1 
        2  1225 1 1 43 SER HG   H    5.738  14.638  -9.834 1.00 . A A .  43 SER HG   1 1 
        2  1226 1 1 43 SER N    N    4.610  11.114 -11.196 1.00 . A A .  43 SER N    1 1 
        2  1227 1 1 43 SER O    O    8.059  10.882 -11.633 1.00 . A A .  43 SER O    1 1 
        2  1228 1 1 43 SER OG   O    5.198  13.885 -10.085 1.00 . A A .  43 SER OG   1 1 
        2  1229 1 1 44 GLY C    C    7.823   8.112  -8.570 1.00 . A A .  44 GLY C    1 1 
        2  1230 1 1 44 GLY CA   C    7.837   8.709  -9.963 1.00 . A A .  44 GLY CA   1 1 
        2  1231 1 1 44 GLY H    H    5.989   9.690  -9.632 1.00 . A A .  44 GLY H    1 1 
        2  1232 1 1 44 GLY HA2  H    7.659   7.923 -10.682 1.00 . A A .  44 GLY HA2  1 1 
        2  1233 1 1 44 GLY HA3  H    8.810   9.140 -10.148 1.00 . A A .  44 GLY HA3  1 1 
        2  1234 1 1 44 GLY N    N    6.829   9.739 -10.135 1.00 . A A .  44 GLY N    1 1 
        2  1235 1 1 44 GLY O    O    7.889   8.861  -7.596 1.00 . A A .  44 GLY O    1 1 
        2  1236 2 2  1 ZN  ZN   ZN   3.435   5.088  -1.028 1.00 . B A . 201 ZN  ZN   1 1 
        3  1237 1 1  1 GLY C    C   26.849  10.538  -9.760 1.00 . A A .   1 GLY C    1 1 
        3  1238 1 1  1 GLY CA   C   27.433   9.774 -10.932 1.00 . A A .   1 GLY CA   1 1 
        3  1239 1 1  1 GLY H1   H   29.521   9.425 -10.873 1.00 . A A .   1 GLY H1   1 1 
        3  1240 1 1  1 GLY HA2  H   26.882  10.029 -11.825 1.00 . A A .   1 GLY HA2  1 1 
        3  1241 1 1  1 GLY HA3  H   27.326   8.715 -10.746 1.00 . A A .   1 GLY HA3  1 1 
        3  1242 1 1  1 GLY N    N   28.837  10.072 -11.145 1.00 . A A .   1 GLY N    1 1 
        3  1243 1 1  1 GLY O    O   26.398   9.939  -8.783 1.00 . A A .   1 GLY O    1 1 
        3  1244 1 1  2 SER C    C   24.824  12.898  -8.945 1.00 . A A .   2 SER C    1 1 
        3  1245 1 1  2 SER CA   C   26.331  12.710  -8.793 1.00 . A A .   2 SER CA   1 1 
        3  1246 1 1  2 SER CB   C   27.029  14.072  -8.802 1.00 . A A .   2 SER CB   1 1 
        3  1247 1 1  2 SER H    H   27.232  12.281 -10.660 1.00 . A A .   2 SER H    1 1 
        3  1248 1 1  2 SER HA   H   26.527  12.221  -7.851 1.00 . A A .   2 SER HA   1 1 
        3  1249 1 1  2 SER HB2  H   27.210  14.373  -9.823 1.00 . A A .   2 SER HB2  1 1 
        3  1250 1 1  2 SER HB3  H   26.396  14.801  -8.318 1.00 . A A .   2 SER HB3  1 1 
        3  1251 1 1  2 SER HG   H   28.985  14.158  -8.738 1.00 . A A .   2 SER HG   1 1 
        3  1252 1 1  2 SER N    N   26.858  11.863  -9.856 1.00 . A A .   2 SER N    1 1 
        3  1253 1 1  2 SER O    O   24.066  12.724  -7.990 1.00 . A A .   2 SER O    1 1 
        3  1254 1 1  2 SER OG   O   28.268  14.014  -8.117 1.00 . A A .   2 SER OG   1 1 
        3  1255 1 1  3 SER C    C   22.191  12.176 -10.251 1.00 . A A .   3 SER C    1 1 
        3  1256 1 1  3 SER CA   C   22.982  13.468 -10.430 1.00 . A A .   3 SER CA   1 1 
        3  1257 1 1  3 SER CB   C   22.795  14.001 -11.852 1.00 . A A .   3 SER CB   1 1 
        3  1258 1 1  3 SER H    H   25.051  13.376 -10.873 1.00 . A A .   3 SER H    1 1 
        3  1259 1 1  3 SER HA   H   22.614  14.202  -9.729 1.00 . A A .   3 SER HA   1 1 
        3  1260 1 1  3 SER HB2  H   23.130  15.027 -11.896 1.00 . A A .   3 SER HB2  1 1 
        3  1261 1 1  3 SER HB3  H   23.377  13.403 -12.538 1.00 . A A .   3 SER HB3  1 1 
        3  1262 1 1  3 SER HG   H   21.278  13.150 -12.752 1.00 . A A .   3 SER HG   1 1 
        3  1263 1 1  3 SER N    N   24.397  13.253 -10.153 1.00 . A A .   3 SER N    1 1 
        3  1264 1 1  3 SER O    O   22.381  11.211 -10.990 1.00 . A A .   3 SER O    1 1 
        3  1265 1 1  3 SER OG   O   21.434  13.948 -12.242 1.00 . A A .   3 SER OG   1 1 
        3  1266 1 1  4 GLY C    C   21.256   9.918  -8.248 1.00 . A A .   4 GLY C    1 1 
        3  1267 1 1  4 GLY CA   C   20.494  10.989  -9.004 1.00 . A A .   4 GLY CA   1 1 
        3  1268 1 1  4 GLY H    H   21.192  12.965  -8.706 1.00 . A A .   4 GLY H    1 1 
        3  1269 1 1  4 GLY HA2  H   19.630  11.278  -8.424 1.00 . A A .   4 GLY HA2  1 1 
        3  1270 1 1  4 GLY HA3  H   20.161  10.579  -9.946 1.00 . A A .   4 GLY HA3  1 1 
        3  1271 1 1  4 GLY N    N   21.301  12.166  -9.263 1.00 . A A .   4 GLY N    1 1 
        3  1272 1 1  4 GLY O    O   22.277   9.421  -8.723 1.00 . A A .   4 GLY O    1 1 
        3  1273 1 1  5 SER C    C   20.400   7.489  -5.800 1.00 . A A .   5 SER C    1 1 
        3  1274 1 1  5 SER CA   C   21.405   8.549  -6.241 1.00 . A A .   5 SER CA   1 1 
        3  1275 1 1  5 SER CB   C   22.053   9.195  -5.015 1.00 . A A .   5 SER CB   1 1 
        3  1276 1 1  5 SER H    H   19.943   9.996  -6.742 1.00 . A A .   5 SER H    1 1 
        3  1277 1 1  5 SER HA   H   22.172   8.075  -6.836 1.00 . A A .   5 SER HA   1 1 
        3  1278 1 1  5 SER HB2  H   21.472  10.053  -4.714 1.00 . A A .   5 SER HB2  1 1 
        3  1279 1 1  5 SER HB3  H   22.082   8.478  -4.207 1.00 . A A .   5 SER HB3  1 1 
        3  1280 1 1  5 SER HG   H   23.604  10.357  -4.734 1.00 . A A .   5 SER HG   1 1 
        3  1281 1 1  5 SER N    N   20.760   9.563  -7.067 1.00 . A A .   5 SER N    1 1 
        3  1282 1 1  5 SER O    O   20.403   7.057  -4.647 1.00 . A A .   5 SER O    1 1 
        3  1283 1 1  5 SER OG   O   23.375   9.616  -5.300 1.00 . A A .   5 SER OG   1 1 
        3  1284 1 1  6 SER C    C   19.169   4.703  -6.202 1.00 . A A .   6 SER C    1 1 
        3  1285 1 1  6 SER CA   C   18.528   6.068  -6.433 1.00 . A A .   6 SER CA   1 1 
        3  1286 1 1  6 SER CB   C   17.518   5.982  -7.579 1.00 . A A .   6 SER CB   1 1 
        3  1287 1 1  6 SER H    H   19.589   7.457  -7.628 1.00 . A A .   6 SER H    1 1 
        3  1288 1 1  6 SER HA   H   18.013   6.368  -5.533 1.00 . A A .   6 SER HA   1 1 
        3  1289 1 1  6 SER HB2  H   18.029   6.132  -8.518 1.00 . A A .   6 SER HB2  1 1 
        3  1290 1 1  6 SER HB3  H   17.053   5.007  -7.573 1.00 . A A .   6 SER HB3  1 1 
        3  1291 1 1  6 SER HG   H   16.496   7.292  -6.542 1.00 . A A .   6 SER HG   1 1 
        3  1292 1 1  6 SER N    N   19.541   7.074  -6.726 1.00 . A A .   6 SER N    1 1 
        3  1293 1 1  6 SER O    O   20.371   4.528  -6.396 1.00 . A A .   6 SER O    1 1 
        3  1294 1 1  6 SER OG   O   16.510   6.969  -7.446 1.00 . A A .   6 SER OG   1 1 
        3  1295 1 1  7 GLY C    C   17.891   1.322  -5.980 1.00 . A A .   7 GLY C    1 1 
        3  1296 1 1  7 GLY CA   C   18.859   2.399  -5.534 1.00 . A A .   7 GLY CA   1 1 
        3  1297 1 1  7 GLY H    H   17.405   3.934  -5.648 1.00 . A A .   7 GLY H    1 1 
        3  1298 1 1  7 GLY HA2  H   19.792   2.273  -6.064 1.00 . A A .   7 GLY HA2  1 1 
        3  1299 1 1  7 GLY HA3  H   19.040   2.289  -4.475 1.00 . A A .   7 GLY HA3  1 1 
        3  1300 1 1  7 GLY N    N   18.355   3.737  -5.786 1.00 . A A .   7 GLY N    1 1 
        3  1301 1 1  7 GLY O    O   17.065   1.545  -6.866 1.00 . A A .   7 GLY O    1 1 
        3  1302 1 1  8 THR C    C   16.474  -1.563  -4.459 1.00 . A A .   8 THR C    1 1 
        3  1303 1 1  8 THR CA   C   17.121  -0.971  -5.706 1.00 . A A .   8 THR CA   1 1 
        3  1304 1 1  8 THR CB   C   17.892  -2.080  -6.446 1.00 . A A .   8 THR CB   1 1 
        3  1305 1 1  8 THR CG2  C   18.953  -2.694  -5.546 1.00 . A A .   8 THR CG2  1 1 
        3  1306 1 1  8 THR H    H   18.670   0.030  -4.668 1.00 . A A .   8 THR H    1 1 
        3  1307 1 1  8 THR HA   H   16.345  -0.602  -6.361 1.00 . A A .   8 THR HA   1 1 
        3  1308 1 1  8 THR HB   H   18.380  -1.645  -7.307 1.00 . A A .   8 THR HB   1 1 
        3  1309 1 1  8 THR HG1  H   16.398  -2.735  -7.554 1.00 . A A .   8 THR HG1  1 1 
        3  1310 1 1  8 THR HG21 H   19.747  -3.103  -6.153 1.00 . A A .   8 THR HG21 1 1 
        3  1311 1 1  8 THR HG22 H   18.511  -3.482  -4.954 1.00 . A A .   8 THR HG22 1 1 
        3  1312 1 1  8 THR HG23 H   19.354  -1.934  -4.892 1.00 . A A .   8 THR HG23 1 1 
        3  1313 1 1  8 THR N    N   17.992   0.147  -5.366 1.00 . A A .   8 THR N    1 1 
        3  1314 1 1  8 THR O    O   17.163  -1.952  -3.516 1.00 . A A .   8 THR O    1 1 
        3  1315 1 1  8 THR OG1  O   16.986  -3.097  -6.887 1.00 . A A .   8 THR OG1  1 1 
        3  1316 1 1  9 ARG C    C   14.380  -3.699  -3.380 1.00 . A A .   9 ARG C    1 1 
        3  1317 1 1  9 ARG CA   C   14.407  -2.174  -3.329 1.00 . A A .   9 ARG CA   1 1 
        3  1318 1 1  9 ARG CB   C   12.978  -1.629  -3.316 1.00 . A A .   9 ARG CB   1 1 
        3  1319 1 1  9 ARG CD   C   13.387   0.822  -3.690 1.00 . A A .   9 ARG CD   1 1 
        3  1320 1 1  9 ARG CG   C   12.865  -0.232  -2.727 1.00 . A A .   9 ARG CG   1 1 
        3  1321 1 1  9 ARG CZ   C   13.732   3.256  -3.620 1.00 . A A .   9 ARG CZ   1 1 
        3  1322 1 1  9 ARG H    H   14.653  -1.304  -5.243 1.00 . A A .   9 ARG H    1 1 
        3  1323 1 1  9 ARG HA   H   14.909  -1.865  -2.425 1.00 . A A .   9 ARG HA   1 1 
        3  1324 1 1  9 ARG HB2  H   12.607  -1.599  -4.330 1.00 . A A .   9 ARG HB2  1 1 
        3  1325 1 1  9 ARG HB3  H   12.357  -2.293  -2.734 1.00 . A A .   9 ARG HB3  1 1 
        3  1326 1 1  9 ARG HD2  H   14.281   0.446  -4.165 1.00 . A A .   9 ARG HD2  1 1 
        3  1327 1 1  9 ARG HD3  H   12.634   1.011  -4.440 1.00 . A A .   9 ARG HD3  1 1 
        3  1328 1 1  9 ARG HE   H   13.906   2.034  -2.053 1.00 . A A .   9 ARG HE   1 1 
        3  1329 1 1  9 ARG HG2  H   11.826  -0.025  -2.514 1.00 . A A .   9 ARG HG2  1 1 
        3  1330 1 1  9 ARG HG3  H   13.438  -0.189  -1.814 1.00 . A A .   9 ARG HG3  1 1 
        3  1331 1 1  9 ARG HH11 H   13.239   2.519  -5.435 1.00 . A A .   9 ARG HH11 1 1 
        3  1332 1 1  9 ARG HH12 H   13.484   4.233  -5.371 1.00 . A A .   9 ARG HH12 1 1 
        3  1333 1 1  9 ARG HH21 H   14.232   4.289  -1.956 1.00 . A A .   9 ARG HH21 1 1 
        3  1334 1 1  9 ARG HH22 H   14.050   5.239  -3.392 1.00 . A A .   9 ARG HH22 1 1 
        3  1335 1 1  9 ARG N    N   15.147  -1.630  -4.461 1.00 . A A .   9 ARG N    1 1 
        3  1336 1 1  9 ARG NE   N   13.704   2.076  -3.010 1.00 . A A .   9 ARG NE   1 1 
        3  1337 1 1  9 ARG NH1  N   13.464   3.343  -4.915 1.00 . A A .   9 ARG NH1  1 1 
        3  1338 1 1  9 ARG NH2  N   14.029   4.351  -2.933 1.00 . A A .   9 ARG NH2  1 1 
        3  1339 1 1  9 ARG O    O   14.008  -4.289  -4.394 1.00 . A A .   9 ARG O    1 1 
        3  1340 1 1 10 GLU C    C   13.437  -6.330  -1.789 1.00 . A A .  10 GLU C    1 1 
        3  1341 1 1 10 GLU CA   C   14.801  -5.786  -2.201 1.00 . A A .  10 GLU CA   1 1 
        3  1342 1 1 10 GLU CB   C   15.869  -6.248  -1.207 1.00 . A A .  10 GLU CB   1 1 
        3  1343 1 1 10 GLU CD   C   17.778  -7.881  -0.948 1.00 . A A .  10 GLU CD   1 1 
        3  1344 1 1 10 GLU CG   C   16.370  -7.659  -1.465 1.00 . A A .  10 GLU CG   1 1 
        3  1345 1 1 10 GLU H    H   15.064  -3.805  -1.504 1.00 . A A .  10 GLU H    1 1 
        3  1346 1 1 10 GLU HA   H   15.046  -6.168  -3.181 1.00 . A A .  10 GLU HA   1 1 
        3  1347 1 1 10 GLU HB2  H   16.710  -5.573  -1.261 1.00 . A A .  10 GLU HB2  1 1 
        3  1348 1 1 10 GLU HB3  H   15.454  -6.214  -0.211 1.00 . A A .  10 GLU HB3  1 1 
        3  1349 1 1 10 GLU HG2  H   15.709  -8.358  -0.975 1.00 . A A .  10 GLU HG2  1 1 
        3  1350 1 1 10 GLU HG3  H   16.360  -7.842  -2.530 1.00 . A A .  10 GLU HG3  1 1 
        3  1351 1 1 10 GLU N    N   14.779  -4.330  -2.280 1.00 . A A .  10 GLU N    1 1 
        3  1352 1 1 10 GLU O    O   13.340  -7.230  -0.954 1.00 . A A .  10 GLU O    1 1 
        3  1353 1 1 10 GLU OE1  O   18.690  -7.139  -1.369 1.00 . A A .  10 GLU OE1  1 1 
        3  1354 1 1 10 GLU OE2  O   17.968  -8.799  -0.122 1.00 . A A .  10 GLU OE2  1 1 
        3  1355 1 1 11 LYS C    C   10.184  -6.297  -3.346 1.00 . A A .  11 LYS C    1 1 
        3  1356 1 1 11 LYS CA   C   11.022  -6.205  -2.075 1.00 . A A .  11 LYS CA   1 1 
        3  1357 1 1 11 LYS CB   C   10.368  -5.234  -1.090 1.00 . A A .  11 LYS CB   1 1 
        3  1358 1 1 11 LYS CD   C   10.489  -4.429   1.287 1.00 . A A .  11 LYS CD   1 1 
        3  1359 1 1 11 LYS CE   C   11.815  -3.684   1.302 1.00 . A A .  11 LYS CE   1 1 
        3  1360 1 1 11 LYS CG   C   10.539  -5.636   0.365 1.00 . A A .  11 LYS CG   1 1 
        3  1361 1 1 11 LYS H    H   12.523  -5.063  -3.037 1.00 . A A .  11 LYS H    1 1 
        3  1362 1 1 11 LYS HA   H   11.076  -7.183  -1.622 1.00 . A A .  11 LYS HA   1 1 
        3  1363 1 1 11 LYS HB2  H   10.804  -4.255  -1.225 1.00 . A A .  11 LYS HB2  1 1 
        3  1364 1 1 11 LYS HB3  H    9.311  -5.179  -1.305 1.00 . A A .  11 LYS HB3  1 1 
        3  1365 1 1 11 LYS HD2  H    9.716  -3.757   0.945 1.00 . A A .  11 LYS HD2  1 1 
        3  1366 1 1 11 LYS HD3  H   10.262  -4.762   2.290 1.00 . A A .  11 LYS HD3  1 1 
        3  1367 1 1 11 LYS HE2  H   12.540  -4.277   1.838 1.00 . A A .  11 LYS HE2  1 1 
        3  1368 1 1 11 LYS HE3  H   12.147  -3.546   0.283 1.00 . A A .  11 LYS HE3  1 1 
        3  1369 1 1 11 LYS HG2  H    9.745  -6.316   0.637 1.00 . A A .  11 LYS HG2  1 1 
        3  1370 1 1 11 LYS HG3  H   11.493  -6.129   0.483 1.00 . A A .  11 LYS HG3  1 1 
        3  1371 1 1 11 LYS HZ1  H   10.736  -2.225   2.335 1.00 . A A .  11 LYS HZ1  1 1 
        3  1372 1 1 11 LYS HZ2  H   11.893  -1.597   1.272 1.00 . A A .  11 LYS HZ2  1 1 
        3  1373 1 1 11 LYS HZ3  H   12.377  -2.279   2.742 1.00 . A A .  11 LYS HZ3  1 1 
        3  1374 1 1 11 LYS N    N   12.383  -5.777  -2.379 1.00 . A A .  11 LYS N    1 1 
        3  1375 1 1 11 LYS NZ   N   11.697  -2.353   1.959 1.00 . A A .  11 LYS NZ   1 1 
        3  1376 1 1 11 LYS O    O   10.267  -5.451  -4.236 1.00 . A A .  11 LYS O    1 1 
        3  1377 1 1 12 PRO C    C    7.356  -6.554  -4.677 1.00 . A A .  12 PRO C    1 1 
        3  1378 1 1 12 PRO CA   C    8.485  -7.575  -4.592 1.00 . A A .  12 PRO CA   1 1 
        3  1379 1 1 12 PRO CB   C    7.922  -8.976  -4.343 1.00 . A A .  12 PRO CB   1 1 
        3  1380 1 1 12 PRO CD   C    9.205  -8.397  -2.412 1.00 . A A .  12 PRO CD   1 1 
        3  1381 1 1 12 PRO CG   C    7.988  -9.154  -2.866 1.00 . A A .  12 PRO CG   1 1 
        3  1382 1 1 12 PRO HA   H    9.044  -7.569  -5.516 1.00 . A A .  12 PRO HA   1 1 
        3  1383 1 1 12 PRO HB2  H    6.903  -9.026  -4.703 1.00 . A A .  12 PRO HB2  1 1 
        3  1384 1 1 12 PRO HB3  H    8.527  -9.708  -4.856 1.00 . A A .  12 PRO HB3  1 1 
        3  1385 1 1 12 PRO HD2  H    9.038  -7.963  -1.437 1.00 . A A .  12 PRO HD2  1 1 
        3  1386 1 1 12 PRO HD3  H   10.069  -9.045  -2.395 1.00 . A A .  12 PRO HD3  1 1 
        3  1387 1 1 12 PRO HG2  H    7.100  -8.747  -2.406 1.00 . A A .  12 PRO HG2  1 1 
        3  1388 1 1 12 PRO HG3  H    8.089 -10.203  -2.627 1.00 . A A .  12 PRO HG3  1 1 
        3  1389 1 1 12 PRO N    N    9.356  -7.349  -3.435 1.00 . A A .  12 PRO N    1 1 
        3  1390 1 1 12 PRO O    O    7.043  -6.048  -5.755 1.00 . A A .  12 PRO O    1 1 
        3  1391 1 1 13 TYR C    C    6.182  -3.867  -3.395 1.00 . A A .  13 TYR C    1 1 
        3  1392 1 1 13 TYR CA   C    5.652  -5.295  -3.480 1.00 . A A .  13 TYR CA   1 1 
        3  1393 1 1 13 TYR CB   C    4.749  -5.588  -2.280 1.00 . A A .  13 TYR CB   1 1 
        3  1394 1 1 13 TYR CD1  C    2.991  -7.214  -3.082 1.00 . A A .  13 TYR CD1  1 1 
        3  1395 1 1 13 TYR CD2  C    4.662  -8.013  -1.583 1.00 . A A .  13 TYR CD2  1 1 
        3  1396 1 1 13 TYR CE1  C    2.414  -8.468  -3.116 1.00 . A A .  13 TYR CE1  1 1 
        3  1397 1 1 13 TYR CE2  C    4.093  -9.272  -1.612 1.00 . A A .  13 TYR CE2  1 1 
        3  1398 1 1 13 TYR CG   C    4.122  -6.963  -2.315 1.00 . A A .  13 TYR CG   1 1 
        3  1399 1 1 13 TYR CZ   C    2.969  -9.494  -2.380 1.00 . A A .  13 TYR CZ   1 1 
        3  1400 1 1 13 TYR H    H    7.042  -6.692  -2.707 1.00 . A A .  13 TYR H    1 1 
        3  1401 1 1 13 TYR HA   H    5.074  -5.400  -4.386 1.00 . A A .  13 TYR HA   1 1 
        3  1402 1 1 13 TYR HB2  H    5.330  -5.512  -1.374 1.00 . A A .  13 TYR HB2  1 1 
        3  1403 1 1 13 TYR HB3  H    3.951  -4.860  -2.253 1.00 . A A .  13 TYR HB3  1 1 
        3  1404 1 1 13 TYR HD1  H    2.559  -6.408  -3.658 1.00 . A A .  13 TYR HD1  1 1 
        3  1405 1 1 13 TYR HD2  H    5.543  -7.836  -0.982 1.00 . A A .  13 TYR HD2  1 1 
        3  1406 1 1 13 TYR HE1  H    1.535  -8.643  -3.718 1.00 . A A .  13 TYR HE1  1 1 
        3  1407 1 1 13 TYR HE2  H    4.527 -10.076  -1.036 1.00 . A A .  13 TYR HE2  1 1 
        3  1408 1 1 13 TYR HH   H    1.735 -10.813  -1.723 1.00 . A A .  13 TYR HH   1 1 
        3  1409 1 1 13 TYR N    N    6.748  -6.255  -3.534 1.00 . A A .  13 TYR N    1 1 
        3  1410 1 1 13 TYR O    O    6.974  -3.539  -2.512 1.00 . A A .  13 TYR O    1 1 
        3  1411 1 1 13 TYR OH   O    2.399 -10.746  -2.413 1.00 . A A .  13 TYR OH   1 1 
        3  1412 1 1 14 GLU C    C    4.977  -0.697  -4.558 1.00 . A A .  14 GLU C    1 1 
        3  1413 1 1 14 GLU CA   C    6.168  -1.629  -4.351 1.00 . A A .  14 GLU CA   1 1 
        3  1414 1 1 14 GLU CB   C    7.197  -1.414  -5.463 1.00 . A A .  14 GLU CB   1 1 
        3  1415 1 1 14 GLU CD   C    9.568  -2.056  -6.052 1.00 . A A .  14 GLU CD   1 1 
        3  1416 1 1 14 GLU CG   C    8.637  -1.511  -4.987 1.00 . A A .  14 GLU CG   1 1 
        3  1417 1 1 14 GLU H    H    5.108  -3.344  -4.999 1.00 . A A .  14 GLU H    1 1 
        3  1418 1 1 14 GLU HA   H    6.626  -1.403  -3.400 1.00 . A A .  14 GLU HA   1 1 
        3  1419 1 1 14 GLU HB2  H    7.042  -2.158  -6.230 1.00 . A A .  14 GLU HB2  1 1 
        3  1420 1 1 14 GLU HB3  H    7.047  -0.433  -5.890 1.00 . A A .  14 GLU HB3  1 1 
        3  1421 1 1 14 GLU HG2  H    8.976  -0.526  -4.704 1.00 . A A .  14 GLU HG2  1 1 
        3  1422 1 1 14 GLU HG3  H    8.675  -2.164  -4.127 1.00 . A A .  14 GLU HG3  1 1 
        3  1423 1 1 14 GLU N    N    5.738  -3.022  -4.321 1.00 . A A .  14 GLU N    1 1 
        3  1424 1 1 14 GLU O    O    4.051  -1.011  -5.305 1.00 . A A .  14 GLU O    1 1 
        3  1425 1 1 14 GLU OE1  O    9.719  -1.396  -7.101 1.00 . A A .  14 GLU OE1  1 1 
        3  1426 1 1 14 GLU OE2  O   10.145  -3.143  -5.837 1.00 . A A .  14 GLU OE2  1 1 
        3  1427 1 1 15 CYS C    C    3.934   2.088  -5.373 1.00 . A A .  15 CYS C    1 1 
        3  1428 1 1 15 CYS CA   C    3.934   1.429  -3.997 1.00 . A A .  15 CYS CA   1 1 
        3  1429 1 1 15 CYS CB   C    4.075   2.495  -2.909 1.00 . A A .  15 CYS CB   1 1 
        3  1430 1 1 15 CYS H    H    5.775   0.645  -3.308 1.00 . A A .  15 CYS H    1 1 
        3  1431 1 1 15 CYS HA   H    2.997   0.910  -3.860 1.00 . A A .  15 CYS HA   1 1 
        3  1432 1 1 15 CYS HB2  H    4.168   2.009  -1.949 1.00 . A A .  15 CYS HB2  1 1 
        3  1433 1 1 15 CYS HB3  H    4.965   3.077  -3.099 1.00 . A A .  15 CYS HB3  1 1 
        3  1434 1 1 15 CYS N    N    5.009   0.451  -3.889 1.00 . A A .  15 CYS N    1 1 
        3  1435 1 1 15 CYS O    O    4.943   2.643  -5.807 1.00 . A A .  15 CYS O    1 1 
        3  1436 1 1 15 CYS SG   S    2.669   3.649  -2.811 1.00 . A A .  15 CYS SG   1 1 
        3  1437 1 1 16 SER C    C    2.393   4.107  -7.291 1.00 . A A .  16 SER C    1 1 
        3  1438 1 1 16 SER CA   C    2.663   2.608  -7.383 1.00 . A A .  16 SER CA   1 1 
        3  1439 1 1 16 SER CB   C    1.537   1.922  -8.158 1.00 . A A .  16 SER CB   1 1 
        3  1440 1 1 16 SER H    H    2.025   1.565  -5.655 1.00 . A A .  16 SER H    1 1 
        3  1441 1 1 16 SER HA   H    3.595   2.454  -7.907 1.00 . A A .  16 SER HA   1 1 
        3  1442 1 1 16 SER HB2  H    1.526   0.870  -7.917 1.00 . A A .  16 SER HB2  1 1 
        3  1443 1 1 16 SER HB3  H    0.591   2.365  -7.881 1.00 . A A .  16 SER HB3  1 1 
        3  1444 1 1 16 SER HG   H    1.471   2.956  -9.821 1.00 . A A .  16 SER HG   1 1 
        3  1445 1 1 16 SER N    N    2.795   2.022  -6.055 1.00 . A A .  16 SER N    1 1 
        3  1446 1 1 16 SER O    O    1.939   4.726  -8.253 1.00 . A A .  16 SER O    1 1 
        3  1447 1 1 16 SER OG   O    1.718   2.067  -9.556 1.00 . A A .  16 SER OG   1 1 
        3  1448 1 1 17 GLU C    C    3.782   6.822  -5.637 1.00 . A A .  17 GLU C    1 1 
        3  1449 1 1 17 GLU CA   C    2.460   6.108  -5.908 1.00 . A A .  17 GLU CA   1 1 
        3  1450 1 1 17 GLU CB   C    1.500   6.329  -4.738 1.00 . A A .  17 GLU CB   1 1 
        3  1451 1 1 17 GLU CD   C   -0.963   6.189  -4.191 1.00 . A A .  17 GLU CD   1 1 
        3  1452 1 1 17 GLU CG   C    0.228   5.502  -4.829 1.00 . A A .  17 GLU CG   1 1 
        3  1453 1 1 17 GLU H    H    3.034   4.135  -5.397 1.00 . A A .  17 GLU H    1 1 
        3  1454 1 1 17 GLU HA   H    2.021   6.519  -6.804 1.00 . A A .  17 GLU HA   1 1 
        3  1455 1 1 17 GLU HB2  H    2.006   6.073  -3.819 1.00 . A A .  17 GLU HB2  1 1 
        3  1456 1 1 17 GLU HB3  H    1.223   7.372  -4.707 1.00 . A A .  17 GLU HB3  1 1 
        3  1457 1 1 17 GLU HG2  H    0.005   5.322  -5.870 1.00 . A A .  17 GLU HG2  1 1 
        3  1458 1 1 17 GLU HG3  H    0.391   4.558  -4.330 1.00 . A A .  17 GLU HG3  1 1 
        3  1459 1 1 17 GLU N    N    2.674   4.682  -6.126 1.00 . A A .  17 GLU N    1 1 
        3  1460 1 1 17 GLU O    O    4.099   7.827  -6.272 1.00 . A A .  17 GLU O    1 1 
        3  1461 1 1 17 GLU OE1  O   -1.004   7.438  -4.206 1.00 . A A .  17 GLU OE1  1 1 
        3  1462 1 1 17 GLU OE2  O   -1.852   5.480  -3.676 1.00 . A A .  17 GLU OE2  1 1 
        3  1463 1 1 18 CYS C    C    6.982   5.954  -4.728 1.00 . A A .  18 CYS C    1 1 
        3  1464 1 1 18 CYS CA   C    5.835   6.879  -4.331 1.00 . A A .  18 CYS CA   1 1 
        3  1465 1 1 18 CYS CB   C    5.890   7.162  -2.829 1.00 . A A .  18 CYS CB   1 1 
        3  1466 1 1 18 CYS H    H    4.241   5.491  -4.217 1.00 . A A .  18 CYS H    1 1 
        3  1467 1 1 18 CYS HA   H    5.937   7.809  -4.868 1.00 . A A .  18 CYS HA   1 1 
        3  1468 1 1 18 CYS HB2  H    6.857   7.576  -2.584 1.00 . A A .  18 CYS HB2  1 1 
        3  1469 1 1 18 CYS HB3  H    5.123   7.880  -2.577 1.00 . A A .  18 CYS HB3  1 1 
        3  1470 1 1 18 CYS N    N    4.548   6.294  -4.689 1.00 . A A .  18 CYS N    1 1 
        3  1471 1 1 18 CYS O    O    8.010   6.404  -5.233 1.00 . A A .  18 CYS O    1 1 
        3  1472 1 1 18 CYS SG   S    5.638   5.691  -1.785 1.00 . A A .  18 CYS SG   1 1 
        3  1473 1 1 19 GLY C    C    8.234   2.840  -3.647 1.00 . A A .  19 GLY C    1 1 
        3  1474 1 1 19 GLY CA   C    7.824   3.690  -4.833 1.00 . A A .  19 GLY CA   1 1 
        3  1475 1 1 19 GLY H    H    5.957   4.357  -4.090 1.00 . A A .  19 GLY H    1 1 
        3  1476 1 1 19 GLY HA2  H    7.451   3.044  -5.614 1.00 . A A .  19 GLY HA2  1 1 
        3  1477 1 1 19 GLY HA3  H    8.693   4.217  -5.201 1.00 . A A .  19 GLY HA3  1 1 
        3  1478 1 1 19 GLY N    N    6.798   4.658  -4.495 1.00 . A A .  19 GLY N    1 1 
        3  1479 1 1 19 GLY O    O    9.196   2.076  -3.724 1.00 . A A .  19 GLY O    1 1 
        3  1480 1 1 20 LYS C    C    7.994   0.735  -1.658 1.00 . A A .  20 LYS C    1 1 
        3  1481 1 1 20 LYS CA   C    7.795   2.212  -1.337 1.00 . A A .  20 LYS CA   1 1 
        3  1482 1 1 20 LYS CB   C    6.662   2.376  -0.320 1.00 . A A .  20 LYS CB   1 1 
        3  1483 1 1 20 LYS CD   C    6.275   2.917   2.102 1.00 . A A .  20 LYS CD   1 1 
        3  1484 1 1 20 LYS CE   C    6.846   2.815   3.508 1.00 . A A .  20 LYS CE   1 1 
        3  1485 1 1 20 LYS CG   C    7.085   2.097   1.112 1.00 . A A .  20 LYS CG   1 1 
        3  1486 1 1 20 LYS H    H    6.748   3.599  -2.546 1.00 . A A .  20 LYS H    1 1 
        3  1487 1 1 20 LYS HA   H    8.708   2.602  -0.912 1.00 . A A .  20 LYS HA   1 1 
        3  1488 1 1 20 LYS HB2  H    6.291   3.389  -0.373 1.00 . A A .  20 LYS HB2  1 1 
        3  1489 1 1 20 LYS HB3  H    5.864   1.695  -0.577 1.00 . A A .  20 LYS HB3  1 1 
        3  1490 1 1 20 LYS HD2  H    6.289   3.952   1.795 1.00 . A A .  20 LYS HD2  1 1 
        3  1491 1 1 20 LYS HD3  H    5.257   2.555   2.108 1.00 . A A .  20 LYS HD3  1 1 
        3  1492 1 1 20 LYS HE2  H    7.904   3.025   3.470 1.00 . A A .  20 LYS HE2  1 1 
        3  1493 1 1 20 LYS HE3  H    6.356   3.545   4.135 1.00 . A A .  20 LYS HE3  1 1 
        3  1494 1 1 20 LYS HG2  H    6.937   1.048   1.323 1.00 . A A .  20 LYS HG2  1 1 
        3  1495 1 1 20 LYS HG3  H    8.131   2.344   1.223 1.00 . A A .  20 LYS HG3  1 1 
        3  1496 1 1 20 LYS HZ1  H    7.197   1.360   4.965 1.00 . A A .  20 LYS HZ1  1 1 
        3  1497 1 1 20 LYS HZ2  H    6.944   0.730   3.415 1.00 . A A .  20 LYS HZ2  1 1 
        3  1498 1 1 20 LYS HZ3  H    5.636   1.315   4.315 1.00 . A A .  20 LYS HZ3  1 1 
        3  1499 1 1 20 LYS N    N    7.503   2.973  -2.545 1.00 . A A .  20 LYS N    1 1 
        3  1500 1 1 20 LYS NZ   N    6.641   1.460   4.092 1.00 . A A .  20 LYS NZ   1 1 
        3  1501 1 1 20 LYS O    O    7.852   0.315  -2.807 1.00 . A A .  20 LYS O    1 1 
        3  1502 1 1 21 ALA C    C    7.985  -2.267   0.374 1.00 . A A .  21 ALA C    1 1 
        3  1503 1 1 21 ALA CA   C    8.535  -1.481  -0.811 1.00 . A A .  21 ALA CA   1 1 
        3  1504 1 1 21 ALA CB   C   10.016  -1.774  -0.999 1.00 . A A .  21 ALA CB   1 1 
        3  1505 1 1 21 ALA H    H    8.419   0.343   0.255 1.00 . A A .  21 ALA H    1 1 
        3  1506 1 1 21 ALA HA   H    8.016  -1.790  -1.707 1.00 . A A .  21 ALA HA   1 1 
        3  1507 1 1 21 ALA HB1  H   10.418  -2.195  -0.089 1.00 . A A .  21 ALA HB1  1 1 
        3  1508 1 1 21 ALA HB2  H   10.143  -2.479  -1.808 1.00 . A A .  21 ALA HB2  1 1 
        3  1509 1 1 21 ALA HB3  H   10.537  -0.858  -1.233 1.00 . A A .  21 ALA HB3  1 1 
        3  1510 1 1 21 ALA N    N    8.321  -0.050  -0.637 1.00 . A A .  21 ALA N    1 1 
        3  1511 1 1 21 ALA O    O    7.957  -1.772   1.501 1.00 . A A .  21 ALA O    1 1 
        3  1512 1 1 22 PHE C    C    7.296  -5.817   0.876 1.00 . A A .  22 PHE C    1 1 
        3  1513 1 1 22 PHE CA   C    6.994  -4.348   1.157 1.00 . A A .  22 PHE CA   1 1 
        3  1514 1 1 22 PHE CB   C    5.482  -4.139   1.270 1.00 . A A .  22 PHE CB   1 1 
        3  1515 1 1 22 PHE CD1  C    5.030  -1.785   0.531 1.00 . A A .  22 PHE CD1  1 1 
        3  1516 1 1 22 PHE CD2  C    4.791  -2.311   2.844 1.00 . A A .  22 PHE CD2  1 1 
        3  1517 1 1 22 PHE CE1  C    4.671  -0.475   0.788 1.00 . A A .  22 PHE CE1  1 1 
        3  1518 1 1 22 PHE CE2  C    4.431  -1.003   3.107 1.00 . A A .  22 PHE CE2  1 1 
        3  1519 1 1 22 PHE CG   C    5.093  -2.717   1.554 1.00 . A A .  22 PHE CG   1 1 
        3  1520 1 1 22 PHE CZ   C    4.373  -0.083   2.078 1.00 . A A .  22 PHE CZ   1 1 
        3  1521 1 1 22 PHE H    H    7.594  -3.833  -0.807 1.00 . A A .  22 PHE H    1 1 
        3  1522 1 1 22 PHE HA   H    7.458  -4.070   2.091 1.00 . A A .  22 PHE HA   1 1 
        3  1523 1 1 22 PHE HB2  H    5.015  -4.432   0.342 1.00 . A A .  22 PHE HB2  1 1 
        3  1524 1 1 22 PHE HB3  H    5.100  -4.755   2.071 1.00 . A A .  22 PHE HB3  1 1 
        3  1525 1 1 22 PHE HD1  H    5.263  -2.091  -0.480 1.00 . A A .  22 PHE HD1  1 1 
        3  1526 1 1 22 PHE HD2  H    4.837  -3.029   3.650 1.00 . A A .  22 PHE HD2  1 1 
        3  1527 1 1 22 PHE HE1  H    4.626   0.241  -0.019 1.00 . A A .  22 PHE HE1  1 1 
        3  1528 1 1 22 PHE HE2  H    4.199  -0.699   4.117 1.00 . A A .  22 PHE HE2  1 1 
        3  1529 1 1 22 PHE HZ   H    4.092   0.939   2.281 1.00 . A A .  22 PHE HZ   1 1 
        3  1530 1 1 22 PHE N    N    7.546  -3.494   0.112 1.00 . A A .  22 PHE N    1 1 
        3  1531 1 1 22 PHE O    O    7.686  -6.179  -0.234 1.00 . A A .  22 PHE O    1 1 
        3  1532 1 1 23 ILE C    C    6.094  -8.835   1.374 1.00 . A A .  23 ILE C    1 1 
        3  1533 1 1 23 ILE CA   C    7.367  -8.086   1.751 1.00 . A A .  23 ILE CA   1 1 
        3  1534 1 1 23 ILE CB   C    7.936  -8.685   3.051 1.00 . A A .  23 ILE CB   1 1 
        3  1535 1 1 23 ILE CD1  C    8.927  -6.754   4.382 1.00 . A A .  23 ILE CD1  1 1 
        3  1536 1 1 23 ILE CG1  C    9.200  -7.933   3.474 1.00 . A A .  23 ILE CG1  1 1 
        3  1537 1 1 23 ILE CG2  C    8.231 -10.166   2.867 1.00 . A A .  23 ILE CG2  1 1 
        3  1538 1 1 23 ILE H    H    6.802  -6.307   2.750 1.00 . A A .  23 ILE H    1 1 
        3  1539 1 1 23 ILE HA   H    8.098  -8.220   0.967 1.00 . A A .  23 ILE HA   1 1 
        3  1540 1 1 23 ILE HB   H    7.190  -8.584   3.824 1.00 . A A .  23 ILE HB   1 1 
        3  1541 1 1 23 ILE HD11 H    9.230  -5.842   3.888 1.00 . A A .  23 ILE HD11 1 1 
        3  1542 1 1 23 ILE HD12 H    7.871  -6.708   4.604 1.00 . A A .  23 ILE HD12 1 1 
        3  1543 1 1 23 ILE HD13 H    9.484  -6.868   5.299 1.00 . A A .  23 ILE HD13 1 1 
        3  1544 1 1 23 ILE HG12 H    9.855  -8.610   4.000 1.00 . A A .  23 ILE HG12 1 1 
        3  1545 1 1 23 ILE HG13 H    9.703  -7.564   2.592 1.00 . A A .  23 ILE HG13 1 1 
        3  1546 1 1 23 ILE HG21 H    8.904 -10.298   2.033 1.00 . A A .  23 ILE HG21 1 1 
        3  1547 1 1 23 ILE HG22 H    8.690 -10.555   3.763 1.00 . A A .  23 ILE HG22 1 1 
        3  1548 1 1 23 ILE HG23 H    7.310 -10.695   2.674 1.00 . A A .  23 ILE HG23 1 1 
        3  1549 1 1 23 ILE N    N    7.115  -6.657   1.889 1.00 . A A .  23 ILE N    1 1 
        3  1550 1 1 23 ILE O    O    6.131  -9.788   0.596 1.00 . A A .  23 ILE O    1 1 
        3  1551 1 1 24 ARG C    C    2.684  -8.005   1.115 1.00 . A A .  24 ARG C    1 1 
        3  1552 1 1 24 ARG CA   C    3.684  -9.026   1.651 1.00 . A A .  24 ARG CA   1 1 
        3  1553 1 1 24 ARG CB   C    3.129  -9.684   2.915 1.00 . A A .  24 ARG CB   1 1 
        3  1554 1 1 24 ARG CD   C    4.318 -11.885   2.673 1.00 . A A .  24 ARG CD   1 1 
        3  1555 1 1 24 ARG CG   C    4.090 -10.671   3.559 1.00 . A A .  24 ARG CG   1 1 
        3  1556 1 1 24 ARG CZ   C    5.345 -14.102   2.948 1.00 . A A .  24 ARG CZ   1 1 
        3  1557 1 1 24 ARG H    H    5.004  -7.632   2.542 1.00 . A A .  24 ARG H    1 1 
        3  1558 1 1 24 ARG HA   H    3.842  -9.785   0.900 1.00 . A A .  24 ARG HA   1 1 
        3  1559 1 1 24 ARG HB2  H    2.901  -8.914   3.638 1.00 . A A .  24 ARG HB2  1 1 
        3  1560 1 1 24 ARG HB3  H    2.221 -10.211   2.663 1.00 . A A .  24 ARG HB3  1 1 
        3  1561 1 1 24 ARG HD2  H    3.412 -12.088   2.123 1.00 . A A .  24 ARG HD2  1 1 
        3  1562 1 1 24 ARG HD3  H    5.117 -11.664   1.981 1.00 . A A .  24 ARG HD3  1 1 
        3  1563 1 1 24 ARG HE   H    4.404 -13.095   4.390 1.00 . A A .  24 ARG HE   1 1 
        3  1564 1 1 24 ARG HG2  H    5.036 -10.179   3.728 1.00 . A A .  24 ARG HG2  1 1 
        3  1565 1 1 24 ARG HG3  H    3.677 -10.996   4.503 1.00 . A A .  24 ARG HG3  1 1 
        3  1566 1 1 24 ARG HH11 H    5.512 -13.311   1.096 1.00 . A A .  24 ARG HH11 1 1 
        3  1567 1 1 24 ARG HH12 H    6.232 -14.873   1.304 1.00 . A A .  24 ARG HH12 1 1 
        3  1568 1 1 24 ARG HH21 H    5.348 -15.152   4.675 1.00 . A A .  24 ARG HH21 1 1 
        3  1569 1 1 24 ARG HH22 H    6.138 -15.920   3.339 1.00 . A A .  24 ARG HH22 1 1 
        3  1570 1 1 24 ARG N    N    4.969  -8.397   1.929 1.00 . A A .  24 ARG N    1 1 
        3  1571 1 1 24 ARG NE   N    4.676 -13.069   3.449 1.00 . A A .  24 ARG NE   1 1 
        3  1572 1 1 24 ARG NH1  N    5.727 -14.095   1.678 1.00 . A A .  24 ARG NH1  1 1 
        3  1573 1 1 24 ARG NH2  N    5.634 -15.143   3.717 1.00 . A A .  24 ARG NH2  1 1 
        3  1574 1 1 24 ARG O    O    2.589  -6.889   1.624 1.00 . A A .  24 ARG O    1 1 
        3  1575 1 1 25 ASN C    C    0.166  -6.761   0.551 1.00 . A A .  25 ASN C    1 1 
        3  1576 1 1 25 ASN CA   C    0.949  -7.515  -0.520 1.00 . A A .  25 ASN CA   1 1 
        3  1577 1 1 25 ASN CB   C   -0.012  -8.320  -1.397 1.00 . A A .  25 ASN CB   1 1 
        3  1578 1 1 25 ASN CG   C   -0.604  -7.490  -2.520 1.00 . A A .  25 ASN CG   1 1 
        3  1579 1 1 25 ASN H    H    2.062  -9.299  -0.277 1.00 . A A .  25 ASN H    1 1 
        3  1580 1 1 25 ASN HA   H    1.472  -6.800  -1.137 1.00 . A A .  25 ASN HA   1 1 
        3  1581 1 1 25 ASN HB2  H    0.521  -9.152  -1.834 1.00 . A A .  25 ASN HB2  1 1 
        3  1582 1 1 25 ASN HB3  H   -0.819  -8.696  -0.787 1.00 . A A .  25 ASN HB3  1 1 
        3  1583 1 1 25 ASN HD21 H   -0.858  -5.954  -1.282 1.00 . A A .  25 ASN HD21 1 1 
        3  1584 1 1 25 ASN HD22 H   -1.368  -5.697  -2.913 1.00 . A A .  25 ASN HD22 1 1 
        3  1585 1 1 25 ASN N    N    1.941  -8.396   0.085 1.00 . A A .  25 ASN N    1 1 
        3  1586 1 1 25 ASN ND2  N   -0.981  -6.256  -2.206 1.00 . A A .  25 ASN ND2  1 1 
        3  1587 1 1 25 ASN O    O    0.142  -5.530   0.566 1.00 . A A .  25 ASN O    1 1 
        3  1588 1 1 25 ASN OD1  O   -0.721  -7.953  -3.654 1.00 . A A .  25 ASN OD1  1 1 
        3  1589 1 1 26 SER C    C   -0.533  -5.715   3.124 1.00 . A A .  26 SER C    1 1 
        3  1590 1 1 26 SER CA   C   -1.260  -6.911   2.518 1.00 . A A .  26 SER CA   1 1 
        3  1591 1 1 26 SER CB   C   -1.552  -7.948   3.604 1.00 . A A .  26 SER CB   1 1 
        3  1592 1 1 26 SER H    H   -0.417  -8.485   1.380 1.00 . A A .  26 SER H    1 1 
        3  1593 1 1 26 SER HA   H   -2.195  -6.573   2.095 1.00 . A A .  26 SER HA   1 1 
        3  1594 1 1 26 SER HB2  H   -0.725  -8.639   3.670 1.00 . A A .  26 SER HB2  1 1 
        3  1595 1 1 26 SER HB3  H   -1.679  -7.447   4.552 1.00 . A A .  26 SER HB3  1 1 
        3  1596 1 1 26 SER HG   H   -2.879  -9.336   3.992 1.00 . A A .  26 SER HG   1 1 
        3  1597 1 1 26 SER N    N   -0.474  -7.508   1.445 1.00 . A A .  26 SER N    1 1 
        3  1598 1 1 26 SER O    O   -1.138  -4.677   3.390 1.00 . A A .  26 SER O    1 1 
        3  1599 1 1 26 SER OG   O   -2.732  -8.676   3.310 1.00 . A A .  26 SER OG   1 1 
        3  1600 1 1 27 GLN C    C    1.529  -3.550   3.044 1.00 . A A .  27 GLN C    1 1 
        3  1601 1 1 27 GLN CA   C    1.580  -4.802   3.914 1.00 . A A .  27 GLN CA   1 1 
        3  1602 1 1 27 GLN CB   C    3.029  -5.265   4.077 1.00 . A A .  27 GLN CB   1 1 
        3  1603 1 1 27 GLN CD   C    3.336  -6.277   6.372 1.00 . A A .  27 GLN CD   1 1 
        3  1604 1 1 27 GLN CG   C    3.172  -6.543   4.889 1.00 . A A .  27 GLN CG   1 1 
        3  1605 1 1 27 GLN H    H    1.195  -6.720   3.106 1.00 . A A .  27 GLN H    1 1 
        3  1606 1 1 27 GLN HA   H    1.176  -4.566   4.887 1.00 . A A .  27 GLN HA   1 1 
        3  1607 1 1 27 GLN HB2  H    3.452  -5.436   3.099 1.00 . A A .  27 GLN HB2  1 1 
        3  1608 1 1 27 GLN HB3  H    3.590  -4.486   4.572 1.00 . A A .  27 GLN HB3  1 1 
        3  1609 1 1 27 GLN HE21 H    4.902  -7.500   6.443 1.00 . A A .  27 GLN HE21 1 1 
        3  1610 1 1 27 GLN HE22 H    4.465  -6.753   7.938 1.00 . A A .  27 GLN HE22 1 1 
        3  1611 1 1 27 GLN HG2  H    2.289  -7.147   4.743 1.00 . A A .  27 GLN HG2  1 1 
        3  1612 1 1 27 GLN HG3  H    4.038  -7.083   4.536 1.00 . A A .  27 GLN HG3  1 1 
        3  1613 1 1 27 GLN N    N    0.770  -5.869   3.339 1.00 . A A .  27 GLN N    1 1 
        3  1614 1 1 27 GLN NE2  N    4.335  -6.907   6.980 1.00 . A A .  27 GLN NE2  1 1 
        3  1615 1 1 27 GLN O    O    1.405  -2.434   3.551 1.00 . A A .  27 GLN O    1 1 
        3  1616 1 1 27 GLN OE1  O    2.574  -5.513   6.966 1.00 . A A .  27 GLN OE1  1 1 
        3  1617 1 1 28 LEU C    C    0.218  -1.962   0.788 1.00 . A A .  28 LEU C    1 1 
        3  1618 1 1 28 LEU CA   C    1.590  -2.628   0.792 1.00 . A A .  28 LEU CA   1 1 
        3  1619 1 1 28 LEU CB   C    1.938  -3.113  -0.616 1.00 . A A .  28 LEU CB   1 1 
        3  1620 1 1 28 LEU CD1  C    2.356  -0.870  -1.654 1.00 . A A .  28 LEU CD1  1 1 
        3  1621 1 1 28 LEU CD2  C    1.824  -2.837  -3.105 1.00 . A A .  28 LEU CD2  1 1 
        3  1622 1 1 28 LEU CG   C    1.572  -2.169  -1.761 1.00 . A A .  28 LEU CG   1 1 
        3  1623 1 1 28 LEU H    H    1.722  -4.654   1.389 1.00 . A A .  28 LEU H    1 1 
        3  1624 1 1 28 LEU HA   H    2.327  -1.905   1.108 1.00 . A A .  28 LEU HA   1 1 
        3  1625 1 1 28 LEU HB2  H    3.004  -3.281  -0.654 1.00 . A A .  28 LEU HB2  1 1 
        3  1626 1 1 28 LEU HB3  H    1.423  -4.049  -0.779 1.00 . A A .  28 LEU HB3  1 1 
        3  1627 1 1 28 LEU HD11 H    2.799  -0.638  -2.610 1.00 . A A .  28 LEU HD11 1 1 
        3  1628 1 1 28 LEU HD12 H    3.134  -0.980  -0.913 1.00 . A A .  28 LEU HD12 1 1 
        3  1629 1 1 28 LEU HD13 H    1.690  -0.071  -1.361 1.00 . A A .  28 LEU HD13 1 1 
        3  1630 1 1 28 LEU HD21 H    0.899  -3.245  -3.483 1.00 . A A .  28 LEU HD21 1 1 
        3  1631 1 1 28 LEU HD22 H    2.545  -3.631  -2.981 1.00 . A A .  28 LEU HD22 1 1 
        3  1632 1 1 28 LEU HD23 H    2.209  -2.107  -3.803 1.00 . A A .  28 LEU HD23 1 1 
        3  1633 1 1 28 LEU HG   H    0.519  -1.929  -1.698 1.00 . A A .  28 LEU HG   1 1 
        3  1634 1 1 28 LEU N    N    1.625  -3.742   1.734 1.00 . A A .  28 LEU N    1 1 
        3  1635 1 1 28 LEU O    O    0.107  -0.744   0.933 1.00 . A A .  28 LEU O    1 1 
        3  1636 1 1 29 ILE C    C   -2.415  -1.246   1.722 1.00 . A A .  29 ILE C    1 1 
        3  1637 1 1 29 ILE CA   C   -2.190  -2.258   0.604 1.00 . A A .  29 ILE CA   1 1 
        3  1638 1 1 29 ILE CB   C   -3.219  -3.395   0.741 1.00 . A A .  29 ILE CB   1 1 
        3  1639 1 1 29 ILE CD1  C   -3.836  -5.671  -0.218 1.00 . A A .  29 ILE CD1  1 1 
        3  1640 1 1 29 ILE CG1  C   -3.095  -4.370  -0.432 1.00 . A A .  29 ILE CG1  1 1 
        3  1641 1 1 29 ILE CG2  C   -4.629  -2.828   0.819 1.00 . A A .  29 ILE CG2  1 1 
        3  1642 1 1 29 ILE H    H   -0.673  -3.730   0.513 1.00 . A A .  29 ILE H    1 1 
        3  1643 1 1 29 ILE HA   H   -2.349  -1.769  -0.347 1.00 . A A .  29 ILE HA   1 1 
        3  1644 1 1 29 ILE HB   H   -3.019  -3.923   1.661 1.00 . A A .  29 ILE HB   1 1 
        3  1645 1 1 29 ILE HD11 H   -3.141  -6.496  -0.284 1.00 . A A .  29 ILE HD11 1 1 
        3  1646 1 1 29 ILE HD12 H   -4.297  -5.667   0.759 1.00 . A A .  29 ILE HD12 1 1 
        3  1647 1 1 29 ILE HD13 H   -4.598  -5.781  -0.975 1.00 . A A .  29 ILE HD13 1 1 
        3  1648 1 1 29 ILE HG12 H   -3.491  -3.905  -1.321 1.00 . A A .  29 ILE HG12 1 1 
        3  1649 1 1 29 ILE HG13 H   -2.052  -4.603  -0.587 1.00 . A A .  29 ILE HG13 1 1 
        3  1650 1 1 29 ILE HG21 H   -4.756  -2.306   1.756 1.00 . A A .  29 ILE HG21 1 1 
        3  1651 1 1 29 ILE HG22 H   -4.785  -2.140   0.001 1.00 . A A .  29 ILE HG22 1 1 
        3  1652 1 1 29 ILE HG23 H   -5.345  -3.633   0.755 1.00 . A A .  29 ILE HG23 1 1 
        3  1653 1 1 29 ILE N    N   -0.825  -2.769   0.623 1.00 . A A .  29 ILE N    1 1 
        3  1654 1 1 29 ILE O    O   -2.859  -0.124   1.480 1.00 . A A .  29 ILE O    1 1 
        3  1655 1 1 30 VAL C    C   -1.607   0.576   3.872 1.00 . A A .  30 VAL C    1 1 
        3  1656 1 1 30 VAL CA   C   -2.266  -0.779   4.107 1.00 . A A .  30 VAL CA   1 1 
        3  1657 1 1 30 VAL CB   C   -1.671  -1.414   5.377 1.00 . A A .  30 VAL CB   1 1 
        3  1658 1 1 30 VAL CG1  C   -1.771  -0.453   6.552 1.00 . A A .  30 VAL CG1  1 1 
        3  1659 1 1 30 VAL CG2  C   -2.369  -2.729   5.692 1.00 . A A .  30 VAL CG2  1 1 
        3  1660 1 1 30 VAL H    H   -1.752  -2.556   3.080 1.00 . A A .  30 VAL H    1 1 
        3  1661 1 1 30 VAL HA   H   -3.325  -0.630   4.265 1.00 . A A .  30 VAL HA   1 1 
        3  1662 1 1 30 VAL HB   H   -0.626  -1.619   5.197 1.00 . A A .  30 VAL HB   1 1 
        3  1663 1 1 30 VAL HG11 H   -2.593  -0.748   7.188 1.00 . A A .  30 VAL HG11 1 1 
        3  1664 1 1 30 VAL HG12 H   -0.850  -0.477   7.117 1.00 . A A .  30 VAL HG12 1 1 
        3  1665 1 1 30 VAL HG13 H   -1.942   0.548   6.184 1.00 . A A .  30 VAL HG13 1 1 
        3  1666 1 1 30 VAL HG21 H   -2.087  -3.059   6.681 1.00 . A A .  30 VAL HG21 1 1 
        3  1667 1 1 30 VAL HG22 H   -3.438  -2.587   5.650 1.00 . A A .  30 VAL HG22 1 1 
        3  1668 1 1 30 VAL HG23 H   -2.076  -3.475   4.967 1.00 . A A .  30 VAL HG23 1 1 
        3  1669 1 1 30 VAL N    N   -2.102  -1.650   2.950 1.00 . A A .  30 VAL N    1 1 
        3  1670 1 1 30 VAL O    O   -2.147   1.615   4.253 1.00 . A A .  30 VAL O    1 1 
        3  1671 1 1 31 HIS C    C   -0.455   2.643   1.943 1.00 . A A .  31 HIS C    1 1 
        3  1672 1 1 31 HIS CA   C    0.297   1.785   2.956 1.00 . A A .  31 HIS CA   1 1 
        3  1673 1 1 31 HIS CB   C    1.694   1.457   2.427 1.00 . A A .  31 HIS CB   1 1 
        3  1674 1 1 31 HIS CD2  C    2.870   3.020   0.723 1.00 . A A .  31 HIS CD2  1 1 
        3  1675 1 1 31 HIS CE1  C    3.518   4.583   2.116 1.00 . A A .  31 HIS CE1  1 1 
        3  1676 1 1 31 HIS CG   C    2.455   2.660   1.960 1.00 . A A .  31 HIS CG   1 1 
        3  1677 1 1 31 HIS H    H   -0.058  -0.302   2.964 1.00 . A A .  31 HIS H    1 1 
        3  1678 1 1 31 HIS HA   H    0.392   2.338   3.878 1.00 . A A .  31 HIS HA   1 1 
        3  1679 1 1 31 HIS HB2  H    2.268   0.987   3.211 1.00 . A A .  31 HIS HB2  1 1 
        3  1680 1 1 31 HIS HB3  H    1.605   0.776   1.593 1.00 . A A .  31 HIS HB3  1 1 
        3  1681 1 1 31 HIS HD1  H    2.728   3.689   3.778 1.00 . A A .  31 HIS HD1  1 1 
        3  1682 1 1 31 HIS HD2  H    2.713   2.467  -0.193 1.00 . A A .  31 HIS HD2  1 1 
        3  1683 1 1 31 HIS HE1  H    3.960   5.483   2.518 1.00 . A A .  31 HIS HE1  1 1 
        3  1684 1 1 31 HIS N    N   -0.436   0.557   3.243 1.00 . A A .  31 HIS N    1 1 
        3  1685 1 1 31 HIS ND1  N    2.877   3.660   2.810 1.00 . A A .  31 HIS ND1  1 1 
        3  1686 1 1 31 HIS NE2  N    3.528   4.219   0.847 1.00 . A A .  31 HIS NE2  1 1 
        3  1687 1 1 31 HIS O    O   -0.515   3.865   2.076 1.00 . A A .  31 HIS O    1 1 
        3  1688 1 1 32 GLN C    C   -2.932   3.485   0.503 1.00 . A A .  32 GLN C    1 1 
        3  1689 1 1 32 GLN CA   C   -1.773   2.700  -0.102 1.00 . A A .  32 GLN CA   1 1 
        3  1690 1 1 32 GLN CB   C   -2.299   1.711  -1.143 1.00 . A A .  32 GLN CB   1 1 
        3  1691 1 1 32 GLN CD   C   -1.707   0.252  -3.119 1.00 . A A .  32 GLN CD   1 1 
        3  1692 1 1 32 GLN CG   C   -1.201   0.957  -1.875 1.00 . A A .  32 GLN CG   1 1 
        3  1693 1 1 32 GLN H    H   -0.943   1.020   0.883 1.00 . A A .  32 GLN H    1 1 
        3  1694 1 1 32 GLN HA   H   -1.099   3.392  -0.584 1.00 . A A .  32 GLN HA   1 1 
        3  1695 1 1 32 GLN HB2  H   -2.935   0.991  -0.650 1.00 . A A .  32 GLN HB2  1 1 
        3  1696 1 1 32 GLN HB3  H   -2.882   2.253  -1.874 1.00 . A A .  32 GLN HB3  1 1 
        3  1697 1 1 32 GLN HE21 H   -0.265   1.084  -4.206 1.00 . A A .  32 GLN HE21 1 1 
        3  1698 1 1 32 GLN HE22 H   -1.342   0.038  -5.061 1.00 . A A .  32 GLN HE22 1 1 
        3  1699 1 1 32 GLN HG2  H   -0.432   1.657  -2.165 1.00 . A A .  32 GLN HG2  1 1 
        3  1700 1 1 32 GLN HG3  H   -0.782   0.220  -1.207 1.00 . A A .  32 GLN HG3  1 1 
        3  1701 1 1 32 GLN N    N   -1.026   1.995   0.933 1.00 . A A .  32 GLN N    1 1 
        3  1702 1 1 32 GLN NE2  N   -1.038   0.481  -4.243 1.00 . A A .  32 GLN NE2  1 1 
        3  1703 1 1 32 GLN O    O   -3.315   4.538  -0.009 1.00 . A A .  32 GLN O    1 1 
        3  1704 1 1 32 GLN OE1  O   -2.688  -0.491  -3.070 1.00 . A A .  32 GLN OE1  1 1 
        3  1705 1 1 33 ARG C    C   -4.257   5.062   2.622 1.00 . A A .  33 ARG C    1 1 
        3  1706 1 1 33 ARG CA   C   -4.604   3.619   2.267 1.00 . A A .  33 ARG CA   1 1 
        3  1707 1 1 33 ARG CB   C   -4.984   2.848   3.532 1.00 . A A .  33 ARG CB   1 1 
        3  1708 1 1 33 ARG CD   C   -6.287   0.854   4.334 1.00 . A A .  33 ARG CD   1 1 
        3  1709 1 1 33 ARG CG   C   -5.337   1.392   3.275 1.00 . A A .  33 ARG CG   1 1 
        3  1710 1 1 33 ARG CZ   C   -6.160   0.066   6.659 1.00 . A A .  33 ARG CZ   1 1 
        3  1711 1 1 33 ARG H    H   -3.137   2.125   1.954 1.00 . A A .  33 ARG H    1 1 
        3  1712 1 1 33 ARG HA   H   -5.444   3.619   1.590 1.00 . A A .  33 ARG HA   1 1 
        3  1713 1 1 33 ARG HB2  H   -4.154   2.878   4.222 1.00 . A A .  33 ARG HB2  1 1 
        3  1714 1 1 33 ARG HB3  H   -5.838   3.327   3.988 1.00 . A A .  33 ARG HB3  1 1 
        3  1715 1 1 33 ARG HD2  H   -6.941   1.653   4.651 1.00 . A A .  33 ARG HD2  1 1 
        3  1716 1 1 33 ARG HD3  H   -6.875   0.059   3.899 1.00 . A A .  33 ARG HD3  1 1 
        3  1717 1 1 33 ARG HE   H   -4.611   0.181   5.408 1.00 . A A .  33 ARG HE   1 1 
        3  1718 1 1 33 ARG HG2  H   -5.810   1.311   2.308 1.00 . A A .  33 ARG HG2  1 1 
        3  1719 1 1 33 ARG HG3  H   -4.430   0.805   3.286 1.00 . A A .  33 ARG HG3  1 1 
        3  1720 1 1 33 ARG HH11 H   -8.005   0.617   6.048 1.00 . A A .  33 ARG HH11 1 1 
        3  1721 1 1 33 ARG HH12 H   -7.901   0.060   7.685 1.00 . A A .  33 ARG HH12 1 1 
        3  1722 1 1 33 ARG HH21 H   -4.461  -0.555   7.562 1.00 . A A .  33 ARG HH21 1 1 
        3  1723 1 1 33 ARG HH22 H   -5.885  -0.606   8.545 1.00 . A A .  33 ARG HH22 1 1 
        3  1724 1 1 33 ARG N    N   -3.487   2.967   1.594 1.00 . A A .  33 ARG N    1 1 
        3  1725 1 1 33 ARG NE   N   -5.574   0.335   5.498 1.00 . A A .  33 ARG NE   1 1 
        3  1726 1 1 33 ARG NH1  N   -7.462   0.265   6.810 1.00 . A A .  33 ARG NH1  1 1 
        3  1727 1 1 33 ARG NH2  N   -5.443  -0.404   7.672 1.00 . A A .  33 ARG NH2  1 1 
        3  1728 1 1 33 ARG O    O   -5.098   5.956   2.526 1.00 . A A .  33 ARG O    1 1 
        3  1729 1 1 34 THR C    C   -2.591   7.561   2.211 1.00 . A A .  34 THR C    1 1 
        3  1730 1 1 34 THR CA   C   -2.554   6.614   3.405 1.00 . A A .  34 THR CA   1 1 
        3  1731 1 1 34 THR CB   C   -1.122   6.579   3.972 1.00 . A A .  34 THR CB   1 1 
        3  1732 1 1 34 THR CG2  C   -1.018   5.582   5.117 1.00 . A A .  34 THR CG2  1 1 
        3  1733 1 1 34 THR H    H   -2.388   4.528   3.089 1.00 . A A .  34 THR H    1 1 
        3  1734 1 1 34 THR HA   H   -3.214   6.992   4.173 1.00 . A A .  34 THR HA   1 1 
        3  1735 1 1 34 THR HB   H   -0.875   7.562   4.347 1.00 . A A .  34 THR HB   1 1 
        3  1736 1 1 34 THR HG1  H    0.222   7.021   2.598 1.00 . A A .  34 THR HG1  1 1 
        3  1737 1 1 34 THR HG21 H    0.018   5.460   5.394 1.00 . A A .  34 THR HG21 1 1 
        3  1738 1 1 34 THR HG22 H   -1.421   4.630   4.803 1.00 . A A .  34 THR HG22 1 1 
        3  1739 1 1 34 THR HG23 H   -1.578   5.947   5.965 1.00 . A A .  34 THR HG23 1 1 
        3  1740 1 1 34 THR N    N   -3.012   5.282   3.034 1.00 . A A .  34 THR N    1 1 
        3  1741 1 1 34 THR O    O   -2.942   8.734   2.346 1.00 . A A .  34 THR O    1 1 
        3  1742 1 1 34 THR OG1  O   -0.195   6.226   2.940 1.00 . A A .  34 THR OG1  1 1 
        3  1743 1 1 35 HIS C    C   -3.640   8.258  -0.566 1.00 . A A .  35 HIS C    1 1 
        3  1744 1 1 35 HIS CA   C   -2.222   7.846  -0.179 1.00 . A A .  35 HIS CA   1 1 
        3  1745 1 1 35 HIS CB   C   -1.576   7.065  -1.323 1.00 . A A .  35 HIS CB   1 1 
        3  1746 1 1 35 HIS CD2  C    0.936   6.436  -1.173 1.00 . A A .  35 HIS CD2  1 1 
        3  1747 1 1 35 HIS CE1  C    1.785   8.346  -1.833 1.00 . A A .  35 HIS CE1  1 1 
        3  1748 1 1 35 HIS CG   C   -0.096   7.273  -1.429 1.00 . A A .  35 HIS CG   1 1 
        3  1749 1 1 35 HIS H    H   -1.960   6.104   0.996 1.00 . A A .  35 HIS H    1 1 
        3  1750 1 1 35 HIS HA   H   -1.642   8.736   0.012 1.00 . A A .  35 HIS HA   1 1 
        3  1751 1 1 35 HIS HB2  H   -1.752   6.010  -1.175 1.00 . A A .  35 HIS HB2  1 1 
        3  1752 1 1 35 HIS HB3  H   -2.022   7.372  -2.258 1.00 . A A .  35 HIS HB3  1 1 
        3  1753 1 1 35 HIS HD1  H   -0.021   9.270  -2.098 1.00 . A A .  35 HIS HD1  1 1 
        3  1754 1 1 35 HIS HD2  H    0.863   5.413  -0.830 1.00 . A A .  35 HIS HD2  1 1 
        3  1755 1 1 35 HIS HE1  H    2.489   9.118  -2.108 1.00 . A A .  35 HIS HE1  1 1 
        3  1756 1 1 35 HIS N    N   -2.229   7.045   1.041 1.00 . A A .  35 HIS N    1 1 
        3  1757 1 1 35 HIS ND1  N    0.469   8.462  -1.839 1.00 . A A .  35 HIS ND1  1 1 
        3  1758 1 1 35 HIS NE2  N    2.094   7.126  -1.432 1.00 . A A .  35 HIS NE2  1 1 
        3  1759 1 1 35 HIS O    O   -3.875   9.391  -0.984 1.00 . A A .  35 HIS O    1 1 
        3  1760 1 1 36 SER C    C   -6.602   8.558   0.240 1.00 . A A .  36 SER C    1 1 
        3  1761 1 1 36 SER CA   C   -5.973   7.594  -0.762 1.00 . A A .  36 SER CA   1 1 
        3  1762 1 1 36 SER CB   C   -6.769   6.288  -0.799 1.00 . A A .  36 SER CB   1 1 
        3  1763 1 1 36 SER H    H   -4.330   6.444  -0.085 1.00 . A A .  36 SER H    1 1 
        3  1764 1 1 36 SER HA   H   -5.996   8.047  -1.742 1.00 . A A .  36 SER HA   1 1 
        3  1765 1 1 36 SER HB2  H   -7.773   6.490  -1.140 1.00 . A A .  36 SER HB2  1 1 
        3  1766 1 1 36 SER HB3  H   -6.290   5.597  -1.478 1.00 . A A .  36 SER HB3  1 1 
        3  1767 1 1 36 SER HG   H   -6.798   4.739   0.399 1.00 . A A .  36 SER HG   1 1 
        3  1768 1 1 36 SER N    N   -4.580   7.329  -0.423 1.00 . A A .  36 SER N    1 1 
        3  1769 1 1 36 SER O    O   -6.253   8.560   1.419 1.00 . A A .  36 SER O    1 1 
        3  1770 1 1 36 SER OG   O   -6.834   5.694   0.486 1.00 . A A .  36 SER OG   1 1 
        3  1771 1 1 37 GLY C    C   -7.987  11.766   0.174 1.00 . A A .  37 GLY C    1 1 
        3  1772 1 1 37 GLY CA   C   -8.197  10.334   0.625 1.00 . A A .  37 GLY CA   1 1 
        3  1773 1 1 37 GLY H    H   -7.771   9.331  -1.190 1.00 . A A .  37 GLY H    1 1 
        3  1774 1 1 37 GLY HA2  H   -9.255  10.122   0.634 1.00 . A A .  37 GLY HA2  1 1 
        3  1775 1 1 37 GLY HA3  H   -7.810  10.225   1.627 1.00 . A A .  37 GLY HA3  1 1 
        3  1776 1 1 37 GLY N    N   -7.533   9.377  -0.241 1.00 . A A .  37 GLY N    1 1 
        3  1777 1 1 37 GLY O    O   -6.970  12.087  -0.441 1.00 . A A .  37 GLY O    1 1 
        3  1778 1 1 38 GLU C    C   -8.744  14.180  -1.417 1.00 . A A .  38 GLU C    1 1 
        3  1779 1 1 38 GLU CA   C   -8.868  14.034   0.097 1.00 . A A .  38 GLU CA   1 1 
        3  1780 1 1 38 GLU CB   C   -7.675  14.701   0.784 1.00 . A A .  38 GLU CB   1 1 
        3  1781 1 1 38 GLU CD   C   -6.752  15.612   2.952 1.00 . A A .  38 GLU CD   1 1 
        3  1782 1 1 38 GLU CG   C   -7.996  15.248   2.165 1.00 . A A .  38 GLU CG   1 1 
        3  1783 1 1 38 GLU H    H   -9.738  12.312   0.970 1.00 . A A .  38 GLU H    1 1 
        3  1784 1 1 38 GLU HA   H   -9.776  14.520   0.420 1.00 . A A .  38 GLU HA   1 1 
        3  1785 1 1 38 GLU HB2  H   -6.880  13.977   0.882 1.00 . A A .  38 GLU HB2  1 1 
        3  1786 1 1 38 GLU HB3  H   -7.331  15.518   0.168 1.00 . A A .  38 GLU HB3  1 1 
        3  1787 1 1 38 GLU HG2  H   -8.605  16.133   2.055 1.00 . A A .  38 GLU HG2  1 1 
        3  1788 1 1 38 GLU HG3  H   -8.546  14.500   2.716 1.00 . A A .  38 GLU HG3  1 1 
        3  1789 1 1 38 GLU N    N   -8.952  12.629   0.478 1.00 . A A .  38 GLU N    1 1 
        3  1790 1 1 38 GLU O    O   -7.967  14.997  -1.911 1.00 . A A .  38 GLU O    1 1 
        3  1791 1 1 38 GLU OE1  O   -5.684  15.026   2.677 1.00 . A A .  38 GLU OE1  1 1 
        3  1792 1 1 38 GLU OE2  O   -6.846  16.482   3.843 1.00 . A A .  38 GLU OE2  1 1 
        3  1793 1 1 39 SER C    C  -10.411  14.512  -4.137 1.00 . A A .  39 SER C    1 1 
        3  1794 1 1 39 SER CA   C   -9.490  13.419  -3.605 1.00 . A A .  39 SER CA   1 1 
        3  1795 1 1 39 SER CB   C   -9.905  12.062  -4.178 1.00 . A A .  39 SER CB   1 1 
        3  1796 1 1 39 SER H    H  -10.114  12.751  -1.696 1.00 . A A .  39 SER H    1 1 
        3  1797 1 1 39 SER HA   H   -8.478  13.635  -3.914 1.00 . A A .  39 SER HA   1 1 
        3  1798 1 1 39 SER HB2  H   -9.140  11.333  -3.961 1.00 . A A .  39 SER HB2  1 1 
        3  1799 1 1 39 SER HB3  H  -10.837  11.754  -3.726 1.00 . A A .  39 SER HB3  1 1 
        3  1800 1 1 39 SER HG   H   -9.303  12.528  -5.983 1.00 . A A .  39 SER HG   1 1 
        3  1801 1 1 39 SER N    N   -9.515  13.382  -2.148 1.00 . A A .  39 SER N    1 1 
        3  1802 1 1 39 SER O    O  -11.463  14.787  -3.562 1.00 . A A .  39 SER O    1 1 
        3  1803 1 1 39 SER OG   O  -10.082  12.135  -5.583 1.00 . A A .  39 SER OG   1 1 
        3  1804 1 1 40 GLY C    C  -10.169  16.768  -7.082 1.00 . A A .  40 GLY C    1 1 
        3  1805 1 1 40 GLY CA   C  -10.805  16.190  -5.833 1.00 . A A .  40 GLY CA   1 1 
        3  1806 1 1 40 GLY H    H   -9.158  14.872  -5.657 1.00 . A A .  40 GLY H    1 1 
        3  1807 1 1 40 GLY HA2  H  -11.776  15.792  -6.088 1.00 . A A .  40 GLY HA2  1 1 
        3  1808 1 1 40 GLY HA3  H  -10.930  16.981  -5.108 1.00 . A A .  40 GLY HA3  1 1 
        3  1809 1 1 40 GLY N    N  -10.006  15.133  -5.241 1.00 . A A .  40 GLY N    1 1 
        3  1810 1 1 40 GLY O    O  -10.386  16.287  -8.194 1.00 . A A .  40 GLY O    1 1 
        3  1811 1 1 41 PRO C    C   -7.575  17.631  -8.619 1.00 . A A .  41 PRO C    1 1 
        3  1812 1 1 41 PRO CA   C   -8.678  18.494  -8.016 1.00 . A A .  41 PRO CA   1 1 
        3  1813 1 1 41 PRO CB   C   -8.083  19.745  -7.364 1.00 . A A .  41 PRO CB   1 1 
        3  1814 1 1 41 PRO CD   C   -9.060  18.451  -5.607 1.00 . A A .  41 PRO CD   1 1 
        3  1815 1 1 41 PRO CG   C   -7.925  19.385  -5.927 1.00 . A A .  41 PRO CG   1 1 
        3  1816 1 1 41 PRO HA   H   -9.371  18.785  -8.792 1.00 . A A .  41 PRO HA   1 1 
        3  1817 1 1 41 PRO HB2  H   -7.131  19.974  -7.822 1.00 . A A .  41 PRO HB2  1 1 
        3  1818 1 1 41 PRO HB3  H   -8.759  20.577  -7.491 1.00 . A A .  41 PRO HB3  1 1 
        3  1819 1 1 41 PRO HD2  H   -8.747  17.711  -4.886 1.00 . A A .  41 PRO HD2  1 1 
        3  1820 1 1 41 PRO HD3  H   -9.911  19.004  -5.238 1.00 . A A .  41 PRO HD3  1 1 
        3  1821 1 1 41 PRO HG2  H   -6.978  18.891  -5.774 1.00 . A A .  41 PRO HG2  1 1 
        3  1822 1 1 41 PRO HG3  H   -7.989  20.274  -5.318 1.00 . A A .  41 PRO HG3  1 1 
        3  1823 1 1 41 PRO N    N   -9.364  17.826  -6.905 1.00 . A A .  41 PRO N    1 1 
        3  1824 1 1 41 PRO O    O   -7.276  16.548  -8.116 1.00 . A A .  41 PRO O    1 1 
        3  1825 1 1 42 SER C    C   -5.035  16.645  -9.364 1.00 . A A .  42 SER C    1 1 
        3  1826 1 1 42 SER CA   C   -5.904  17.390 -10.372 1.00 . A A .  42 SER CA   1 1 
        3  1827 1 1 42 SER CB   C   -5.043  18.350 -11.194 1.00 . A A .  42 SER CB   1 1 
        3  1828 1 1 42 SER H    H   -7.256  18.987 -10.052 1.00 . A A .  42 SER H    1 1 
        3  1829 1 1 42 SER HA   H   -6.361  16.671 -11.037 1.00 . A A .  42 SER HA   1 1 
        3  1830 1 1 42 SER HB2  H   -4.184  17.821 -11.578 1.00 . A A .  42 SER HB2  1 1 
        3  1831 1 1 42 SER HB3  H   -5.625  18.737 -12.017 1.00 . A A .  42 SER HB3  1 1 
        3  1832 1 1 42 SER HG   H   -5.345  19.864  -9.988 1.00 . A A .  42 SER HG   1 1 
        3  1833 1 1 42 SER N    N   -6.973  18.118  -9.699 1.00 . A A .  42 SER N    1 1 
        3  1834 1 1 42 SER O    O   -4.615  17.209  -8.354 1.00 . A A .  42 SER O    1 1 
        3  1835 1 1 42 SER OG   O   -4.593  19.436 -10.402 1.00 . A A .  42 SER OG   1 1 
        3  1836 1 1 43 SER C    C   -2.834  15.370  -8.133 1.00 . A A .  43 SER C    1 1 
        3  1837 1 1 43 SER CA   C   -3.954  14.548  -8.763 1.00 . A A .  43 SER CA   1 1 
        3  1838 1 1 43 SER CB   C   -3.363  13.367  -9.535 1.00 . A A .  43 SER CB   1 1 
        3  1839 1 1 43 SER H    H   -5.134  14.980 -10.467 1.00 . A A .  43 SER H    1 1 
        3  1840 1 1 43 SER HA   H   -4.593  14.171  -7.978 1.00 . A A .  43 SER HA   1 1 
        3  1841 1 1 43 SER HB2  H   -4.164  12.744  -9.903 1.00 . A A .  43 SER HB2  1 1 
        3  1842 1 1 43 SER HB3  H   -2.784  13.739 -10.368 1.00 . A A .  43 SER HB3  1 1 
        3  1843 1 1 43 SER HG   H   -2.734  11.656  -8.817 1.00 . A A .  43 SER HG   1 1 
        3  1844 1 1 43 SER N    N   -4.770  15.373  -9.646 1.00 . A A .  43 SER N    1 1 
        3  1845 1 1 43 SER O    O   -2.331  16.319  -8.734 1.00 . A A .  43 SER O    1 1 
        3  1846 1 1 43 SER OG   O   -2.521  12.586  -8.705 1.00 . A A .  43 SER OG   1 1 
        3  1847 1 1 44 GLY C    C   -0.258  16.113  -7.150 1.00 . A A .  44 GLY C    1 1 
        3  1848 1 1 44 GLY CA   C   -1.389  15.711  -6.224 1.00 . A A .  44 GLY CA   1 1 
        3  1849 1 1 44 GLY H    H   -2.884  14.234  -6.485 1.00 . A A .  44 GLY H    1 1 
        3  1850 1 1 44 GLY HA2  H   -1.804  16.599  -5.772 1.00 . A A .  44 GLY HA2  1 1 
        3  1851 1 1 44 GLY HA3  H   -0.993  15.075  -5.445 1.00 . A A .  44 GLY HA3  1 1 
        3  1852 1 1 44 GLY N    N   -2.447  14.998  -6.916 1.00 . A A .  44 GLY N    1 1 
        3  1853 1 1 44 GLY O    O    0.688  16.754  -6.696 1.00 . A A .  44 GLY O    1 1 
        3  1854 2 2  1 ZN  ZN   ZN   3.419   5.220  -1.264 1.00 . B A . 201 ZN  ZN   1 1 
        4  1855 1 1  1 GLY C    C   36.234  -0.156  -1.970 1.00 . A A .   1 GLY C    1 1 
        4  1856 1 1  1 GLY CA   C   36.783  -1.554  -2.174 1.00 . A A .   1 GLY CA   1 1 
        4  1857 1 1  1 GLY H1   H   38.691  -2.257  -2.764 1.00 . A A .   1 GLY H1   1 1 
        4  1858 1 1  1 GLY HA2  H   36.049  -2.144  -2.702 1.00 . A A .   1 GLY HA2  1 1 
        4  1859 1 1  1 GLY HA3  H   36.962  -2.002  -1.207 1.00 . A A .   1 GLY HA3  1 1 
        4  1860 1 1  1 GLY N    N   38.022  -1.560  -2.928 1.00 . A A .   1 GLY N    1 1 
        4  1861 1 1  1 GLY O    O   36.960   0.750  -1.559 1.00 . A A .   1 GLY O    1 1 
        4  1862 1 1  2 SER C    C   32.817   1.160  -1.820 1.00 . A A .   2 SER C    1 1 
        4  1863 1 1  2 SER CA   C   34.305   1.322  -2.112 1.00 . A A .   2 SER CA   1 1 
        4  1864 1 1  2 SER CB   C   34.500   2.159  -3.378 1.00 . A A .   2 SER CB   1 1 
        4  1865 1 1  2 SER H    H   34.423  -0.739  -2.584 1.00 . A A .   2 SER H    1 1 
        4  1866 1 1  2 SER HA   H   34.770   1.829  -1.280 1.00 . A A .   2 SER HA   1 1 
        4  1867 1 1  2 SER HB2  H   35.553   2.216  -3.610 1.00 . A A .   2 SER HB2  1 1 
        4  1868 1 1  2 SER HB3  H   33.975   1.692  -4.199 1.00 . A A .   2 SER HB3  1 1 
        4  1869 1 1  2 SER HG   H   33.321   3.469  -2.524 1.00 . A A .   2 SER HG   1 1 
        4  1870 1 1  2 SER N    N   34.949   0.022  -2.260 1.00 . A A .   2 SER N    1 1 
        4  1871 1 1  2 SER O    O   32.073   0.595  -2.622 1.00 . A A .   2 SER O    1 1 
        4  1872 1 1  2 SER OG   O   34.000   3.473  -3.202 1.00 . A A .   2 SER OG   1 1 
        4  1873 1 1  3 SER C    C   30.129   2.538  -1.070 1.00 . A A .   3 SER C    1 1 
        4  1874 1 1  3 SER CA   C   30.990   1.570  -0.264 1.00 . A A .   3 SER CA   1 1 
        4  1875 1 1  3 SER CB   C   30.845   1.864   1.230 1.00 . A A .   3 SER CB   1 1 
        4  1876 1 1  3 SER H    H   33.030   2.101  -0.068 1.00 . A A .   3 SER H    1 1 
        4  1877 1 1  3 SER HA   H   30.655   0.562  -0.458 1.00 . A A .   3 SER HA   1 1 
        4  1878 1 1  3 SER HB2  H   31.242   2.846   1.441 1.00 . A A .   3 SER HB2  1 1 
        4  1879 1 1  3 SER HB3  H   29.800   1.833   1.501 1.00 . A A .   3 SER HB3  1 1 
        4  1880 1 1  3 SER HG   H   31.924   0.242   1.432 1.00 . A A .   3 SER HG   1 1 
        4  1881 1 1  3 SER N    N   32.389   1.661  -0.665 1.00 . A A .   3 SER N    1 1 
        4  1882 1 1  3 SER O    O   30.098   3.736  -0.794 1.00 . A A .   3 SER O    1 1 
        4  1883 1 1  3 SER OG   O   31.548   0.911   2.008 1.00 . A A .   3 SER OG   1 1 
        4  1884 1 1  4 GLY C    C   27.473   3.508  -2.111 1.00 . A A .   4 GLY C    1 1 
        4  1885 1 1  4 GLY CA   C   28.578   2.837  -2.902 1.00 . A A .   4 GLY CA   1 1 
        4  1886 1 1  4 GLY H    H   29.494   1.045  -2.244 1.00 . A A .   4 GLY H    1 1 
        4  1887 1 1  4 GLY HA2  H   29.184   3.597  -3.372 1.00 . A A .   4 GLY HA2  1 1 
        4  1888 1 1  4 GLY HA3  H   28.133   2.220  -3.669 1.00 . A A .   4 GLY HA3  1 1 
        4  1889 1 1  4 GLY N    N   29.430   2.007  -2.070 1.00 . A A .   4 GLY N    1 1 
        4  1890 1 1  4 GLY O    O   27.733   4.178  -1.112 1.00 . A A .   4 GLY O    1 1 
        4  1891 1 1  5 SER C    C   24.361   2.899  -1.030 1.00 . A A .   5 SER C    1 1 
        4  1892 1 1  5 SER CA   C   25.085   3.929  -1.892 1.00 . A A .   5 SER CA   1 1 
        4  1893 1 1  5 SER CB   C   24.120   4.519  -2.921 1.00 . A A .   5 SER CB   1 1 
        4  1894 1 1  5 SER H    H   26.091   2.786  -3.363 1.00 . A A .   5 SER H    1 1 
        4  1895 1 1  5 SER HA   H   25.448   4.722  -1.255 1.00 . A A .   5 SER HA   1 1 
        4  1896 1 1  5 SER HB2  H   24.001   3.825  -3.739 1.00 . A A .   5 SER HB2  1 1 
        4  1897 1 1  5 SER HB3  H   23.161   4.691  -2.454 1.00 . A A .   5 SER HB3  1 1 
        4  1898 1 1  5 SER HG   H   23.941   6.430  -3.314 1.00 . A A .   5 SER HG   1 1 
        4  1899 1 1  5 SER N    N   26.234   3.330  -2.561 1.00 . A A .   5 SER N    1 1 
        4  1900 1 1  5 SER O    O   23.980   3.181   0.106 1.00 . A A .   5 SER O    1 1 
        4  1901 1 1  5 SER OG   O   24.607   5.748  -3.431 1.00 . A A .   5 SER OG   1 1 
        4  1902 1 1  6 SER C    C   22.101   1.072  -0.423 1.00 . A A .   6 SER C    1 1 
        4  1903 1 1  6 SER CA   C   23.493   0.631  -0.865 1.00 . A A .   6 SER CA   1 1 
        4  1904 1 1  6 SER CB   C   24.314   0.198   0.352 1.00 . A A .   6 SER CB   1 1 
        4  1905 1 1  6 SER H    H   24.502   1.539  -2.490 1.00 . A A .   6 SER H    1 1 
        4  1906 1 1  6 SER HA   H   23.395  -0.207  -1.539 1.00 . A A .   6 SER HA   1 1 
        4  1907 1 1  6 SER HB2  H   25.359   0.170   0.086 1.00 . A A .   6 SER HB2  1 1 
        4  1908 1 1  6 SER HB3  H   24.165   0.907   1.153 1.00 . A A .   6 SER HB3  1 1 
        4  1909 1 1  6 SER HG   H   24.608  -1.724   0.589 1.00 . A A .   6 SER HG   1 1 
        4  1910 1 1  6 SER N    N   24.175   1.703  -1.580 1.00 . A A .   6 SER N    1 1 
        4  1911 1 1  6 SER O    O   21.676   0.793   0.698 1.00 . A A .   6 SER O    1 1 
        4  1912 1 1  6 SER OG   O   23.922  -1.087   0.801 1.00 . A A .   6 SER OG   1 1 
        4  1913 1 1  7 GLY C    C   19.041   1.834  -2.046 1.00 . A A .   7 GLY C    1 1 
        4  1914 1 1  7 GLY CA   C   20.059   2.233  -0.996 1.00 . A A .   7 GLY CA   1 1 
        4  1915 1 1  7 GLY H    H   21.786   1.957  -2.190 1.00 . A A .   7 GLY H    1 1 
        4  1916 1 1  7 GLY HA2  H   19.760   1.821  -0.045 1.00 . A A .   7 GLY HA2  1 1 
        4  1917 1 1  7 GLY HA3  H   20.077   3.311  -0.921 1.00 . A A .   7 GLY HA3  1 1 
        4  1918 1 1  7 GLY N    N   21.396   1.764  -1.312 1.00 . A A .   7 GLY N    1 1 
        4  1919 1 1  7 GLY O    O   18.343   2.684  -2.601 1.00 . A A .   7 GLY O    1 1 
        4  1920 1 1  8 THR C    C   17.084  -1.012  -2.705 1.00 . A A .   8 THR C    1 1 
        4  1921 1 1  8 THR CA   C   18.018   0.027  -3.315 1.00 . A A .   8 THR CA   1 1 
        4  1922 1 1  8 THR CB   C   18.755  -0.602  -4.513 1.00 . A A .   8 THR CB   1 1 
        4  1923 1 1  8 THR CG2  C   19.656   0.419  -5.190 1.00 . A A .   8 THR CG2  1 1 
        4  1924 1 1  8 THR H    H   19.539  -0.091  -1.847 1.00 . A A .   8 THR H    1 1 
        4  1925 1 1  8 THR HA   H   17.431   0.858  -3.676 1.00 . A A .   8 THR HA   1 1 
        4  1926 1 1  8 THR HB   H   18.021  -0.943  -5.229 1.00 . A A .   8 THR HB   1 1 
        4  1927 1 1  8 THR HG1  H   19.135  -2.104  -3.292 1.00 . A A .   8 THR HG1  1 1 
        4  1928 1 1  8 THR HG21 H   20.583  -0.055  -5.478 1.00 . A A .   8 THR HG21 1 1 
        4  1929 1 1  8 THR HG22 H   19.863   1.227  -4.505 1.00 . A A .   8 THR HG22 1 1 
        4  1930 1 1  8 THR HG23 H   19.163   0.808  -6.068 1.00 . A A .   8 THR HG23 1 1 
        4  1931 1 1  8 THR N    N   18.956   0.537  -2.323 1.00 . A A .   8 THR N    1 1 
        4  1932 1 1  8 THR O    O   17.520  -2.087  -2.294 1.00 . A A .   8 THR O    1 1 
        4  1933 1 1  8 THR OG1  O   19.536  -1.720  -4.076 1.00 . A A .   8 THR OG1  1 1 
        4  1934 1 1  9 ARG C    C   14.818  -2.932  -2.817 1.00 . A A .   9 ARG C    1 1 
        4  1935 1 1  9 ARG CA   C   14.801  -1.590  -2.091 1.00 . A A .   9 ARG CA   1 1 
        4  1936 1 1  9 ARG CB   C   13.407  -0.967  -2.182 1.00 . A A .   9 ARG CB   1 1 
        4  1937 1 1  9 ARG CD   C   12.812  -0.396   0.192 1.00 . A A .   9 ARG CD   1 1 
        4  1938 1 1  9 ARG CG   C   13.173   0.152  -1.179 1.00 . A A .   9 ARG CG   1 1 
        4  1939 1 1  9 ARG CZ   C   12.297   0.533   2.410 1.00 . A A .   9 ARG CZ   1 1 
        4  1940 1 1  9 ARG H    H   15.511   0.187  -2.996 1.00 . A A .   9 ARG H    1 1 
        4  1941 1 1  9 ARG HA   H   15.047  -1.752  -1.053 1.00 . A A .   9 ARG HA   1 1 
        4  1942 1 1  9 ARG HB2  H   13.268  -0.565  -3.175 1.00 . A A .   9 ARG HB2  1 1 
        4  1943 1 1  9 ARG HB3  H   12.670  -1.736  -2.007 1.00 . A A .   9 ARG HB3  1 1 
        4  1944 1 1  9 ARG HD2  H   11.801  -0.773   0.160 1.00 . A A .   9 ARG HD2  1 1 
        4  1945 1 1  9 ARG HD3  H   13.489  -1.201   0.433 1.00 . A A .   9 ARG HD3  1 1 
        4  1946 1 1  9 ARG HE   H   13.442   1.422   1.039 1.00 . A A .   9 ARG HE   1 1 
        4  1947 1 1  9 ARG HG2  H   14.075   0.740  -1.094 1.00 . A A .   9 ARG HG2  1 1 
        4  1948 1 1  9 ARG HG3  H   12.366   0.776  -1.533 1.00 . A A .   9 ARG HG3  1 1 
        4  1949 1 1  9 ARG HH11 H   11.462  -1.266   2.027 1.00 . A A .   9 ARG HH11 1 1 
        4  1950 1 1  9 ARG HH12 H   11.107  -0.600   3.586 1.00 . A A .   9 ARG HH12 1 1 
        4  1951 1 1  9 ARG HH21 H   12.982   2.309   3.090 1.00 . A A .   9 ARG HH21 1 1 
        4  1952 1 1  9 ARG HH22 H   11.971   1.434   4.190 1.00 . A A .   9 ARG HH22 1 1 
        4  1953 1 1  9 ARG N    N   15.797  -0.684  -2.652 1.00 . A A .   9 ARG N    1 1 
        4  1954 1 1  9 ARG NE   N   12.903   0.627   1.231 1.00 . A A .   9 ARG NE   1 1 
        4  1955 1 1  9 ARG NH1  N   11.561  -0.531   2.698 1.00 . A A .   9 ARG NH1  1 1 
        4  1956 1 1  9 ARG NH2  N   12.427   1.505   3.303 1.00 . A A .   9 ARG NH2  1 1 
        4  1957 1 1  9 ARG O    O   15.024  -2.991  -4.028 1.00 . A A .   9 ARG O    1 1 
        4  1958 1 1 10 GLU C    C   13.186  -5.942  -2.612 1.00 . A A .  10 GLU C    1 1 
        4  1959 1 1 10 GLU CA   C   14.592  -5.349  -2.637 1.00 . A A .  10 GLU CA   1 1 
        4  1960 1 1 10 GLU CB   C   15.555  -6.259  -1.873 1.00 . A A .  10 GLU CB   1 1 
        4  1961 1 1 10 GLU CD   C   15.990  -7.542   0.259 1.00 . A A .  10 GLU CD   1 1 
        4  1962 1 1 10 GLU CG   C   15.186  -6.445  -0.411 1.00 . A A .  10 GLU CG   1 1 
        4  1963 1 1 10 GLU H    H   14.442  -3.896  -1.105 1.00 . A A .  10 GLU H    1 1 
        4  1964 1 1 10 GLU HA   H   14.920  -5.274  -3.663 1.00 . A A .  10 GLU HA   1 1 
        4  1965 1 1 10 GLU HB2  H   15.567  -7.230  -2.346 1.00 . A A .  10 GLU HB2  1 1 
        4  1966 1 1 10 GLU HB3  H   16.547  -5.834  -1.920 1.00 . A A .  10 GLU HB3  1 1 
        4  1967 1 1 10 GLU HG2  H   15.364  -5.518   0.113 1.00 . A A .  10 GLU HG2  1 1 
        4  1968 1 1 10 GLU HG3  H   14.137  -6.698  -0.347 1.00 . A A .  10 GLU HG3  1 1 
        4  1969 1 1 10 GLU N    N   14.600  -4.007  -2.066 1.00 . A A .  10 GLU N    1 1 
        4  1970 1 1 10 GLU O    O   12.789  -6.667  -3.525 1.00 . A A .  10 GLU O    1 1 
        4  1971 1 1 10 GLU OE1  O   16.034  -8.664  -0.286 1.00 . A A .  10 GLU OE1  1 1 
        4  1972 1 1 10 GLU OE2  O   16.576  -7.278   1.330 1.00 . A A .  10 GLU OE2  1 1 
        4  1973 1 1 11 LYS C    C   10.389  -6.243  -2.772 1.00 . A A .  11 LYS C    1 1 
        4  1974 1 1 11 LYS CA   C   11.075  -6.130  -1.415 1.00 . A A .  11 LYS CA   1 1 
        4  1975 1 1 11 LYS CB   C   10.267  -5.209  -0.498 1.00 . A A .  11 LYS CB   1 1 
        4  1976 1 1 11 LYS CD   C   11.492  -4.906   1.674 1.00 . A A .  11 LYS CD   1 1 
        4  1977 1 1 11 LYS CE   C   11.217  -4.738   3.160 1.00 . A A .  11 LYS CE   1 1 
        4  1978 1 1 11 LYS CG   C   10.337  -5.597   0.969 1.00 . A A .  11 LYS CG   1 1 
        4  1979 1 1 11 LYS H    H   12.809  -5.047  -0.865 1.00 . A A .  11 LYS H    1 1 
        4  1980 1 1 11 LYS HA   H   11.128  -7.111  -0.969 1.00 . A A .  11 LYS HA   1 1 
        4  1981 1 1 11 LYS HB2  H   10.641  -4.201  -0.601 1.00 . A A .  11 LYS HB2  1 1 
        4  1982 1 1 11 LYS HB3  H    9.232  -5.233  -0.806 1.00 . A A .  11 LYS HB3  1 1 
        4  1983 1 1 11 LYS HD2  H   12.385  -5.499   1.549 1.00 . A A .  11 LYS HD2  1 1 
        4  1984 1 1 11 LYS HD3  H   11.640  -3.930   1.232 1.00 . A A .  11 LYS HD3  1 1 
        4  1985 1 1 11 LYS HE2  H   11.710  -3.842   3.506 1.00 . A A .  11 LYS HE2  1 1 
        4  1986 1 1 11 LYS HE3  H   10.151  -4.641   3.307 1.00 . A A .  11 LYS HE3  1 1 
        4  1987 1 1 11 LYS HG2  H    9.413  -5.313   1.451 1.00 . A A .  11 LYS HG2  1 1 
        4  1988 1 1 11 LYS HG3  H   10.470  -6.667   1.043 1.00 . A A .  11 LYS HG3  1 1 
        4  1989 1 1 11 LYS HZ1  H   11.589  -5.719   4.967 1.00 . A A .  11 LYS HZ1  1 1 
        4  1990 1 1 11 LYS HZ2  H   12.722  -6.058   3.757 1.00 . A A .  11 LYS HZ2  1 1 
        4  1991 1 1 11 LYS HZ3  H   11.183  -6.757   3.695 1.00 . A A .  11 LYS HZ3  1 1 
        4  1992 1 1 11 LYS N    N   12.437  -5.630  -1.561 1.00 . A A .  11 LYS N    1 1 
        4  1993 1 1 11 LYS NZ   N   11.712  -5.899   3.950 1.00 . A A .  11 LYS NZ   1 1 
        4  1994 1 1 11 LYS O    O   10.577  -5.413  -3.661 1.00 . A A .  11 LYS O    1 1 
        4  1995 1 1 12 PRO C    C    7.732  -6.519  -4.415 1.00 . A A .  12 PRO C    1 1 
        4  1996 1 1 12 PRO CA   C    8.840  -7.540  -4.184 1.00 . A A .  12 PRO CA   1 1 
        4  1997 1 1 12 PRO CB   C    8.247  -8.936  -3.977 1.00 . A A .  12 PRO CB   1 1 
        4  1998 1 1 12 PRO CD   C    9.301  -8.325  -1.921 1.00 . A A .  12 PRO CD   1 1 
        4  1999 1 1 12 PRO CG   C    8.142  -9.088  -2.499 1.00 . A A .  12 PRO CG   1 1 
        4  2000 1 1 12 PRO HA   H    9.502  -7.551  -5.037 1.00 . A A .  12 PRO HA   1 1 
        4  2001 1 1 12 PRO HB2  H    7.277  -8.991  -4.451 1.00 . A A .  12 PRO HB2  1 1 
        4  2002 1 1 12 PRO HB3  H    8.905  -9.678  -4.405 1.00 . A A .  12 PRO HB3  1 1 
        4  2003 1 1 12 PRO HD2  H    9.025  -7.874  -0.979 1.00 . A A .  12 PRO HD2  1 1 
        4  2004 1 1 12 PRO HD3  H   10.155  -8.974  -1.794 1.00 . A A .  12 PRO HD3  1 1 
        4  2005 1 1 12 PRO HG2  H    7.209  -8.672  -2.152 1.00 . A A .  12 PRO HG2  1 1 
        4  2006 1 1 12 PRO HG3  H    8.211 -10.132  -2.232 1.00 . A A .  12 PRO HG3  1 1 
        4  2007 1 1 12 PRO N    N    9.573  -7.295  -2.938 1.00 . A A .  12 PRO N    1 1 
        4  2008 1 1 12 PRO O    O    7.642  -5.918  -5.487 1.00 . A A .  12 PRO O    1 1 
        4  2009 1 1 13 TYR C    C    6.298  -3.941  -3.453 1.00 . A A .  13 TYR C    1 1 
        4  2010 1 1 13 TYR CA   C    5.787  -5.378  -3.500 1.00 . A A .  13 TYR CA   1 1 
        4  2011 1 1 13 TYR CB   C    4.787  -5.613  -2.368 1.00 . A A .  13 TYR CB   1 1 
        4  2012 1 1 13 TYR CD1  C    3.010  -7.254  -3.095 1.00 . A A .  13 TYR CD1  1 1 
        4  2013 1 1 13 TYR CD2  C    4.755  -8.042  -1.676 1.00 . A A .  13 TYR CD2  1 1 
        4  2014 1 1 13 TYR CE1  C    2.445  -8.514  -3.108 1.00 . A A .  13 TYR CE1  1 1 
        4  2015 1 1 13 TYR CE2  C    4.198  -9.306  -1.684 1.00 . A A .  13 TYR CE2  1 1 
        4  2016 1 1 13 TYR CG   C    4.172  -6.995  -2.379 1.00 . A A .  13 TYR CG   1 1 
        4  2017 1 1 13 TYR CZ   C    3.043  -9.537  -2.401 1.00 . A A .  13 TYR CZ   1 1 
        4  2018 1 1 13 TYR H    H    7.014  -6.834  -2.577 1.00 . A A .  13 TYR H    1 1 
        4  2019 1 1 13 TYR HA   H    5.291  -5.541  -4.446 1.00 . A A .  13 TYR HA   1 1 
        4  2020 1 1 13 TYR HB2  H    5.288  -5.482  -1.421 1.00 . A A .  13 TYR HB2  1 1 
        4  2021 1 1 13 TYR HB3  H    3.986  -4.893  -2.449 1.00 . A A .  13 TYR HB3  1 1 
        4  2022 1 1 13 TYR HD1  H    2.545  -6.451  -3.648 1.00 . A A .  13 TYR HD1  1 1 
        4  2023 1 1 13 TYR HD2  H    5.660  -7.857  -1.115 1.00 . A A .  13 TYR HD2  1 1 
        4  2024 1 1 13 TYR HE1  H    1.541  -8.696  -3.670 1.00 . A A .  13 TYR HE1  1 1 
        4  2025 1 1 13 TYR HE2  H    4.666 -10.107  -1.131 1.00 . A A .  13 TYR HE2  1 1 
        4  2026 1 1 13 TYR HH   H    1.794 -10.844  -1.747 1.00 . A A .  13 TYR HH   1 1 
        4  2027 1 1 13 TYR N    N    6.891  -6.326  -3.405 1.00 . A A .  13 TYR N    1 1 
        4  2028 1 1 13 TYR O    O    7.172  -3.608  -2.654 1.00 . A A .  13 TYR O    1 1 
        4  2029 1 1 13 TYR OH   O    2.484 -10.794  -2.413 1.00 . A A .  13 TYR OH   1 1 
        4  2030 1 1 14 GLU C    C    4.921  -0.784  -4.488 1.00 . A A .  14 GLU C    1 1 
        4  2031 1 1 14 GLU CA   C    6.142  -1.693  -4.372 1.00 . A A .  14 GLU CA   1 1 
        4  2032 1 1 14 GLU CB   C    7.083  -1.455  -5.554 1.00 . A A .  14 GLU CB   1 1 
        4  2033 1 1 14 GLU CD   C    9.415  -2.053  -6.319 1.00 . A A .  14 GLU CD   1 1 
        4  2034 1 1 14 GLU CG   C    8.555  -1.529  -5.186 1.00 . A A .  14 GLU CG   1 1 
        4  2035 1 1 14 GLU H    H    5.050  -3.420  -4.926 1.00 . A A .  14 GLU H    1 1 
        4  2036 1 1 14 GLU HA   H    6.663  -1.459  -3.456 1.00 . A A .  14 GLU HA   1 1 
        4  2037 1 1 14 GLU HB2  H    6.884  -2.199  -6.312 1.00 . A A .  14 GLU HB2  1 1 
        4  2038 1 1 14 GLU HB3  H    6.885  -0.475  -5.964 1.00 . A A .  14 GLU HB3  1 1 
        4  2039 1 1 14 GLU HG2  H    8.897  -0.539  -4.923 1.00 . A A .  14 GLU HG2  1 1 
        4  2040 1 1 14 GLU HG3  H    8.667  -2.185  -4.335 1.00 . A A .  14 GLU HG3  1 1 
        4  2041 1 1 14 GLU N    N    5.743  -3.094  -4.315 1.00 . A A .  14 GLU N    1 1 
        4  2042 1 1 14 GLU O    O    3.916  -1.150  -5.098 1.00 . A A .  14 GLU O    1 1 
        4  2043 1 1 14 GLU OE1  O    9.294  -1.527  -7.446 1.00 . A A .  14 GLU OE1  1 1 
        4  2044 1 1 14 GLU OE2  O   10.207  -2.988  -6.080 1.00 . A A .  14 GLU OE2  1 1 
        4  2045 1 1 15 CYS C    C    3.886   2.101  -5.269 1.00 . A A .  15 CYS C    1 1 
        4  2046 1 1 15 CYS CA   C    3.921   1.364  -3.932 1.00 . A A .  15 CYS CA   1 1 
        4  2047 1 1 15 CYS CB   C    4.060   2.369  -2.787 1.00 . A A .  15 CYS CB   1 1 
        4  2048 1 1 15 CYS H    H    5.843   0.638  -3.426 1.00 . A A .  15 CYS H    1 1 
        4  2049 1 1 15 CYS HA   H    2.997   0.820  -3.811 1.00 . A A .  15 CYS HA   1 1 
        4  2050 1 1 15 CYS HB2  H    4.215   1.831  -1.863 1.00 . A A .  15 CYS HB2  1 1 
        4  2051 1 1 15 CYS HB3  H    4.915   3.002  -2.976 1.00 . A A .  15 CYS HB3  1 1 
        4  2052 1 1 15 CYS N    N    5.016   0.403  -3.897 1.00 . A A .  15 CYS N    1 1 
        4  2053 1 1 15 CYS O    O    4.880   2.694  -5.688 1.00 . A A .  15 CYS O    1 1 
        4  2054 1 1 15 CYS SG   S    2.609   3.447  -2.563 1.00 . A A .  15 CYS SG   1 1 
        4  2055 1 1 16 SER C    C    2.261   4.199  -7.039 1.00 . A A .  16 SER C    1 1 
        4  2056 1 1 16 SER CA   C    2.572   2.717  -7.222 1.00 . A A .  16 SER CA   1 1 
        4  2057 1 1 16 SER CB   C    1.455   2.045  -8.024 1.00 . A A .  16 SER CB   1 1 
        4  2058 1 1 16 SER H    H    1.979   1.567  -5.546 1.00 . A A .  16 SER H    1 1 
        4  2059 1 1 16 SER HA   H    3.501   2.620  -7.764 1.00 . A A .  16 SER HA   1 1 
        4  2060 1 1 16 SER HB2  H    1.595   0.975  -8.004 1.00 . A A .  16 SER HB2  1 1 
        4  2061 1 1 16 SER HB3  H    0.500   2.292  -7.582 1.00 . A A .  16 SER HB3  1 1 
        4  2062 1 1 16 SER HG   H    2.235   2.130  -9.819 1.00 . A A .  16 SER HG   1 1 
        4  2063 1 1 16 SER N    N    2.736   2.057  -5.932 1.00 . A A .  16 SER N    1 1 
        4  2064 1 1 16 SER O    O    1.749   4.853  -7.947 1.00 . A A .  16 SER O    1 1 
        4  2065 1 1 16 SER OG   O    1.462   2.482  -9.372 1.00 . A A .  16 SER OG   1 1 
        4  2066 1 1 17 GLU C    C    3.639   6.869  -5.314 1.00 . A A .  17 GLU C    1 1 
        4  2067 1 1 17 GLU CA   C    2.328   6.126  -5.554 1.00 . A A .  17 GLU CA   1 1 
        4  2068 1 1 17 GLU CB   C    1.424   6.255  -4.327 1.00 . A A .  17 GLU CB   1 1 
        4  2069 1 1 17 GLU CD   C   -0.994   6.148  -5.049 1.00 . A A .  17 GLU CD   1 1 
        4  2070 1 1 17 GLU CG   C    0.164   5.409  -4.407 1.00 . A A .  17 GLU CG   1 1 
        4  2071 1 1 17 GLU H    H    2.980   4.149  -5.174 1.00 . A A .  17 GLU H    1 1 
        4  2072 1 1 17 GLU HA   H    1.830   6.566  -6.405 1.00 . A A .  17 GLU HA   1 1 
        4  2073 1 1 17 GLU HB2  H    1.980   5.953  -3.451 1.00 . A A .  17 GLU HB2  1 1 
        4  2074 1 1 17 GLU HB3  H    1.132   7.289  -4.217 1.00 . A A .  17 GLU HB3  1 1 
        4  2075 1 1 17 GLU HG2  H    0.375   4.526  -4.992 1.00 . A A .  17 GLU HG2  1 1 
        4  2076 1 1 17 GLU HG3  H   -0.123   5.118  -3.408 1.00 . A A .  17 GLU HG3  1 1 
        4  2077 1 1 17 GLU N    N    2.575   4.721  -5.857 1.00 . A A .  17 GLU N    1 1 
        4  2078 1 1 17 GLU O    O    3.845   7.970  -5.825 1.00 . A A .  17 GLU O    1 1 
        4  2079 1 1 17 GLU OE1  O   -0.961   6.348  -6.281 1.00 . A A .  17 GLU OE1  1 1 
        4  2080 1 1 17 GLU OE2  O   -1.934   6.527  -4.319 1.00 . A A .  17 GLU OE2  1 1 
        4  2081 1 1 18 CYS C    C    6.958   5.951  -4.661 1.00 . A A .  18 CYS C    1 1 
        4  2082 1 1 18 CYS CA   C    5.815   6.861  -4.222 1.00 . A A .  18 CYS CA   1 1 
        4  2083 1 1 18 CYS CB   C    5.921   7.144  -2.722 1.00 . A A .  18 CYS CB   1 1 
        4  2084 1 1 18 CYS H    H    4.302   5.381  -4.154 1.00 . A A .  18 CYS H    1 1 
        4  2085 1 1 18 CYS HA   H    5.885   7.793  -4.762 1.00 . A A .  18 CYS HA   1 1 
        4  2086 1 1 18 CYS HB2  H    6.896   7.561  -2.511 1.00 . A A .  18 CYS HB2  1 1 
        4  2087 1 1 18 CYS HB3  H    5.162   7.860  -2.444 1.00 . A A .  18 CYS HB3  1 1 
        4  2088 1 1 18 CYS N    N    4.523   6.259  -4.532 1.00 . A A .  18 CYS N    1 1 
        4  2089 1 1 18 CYS O    O    7.983   6.420  -5.156 1.00 . A A .  18 CYS O    1 1 
        4  2090 1 1 18 CYS SG   S    5.710   5.672  -1.670 1.00 . A A .  18 CYS SG   1 1 
        4  2091 1 1 19 GLY C    C    8.256   2.835  -3.696 1.00 . A A .  19 GLY C    1 1 
        4  2092 1 1 19 GLY CA   C    7.799   3.693  -4.860 1.00 . A A .  19 GLY CA   1 1 
        4  2093 1 1 19 GLY H    H    5.937   4.331  -4.078 1.00 . A A .  19 GLY H    1 1 
        4  2094 1 1 19 GLY HA2  H    7.406   3.051  -5.634 1.00 . A A .  19 GLY HA2  1 1 
        4  2095 1 1 19 GLY HA3  H    8.649   4.232  -5.251 1.00 . A A .  19 GLY HA3  1 1 
        4  2096 1 1 19 GLY N    N    6.775   4.647  -4.477 1.00 . A A .  19 GLY N    1 1 
        4  2097 1 1 19 GLY O    O    9.202   2.058  -3.822 1.00 . A A .  19 GLY O    1 1 
        4  2098 1 1 20 LYS C    C    8.029   0.723  -1.688 1.00 . A A .  20 LYS C    1 1 
        4  2099 1 1 20 LYS CA   C    7.925   2.210  -1.367 1.00 . A A .  20 LYS CA   1 1 
        4  2100 1 1 20 LYS CB   C    6.878   2.434  -0.274 1.00 . A A .  20 LYS CB   1 1 
        4  2101 1 1 20 LYS CD   C    6.630   2.803   2.199 1.00 . A A .  20 LYS CD   1 1 
        4  2102 1 1 20 LYS CE   C    7.159   2.449   3.580 1.00 . A A .  20 LYS CE   1 1 
        4  2103 1 1 20 LYS CG   C    7.346   2.021   1.111 1.00 . A A .  20 LYS CG   1 1 
        4  2104 1 1 20 LYS H    H    6.838   3.613  -2.521 1.00 . A A .  20 LYS H    1 1 
        4  2105 1 1 20 LYS HA   H    8.884   2.558  -1.013 1.00 . A A .  20 LYS HA   1 1 
        4  2106 1 1 20 LYS HB2  H    6.623   3.483  -0.246 1.00 . A A .  20 LYS HB2  1 1 
        4  2107 1 1 20 LYS HB3  H    5.993   1.864  -0.517 1.00 . A A .  20 LYS HB3  1 1 
        4  2108 1 1 20 LYS HD2  H    6.779   3.859   2.028 1.00 . A A .  20 LYS HD2  1 1 
        4  2109 1 1 20 LYS HD3  H    5.574   2.575   2.158 1.00 . A A .  20 LYS HD3  1 1 
        4  2110 1 1 20 LYS HE2  H    8.229   2.321   3.520 1.00 . A A .  20 LYS HE2  1 1 
        4  2111 1 1 20 LYS HE3  H    6.931   3.259   4.257 1.00 . A A .  20 LYS HE3  1 1 
        4  2112 1 1 20 LYS HG2  H    7.147   0.968   1.249 1.00 . A A .  20 LYS HG2  1 1 
        4  2113 1 1 20 LYS HG3  H    8.409   2.201   1.190 1.00 . A A .  20 LYS HG3  1 1 
        4  2114 1 1 20 LYS HZ1  H    7.193   0.393   3.947 1.00 . A A .  20 LYS HZ1  1 1 
        4  2115 1 1 20 LYS HZ2  H    5.651   1.004   3.615 1.00 . A A .  20 LYS HZ2  1 1 
        4  2116 1 1 20 LYS HZ3  H    6.365   1.284   5.122 1.00 . A A .  20 LYS HZ3  1 1 
        4  2117 1 1 20 LYS N    N    7.583   2.977  -2.559 1.00 . A A .  20 LYS N    1 1 
        4  2118 1 1 20 LYS NZ   N    6.550   1.194   4.102 1.00 . A A .  20 LYS NZ   1 1 
        4  2119 1 1 20 LYS O    O    7.781   0.303  -2.818 1.00 . A A .  20 LYS O    1 1 
        4  2120 1 1 21 ALA C    C    7.922  -2.266   0.314 1.00 . A A .  21 ALA C    1 1 
        4  2121 1 1 21 ALA CA   C    8.530  -1.511  -0.863 1.00 . A A .  21 ALA CA   1 1 
        4  2122 1 1 21 ALA CB   C    9.994  -1.889  -1.035 1.00 . A A .  21 ALA CB   1 1 
        4  2123 1 1 21 ALA H    H    8.581   0.323   0.191 1.00 . A A .  21 ALA H    1 1 
        4  2124 1 1 21 ALA HA   H    8.003  -1.787  -1.765 1.00 . A A .  21 ALA HA   1 1 
        4  2125 1 1 21 ALA HB1  H   10.077  -2.683  -1.761 1.00 . A A .  21 ALA HB1  1 1 
        4  2126 1 1 21 ALA HB2  H   10.548  -1.027  -1.378 1.00 . A A .  21 ALA HB2  1 1 
        4  2127 1 1 21 ALA HB3  H   10.393  -2.222  -0.089 1.00 . A A .  21 ALA HB3  1 1 
        4  2128 1 1 21 ALA N    N    8.397  -0.070  -0.687 1.00 . A A .  21 ALA N    1 1 
        4  2129 1 1 21 ALA O    O    7.888  -1.762   1.437 1.00 . A A .  21 ALA O    1 1 
        4  2130 1 1 22 PHE C    C    7.115  -5.780   0.843 1.00 . A A .  22 PHE C    1 1 
        4  2131 1 1 22 PHE CA   C    6.833  -4.301   1.088 1.00 . A A .  22 PHE CA   1 1 
        4  2132 1 1 22 PHE CB   C    5.323  -4.060   1.140 1.00 . A A .  22 PHE CB   1 1 
        4  2133 1 1 22 PHE CD1  C    5.070  -1.750   0.193 1.00 . A A .  22 PHE CD1  1 1 
        4  2134 1 1 22 PHE CD2  C    4.483  -2.109   2.476 1.00 . A A .  22 PHE CD2  1 1 
        4  2135 1 1 22 PHE CE1  C    4.728  -0.416   0.311 1.00 . A A .  22 PHE CE1  1 1 
        4  2136 1 1 22 PHE CE2  C    4.139  -0.777   2.600 1.00 . A A .  22 PHE CE2  1 1 
        4  2137 1 1 22 PHE CG   C    4.951  -2.611   1.272 1.00 . A A .  22 PHE CG   1 1 
        4  2138 1 1 22 PHE CZ   C    4.263   0.072   1.517 1.00 . A A .  22 PHE CZ   1 1 
        4  2139 1 1 22 PHE H    H    7.497  -3.824  -0.865 1.00 . A A .  22 PHE H    1 1 
        4  2140 1 1 22 PHE HA   H    7.267  -4.015   2.034 1.00 . A A .  22 PHE HA   1 1 
        4  2141 1 1 22 PHE HB2  H    4.874  -4.436   0.232 1.00 . A A .  22 PHE HB2  1 1 
        4  2142 1 1 22 PHE HB3  H    4.910  -4.589   1.986 1.00 . A A .  22 PHE HB3  1 1 
        4  2143 1 1 22 PHE HD1  H    5.434  -2.131  -0.751 1.00 . A A .  22 PHE HD1  1 1 
        4  2144 1 1 22 PHE HD2  H    4.386  -2.771   3.324 1.00 . A A .  22 PHE HD2  1 1 
        4  2145 1 1 22 PHE HE1  H    4.827   0.244  -0.538 1.00 . A A .  22 PHE HE1  1 1 
        4  2146 1 1 22 PHE HE2  H    3.776  -0.398   3.544 1.00 . A A .  22 PHE HE2  1 1 
        4  2147 1 1 22 PHE HZ   H    3.995   1.113   1.611 1.00 . A A .  22 PHE HZ   1 1 
        4  2148 1 1 22 PHE N    N    7.441  -3.477   0.050 1.00 . A A .  22 PHE N    1 1 
        4  2149 1 1 22 PHE O    O    7.331  -6.202  -0.294 1.00 . A A .  22 PHE O    1 1 
        4  2150 1 1 23 ILE C    C    6.127  -8.743   1.349 1.00 . A A .  23 ILE C    1 1 
        4  2151 1 1 23 ILE CA   C    7.369  -7.994   1.819 1.00 . A A .  23 ILE CA   1 1 
        4  2152 1 1 23 ILE CB   C    7.826  -8.578   3.169 1.00 . A A .  23 ILE CB   1 1 
        4  2153 1 1 23 ILE CD1  C    8.598  -6.624   4.606 1.00 . A A .  23 ILE CD1  1 1 
        4  2154 1 1 23 ILE CG1  C    9.009  -7.780   3.721 1.00 . A A .  23 ILE CG1  1 1 
        4  2155 1 1 23 ILE CG2  C    8.196 -10.045   3.014 1.00 . A A .  23 ILE CG2  1 1 
        4  2156 1 1 23 ILE H    H    6.935  -6.168   2.796 1.00 . A A .  23 ILE H    1 1 
        4  2157 1 1 23 ILE HA   H    8.160  -8.143   1.099 1.00 . A A .  23 ILE HA   1 1 
        4  2158 1 1 23 ILE HB   H    7.001  -8.511   3.863 1.00 . A A .  23 ILE HB   1 1 
        4  2159 1 1 23 ILE HD11 H    7.595  -6.791   4.972 1.00 . A A .  23 ILE HD11 1 1 
        4  2160 1 1 23 ILE HD12 H    9.277  -6.552   5.443 1.00 . A A .  23 ILE HD12 1 1 
        4  2161 1 1 23 ILE HD13 H    8.626  -5.707   4.038 1.00 . A A .  23 ILE HD13 1 1 
        4  2162 1 1 23 ILE HG12 H    9.638  -8.435   4.302 1.00 . A A .  23 ILE HG12 1 1 
        4  2163 1 1 23 ILE HG13 H    9.579  -7.379   2.895 1.00 . A A .  23 ILE HG13 1 1 
        4  2164 1 1 23 ILE HG21 H    9.119 -10.126   2.457 1.00 . A A .  23 ILE HG21 1 1 
        4  2165 1 1 23 ILE HG22 H    8.325 -10.489   3.989 1.00 . A A .  23 ILE HG22 1 1 
        4  2166 1 1 23 ILE HG23 H    7.410 -10.561   2.484 1.00 . A A .  23 ILE HG23 1 1 
        4  2167 1 1 23 ILE N    N    7.113  -6.562   1.917 1.00 . A A .  23 ILE N    1 1 
        4  2168 1 1 23 ILE O    O    6.216  -9.669   0.543 1.00 . A A .  23 ILE O    1 1 
        4  2169 1 1 24 ARG C    C    2.701  -7.928   0.999 1.00 . A A .  24 ARG C    1 1 
        4  2170 1 1 24 ARG CA   C    3.707  -8.966   1.487 1.00 . A A .  24 ARG CA   1 1 
        4  2171 1 1 24 ARG CB   C    3.129  -9.733   2.678 1.00 . A A .  24 ARG CB   1 1 
        4  2172 1 1 24 ARG CD   C    4.230 -11.971   2.377 1.00 . A A .  24 ARG CD   1 1 
        4  2173 1 1 24 ARG CG   C    4.089 -10.750   3.272 1.00 . A A .  24 ARG CG   1 1 
        4  2174 1 1 24 ARG CZ   C    4.934 -14.310   2.657 1.00 . A A .  24 ARG CZ   1 1 
        4  2175 1 1 24 ARG H    H    4.961  -7.591   2.494 1.00 . A A .  24 ARG H    1 1 
        4  2176 1 1 24 ARG HA   H    3.906  -9.662   0.686 1.00 . A A .  24 ARG HA   1 1 
        4  2177 1 1 24 ARG HB2  H    2.864  -9.027   3.452 1.00 . A A .  24 ARG HB2  1 1 
        4  2178 1 1 24 ARG HB3  H    2.239 -10.254   2.358 1.00 . A A .  24 ARG HB3  1 1 
        4  2179 1 1 24 ARG HD2  H    3.245 -12.346   2.143 1.00 . A A .  24 ARG HD2  1 1 
        4  2180 1 1 24 ARG HD3  H    4.730 -11.677   1.466 1.00 . A A .  24 ARG HD3  1 1 
        4  2181 1 1 24 ARG HE   H    5.596 -12.782   3.754 1.00 . A A .  24 ARG HE   1 1 
        4  2182 1 1 24 ARG HG2  H    5.059 -10.290   3.391 1.00 . A A .  24 ARG HG2  1 1 
        4  2183 1 1 24 ARG HG3  H    3.716 -11.063   4.237 1.00 . A A .  24 ARG HG3  1 1 
        4  2184 1 1 24 ARG HH11 H    3.585 -13.998   1.185 1.00 . A A .  24 ARG HH11 1 1 
        4  2185 1 1 24 ARG HH12 H    4.090 -15.643   1.393 1.00 . A A .  24 ARG HH12 1 1 
        4  2186 1 1 24 ARG HH21 H    6.268 -14.943   4.038 1.00 . A A .  24 ARG HH21 1 1 
        4  2187 1 1 24 ARG HH22 H    5.615 -16.179   3.017 1.00 . A A .  24 ARG HH22 1 1 
        4  2188 1 1 24 ARG N    N    4.968  -8.335   1.856 1.00 . A A .  24 ARG N    1 1 
        4  2189 1 1 24 ARG NE   N    5.000 -13.034   3.018 1.00 . A A .  24 ARG NE   1 1 
        4  2190 1 1 24 ARG NH1  N    4.137 -14.681   1.664 1.00 . A A .  24 ARG NH1  1 1 
        4  2191 1 1 24 ARG NH2  N    5.666 -15.219   3.289 1.00 . A A .  24 ARG NH2  1 1 
        4  2192 1 1 24 ARG O    O    2.657  -6.807   1.504 1.00 . A A .  24 ARG O    1 1 
        4  2193 1 1 25 ASN C    C    0.118  -6.705   0.566 1.00 . A A .  25 ASN C    1 1 
        4  2194 1 1 25 ASN CA   C    0.890  -7.412  -0.543 1.00 . A A .  25 ASN CA   1 1 
        4  2195 1 1 25 ASN CB   C   -0.077  -8.188  -1.439 1.00 . A A .  25 ASN CB   1 1 
        4  2196 1 1 25 ASN CG   C   -0.675  -7.323  -2.531 1.00 . A A .  25 ASN CG   1 1 
        4  2197 1 1 25 ASN H    H    1.978  -9.217  -0.348 1.00 . A A .  25 ASN H    1 1 
        4  2198 1 1 25 ASN HA   H    1.402  -6.671  -1.138 1.00 . A A .  25 ASN HA   1 1 
        4  2199 1 1 25 ASN HB2  H    0.451  -9.007  -1.904 1.00 . A A .  25 ASN HB2  1 1 
        4  2200 1 1 25 ASN HB3  H   -0.882  -8.581  -0.835 1.00 . A A .  25 ASN HB3  1 1 
        4  2201 1 1 25 ASN HD21 H   -0.784  -5.779  -1.283 1.00 . A A .  25 ASN HD21 1 1 
        4  2202 1 1 25 ASN HD22 H   -1.355  -5.489  -2.887 1.00 . A A .  25 ASN HD22 1 1 
        4  2203 1 1 25 ASN N    N    1.895  -8.310   0.014 1.00 . A A .  25 ASN N    1 1 
        4  2204 1 1 25 ASN ND2  N   -0.967  -6.070  -2.200 1.00 . A A .  25 ASN ND2  1 1 
        4  2205 1 1 25 ASN O    O    0.101  -5.476   0.640 1.00 . A A .  25 ASN O    1 1 
        4  2206 1 1 25 ASN OD1  O   -0.870  -7.775  -3.660 1.00 . A A .  25 ASN OD1  1 1 
        4  2207 1 1 26 SER C    C   -0.566  -5.770   3.182 1.00 . A A .  26 SER C    1 1 
        4  2208 1 1 26 SER CA   C   -1.298  -6.940   2.533 1.00 . A A .  26 SER CA   1 1 
        4  2209 1 1 26 SER CB   C   -1.579  -8.023   3.576 1.00 . A A .  26 SER CB   1 1 
        4  2210 1 1 26 SER H    H   -0.469  -8.463   1.317 1.00 . A A .  26 SER H    1 1 
        4  2211 1 1 26 SER HA   H   -2.236  -6.585   2.133 1.00 . A A .  26 SER HA   1 1 
        4  2212 1 1 26 SER HB2  H   -1.847  -8.941   3.075 1.00 . A A .  26 SER HB2  1 1 
        4  2213 1 1 26 SER HB3  H   -0.692  -8.184   4.172 1.00 . A A .  26 SER HB3  1 1 
        4  2214 1 1 26 SER HG   H   -2.528  -6.726   4.696 1.00 . A A .  26 SER HG   1 1 
        4  2215 1 1 26 SER N    N   -0.521  -7.490   1.428 1.00 . A A .  26 SER N    1 1 
        4  2216 1 1 26 SER O    O   -1.184  -4.786   3.589 1.00 . A A .  26 SER O    1 1 
        4  2217 1 1 26 SER OG   O   -2.642  -7.643   4.433 1.00 . A A .  26 SER OG   1 1 
        4  2218 1 1 27 GLN C    C    1.529  -3.565   3.037 1.00 . A A .  27 GLN C    1 1 
        4  2219 1 1 27 GLN CA   C    1.572  -4.837   3.876 1.00 . A A .  27 GLN CA   1 1 
        4  2220 1 1 27 GLN CB   C    3.018  -5.313   4.029 1.00 . A A .  27 GLN CB   1 1 
        4  2221 1 1 27 GLN CD   C    3.308  -6.421   6.281 1.00 . A A .  27 GLN CD   1 1 
        4  2222 1 1 27 GLN CG   C    3.150  -6.624   4.787 1.00 . A A .  27 GLN CG   1 1 
        4  2223 1 1 27 GLN H    H    1.190  -6.693   2.933 1.00 . A A .  27 GLN H    1 1 
        4  2224 1 1 27 GLN HA   H    1.169  -4.622   4.854 1.00 . A A .  27 GLN HA   1 1 
        4  2225 1 1 27 GLN HB2  H    3.447  -5.445   3.047 1.00 . A A .  27 GLN HB2  1 1 
        4  2226 1 1 27 GLN HB3  H    3.579  -4.558   4.560 1.00 . A A .  27 GLN HB3  1 1 
        4  2227 1 1 27 GLN HE21 H    4.734  -7.805   6.343 1.00 . A A .  27 GLN HE21 1 1 
        4  2228 1 1 27 GLN HE22 H    4.344  -7.060   7.853 1.00 . A A .  27 GLN HE22 1 1 
        4  2229 1 1 27 GLN HG2  H    2.265  -7.217   4.612 1.00 . A A .  27 GLN HG2  1 1 
        4  2230 1 1 27 GLN HG3  H    4.016  -7.153   4.417 1.00 . A A .  27 GLN HG3  1 1 
        4  2231 1 1 27 GLN N    N    0.755  -5.885   3.276 1.00 . A A .  27 GLN N    1 1 
        4  2232 1 1 27 GLN NE2  N    4.220  -7.172   6.888 1.00 . A A .  27 GLN NE2  1 1 
        4  2233 1 1 27 GLN O    O    1.336  -2.467   3.563 1.00 . A A .  27 GLN O    1 1 
        4  2234 1 1 27 GLN OE1  O    2.618  -5.598   6.884 1.00 . A A .  27 GLN OE1  1 1 
        4  2235 1 1 28 LEU C    C    0.331  -1.892   0.830 1.00 . A A .  28 LEU C    1 1 
        4  2236 1 1 28 LEU CA   C    1.692  -2.580   0.816 1.00 . A A .  28 LEU CA   1 1 
        4  2237 1 1 28 LEU CB   C    2.032  -3.036  -0.604 1.00 . A A .  28 LEU CB   1 1 
        4  2238 1 1 28 LEU CD1  C    2.309  -0.739  -1.567 1.00 . A A .  28 LEU CD1  1 1 
        4  2239 1 1 28 LEU CD2  C    1.951  -2.693  -3.086 1.00 . A A .  28 LEU CD2  1 1 
        4  2240 1 1 28 LEU CG   C    1.623  -2.086  -1.730 1.00 . A A .  28 LEU CG   1 1 
        4  2241 1 1 28 LEU H    H    1.859  -4.616   1.369 1.00 . A A .  28 LEU H    1 1 
        4  2242 1 1 28 LEU HA   H    2.441  -1.877   1.149 1.00 . A A .  28 LEU HA   1 1 
        4  2243 1 1 28 LEU HB2  H    3.101  -3.174  -0.660 1.00 . A A .  28 LEU HB2  1 1 
        4  2244 1 1 28 LEU HB3  H    1.539  -3.983  -0.773 1.00 . A A .  28 LEU HB3  1 1 
        4  2245 1 1 28 LEU HD11 H    1.653   0.044  -1.918 1.00 . A A .  28 LEU HD11 1 1 
        4  2246 1 1 28 LEU HD12 H    3.223  -0.728  -2.143 1.00 . A A .  28 LEU HD12 1 1 
        4  2247 1 1 28 LEU HD13 H    2.539  -0.576  -0.524 1.00 . A A .  28 LEU HD13 1 1 
        4  2248 1 1 28 LEU HD21 H    2.174  -3.743  -2.966 1.00 . A A .  28 LEU HD21 1 1 
        4  2249 1 1 28 LEU HD22 H    2.808  -2.189  -3.507 1.00 . A A .  28 LEU HD22 1 1 
        4  2250 1 1 28 LEU HD23 H    1.104  -2.577  -3.747 1.00 . A A .  28 LEU HD23 1 1 
        4  2251 1 1 28 LEU HG   H    0.555  -1.924  -1.685 1.00 . A A .  28 LEU HG   1 1 
        4  2252 1 1 28 LEU N    N    1.710  -3.718   1.730 1.00 . A A .  28 LEU N    1 1 
        4  2253 1 1 28 LEU O    O    0.234  -0.693   1.090 1.00 . A A .  28 LEU O    1 1 
        4  2254 1 1 29 ILE C    C   -2.308  -1.188   1.714 1.00 . A A .  29 ILE C    1 1 
        4  2255 1 1 29 ILE CA   C   -2.073  -2.125   0.534 1.00 . A A .  29 ILE CA   1 1 
        4  2256 1 1 29 ILE CB   C   -3.123  -3.251   0.569 1.00 . A A .  29 ILE CB   1 1 
        4  2257 1 1 29 ILE CD1  C   -3.573  -5.535  -0.459 1.00 . A A .  29 ILE CD1  1 1 
        4  2258 1 1 29 ILE CG1  C   -2.965  -4.164  -0.649 1.00 . A A .  29 ILE CG1  1 1 
        4  2259 1 1 29 ILE CG2  C   -4.526  -2.665   0.620 1.00 . A A .  29 ILE CG2  1 1 
        4  2260 1 1 29 ILE H    H   -0.575  -3.609   0.351 1.00 . A A .  29 ILE H    1 1 
        4  2261 1 1 29 ILE HA   H   -2.200  -1.570  -0.384 1.00 . A A .  29 ILE HA   1 1 
        4  2262 1 1 29 ILE HB   H   -2.967  -3.830   1.466 1.00 . A A .  29 ILE HB   1 1 
        4  2263 1 1 29 ILE HD11 H   -4.437  -5.638  -1.101 1.00 . A A .  29 ILE HD11 1 1 
        4  2264 1 1 29 ILE HD12 H   -2.845  -6.291  -0.714 1.00 . A A .  29 ILE HD12 1 1 
        4  2265 1 1 29 ILE HD13 H   -3.875  -5.657   0.571 1.00 . A A .  29 ILE HD13 1 1 
        4  2266 1 1 29 ILE HG12 H   -3.443  -3.704  -1.500 1.00 . A A .  29 ILE HG12 1 1 
        4  2267 1 1 29 ILE HG13 H   -1.913  -4.293  -0.858 1.00 . A A .  29 ILE HG13 1 1 
        4  2268 1 1 29 ILE HG21 H   -4.533  -1.804   1.272 1.00 . A A .  29 ILE HG21 1 1 
        4  2269 1 1 29 ILE HG22 H   -4.827  -2.366  -0.372 1.00 . A A .  29 ILE HG22 1 1 
        4  2270 1 1 29 ILE HG23 H   -5.213  -3.408   0.997 1.00 . A A .  29 ILE HG23 1 1 
        4  2271 1 1 29 ILE N    N   -0.717  -2.660   0.550 1.00 . A A .  29 ILE N    1 1 
        4  2272 1 1 29 ILE O    O   -2.744  -0.050   1.539 1.00 . A A .  29 ILE O    1 1 
        4  2273 1 1 30 VAL C    C   -1.580   0.507   3.967 1.00 . A A .  30 VAL C    1 1 
        4  2274 1 1 30 VAL CA   C   -2.193  -0.880   4.125 1.00 . A A .  30 VAL CA   1 1 
        4  2275 1 1 30 VAL CB   C   -1.562  -1.571   5.348 1.00 . A A .  30 VAL CB   1 1 
        4  2276 1 1 30 VAL CG1  C   -1.700  -0.698   6.586 1.00 . A A .  30 VAL CG1  1 1 
        4  2277 1 1 30 VAL CG2  C   -2.196  -2.935   5.575 1.00 . A A .  30 VAL CG2  1 1 
        4  2278 1 1 30 VAL H    H   -1.672  -2.589   2.991 1.00 . A A .  30 VAL H    1 1 
        4  2279 1 1 30 VAL HA   H   -3.253  -0.775   4.304 1.00 . A A .  30 VAL HA   1 1 
        4  2280 1 1 30 VAL HB   H   -0.509  -1.715   5.152 1.00 . A A .  30 VAL HB   1 1 
        4  2281 1 1 30 VAL HG11 H   -2.518  -1.060   7.192 1.00 . A A .  30 VAL HG11 1 1 
        4  2282 1 1 30 VAL HG12 H   -0.784  -0.734   7.157 1.00 . A A .  30 VAL HG12 1 1 
        4  2283 1 1 30 VAL HG13 H   -1.899   0.321   6.287 1.00 . A A .  30 VAL HG13 1 1 
        4  2284 1 1 30 VAL HG21 H   -2.665  -2.958   6.547 1.00 . A A .  30 VAL HG21 1 1 
        4  2285 1 1 30 VAL HG22 H   -2.938  -3.117   4.812 1.00 . A A .  30 VAL HG22 1 1 
        4  2286 1 1 30 VAL HG23 H   -1.434  -3.700   5.525 1.00 . A A .  30 VAL HG23 1 1 
        4  2287 1 1 30 VAL N    N   -2.016  -1.674   2.916 1.00 . A A .  30 VAL N    1 1 
        4  2288 1 1 30 VAL O    O   -2.138   1.502   4.431 1.00 . A A .  30 VAL O    1 1 
        4  2289 1 1 31 HIS C    C   -0.481   2.684   2.061 1.00 . A A .  31 HIS C    1 1 
        4  2290 1 1 31 HIS CA   C    0.263   1.832   3.086 1.00 . A A .  31 HIS CA   1 1 
        4  2291 1 1 31 HIS CB   C    1.695   1.581   2.614 1.00 . A A .  31 HIS CB   1 1 
        4  2292 1 1 31 HIS CD2  C    2.830   3.215   0.949 1.00 . A A .  31 HIS CD2  1 1 
        4  2293 1 1 31 HIS CE1  C    3.375   4.793   2.369 1.00 . A A .  31 HIS CE1  1 1 
        4  2294 1 1 31 HIS CG   C    2.407   2.823   2.173 1.00 . A A .  31 HIS CG   1 1 
        4  2295 1 1 31 HIS H    H   -0.031  -0.260   2.961 1.00 . A A .  31 HIS H    1 1 
        4  2296 1 1 31 HIS HA   H    0.291   2.364   4.025 1.00 . A A .  31 HIS HA   1 1 
        4  2297 1 1 31 HIS HB2  H    2.262   1.143   3.422 1.00 . A A .  31 HIS HB2  1 1 
        4  2298 1 1 31 HIS HB3  H    1.677   0.895   1.779 1.00 . A A .  31 HIS HB3  1 1 
        4  2299 1 1 31 HIS HD1  H    2.595   3.846   4.006 1.00 . A A .  31 HIS HD1  1 1 
        4  2300 1 1 31 HIS HD2  H    2.717   2.664   0.025 1.00 . A A .  31 HIS HD2  1 1 
        4  2301 1 1 31 HIS HE1  H    3.765   5.709   2.788 1.00 . A A .  31 HIS HE1  1 1 
        4  2302 1 1 31 HIS N    N   -0.427   0.566   3.307 1.00 . A A .  31 HIS N    1 1 
        4  2303 1 1 31 HIS ND1  N    2.765   3.833   3.041 1.00 . A A .  31 HIS ND1  1 1 
        4  2304 1 1 31 HIS NE2  N    3.428   4.442   1.097 1.00 . A A .  31 HIS NE2  1 1 
        4  2305 1 1 31 HIS O    O   -0.587   3.901   2.213 1.00 . A A .  31 HIS O    1 1 
        4  2306 1 1 32 GLN C    C   -2.912   3.498   0.551 1.00 . A A .  32 GLN C    1 1 
        4  2307 1 1 32 GLN CA   C   -1.725   2.736  -0.029 1.00 . A A .  32 GLN CA   1 1 
        4  2308 1 1 32 GLN CB   C   -2.209   1.745  -1.090 1.00 . A A .  32 GLN CB   1 1 
        4  2309 1 1 32 GLN CD   C   -1.563   0.361  -3.102 1.00 . A A .  32 GLN CD   1 1 
        4  2310 1 1 32 GLN CG   C   -1.080   1.073  -1.854 1.00 . A A .  32 GLN CG   1 1 
        4  2311 1 1 32 GLN H    H   -0.876   1.066   0.956 1.00 . A A .  32 GLN H    1 1 
        4  2312 1 1 32 GLN HA   H   -1.051   3.442  -0.490 1.00 . A A .  32 GLN HA   1 1 
        4  2313 1 1 32 GLN HB2  H   -2.796   0.978  -0.608 1.00 . A A .  32 GLN HB2  1 1 
        4  2314 1 1 32 GLN HB3  H   -2.831   2.271  -1.799 1.00 . A A .  32 GLN HB3  1 1 
        4  2315 1 1 32 GLN HE21 H   -0.439   1.541  -4.240 1.00 . A A .  32 GLN HE21 1 1 
        4  2316 1 1 32 GLN HE22 H   -1.370   0.353  -5.080 1.00 . A A .  32 GLN HE22 1 1 
        4  2317 1 1 32 GLN HG2  H   -0.360   1.824  -2.143 1.00 . A A .  32 GLN HG2  1 1 
        4  2318 1 1 32 GLN HG3  H   -0.605   0.351  -1.206 1.00 . A A .  32 GLN HG3  1 1 
        4  2319 1 1 32 GLN N    N   -0.993   2.037   1.020 1.00 . A A .  32 GLN N    1 1 
        4  2320 1 1 32 GLN NE2  N   -1.076   0.796  -4.258 1.00 . A A .  32 GLN NE2  1 1 
        4  2321 1 1 32 GLN O    O   -3.294   4.552   0.042 1.00 . A A .  32 GLN O    1 1 
        4  2322 1 1 32 GLN OE1  O   -2.366  -0.570  -3.028 1.00 . A A .  32 GLN OE1  1 1 
        4  2323 1 1 33 ARG C    C   -4.339   5.045   2.601 1.00 . A A .  33 ARG C    1 1 
        4  2324 1 1 33 ARG CA   C   -4.637   3.586   2.265 1.00 . A A .  33 ARG CA   1 1 
        4  2325 1 1 33 ARG CB   C   -5.011   2.825   3.539 1.00 . A A .  33 ARG CB   1 1 
        4  2326 1 1 33 ARG CD   C   -6.200   0.781   4.389 1.00 . A A .  33 ARG CD   1 1 
        4  2327 1 1 33 ARG CG   C   -5.298   1.351   3.305 1.00 . A A .  33 ARG CG   1 1 
        4  2328 1 1 33 ARG CZ   C   -8.611   0.410   4.700 1.00 . A A .  33 ARG CZ   1 1 
        4  2329 1 1 33 ARG H    H   -3.142   2.116   1.977 1.00 . A A .  33 ARG H    1 1 
        4  2330 1 1 33 ARG HA   H   -5.469   3.550   1.578 1.00 . A A .  33 ARG HA   1 1 
        4  2331 1 1 33 ARG HB2  H   -4.195   2.903   4.243 1.00 . A A .  33 ARG HB2  1 1 
        4  2332 1 1 33 ARG HB3  H   -5.891   3.278   3.969 1.00 . A A .  33 ARG HB3  1 1 
        4  2333 1 1 33 ARG HD2  H   -6.070  -0.290   4.420 1.00 . A A .  33 ARG HD2  1 1 
        4  2334 1 1 33 ARG HD3  H   -5.912   1.206   5.338 1.00 . A A .  33 ARG HD3  1 1 
        4  2335 1 1 33 ARG HE   H   -7.816   1.817   3.531 1.00 . A A .  33 ARG HE   1 1 
        4  2336 1 1 33 ARG HG2  H   -5.787   1.237   2.349 1.00 . A A .  33 ARG HG2  1 1 
        4  2337 1 1 33 ARG HG3  H   -4.365   0.808   3.302 1.00 . A A .  33 ARG HG3  1 1 
        4  2338 1 1 33 ARG HH11 H   -7.416  -0.844   5.740 1.00 . A A .  33 ARG HH11 1 1 
        4  2339 1 1 33 ARG HH12 H   -9.117  -1.094   5.950 1.00 . A A .  33 ARG HH12 1 1 
        4  2340 1 1 33 ARG HH21 H  -10.058   1.497   3.800 1.00 . A A .  33 ARG HH21 1 1 
        4  2341 1 1 33 ARG HH22 H  -10.619   0.237   4.846 1.00 . A A .  33 ARG HH22 1 1 
        4  2342 1 1 33 ARG N    N   -3.492   2.958   1.617 1.00 . A A .  33 ARG N    1 1 
        4  2343 1 1 33 ARG NE   N   -7.608   1.080   4.142 1.00 . A A .  33 ARG NE   1 1 
        4  2344 1 1 33 ARG NH1  N   -8.361  -0.592   5.531 1.00 . A A .  33 ARG NH1  1 1 
        4  2345 1 1 33 ARG NH2  N   -9.866   0.742   4.426 1.00 . A A .  33 ARG NH2  1 1 
        4  2346 1 1 33 ARG O    O   -5.200   5.914   2.463 1.00 . A A .  33 ARG O    1 1 
        4  2347 1 1 34 THR C    C   -2.688   7.570   2.177 1.00 . A A .  34 THR C    1 1 
        4  2348 1 1 34 THR CA   C   -2.701   6.658   3.399 1.00 . A A .  34 THR CA   1 1 
        4  2349 1 1 34 THR CB   C   -1.303   6.667   4.046 1.00 . A A .  34 THR CB   1 1 
        4  2350 1 1 34 THR CG2  C   -1.234   5.679   5.200 1.00 . A A .  34 THR CG2  1 1 
        4  2351 1 1 34 THR H    H   -2.470   4.571   3.130 1.00 . A A .  34 THR H    1 1 
        4  2352 1 1 34 THR HA   H   -3.409   7.044   4.117 1.00 . A A .  34 THR HA   1 1 
        4  2353 1 1 34 THR HB   H   -1.107   7.659   4.429 1.00 . A A .  34 THR HB   1 1 
        4  2354 1 1 34 THR HG1  H    0.307   5.702   3.441 1.00 . A A .  34 THR HG1  1 1 
        4  2355 1 1 34 THR HG21 H   -0.212   5.585   5.533 1.00 . A A .  34 THR HG21 1 1 
        4  2356 1 1 34 THR HG22 H   -1.595   4.715   4.871 1.00 . A A .  34 THR HG22 1 1 
        4  2357 1 1 34 THR HG23 H   -1.848   6.033   6.015 1.00 . A A .  34 THR HG23 1 1 
        4  2358 1 1 34 THR N    N   -3.112   5.306   3.042 1.00 . A A .  34 THR N    1 1 
        4  2359 1 1 34 THR O    O   -3.054   8.742   2.261 1.00 . A A .  34 THR O    1 1 
        4  2360 1 1 34 THR OG1  O   -0.309   6.338   3.070 1.00 . A A .  34 THR OG1  1 1 
        4  2361 1 1 35 HIS C    C   -3.608   8.163  -0.673 1.00 . A A .  35 HIS C    1 1 
        4  2362 1 1 35 HIS CA   C   -2.207   7.788  -0.200 1.00 . A A .  35 HIS CA   1 1 
        4  2363 1 1 35 HIS CB   C   -1.487   6.986  -1.284 1.00 . A A .  35 HIS CB   1 1 
        4  2364 1 1 35 HIS CD2  C    1.008   6.376  -0.924 1.00 . A A .  35 HIS CD2  1 1 
        4  2365 1 1 35 HIS CE1  C    1.901   8.250  -1.628 1.00 . A A .  35 HIS CE1  1 1 
        4  2366 1 1 35 HIS CG   C   -0.004   7.194  -1.298 1.00 . A A .  35 HIS CG   1 1 
        4  2367 1 1 35 HIS H    H   -1.987   6.084   1.037 1.00 . A A .  35 HIS H    1 1 
        4  2368 1 1 35 HIS HA   H   -1.652   8.693  -0.005 1.00 . A A .  35 HIS HA   1 1 
        4  2369 1 1 35 HIS HB2  H   -1.673   5.934  -1.127 1.00 . A A .  35 HIS HB2  1 1 
        4  2370 1 1 35 HIS HB3  H   -1.872   7.275  -2.252 1.00 . A A .  35 HIS HB3  1 1 
        4  2371 1 1 35 HIS HD1  H    0.118   9.150  -2.071 1.00 . A A .  35 HIS HD1  1 1 
        4  2372 1 1 35 HIS HD2  H    0.911   5.374  -0.529 1.00 . A A .  35 HIS HD2  1 1 
        4  2373 1 1 35 HIS HE1  H    2.622   9.008  -1.896 1.00 . A A .  35 HIS HE1  1 1 
        4  2374 1 1 35 HIS N    N   -2.266   7.023   1.041 1.00 . A A .  35 HIS N    1 1 
        4  2375 1 1 35 HIS ND1  N    0.589   8.360  -1.733 1.00 . A A .  35 HIS ND1  1 1 
        4  2376 1 1 35 HIS NE2  N    2.181   7.056  -1.139 1.00 . A A .  35 HIS NE2  1 1 
        4  2377 1 1 35 HIS O    O   -3.837   9.277  -1.144 1.00 . A A .  35 HIS O    1 1 
        4  2378 1 1 36 SER C    C   -6.541   8.606  -0.179 1.00 . A A .  36 SER C    1 1 
        4  2379 1 1 36 SER CA   C   -5.919   7.456  -0.965 1.00 . A A .  36 SER CA   1 1 
        4  2380 1 1 36 SER CB   C   -6.751   6.186  -0.777 1.00 . A A .  36 SER CB   1 1 
        4  2381 1 1 36 SER H    H   -4.297   6.357  -0.163 1.00 . A A .  36 SER H    1 1 
        4  2382 1 1 36 SER HA   H   -5.908   7.716  -2.013 1.00 . A A .  36 SER HA   1 1 
        4  2383 1 1 36 SER HB2  H   -6.118   5.321  -0.906 1.00 . A A .  36 SER HB2  1 1 
        4  2384 1 1 36 SER HB3  H   -7.172   6.179   0.218 1.00 . A A .  36 SER HB3  1 1 
        4  2385 1 1 36 SER HG   H   -7.547   6.583  -2.522 1.00 . A A .  36 SER HG   1 1 
        4  2386 1 1 36 SER N    N   -4.542   7.225  -0.546 1.00 . A A .  36 SER N    1 1 
        4  2387 1 1 36 SER O    O   -6.958   8.436   0.966 1.00 . A A .  36 SER O    1 1 
        4  2388 1 1 36 SER OG   O   -7.807   6.123  -1.720 1.00 . A A .  36 SER OG   1 1 
        4  2389 1 1 37 GLY C    C   -8.567  11.258  -0.647 1.00 . A A .  37 GLY C    1 1 
        4  2390 1 1 37 GLY CA   C   -7.172  10.940  -0.148 1.00 . A A .  37 GLY CA   1 1 
        4  2391 1 1 37 GLY H    H   -6.252   9.855  -1.717 1.00 . A A .  37 GLY H    1 1 
        4  2392 1 1 37 GLY HA2  H   -7.214  10.756   0.915 1.00 . A A .  37 GLY HA2  1 1 
        4  2393 1 1 37 GLY HA3  H   -6.534  11.792  -0.331 1.00 . A A .  37 GLY HA3  1 1 
        4  2394 1 1 37 GLY N    N   -6.600   9.778  -0.804 1.00 . A A .  37 GLY N    1 1 
        4  2395 1 1 37 GLY O    O   -8.761  12.213  -1.399 1.00 . A A .  37 GLY O    1 1 
        4  2396 1 1 38 GLU C    C  -11.646  11.601   0.316 1.00 . A A .  38 GLU C    1 1 
        4  2397 1 1 38 GLU CA   C  -10.925  10.656  -0.642 1.00 . A A .  38 GLU CA   1 1 
        4  2398 1 1 38 GLU CB   C  -11.662   9.316  -0.704 1.00 . A A .  38 GLU CB   1 1 
        4  2399 1 1 38 GLU CD   C  -13.946   8.323  -1.125 1.00 . A A .  38 GLU CD   1 1 
        4  2400 1 1 38 GLU CG   C  -12.919   9.352  -1.556 1.00 . A A .  38 GLU CG   1 1 
        4  2401 1 1 38 GLU H    H   -9.323   9.711   0.369 1.00 . A A .  38 GLU H    1 1 
        4  2402 1 1 38 GLU HA   H  -10.917  11.098  -1.626 1.00 . A A .  38 GLU HA   1 1 
        4  2403 1 1 38 GLU HB2  H  -10.995   8.572  -1.113 1.00 . A A .  38 GLU HB2  1 1 
        4  2404 1 1 38 GLU HB3  H  -11.940   9.026   0.298 1.00 . A A .  38 GLU HB3  1 1 
        4  2405 1 1 38 GLU HG2  H  -13.362  10.334  -1.480 1.00 . A A .  38 GLU HG2  1 1 
        4  2406 1 1 38 GLU HG3  H  -12.648   9.160  -2.584 1.00 . A A .  38 GLU HG3  1 1 
        4  2407 1 1 38 GLU N    N   -9.541  10.456  -0.229 1.00 . A A .  38 GLU N    1 1 
        4  2408 1 1 38 GLU O    O  -12.448  11.170   1.144 1.00 . A A .  38 GLU O    1 1 
        4  2409 1 1 38 GLU OE1  O  -13.932   7.931   0.061 1.00 . A A .  38 GLU OE1  1 1 
        4  2410 1 1 38 GLU OE2  O  -14.763   7.909  -1.974 1.00 . A A .  38 GLU OE2  1 1 
        4  2411 1 1 39 SER C    C  -12.847  14.844   0.236 1.00 . A A .  39 SER C    1 1 
        4  2412 1 1 39 SER CA   C  -11.971  13.898   1.052 1.00 . A A .  39 SER CA   1 1 
        4  2413 1 1 39 SER CB   C  -10.896  14.694   1.795 1.00 . A A .  39 SER CB   1 1 
        4  2414 1 1 39 SER H    H  -10.707  13.174  -0.484 1.00 . A A .  39 SER H    1 1 
        4  2415 1 1 39 SER HA   H  -12.589  13.386   1.774 1.00 . A A .  39 SER HA   1 1 
        4  2416 1 1 39 SER HB2  H  -10.068  14.884   1.129 1.00 . A A .  39 SER HB2  1 1 
        4  2417 1 1 39 SER HB3  H  -11.313  15.634   2.128 1.00 . A A .  39 SER HB3  1 1 
        4  2418 1 1 39 SER HG   H  -10.875  14.286   3.711 1.00 . A A .  39 SER HG   1 1 
        4  2419 1 1 39 SER N    N  -11.354  12.892   0.195 1.00 . A A .  39 SER N    1 1 
        4  2420 1 1 39 SER O    O  -12.434  15.951  -0.106 1.00 . A A .  39 SER O    1 1 
        4  2421 1 1 39 SER OG   O  -10.420  13.980   2.923 1.00 . A A .  39 SER OG   1 1 
        4  2422 1 1 40 GLY C    C  -14.482  15.464  -2.257 1.00 . A A .  40 GLY C    1 1 
        4  2423 1 1 40 GLY CA   C  -14.977  15.215  -0.846 1.00 . A A .  40 GLY CA   1 1 
        4  2424 1 1 40 GLY H    H  -14.336  13.506   0.227 1.00 . A A .  40 GLY H    1 1 
        4  2425 1 1 40 GLY HA2  H  -15.934  14.717  -0.894 1.00 . A A .  40 GLY HA2  1 1 
        4  2426 1 1 40 GLY HA3  H  -15.102  16.165  -0.348 1.00 . A A .  40 GLY HA3  1 1 
        4  2427 1 1 40 GLY N    N  -14.061  14.397  -0.073 1.00 . A A .  40 GLY N    1 1 
        4  2428 1 1 40 GLY O    O  -13.301  15.297  -2.562 1.00 . A A .  40 GLY O    1 1 
        4  2429 1 1 41 PRO C    C  -14.220  17.406  -4.705 1.00 . A A .  41 PRO C    1 1 
        4  2430 1 1 41 PRO CA   C  -15.073  16.152  -4.548 1.00 . A A .  41 PRO CA   1 1 
        4  2431 1 1 41 PRO CB   C  -16.444  16.353  -5.198 1.00 . A A .  41 PRO CB   1 1 
        4  2432 1 1 41 PRO CD   C  -16.825  16.092  -2.853 1.00 . A A .  41 PRO CD   1 1 
        4  2433 1 1 41 PRO CG   C  -17.331  16.792  -4.084 1.00 . A A .  41 PRO CG   1 1 
        4  2434 1 1 41 PRO HA   H  -14.571  15.316  -5.013 1.00 . A A .  41 PRO HA   1 1 
        4  2435 1 1 41 PRO HB2  H  -16.373  17.109  -5.968 1.00 . A A .  41 PRO HB2  1 1 
        4  2436 1 1 41 PRO HB3  H  -16.782  15.423  -5.629 1.00 . A A .  41 PRO HB3  1 1 
        4  2437 1 1 41 PRO HD2  H  -16.947  16.722  -1.984 1.00 . A A .  41 PRO HD2  1 1 
        4  2438 1 1 41 PRO HD3  H  -17.339  15.152  -2.715 1.00 . A A .  41 PRO HD3  1 1 
        4  2439 1 1 41 PRO HG2  H  -17.264  17.862  -3.961 1.00 . A A .  41 PRO HG2  1 1 
        4  2440 1 1 41 PRO HG3  H  -18.350  16.499  -4.289 1.00 . A A .  41 PRO HG3  1 1 
        4  2441 1 1 41 PRO N    N  -15.399  15.872  -3.147 1.00 . A A .  41 PRO N    1 1 
        4  2442 1 1 41 PRO O    O  -13.623  17.635  -5.757 1.00 . A A .  41 PRO O    1 1 
        4  2443 1 1 42 SER C    C  -13.198  19.998  -2.264 1.00 . A A .  42 SER C    1 1 
        4  2444 1 1 42 SER CA   C  -13.388  19.448  -3.675 1.00 . A A .  42 SER CA   1 1 
        4  2445 1 1 42 SER CB   C  -14.076  20.495  -4.553 1.00 . A A .  42 SER CB   1 1 
        4  2446 1 1 42 SER H    H  -14.663  17.978  -2.842 1.00 . A A .  42 SER H    1 1 
        4  2447 1 1 42 SER HA   H  -12.418  19.221  -4.093 1.00 . A A .  42 SER HA   1 1 
        4  2448 1 1 42 SER HB2  H  -13.387  21.301  -4.755 1.00 . A A .  42 SER HB2  1 1 
        4  2449 1 1 42 SER HB3  H  -14.377  20.037  -5.484 1.00 . A A .  42 SER HB3  1 1 
        4  2450 1 1 42 SER HG   H  -15.346  21.939  -4.177 1.00 . A A .  42 SER HG   1 1 
        4  2451 1 1 42 SER N    N  -14.166  18.215  -3.652 1.00 . A A .  42 SER N    1 1 
        4  2452 1 1 42 SER O    O  -13.937  19.645  -1.345 1.00 . A A .  42 SER O    1 1 
        4  2453 1 1 42 SER OG   O  -15.223  21.024  -3.912 1.00 . A A .  42 SER OG   1 1 
        4  2454 1 1 43 SER C    C  -11.894  22.982  -0.895 1.00 . A A .  43 SER C    1 1 
        4  2455 1 1 43 SER CA   C  -11.913  21.459  -0.802 1.00 . A A .  43 SER CA   1 1 
        4  2456 1 1 43 SER CB   C  -10.569  20.952  -0.274 1.00 . A A .  43 SER CB   1 1 
        4  2457 1 1 43 SER H    H  -11.649  21.104  -2.873 1.00 . A A .  43 SER H    1 1 
        4  2458 1 1 43 SER HA   H  -12.694  21.161  -0.119 1.00 . A A .  43 SER HA   1 1 
        4  2459 1 1 43 SER HB2  H   -9.866  20.886  -1.090 1.00 . A A .  43 SER HB2  1 1 
        4  2460 1 1 43 SER HB3  H  -10.195  21.641   0.469 1.00 . A A .  43 SER HB3  1 1 
        4  2461 1 1 43 SER HG   H   -9.880  19.427   0.745 1.00 . A A .  43 SER HG   1 1 
        4  2462 1 1 43 SER N    N  -12.203  20.863  -2.101 1.00 . A A .  43 SER N    1 1 
        4  2463 1 1 43 SER O    O  -10.998  23.567  -1.503 1.00 . A A .  43 SER O    1 1 
        4  2464 1 1 43 SER OG   O  -10.704  19.672   0.318 1.00 . A A .  43 SER OG   1 1 
        4  2465 1 1 44 GLY C    C  -14.391  25.571  -0.153 1.00 . A A .  44 GLY C    1 1 
        4  2466 1 1 44 GLY CA   C  -12.971  25.067  -0.313 1.00 . A A .  44 GLY CA   1 1 
        4  2467 1 1 44 GLY H    H  -13.577  23.099   0.182 1.00 . A A .  44 GLY H    1 1 
        4  2468 1 1 44 GLY HA2  H  -12.366  25.464   0.489 1.00 . A A .  44 GLY HA2  1 1 
        4  2469 1 1 44 GLY HA3  H  -12.579  25.421  -1.255 1.00 . A A .  44 GLY HA3  1 1 
        4  2470 1 1 44 GLY N    N  -12.891  23.618  -0.287 1.00 . A A .  44 GLY N    1 1 
        4  2471 1 1 44 GLY O    O  -15.077  25.147   0.776 1.00 . A A .  44 GLY O    1 1 
        4  2472 2 2  1 ZN  ZN   ZN   3.499   5.135  -1.167 1.00 . B A . 201 ZN  ZN   1 1 
        5  2473 1 1  1 GLY C    C   29.165  11.309  -3.175 1.00 . A A .   1 GLY C    1 1 
        5  2474 1 1  1 GLY CA   C   30.387  12.154  -3.472 1.00 . A A .   1 GLY CA   1 1 
        5  2475 1 1  1 GLY H1   H   31.033  10.669  -4.836 1.00 . A A .   1 GLY H1   1 1 
        5  2476 1 1  1 GLY HA2  H   30.919  12.337  -2.550 1.00 . A A .   1 GLY HA2  1 1 
        5  2477 1 1  1 GLY HA3  H   30.065  13.100  -3.883 1.00 . A A .   1 GLY HA3  1 1 
        5  2478 1 1  1 GLY N    N   31.288  11.517  -4.415 1.00 . A A .   1 GLY N    1 1 
        5  2479 1 1  1 GLY O    O   29.246  10.324  -2.441 1.00 . A A .   1 GLY O    1 1 
        5  2480 1 1  2 SER C    C   26.855   9.572  -4.148 1.00 . A A .   2 SER C    1 1 
        5  2481 1 1  2 SER CA   C   26.782  10.967  -3.534 1.00 . A A .   2 SER CA   1 1 
        5  2482 1 1  2 SER CB   C   25.607  11.740  -4.136 1.00 . A A .   2 SER CB   1 1 
        5  2483 1 1  2 SER H    H   28.027  12.487  -4.322 1.00 . A A .   2 SER H    1 1 
        5  2484 1 1  2 SER HA   H   26.631  10.871  -2.469 1.00 . A A .   2 SER HA   1 1 
        5  2485 1 1  2 SER HB2  H   25.944  12.282  -5.007 1.00 . A A .   2 SER HB2  1 1 
        5  2486 1 1  2 SER HB3  H   24.831  11.044  -4.423 1.00 . A A .   2 SER HB3  1 1 
        5  2487 1 1  2 SER HG   H   25.729  12.857  -2.532 1.00 . A A .   2 SER HG   1 1 
        5  2488 1 1  2 SER N    N   28.028  11.694  -3.746 1.00 . A A .   2 SER N    1 1 
        5  2489 1 1  2 SER O    O   26.625   8.571  -3.470 1.00 . A A .   2 SER O    1 1 
        5  2490 1 1  2 SER OG   O   25.071  12.662  -3.203 1.00 . A A .   2 SER OG   1 1 
        5  2491 1 1  3 SER C    C   26.112   7.328  -5.784 1.00 . A A .   3 SER C    1 1 
        5  2492 1 1  3 SER CA   C   27.279   8.244  -6.143 1.00 . A A .   3 SER CA   1 1 
        5  2493 1 1  3 SER CB   C   28.604   7.555  -5.811 1.00 . A A .   3 SER CB   1 1 
        5  2494 1 1  3 SER H    H   27.350  10.348  -5.922 1.00 . A A .   3 SER H    1 1 
        5  2495 1 1  3 SER HA   H   27.246   8.451  -7.203 1.00 . A A .   3 SER HA   1 1 
        5  2496 1 1  3 SER HB2  H   28.785   7.622  -4.750 1.00 . A A .   3 SER HB2  1 1 
        5  2497 1 1  3 SER HB3  H   28.549   6.516  -6.103 1.00 . A A .   3 SER HB3  1 1 
        5  2498 1 1  3 SER HG   H   29.355   8.594  -7.292 1.00 . A A .   3 SER HG   1 1 
        5  2499 1 1  3 SER N    N   27.178   9.515  -5.436 1.00 . A A .   3 SER N    1 1 
        5  2500 1 1  3 SER O    O   26.291   6.129  -5.575 1.00 . A A .   3 SER O    1 1 
        5  2501 1 1  3 SER OG   O   29.682   8.166  -6.498 1.00 . A A .   3 SER OG   1 1 
        5  2502 1 1  4 GLY C    C   23.246   6.289  -6.544 1.00 . A A .   4 GLY C    1 1 
        5  2503 1 1  4 GLY CA   C   23.737   7.127  -5.380 1.00 . A A .   4 GLY CA   1 1 
        5  2504 1 1  4 GLY H    H   24.833   8.865  -5.891 1.00 . A A .   4 GLY H    1 1 
        5  2505 1 1  4 GLY HA2  H   23.973   6.473  -4.554 1.00 . A A .   4 GLY HA2  1 1 
        5  2506 1 1  4 GLY HA3  H   22.949   7.801  -5.079 1.00 . A A .   4 GLY HA3  1 1 
        5  2507 1 1  4 GLY N    N   24.916   7.904  -5.714 1.00 . A A .   4 GLY N    1 1 
        5  2508 1 1  4 GLY O    O   24.034   5.620  -7.212 1.00 . A A .   4 GLY O    1 1 
        5  2509 1 1  5 SER C    C   21.931   4.151  -7.934 1.00 . A A .   5 SER C    1 1 
        5  2510 1 1  5 SER CA   C   21.343   5.558  -7.874 1.00 . A A .   5 SER CA   1 1 
        5  2511 1 1  5 SER CB   C   21.562   6.272  -9.209 1.00 . A A .   5 SER CB   1 1 
        5  2512 1 1  5 SER H    H   21.363   6.877  -6.218 1.00 . A A .   5 SER H    1 1 
        5  2513 1 1  5 SER HA   H   20.282   5.484  -7.685 1.00 . A A .   5 SER HA   1 1 
        5  2514 1 1  5 SER HB2  H   21.160   5.668 -10.008 1.00 . A A .   5 SER HB2  1 1 
        5  2515 1 1  5 SER HB3  H   21.058   7.227  -9.191 1.00 . A A .   5 SER HB3  1 1 
        5  2516 1 1  5 SER HG   H   23.354   5.665  -9.719 1.00 . A A .   5 SER HG   1 1 
        5  2517 1 1  5 SER N    N   21.939   6.324  -6.786 1.00 . A A .   5 SER N    1 1 
        5  2518 1 1  5 SER O    O   22.222   3.634  -9.012 1.00 . A A .   5 SER O    1 1 
        5  2519 1 1  5 SER OG   O   22.942   6.489  -9.451 1.00 . A A .   5 SER OG   1 1 
        5  2520 1 1  6 SER C    C   21.978   1.390  -5.582 1.00 . A A .   6 SER C    1 1 
        5  2521 1 1  6 SER CA   C   22.660   2.193  -6.685 1.00 . A A .   6 SER CA   1 1 
        5  2522 1 1  6 SER CB   C   24.166   2.257  -6.428 1.00 . A A .   6 SER CB   1 1 
        5  2523 1 1  6 SER H    H   21.851   4.004  -5.942 1.00 . A A .   6 SER H    1 1 
        5  2524 1 1  6 SER HA   H   22.485   1.704  -7.631 1.00 . A A .   6 SER HA   1 1 
        5  2525 1 1  6 SER HB2  H   24.652   2.737  -7.264 1.00 . A A .   6 SER HB2  1 1 
        5  2526 1 1  6 SER HB3  H   24.352   2.827  -5.529 1.00 . A A .   6 SER HB3  1 1 
        5  2527 1 1  6 SER HG   H   25.134   0.685  -7.085 1.00 . A A .   6 SER HG   1 1 
        5  2528 1 1  6 SER N    N   22.103   3.539  -6.767 1.00 . A A .   6 SER N    1 1 
        5  2529 1 1  6 SER O    O   21.859   1.849  -4.447 1.00 . A A .   6 SER O    1 1 
        5  2530 1 1  6 SER OG   O   24.712   0.959  -6.267 1.00 . A A .   6 SER OG   1 1 
        5  2531 1 1  7 GLY C    C   19.596  -1.286  -5.501 1.00 . A A .   7 GLY C    1 1 
        5  2532 1 1  7 GLY CA   C   20.866  -0.664  -4.955 1.00 . A A .   7 GLY CA   1 1 
        5  2533 1 1  7 GLY H    H   21.653  -0.129  -6.846 1.00 . A A .   7 GLY H    1 1 
        5  2534 1 1  7 GLY HA2  H   21.542  -1.452  -4.659 1.00 . A A .   7 GLY HA2  1 1 
        5  2535 1 1  7 GLY HA3  H   20.617  -0.072  -4.086 1.00 . A A .   7 GLY HA3  1 1 
        5  2536 1 1  7 GLY N    N   21.531   0.185  -5.925 1.00 . A A .   7 GLY N    1 1 
        5  2537 1 1  7 GLY O    O   18.543  -0.648  -5.527 1.00 . A A .   7 GLY O    1 1 
        5  2538 1 1  8 THR C    C   17.422  -3.352  -5.470 1.00 . A A .   8 THR C    1 1 
        5  2539 1 1  8 THR CA   C   18.546  -3.244  -6.494 1.00 . A A .   8 THR CA   1 1 
        5  2540 1 1  8 THR CB   C   18.932  -4.659  -6.967 1.00 . A A .   8 THR CB   1 1 
        5  2541 1 1  8 THR CG2  C   19.466  -5.489  -5.810 1.00 . A A .   8 THR CG2  1 1 
        5  2542 1 1  8 THR H    H   20.560  -2.992  -5.896 1.00 . A A .   8 THR H    1 1 
        5  2543 1 1  8 THR HA   H   18.190  -2.687  -7.349 1.00 . A A .   8 THR HA   1 1 
        5  2544 1 1  8 THR HB   H   19.706  -4.573  -7.717 1.00 . A A .   8 THR HB   1 1 
        5  2545 1 1  8 THR HG1  H   17.876  -5.312  -8.499 1.00 . A A .   8 THR HG1  1 1 
        5  2546 1 1  8 THR HG21 H   20.505  -5.247  -5.644 1.00 . A A .   8 THR HG21 1 1 
        5  2547 1 1  8 THR HG22 H   19.374  -6.538  -6.047 1.00 . A A .   8 THR HG22 1 1 
        5  2548 1 1  8 THR HG23 H   18.899  -5.270  -4.917 1.00 . A A .   8 THR HG23 1 1 
        5  2549 1 1  8 THR N    N   19.694  -2.536  -5.943 1.00 . A A .   8 THR N    1 1 
        5  2550 1 1  8 THR O    O   17.659  -3.275  -4.265 1.00 . A A .   8 THR O    1 1 
        5  2551 1 1  8 THR OG1  O   17.794  -5.310  -7.543 1.00 . A A .   8 THR OG1  1 1 
        5  2552 1 1  9 ARG C    C   14.911  -5.068  -4.537 1.00 . A A .   9 ARG C    1 1 
        5  2553 1 1  9 ARG CA   C   15.038  -3.649  -5.083 1.00 . A A .   9 ARG CA   1 1 
        5  2554 1 1  9 ARG CB   C   13.764  -3.266  -5.838 1.00 . A A .   9 ARG CB   1 1 
        5  2555 1 1  9 ARG CD   C   14.211  -1.237  -7.252 1.00 . A A .   9 ARG CD   1 1 
        5  2556 1 1  9 ARG CG   C   13.567  -1.765  -5.980 1.00 . A A .   9 ARG CG   1 1 
        5  2557 1 1  9 ARG CZ   C   15.118   0.879  -8.116 1.00 . A A .   9 ARG CZ   1 1 
        5  2558 1 1  9 ARG H    H   16.074  -3.585  -6.928 1.00 . A A .   9 ARG H    1 1 
        5  2559 1 1  9 ARG HA   H   15.174  -2.968  -4.257 1.00 . A A .   9 ARG HA   1 1 
        5  2560 1 1  9 ARG HB2  H   13.802  -3.697  -6.828 1.00 . A A .   9 ARG HB2  1 1 
        5  2561 1 1  9 ARG HB3  H   12.913  -3.670  -5.311 1.00 . A A .   9 ARG HB3  1 1 
        5  2562 1 1  9 ARG HD2  H   15.154  -1.741  -7.399 1.00 . A A .   9 ARG HD2  1 1 
        5  2563 1 1  9 ARG HD3  H   13.557  -1.449  -8.085 1.00 . A A .   9 ARG HD3  1 1 
        5  2564 1 1  9 ARG HE   H   14.088   0.688  -6.418 1.00 . A A .   9 ARG HE   1 1 
        5  2565 1 1  9 ARG HG2  H   12.509  -1.551  -6.009 1.00 . A A .   9 ARG HG2  1 1 
        5  2566 1 1  9 ARG HG3  H   14.014  -1.272  -5.129 1.00 . A A .   9 ARG HG3  1 1 
        5  2567 1 1  9 ARG HH11 H   15.485  -0.738  -9.270 1.00 . A A .   9 ARG HH11 1 1 
        5  2568 1 1  9 ARG HH12 H   16.119   0.760  -9.867 1.00 . A A .   9 ARG HH12 1 1 
        5  2569 1 1  9 ARG HH21 H   14.917   2.666  -7.194 1.00 . A A .   9 ARG HH21 1 1 
        5  2570 1 1  9 ARG HH22 H   15.796   2.696  -8.685 1.00 . A A .   9 ARG HH22 1 1 
        5  2571 1 1  9 ARG N    N   16.199  -3.531  -5.958 1.00 . A A .   9 ARG N    1 1 
        5  2572 1 1  9 ARG NE   N   14.447   0.203  -7.189 1.00 . A A .   9 ARG NE   1 1 
        5  2573 1 1  9 ARG NH1  N   15.615   0.248  -9.171 1.00 . A A .   9 ARG NH1  1 1 
        5  2574 1 1  9 ARG NH2  N   15.291   2.188  -7.988 1.00 . A A .   9 ARG NH2  1 1 
        5  2575 1 1  9 ARG O    O   14.928  -6.038  -5.293 1.00 . A A .   9 ARG O    1 1 
        5  2576 1 1 10 GLU C    C   13.187  -6.854  -2.388 1.00 . A A .  10 GLU C    1 1 
        5  2577 1 1 10 GLU CA   C   14.655  -6.480  -2.571 1.00 . A A .  10 GLU CA   1 1 
        5  2578 1 1 10 GLU CB   C   15.363  -6.472  -1.215 1.00 . A A .  10 GLU CB   1 1 
        5  2579 1 1 10 GLU CD   C   15.805  -8.937  -1.545 1.00 . A A .  10 GLU CD   1 1 
        5  2580 1 1 10 GLU CG   C   15.443  -7.841  -0.561 1.00 . A A .  10 GLU CG   1 1 
        5  2581 1 1 10 GLU H    H   14.776  -4.369  -2.668 1.00 . A A .  10 GLU H    1 1 
        5  2582 1 1 10 GLU HA   H   15.125  -7.215  -3.207 1.00 . A A .  10 GLU HA   1 1 
        5  2583 1 1 10 GLU HB2  H   16.369  -6.101  -1.349 1.00 . A A .  10 GLU HB2  1 1 
        5  2584 1 1 10 GLU HB3  H   14.831  -5.809  -0.549 1.00 . A A .  10 GLU HB3  1 1 
        5  2585 1 1 10 GLU HG2  H   16.193  -7.813   0.215 1.00 . A A .  10 GLU HG2  1 1 
        5  2586 1 1 10 GLU HG3  H   14.483  -8.073  -0.123 1.00 . A A .  10 GLU HG3  1 1 
        5  2587 1 1 10 GLU N    N   14.784  -5.180  -3.218 1.00 . A A .  10 GLU N    1 1 
        5  2588 1 1 10 GLU O    O   12.780  -7.979  -2.680 1.00 . A A .  10 GLU O    1 1 
        5  2589 1 1 10 GLU OE1  O   16.742  -8.730  -2.344 1.00 . A A .  10 GLU OE1  1 1 
        5  2590 1 1 10 GLU OE2  O   15.151 -10.000  -1.516 1.00 . A A .  10 GLU OE2  1 1 
        5  2591 1 1 11 LYS C    C   10.222  -6.214  -3.007 1.00 . A A .  11 LYS C    1 1 
        5  2592 1 1 11 LYS CA   C   10.973  -6.130  -1.681 1.00 . A A .  11 LYS CA   1 1 
        5  2593 1 1 11 LYS CB   C   10.385  -5.010  -0.821 1.00 . A A .  11 LYS CB   1 1 
        5  2594 1 1 11 LYS CD   C   11.810  -5.157   1.243 1.00 . A A .  11 LYS CD   1 1 
        5  2595 1 1 11 LYS CE   C   12.248  -3.701   1.266 1.00 . A A .  11 LYS CE   1 1 
        5  2596 1 1 11 LYS CG   C   10.411  -5.309   0.668 1.00 . A A .  11 LYS CG   1 1 
        5  2597 1 1 11 LYS H    H   12.779  -5.026  -1.690 1.00 . A A .  11 LYS H    1 1 
        5  2598 1 1 11 LYS HA   H   10.864  -7.068  -1.159 1.00 . A A .  11 LYS HA   1 1 
        5  2599 1 1 11 LYS HB2  H   10.948  -4.105  -0.995 1.00 . A A .  11 LYS HB2  1 1 
        5  2600 1 1 11 LYS HB3  H    9.358  -4.846  -1.116 1.00 . A A .  11 LYS HB3  1 1 
        5  2601 1 1 11 LYS HD2  H   11.818  -5.540   2.253 1.00 . A A .  11 LYS HD2  1 1 
        5  2602 1 1 11 LYS HD3  H   12.502  -5.723   0.636 1.00 . A A .  11 LYS HD3  1 1 
        5  2603 1 1 11 LYS HE2  H   12.653  -3.445   0.299 1.00 . A A .  11 LYS HE2  1 1 
        5  2604 1 1 11 LYS HE3  H   11.386  -3.083   1.470 1.00 . A A .  11 LYS HE3  1 1 
        5  2605 1 1 11 LYS HG2  H    9.749  -4.624   1.176 1.00 . A A .  11 LYS HG2  1 1 
        5  2606 1 1 11 LYS HG3  H   10.074  -6.323   0.828 1.00 . A A .  11 LYS HG3  1 1 
        5  2607 1 1 11 LYS HZ1  H   14.005  -4.196   2.281 1.00 . A A .  11 LYS HZ1  1 1 
        5  2608 1 1 11 LYS HZ2  H   12.844  -3.439   3.250 1.00 . A A .  11 LYS HZ2  1 1 
        5  2609 1 1 11 LYS HZ3  H   13.742  -2.531   2.140 1.00 . A A .  11 LYS HZ3  1 1 
        5  2610 1 1 11 LYS N    N   12.396  -5.903  -1.903 1.00 . A A .  11 LYS N    1 1 
        5  2611 1 1 11 LYS NZ   N   13.283  -3.449   2.307 1.00 . A A .  11 LYS NZ   1 1 
        5  2612 1 1 11 LYS O    O   10.363  -5.361  -3.883 1.00 . A A .  11 LYS O    1 1 
        5  2613 1 1 12 PRO C    C    7.491  -6.467  -4.526 1.00 . A A .  12 PRO C    1 1 
        5  2614 1 1 12 PRO CA   C    8.614  -7.486  -4.374 1.00 . A A .  12 PRO CA   1 1 
        5  2615 1 1 12 PRO CB   C    8.039  -8.890  -4.174 1.00 . A A .  12 PRO CB   1 1 
        5  2616 1 1 12 PRO CD   C    9.189  -8.323  -2.156 1.00 . A A .  12 PRO CD   1 1 
        5  2617 1 1 12 PRO CG   C    8.007  -9.080  -2.696 1.00 . A A .  12 PRO CG   1 1 
        5  2618 1 1 12 PRO HA   H    9.234  -7.472  -5.258 1.00 . A A .  12 PRO HA   1 1 
        5  2619 1 1 12 PRO HB2  H    7.047  -8.940  -4.601 1.00 . A A .  12 PRO HB2  1 1 
        5  2620 1 1 12 PRO HB3  H    8.679  -9.617  -4.651 1.00 . A A .  12 PRO HB3  1 1 
        5  2621 1 1 12 PRO HD2  H    8.956  -7.898  -1.191 1.00 . A A .  12 PRO HD2  1 1 
        5  2622 1 1 12 PRO HD3  H   10.051  -8.970  -2.087 1.00 . A A .  12 PRO HD3  1 1 
        5  2623 1 1 12 PRO HG2  H    7.089  -8.678  -2.295 1.00 . A A .  12 PRO HG2  1 1 
        5  2624 1 1 12 PRO HG3  H    8.094 -10.130  -2.459 1.00 . A A .  12 PRO HG3  1 1 
        5  2625 1 1 12 PRO N    N    9.405  -7.267  -3.159 1.00 . A A .  12 PRO N    1 1 
        5  2626 1 1 12 PRO O    O    7.329  -5.860  -5.585 1.00 . A A .  12 PRO O    1 1 
        5  2627 1 1 13 TYR C    C    6.111  -3.903  -3.365 1.00 . A A .  13 TYR C    1 1 
        5  2628 1 1 13 TYR CA   C    5.607  -5.338  -3.478 1.00 . A A .  13 TYR CA   1 1 
        5  2629 1 1 13 TYR CB   C    4.635  -5.641  -2.337 1.00 . A A .  13 TYR CB   1 1 
        5  2630 1 1 13 TYR CD1  C    3.017  -7.366  -3.222 1.00 . A A .  13 TYR CD1  1 1 
        5  2631 1 1 13 TYR CD2  C    4.596  -8.046  -1.570 1.00 . A A .  13 TYR CD2  1 1 
        5  2632 1 1 13 TYR CE1  C    2.500  -8.647  -3.261 1.00 . A A .  13 TYR CE1  1 1 
        5  2633 1 1 13 TYR CE2  C    4.085  -9.330  -1.604 1.00 . A A .  13 TYR CE2  1 1 
        5  2634 1 1 13 TYR CG   C    4.072  -7.044  -2.377 1.00 . A A .  13 TYR CG   1 1 
        5  2635 1 1 13 TYR CZ   C    3.037  -9.625  -2.450 1.00 . A A .  13 TYR CZ   1 1 
        5  2636 1 1 13 TYR H    H    6.895  -6.796  -2.646 1.00 . A A .  13 TYR H    1 1 
        5  2637 1 1 13 TYR HA   H    5.088  -5.452  -4.419 1.00 . A A .  13 TYR HA   1 1 
        5  2638 1 1 13 TYR HB2  H    5.146  -5.516  -1.395 1.00 . A A .  13 TYR HB2  1 1 
        5  2639 1 1 13 TYR HB3  H    3.806  -4.949  -2.385 1.00 . A A .  13 TYR HB3  1 1 
        5  2640 1 1 13 TYR HD1  H    2.599  -6.598  -3.856 1.00 . A A .  13 TYR HD1  1 1 
        5  2641 1 1 13 TYR HD2  H    5.417  -7.812  -0.908 1.00 . A A .  13 TYR HD2  1 1 
        5  2642 1 1 13 TYR HE1  H    1.679  -8.878  -3.924 1.00 . A A .  13 TYR HE1  1 1 
        5  2643 1 1 13 TYR HE2  H    4.506 -10.096  -0.969 1.00 . A A .  13 TYR HE2  1 1 
        5  2644 1 1 13 TYR HH   H    2.689 -11.336  -1.647 1.00 . A A .  13 TYR HH   1 1 
        5  2645 1 1 13 TYR N    N    6.717  -6.283  -3.462 1.00 . A A .  13 TYR N    1 1 
        5  2646 1 1 13 TYR O    O    6.852  -3.566  -2.442 1.00 . A A .  13 TYR O    1 1 
        5  2647 1 1 13 TYR OH   O    2.525 -10.901  -2.487 1.00 . A A .  13 TYR OH   1 1 
        5  2648 1 1 14 GLU C    C    4.904  -0.742  -4.451 1.00 . A A .  14 GLU C    1 1 
        5  2649 1 1 14 GLU CA   C    6.113  -1.663  -4.316 1.00 . A A .  14 GLU CA   1 1 
        5  2650 1 1 14 GLU CB   C    7.097  -1.402  -5.458 1.00 . A A .  14 GLU CB   1 1 
        5  2651 1 1 14 GLU CD   C    9.440  -2.014  -6.176 1.00 . A A .  14 GLU CD   1 1 
        5  2652 1 1 14 GLU CG   C    8.554  -1.525  -5.047 1.00 . A A .  14 GLU CG   1 1 
        5  2653 1 1 14 GLU H    H    5.112  -3.390  -5.019 1.00 . A A .  14 GLU H    1 1 
        5  2654 1 1 14 GLU HA   H    6.603  -1.457  -3.377 1.00 . A A .  14 GLU HA   1 1 
        5  2655 1 1 14 GLU HB2  H    6.906  -2.110  -6.251 1.00 . A A .  14 GLU HB2  1 1 
        5  2656 1 1 14 GLU HB3  H    6.935  -0.403  -5.835 1.00 . A A .  14 GLU HB3  1 1 
        5  2657 1 1 14 GLU HG2  H    8.908  -0.557  -4.726 1.00 . A A .  14 GLU HG2  1 1 
        5  2658 1 1 14 GLU HG3  H    8.625  -2.223  -4.225 1.00 . A A .  14 GLU HG3  1 1 
        5  2659 1 1 14 GLU N    N    5.702  -3.062  -4.310 1.00 . A A .  14 GLU N    1 1 
        5  2660 1 1 14 GLU O    O    3.937  -1.064  -5.143 1.00 . A A .  14 GLU O    1 1 
        5  2661 1 1 14 GLU OE1  O    9.209  -3.139  -6.668 1.00 . A A .  14 GLU OE1  1 1 
        5  2662 1 1 14 GLU OE2  O   10.364  -1.271  -6.569 1.00 . A A .  14 GLU OE2  1 1 
        5  2663 1 1 15 CYS C    C    3.848   2.102  -5.169 1.00 . A A .  15 CYS C    1 1 
        5  2664 1 1 15 CYS CA   C    3.876   1.375  -3.828 1.00 . A A .  15 CYS CA   1 1 
        5  2665 1 1 15 CYS CB   C    4.019   2.387  -2.690 1.00 . A A .  15 CYS CB   1 1 
        5  2666 1 1 15 CYS H    H    5.761   0.607  -3.250 1.00 . A A .  15 CYS H    1 1 
        5  2667 1 1 15 CYS HA   H    2.948   0.837  -3.705 1.00 . A A .  15 CYS HA   1 1 
        5  2668 1 1 15 CYS HB2  H    4.203   1.855  -1.767 1.00 . A A .  15 CYS HB2  1 1 
        5  2669 1 1 15 CYS HB3  H    4.858   3.035  -2.898 1.00 . A A .  15 CYS HB3  1 1 
        5  2670 1 1 15 CYS N    N    4.964   0.406  -3.785 1.00 . A A .  15 CYS N    1 1 
        5  2671 1 1 15 CYS O    O    4.818   2.755  -5.554 1.00 . A A .  15 CYS O    1 1 
        5  2672 1 1 15 CYS SG   S    2.553   3.438  -2.440 1.00 . A A .  15 CYS SG   1 1 
        5  2673 1 1 16 SER C    C    2.370   4.132  -7.018 1.00 . A A .  16 SER C    1 1 
        5  2674 1 1 16 SER CA   C    2.575   2.628  -7.177 1.00 . A A .  16 SER CA   1 1 
        5  2675 1 1 16 SER CB   C    1.395   2.018  -7.935 1.00 . A A .  16 SER CB   1 1 
        5  2676 1 1 16 SER H    H    1.990   1.451  -5.517 1.00 . A A .  16 SER H    1 1 
        5  2677 1 1 16 SER HA   H    3.481   2.458  -7.740 1.00 . A A .  16 SER HA   1 1 
        5  2678 1 1 16 SER HB2  H    1.492   0.943  -7.942 1.00 . A A .  16 SER HB2  1 1 
        5  2679 1 1 16 SER HB3  H    0.473   2.294  -7.443 1.00 . A A .  16 SER HB3  1 1 
        5  2680 1 1 16 SER HG   H    0.459   2.746  -9.494 1.00 . A A .  16 SER HG   1 1 
        5  2681 1 1 16 SER N    N    2.729   1.985  -5.877 1.00 . A A .  16 SER N    1 1 
        5  2682 1 1 16 SER O    O    2.206   4.853  -8.001 1.00 . A A .  16 SER O    1 1 
        5  2683 1 1 16 SER OG   O    1.355   2.481  -9.274 1.00 . A A .  16 SER OG   1 1 
        5  2684 1 1 17 GLU C    C    3.538   6.723  -5.356 1.00 . A A .  17 GLU C    1 1 
        5  2685 1 1 17 GLU CA   C    2.194   6.013  -5.485 1.00 . A A .  17 GLU CA   1 1 
        5  2686 1 1 17 GLU CB   C    1.385   6.193  -4.198 1.00 . A A .  17 GLU CB   1 1 
        5  2687 1 1 17 GLU CD   C   -0.976   6.242  -5.096 1.00 . A A .  17 GLU CD   1 1 
        5  2688 1 1 17 GLU CG   C    0.029   5.507  -4.230 1.00 . A A .  17 GLU CG   1 1 
        5  2689 1 1 17 GLU H    H    2.515   3.971  -5.030 1.00 . A A .  17 GLU H    1 1 
        5  2690 1 1 17 GLU HA   H    1.647   6.449  -6.307 1.00 . A A .  17 GLU HA   1 1 
        5  2691 1 1 17 GLU HB2  H    1.951   5.789  -3.372 1.00 . A A .  17 GLU HB2  1 1 
        5  2692 1 1 17 GLU HB3  H    1.226   7.248  -4.032 1.00 . A A .  17 GLU HB3  1 1 
        5  2693 1 1 17 GLU HG2  H    0.155   4.508  -4.621 1.00 . A A .  17 GLU HG2  1 1 
        5  2694 1 1 17 GLU HG3  H   -0.356   5.452  -3.223 1.00 . A A .  17 GLU HG3  1 1 
        5  2695 1 1 17 GLU N    N    2.380   4.596  -5.772 1.00 . A A .  17 GLU N    1 1 
        5  2696 1 1 17 GLU O    O    3.803   7.706  -6.050 1.00 . A A .  17 GLU O    1 1 
        5  2697 1 1 17 GLU OE1  O   -0.986   6.006  -6.322 1.00 . A A .  17 GLU OE1  1 1 
        5  2698 1 1 17 GLU OE2  O   -1.752   7.051  -4.547 1.00 . A A .  17 GLU OE2  1 1 
        5  2699 1 1 18 CYS C    C    6.802   5.868  -4.731 1.00 . A A .  18 CYS C    1 1 
        5  2700 1 1 18 CYS CA   C    5.701   6.805  -4.242 1.00 . A A .  18 CYS CA   1 1 
        5  2701 1 1 18 CYS CB   C    5.901   7.114  -2.758 1.00 . A A .  18 CYS CB   1 1 
        5  2702 1 1 18 CYS H    H    4.116   5.434  -3.941 1.00 . A A .  18 CYS H    1 1 
        5  2703 1 1 18 CYS HA   H    5.754   7.725  -4.803 1.00 . A A .  18 CYS HA   1 1 
        5  2704 1 1 18 CYS HB2  H    6.896   7.510  -2.611 1.00 . A A .  18 CYS HB2  1 1 
        5  2705 1 1 18 CYS HB3  H    5.176   7.853  -2.451 1.00 . A A .  18 CYS HB3  1 1 
        5  2706 1 1 18 CYS N    N    4.384   6.220  -4.464 1.00 . A A .  18 CYS N    1 1 
        5  2707 1 1 18 CYS O    O    7.778   6.304  -5.339 1.00 . A A .  18 CYS O    1 1 
        5  2708 1 1 18 CYS SG   S    5.717   5.668  -1.665 1.00 . A A .  18 CYS SG   1 1 
        5  2709 1 1 19 GLY C    C    8.139   2.764  -3.724 1.00 . A A .  19 GLY C    1 1 
        5  2710 1 1 19 GLY CA   C    7.622   3.598  -4.880 1.00 . A A .  19 GLY CA   1 1 
        5  2711 1 1 19 GLY H    H    5.837   4.286  -3.972 1.00 . A A .  19 GLY H    1 1 
        5  2712 1 1 19 GLY HA2  H    7.174   2.942  -5.611 1.00 . A A .  19 GLY HA2  1 1 
        5  2713 1 1 19 GLY HA3  H    8.454   4.115  -5.336 1.00 . A A .  19 GLY HA3  1 1 
        5  2714 1 1 19 GLY N    N    6.636   4.576  -4.461 1.00 . A A .  19 GLY N    1 1 
        5  2715 1 1 19 GLY O    O    9.084   1.991  -3.880 1.00 . A A .  19 GLY O    1 1 
        5  2716 1 1 20 LYS C    C    8.066   0.692  -1.682 1.00 . A A .  20 LYS C    1 1 
        5  2717 1 1 20 LYS CA   C    7.922   2.179  -1.371 1.00 . A A .  20 LYS CA   1 1 
        5  2718 1 1 20 LYS CB   C    6.901   2.379  -0.249 1.00 . A A .  20 LYS CB   1 1 
        5  2719 1 1 20 LYS CD   C    6.717   3.025   2.172 1.00 . A A .  20 LYS CD   1 1 
        5  2720 1 1 20 LYS CE   C    7.485   3.139   3.479 1.00 . A A .  20 LYS CE   1 1 
        5  2721 1 1 20 LYS CG   C    7.487   2.213   1.143 1.00 . A A .  20 LYS CG   1 1 
        5  2722 1 1 20 LYS H    H    6.772   3.554  -2.497 1.00 . A A .  20 LYS H    1 1 
        5  2723 1 1 20 LYS HA   H    8.878   2.561  -1.049 1.00 . A A .  20 LYS HA   1 1 
        5  2724 1 1 20 LYS HB2  H    6.488   3.374  -0.327 1.00 . A A .  20 LYS HB2  1 1 
        5  2725 1 1 20 LYS HB3  H    6.105   1.658  -0.370 1.00 . A A .  20 LYS HB3  1 1 
        5  2726 1 1 20 LYS HD2  H    6.546   4.017   1.780 1.00 . A A .  20 LYS HD2  1 1 
        5  2727 1 1 20 LYS HD3  H    5.769   2.542   2.362 1.00 . A A .  20 LYS HD3  1 1 
        5  2728 1 1 20 LYS HE2  H    6.779   3.224   4.291 1.00 . A A .  20 LYS HE2  1 1 
        5  2729 1 1 20 LYS HE3  H    8.080   2.247   3.611 1.00 . A A .  20 LYS HE3  1 1 
        5  2730 1 1 20 LYS HG2  H    7.446   1.170   1.419 1.00 . A A .  20 LYS HG2  1 1 
        5  2731 1 1 20 LYS HG3  H    8.515   2.545   1.132 1.00 . A A .  20 LYS HG3  1 1 
        5  2732 1 1 20 LYS HZ1  H    8.645   4.567   4.470 1.00 . A A .  20 LYS HZ1  1 1 
        5  2733 1 1 20 LYS HZ2  H    7.903   5.143   3.063 1.00 . A A .  20 LYS HZ2  1 1 
        5  2734 1 1 20 LYS HZ3  H    9.250   4.126   2.953 1.00 . A A .  20 LYS HZ3  1 1 
        5  2735 1 1 20 LYS N    N    7.520   2.922  -2.559 1.00 . A A .  20 LYS N    1 1 
        5  2736 1 1 20 LYS NZ   N    8.384   4.327   3.493 1.00 . A A .  20 LYS NZ   1 1 
        5  2737 1 1 20 LYS O    O    7.832   0.259  -2.810 1.00 . A A .  20 LYS O    1 1 
        5  2738 1 1 21 ALA C    C    8.086  -2.282   0.367 1.00 . A A .  21 ALA C    1 1 
        5  2739 1 1 21 ALA CA   C    8.623  -1.522  -0.841 1.00 . A A .  21 ALA CA   1 1 
        5  2740 1 1 21 ALA CB   C   10.091  -1.856  -1.066 1.00 . A A .  21 ALA CB   1 1 
        5  2741 1 1 21 ALA H    H    8.624   0.320   0.201 1.00 . A A .  21 ALA H    1 1 
        5  2742 1 1 21 ALA HA   H    8.072  -1.825  -1.719 1.00 . A A .  21 ALA HA   1 1 
        5  2743 1 1 21 ALA HB1  H   10.643  -0.946  -1.248 1.00 . A A .  21 ALA HB1  1 1 
        5  2744 1 1 21 ALA HB2  H   10.486  -2.348  -0.189 1.00 . A A .  21 ALA HB2  1 1 
        5  2745 1 1 21 ALA HB3  H   10.183  -2.511  -1.919 1.00 . A A .  21 ALA HB3  1 1 
        5  2746 1 1 21 ALA N    N    8.452  -0.084  -0.675 1.00 . A A .  21 ALA N    1 1 
        5  2747 1 1 21 ALA O    O    8.035  -1.749   1.476 1.00 . A A .  21 ALA O    1 1 
        5  2748 1 1 22 PHE C    C    7.451  -5.835   0.961 1.00 . A A .  22 PHE C    1 1 
        5  2749 1 1 22 PHE CA   C    7.147  -4.362   1.215 1.00 . A A .  22 PHE CA   1 1 
        5  2750 1 1 22 PHE CB   C    5.637  -4.155   1.343 1.00 . A A .  22 PHE CB   1 1 
        5  2751 1 1 22 PHE CD1  C    5.141  -1.874   0.423 1.00 . A A .  22 PHE CD1  1 1 
        5  2752 1 1 22 PHE CD2  C    4.971  -2.207   2.778 1.00 . A A .  22 PHE CD2  1 1 
        5  2753 1 1 22 PHE CE1  C    4.777  -0.549   0.580 1.00 . A A .  22 PHE CE1  1 1 
        5  2754 1 1 22 PHE CE2  C    4.606  -0.884   2.941 1.00 . A A .  22 PHE CE2  1 1 
        5  2755 1 1 22 PHE CG   C    5.241  -2.716   1.518 1.00 . A A .  22 PHE CG   1 1 
        5  2756 1 1 22 PHE CZ   C    4.510  -0.054   1.842 1.00 . A A .  22 PHE CZ   1 1 
        5  2757 1 1 22 PHE H    H    7.749  -3.898  -0.761 1.00 . A A .  22 PHE H    1 1 
        5  2758 1 1 22 PHE HA   H    7.622  -4.062   2.136 1.00 . A A .  22 PHE HA   1 1 
        5  2759 1 1 22 PHE HB2  H    5.153  -4.525   0.452 1.00 . A A .  22 PHE HB2  1 1 
        5  2760 1 1 22 PHE HB3  H    5.277  -4.706   2.198 1.00 . A A .  22 PHE HB3  1 1 
        5  2761 1 1 22 PHE HD1  H    5.349  -2.261  -0.565 1.00 . A A .  22 PHE HD1  1 1 
        5  2762 1 1 22 PHE HD2  H    5.047  -2.854   3.639 1.00 . A A .  22 PHE HD2  1 1 
        5  2763 1 1 22 PHE HE1  H    4.702   0.097  -0.282 1.00 . A A .  22 PHE HE1  1 1 
        5  2764 1 1 22 PHE HE2  H    4.399  -0.499   3.929 1.00 . A A .  22 PHE HE2  1 1 
        5  2765 1 1 22 PHE HZ   H    4.225   0.980   1.967 1.00 . A A .  22 PHE HZ   1 1 
        5  2766 1 1 22 PHE N    N    7.684  -3.529   0.145 1.00 . A A .  22 PHE N    1 1 
        5  2767 1 1 22 PHE O    O    7.963  -6.201  -0.097 1.00 . A A .  22 PHE O    1 1 
        5  2768 1 1 23 ILE C    C    6.096  -8.846   1.420 1.00 . A A .  23 ILE C    1 1 
        5  2769 1 1 23 ILE CA   C    7.369  -8.109   1.822 1.00 . A A .  23 ILE CA   1 1 
        5  2770 1 1 23 ILE CB   C    7.897  -8.702   3.142 1.00 . A A .  23 ILE CB   1 1 
        5  2771 1 1 23 ILE CD1  C   10.353  -8.185   2.722 1.00 . A A .  23 ILE CD1  1 1 
        5  2772 1 1 23 ILE CG1  C    9.146  -7.948   3.602 1.00 . A A .  23 ILE CG1  1 1 
        5  2773 1 1 23 ILE CG2  C    8.198 -10.184   2.974 1.00 . A A .  23 ILE CG2  1 1 
        5  2774 1 1 23 ILE H    H    6.726  -6.324   2.759 1.00 . A A .  23 ILE H    1 1 
        5  2775 1 1 23 ILE HA   H    8.117  -8.261   1.058 1.00 . A A .  23 ILE HA   1 1 
        5  2776 1 1 23 ILE HB   H    7.126  -8.599   3.891 1.00 . A A .  23 ILE HB   1 1 
        5  2777 1 1 23 ILE HD11 H   10.964  -7.294   2.701 1.00 . A A .  23 ILE HD11 1 1 
        5  2778 1 1 23 ILE HD12 H   10.931  -9.007   3.118 1.00 . A A .  23 ILE HD12 1 1 
        5  2779 1 1 23 ILE HD13 H   10.028  -8.421   1.720 1.00 . A A .  23 ILE HD13 1 1 
        5  2780 1 1 23 ILE HG12 H    8.940  -6.889   3.603 1.00 . A A .  23 ILE HG12 1 1 
        5  2781 1 1 23 ILE HG13 H    9.398  -8.262   4.605 1.00 . A A .  23 ILE HG13 1 1 
        5  2782 1 1 23 ILE HG21 H    8.841 -10.325   2.118 1.00 . A A .  23 ILE HG21 1 1 
        5  2783 1 1 23 ILE HG22 H    8.693 -10.553   3.860 1.00 . A A .  23 ILE HG22 1 1 
        5  2784 1 1 23 ILE HG23 H    7.275 -10.724   2.825 1.00 . A A .  23 ILE HG23 1 1 
        5  2785 1 1 23 ILE N    N    7.131  -6.676   1.939 1.00 . A A .  23 ILE N    1 1 
        5  2786 1 1 23 ILE O    O    6.129  -9.756   0.591 1.00 . A A .  23 ILE O    1 1 
        5  2787 1 1 24 ARG C    C    2.696  -8.037   1.189 1.00 . A A .  24 ARG C    1 1 
        5  2788 1 1 24 ARG CA   C    3.690  -9.068   1.715 1.00 . A A .  24 ARG CA   1 1 
        5  2789 1 1 24 ARG CB   C    3.126  -9.745   2.965 1.00 . A A .  24 ARG CB   1 1 
        5  2790 1 1 24 ARG CD   C    3.532 -11.256   4.932 1.00 . A A .  24 ARG CD   1 1 
        5  2791 1 1 24 ARG CG   C    4.114 -10.671   3.655 1.00 . A A .  24 ARG CG   1 1 
        5  2792 1 1 24 ARG CZ   C    1.959 -13.066   5.473 1.00 . A A .  24 ARG CZ   1 1 
        5  2793 1 1 24 ARG H    H    5.013  -7.716   2.664 1.00 . A A .  24 ARG H    1 1 
        5  2794 1 1 24 ARG HA   H    3.852  -9.816   0.953 1.00 . A A .  24 ARG HA   1 1 
        5  2795 1 1 24 ARG HB2  H    2.829  -8.983   3.670 1.00 . A A .  24 ARG HB2  1 1 
        5  2796 1 1 24 ARG HB3  H    2.258 -10.324   2.686 1.00 . A A .  24 ARG HB3  1 1 
        5  2797 1 1 24 ARG HD2  H    4.288 -11.857   5.415 1.00 . A A .  24 ARG HD2  1 1 
        5  2798 1 1 24 ARG HD3  H    3.245 -10.445   5.585 1.00 . A A .  24 ARG HD3  1 1 
        5  2799 1 1 24 ARG HE   H    1.852 -11.911   3.851 1.00 . A A .  24 ARG HE   1 1 
        5  2800 1 1 24 ARG HG2  H    4.365 -11.479   2.984 1.00 . A A .  24 ARG HG2  1 1 
        5  2801 1 1 24 ARG HG3  H    5.006 -10.113   3.899 1.00 . A A .  24 ARG HG3  1 1 
        5  2802 1 1 24 ARG HH11 H    3.438 -12.794   6.822 1.00 . A A .  24 ARG HH11 1 1 
        5  2803 1 1 24 ARG HH12 H    2.322 -14.067   7.191 1.00 . A A .  24 ARG HH12 1 1 
        5  2804 1 1 24 ARG HH21 H    0.377 -13.584   4.326 1.00 . A A .  24 ARG HH21 1 1 
        5  2805 1 1 24 ARG HH22 H    0.582 -14.516   5.771 1.00 . A A .  24 ARG HH22 1 1 
        5  2806 1 1 24 ARG N    N    4.975  -8.446   2.012 1.00 . A A .  24 ARG N    1 1 
        5  2807 1 1 24 ARG NE   N    2.362 -12.089   4.669 1.00 . A A .  24 ARG NE   1 1 
        5  2808 1 1 24 ARG NH1  N    2.628 -13.331   6.587 1.00 . A A .  24 ARG NH1  1 1 
        5  2809 1 1 24 ARG NH2  N    0.884 -13.781   5.165 1.00 . A A .  24 ARG NH2  1 1 
        5  2810 1 1 24 ARG O    O    2.527  -6.969   1.774 1.00 . A A .  24 ARG O    1 1 
        5  2811 1 1 25 ASN C    C    0.264  -6.733   0.545 1.00 . A A .  25 ASN C    1 1 
        5  2812 1 1 25 ASN CA   C    1.064  -7.469  -0.526 1.00 . A A .  25 ASN CA   1 1 
        5  2813 1 1 25 ASN CB   C    0.117  -8.252  -1.438 1.00 . A A .  25 ASN CB   1 1 
        5  2814 1 1 25 ASN CG   C   -0.430  -7.403  -2.569 1.00 . A A .  25 ASN CG   1 1 
        5  2815 1 1 25 ASN H    H    2.219  -9.233  -0.341 1.00 . A A .  25 ASN H    1 1 
        5  2816 1 1 25 ASN HA   H    1.602  -6.745  -1.118 1.00 . A A .  25 ASN HA   1 1 
        5  2817 1 1 25 ASN HB2  H    0.650  -9.088  -1.867 1.00 . A A .  25 ASN HB2  1 1 
        5  2818 1 1 25 ASN HB3  H   -0.713  -8.621  -0.854 1.00 . A A .  25 ASN HB3  1 1 
        5  2819 1 1 25 ASN HD21 H   -0.818  -5.921  -1.301 1.00 . A A .  25 ASN HD21 1 1 
        5  2820 1 1 25 ASN HD22 H   -1.230  -5.624  -2.953 1.00 . A A .  25 ASN HD22 1 1 
        5  2821 1 1 25 ASN N    N    2.041  -8.367   0.080 1.00 . A A .  25 ASN N    1 1 
        5  2822 1 1 25 ASN ND2  N   -0.870  -6.194  -2.241 1.00 . A A .  25 ASN ND2  1 1 
        5  2823 1 1 25 ASN O    O    0.188  -5.505   0.543 1.00 . A A .  25 ASN O    1 1 
        5  2824 1 1 25 ASN OD1  O   -0.456  -7.830  -3.723 1.00 . A A .  25 ASN OD1  1 1 
        5  2825 1 1 26 SER C    C   -0.463  -5.657   3.086 1.00 . A A .  26 SER C    1 1 
        5  2826 1 1 26 SER CA   C   -1.127  -6.915   2.534 1.00 . A A .  26 SER CA   1 1 
        5  2827 1 1 26 SER CB   C   -1.326  -7.935   3.657 1.00 . A A .  26 SER CB   1 1 
        5  2828 1 1 26 SER H    H   -0.232  -8.468   1.407 1.00 . A A .  26 SER H    1 1 
        5  2829 1 1 26 SER HA   H   -2.091  -6.649   2.126 1.00 . A A .  26 SER HA   1 1 
        5  2830 1 1 26 SER HB2  H   -1.999  -8.709   3.321 1.00 . A A .  26 SER HB2  1 1 
        5  2831 1 1 26 SER HB3  H   -0.372  -8.373   3.914 1.00 . A A .  26 SER HB3  1 1 
        5  2832 1 1 26 SER HG   H   -2.830  -7.298   4.738 1.00 . A A .  26 SER HG   1 1 
        5  2833 1 1 26 SER N    N   -0.330  -7.494   1.459 1.00 . A A .  26 SER N    1 1 
        5  2834 1 1 26 SER O    O   -1.121  -4.640   3.303 1.00 . A A .  26 SER O    1 1 
        5  2835 1 1 26 SER OG   O   -1.873  -7.323   4.811 1.00 . A A .  26 SER OG   1 1 
        5  2836 1 1 27 GLN C    C    1.484  -3.396   2.913 1.00 . A A .  27 GLN C    1 1 
        5  2837 1 1 27 GLN CA   C    1.598  -4.604   3.837 1.00 . A A .  27 GLN CA   1 1 
        5  2838 1 1 27 GLN CB   C    3.068  -4.984   4.020 1.00 . A A .  27 GLN CB   1 1 
        5  2839 1 1 27 GLN CD   C    4.556  -6.265   5.611 1.00 . A A .  27 GLN CD   1 1 
        5  2840 1 1 27 GLN CG   C    3.271  -6.270   4.805 1.00 . A A .  27 GLN CG   1 1 
        5  2841 1 1 27 GLN H    H    1.313  -6.574   3.117 1.00 . A A .  27 GLN H    1 1 
        5  2842 1 1 27 GLN HA   H    1.180  -4.347   4.799 1.00 . A A .  27 GLN HA   1 1 
        5  2843 1 1 27 GLN HB2  H    3.520  -5.107   3.047 1.00 . A A .  27 GLN HB2  1 1 
        5  2844 1 1 27 GLN HB3  H    3.572  -4.185   4.543 1.00 . A A .  27 GLN HB3  1 1 
        5  2845 1 1 27 GLN HE21 H    5.529  -5.415   4.099 1.00 . A A .  27 GLN HE21 1 1 
        5  2846 1 1 27 GLN HE22 H    6.470  -5.740   5.511 1.00 . A A .  27 GLN HE22 1 1 
        5  2847 1 1 27 GLN HG2  H    2.441  -6.397   5.484 1.00 . A A .  27 GLN HG2  1 1 
        5  2848 1 1 27 GLN HG3  H    3.300  -7.098   4.113 1.00 . A A .  27 GLN HG3  1 1 
        5  2849 1 1 27 GLN N    N    0.844  -5.736   3.310 1.00 . A A .  27 GLN N    1 1 
        5  2850 1 1 27 GLN NE2  N    5.627  -5.756   5.013 1.00 . A A .  27 GLN NE2  1 1 
        5  2851 1 1 27 GLN O    O    1.314  -2.265   3.371 1.00 . A A .  27 GLN O    1 1 
        5  2852 1 1 27 GLN OE1  O    4.586  -6.714   6.757 1.00 . A A .  27 GLN OE1  1 1 
        5  2853 1 1 28 LEU C    C    0.095  -1.947   0.627 1.00 . A A .  28 LEU C    1 1 
        5  2854 1 1 28 LEU CA   C    1.485  -2.574   0.622 1.00 . A A .  28 LEU CA   1 1 
        5  2855 1 1 28 LEU CB   C    1.809  -3.114  -0.772 1.00 . A A .  28 LEU CB   1 1 
        5  2856 1 1 28 LEU CD1  C    2.157  -0.882  -1.857 1.00 . A A .  28 LEU CD1  1 1 
        5  2857 1 1 28 LEU CD2  C    1.730  -2.902  -3.269 1.00 . A A .  28 LEU CD2  1 1 
        5  2858 1 1 28 LEU CG   C    1.426  -2.213  -1.946 1.00 . A A .  28 LEU CG   1 1 
        5  2859 1 1 28 LEU H    H    1.712  -4.564   1.307 1.00 . A A .  28 LEU H    1 1 
        5  2860 1 1 28 LEU HA   H    2.209  -1.817   0.883 1.00 . A A .  28 LEU HA   1 1 
        5  2861 1 1 28 LEU HB2  H    2.873  -3.287  -0.821 1.00 . A A .  28 LEU HB2  1 1 
        5  2862 1 1 28 LEU HB3  H    1.287  -4.054  -0.891 1.00 . A A .  28 LEU HB3  1 1 
        5  2863 1 1 28 LEU HD11 H    3.162  -0.997  -2.232 1.00 . A A .  28 LEU HD11 1 1 
        5  2864 1 1 28 LEU HD12 H    2.191  -0.559  -0.827 1.00 . A A .  28 LEU HD12 1 1 
        5  2865 1 1 28 LEU HD13 H    1.634  -0.144  -2.448 1.00 . A A .  28 LEU HD13 1 1 
        5  2866 1 1 28 LEU HD21 H    1.062  -3.741  -3.399 1.00 . A A .  28 LEU HD21 1 1 
        5  2867 1 1 28 LEU HD22 H    2.752  -3.252  -3.266 1.00 . A A .  28 LEU HD22 1 1 
        5  2868 1 1 28 LEU HD23 H    1.592  -2.202  -4.080 1.00 . A A .  28 LEU HD23 1 1 
        5  2869 1 1 28 LEU HG   H    0.364  -2.013  -1.908 1.00 . A A .  28 LEU HG   1 1 
        5  2870 1 1 28 LEU N    N    1.578  -3.642   1.612 1.00 . A A .  28 LEU N    1 1 
        5  2871 1 1 28 LEU O    O   -0.046  -0.727   0.719 1.00 . A A .  28 LEU O    1 1 
        5  2872 1 1 29 ILE C    C   -2.562  -1.353   1.679 1.00 . A A .  29 ILE C    1 1 
        5  2873 1 1 29 ILE CA   C   -2.308  -2.316   0.525 1.00 . A A .  29 ILE CA   1 1 
        5  2874 1 1 29 ILE CB   C   -3.304  -3.487   0.619 1.00 . A A .  29 ILE CB   1 1 
        5  2875 1 1 29 ILE CD1  C   -3.806  -5.769  -0.390 1.00 . A A .  29 ILE CD1  1 1 
        5  2876 1 1 29 ILE CG1  C   -3.135  -4.426  -0.577 1.00 . A A .  29 ILE CG1  1 1 
        5  2877 1 1 29 ILE CG2  C   -4.731  -2.963   0.691 1.00 . A A .  29 ILE CG2  1 1 
        5  2878 1 1 29 ILE H    H   -0.753  -3.749   0.458 1.00 . A A .  29 ILE H    1 1 
        5  2879 1 1 29 ILE HA   H   -2.480  -1.797  -0.407 1.00 . A A .  29 ILE HA   1 1 
        5  2880 1 1 29 ILE HB   H   -3.100  -4.032   1.528 1.00 . A A .  29 ILE HB   1 1 
        5  2881 1 1 29 ILE HD11 H   -3.544  -6.420  -1.212 1.00 . A A .  29 ILE HD11 1 1 
        5  2882 1 1 29 ILE HD12 H   -3.475  -6.211   0.538 1.00 . A A .  29 ILE HD12 1 1 
        5  2883 1 1 29 ILE HD13 H   -4.877  -5.636  -0.365 1.00 . A A .  29 ILE HD13 1 1 
        5  2884 1 1 29 ILE HG12 H   -3.560  -3.963  -1.453 1.00 . A A .  29 ILE HG12 1 1 
        5  2885 1 1 29 ILE HG13 H   -2.082  -4.600  -0.742 1.00 . A A .  29 ILE HG13 1 1 
        5  2886 1 1 29 ILE HG21 H   -5.376  -3.731   1.093 1.00 . A A .  29 ILE HG21 1 1 
        5  2887 1 1 29 ILE HG22 H   -4.763  -2.096   1.333 1.00 . A A .  29 ILE HG22 1 1 
        5  2888 1 1 29 ILE HG23 H   -5.066  -2.692  -0.298 1.00 . A A .  29 ILE HG23 1 1 
        5  2889 1 1 29 ILE N    N   -0.929  -2.788   0.529 1.00 . A A .  29 ILE N    1 1 
        5  2890 1 1 29 ILE O    O   -3.029  -0.232   1.476 1.00 . A A .  29 ILE O    1 1 
        5  2891 1 1 30 VAL C    C   -1.783   0.392   3.915 1.00 . A A .  30 VAL C    1 1 
        5  2892 1 1 30 VAL CA   C   -2.441  -0.973   4.081 1.00 . A A .  30 VAL CA   1 1 
        5  2893 1 1 30 VAL CB   C   -1.869  -1.658   5.336 1.00 . A A .  30 VAL CB   1 1 
        5  2894 1 1 30 VAL CG1  C   -1.943  -0.723   6.534 1.00 . A A .  30 VAL CG1  1 1 
        5  2895 1 1 30 VAL CG2  C   -2.608  -2.957   5.617 1.00 . A A .  30 VAL CG2  1 1 
        5  2896 1 1 30 VAL H    H   -1.881  -2.699   2.992 1.00 . A A .  30 VAL H    1 1 
        5  2897 1 1 30 VAL HA   H   -3.503  -0.835   4.224 1.00 . A A .  30 VAL HA   1 1 
        5  2898 1 1 30 VAL HB   H   -0.831  -1.891   5.153 1.00 . A A .  30 VAL HB   1 1 
        5  2899 1 1 30 VAL HG11 H   -2.278   0.251   6.210 1.00 . A A .  30 VAL HG11 1 1 
        5  2900 1 1 30 VAL HG12 H   -2.637  -1.121   7.260 1.00 . A A .  30 VAL HG12 1 1 
        5  2901 1 1 30 VAL HG13 H   -0.964  -0.635   6.983 1.00 . A A .  30 VAL HG13 1 1 
        5  2902 1 1 30 VAL HG21 H   -3.672  -2.792   5.537 1.00 . A A .  30 VAL HG21 1 1 
        5  2903 1 1 30 VAL HG22 H   -2.304  -3.705   4.901 1.00 . A A .  30 VAL HG22 1 1 
        5  2904 1 1 30 VAL HG23 H   -2.372  -3.298   6.615 1.00 . A A .  30 VAL HG23 1 1 
        5  2905 1 1 30 VAL N    N   -2.250  -1.796   2.893 1.00 . A A .  30 VAL N    1 1 
        5  2906 1 1 30 VAL O    O   -2.326   1.411   4.343 1.00 . A A .  30 VAL O    1 1 
        5  2907 1 1 31 HIS C    C   -0.614   2.542   2.076 1.00 . A A .  31 HIS C    1 1 
        5  2908 1 1 31 HIS CA   C    0.123   1.646   3.067 1.00 . A A .  31 HIS CA   1 1 
        5  2909 1 1 31 HIS CB   C    1.531   1.346   2.552 1.00 . A A .  31 HIS CB   1 1 
        5  2910 1 1 31 HIS CD2  C    2.701   2.917   0.851 1.00 . A A .  31 HIS CD2  1 1 
        5  2911 1 1 31 HIS CE1  C    3.280   4.514   2.236 1.00 . A A .  31 HIS CE1  1 1 
        5  2912 1 1 31 HIS CG   C    2.270   2.562   2.084 1.00 . A A .  31 HIS CG   1 1 
        5  2913 1 1 31 HIS H    H   -0.228  -0.439   2.973 1.00 . A A .  31 HIS H    1 1 
        5  2914 1 1 31 HIS HA   H    0.198   2.162   4.012 1.00 . A A .  31 HIS HA   1 1 
        5  2915 1 1 31 HIS HB2  H    2.108   0.892   3.344 1.00 . A A .  31 HIS HB2  1 1 
        5  2916 1 1 31 HIS HB3  H    1.465   0.658   1.722 1.00 . A A .  31 HIS HB3  1 1 
        5  2917 1 1 31 HIS HD1  H    2.480   3.621   3.894 1.00 . A A .  31 HIS HD1  1 1 
        5  2918 1 1 31 HIS HD2  H    2.576   2.348  -0.060 1.00 . A A .  31 HIS HD2  1 1 
        5  2919 1 1 31 HIS HE1  H    3.690   5.430   2.634 1.00 . A A .  31 HIS HE1  1 1 
        5  2920 1 1 31 HIS N    N   -0.610   0.405   3.291 1.00 . A A .  31 HIS N    1 1 
        5  2921 1 1 31 HIS ND1  N    2.650   3.583   2.930 1.00 . A A .  31 HIS ND1  1 1 
        5  2922 1 1 31 HIS NE2  N    3.325   4.134   0.972 1.00 . A A .  31 HIS NE2  1 1 
        5  2923 1 1 31 HIS O    O   -0.729   3.749   2.284 1.00 . A A .  31 HIS O    1 1 
        5  2924 1 1 32 GLN C    C   -2.988   3.471   0.588 1.00 . A A .  32 GLN C    1 1 
        5  2925 1 1 32 GLN CA   C   -1.834   2.685  -0.025 1.00 . A A .  32 GLN CA   1 1 
        5  2926 1 1 32 GLN CB   C   -2.363   1.733  -1.099 1.00 . A A .  32 GLN CB   1 1 
        5  2927 1 1 32 GLN CD   C   -1.758   0.459  -3.195 1.00 . A A .  32 GLN CD   1 1 
        5  2928 1 1 32 GLN CG   C   -1.267   1.024  -1.877 1.00 . A A .  32 GLN CG   1 1 
        5  2929 1 1 32 GLN H    H   -0.985   0.976   0.890 1.00 . A A .  32 GLN H    1 1 
        5  2930 1 1 32 GLN HA   H   -1.144   3.379  -0.481 1.00 . A A .  32 GLN HA   1 1 
        5  2931 1 1 32 GLN HB2  H   -2.981   0.985  -0.627 1.00 . A A .  32 GLN HB2  1 1 
        5  2932 1 1 32 GLN HB3  H   -2.964   2.296  -1.798 1.00 . A A .  32 GLN HB3  1 1 
        5  2933 1 1 32 GLN HE21 H   -0.360   1.473  -4.180 1.00 . A A .  32 GLN HE21 1 1 
        5  2934 1 1 32 GLN HE22 H   -1.406   0.501  -5.151 1.00 . A A .  32 GLN HE22 1 1 
        5  2935 1 1 32 GLN HG2  H   -0.473   1.728  -2.079 1.00 . A A .  32 GLN HG2  1 1 
        5  2936 1 1 32 GLN HG3  H   -0.883   0.213  -1.275 1.00 . A A .  32 GLN HG3  1 1 
        5  2937 1 1 32 GLN N    N   -1.109   1.941   0.999 1.00 . A A .  32 GLN N    1 1 
        5  2938 1 1 32 GLN NE2  N   -1.110   0.851  -4.286 1.00 . A A .  32 GLN NE2  1 1 
        5  2939 1 1 32 GLN O    O   -3.485   4.428  -0.007 1.00 . A A .  32 GLN O    1 1 
        5  2940 1 1 32 GLN OE1  O   -2.710  -0.321  -3.233 1.00 . A A .  32 GLN OE1  1 1 
        5  2941 1 1 33 ARG C    C   -4.140   5.167   2.814 1.00 . A A .  33 ARG C    1 1 
        5  2942 1 1 33 ARG CA   C   -4.507   3.726   2.472 1.00 . A A .  33 ARG CA   1 1 
        5  2943 1 1 33 ARG CB   C   -4.870   2.964   3.748 1.00 . A A .  33 ARG CB   1 1 
        5  2944 1 1 33 ARG CD   C   -6.031   0.958   4.718 1.00 . A A .  33 ARG CD   1 1 
        5  2945 1 1 33 ARG CG   C   -5.343   1.542   3.494 1.00 . A A .  33 ARG CG   1 1 
        5  2946 1 1 33 ARG CZ   C   -8.233   1.154   5.794 1.00 . A A .  33 ARG CZ   1 1 
        5  2947 1 1 33 ARG H    H   -2.974   2.292   2.203 1.00 . A A .  33 ARG H    1 1 
        5  2948 1 1 33 ARG HA   H   -5.361   3.732   1.812 1.00 . A A .  33 ARG HA   1 1 
        5  2949 1 1 33 ARG HB2  H   -4.000   2.922   4.387 1.00 . A A .  33 ARG HB2  1 1 
        5  2950 1 1 33 ARG HB3  H   -5.657   3.497   4.259 1.00 . A A .  33 ARG HB3  1 1 
        5  2951 1 1 33 ARG HD2  H   -6.265  -0.078   4.523 1.00 . A A .  33 ARG HD2  1 1 
        5  2952 1 1 33 ARG HD3  H   -5.357   1.022   5.558 1.00 . A A .  33 ARG HD3  1 1 
        5  2953 1 1 33 ARG HE   H   -7.376   2.573   4.684 1.00 . A A .  33 ARG HE   1 1 
        5  2954 1 1 33 ARG HG2  H   -6.041   1.547   2.670 1.00 . A A .  33 ARG HG2  1 1 
        5  2955 1 1 33 ARG HG3  H   -4.491   0.929   3.243 1.00 . A A .  33 ARG HG3  1 1 
        5  2956 1 1 33 ARG HH11 H   -7.287  -0.604   6.107 1.00 . A A .  33 ARG HH11 1 1 
        5  2957 1 1 33 ARG HH12 H   -8.840  -0.453   6.860 1.00 . A A .  33 ARG HH12 1 1 
        5  2958 1 1 33 ARG HH21 H   -9.422   2.784   5.671 1.00 . A A .  33 ARG HH21 1 1 
        5  2959 1 1 33 ARG HH22 H  -10.054   1.474   6.611 1.00 . A A .  33 ARG HH22 1 1 
        5  2960 1 1 33 ARG N    N   -3.410   3.061   1.779 1.00 . A A .  33 ARG N    1 1 
        5  2961 1 1 33 ARG NE   N   -7.265   1.668   5.044 1.00 . A A .  33 ARG NE   1 1 
        5  2962 1 1 33 ARG NH1  N   -8.110  -0.068   6.294 1.00 . A A .  33 ARG NH1  1 1 
        5  2963 1 1 33 ARG NH2  N   -9.326   1.862   6.046 1.00 . A A .  33 ARG NH2  1 1 
        5  2964 1 1 33 ARG O    O   -5.007   6.037   2.903 1.00 . A A .  33 ARG O    1 1 
        5  2965 1 1 34 THR C    C   -2.424   7.673   2.131 1.00 . A A .  34 THR C    1 1 
        5  2966 1 1 34 THR CA   C   -2.365   6.747   3.341 1.00 . A A .  34 THR CA   1 1 
        5  2967 1 1 34 THR CB   C   -0.919   6.706   3.871 1.00 . A A .  34 THR CB   1 1 
        5  2968 1 1 34 THR CG2  C    0.053   6.334   2.761 1.00 . A A .  34 THR CG2  1 1 
        5  2969 1 1 34 THR H    H   -2.204   4.679   2.922 1.00 . A A .  34 THR H    1 1 
        5  2970 1 1 34 THR HA   H   -3.000   7.146   4.119 1.00 . A A .  34 THR HA   1 1 
        5  2971 1 1 34 THR HB   H   -0.859   5.957   4.648 1.00 . A A .  34 THR HB   1 1 
        5  2972 1 1 34 THR HG1  H    0.383   8.000   4.591 1.00 . A A .  34 THR HG1  1 1 
        5  2973 1 1 34 THR HG21 H    0.579   7.218   2.434 1.00 . A A .  34 THR HG21 1 1 
        5  2974 1 1 34 THR HG22 H   -0.493   5.912   1.931 1.00 . A A .  34 THR HG22 1 1 
        5  2975 1 1 34 THR HG23 H    0.762   5.609   3.132 1.00 . A A .  34 THR HG23 1 1 
        5  2976 1 1 34 THR N    N   -2.847   5.413   3.007 1.00 . A A .  34 THR N    1 1 
        5  2977 1 1 34 THR O    O   -2.636   8.878   2.268 1.00 . A A .  34 THR O    1 1 
        5  2978 1 1 34 THR OG1  O   -0.562   7.979   4.419 1.00 . A A .  34 THR OG1  1 1 
        5  2979 1 1 35 HIS C    C   -3.705   8.222  -0.676 1.00 . A A .  35 HIS C    1 1 
        5  2980 1 1 35 HIS CA   C   -2.270   7.876  -0.290 1.00 . A A .  35 HIS CA   1 1 
        5  2981 1 1 35 HIS CB   C   -1.599   7.099  -1.423 1.00 . A A .  35 HIS CB   1 1 
        5  2982 1 1 35 HIS CD2  C    0.888   6.426  -1.122 1.00 . A A .  35 HIS CD2  1 1 
        5  2983 1 1 35 HIS CE1  C    1.810   8.283  -1.835 1.00 . A A .  35 HIS CE1  1 1 
        5  2984 1 1 35 HIS CG   C   -0.112   7.270  -1.468 1.00 . A A .  35 HIS CG   1 1 
        5  2985 1 1 35 HIS H    H   -2.073   6.137   0.900 1.00 . A A .  35 HIS H    1 1 
        5  2986 1 1 35 HIS HA   H   -1.725   8.792  -0.122 1.00 . A A .  35 HIS HA   1 1 
        5  2987 1 1 35 HIS HB2  H   -1.807   6.046  -1.301 1.00 . A A .  35 HIS HB2  1 1 
        5  2988 1 1 35 HIS HB3  H   -2.002   7.433  -2.368 1.00 . A A .  35 HIS HB3  1 1 
        5  2989 1 1 35 HIS HD1  H    0.040   9.228  -2.231 1.00 . A A .  35 HIS HD1  1 1 
        5  2990 1 1 35 HIS HD2  H    0.776   5.424  -0.732 1.00 . A A .  35 HIS HD2  1 1 
        5  2991 1 1 35 HIS HE1  H    2.544   9.024  -2.114 1.00 . A A .  35 HIS HE1  1 1 
        5  2992 1 1 35 HIS N    N   -2.237   7.101   0.945 1.00 . A A .  35 HIS N    1 1 
        5  2993 1 1 35 HIS ND1  N    0.499   8.425  -1.910 1.00 . A A .  35 HIS ND1  1 1 
        5  2994 1 1 35 HIS NE2  N    2.072   7.079  -1.360 1.00 . A A .  35 HIS NE2  1 1 
        5  2995 1 1 35 HIS O    O   -3.987   9.333  -1.125 1.00 . A A .  35 HIS O    1 1 
        5  2996 1 1 36 SER C    C   -6.636   8.533   0.063 1.00 . A A .  36 SER C    1 1 
        5  2997 1 1 36 SER CA   C   -6.014   7.465  -0.832 1.00 . A A .  36 SER CA   1 1 
        5  2998 1 1 36 SER CB   C   -6.787   6.152  -0.692 1.00 . A A .  36 SER CB   1 1 
        5  2999 1 1 36 SER H    H   -4.322   6.398  -0.137 1.00 . A A .  36 SER H    1 1 
        5  3000 1 1 36 SER HA   H   -6.066   7.797  -1.858 1.00 . A A .  36 SER HA   1 1 
        5  3001 1 1 36 SER HB2  H   -6.386   5.426  -1.383 1.00 . A A .  36 SER HB2  1 1 
        5  3002 1 1 36 SER HB3  H   -6.684   5.783   0.318 1.00 . A A .  36 SER HB3  1 1 
        5  3003 1 1 36 SER HG   H   -8.573   5.488  -1.145 1.00 . A A .  36 SER HG   1 1 
        5  3004 1 1 36 SER N    N   -4.608   7.263  -0.498 1.00 . A A .  36 SER N    1 1 
        5  3005 1 1 36 SER O    O   -7.395   9.383  -0.402 1.00 . A A .  36 SER O    1 1 
        5  3006 1 1 36 SER OG   O   -8.163   6.339  -0.973 1.00 . A A .  36 SER OG   1 1 
        5  3007 1 1 37 GLY C    C   -6.950  10.839   1.696 1.00 . A A .  37 GLY C    1 1 
        5  3008 1 1 37 GLY CA   C   -6.845   9.448   2.291 1.00 . A A .  37 GLY CA   1 1 
        5  3009 1 1 37 GLY H    H   -5.700   7.781   1.665 1.00 . A A .  37 GLY H    1 1 
        5  3010 1 1 37 GLY HA2  H   -7.827   9.126   2.602 1.00 . A A .  37 GLY HA2  1 1 
        5  3011 1 1 37 GLY HA3  H   -6.199   9.487   3.156 1.00 . A A .  37 GLY HA3  1 1 
        5  3012 1 1 37 GLY N    N   -6.310   8.481   1.350 1.00 . A A .  37 GLY N    1 1 
        5  3013 1 1 37 GLY O    O   -7.944  11.534   1.901 1.00 . A A .  37 GLY O    1 1 
        5  3014 1 1 38 GLU C    C   -5.484  12.466  -1.129 1.00 . A A .  38 GLU C    1 1 
        5  3015 1 1 38 GLU CA   C   -5.901  12.563   0.336 1.00 . A A .  38 GLU CA   1 1 
        5  3016 1 1 38 GLU CB   C   -4.948  13.493   1.088 1.00 . A A .  38 GLU CB   1 1 
        5  3017 1 1 38 GLU CD   C   -4.907  15.511   2.609 1.00 . A A .  38 GLU CD   1 1 
        5  3018 1 1 38 GLU CG   C   -5.593  14.202   2.267 1.00 . A A .  38 GLU CG   1 1 
        5  3019 1 1 38 GLU H    H   -5.156  10.644   0.833 1.00 . A A .  38 GLU H    1 1 
        5  3020 1 1 38 GLU HA   H   -6.900  12.968   0.387 1.00 . A A .  38 GLU HA   1 1 
        5  3021 1 1 38 GLU HB2  H   -4.113  12.914   1.456 1.00 . A A .  38 GLU HB2  1 1 
        5  3022 1 1 38 GLU HB3  H   -4.580  14.242   0.403 1.00 . A A .  38 GLU HB3  1 1 
        5  3023 1 1 38 GLU HG2  H   -6.625  14.408   2.026 1.00 . A A .  38 GLU HG2  1 1 
        5  3024 1 1 38 GLU HG3  H   -5.549  13.553   3.130 1.00 . A A .  38 GLU HG3  1 1 
        5  3025 1 1 38 GLU N    N   -5.920  11.245   0.960 1.00 . A A .  38 GLU N    1 1 
        5  3026 1 1 38 GLU O    O   -4.513  11.787  -1.465 1.00 . A A .  38 GLU O    1 1 
        5  3027 1 1 38 GLU OE1  O   -5.141  16.508   1.895 1.00 . A A .  38 GLU OE1  1 1 
        5  3028 1 1 38 GLU OE2  O   -4.135  15.536   3.590 1.00 . A A .  38 GLU OE2  1 1 
        5  3029 1 1 39 SER C    C   -4.832  14.134  -3.764 1.00 . A A .  39 SER C    1 1 
        5  3030 1 1 39 SER CA   C   -5.935  13.136  -3.425 1.00 . A A .  39 SER CA   1 1 
        5  3031 1 1 39 SER CB   C   -7.198  13.462  -4.225 1.00 . A A .  39 SER CB   1 1 
        5  3032 1 1 39 SER H    H   -6.986  13.671  -1.666 1.00 . A A .  39 SER H    1 1 
        5  3033 1 1 39 SER HA   H   -5.600  12.144  -3.686 1.00 . A A .  39 SER HA   1 1 
        5  3034 1 1 39 SER HB2  H   -7.519  14.466  -3.992 1.00 . A A .  39 SER HB2  1 1 
        5  3035 1 1 39 SER HB3  H   -6.980  13.390  -5.281 1.00 . A A .  39 SER HB3  1 1 
        5  3036 1 1 39 SER HG   H   -8.961  13.040  -3.483 1.00 . A A .  39 SER HG   1 1 
        5  3037 1 1 39 SER N    N   -6.225  13.148  -1.995 1.00 . A A .  39 SER N    1 1 
        5  3038 1 1 39 SER O    O   -4.925  14.869  -4.746 1.00 . A A .  39 SER O    1 1 
        5  3039 1 1 39 SER OG   O   -8.247  12.563  -3.912 1.00 . A A .  39 SER OG   1 1 
        5  3040 1 1 40 GLY C    C   -2.159  14.997  -4.593 1.00 . A A .  40 GLY C    1 1 
        5  3041 1 1 40 GLY CA   C   -2.680  15.064  -3.172 1.00 . A A .  40 GLY CA   1 1 
        5  3042 1 1 40 GLY H    H   -3.767  13.544  -2.175 1.00 . A A .  40 GLY H    1 1 
        5  3043 1 1 40 GLY HA2  H   -3.010  16.071  -2.967 1.00 . A A .  40 GLY HA2  1 1 
        5  3044 1 1 40 GLY HA3  H   -1.877  14.814  -2.494 1.00 . A A .  40 GLY HA3  1 1 
        5  3045 1 1 40 GLY N    N   -3.787  14.153  -2.943 1.00 . A A .  40 GLY N    1 1 
        5  3046 1 1 40 GLY O    O   -2.653  14.233  -5.423 1.00 . A A .  40 GLY O    1 1 
        5  3047 1 1 41 PRO C    C    0.260  14.598  -6.548 1.00 . A A .  41 PRO C    1 1 
        5  3048 1 1 41 PRO CA   C   -0.527  15.863  -6.224 1.00 . A A .  41 PRO CA   1 1 
        5  3049 1 1 41 PRO CB   C    0.410  17.070  -6.140 1.00 . A A .  41 PRO CB   1 1 
        5  3050 1 1 41 PRO CD   C   -0.499  16.750  -3.953 1.00 . A A .  41 PRO CD   1 1 
        5  3051 1 1 41 PRO CG   C    0.731  17.201  -4.691 1.00 . A A .  41 PRO CG   1 1 
        5  3052 1 1 41 PRO HA   H   -1.267  16.032  -6.993 1.00 . A A .  41 PRO HA   1 1 
        5  3053 1 1 41 PRO HB2  H    1.298  16.881  -6.727 1.00 . A A .  41 PRO HB2  1 1 
        5  3054 1 1 41 PRO HB3  H   -0.094  17.949  -6.513 1.00 . A A .  41 PRO HB3  1 1 
        5  3055 1 1 41 PRO HD2  H   -0.227  16.251  -3.035 1.00 . A A .  41 PRO HD2  1 1 
        5  3056 1 1 41 PRO HD3  H   -1.146  17.591  -3.749 1.00 . A A .  41 PRO HD3  1 1 
        5  3057 1 1 41 PRO HG2  H    1.570  16.569  -4.442 1.00 . A A .  41 PRO HG2  1 1 
        5  3058 1 1 41 PRO HG3  H    0.952  18.231  -4.456 1.00 . A A .  41 PRO HG3  1 1 
        5  3059 1 1 41 PRO N    N   -1.138  15.813  -4.892 1.00 . A A .  41 PRO N    1 1 
        5  3060 1 1 41 PRO O    O    0.097  14.011  -7.617 1.00 . A A .  41 PRO O    1 1 
        5  3061 1 1 42 SER C    C    2.331  12.832  -7.271 1.00 . A A .  42 SER C    1 1 
        5  3062 1 1 42 SER CA   C    1.931  12.991  -5.807 1.00 . A A .  42 SER CA   1 1 
        5  3063 1 1 42 SER CB   C    1.172  11.749  -5.337 1.00 . A A .  42 SER CB   1 1 
        5  3064 1 1 42 SER H    H    1.201  14.696  -4.787 1.00 . A A .  42 SER H    1 1 
        5  3065 1 1 42 SER HA   H    2.825  13.103  -5.212 1.00 . A A .  42 SER HA   1 1 
        5  3066 1 1 42 SER HB2  H    0.838  11.898  -4.321 1.00 . A A .  42 SER HB2  1 1 
        5  3067 1 1 42 SER HB3  H    0.317  11.588  -5.977 1.00 . A A .  42 SER HB3  1 1 
        5  3068 1 1 42 SER HG   H    1.810  10.099  -6.179 1.00 . A A .  42 SER HG   1 1 
        5  3069 1 1 42 SER N    N    1.115  14.184  -5.618 1.00 . A A .  42 SER N    1 1 
        5  3070 1 1 42 SER O    O    2.279  11.734  -7.825 1.00 . A A .  42 SER O    1 1 
        5  3071 1 1 42 SER OG   O    1.999  10.599  -5.381 1.00 . A A .  42 SER OG   1 1 
        5  3072 1 1 43 SER C    C    4.656  13.921  -9.419 1.00 . A A .  43 SER C    1 1 
        5  3073 1 1 43 SER CA   C    3.135  13.923  -9.293 1.00 . A A .  43 SER CA   1 1 
        5  3074 1 1 43 SER CB   C    2.553  15.133 -10.027 1.00 . A A .  43 SER CB   1 1 
        5  3075 1 1 43 SER H    H    2.750  14.783  -7.397 1.00 . A A .  43 SER H    1 1 
        5  3076 1 1 43 SER HA   H    2.747  13.020  -9.741 1.00 . A A .  43 SER HA   1 1 
        5  3077 1 1 43 SER HB2  H    1.545  15.307  -9.684 1.00 . A A .  43 SER HB2  1 1 
        5  3078 1 1 43 SER HB3  H    3.160  16.002  -9.818 1.00 . A A .  43 SER HB3  1 1 
        5  3079 1 1 43 SER HG   H    1.838  15.453 -11.822 1.00 . A A .  43 SER HG   1 1 
        5  3080 1 1 43 SER N    N    2.730  13.937  -7.892 1.00 . A A .  43 SER N    1 1 
        5  3081 1 1 43 SER O    O    5.368  14.285  -8.484 1.00 . A A .  43 SER O    1 1 
        5  3082 1 1 43 SER OG   O    2.530  14.917 -11.427 1.00 . A A .  43 SER OG   1 1 
        5  3083 1 1 44 GLY C    C    7.043  14.525 -11.788 1.00 . A A .  44 GLY C    1 1 
        5  3084 1 1 44 GLY CA   C    6.579  13.463 -10.811 1.00 . A A .  44 GLY CA   1 1 
        5  3085 1 1 44 GLY H    H    4.531  13.227 -11.292 1.00 . A A .  44 GLY H    1 1 
        5  3086 1 1 44 GLY HA2  H    7.087  13.609  -9.869 1.00 . A A .  44 GLY HA2  1 1 
        5  3087 1 1 44 GLY HA3  H    6.841  12.491 -11.202 1.00 . A A .  44 GLY HA3  1 1 
        5  3088 1 1 44 GLY N    N    5.147  13.506 -10.583 1.00 . A A .  44 GLY N    1 1 
        5  3089 1 1 44 GLY O    O    6.581  15.662 -11.701 1.00 . A A .  44 GLY O    1 1 
        5  3090 2 2  1 ZN  ZN   ZN   3.468   5.185  -1.134 1.00 . B A . 201 ZN  ZN   1 1 
        6  3091 1 1  1 GLY C    C   24.918   9.848  -1.237 1.00 . A A .   1 GLY C    1 1 
        6  3092 1 1  1 GLY CA   C   23.722  10.694  -1.629 1.00 . A A .   1 GLY CA   1 1 
        6  3093 1 1  1 GLY H1   H   24.806  11.916  -2.976 1.00 . A A .   1 GLY H1   1 1 
        6  3094 1 1  1 GLY HA2  H   23.502  11.381  -0.825 1.00 . A A .   1 GLY HA2  1 1 
        6  3095 1 1  1 GLY HA3  H   22.871  10.045  -1.778 1.00 . A A .   1 GLY HA3  1 1 
        6  3096 1 1  1 GLY N    N   23.953  11.452  -2.845 1.00 . A A .   1 GLY N    1 1 
        6  3097 1 1  1 GLY O    O   26.036  10.353  -1.132 1.00 . A A .   1 GLY O    1 1 
        6  3098 1 1  2 SER C    C   25.698   6.365  -1.467 1.00 . A A .   2 SER C    1 1 
        6  3099 1 1  2 SER CA   C   25.749   7.641  -0.633 1.00 . A A .   2 SER CA   1 1 
        6  3100 1 1  2 SER CB   C   25.638   7.296   0.854 1.00 . A A .   2 SER CB   1 1 
        6  3101 1 1  2 SER H    H   23.770   8.215  -1.121 1.00 . A A .   2 SER H    1 1 
        6  3102 1 1  2 SER HA   H   26.692   8.136  -0.809 1.00 . A A .   2 SER HA   1 1 
        6  3103 1 1  2 SER HB2  H   26.525   6.766   1.165 1.00 . A A .   2 SER HB2  1 1 
        6  3104 1 1  2 SER HB3  H   25.545   8.208   1.426 1.00 . A A .   2 SER HB3  1 1 
        6  3105 1 1  2 SER HG   H   24.544   6.151   2.006 1.00 . A A .   2 SER HG   1 1 
        6  3106 1 1  2 SER N    N   24.683   8.558  -1.020 1.00 . A A .   2 SER N    1 1 
        6  3107 1 1  2 SER O    O   24.708   6.094  -2.147 1.00 . A A .   2 SER O    1 1 
        6  3108 1 1  2 SER OG   O   24.507   6.481   1.106 1.00 . A A .   2 SER OG   1 1 
        6  3109 1 1  3 SER C    C   25.531   3.583  -2.107 1.00 . A A .   3 SER C    1 1 
        6  3110 1 1  3 SER CA   C   26.854   4.340  -2.164 1.00 . A A .   3 SER CA   1 1 
        6  3111 1 1  3 SER CB   C   27.981   3.461  -1.617 1.00 . A A .   3 SER CB   1 1 
        6  3112 1 1  3 SER H    H   27.531   5.857  -0.851 1.00 . A A .   3 SER H    1 1 
        6  3113 1 1  3 SER HA   H   27.070   4.588  -3.193 1.00 . A A .   3 SER HA   1 1 
        6  3114 1 1  3 SER HB2  H   28.101   2.597  -2.253 1.00 . A A .   3 SER HB2  1 1 
        6  3115 1 1  3 SER HB3  H   28.901   4.028  -1.602 1.00 . A A .   3 SER HB3  1 1 
        6  3116 1 1  3 SER HG   H   27.588   3.784   0.274 1.00 . A A .   3 SER HG   1 1 
        6  3117 1 1  3 SER N    N   26.773   5.586  -1.411 1.00 . A A .   3 SER N    1 1 
        6  3118 1 1  3 SER O    O   24.779   3.697  -1.140 1.00 . A A .   3 SER O    1 1 
        6  3119 1 1  3 SER OG   O   27.693   3.023  -0.301 1.00 . A A .   3 SER OG   1 1 
        6  3120 1 1  4 GLY C    C   24.202   0.619  -2.725 1.00 . A A .   4 GLY C    1 1 
        6  3121 1 1  4 GLY CA   C   24.020   2.046  -3.203 1.00 . A A .   4 GLY CA   1 1 
        6  3122 1 1  4 GLY H    H   25.889   2.758  -3.896 1.00 . A A .   4 GLY H    1 1 
        6  3123 1 1  4 GLY HA2  H   23.282   2.531  -2.581 1.00 . A A .   4 GLY HA2  1 1 
        6  3124 1 1  4 GLY HA3  H   23.661   2.029  -4.222 1.00 . A A .   4 GLY HA3  1 1 
        6  3125 1 1  4 GLY N    N   25.252   2.810  -3.152 1.00 . A A .   4 GLY N    1 1 
        6  3126 1 1  4 GLY O    O   23.727  -0.322  -3.362 1.00 . A A .   4 GLY O    1 1 
        6  3127 1 1  5 SER C    C   24.615  -0.961   0.386 1.00 . A A .   5 SER C    1 1 
        6  3128 1 1  5 SER CA   C   25.143  -0.867  -1.042 1.00 . A A .   5 SER CA   1 1 
        6  3129 1 1  5 SER CB   C   26.641  -1.180  -1.066 1.00 . A A .   5 SER CB   1 1 
        6  3130 1 1  5 SER H    H   25.247   1.246  -1.140 1.00 . A A .   5 SER H    1 1 
        6  3131 1 1  5 SER HA   H   24.623  -1.589  -1.654 1.00 . A A .   5 SER HA   1 1 
        6  3132 1 1  5 SER HB2  H   26.804  -2.172  -0.672 1.00 . A A .   5 SER HB2  1 1 
        6  3133 1 1  5 SER HB3  H   26.999  -1.133  -2.084 1.00 . A A .   5 SER HB3  1 1 
        6  3134 1 1  5 SER HG   H   27.930  -0.725   0.338 1.00 . A A .   5 SER HG   1 1 
        6  3135 1 1  5 SER N    N   24.894   0.456  -1.602 1.00 . A A .   5 SER N    1 1 
        6  3136 1 1  5 SER O    O   25.280  -1.497   1.272 1.00 . A A .   5 SER O    1 1 
        6  3137 1 1  5 SER OG   O   27.368  -0.251  -0.281 1.00 . A A .   5 SER OG   1 1 
        6  3138 1 1  6 SER C    C   21.850  -1.645   2.062 1.00 . A A .   6 SER C    1 1 
        6  3139 1 1  6 SER CA   C   22.795  -0.456   1.923 1.00 . A A .   6 SER CA   1 1 
        6  3140 1 1  6 SER CB   C   22.035   0.847   2.173 1.00 . A A .   6 SER CB   1 1 
        6  3141 1 1  6 SER H    H   22.932  -0.022  -0.145 1.00 . A A .   6 SER H    1 1 
        6  3142 1 1  6 SER HA   H   23.583  -0.550   2.655 1.00 . A A .   6 SER HA   1 1 
        6  3143 1 1  6 SER HB2  H   21.341   1.017   1.364 1.00 . A A .   6 SER HB2  1 1 
        6  3144 1 1  6 SER HB3  H   21.491   0.770   3.104 1.00 . A A .   6 SER HB3  1 1 
        6  3145 1 1  6 SER HG   H   22.686   2.497   3.005 1.00 . A A .   6 SER HG   1 1 
        6  3146 1 1  6 SER N    N   23.413  -0.435   0.602 1.00 . A A .   6 SER N    1 1 
        6  3147 1 1  6 SER O    O   20.635  -1.507   1.921 1.00 . A A .   6 SER O    1 1 
        6  3148 1 1  6 SER OG   O   22.922   1.949   2.253 1.00 . A A .   6 SER OG   1 1 
        6  3149 1 1  7 GLY C    C   20.814  -4.339   1.245 1.00 . A A .   7 GLY C    1 1 
        6  3150 1 1  7 GLY CA   C   21.611  -4.012   2.493 1.00 . A A .   7 GLY CA   1 1 
        6  3151 1 1  7 GLY H    H   23.391  -2.866   2.441 1.00 . A A .   7 GLY H    1 1 
        6  3152 1 1  7 GLY HA2  H   22.261  -4.844   2.720 1.00 . A A .   7 GLY HA2  1 1 
        6  3153 1 1  7 GLY HA3  H   20.926  -3.868   3.316 1.00 . A A .   7 GLY HA3  1 1 
        6  3154 1 1  7 GLY N    N   22.417  -2.815   2.339 1.00 . A A .   7 GLY N    1 1 
        6  3155 1 1  7 GLY O    O   20.444  -3.445   0.483 1.00 . A A .   7 GLY O    1 1 
        6  3156 1 1  8 THR C    C   18.298  -5.863   0.073 1.00 . A A .   8 THR C    1 1 
        6  3157 1 1  8 THR CA   C   19.794  -6.067  -0.132 1.00 . A A .   8 THR CA   1 1 
        6  3158 1 1  8 THR CB   C   20.061  -7.552  -0.442 1.00 . A A .   8 THR CB   1 1 
        6  3159 1 1  8 THR CG2  C   21.492  -7.758  -0.915 1.00 . A A .   8 THR CG2  1 1 
        6  3160 1 1  8 THR H    H   20.871  -6.290   1.677 1.00 . A A .   8 THR H    1 1 
        6  3161 1 1  8 THR HA   H   20.115  -5.480  -0.980 1.00 . A A .   8 THR HA   1 1 
        6  3162 1 1  8 THR HB   H   19.389  -7.866  -1.228 1.00 . A A .   8 THR HB   1 1 
        6  3163 1 1  8 THR HG1  H   19.542  -7.780   1.447 1.00 . A A .   8 THR HG1  1 1 
        6  3164 1 1  8 THR HG21 H   22.076  -6.880  -0.685 1.00 . A A .   8 THR HG21 1 1 
        6  3165 1 1  8 THR HG22 H   21.498  -7.925  -1.982 1.00 . A A .   8 THR HG22 1 1 
        6  3166 1 1  8 THR HG23 H   21.917  -8.615  -0.414 1.00 . A A .   8 THR HG23 1 1 
        6  3167 1 1  8 THR N    N   20.550  -5.624   1.034 1.00 . A A .   8 THR N    1 1 
        6  3168 1 1  8 THR O    O   17.654  -6.614   0.806 1.00 . A A .   8 THR O    1 1 
        6  3169 1 1  8 THR OG1  O   19.819  -8.348   0.724 1.00 . A A .   8 THR OG1  1 1 
        6  3170 1 1  9 ARG C    C   15.652  -4.594  -1.835 1.00 . A A .   9 ARG C    1 1 
        6  3171 1 1  9 ARG CA   C   16.328  -4.540  -0.468 1.00 . A A .   9 ARG CA   1 1 
        6  3172 1 1  9 ARG CB   C   16.127  -3.159   0.158 1.00 . A A .   9 ARG CB   1 1 
        6  3173 1 1  9 ARG CD   C   16.463  -1.672   2.156 1.00 . A A .   9 ARG CD   1 1 
        6  3174 1 1  9 ARG CG   C   16.490  -3.100   1.633 1.00 . A A .   9 ARG CG   1 1 
        6  3175 1 1  9 ARG CZ   C   14.914   0.236   2.201 1.00 . A A .   9 ARG CZ   1 1 
        6  3176 1 1  9 ARG H    H   18.315  -4.280  -1.148 1.00 . A A .   9 ARG H    1 1 
        6  3177 1 1  9 ARG HA   H   15.879  -5.285   0.172 1.00 . A A .   9 ARG HA   1 1 
        6  3178 1 1  9 ARG HB2  H   16.740  -2.444  -0.370 1.00 . A A .   9 ARG HB2  1 1 
        6  3179 1 1  9 ARG HB3  H   15.090  -2.878   0.054 1.00 . A A .   9 ARG HB3  1 1 
        6  3180 1 1  9 ARG HD2  H   16.721  -1.683   3.205 1.00 . A A .   9 ARG HD2  1 1 
        6  3181 1 1  9 ARG HD3  H   17.193  -1.090   1.613 1.00 . A A .   9 ARG HD3  1 1 
        6  3182 1 1  9 ARG HE   H   14.407  -1.633   1.725 1.00 . A A .   9 ARG HE   1 1 
        6  3183 1 1  9 ARG HG2  H   15.780  -3.690   2.193 1.00 . A A .   9 ARG HG2  1 1 
        6  3184 1 1  9 ARG HG3  H   17.482  -3.505   1.766 1.00 . A A .   9 ARG HG3  1 1 
        6  3185 1 1  9 ARG HH11 H   16.823   0.679   2.694 1.00 . A A .   9 ARG HH11 1 1 
        6  3186 1 1  9 ARG HH12 H   15.720   2.015   2.721 1.00 . A A .   9 ARG HH12 1 1 
        6  3187 1 1  9 ARG HH21 H   12.946   0.118   1.757 1.00 . A A .   9 ARG HH21 1 1 
        6  3188 1 1  9 ARG HH22 H   13.515   1.695   2.189 1.00 . A A .   9 ARG HH22 1 1 
        6  3189 1 1  9 ARG N    N   17.750  -4.843  -0.579 1.00 . A A .   9 ARG N    1 1 
        6  3190 1 1  9 ARG NE   N   15.149  -1.055   1.997 1.00 . A A .   9 ARG NE   1 1 
        6  3191 1 1  9 ARG NH1  N   15.900   1.043   2.569 1.00 . A A .   9 ARG NH1  1 1 
        6  3192 1 1  9 ARG NH2  N   13.691   0.723   2.035 1.00 . A A .   9 ARG NH2  1 1 
        6  3193 1 1  9 ARG O    O   15.507  -3.574  -2.507 1.00 . A A .   9 ARG O    1 1 
        6  3194 1 1 10 GLU C    C   13.161  -6.504  -3.339 1.00 . A A .  10 GLU C    1 1 
        6  3195 1 1 10 GLU CA   C   14.582  -5.979  -3.526 1.00 . A A .  10 GLU CA   1 1 
        6  3196 1 1 10 GLU CB   C   15.384  -6.945  -4.400 1.00 . A A .  10 GLU CB   1 1 
        6  3197 1 1 10 GLU CD   C   15.689  -7.857  -6.735 1.00 . A A .  10 GLU CD   1 1 
        6  3198 1 1 10 GLU CG   C   15.239  -6.682  -5.889 1.00 . A A .  10 GLU CG   1 1 
        6  3199 1 1 10 GLU H    H   15.385  -6.568  -1.658 1.00 . A A .  10 GLU H    1 1 
        6  3200 1 1 10 GLU HA   H   14.535  -5.018  -4.017 1.00 . A A .  10 GLU HA   1 1 
        6  3201 1 1 10 GLU HB2  H   16.429  -6.863  -4.140 1.00 . A A .  10 GLU HB2  1 1 
        6  3202 1 1 10 GLU HB3  H   15.050  -7.953  -4.199 1.00 . A A .  10 GLU HB3  1 1 
        6  3203 1 1 10 GLU HG2  H   14.201  -6.479  -6.107 1.00 . A A .  10 GLU HG2  1 1 
        6  3204 1 1 10 GLU HG3  H   15.836  -5.821  -6.149 1.00 . A A .  10 GLU HG3  1 1 
        6  3205 1 1 10 GLU N    N   15.241  -5.792  -2.239 1.00 . A A .  10 GLU N    1 1 
        6  3206 1 1 10 GLU O    O   12.725  -7.413  -4.045 1.00 . A A .  10 GLU O    1 1 
        6  3207 1 1 10 GLU OE1  O   15.499  -9.011  -6.296 1.00 . A A .  10 GLU OE1  1 1 
        6  3208 1 1 10 GLU OE2  O   16.231  -7.624  -7.835 1.00 . A A .  10 GLU OE2  1 1 
        6  3209 1 1 11 LYS C    C   10.242  -6.369  -3.378 1.00 . A A .  11 LYS C    1 1 
        6  3210 1 1 11 LYS CA   C   11.073  -6.334  -2.099 1.00 . A A .  11 LYS CA   1 1 
        6  3211 1 1 11 LYS CB   C   10.432  -5.379  -1.089 1.00 . A A .  11 LYS CB   1 1 
        6  3212 1 1 11 LYS CD   C   10.513  -4.641   1.311 1.00 . A A .  11 LYS CD   1 1 
        6  3213 1 1 11 LYS CE   C   11.799  -3.830   1.315 1.00 . A A .  11 LYS CE   1 1 
        6  3214 1 1 11 LYS CG   C   10.601  -5.819   0.355 1.00 . A A .  11 LYS CG   1 1 
        6  3215 1 1 11 LYS H    H   12.847  -5.206  -1.851 1.00 . A A .  11 LYS H    1 1 
        6  3216 1 1 11 LYS HA   H   11.102  -7.326  -1.675 1.00 . A A .  11 LYS HA   1 1 
        6  3217 1 1 11 LYS HB2  H   10.881  -4.403  -1.201 1.00 . A A .  11 LYS HB2  1 1 
        6  3218 1 1 11 LYS HB3  H    9.375  -5.307  -1.301 1.00 . A A .  11 LYS HB3  1 1 
        6  3219 1 1 11 LYS HD2  H    9.698  -4.002   1.006 1.00 . A A .  11 LYS HD2  1 1 
        6  3220 1 1 11 LYS HD3  H   10.328  -5.012   2.309 1.00 . A A .  11 LYS HD3  1 1 
        6  3221 1 1 11 LYS HE2  H   12.588  -4.432   1.737 1.00 . A A .  11 LYS HE2  1 1 
        6  3222 1 1 11 LYS HE3  H   12.049  -3.571   0.296 1.00 . A A .  11 LYS HE3  1 1 
        6  3223 1 1 11 LYS HG2  H    9.822  -6.526   0.599 1.00 . A A .  11 LYS HG2  1 1 
        6  3224 1 1 11 LYS HG3  H   11.566  -6.291   0.467 1.00 . A A .  11 LYS HG3  1 1 
        6  3225 1 1 11 LYS HZ1  H   12.380  -1.887   1.816 1.00 . A A .  11 LYS HZ1  1 1 
        6  3226 1 1 11 LYS HZ2  H   11.793  -2.786   3.124 1.00 . A A .  11 LYS HZ2  1 1 
        6  3227 1 1 11 LYS HZ3  H   10.719  -2.167   1.974 1.00 . A A .  11 LYS HZ3  1 1 
        6  3228 1 1 11 LYS N    N   12.444  -5.926  -2.381 1.00 . A A .  11 LYS N    1 1 
        6  3229 1 1 11 LYS NZ   N   11.663  -2.580   2.113 1.00 . A A .  11 LYS NZ   1 1 
        6  3230 1 1 11 LYS O    O   10.361  -5.507  -4.248 1.00 . A A .  11 LYS O    1 1 
        6  3231 1 1 12 PRO C    C    7.417  -6.501  -4.734 1.00 . A A .  12 PRO C    1 1 
        6  3232 1 1 12 PRO CA   C    8.511  -7.561  -4.664 1.00 . A A .  12 PRO CA   1 1 
        6  3233 1 1 12 PRO CB   C    7.898  -8.948  -4.451 1.00 . A A .  12 PRO CB   1 1 
        6  3234 1 1 12 PRO CD   C    9.186  -8.455  -2.498 1.00 . A A .  12 PRO CD   1 1 
        6  3235 1 1 12 PRO CG   C    7.947  -9.161  -2.977 1.00 . A A .  12 PRO CG   1 1 
        6  3236 1 1 12 PRO HA   H    9.077  -7.553  -5.584 1.00 . A A .  12 PRO HA   1 1 
        6  3237 1 1 12 PRO HB2  H    6.882  -8.955  -4.819 1.00 . A A .  12 PRO HB2  1 1 
        6  3238 1 1 12 PRO HB3  H    8.483  -9.688  -4.977 1.00 . A A .  12 PRO HB3  1 1 
        6  3239 1 1 12 PRO HD2  H    9.026  -8.038  -1.515 1.00 . A A .  12 PRO HD2  1 1 
        6  3240 1 1 12 PRO HD3  H   10.027  -9.133  -2.490 1.00 . A A .  12 PRO HD3  1 1 
        6  3241 1 1 12 PRO HG2  H    7.070  -8.734  -2.515 1.00 . A A .  12 PRO HG2  1 1 
        6  3242 1 1 12 PRO HG3  H    8.011 -10.217  -2.762 1.00 . A A .  12 PRO HG3  1 1 
        6  3243 1 1 12 PRO N    N    9.380  -7.390  -3.496 1.00 . A A .  12 PRO N    1 1 
        6  3244 1 1 12 PRO O    O    7.178  -5.910  -5.788 1.00 . A A .  12 PRO O    1 1 
        6  3245 1 1 13 TYR C    C    6.255  -3.861  -3.475 1.00 . A A .  13 TYR C    1 1 
        6  3246 1 1 13 TYR CA   C    5.687  -5.275  -3.540 1.00 . A A .  13 TYR CA   1 1 
        6  3247 1 1 13 TYR CB   C    4.798  -5.536  -2.323 1.00 . A A .  13 TYR CB   1 1 
        6  3248 1 1 13 TYR CD1  C    2.969  -7.082  -3.125 1.00 . A A .  13 TYR CD1  1 1 
        6  3249 1 1 13 TYR CD2  C    4.595  -7.952  -1.615 1.00 . A A .  13 TYR CD2  1 1 
        6  3250 1 1 13 TYR CE1  C    2.335  -8.309  -3.156 1.00 . A A .  13 TYR CE1  1 1 
        6  3251 1 1 13 TYR CE2  C    3.968  -9.182  -1.641 1.00 . A A .  13 TYR CE2  1 1 
        6  3252 1 1 13 TYR CG   C    4.108  -6.881  -2.355 1.00 . A A .  13 TYR CG   1 1 
        6  3253 1 1 13 TYR CZ   C    2.838  -9.356  -2.413 1.00 . A A .  13 TYR CZ   1 1 
        6  3254 1 1 13 TYR H    H    6.993  -6.767  -2.799 1.00 . A A .  13 TYR H    1 1 
        6  3255 1 1 13 TYR HA   H    5.091  -5.371  -4.436 1.00 . A A .  13 TYR HA   1 1 
        6  3256 1 1 13 TYR HB2  H    5.401  -5.495  -1.429 1.00 . A A .  13 TYR HB2  1 1 
        6  3257 1 1 13 TYR HB3  H    4.035  -4.773  -2.273 1.00 . A A .  13 TYR HB3  1 1 
        6  3258 1 1 13 TYR HD1  H    2.578  -6.260  -3.707 1.00 . A A .  13 TYR HD1  1 1 
        6  3259 1 1 13 TYR HD2  H    5.480  -7.813  -1.011 1.00 . A A .  13 TYR HD2  1 1 
        6  3260 1 1 13 TYR HE1  H    1.450  -8.445  -3.761 1.00 . A A .  13 TYR HE1  1 1 
        6  3261 1 1 13 TYR HE2  H    4.362 -10.003  -1.059 1.00 . A A .  13 TYR HE2  1 1 
        6  3262 1 1 13 TYR HH   H    1.690 -10.692  -1.643 1.00 . A A .  13 TYR HH   1 1 
        6  3263 1 1 13 TYR N    N    6.757  -6.264  -3.606 1.00 . A A .  13 TYR N    1 1 
        6  3264 1 1 13 TYR O    O    7.217  -3.600  -2.752 1.00 . A A .  13 TYR O    1 1 
        6  3265 1 1 13 TYR OH   O    2.210 -10.580  -2.442 1.00 . A A .  13 TYR OH   1 1 
        6  3266 1 1 14 GLU C    C    4.912  -0.615  -4.400 1.00 . A A .  14 GLU C    1 1 
        6  3267 1 1 14 GLU CA   C    6.098  -1.564  -4.264 1.00 . A A .  14 GLU CA   1 1 
        6  3268 1 1 14 GLU CB   C    7.077  -1.344  -5.419 1.00 . A A .  14 GLU CB   1 1 
        6  3269 1 1 14 GLU CD   C    9.399  -2.023  -6.147 1.00 . A A .  14 GLU CD   1 1 
        6  3270 1 1 14 GLU CG   C    8.535  -1.493  -5.019 1.00 . A A .  14 GLU CG   1 1 
        6  3271 1 1 14 GLU H    H    4.891  -3.222  -4.790 1.00 . A A .  14 GLU H    1 1 
        6  3272 1 1 14 GLU HA   H    6.603  -1.359  -3.333 1.00 . A A .  14 GLU HA   1 1 
        6  3273 1 1 14 GLU HB2  H    6.864  -2.061  -6.198 1.00 . A A .  14 GLU HB2  1 1 
        6  3274 1 1 14 GLU HB3  H    6.934  -0.347  -5.811 1.00 . A A .  14 GLU HB3  1 1 
        6  3275 1 1 14 GLU HG2  H    8.914  -0.527  -4.719 1.00 . A A .  14 GLU HG2  1 1 
        6  3276 1 1 14 GLU HG3  H    8.598  -2.177  -4.185 1.00 . A A .  14 GLU HG3  1 1 
        6  3277 1 1 14 GLU N    N    5.653  -2.952  -4.235 1.00 . A A .  14 GLU N    1 1 
        6  3278 1 1 14 GLU O    O    3.955  -0.897  -5.122 1.00 . A A .  14 GLU O    1 1 
        6  3279 1 1 14 GLU OE1  O    9.174  -3.173  -6.577 1.00 . A A .  14 GLU OE1  1 1 
        6  3280 1 1 14 GLU OE2  O   10.300  -1.286  -6.600 1.00 . A A .  14 GLU OE2  1 1 
        6  3281 1 1 15 CYS C    C    3.933   2.272  -5.060 1.00 . A A .  15 CYS C    1 1 
        6  3282 1 1 15 CYS CA   C    3.914   1.505  -3.741 1.00 . A A .  15 CYS CA   1 1 
        6  3283 1 1 15 CYS CB   C    4.051   2.480  -2.570 1.00 . A A .  15 CYS CB   1 1 
        6  3284 1 1 15 CYS H    H    5.770   0.682  -3.143 1.00 . A A .  15 CYS H    1 1 
        6  3285 1 1 15 CYS HA   H    2.972   0.984  -3.656 1.00 . A A .  15 CYS HA   1 1 
        6  3286 1 1 15 CYS HB2  H    4.192   1.918  -1.658 1.00 . A A .  15 CYS HB2  1 1 
        6  3287 1 1 15 CYS HB3  H    4.912   3.111  -2.735 1.00 . A A .  15 CYS HB3  1 1 
        6  3288 1 1 15 CYS N    N    4.981   0.513  -3.701 1.00 . A A .  15 CYS N    1 1 
        6  3289 1 1 15 CYS O    O    4.946   2.865  -5.431 1.00 . A A .  15 CYS O    1 1 
        6  3290 1 1 15 CYS SG   S    2.606   3.564  -2.332 1.00 . A A .  15 CYS SG   1 1 
        6  3291 1 1 16 SER C    C    2.501   4.445  -6.838 1.00 . A A .  16 SER C    1 1 
        6  3292 1 1 16 SER CA   C    2.694   2.945  -7.044 1.00 . A A .  16 SER CA   1 1 
        6  3293 1 1 16 SER CB   C    1.528   2.376  -7.855 1.00 . A A .  16 SER CB   1 1 
        6  3294 1 1 16 SER H    H    2.032   1.764  -5.416 1.00 . A A .  16 SER H    1 1 
        6  3295 1 1 16 SER HA   H    3.612   2.784  -7.589 1.00 . A A .  16 SER HA   1 1 
        6  3296 1 1 16 SER HB2  H    1.681   1.319  -8.007 1.00 . A A .  16 SER HB2  1 1 
        6  3297 1 1 16 SER HB3  H    0.607   2.532  -7.312 1.00 . A A .  16 SER HB3  1 1 
        6  3298 1 1 16 SER HG   H    1.414   3.962  -8.999 1.00 . A A .  16 SER HG   1 1 
        6  3299 1 1 16 SER N    N    2.806   2.255  -5.765 1.00 . A A .  16 SER N    1 1 
        6  3300 1 1 16 SER O    O    2.287   5.190  -7.793 1.00 . A A .  16 SER O    1 1 
        6  3301 1 1 16 SER OG   O    1.427   3.010  -9.118 1.00 . A A .  16 SER OG   1 1 
        6  3302 1 1 17 GLU C    C    3.763   6.957  -5.022 1.00 . A A .  17 GLU C    1 1 
        6  3303 1 1 17 GLU CA   C    2.411   6.287  -5.251 1.00 . A A .  17 GLU CA   1 1 
        6  3304 1 1 17 GLU CB   C    1.537   6.440  -4.005 1.00 . A A .  17 GLU CB   1 1 
        6  3305 1 1 17 GLU CD   C   -0.828   6.549  -4.886 1.00 . A A .  17 GLU CD   1 1 
        6  3306 1 1 17 GLU CG   C    0.194   5.738  -4.113 1.00 . A A .  17 GLU CG   1 1 
        6  3307 1 1 17 GLU H    H    2.751   4.234  -4.865 1.00 . A A .  17 GLU H    1 1 
        6  3308 1 1 17 GLU HA   H    1.921   6.769  -6.084 1.00 . A A .  17 GLU HA   1 1 
        6  3309 1 1 17 GLU HB2  H    2.066   6.032  -3.156 1.00 . A A .  17 GLU HB2  1 1 
        6  3310 1 1 17 GLU HB3  H    1.356   7.491  -3.833 1.00 . A A .  17 GLU HB3  1 1 
        6  3311 1 1 17 GLU HG2  H    0.335   4.793  -4.616 1.00 . A A .  17 GLU HG2  1 1 
        6  3312 1 1 17 GLU HG3  H   -0.187   5.561  -3.118 1.00 . A A .  17 GLU HG3  1 1 
        6  3313 1 1 17 GLU N    N    2.578   4.878  -5.583 1.00 . A A .  17 GLU N    1 1 
        6  3314 1 1 17 GLU O    O    4.062   7.996  -5.612 1.00 . A A .  17 GLU O    1 1 
        6  3315 1 1 17 GLU OE1  O   -1.354   7.532  -4.322 1.00 . A A .  17 GLU OE1  1 1 
        6  3316 1 1 17 GLU OE2  O   -1.102   6.202  -6.054 1.00 . A A .  17 GLU OE2  1 1 
        6  3317 1 1 18 CYS C    C    6.994   5.963  -4.366 1.00 . A A .  18 CYS C    1 1 
        6  3318 1 1 18 CYS CA   C    5.897   6.890  -3.853 1.00 . A A .  18 CYS CA   1 1 
        6  3319 1 1 18 CYS CB   C    6.048   7.091  -2.344 1.00 . A A .  18 CYS CB   1 1 
        6  3320 1 1 18 CYS H    H    4.282   5.528  -3.723 1.00 . A A .  18 CYS H    1 1 
        6  3321 1 1 18 CYS HA   H    5.991   7.846  -4.346 1.00 . A A .  18 CYS HA   1 1 
        6  3322 1 1 18 CYS HB2  H    7.044   7.454  -2.135 1.00 . A A .  18 CYS HB2  1 1 
        6  3323 1 1 18 CYS HB3  H    5.327   7.823  -2.012 1.00 . A A .  18 CYS HB3  1 1 
        6  3324 1 1 18 CYS N    N    4.577   6.354  -4.162 1.00 . A A .  18 CYS N    1 1 
        6  3325 1 1 18 CYS O    O    8.015   6.417  -4.882 1.00 . A A .  18 CYS O    1 1 
        6  3326 1 1 18 CYS SG   S    5.795   5.577  -1.363 1.00 . A A .  18 CYS SG   1 1 
        6  3327 1 1 19 GLY C    C    8.264   2.809  -3.550 1.00 . A A .  19 GLY C    1 1 
        6  3328 1 1 19 GLY CA   C    7.754   3.688  -4.675 1.00 . A A .  19 GLY CA   1 1 
        6  3329 1 1 19 GLY H    H    5.944   4.355  -3.803 1.00 . A A .  19 GLY H    1 1 
        6  3330 1 1 19 GLY HA2  H    7.302   3.063  -5.430 1.00 . A A .  19 GLY HA2  1 1 
        6  3331 1 1 19 GLY HA3  H    8.591   4.214  -5.112 1.00 . A A .  19 GLY HA3  1 1 
        6  3332 1 1 19 GLY N    N    6.776   4.659  -4.221 1.00 . A A .  19 GLY N    1 1 
        6  3333 1 1 19 GLY O    O    9.218   2.052  -3.727 1.00 . A A .  19 GLY O    1 1 
        6  3334 1 1 20 LYS C    C    8.142   0.642  -1.593 1.00 . A A .  20 LYS C    1 1 
        6  3335 1 1 20 LYS CA   C    8.020   2.118  -1.228 1.00 . A A .  20 LYS CA   1 1 
        6  3336 1 1 20 LYS CB   C    7.004   2.293  -0.098 1.00 . A A .  20 LYS CB   1 1 
        6  3337 1 1 20 LYS CD   C    6.873   2.990   2.312 1.00 . A A .  20 LYS CD   1 1 
        6  3338 1 1 20 LYS CE   C    7.390   2.738   3.720 1.00 . A A .  20 LYS CE   1 1 
        6  3339 1 1 20 LYS CG   C    7.604   2.137   1.289 1.00 . A A .  20 LYS CG   1 1 
        6  3340 1 1 20 LYS H    H    6.872   3.531  -2.309 1.00 . A A .  20 LYS H    1 1 
        6  3341 1 1 20 LYS HA   H    8.982   2.475  -0.894 1.00 . A A .  20 LYS HA   1 1 
        6  3342 1 1 20 LYS HB2  H    6.568   3.278  -0.170 1.00 . A A .  20 LYS HB2  1 1 
        6  3343 1 1 20 LYS HB3  H    6.223   1.554  -0.214 1.00 . A A .  20 LYS HB3  1 1 
        6  3344 1 1 20 LYS HD2  H    7.018   4.032   2.069 1.00 . A A .  20 LYS HD2  1 1 
        6  3345 1 1 20 LYS HD3  H    5.818   2.755   2.277 1.00 . A A .  20 LYS HD3  1 1 
        6  3346 1 1 20 LYS HE2  H    8.463   2.848   3.720 1.00 . A A .  20 LYS HE2  1 1 
        6  3347 1 1 20 LYS HE3  H    6.953   3.467   4.386 1.00 . A A .  20 LYS HE3  1 1 
        6  3348 1 1 20 LYS HG2  H    7.536   1.101   1.586 1.00 . A A .  20 LYS HG2  1 1 
        6  3349 1 1 20 LYS HG3  H    8.641   2.438   1.258 1.00 . A A .  20 LYS HG3  1 1 
        6  3350 1 1 20 LYS HZ1  H    7.073   0.696   3.412 1.00 . A A .  20 LYS HZ1  1 1 
        6  3351 1 1 20 LYS HZ2  H    6.085   1.370   4.609 1.00 . A A .  20 LYS HZ2  1 1 
        6  3352 1 1 20 LYS HZ3  H    7.718   1.068   4.931 1.00 . A A .  20 LYS HZ3  1 1 
        6  3353 1 1 20 LYS N    N    7.627   2.910  -2.388 1.00 . A A .  20 LYS N    1 1 
        6  3354 1 1 20 LYS NZ   N    7.042   1.372   4.202 1.00 . A A .  20 LYS NZ   1 1 
        6  3355 1 1 20 LYS O    O    7.961   0.262  -2.750 1.00 . A A .  20 LYS O    1 1 
        6  3356 1 1 21 ALA C    C    7.993  -2.411   0.343 1.00 . A A .  21 ALA C    1 1 
        6  3357 1 1 21 ALA CA   C    8.590  -1.620  -0.815 1.00 . A A .  21 ALA CA   1 1 
        6  3358 1 1 21 ALA CB   C   10.056  -1.982  -1.004 1.00 . A A .  21 ALA CB   1 1 
        6  3359 1 1 21 ALA H    H    8.580   0.178   0.301 1.00 . A A .  21 ALA H    1 1 
        6  3360 1 1 21 ALA HA   H    8.062  -1.874  -1.723 1.00 . A A .  21 ALA HA   1 1 
        6  3361 1 1 21 ALA HB1  H   10.407  -2.522  -0.138 1.00 . A A .  21 ALA HB1  1 1 
        6  3362 1 1 21 ALA HB2  H   10.162  -2.602  -1.883 1.00 . A A .  21 ALA HB2  1 1 
        6  3363 1 1 21 ALA HB3  H   10.637  -1.080  -1.127 1.00 . A A .  21 ALA HB3  1 1 
        6  3364 1 1 21 ALA N    N    8.448  -0.185  -0.599 1.00 . A A .  21 ALA N    1 1 
        6  3365 1 1 21 ALA O    O    7.841  -1.893   1.449 1.00 . A A .  21 ALA O    1 1 
        6  3366 1 1 22 PHE C    C    7.316  -6.003   0.776 1.00 . A A .  22 PHE C    1 1 
        6  3367 1 1 22 PHE CA   C    7.071  -4.532   1.102 1.00 . A A .  22 PHE CA   1 1 
        6  3368 1 1 22 PHE CB   C    5.569  -4.269   1.226 1.00 . A A .  22 PHE CB   1 1 
        6  3369 1 1 22 PHE CD1  C    5.193  -1.923   0.418 1.00 . A A .  22 PHE CD1  1 1 
        6  3370 1 1 22 PHE CD2  C    4.955  -2.371   2.748 1.00 . A A .  22 PHE CD2  1 1 
        6  3371 1 1 22 PHE CE1  C    4.882  -0.594   0.637 1.00 . A A .  22 PHE CE1  1 1 
        6  3372 1 1 22 PHE CE2  C    4.643  -1.043   2.973 1.00 . A A .  22 PHE CE2  1 1 
        6  3373 1 1 22 PHE CG   C    5.232  -2.825   1.468 1.00 . A A .  22 PHE CG   1 1 
        6  3374 1 1 22 PHE CZ   C    4.608  -0.154   1.917 1.00 . A A .  22 PHE CZ   1 1 
        6  3375 1 1 22 PHE H    H    7.800  -4.026  -0.820 1.00 . A A .  22 PHE H    1 1 
        6  3376 1 1 22 PHE HA   H    7.547  -4.301   2.042 1.00 . A A .  22 PHE HA   1 1 
        6  3377 1 1 22 PHE HB2  H    5.081  -4.574   0.313 1.00 . A A .  22 PHE HB2  1 1 
        6  3378 1 1 22 PHE HB3  H    5.177  -4.846   2.049 1.00 . A A .  22 PHE HB3  1 1 
        6  3379 1 1 22 PHE HD1  H    5.407  -2.267  -0.585 1.00 . A A .  22 PHE HD1  1 1 
        6  3380 1 1 22 PHE HD2  H    4.983  -3.065   3.575 1.00 . A A .  22 PHE HD2  1 1 
        6  3381 1 1 22 PHE HE1  H    4.856   0.098  -0.191 1.00 . A A .  22 PHE HE1  1 1 
        6  3382 1 1 22 PHE HE2  H    4.430  -0.701   3.975 1.00 . A A .  22 PHE HE2  1 1 
        6  3383 1 1 22 PHE HZ   H    4.365   0.884   2.091 1.00 . A A .  22 PHE HZ   1 1 
        6  3384 1 1 22 PHE N    N    7.654  -3.669   0.081 1.00 . A A .  22 PHE N    1 1 
        6  3385 1 1 22 PHE O    O    7.701  -6.345  -0.342 1.00 . A A .  22 PHE O    1 1 
        6  3386 1 1 23 ILE C    C    5.967  -8.997   1.256 1.00 . A A .  23 ILE C    1 1 
        6  3387 1 1 23 ILE CA   C    7.284  -8.299   1.578 1.00 . A A .  23 ILE CA   1 1 
        6  3388 1 1 23 ILE CB   C    7.903  -8.947   2.830 1.00 . A A .  23 ILE CB   1 1 
        6  3389 1 1 23 ILE CD1  C    9.528  -8.388   4.709 1.00 . A A .  23 ILE CD1  1 1 
        6  3390 1 1 23 ILE CG1  C    9.162  -8.188   3.254 1.00 . A A .  23 ILE CG1  1 1 
        6  3391 1 1 23 ILE CG2  C    8.225 -10.411   2.566 1.00 . A A .  23 ILE CG2  1 1 
        6  3392 1 1 23 ILE H    H    6.783  -6.532   2.628 1.00 . A A .  23 ILE H    1 1 
        6  3393 1 1 23 ILE HA   H    7.965  -8.440   0.750 1.00 . A A .  23 ILE HA   1 1 
        6  3394 1 1 23 ILE HB   H    7.178  -8.901   3.628 1.00 . A A .  23 ILE HB   1 1 
        6  3395 1 1 23 ILE HD11 H   10.357  -7.744   4.963 1.00 . A A .  23 ILE HD11 1 1 
        6  3396 1 1 23 ILE HD12 H    8.679  -8.144   5.330 1.00 . A A .  23 ILE HD12 1 1 
        6  3397 1 1 23 ILE HD13 H    9.809  -9.418   4.871 1.00 . A A .  23 ILE HD13 1 1 
        6  3398 1 1 23 ILE HG12 H    9.995  -8.521   2.655 1.00 . A A .  23 ILE HG12 1 1 
        6  3399 1 1 23 ILE HG13 H    9.007  -7.131   3.093 1.00 . A A .  23 ILE HG13 1 1 
        6  3400 1 1 23 ILE HG21 H    7.382 -11.022   2.854 1.00 . A A .  23 ILE HG21 1 1 
        6  3401 1 1 23 ILE HG22 H    8.427 -10.550   1.515 1.00 . A A .  23 ILE HG22 1 1 
        6  3402 1 1 23 ILE HG23 H    9.091 -10.699   3.141 1.00 . A A .  23 ILE HG23 1 1 
        6  3403 1 1 23 ILE N    N    7.089  -6.866   1.760 1.00 . A A .  23 ILE N    1 1 
        6  3404 1 1 23 ILE O    O    5.939  -9.984   0.522 1.00 . A A .  23 ILE O    1 1 
        6  3405 1 1 24 ARG C    C    2.584  -7.987   1.074 1.00 . A A .  24 ARG C    1 1 
        6  3406 1 1 24 ARG CA   C    3.556  -9.048   1.583 1.00 . A A .  24 ARG CA   1 1 
        6  3407 1 1 24 ARG CB   C    3.018  -9.672   2.872 1.00 . A A .  24 ARG CB   1 1 
        6  3408 1 1 24 ARG CD   C    3.912 -12.004   2.598 1.00 . A A .  24 ARG CD   1 1 
        6  3409 1 1 24 ARG CG   C    3.922 -10.746   3.453 1.00 . A A .  24 ARG CG   1 1 
        6  3410 1 1 24 ARG CZ   C    2.997 -13.785   4.025 1.00 . A A .  24 ARG CZ   1 1 
        6  3411 1 1 24 ARG H    H    4.964  -7.688   2.387 1.00 . A A .  24 ARG H    1 1 
        6  3412 1 1 24 ARG HA   H    3.653  -9.819   0.834 1.00 . A A .  24 ARG HA   1 1 
        6  3413 1 1 24 ARG HB2  H    2.899  -8.894   3.612 1.00 . A A .  24 ARG HB2  1 1 
        6  3414 1 1 24 ARG HB3  H    2.054 -10.114   2.669 1.00 . A A .  24 ARG HB3  1 1 
        6  3415 1 1 24 ARG HD2  H    3.744 -11.723   1.569 1.00 . A A .  24 ARG HD2  1 1 
        6  3416 1 1 24 ARG HD3  H    4.872 -12.491   2.686 1.00 . A A .  24 ARG HD3  1 1 
        6  3417 1 1 24 ARG HE   H    2.028 -12.931   2.506 1.00 . A A .  24 ARG HE   1 1 
        6  3418 1 1 24 ARG HG2  H    4.932 -10.366   3.502 1.00 . A A .  24 ARG HG2  1 1 
        6  3419 1 1 24 ARG HG3  H    3.580 -10.994   4.446 1.00 . A A .  24 ARG HG3  1 1 
        6  3420 1 1 24 ARG HH11 H    4.873 -13.201   4.493 1.00 . A A .  24 ARG HH11 1 1 
        6  3421 1 1 24 ARG HH12 H    4.217 -14.455   5.491 1.00 . A A .  24 ARG HH12 1 1 
        6  3422 1 1 24 ARG HH21 H    1.152 -14.583   3.813 1.00 . A A .  24 ARG HH21 1 1 
        6  3423 1 1 24 ARG HH22 H    2.100 -15.241   5.103 1.00 . A A .  24 ARG HH22 1 1 
        6  3424 1 1 24 ARG N    N    4.877  -8.476   1.811 1.00 . A A .  24 ARG N    1 1 
        6  3425 1 1 24 ARG NE   N    2.867 -12.938   3.011 1.00 . A A .  24 ARG NE   1 1 
        6  3426 1 1 24 ARG NH1  N    4.122 -13.817   4.727 1.00 . A A .  24 ARG NH1  1 1 
        6  3427 1 1 24 ARG NH2  N    2.001 -14.604   4.339 1.00 . A A .  24 ARG NH2  1 1 
        6  3428 1 1 24 ARG O    O    2.541  -6.872   1.592 1.00 . A A .  24 ARG O    1 1 
        6  3429 1 1 25 ASN C    C    0.068  -6.683   0.569 1.00 . A A .  25 ASN C    1 1 
        6  3430 1 1 25 ASN CA   C    0.837  -7.422  -0.523 1.00 . A A .  25 ASN CA   1 1 
        6  3431 1 1 25 ASN CB   C   -0.139  -8.178  -1.427 1.00 . A A .  25 ASN CB   1 1 
        6  3432 1 1 25 ASN CG   C   -0.700  -7.303  -2.531 1.00 . A A .  25 ASN CG   1 1 
        6  3433 1 1 25 ASN H    H    1.888  -9.247  -0.314 1.00 . A A .  25 ASN H    1 1 
        6  3434 1 1 25 ASN HA   H    1.378  -6.700  -1.117 1.00 . A A .  25 ASN HA   1 1 
        6  3435 1 1 25 ASN HB2  H    0.374  -9.013  -1.882 1.00 . A A .  25 ASN HB2  1 1 
        6  3436 1 1 25 ASN HB3  H   -0.961  -8.546  -0.832 1.00 . A A .  25 ASN HB3  1 1 
        6  3437 1 1 25 ASN HD21 H   -0.806  -5.756  -1.286 1.00 . A A .  25 ASN HD21 1 1 
        6  3438 1 1 25 ASN HD22 H   -1.342  -5.458  -2.901 1.00 . A A .  25 ASN HD22 1 1 
        6  3439 1 1 25 ASN N    N    1.807  -8.343   0.057 1.00 . A A .  25 ASN N    1 1 
        6  3440 1 1 25 ASN ND2  N   -0.977  -6.045  -2.207 1.00 . A A .  25 ASN ND2  1 1 
        6  3441 1 1 25 ASN O    O    0.080  -5.454   0.627 1.00 . A A .  25 ASN O    1 1 
        6  3442 1 1 25 ASN OD1  O   -0.882  -7.753  -3.663 1.00 . A A .  25 ASN OD1  1 1 
        6  3443 1 1 26 SER C    C   -0.629  -5.692   3.156 1.00 . A A .  26 SER C    1 1 
        6  3444 1 1 26 SER CA   C   -1.376  -6.861   2.520 1.00 . A A .  26 SER CA   1 1 
        6  3445 1 1 26 SER CB   C   -1.683  -7.921   3.579 1.00 . A A .  26 SER CB   1 1 
        6  3446 1 1 26 SER H    H   -0.570  -8.417   1.333 1.00 . A A .  26 SER H    1 1 
        6  3447 1 1 26 SER HA   H   -2.305  -6.497   2.107 1.00 . A A .  26 SER HA   1 1 
        6  3448 1 1 26 SER HB2  H   -2.238  -8.728   3.127 1.00 . A A .  26 SER HB2  1 1 
        6  3449 1 1 26 SER HB3  H   -0.755  -8.303   3.981 1.00 . A A .  26 SER HB3  1 1 
        6  3450 1 1 26 SER HG   H   -3.307  -7.807   4.668 1.00 . A A .  26 SER HG   1 1 
        6  3451 1 1 26 SER N    N   -0.599  -7.442   1.432 1.00 . A A .  26 SER N    1 1 
        6  3452 1 1 26 SER O    O   -1.234  -4.689   3.535 1.00 . A A .  26 SER O    1 1 
        6  3453 1 1 26 SER OG   O   -2.450  -7.376   4.639 1.00 . A A .  26 SER OG   1 1 
        6  3454 1 1 27 GLN C    C    1.498  -3.525   3.000 1.00 . A A .  27 GLN C    1 1 
        6  3455 1 1 27 GLN CA   C    1.517  -4.785   3.858 1.00 . A A .  27 GLN CA   1 1 
        6  3456 1 1 27 GLN CB   C    2.955  -5.280   4.025 1.00 . A A .  27 GLN CB   1 1 
        6  3457 1 1 27 GLN CD   C    3.204  -6.363   6.295 1.00 . A A .  27 GLN CD   1 1 
        6  3458 1 1 27 GLN CG   C    3.063  -6.583   4.801 1.00 . A A .  27 GLN CG   1 1 
        6  3459 1 1 27 GLN H    H    1.111  -6.652   2.947 1.00 . A A .  27 GLN H    1 1 
        6  3460 1 1 27 GLN HA   H    1.112  -4.550   4.830 1.00 . A A .  27 GLN HA   1 1 
        6  3461 1 1 27 GLN HB2  H    3.387  -5.431   3.048 1.00 . A A .  27 GLN HB2  1 1 
        6  3462 1 1 27 GLN HB3  H    3.524  -4.526   4.549 1.00 . A A .  27 GLN HB3  1 1 
        6  3463 1 1 27 GLN HE21 H    4.615  -7.760   6.392 1.00 . A A .  27 GLN HE21 1 1 
        6  3464 1 1 27 GLN HE22 H    4.213  -6.993   7.887 1.00 . A A .  27 GLN HE22 1 1 
        6  3465 1 1 27 GLN HG2  H    2.174  -7.169   4.622 1.00 . A A .  27 GLN HG2  1 1 
        6  3466 1 1 27 GLN HG3  H    3.927  -7.126   4.449 1.00 . A A .  27 GLN HG3  1 1 
        6  3467 1 1 27 GLN N    N    0.688  -5.829   3.268 1.00 . A A .  27 GLN N    1 1 
        6  3468 1 1 27 GLN NE2  N    4.101  -7.115   6.922 1.00 . A A .  27 GLN NE2  1 1 
        6  3469 1 1 27 GLN O    O    1.330  -2.416   3.510 1.00 . A A .  27 GLN O    1 1 
        6  3470 1 1 27 GLN OE1  O    2.514  -5.526   6.878 1.00 . A A .  27 GLN OE1  1 1 
        6  3471 1 1 28 LEU C    C    0.332  -1.852   0.783 1.00 . A A .  28 LEU C    1 1 
        6  3472 1 1 28 LEU CA   C    1.674  -2.577   0.765 1.00 . A A .  28 LEU CA   1 1 
        6  3473 1 1 28 LEU CB   C    1.985  -3.062  -0.652 1.00 . A A .  28 LEU CB   1 1 
        6  3474 1 1 28 LEU CD1  C    2.387  -0.787  -1.625 1.00 . A A .  28 LEU CD1  1 1 
        6  3475 1 1 28 LEU CD2  C    1.934  -2.729  -3.136 1.00 . A A .  28 LEU CD2  1 1 
        6  3476 1 1 28 LEU CG   C    1.631  -2.098  -1.785 1.00 . A A .  28 LEU CG   1 1 
        6  3477 1 1 28 LEU H    H    1.800  -4.607   1.347 1.00 . A A .  28 LEU H    1 1 
        6  3478 1 1 28 LEU HA   H    2.445  -1.889   1.078 1.00 . A A .  28 LEU HA   1 1 
        6  3479 1 1 28 LEU HB2  H    3.043  -3.263  -0.707 1.00 . A A .  28 LEU HB2  1 1 
        6  3480 1 1 28 LEU HB3  H    1.437  -3.980  -0.814 1.00 . A A .  28 LEU HB3  1 1 
        6  3481 1 1 28 LEU HD11 H    2.934  -0.799  -0.695 1.00 . A A .  28 LEU HD11 1 1 
        6  3482 1 1 28 LEU HD12 H    1.685   0.034  -1.620 1.00 . A A .  28 LEU HD12 1 1 
        6  3483 1 1 28 LEU HD13 H    3.076  -0.666  -2.448 1.00 . A A .  28 LEU HD13 1 1 
        6  3484 1 1 28 LEU HD21 H    2.348  -1.982  -3.798 1.00 . A A .  28 LEU HD21 1 1 
        6  3485 1 1 28 LEU HD22 H    1.023  -3.122  -3.562 1.00 . A A .  28 LEU HD22 1 1 
        6  3486 1 1 28 LEU HD23 H    2.647  -3.531  -3.008 1.00 . A A .  28 LEU HD23 1 1 
        6  3487 1 1 28 LEU HG   H    0.573  -1.879  -1.746 1.00 . A A .  28 LEU HG   1 1 
        6  3488 1 1 28 LEU N    N    1.671  -3.701   1.695 1.00 . A A .  28 LEU N    1 1 
        6  3489 1 1 28 LEU O    O    0.272  -0.641   1.002 1.00 . A A .  28 LEU O    1 1 
        6  3490 1 1 29 ILE C    C   -2.281  -1.077   1.721 1.00 . A A .  29 ILE C    1 1 
        6  3491 1 1 29 ILE CA   C   -2.083  -2.029   0.547 1.00 . A A .  29 ILE CA   1 1 
        6  3492 1 1 29 ILE CB   C   -3.163  -3.126   0.602 1.00 . A A .  29 ILE CB   1 1 
        6  3493 1 1 29 ILE CD1  C   -3.706  -5.403  -0.395 1.00 . A A .  29 ILE CD1  1 1 
        6  3494 1 1 29 ILE CG1  C   -3.026  -4.067  -0.596 1.00 . A A .  29 ILE CG1  1 1 
        6  3495 1 1 29 ILE CG2  C   -4.550  -2.502   0.637 1.00 . A A .  29 ILE CG2  1 1 
        6  3496 1 1 29 ILE H    H   -0.630  -3.558   0.385 1.00 . A A .  29 ILE H    1 1 
        6  3497 1 1 29 ILE HA   H   -2.206  -1.477  -0.374 1.00 . A A .  29 ILE HA   1 1 
        6  3498 1 1 29 ILE HB   H   -3.025  -3.690   1.512 1.00 . A A .  29 ILE HB   1 1 
        6  3499 1 1 29 ILE HD11 H   -4.768  -5.295  -0.564 1.00 . A A .  29 ILE HD11 1 1 
        6  3500 1 1 29 ILE HD12 H   -3.304  -6.121  -1.094 1.00 . A A .  29 ILE HD12 1 1 
        6  3501 1 1 29 ILE HD13 H   -3.536  -5.747   0.614 1.00 . A A .  29 ILE HD13 1 1 
        6  3502 1 1 29 ILE HG12 H   -3.462  -3.600  -1.464 1.00 . A A .  29 ILE HG12 1 1 
        6  3503 1 1 29 ILE HG13 H   -1.977  -4.252  -0.781 1.00 . A A .  29 ILE HG13 1 1 
        6  3504 1 1 29 ILE HG21 H   -5.291  -3.280   0.751 1.00 . A A .  29 ILE HG21 1 1 
        6  3505 1 1 29 ILE HG22 H   -4.616  -1.819   1.470 1.00 . A A .  29 ILE HG22 1 1 
        6  3506 1 1 29 ILE HG23 H   -4.728  -1.967  -0.283 1.00 . A A .  29 ILE HG23 1 1 
        6  3507 1 1 29 ILE N    N   -0.742  -2.600   0.553 1.00 . A A .  29 ILE N    1 1 
        6  3508 1 1 29 ILE O    O   -2.709   0.064   1.545 1.00 . A A .  29 ILE O    1 1 
        6  3509 1 1 30 VAL C    C   -1.408   0.603   3.968 1.00 . A A .  30 VAL C    1 1 
        6  3510 1 1 30 VAL CA   C   -2.105  -0.743   4.126 1.00 . A A .  30 VAL CA   1 1 
        6  3511 1 1 30 VAL CB   C   -1.528  -1.466   5.358 1.00 . A A .  30 VAL CB   1 1 
        6  3512 1 1 30 VAL CG1  C   -1.629  -0.582   6.592 1.00 . A A .  30 VAL CG1  1 1 
        6  3513 1 1 30 VAL CG2  C   -2.241  -2.791   5.581 1.00 . A A .  30 VAL CG2  1 1 
        6  3514 1 1 30 VAL H    H   -1.629  -2.470   2.999 1.00 . A A .  30 VAL H    1 1 
        6  3515 1 1 30 VAL HA   H   -3.159  -0.575   4.295 1.00 . A A .  30 VAL HA   1 1 
        6  3516 1 1 30 VAL HB   H   -0.483  -1.670   5.174 1.00 . A A .  30 VAL HB   1 1 
        6  3517 1 1 30 VAL HG11 H   -1.772   0.445   6.288 1.00 . A A .  30 VAL HG11 1 1 
        6  3518 1 1 30 VAL HG12 H   -2.467  -0.900   7.195 1.00 . A A .  30 VAL HG12 1 1 
        6  3519 1 1 30 VAL HG13 H   -0.719  -0.663   7.168 1.00 . A A .  30 VAL HG13 1 1 
        6  3520 1 1 30 VAL HG21 H   -2.621  -2.830   6.591 1.00 . A A .  30 VAL HG21 1 1 
        6  3521 1 1 30 VAL HG22 H   -3.061  -2.879   4.883 1.00 . A A .  30 VAL HG22 1 1 
        6  3522 1 1 30 VAL HG23 H   -1.547  -3.604   5.426 1.00 . A A .  30 VAL HG23 1 1 
        6  3523 1 1 30 VAL N    N   -1.965  -1.553   2.922 1.00 . A A .  30 VAL N    1 1 
        6  3524 1 1 30 VAL O    O   -1.912   1.633   4.418 1.00 . A A .  30 VAL O    1 1 
        6  3525 1 1 31 HIS C    C   -0.120   2.667   2.017 1.00 . A A .  31 HIS C    1 1 
        6  3526 1 1 31 HIS CA   C    0.522   1.810   3.104 1.00 . A A .  31 HIS CA   1 1 
        6  3527 1 1 31 HIS CB   C    1.962   1.471   2.718 1.00 . A A .  31 HIS CB   1 1 
        6  3528 1 1 31 HIS CD2  C    3.064   3.144   1.071 1.00 . A A .  31 HIS CD2  1 1 
        6  3529 1 1 31 HIS CE1  C    4.010   4.466   2.542 1.00 . A A .  31 HIS CE1  1 1 
        6  3530 1 1 31 HIS CG   C    2.767   2.663   2.301 1.00 . A A .  31 HIS CG   1 1 
        6  3531 1 1 31 HIS H    H    0.105  -0.262   2.988 1.00 . A A .  31 HIS H    1 1 
        6  3532 1 1 31 HIS HA   H    0.528   2.369   4.028 1.00 . A A .  31 HIS HA   1 1 
        6  3533 1 1 31 HIS HB2  H    2.457   1.017   3.564 1.00 . A A .  31 HIS HB2  1 1 
        6  3534 1 1 31 HIS HB3  H    1.952   0.771   1.895 1.00 . A A .  31 HIS HB3  1 1 
        6  3535 1 1 31 HIS HD1  H    3.345   3.430   4.176 1.00 . A A .  31 HIS HD1  1 1 
        6  3536 1 1 31 HIS HD2  H    2.750   2.725   0.125 1.00 . A A .  31 HIS HD2  1 1 
        6  3537 1 1 31 HIS HE1  H    4.575   5.272   2.985 1.00 . A A .  31 HIS HE1  1 1 
        6  3538 1 1 31 HIS N    N   -0.245   0.589   3.324 1.00 . A A .  31 HIS N    1 1 
        6  3539 1 1 31 HIS ND1  N    3.376   3.512   3.200 1.00 . A A .  31 HIS ND1  1 1 
        6  3540 1 1 31 HIS NE2  N    3.837   4.265   1.248 1.00 . A A .  31 HIS NE2  1 1 
        6  3541 1 1 31 HIS O    O    0.128   3.870   1.935 1.00 . A A .  31 HIS O    1 1 
        6  3542 1 1 32 GLN C    C   -2.888   3.426   0.605 1.00 . A A .  32 GLN C    1 1 
        6  3543 1 1 32 GLN CA   C   -1.620   2.744   0.102 1.00 . A A .  32 GLN CA   1 1 
        6  3544 1 1 32 GLN CB   C   -1.962   1.775  -1.030 1.00 . A A .  32 GLN CB   1 1 
        6  3545 1 1 32 GLN CD   C   -1.096   0.583  -3.083 1.00 . A A .  32 GLN CD   1 1 
        6  3546 1 1 32 GLN CG   C   -0.743   1.239  -1.763 1.00 . A A .  32 GLN CG   1 1 
        6  3547 1 1 32 GLN H    H   -1.101   1.079   1.302 1.00 . A A .  32 GLN H    1 1 
        6  3548 1 1 32 GLN HA   H   -0.945   3.498  -0.273 1.00 . A A .  32 GLN HA   1 1 
        6  3549 1 1 32 GLN HB2  H   -2.506   0.937  -0.620 1.00 . A A .  32 GLN HB2  1 1 
        6  3550 1 1 32 GLN HB3  H   -2.590   2.285  -1.747 1.00 . A A .  32 GLN HB3  1 1 
        6  3551 1 1 32 GLN HE21 H    0.167   1.780  -4.044 1.00 . A A .  32 GLN HE21 1 1 
        6  3552 1 1 32 GLN HE22 H   -0.685   0.643  -5.026 1.00 . A A .  32 GLN HE22 1 1 
        6  3553 1 1 32 GLN HG2  H   -0.066   2.059  -1.956 1.00 . A A .  32 GLN HG2  1 1 
        6  3554 1 1 32 GLN HG3  H   -0.253   0.510  -1.134 1.00 . A A .  32 GLN HG3  1 1 
        6  3555 1 1 32 GLN N    N   -0.944   2.039   1.185 1.00 . A A .  32 GLN N    1 1 
        6  3556 1 1 32 GLN NE2  N   -0.476   1.049  -4.160 1.00 . A A .  32 GLN NE2  1 1 
        6  3557 1 1 32 GLN O    O   -3.346   4.411   0.025 1.00 . A A .  32 GLN O    1 1 
        6  3558 1 1 32 GLN OE1  O   -1.917  -0.333  -3.133 1.00 . A A .  32 GLN OE1  1 1 
        6  3559 1 1 33 ARG C    C   -4.506   4.945   2.539 1.00 . A A .  33 ARG C    1 1 
        6  3560 1 1 33 ARG CA   C   -4.667   3.452   2.265 1.00 . A A .  33 ARG CA   1 1 
        6  3561 1 1 33 ARG CB   C   -5.021   2.721   3.561 1.00 . A A .  33 ARG CB   1 1 
        6  3562 1 1 33 ARG CD   C   -6.103   0.691   4.574 1.00 . A A .  33 ARG CD   1 1 
        6  3563 1 1 33 ARG CG   C   -5.396   1.262   3.355 1.00 . A A .  33 ARG CG   1 1 
        6  3564 1 1 33 ARG CZ   C   -8.392   0.727   5.470 1.00 . A A .  33 ARG CZ   1 1 
        6  3565 1 1 33 ARG H    H   -3.039   2.110   2.103 1.00 . A A .  33 ARG H    1 1 
        6  3566 1 1 33 ARG HA   H   -5.468   3.313   1.554 1.00 . A A .  33 ARG HA   1 1 
        6  3567 1 1 33 ARG HB2  H   -4.172   2.761   4.227 1.00 . A A .  33 ARG HB2  1 1 
        6  3568 1 1 33 ARG HB3  H   -5.857   3.222   4.026 1.00 . A A .  33 ARG HB3  1 1 
        6  3569 1 1 33 ARG HD2  H   -6.233  -0.372   4.433 1.00 . A A .  33 ARG HD2  1 1 
        6  3570 1 1 33 ARG HD3  H   -5.488   0.865   5.444 1.00 . A A .  33 ARG HD3  1 1 
        6  3571 1 1 33 ARG HE   H   -7.564   2.191   4.399 1.00 . A A .  33 ARG HE   1 1 
        6  3572 1 1 33 ARG HG2  H   -6.054   1.186   2.502 1.00 . A A .  33 ARG HG2  1 1 
        6  3573 1 1 33 ARG HG3  H   -4.497   0.693   3.171 1.00 . A A .  33 ARG HG3  1 1 
        6  3574 1 1 33 ARG HH11 H   -7.339  -0.944   5.895 1.00 . A A .  33 ARG HH11 1 1 
        6  3575 1 1 33 ARG HH12 H   -8.954  -0.905   6.521 1.00 . A A .  33 ARG HH12 1 1 
        6  3576 1 1 33 ARG HH21 H   -9.692   2.254   5.217 1.00 . A A .  33 ARG HH21 1 1 
        6  3577 1 1 33 ARG HH22 H  -10.292   0.913   6.134 1.00 . A A .  33 ARG HH22 1 1 
        6  3578 1 1 33 ARG N    N   -3.451   2.896   1.686 1.00 . A A .  33 ARG N    1 1 
        6  3579 1 1 33 ARG NE   N   -7.411   1.305   4.786 1.00 . A A .  33 ARG NE   1 1 
        6  3580 1 1 33 ARG NH1  N   -8.214  -0.473   6.005 1.00 . A A .  33 ARG NH1  1 1 
        6  3581 1 1 33 ARG NH2  N   -9.554   1.349   5.619 1.00 . A A .  33 ARG NH2  1 1 
        6  3582 1 1 33 ARG O    O   -5.419   5.734   2.297 1.00 . A A .  33 ARG O    1 1 
        6  3583 1 1 34 THR C    C   -2.961   7.557   2.081 1.00 . A A .  34 THR C    1 1 
        6  3584 1 1 34 THR CA   C   -3.055   6.722   3.353 1.00 . A A .  34 THR CA   1 1 
        6  3585 1 1 34 THR CB   C   -1.745   6.869   4.149 1.00 . A A .  34 THR CB   1 1 
        6  3586 1 1 34 THR CG2  C   -0.545   6.507   3.286 1.00 . A A .  34 THR CG2  1 1 
        6  3587 1 1 34 THR H    H   -2.648   4.649   3.216 1.00 . A A .  34 THR H    1 1 
        6  3588 1 1 34 THR HA   H   -3.865   7.099   3.961 1.00 . A A .  34 THR HA   1 1 
        6  3589 1 1 34 THR HB   H   -1.777   6.196   4.994 1.00 . A A .  34 THR HB   1 1 
        6  3590 1 1 34 THR HG1  H   -2.297   8.394   5.270 1.00 . A A .  34 THR HG1  1 1 
        6  3591 1 1 34 THR HG21 H    0.251   6.138   3.915 1.00 . A A .  34 THR HG21 1 1 
        6  3592 1 1 34 THR HG22 H   -0.206   7.384   2.755 1.00 . A A .  34 THR HG22 1 1 
        6  3593 1 1 34 THR HG23 H   -0.828   5.743   2.577 1.00 . A A .  34 THR HG23 1 1 
        6  3594 1 1 34 THR N    N   -3.337   5.325   3.045 1.00 . A A .  34 THR N    1 1 
        6  3595 1 1 34 THR O    O   -3.418   8.700   2.042 1.00 . A A .  34 THR O    1 1 
        6  3596 1 1 34 THR OG1  O   -1.609   8.212   4.625 1.00 . A A .  34 THR OG1  1 1 
        6  3597 1 1 35 HIS C    C   -3.572   7.944  -0.869 1.00 . A A .  35 HIS C    1 1 
        6  3598 1 1 35 HIS CA   C   -2.212   7.671  -0.233 1.00 . A A .  35 HIS CA   1 1 
        6  3599 1 1 35 HIS CB   C   -1.347   6.845  -1.185 1.00 . A A .  35 HIS CB   1 1 
        6  3600 1 1 35 HIS CD2  C    1.124   6.465  -0.495 1.00 . A A .  35 HIS CD2  1 1 
        6  3601 1 1 35 HIS CE1  C    1.985   8.279  -1.374 1.00 . A A .  35 HIS CE1  1 1 
        6  3602 1 1 35 HIS CG   C    0.116   7.150  -1.082 1.00 . A A .  35 HIS CG   1 1 
        6  3603 1 1 35 HIS H    H   -2.022   6.067   1.135 1.00 . A A .  35 HIS H    1 1 
        6  3604 1 1 35 HIS HA   H   -1.723   8.614  -0.042 1.00 . A A .  35 HIS HA   1 1 
        6  3605 1 1 35 HIS HB2  H   -1.483   5.796  -0.965 1.00 . A A .  35 HIS HB2  1 1 
        6  3606 1 1 35 HIS HB3  H   -1.657   7.038  -2.202 1.00 . A A .  35 HIS HB3  1 1 
        6  3607 1 1 35 HIS HD1  H    0.214   8.983  -2.117 1.00 . A A .  35 HIS HD1  1 1 
        6  3608 1 1 35 HIS HD2  H    1.040   5.524   0.031 1.00 . A A .  35 HIS HD2  1 1 
        6  3609 1 1 35 HIS HE1  H    2.689   9.039  -1.678 1.00 . A A .  35 HIS HE1  1 1 
        6  3610 1 1 35 HIS N    N   -2.366   6.980   1.042 1.00 . A A .  35 HIS N    1 1 
        6  3611 1 1 35 HIS ND1  N    0.688   8.282  -1.623 1.00 . A A .  35 HIS ND1  1 1 
        6  3612 1 1 35 HIS NE2  N    2.276   7.187  -0.690 1.00 . A A .  35 HIS NE2  1 1 
        6  3613 1 1 35 HIS O    O   -3.782   8.991  -1.482 1.00 . A A .  35 HIS O    1 1 
        6  3614 1 1 36 SER C    C   -6.708   8.003  -0.393 1.00 . A A .  36 SER C    1 1 
        6  3615 1 1 36 SER CA   C   -5.828   7.132  -1.285 1.00 . A A .  36 SER CA   1 1 
        6  3616 1 1 36 SER CB   C   -6.471   5.756  -1.467 1.00 . A A .  36 SER CB   1 1 
        6  3617 1 1 36 SER H    H   -4.263   6.184  -0.221 1.00 . A A .  36 SER H    1 1 
        6  3618 1 1 36 SER HA   H   -5.734   7.606  -2.250 1.00 . A A .  36 SER HA   1 1 
        6  3619 1 1 36 SER HB2  H   -6.097   5.084  -0.709 1.00 . A A .  36 SER HB2  1 1 
        6  3620 1 1 36 SER HB3  H   -7.543   5.846  -1.370 1.00 . A A .  36 SER HB3  1 1 
        6  3621 1 1 36 SER HG   H   -5.290   4.836  -2.730 1.00 . A A .  36 SER HG   1 1 
        6  3622 1 1 36 SER N    N   -4.491   6.996  -0.720 1.00 . A A .  36 SER N    1 1 
        6  3623 1 1 36 SER O    O   -7.383   7.505   0.508 1.00 . A A .  36 SER O    1 1 
        6  3624 1 1 36 SER OG   O   -6.171   5.217  -2.743 1.00 . A A .  36 SER OG   1 1 
        6  3625 1 1 37 GLY C    C   -7.319  11.668  -0.301 1.00 . A A .  37 GLY C    1 1 
        6  3626 1 1 37 GLY CA   C   -7.495  10.227   0.136 1.00 . A A .  37 GLY CA   1 1 
        6  3627 1 1 37 GLY H    H   -6.137   9.647  -1.382 1.00 . A A .  37 GLY H    1 1 
        6  3628 1 1 37 GLY HA2  H   -8.536   9.956   0.039 1.00 . A A .  37 GLY HA2  1 1 
        6  3629 1 1 37 GLY HA3  H   -7.206  10.140   1.174 1.00 . A A .  37 GLY HA3  1 1 
        6  3630 1 1 37 GLY N    N   -6.695   9.307  -0.651 1.00 . A A .  37 GLY N    1 1 
        6  3631 1 1 37 GLY O    O   -8.294  12.409  -0.421 1.00 . A A .  37 GLY O    1 1 
        6  3632 1 1 38 GLU C    C   -5.972  13.586  -2.465 1.00 . A A .  38 GLU C    1 1 
        6  3633 1 1 38 GLU CA   C   -5.774  13.428  -0.960 1.00 . A A .  38 GLU CA   1 1 
        6  3634 1 1 38 GLU CB   C   -4.339  13.801  -0.582 1.00 . A A .  38 GLU CB   1 1 
        6  3635 1 1 38 GLU CD   C   -1.961  12.952  -0.501 1.00 . A A .  38 GLU CD   1 1 
        6  3636 1 1 38 GLU CG   C   -3.289  12.915  -1.232 1.00 . A A .  38 GLU CG   1 1 
        6  3637 1 1 38 GLU H    H   -5.338  11.428  -0.423 1.00 . A A .  38 GLU H    1 1 
        6  3638 1 1 38 GLU HA   H   -6.455  14.092  -0.448 1.00 . A A .  38 GLU HA   1 1 
        6  3639 1 1 38 GLU HB2  H   -4.154  14.822  -0.880 1.00 . A A .  38 GLU HB2  1 1 
        6  3640 1 1 38 GLU HB3  H   -4.231  13.723   0.490 1.00 . A A .  38 GLU HB3  1 1 
        6  3641 1 1 38 GLU HG2  H   -3.650  11.897  -1.240 1.00 . A A .  38 GLU HG2  1 1 
        6  3642 1 1 38 GLU HG3  H   -3.134  13.249  -2.248 1.00 . A A .  38 GLU HG3  1 1 
        6  3643 1 1 38 GLU N    N   -6.073  12.066  -0.537 1.00 . A A .  38 GLU N    1 1 
        6  3644 1 1 38 GLU O    O   -6.570  14.559  -2.924 1.00 . A A .  38 GLU O    1 1 
        6  3645 1 1 38 GLU OE1  O   -1.830  12.258   0.529 1.00 . A A .  38 GLU OE1  1 1 
        6  3646 1 1 38 GLU OE2  O   -1.052  13.676  -0.960 1.00 . A A .  38 GLU OE2  1 1 
        6  3647 1 1 39 SER C    C   -6.835  11.917  -5.142 1.00 . A A .  39 SER C    1 1 
        6  3648 1 1 39 SER CA   C   -5.582  12.656  -4.680 1.00 . A A .  39 SER CA   1 1 
        6  3649 1 1 39 SER CB   C   -4.343  12.036  -5.327 1.00 . A A .  39 SER CB   1 1 
        6  3650 1 1 39 SER H    H   -4.999  11.872  -2.802 1.00 . A A .  39 SER H    1 1 
        6  3651 1 1 39 SER HA   H   -5.657  13.690  -4.983 1.00 . A A .  39 SER HA   1 1 
        6  3652 1 1 39 SER HB2  H   -4.186  11.046  -4.925 1.00 . A A .  39 SER HB2  1 1 
        6  3653 1 1 39 SER HB3  H   -4.492  11.970  -6.395 1.00 . A A .  39 SER HB3  1 1 
        6  3654 1 1 39 SER HG   H   -3.404  13.749  -5.181 1.00 . A A .  39 SER HG   1 1 
        6  3655 1 1 39 SER N    N   -5.465  12.623  -3.227 1.00 . A A .  39 SER N    1 1 
        6  3656 1 1 39 SER O    O   -6.944  10.701  -4.986 1.00 . A A .  39 SER O    1 1 
        6  3657 1 1 39 SER OG   O   -3.189  12.819  -5.074 1.00 . A A .  39 SER OG   1 1 
        6  3658 1 1 40 GLY C    C   -9.932  13.070  -6.843 1.00 . A A .  40 GLY C    1 1 
        6  3659 1 1 40 GLY CA   C   -9.011  12.061  -6.187 1.00 . A A .  40 GLY CA   1 1 
        6  3660 1 1 40 GLY H    H   -7.636  13.626  -5.809 1.00 . A A .  40 GLY H    1 1 
        6  3661 1 1 40 GLY HA2  H   -8.769  11.289  -6.903 1.00 . A A .  40 GLY HA2  1 1 
        6  3662 1 1 40 GLY HA3  H   -9.525  11.612  -5.349 1.00 . A A .  40 GLY HA3  1 1 
        6  3663 1 1 40 GLY N    N   -7.778  12.661  -5.711 1.00 . A A .  40 GLY N    1 1 
        6  3664 1 1 40 GLY O    O   -9.488  14.054  -7.435 1.00 . A A .  40 GLY O    1 1 
        6  3665 1 1 41 PRO C    C  -12.351  15.051  -6.600 1.00 . A A .  41 PRO C    1 1 
        6  3666 1 1 41 PRO CA   C  -12.261  13.713  -7.326 1.00 . A A .  41 PRO CA   1 1 
        6  3667 1 1 41 PRO CB   C  -13.561  12.923  -7.156 1.00 . A A .  41 PRO CB   1 1 
        6  3668 1 1 41 PRO CD   C  -11.847  11.675  -6.051 1.00 . A A .  41 PRO CD   1 1 
        6  3669 1 1 41 PRO CG   C  -13.309  12.024  -5.995 1.00 . A A .  41 PRO CG   1 1 
        6  3670 1 1 41 PRO HA   H  -12.078  13.886  -8.377 1.00 . A A .  41 PRO HA   1 1 
        6  3671 1 1 41 PRO HB2  H  -14.376  13.605  -6.959 1.00 . A A .  41 PRO HB2  1 1 
        6  3672 1 1 41 PRO HB3  H  -13.765  12.360  -8.054 1.00 . A A .  41 PRO HB3  1 1 
        6  3673 1 1 41 PRO HD2  H  -11.445  11.572  -5.054 1.00 . A A .  41 PRO HD2  1 1 
        6  3674 1 1 41 PRO HD3  H  -11.697  10.767  -6.616 1.00 . A A .  41 PRO HD3  1 1 
        6  3675 1 1 41 PRO HG2  H  -13.536  12.541  -5.074 1.00 . A A .  41 PRO HG2  1 1 
        6  3676 1 1 41 PRO HG3  H  -13.910  11.132  -6.084 1.00 . A A .  41 PRO HG3  1 1 
        6  3677 1 1 41 PRO N    N  -11.247  12.829  -6.743 1.00 . A A .  41 PRO N    1 1 
        6  3678 1 1 41 PRO O    O  -13.115  15.931  -6.994 1.00 . A A .  41 PRO O    1 1 
        6  3679 1 1 42 SER C    C  -11.055  17.600  -5.590 1.00 . A A .  42 SER C    1 1 
        6  3680 1 1 42 SER CA   C  -11.559  16.426  -4.755 1.00 . A A .  42 SER CA   1 1 
        6  3681 1 1 42 SER CB   C  -10.684  16.259  -3.511 1.00 . A A .  42 SER CB   1 1 
        6  3682 1 1 42 SER H    H  -10.977  14.458  -5.274 1.00 . A A .  42 SER H    1 1 
        6  3683 1 1 42 SER HA   H  -12.573  16.628  -4.447 1.00 . A A .  42 SER HA   1 1 
        6  3684 1 1 42 SER HB2  H  -11.020  15.400  -2.951 1.00 . A A .  42 SER HB2  1 1 
        6  3685 1 1 42 SER HB3  H   -9.657  16.114  -3.813 1.00 . A A .  42 SER HB3  1 1 
        6  3686 1 1 42 SER HG   H  -10.651  17.140  -1.762 1.00 . A A .  42 SER HG   1 1 
        6  3687 1 1 42 SER N    N  -11.565  15.196  -5.538 1.00 . A A .  42 SER N    1 1 
        6  3688 1 1 42 SER O    O  -10.323  17.415  -6.563 1.00 . A A .  42 SER O    1 1 
        6  3689 1 1 42 SER OG   O  -10.758  17.404  -2.678 1.00 . A A .  42 SER OG   1 1 
        6  3690 1 1 43 SER C    C  -10.337  20.985  -4.982 1.00 . A A .  43 SER C    1 1 
        6  3691 1 1 43 SER CA   C  -11.047  20.012  -5.918 1.00 . A A .  43 SER CA   1 1 
        6  3692 1 1 43 SER CB   C  -12.264  20.690  -6.550 1.00 . A A .  43 SER CB   1 1 
        6  3693 1 1 43 SER H    H  -12.038  18.890  -4.420 1.00 . A A .  43 SER H    1 1 
        6  3694 1 1 43 SER HA   H  -10.363  19.718  -6.700 1.00 . A A .  43 SER HA   1 1 
        6  3695 1 1 43 SER HB2  H  -13.041  20.794  -5.808 1.00 . A A .  43 SER HB2  1 1 
        6  3696 1 1 43 SER HB3  H  -11.980  21.668  -6.913 1.00 . A A .  43 SER HB3  1 1 
        6  3697 1 1 43 SER HG   H  -12.440  20.293  -8.461 1.00 . A A .  43 SER HG   1 1 
        6  3698 1 1 43 SER N    N  -11.454  18.807  -5.204 1.00 . A A .  43 SER N    1 1 
        6  3699 1 1 43 SER O    O  -10.911  21.448  -3.997 1.00 . A A .  43 SER O    1 1 
        6  3700 1 1 43 SER OG   O  -12.767  19.929  -7.635 1.00 . A A .  43 SER OG   1 1 
        6  3701 1 1 44 GLY C    C   -7.579  21.502  -3.353 1.00 . A A .  44 GLY C    1 1 
        6  3702 1 1 44 GLY CA   C   -8.313  22.207  -4.476 1.00 . A A .  44 GLY CA   1 1 
        6  3703 1 1 44 GLY H    H   -8.676  20.892  -6.095 1.00 . A A .  44 GLY H    1 1 
        6  3704 1 1 44 GLY HA2  H   -7.593  22.715  -5.100 1.00 . A A .  44 GLY HA2  1 1 
        6  3705 1 1 44 GLY HA3  H   -8.983  22.939  -4.049 1.00 . A A .  44 GLY HA3  1 1 
        6  3706 1 1 44 GLY N    N   -9.082  21.291  -5.298 1.00 . A A .  44 GLY N    1 1 
        6  3707 1 1 44 GLY O    O   -7.518  20.273  -3.356 1.00 . A A .  44 GLY O    1 1 
        6  3708 2 2  1 ZN  ZN   ZN   3.510   5.194  -0.865 1.00 . B A . 201 ZN  ZN   1 1 
        7  3709 1 1  1 GLY C    C   20.739  17.562  -3.034 1.00 . A A .   1 GLY C    1 1 
        7  3710 1 1  1 GLY CA   C   21.847  18.568  -2.790 1.00 . A A .   1 GLY CA   1 1 
        7  3711 1 1  1 GLY H1   H   20.809  20.234  -3.582 1.00 . A A .   1 GLY H1   1 1 
        7  3712 1 1  1 GLY HA2  H   22.610  18.436  -3.543 1.00 . A A .   1 GLY HA2  1 1 
        7  3713 1 1  1 GLY HA3  H   22.278  18.381  -1.818 1.00 . A A .   1 GLY HA3  1 1 
        7  3714 1 1  1 GLY N    N   21.373  19.938  -2.837 1.00 . A A .   1 GLY N    1 1 
        7  3715 1 1  1 GLY O    O   19.558  17.900  -2.960 1.00 . A A .   1 GLY O    1 1 
        7  3716 1 1  2 SER C    C   20.292  14.136  -2.574 1.00 . A A .   2 SER C    1 1 
        7  3717 1 1  2 SER CA   C   20.150  15.266  -3.588 1.00 . A A .   2 SER CA   1 1 
        7  3718 1 1  2 SER CB   C   20.328  14.720  -5.006 1.00 . A A .   2 SER CB   1 1 
        7  3719 1 1  2 SER H    H   22.077  16.116  -3.371 1.00 . A A .   2 SER H    1 1 
        7  3720 1 1  2 SER HA   H   19.162  15.693  -3.498 1.00 . A A .   2 SER HA   1 1 
        7  3721 1 1  2 SER HB2  H   21.368  14.788  -5.287 1.00 . A A .   2 SER HB2  1 1 
        7  3722 1 1  2 SER HB3  H   20.014  13.687  -5.033 1.00 . A A .   2 SER HB3  1 1 
        7  3723 1 1  2 SER HG   H   18.676  15.078  -5.995 1.00 . A A .   2 SER HG   1 1 
        7  3724 1 1  2 SER N    N   21.120  16.323  -3.327 1.00 . A A .   2 SER N    1 1 
        7  3725 1 1  2 SER O    O   21.259  14.087  -1.814 1.00 . A A .   2 SER O    1 1 
        7  3726 1 1  2 SER OG   O   19.555  15.457  -5.938 1.00 . A A .   2 SER OG   1 1 
        7  3727 1 1  3 SER C    C   19.126  10.785  -2.393 1.00 . A A .   3 SER C    1 1 
        7  3728 1 1  3 SER CA   C   19.335  12.099  -1.646 1.00 . A A .   3 SER CA   1 1 
        7  3729 1 1  3 SER CB   C   18.250  12.271  -0.581 1.00 . A A .   3 SER CB   1 1 
        7  3730 1 1  3 SER H    H   18.576  13.322  -3.200 1.00 . A A .   3 SER H    1 1 
        7  3731 1 1  3 SER HA   H   20.301  12.076  -1.165 1.00 . A A .   3 SER HA   1 1 
        7  3732 1 1  3 SER HB2  H   18.400  13.209  -0.067 1.00 . A A .   3 SER HB2  1 1 
        7  3733 1 1  3 SER HB3  H   17.280  12.271  -1.055 1.00 . A A .   3 SER HB3  1 1 
        7  3734 1 1  3 SER HG   H   19.209  10.975   0.532 1.00 . A A .   3 SER HG   1 1 
        7  3735 1 1  3 SER N    N   19.321  13.228  -2.569 1.00 . A A .   3 SER N    1 1 
        7  3736 1 1  3 SER O    O   18.207  10.656  -3.200 1.00 . A A .   3 SER O    1 1 
        7  3737 1 1  3 SER OG   O   18.296  11.219   0.367 1.00 . A A .   3 SER OG   1 1 
        7  3738 1 1  4 GLY C    C   21.191   8.074  -3.390 1.00 . A A .   4 GLY C    1 1 
        7  3739 1 1  4 GLY CA   C   19.881   8.519  -2.768 1.00 . A A .   4 GLY CA   1 1 
        7  3740 1 1  4 GLY H    H   20.701   9.971  -1.463 1.00 . A A .   4 GLY H    1 1 
        7  3741 1 1  4 GLY HA2  H   19.572   7.784  -2.040 1.00 . A A .   4 GLY HA2  1 1 
        7  3742 1 1  4 GLY HA3  H   19.131   8.580  -3.543 1.00 . A A .   4 GLY HA3  1 1 
        7  3743 1 1  4 GLY N    N   19.987   9.811  -2.116 1.00 . A A .   4 GLY N    1 1 
        7  3744 1 1  4 GLY O    O   21.215   7.589  -4.521 1.00 . A A .   4 GLY O    1 1 
        7  3745 1 1  5 SER C    C   23.707   6.344  -3.289 1.00 . A A .   5 SER C    1 1 
        7  3746 1 1  5 SER CA   C   23.602   7.859  -3.137 1.00 . A A .   5 SER CA   1 1 
        7  3747 1 1  5 SER CB   C   24.687   8.364  -2.184 1.00 . A A .   5 SER CB   1 1 
        7  3748 1 1  5 SER H    H   22.197   8.634  -1.756 1.00 . A A .   5 SER H    1 1 
        7  3749 1 1  5 SER HA   H   23.743   8.316  -4.105 1.00 . A A .   5 SER HA   1 1 
        7  3750 1 1  5 SER HB2  H   25.658   8.147  -2.601 1.00 . A A .   5 SER HB2  1 1 
        7  3751 1 1  5 SER HB3  H   24.581   9.431  -2.055 1.00 . A A .   5 SER HB3  1 1 
        7  3752 1 1  5 SER HG   H   24.767   6.800  -1.007 1.00 . A A .   5 SER HG   1 1 
        7  3753 1 1  5 SER N    N   22.282   8.241  -2.650 1.00 . A A .   5 SER N    1 1 
        7  3754 1 1  5 SER O    O   24.259   5.844  -4.269 1.00 . A A .   5 SER O    1 1 
        7  3755 1 1  5 SER OG   O   24.584   7.738  -0.917 1.00 . A A .   5 SER OG   1 1 
        7  3756 1 1  6 SER C    C   22.118   3.578  -1.440 1.00 . A A .   6 SER C    1 1 
        7  3757 1 1  6 SER CA   C   23.209   4.162  -2.332 1.00 . A A .   6 SER CA   1 1 
        7  3758 1 1  6 SER CB   C   24.580   3.658  -1.877 1.00 . A A .   6 SER CB   1 1 
        7  3759 1 1  6 SER H    H   22.746   6.076  -1.556 1.00 . A A .   6 SER H    1 1 
        7  3760 1 1  6 SER HA   H   23.036   3.841  -3.349 1.00 . A A .   6 SER HA   1 1 
        7  3761 1 1  6 SER HB2  H   24.757   3.972  -0.860 1.00 . A A .   6 SER HB2  1 1 
        7  3762 1 1  6 SER HB3  H   24.600   2.579  -1.930 1.00 . A A .   6 SER HB3  1 1 
        7  3763 1 1  6 SER HG   H   25.322   4.174  -3.616 1.00 . A A .   6 SER HG   1 1 
        7  3764 1 1  6 SER N    N   23.173   5.619  -2.311 1.00 . A A .   6 SER N    1 1 
        7  3765 1 1  6 SER O    O   22.205   3.639  -0.214 1.00 . A A .   6 SER O    1 1 
        7  3766 1 1  6 SER OG   O   25.612   4.174  -2.700 1.00 . A A .   6 SER OG   1 1 
        7  3767 1 1  7 GLY C    C   18.973   1.754  -2.207 1.00 . A A .   7 GLY C    1 1 
        7  3768 1 1  7 GLY CA   C   19.997   2.425  -1.313 1.00 . A A .   7 GLY CA   1 1 
        7  3769 1 1  7 GLY H    H   21.075   2.993  -3.045 1.00 . A A .   7 GLY H    1 1 
        7  3770 1 1  7 GLY HA2  H   20.397   1.693  -0.628 1.00 . A A .   7 GLY HA2  1 1 
        7  3771 1 1  7 GLY HA3  H   19.507   3.203  -0.746 1.00 . A A .   7 GLY HA3  1 1 
        7  3772 1 1  7 GLY N    N   21.090   3.012  -2.065 1.00 . A A .   7 GLY N    1 1 
        7  3773 1 1  7 GLY O    O   18.294   2.416  -2.994 1.00 . A A .   7 GLY O    1 1 
        7  3774 1 1  8 THR C    C   17.257  -1.430  -2.074 1.00 . A A .   8 THR C    1 1 
        7  3775 1 1  8 THR CA   C   17.915  -0.327  -2.895 1.00 . A A .   8 THR CA   1 1 
        7  3776 1 1  8 THR CB   C   18.602  -0.957  -4.122 1.00 . A A .   8 THR CB   1 1 
        7  3777 1 1  8 THR CG2  C   19.046   0.117  -5.103 1.00 . A A .   8 THR CG2  1 1 
        7  3778 1 1  8 THR H    H   19.430  -0.036  -1.445 1.00 . A A .   8 THR H    1 1 
        7  3779 1 1  8 THR HA   H   17.152   0.352  -3.245 1.00 . A A .   8 THR HA   1 1 
        7  3780 1 1  8 THR HB   H   17.895  -1.607  -4.617 1.00 . A A .   8 THR HB   1 1 
        7  3781 1 1  8 THR HG1  H   20.375  -1.767  -4.421 1.00 . A A .   8 THR HG1  1 1 
        7  3782 1 1  8 THR HG21 H   19.526   0.920  -4.565 1.00 . A A .   8 THR HG21 1 1 
        7  3783 1 1  8 THR HG22 H   18.185   0.501  -5.631 1.00 . A A .   8 THR HG22 1 1 
        7  3784 1 1  8 THR HG23 H   19.742  -0.309  -5.811 1.00 . A A .   8 THR HG23 1 1 
        7  3785 1 1  8 THR N    N   18.861   0.434  -2.089 1.00 . A A .   8 THR N    1 1 
        7  3786 1 1  8 THR O    O   17.917  -2.109  -1.287 1.00 . A A .   8 THR O    1 1 
        7  3787 1 1  8 THR OG1  O   19.734  -1.729  -3.707 1.00 . A A .   8 THR OG1  1 1 
        7  3788 1 1  9 ARG C    C   14.911  -3.822  -2.436 1.00 . A A .   9 ARG C    1 1 
        7  3789 1 1  9 ARG CA   C   15.205  -2.624  -1.538 1.00 . A A .   9 ARG CA   1 1 
        7  3790 1 1  9 ARG CB   C   13.896  -2.043  -1.000 1.00 . A A .   9 ARG CB   1 1 
        7  3791 1 1  9 ARG CD   C   14.121  -2.351   1.484 1.00 . A A .   9 ARG CD   1 1 
        7  3792 1 1  9 ARG CG   C   13.368  -2.765   0.229 1.00 . A A .   9 ARG CG   1 1 
        7  3793 1 1  9 ARG CZ   C   16.336  -2.768   2.465 1.00 . A A .   9 ARG CZ   1 1 
        7  3794 1 1  9 ARG H    H   15.482  -1.031  -2.903 1.00 . A A .   9 ARG H    1 1 
        7  3795 1 1  9 ARG HA   H   15.811  -2.952  -0.707 1.00 . A A .   9 ARG HA   1 1 
        7  3796 1 1  9 ARG HB2  H   14.056  -1.006  -0.740 1.00 . A A .   9 ARG HB2  1 1 
        7  3797 1 1  9 ARG HB3  H   13.146  -2.100  -1.774 1.00 . A A .   9 ARG HB3  1 1 
        7  3798 1 1  9 ARG HD2  H   14.394  -1.311   1.397 1.00 . A A .   9 ARG HD2  1 1 
        7  3799 1 1  9 ARG HD3  H   13.472  -2.483   2.336 1.00 . A A .   9 ARG HD3  1 1 
        7  3800 1 1  9 ARG HE   H   15.398  -3.998   1.207 1.00 . A A .   9 ARG HE   1 1 
        7  3801 1 1  9 ARG HG2  H   12.323  -2.525   0.354 1.00 . A A .   9 ARG HG2  1 1 
        7  3802 1 1  9 ARG HG3  H   13.481  -3.829   0.085 1.00 . A A .   9 ARG HG3  1 1 
        7  3803 1 1  9 ARG HH11 H   15.471  -1.031   3.026 1.00 . A A .   9 ARG HH11 1 1 
        7  3804 1 1  9 ARG HH12 H   17.033  -1.337   3.711 1.00 . A A .   9 ARG HH12 1 1 
        7  3805 1 1  9 ARG HH21 H   17.454  -4.413   2.102 1.00 . A A .   9 ARG HH21 1 1 
        7  3806 1 1  9 ARG HH22 H   18.160  -3.260   3.184 1.00 . A A .   9 ARG HH22 1 1 
        7  3807 1 1  9 ARG N    N   15.953  -1.603  -2.262 1.00 . A A .   9 ARG N    1 1 
        7  3808 1 1  9 ARG NE   N   15.332  -3.144   1.682 1.00 . A A .   9 ARG NE   1 1 
        7  3809 1 1  9 ARG NH1  N   16.275  -1.617   3.121 1.00 . A A .   9 ARG NH1  1 1 
        7  3810 1 1  9 ARG NH2  N   17.405  -3.544   2.595 1.00 . A A .   9 ARG NH2  1 1 
        7  3811 1 1  9 ARG O    O   14.835  -3.690  -3.657 1.00 . A A .   9 ARG O    1 1 
        7  3812 1 1 10 GLU C    C   12.965  -6.498  -2.587 1.00 . A A .  10 GLU C    1 1 
        7  3813 1 1 10 GLU CA   C   14.463  -6.211  -2.566 1.00 . A A .  10 GLU CA   1 1 
        7  3814 1 1 10 GLU CB   C   15.212  -7.395  -1.951 1.00 . A A .  10 GLU CB   1 1 
        7  3815 1 1 10 GLU CD   C   15.742  -9.861  -2.084 1.00 . A A .  10 GLU CD   1 1 
        7  3816 1 1 10 GLU CG   C   15.140  -8.661  -2.788 1.00 . A A .  10 GLU CG   1 1 
        7  3817 1 1 10 GLU H    H   14.820  -5.031  -0.845 1.00 . A A .  10 GLU H    1 1 
        7  3818 1 1 10 GLU HA   H   14.805  -6.068  -3.580 1.00 . A A .  10 GLU HA   1 1 
        7  3819 1 1 10 GLU HB2  H   16.251  -7.126  -1.831 1.00 . A A .  10 GLU HB2  1 1 
        7  3820 1 1 10 GLU HB3  H   14.790  -7.607  -0.980 1.00 . A A .  10 GLU HB3  1 1 
        7  3821 1 1 10 GLU HG2  H   14.105  -8.874  -3.008 1.00 . A A .  10 GLU HG2  1 1 
        7  3822 1 1 10 GLU HG3  H   15.676  -8.498  -3.712 1.00 . A A .  10 GLU HG3  1 1 
        7  3823 1 1 10 GLU N    N   14.747  -4.990  -1.821 1.00 . A A .  10 GLU N    1 1 
        7  3824 1 1 10 GLU O    O   12.455  -7.129  -3.514 1.00 . A A .  10 GLU O    1 1 
        7  3825 1 1 10 GLU OE1  O   16.977 -10.032  -2.151 1.00 . A A .  10 GLU OE1  1 1 
        7  3826 1 1 10 GLU OE2  O   14.977 -10.630  -1.465 1.00 . A A .  10 GLU OE2  1 1 
        7  3827 1 1 11 LYS C    C   10.173  -6.213  -2.838 1.00 . A A .  11 LYS C    1 1 
        7  3828 1 1 11 LYS CA   C   10.824  -6.238  -1.458 1.00 . A A .  11 LYS CA   1 1 
        7  3829 1 1 11 LYS CB   C   10.196  -5.163  -0.567 1.00 . A A .  11 LYS CB   1 1 
        7  3830 1 1 11 LYS CD   C   11.428  -5.398   1.610 1.00 . A A .  11 LYS CD   1 1 
        7  3831 1 1 11 LYS CE   C   11.239  -5.265   3.113 1.00 . A A .  11 LYS CE   1 1 
        7  3832 1 1 11 LYS CG   C   10.098  -5.567   0.894 1.00 . A A .  11 LYS CG   1 1 
        7  3833 1 1 11 LYS H    H   12.727  -5.537  -0.851 1.00 . A A .  11 LYS H    1 1 
        7  3834 1 1 11 LYS HA   H   10.657  -7.206  -1.012 1.00 . A A .  11 LYS HA   1 1 
        7  3835 1 1 11 LYS HB2  H   10.792  -4.265  -0.632 1.00 . A A .  11 LYS HB2  1 1 
        7  3836 1 1 11 LYS HB3  H    9.200  -4.951  -0.928 1.00 . A A .  11 LYS HB3  1 1 
        7  3837 1 1 11 LYS HD2  H   12.046  -6.261   1.411 1.00 . A A .  11 LYS HD2  1 1 
        7  3838 1 1 11 LYS HD3  H   11.917  -4.509   1.237 1.00 . A A .  11 LYS HD3  1 1 
        7  3839 1 1 11 LYS HE2  H   10.360  -4.667   3.301 1.00 . A A .  11 LYS HE2  1 1 
        7  3840 1 1 11 LYS HE3  H   11.100  -6.250   3.534 1.00 . A A .  11 LYS HE3  1 1 
        7  3841 1 1 11 LYS HG2  H    9.359  -4.947   1.380 1.00 . A A .  11 LYS HG2  1 1 
        7  3842 1 1 11 LYS HG3  H    9.797  -6.603   0.952 1.00 . A A .  11 LYS HG3  1 1 
        7  3843 1 1 11 LYS HZ1  H   13.273  -4.802   3.210 1.00 . A A .  11 LYS HZ1  1 1 
        7  3844 1 1 11 LYS HZ2  H   12.543  -5.002   4.723 1.00 . A A .  11 LYS HZ2  1 1 
        7  3845 1 1 11 LYS HZ3  H   12.265  -3.593   3.830 1.00 . A A .  11 LYS HZ3  1 1 
        7  3846 1 1 11 LYS N    N   12.264  -6.032  -1.559 1.00 . A A .  11 LYS N    1 1 
        7  3847 1 1 11 LYS NZ   N   12.412  -4.620   3.764 1.00 . A A .  11 LYS NZ   1 1 
        7  3848 1 1 11 LYS O    O   10.390  -5.302  -3.637 1.00 . A A .  11 LYS O    1 1 
        7  3849 1 1 12 PRO C    C    7.558  -6.303  -4.567 1.00 . A A .  12 PRO C    1 1 
        7  3850 1 1 12 PRO CA   C    8.653  -7.353  -4.407 1.00 . A A .  12 PRO CA   1 1 
        7  3851 1 1 12 PRO CB   C    8.045  -8.756  -4.352 1.00 . A A .  12 PRO CB   1 1 
        7  3852 1 1 12 PRO CD   C    9.049  -8.357  -2.220 1.00 . A A .  12 PRO CD   1 1 
        7  3853 1 1 12 PRO CG   C    7.900  -9.050  -2.898 1.00 . A A .  12 PRO CG   1 1 
        7  3854 1 1 12 PRO HA   H    9.337  -7.288  -5.240 1.00 . A A .  12 PRO HA   1 1 
        7  3855 1 1 12 PRO HB2  H    7.087  -8.756  -4.853 1.00 . A A .  12 PRO HB2  1 1 
        7  3856 1 1 12 PRO HB3  H    8.708  -9.459  -4.832 1.00 . A A .  12 PRO HB3  1 1 
        7  3857 1 1 12 PRO HD2  H    8.750  -7.996  -1.246 1.00 . A A .  12 PRO HD2  1 1 
        7  3858 1 1 12 PRO HD3  H    9.894  -9.023  -2.134 1.00 . A A .  12 PRO HD3  1 1 
        7  3859 1 1 12 PRO HG2  H    6.961  -8.660  -2.537 1.00 . A A .  12 PRO HG2  1 1 
        7  3860 1 1 12 PRO HG3  H    7.955 -10.115  -2.732 1.00 . A A .  12 PRO HG3  1 1 
        7  3861 1 1 12 PRO N    N    9.354  -7.236  -3.125 1.00 . A A .  12 PRO N    1 1 
        7  3862 1 1 12 PRO O    O    7.484  -5.621  -5.589 1.00 . A A .  12 PRO O    1 1 
        7  3863 1 1 13 TYR C    C    6.146  -3.790  -3.436 1.00 . A A .  13 TYR C    1 1 
        7  3864 1 1 13 TYR CA   C    5.619  -5.214  -3.581 1.00 . A A .  13 TYR CA   1 1 
        7  3865 1 1 13 TYR CB   C    4.615  -5.514  -2.466 1.00 . A A .  13 TYR CB   1 1 
        7  3866 1 1 13 TYR CD1  C    2.978  -7.185  -3.418 1.00 . A A .  13 TYR CD1  1 1 
        7  3867 1 1 13 TYR CD2  C    4.502  -7.932  -1.744 1.00 . A A .  13 TYR CD2  1 1 
        7  3868 1 1 13 TYR CE1  C    2.431  -8.451  -3.492 1.00 . A A .  13 TYR CE1  1 1 
        7  3869 1 1 13 TYR CE2  C    3.962  -9.202  -1.813 1.00 . A A .  13 TYR CE2  1 1 
        7  3870 1 1 13 TYR CG   C    4.020  -6.902  -2.544 1.00 . A A .  13 TYR CG   1 1 
        7  3871 1 1 13 TYR CZ   C    2.927  -9.456  -2.687 1.00 . A A .  13 TYR CZ   1 1 
        7  3872 1 1 13 TYR H    H    6.821  -6.752  -2.764 1.00 . A A .  13 TYR H    1 1 
        7  3873 1 1 13 TYR HA   H    5.120  -5.306  -4.535 1.00 . A A .  13 TYR HA   1 1 
        7  3874 1 1 13 TYR HB2  H    5.109  -5.419  -1.511 1.00 . A A .  13 TYR HB2  1 1 
        7  3875 1 1 13 TYR HB3  H    3.804  -4.802  -2.520 1.00 . A A .  13 TYR HB3  1 1 
        7  3876 1 1 13 TYR HD1  H    2.592  -6.396  -4.047 1.00 . A A .  13 TYR HD1  1 1 
        7  3877 1 1 13 TYR HD2  H    5.313  -7.729  -1.060 1.00 . A A .  13 TYR HD2  1 1 
        7  3878 1 1 13 TYR HE1  H    1.621  -8.651  -4.177 1.00 . A A .  13 TYR HE1  1 1 
        7  3879 1 1 13 TYR HE2  H    4.350  -9.989  -1.183 1.00 . A A .  13 TYR HE2  1 1 
        7  3880 1 1 13 TYR HH   H    1.434 -10.667  -2.646 1.00 . A A .  13 TYR HH   1 1 
        7  3881 1 1 13 TYR N    N    6.711  -6.180  -3.551 1.00 . A A .  13 TYR N    1 1 
        7  3882 1 1 13 TYR O    O    6.885  -3.483  -2.501 1.00 . A A .  13 TYR O    1 1 
        7  3883 1 1 13 TYR OH   O    2.386 -10.720  -2.759 1.00 . A A .  13 TYR OH   1 1 
        7  3884 1 1 14 GLU C    C    5.004  -0.590  -4.498 1.00 . A A .  14 GLU C    1 1 
        7  3885 1 1 14 GLU CA   C    6.193  -1.533  -4.345 1.00 . A A .  14 GLU CA   1 1 
        7  3886 1 1 14 GLU CB   C    7.211  -1.274  -5.458 1.00 . A A .  14 GLU CB   1 1 
        7  3887 1 1 14 GLU CD   C    9.557  -1.924  -6.131 1.00 . A A .  14 GLU CD   1 1 
        7  3888 1 1 14 GLU CG   C    8.654  -1.439  -5.013 1.00 . A A .  14 GLU CG   1 1 
        7  3889 1 1 14 GLU H    H    5.169  -3.230  -5.088 1.00 . A A .  14 GLU H    1 1 
        7  3890 1 1 14 GLU HA   H    6.663  -1.348  -3.390 1.00 . A A .  14 GLU HA   1 1 
        7  3891 1 1 14 GLU HB2  H    7.024  -1.964  -6.268 1.00 . A A .  14 GLU HB2  1 1 
        7  3892 1 1 14 GLU HB3  H    7.081  -0.265  -5.819 1.00 . A A .  14 GLU HB3  1 1 
        7  3893 1 1 14 GLU HG2  H    9.021  -0.485  -4.663 1.00 . A A .  14 GLU HG2  1 1 
        7  3894 1 1 14 GLU HG3  H    8.689  -2.155  -4.206 1.00 . A A .  14 GLU HG3  1 1 
        7  3895 1 1 14 GLU N    N    5.759  -2.925  -4.368 1.00 . A A .  14 GLU N    1 1 
        7  3896 1 1 14 GLU O    O    4.047  -0.890  -5.213 1.00 . A A .  14 GLU O    1 1 
        7  3897 1 1 14 GLU OE1  O    9.583  -1.273  -7.197 1.00 . A A .  14 GLU OE1  1 1 
        7  3898 1 1 14 GLU OE2  O   10.238  -2.953  -5.940 1.00 . A A .  14 GLU OE2  1 1 
        7  3899 1 1 15 CYS C    C    4.041   2.308  -5.199 1.00 . A A .  15 CYS C    1 1 
        7  3900 1 1 15 CYS CA   C    4.000   1.540  -3.881 1.00 . A A .  15 CYS CA   1 1 
        7  3901 1 1 15 CYS CB   C    4.112   2.515  -2.707 1.00 . A A .  15 CYS CB   1 1 
        7  3902 1 1 15 CYS H    H    5.860   0.735  -3.269 1.00 . A A .  15 CYS H    1 1 
        7  3903 1 1 15 CYS HA   H    3.060   1.015  -3.813 1.00 . A A .  15 CYS HA   1 1 
        7  3904 1 1 15 CYS HB2  H    4.253   1.953  -1.795 1.00 . A A .  15 CYS HB2  1 1 
        7  3905 1 1 15 CYS HB3  H    4.965   3.158  -2.863 1.00 . A A .  15 CYS HB3  1 1 
        7  3906 1 1 15 CYS N    N    5.070   0.552  -3.822 1.00 . A A .  15 CYS N    1 1 
        7  3907 1 1 15 CYS O    O    5.030   2.970  -5.514 1.00 . A A .  15 CYS O    1 1 
        7  3908 1 1 15 CYS SG   S    2.649   3.577  -2.480 1.00 . A A .  15 CYS SG   1 1 
        7  3909 1 1 16 SER C    C    2.651   4.394  -7.057 1.00 . A A .  16 SER C    1 1 
        7  3910 1 1 16 SER CA   C    2.871   2.897  -7.251 1.00 . A A .  16 SER CA   1 1 
        7  3911 1 1 16 SER CB   C    1.736   2.307  -8.090 1.00 . A A .  16 SER CB   1 1 
        7  3912 1 1 16 SER H    H    2.202   1.671  -5.660 1.00 . A A .  16 SER H    1 1 
        7  3913 1 1 16 SER HA   H    3.806   2.747  -7.770 1.00 . A A .  16 SER HA   1 1 
        7  3914 1 1 16 SER HB2  H    1.861   2.603  -9.120 1.00 . A A .  16 SER HB2  1 1 
        7  3915 1 1 16 SER HB3  H    1.762   1.229  -8.019 1.00 . A A .  16 SER HB3  1 1 
        7  3916 1 1 16 SER HG   H   -0.122   2.856  -8.380 1.00 . A A .  16 SER HG   1 1 
        7  3917 1 1 16 SER N    N    2.959   2.215  -5.965 1.00 . A A .  16 SER N    1 1 
        7  3918 1 1 16 SER O    O    2.467   5.135  -8.023 1.00 . A A .  16 SER O    1 1 
        7  3919 1 1 16 SER OG   O    0.474   2.764  -7.633 1.00 . A A .  16 SER OG   1 1 
        7  3920 1 1 17 GLU C    C    3.808   6.936  -5.235 1.00 . A A .  17 GLU C    1 1 
        7  3921 1 1 17 GLU CA   C    2.472   6.240  -5.481 1.00 . A A .  17 GLU CA   1 1 
        7  3922 1 1 17 GLU CB   C    1.575   6.384  -4.251 1.00 . A A .  17 GLU CB   1 1 
        7  3923 1 1 17 GLU CD   C   -0.770   6.521  -5.180 1.00 . A A .  17 GLU CD   1 1 
        7  3924 1 1 17 GLU CG   C    0.229   5.694  -4.394 1.00 . A A .  17 GLU CG   1 1 
        7  3925 1 1 17 GLU H    H    2.822   4.192  -5.075 1.00 . A A .  17 GLU H    1 1 
        7  3926 1 1 17 GLU HA   H    1.988   6.707  -6.325 1.00 . A A .  17 GLU HA   1 1 
        7  3927 1 1 17 GLU HB2  H    2.084   5.962  -3.397 1.00 . A A .  17 GLU HB2  1 1 
        7  3928 1 1 17 GLU HB3  H    1.399   7.434  -4.069 1.00 . A A .  17 GLU HB3  1 1 
        7  3929 1 1 17 GLU HG2  H    0.374   4.753  -4.904 1.00 . A A .  17 GLU HG2  1 1 
        7  3930 1 1 17 GLU HG3  H   -0.174   5.510  -3.409 1.00 . A A .  17 GLU HG3  1 1 
        7  3931 1 1 17 GLU N    N    2.671   4.832  -5.802 1.00 . A A .  17 GLU N    1 1 
        7  3932 1 1 17 GLU O    O    4.100   7.974  -5.829 1.00 . A A .  17 GLU O    1 1 
        7  3933 1 1 17 GLU OE1  O   -0.652   7.764  -5.165 1.00 . A A .  17 GLU OE1  1 1 
        7  3934 1 1 17 GLU OE2  O   -1.669   5.926  -5.810 1.00 . A A .  17 GLU OE2  1 1 
        7  3935 1 1 18 CYS C    C    7.043   5.989  -4.478 1.00 . A A .  18 CYS C    1 1 
        7  3936 1 1 18 CYS CA   C    5.921   6.918  -4.026 1.00 . A A .  18 CYS CA   1 1 
        7  3937 1 1 18 CYS CB   C    6.027   7.170  -2.520 1.00 . A A .  18 CYS CB   1 1 
        7  3938 1 1 18 CYS H    H    4.328   5.529  -3.912 1.00 . A A .  18 CYS H    1 1 
        7  3939 1 1 18 CYS HA   H    6.017   7.859  -4.547 1.00 . A A .  18 CYS HA   1 1 
        7  3940 1 1 18 CYS HB2  H    7.011   7.557  -2.297 1.00 . A A .  18 CYS HB2  1 1 
        7  3941 1 1 18 CYS HB3  H    5.285   7.899  -2.231 1.00 . A A .  18 CYS HB3  1 1 
        7  3942 1 1 18 CYS N    N    4.616   6.356  -4.353 1.00 . A A .  18 CYS N    1 1 
        7  3943 1 1 18 CYS O    O    8.073   6.439  -4.978 1.00 . A A .  18 CYS O    1 1 
        7  3944 1 1 18 CYS SG   S    5.773   5.684  -1.498 1.00 . A A .  18 CYS SG   1 1 
        7  3945 1 1 19 GLY C    C    8.289   2.846  -3.535 1.00 . A A .  19 GLY C    1 1 
        7  3946 1 1 19 GLY CA   C    7.838   3.715  -4.692 1.00 . A A .  19 GLY CA   1 1 
        7  3947 1 1 19 GLY H    H    5.995   4.386  -3.893 1.00 . A A .  19 GLY H    1 1 
        7  3948 1 1 19 GLY HA2  H    7.426   3.083  -5.464 1.00 . A A .  19 GLY HA2  1 1 
        7  3949 1 1 19 GLY HA3  H    8.695   4.239  -5.088 1.00 . A A .  19 GLY HA3  1 1 
        7  3950 1 1 19 GLY N    N    6.836   4.688  -4.297 1.00 . A A .  19 GLY N    1 1 
        7  3951 1 1 19 GLY O    O    9.246   2.082  -3.658 1.00 . A A .  19 GLY O    1 1 
        7  3952 1 1 20 LYS C    C    8.085   0.703  -1.568 1.00 . A A .  20 LYS C    1 1 
        7  3953 1 1 20 LYS CA   C    7.932   2.180  -1.221 1.00 . A A .  20 LYS CA   1 1 
        7  3954 1 1 20 LYS CB   C    6.853   2.354  -0.149 1.00 . A A .  20 LYS CB   1 1 
        7  3955 1 1 20 LYS CD   C    6.592   2.957   2.275 1.00 . A A .  20 LYS CD   1 1 
        7  3956 1 1 20 LYS CE   C    7.418   3.210   3.528 1.00 . A A .  20 LYS CE   1 1 
        7  3957 1 1 20 LYS CG   C    7.357   2.119   1.264 1.00 . A A .  20 LYS CG   1 1 
        7  3958 1 1 20 LYS H    H    6.844   3.587  -2.369 1.00 . A A .  20 LYS H    1 1 
        7  3959 1 1 20 LYS HA   H    8.872   2.546  -0.836 1.00 . A A .  20 LYS HA   1 1 
        7  3960 1 1 20 LYS HB2  H    6.464   3.360  -0.208 1.00 . A A .  20 LYS HB2  1 1 
        7  3961 1 1 20 LYS HB3  H    6.053   1.656  -0.345 1.00 . A A .  20 LYS HB3  1 1 
        7  3962 1 1 20 LYS HD2  H    6.341   3.907   1.826 1.00 . A A .  20 LYS HD2  1 1 
        7  3963 1 1 20 LYS HD3  H    5.686   2.436   2.551 1.00 . A A .  20 LYS HD3  1 1 
        7  3964 1 1 20 LYS HE2  H    6.810   3.744   4.242 1.00 . A A .  20 LYS HE2  1 1 
        7  3965 1 1 20 LYS HE3  H    7.713   2.259   3.946 1.00 . A A .  20 LYS HE3  1 1 
        7  3966 1 1 20 LYS HG2  H    7.233   1.075   1.512 1.00 . A A .  20 LYS HG2  1 1 
        7  3967 1 1 20 LYS HG3  H    8.404   2.380   1.312 1.00 . A A .  20 LYS HG3  1 1 
        7  3968 1 1 20 LYS HZ1  H    9.048   4.376   4.119 1.00 . A A .  20 LYS HZ1  1 1 
        7  3969 1 1 20 LYS HZ2  H    8.400   4.814   2.618 1.00 . A A .  20 LYS HZ2  1 1 
        7  3970 1 1 20 LYS HZ3  H    9.347   3.420   2.756 1.00 . A A .  20 LYS HZ3  1 1 
        7  3971 1 1 20 LYS N    N    7.598   2.961  -2.406 1.00 . A A .  20 LYS N    1 1 
        7  3972 1 1 20 LYS NZ   N    8.639   4.011   3.235 1.00 . A A .  20 LYS NZ   1 1 
        7  3973 1 1 20 LYS O    O    7.937   0.309  -2.724 1.00 . A A .  20 LYS O    1 1 
        7  3974 1 1 21 ALA C    C    7.944  -2.334   0.398 1.00 . A A .  21 ALA C    1 1 
        7  3975 1 1 21 ALA CA   C    8.549  -1.544  -0.757 1.00 . A A .  21 ALA CA   1 1 
        7  3976 1 1 21 ALA CB   C   10.024  -1.885  -0.917 1.00 . A A .  21 ALA CB   1 1 
        7  3977 1 1 21 ALA H    H    8.486   0.264   0.341 1.00 . A A .  21 ALA H    1 1 
        7  3978 1 1 21 ALA HA   H    8.041  -1.817  -1.671 1.00 . A A .  21 ALA HA   1 1 
        7  3979 1 1 21 ALA HB1  H   10.592  -0.975  -1.039 1.00 . A A .  21 ALA HB1  1 1 
        7  3980 1 1 21 ALA HB2  H   10.368  -2.410  -0.037 1.00 . A A .  21 ALA HB2  1 1 
        7  3981 1 1 21 ALA HB3  H   10.156  -2.512  -1.786 1.00 . A A .  21 ALA HB3  1 1 
        7  3982 1 1 21 ALA N    N    8.380  -0.110  -0.559 1.00 . A A .  21 ALA N    1 1 
        7  3983 1 1 21 ALA O    O    7.858  -1.840   1.523 1.00 . A A .  21 ALA O    1 1 
        7  3984 1 1 22 PHE C    C    7.207  -5.890   0.836 1.00 . A A .  22 PHE C    1 1 
        7  3985 1 1 22 PHE CA   C    6.925  -4.419   1.130 1.00 . A A .  22 PHE CA   1 1 
        7  3986 1 1 22 PHE CB   C    5.415  -4.182   1.202 1.00 . A A .  22 PHE CB   1 1 
        7  3987 1 1 22 PHE CD1  C    5.048  -1.861   0.322 1.00 . A A .  22 PHE CD1  1 1 
        7  3988 1 1 22 PHE CD2  C    4.690  -2.262   2.645 1.00 . A A .  22 PHE CD2  1 1 
        7  3989 1 1 22 PHE CE1  C    4.706  -0.533   0.495 1.00 . A A .  22 PHE CE1  1 1 
        7  3990 1 1 22 PHE CE2  C    4.347  -0.936   2.824 1.00 . A A .  22 PHE CE2  1 1 
        7  3991 1 1 22 PHE CG   C    5.043  -2.740   1.393 1.00 . A A .  22 PHE CG   1 1 
        7  3992 1 1 22 PHE CZ   C    4.356  -0.070   1.748 1.00 . A A .  22 PHE CZ   1 1 
        7  3993 1 1 22 PHE H    H    7.620  -3.900  -0.801 1.00 . A A .  22 PHE H    1 1 
        7  3994 1 1 22 PHE HA   H    7.367  -4.164   2.081 1.00 . A A .  22 PHE HA   1 1 
        7  3995 1 1 22 PHE HB2  H    4.961  -4.522   0.283 1.00 . A A .  22 PHE HB2  1 1 
        7  3996 1 1 22 PHE HB3  H    5.009  -4.744   2.029 1.00 . A A .  22 PHE HB3  1 1 
        7  3997 1 1 22 PHE HD1  H    5.322  -2.223  -0.659 1.00 . A A .  22 PHE HD1  1 1 
        7  3998 1 1 22 PHE HD2  H    4.684  -2.938   3.488 1.00 . A A .  22 PHE HD2  1 1 
        7  3999 1 1 22 PHE HE1  H    4.714   0.141  -0.349 1.00 . A A .  22 PHE HE1  1 1 
        7  4000 1 1 22 PHE HE2  H    4.074  -0.575   3.805 1.00 . A A .  22 PHE HE2  1 1 
        7  4001 1 1 22 PHE HZ   H    4.088   0.967   1.885 1.00 . A A .  22 PHE HZ   1 1 
        7  4002 1 1 22 PHE N    N    7.525  -3.562   0.114 1.00 . A A .  22 PHE N    1 1 
        7  4003 1 1 22 PHE O    O    7.550  -6.254  -0.289 1.00 . A A .  22 PHE O    1 1 
        7  4004 1 1 23 ILE C    C    6.018  -8.893   1.322 1.00 . A A .  23 ILE C    1 1 
        7  4005 1 1 23 ILE CA   C    7.299  -8.160   1.707 1.00 . A A .  23 ILE CA   1 1 
        7  4006 1 1 23 ILE CB   C    7.860  -8.775   3.002 1.00 . A A .  23 ILE CB   1 1 
        7  4007 1 1 23 ILE CD1  C    9.481  -8.179   4.872 1.00 . A A .  23 ILE CD1  1 1 
        7  4008 1 1 23 ILE CG1  C    9.168  -8.085   3.395 1.00 . A A .  23 ILE CG1  1 1 
        7  4009 1 1 23 ILE CG2  C    8.075 -10.271   2.828 1.00 . A A .  23 ILE CG2  1 1 
        7  4010 1 1 23 ILE H    H    6.785  -6.379   2.728 1.00 . A A .  23 ILE H    1 1 
        7  4011 1 1 23 ILE HA   H    8.028  -8.296   0.921 1.00 . A A .  23 ILE HA   1 1 
        7  4012 1 1 23 ILE HB   H    7.134  -8.629   3.788 1.00 . A A .  23 ILE HB   1 1 
        7  4013 1 1 23 ILE HD11 H    9.488  -7.188   5.302 1.00 . A A .  23 ILE HD11 1 1 
        7  4014 1 1 23 ILE HD12 H    8.728  -8.778   5.363 1.00 . A A .  23 ILE HD12 1 1 
        7  4015 1 1 23 ILE HD13 H   10.450  -8.636   5.007 1.00 . A A .  23 ILE HD13 1 1 
        7  4016 1 1 23 ILE HG12 H    9.983  -8.539   2.854 1.00 . A A .  23 ILE HG12 1 1 
        7  4017 1 1 23 ILE HG13 H    9.107  -7.038   3.134 1.00 . A A .  23 ILE HG13 1 1 
        7  4018 1 1 23 ILE HG21 H    7.177 -10.720   2.429 1.00 . A A .  23 ILE HG21 1 1 
        7  4019 1 1 23 ILE HG22 H    8.895 -10.439   2.146 1.00 . A A .  23 ILE HG22 1 1 
        7  4020 1 1 23 ILE HG23 H    8.305 -10.715   3.785 1.00 . A A .  23 ILE HG23 1 1 
        7  4021 1 1 23 ILE N    N    7.060  -6.730   1.855 1.00 . A A .  23 ILE N    1 1 
        7  4022 1 1 23 ILE O    O    6.044  -9.835   0.530 1.00 . A A .  23 ILE O    1 1 
        7  4023 1 1 24 ARG C    C    2.605  -8.026   1.117 1.00 . A A .  24 ARG C    1 1 
        7  4024 1 1 24 ARG CA   C    3.607  -9.068   1.604 1.00 . A A .  24 ARG CA   1 1 
        7  4025 1 1 24 ARG CB   C    3.066  -9.767   2.852 1.00 . A A .  24 ARG CB   1 1 
        7  4026 1 1 24 ARG CD   C    4.213 -11.987   2.583 1.00 . A A .  24 ARG CD   1 1 
        7  4027 1 1 24 ARG CG   C    4.040 -10.761   3.465 1.00 . A A .  24 ARG CG   1 1 
        7  4028 1 1 24 ARG CZ   C    3.008 -14.078   2.112 1.00 . A A .  24 ARG CZ   1 1 
        7  4029 1 1 24 ARG H    H    4.942  -7.699   2.512 1.00 . A A .  24 ARG H    1 1 
        7  4030 1 1 24 ARG HA   H    3.753  -9.802   0.826 1.00 . A A .  24 ARG HA   1 1 
        7  4031 1 1 24 ARG HB2  H    2.832  -9.020   3.597 1.00 . A A .  24 ARG HB2  1 1 
        7  4032 1 1 24 ARG HB3  H    2.163 -10.297   2.590 1.00 . A A .  24 ARG HB3  1 1 
        7  4033 1 1 24 ARG HD2  H    4.404 -11.663   1.571 1.00 . A A .  24 ARG HD2  1 1 
        7  4034 1 1 24 ARG HD3  H    5.056 -12.557   2.944 1.00 . A A .  24 ARG HD3  1 1 
        7  4035 1 1 24 ARG HE   H    2.204 -12.468   2.971 1.00 . A A .  24 ARG HE   1 1 
        7  4036 1 1 24 ARG HG2  H    5.000 -10.281   3.587 1.00 . A A .  24 ARG HG2  1 1 
        7  4037 1 1 24 ARG HG3  H    3.664 -11.071   4.429 1.00 . A A .  24 ARG HG3  1 1 
        7  4038 1 1 24 ARG HH11 H    4.951 -14.073   1.558 1.00 . A A .  24 ARG HH11 1 1 
        7  4039 1 1 24 ARG HH12 H    4.090 -15.541   1.232 1.00 . A A .  24 ARG HH12 1 1 
        7  4040 1 1 24 ARG HH21 H    1.060 -14.395   2.547 1.00 . A A .  24 ARG HH21 1 1 
        7  4041 1 1 24 ARG HH22 H    1.877 -15.722   1.794 1.00 . A A .  24 ARG HH22 1 1 
        7  4042 1 1 24 ARG N    N    4.898  -8.454   1.888 1.00 . A A .  24 ARG N    1 1 
        7  4043 1 1 24 ARG NE   N    3.027 -12.839   2.591 1.00 . A A .  24 ARG NE   1 1 
        7  4044 1 1 24 ARG NH1  N    4.106 -14.607   1.591 1.00 . A A .  24 ARG NH1  1 1 
        7  4045 1 1 24 ARG NH2  N    1.890 -14.790   2.155 1.00 . A A .  24 ARG NH2  1 1 
        7  4046 1 1 24 ARG O    O    2.490  -6.944   1.692 1.00 . A A .  24 ARG O    1 1 
        7  4047 1 1 25 ASN C    C    0.122  -6.731   0.590 1.00 . A A .  25 ASN C    1 1 
        7  4048 1 1 25 ASN CA   C    0.890  -7.452  -0.513 1.00 . A A .  25 ASN CA   1 1 
        7  4049 1 1 25 ASN CB   C   -0.083  -8.222  -1.409 1.00 . A A .  25 ASN CB   1 1 
        7  4050 1 1 25 ASN CG   C   -0.656  -7.358  -2.516 1.00 . A A .  25 ASN CG   1 1 
        7  4051 1 1 25 ASN H    H    2.019  -9.237  -0.363 1.00 . A A .  25 ASN H    1 1 
        7  4052 1 1 25 ASN HA   H    1.413  -6.721  -1.110 1.00 . A A .  25 ASN HA   1 1 
        7  4053 1 1 25 ASN HB2  H    0.435  -9.055  -1.860 1.00 . A A .  25 ASN HB2  1 1 
        7  4054 1 1 25 ASN HB3  H   -0.899  -8.593  -0.808 1.00 . A A .  25 ASN HB3  1 1 
        7  4055 1 1 25 ASN HD21 H   -0.876  -5.839  -1.251 1.00 . A A .  25 ASN HD21 1 1 
        7  4056 1 1 25 ASN HD22 H   -1.379  -5.542  -2.877 1.00 . A A .  25 ASN HD22 1 1 
        7  4057 1 1 25 ASN N    N    1.882  -8.360   0.053 1.00 . A A .  25 ASN N    1 1 
        7  4058 1 1 25 ASN ND2  N   -1.005  -6.122  -2.181 1.00 . A A .  25 ASN ND2  1 1 
        7  4059 1 1 25 ASN O    O    0.110  -5.501   0.650 1.00 . A A .  25 ASN O    1 1 
        7  4060 1 1 25 ASN OD1  O   -0.782  -7.798  -3.659 1.00 . A A .  25 ASN OD1  1 1 
        7  4061 1 1 26 SER C    C   -0.564  -5.751   3.182 1.00 . A A .  26 SER C    1 1 
        7  4062 1 1 26 SER CA   C   -1.292  -6.939   2.561 1.00 . A A .  26 SER CA   1 1 
        7  4063 1 1 26 SER CB   C   -1.556  -8.004   3.626 1.00 . A A .  26 SER CB   1 1 
        7  4064 1 1 26 SER H    H   -0.471  -8.478   1.361 1.00 . A A .  26 SER H    1 1 
        7  4065 1 1 26 SER HA   H   -2.236  -6.599   2.161 1.00 . A A .  26 SER HA   1 1 
        7  4066 1 1 26 SER HB2  H   -1.851  -8.925   3.146 1.00 . A A .  26 SER HB2  1 1 
        7  4067 1 1 26 SER HB3  H   -0.654  -8.169   4.198 1.00 . A A .  26 SER HB3  1 1 
        7  4068 1 1 26 SER HG   H   -2.660  -6.640   4.499 1.00 . A A .  26 SER HG   1 1 
        7  4069 1 1 26 SER N    N   -0.518  -7.504   1.461 1.00 . A A .  26 SER N    1 1 
        7  4070 1 1 26 SER O    O   -1.184  -4.750   3.542 1.00 . A A .  26 SER O    1 1 
        7  4071 1 1 26 SER OG   O   -2.588  -7.598   4.508 1.00 . A A .  26 SER OG   1 1 
        7  4072 1 1 27 GLN C    C    1.522  -3.554   3.015 1.00 . A A .  27 GLN C    1 1 
        7  4073 1 1 27 GLN CA   C    1.566  -4.806   3.884 1.00 . A A .  27 GLN CA   1 1 
        7  4074 1 1 27 GLN CB   C    3.013  -5.275   4.052 1.00 . A A .  27 GLN CB   1 1 
        7  4075 1 1 27 GLN CD   C    3.291  -6.337   6.327 1.00 . A A .  27 GLN CD   1 1 
        7  4076 1 1 27 GLN CG   C    3.146  -6.570   4.836 1.00 . A A .  27 GLN CG   1 1 
        7  4077 1 1 27 GLN H    H    1.190  -6.692   2.999 1.00 . A A .  27 GLN H    1 1 
        7  4078 1 1 27 GLN HA   H    1.159  -4.570   4.855 1.00 . A A .  27 GLN HA   1 1 
        7  4079 1 1 27 GLN HB2  H    3.446  -5.424   3.074 1.00 . A A .  27 GLN HB2  1 1 
        7  4080 1 1 27 GLN HB3  H    3.569  -4.507   4.569 1.00 . A A .  27 GLN HB3  1 1 
        7  4081 1 1 27 GLN HE21 H    4.728  -7.708   6.426 1.00 . A A .  27 GLN HE21 1 1 
        7  4082 1 1 27 GLN HE22 H    4.320  -6.938   7.918 1.00 . A A .  27 GLN HE22 1 1 
        7  4083 1 1 27 GLN HG2  H    2.265  -7.171   4.665 1.00 . A A .  27 GLN HG2  1 1 
        7  4084 1 1 27 GLN HG3  H    4.017  -7.101   4.482 1.00 . A A .  27 GLN HG3  1 1 
        7  4085 1 1 27 GLN N    N    0.754  -5.870   3.305 1.00 . A A .  27 GLN N    1 1 
        7  4086 1 1 27 GLN NE2  N    4.204  -7.069   6.954 1.00 . A A .  27 GLN NE2  1 1 
        7  4087 1 1 27 GLN O    O    1.381  -2.439   3.520 1.00 . A A .  27 GLN O    1 1 
        7  4088 1 1 27 GLN OE1  O    2.589  -5.510   6.909 1.00 . A A .  27 GLN OE1  1 1 
        7  4089 1 1 28 LEU C    C    0.267  -1.923   0.793 1.00 . A A .  28 LEU C    1 1 
        7  4090 1 1 28 LEU CA   C    1.620  -2.628   0.765 1.00 . A A .  28 LEU CA   1 1 
        7  4091 1 1 28 LEU CB   C    1.921  -3.123  -0.651 1.00 . A A .  28 LEU CB   1 1 
        7  4092 1 1 28 LEU CD1  C    2.349  -0.861  -1.643 1.00 . A A .  28 LEU CD1  1 1 
        7  4093 1 1 28 LEU CD2  C    1.851  -2.804  -3.136 1.00 . A A .  28 LEU CD2  1 1 
        7  4094 1 1 28 LEU CG   C    1.572  -2.160  -1.786 1.00 . A A .  28 LEU CG   1 1 
        7  4095 1 1 28 LEU H    H    1.755  -4.654   1.362 1.00 . A A .  28 LEU H    1 1 
        7  4096 1 1 28 LEU HA   H    2.384  -1.926   1.063 1.00 . A A .  28 LEU HA   1 1 
        7  4097 1 1 28 LEU HB2  H    2.978  -3.334  -0.709 1.00 . A A .  28 LEU HB2  1 1 
        7  4098 1 1 28 LEU HB3  H    1.364  -4.036  -0.807 1.00 . A A .  28 LEU HB3  1 1 
        7  4099 1 1 28 LEU HD11 H    1.740  -0.037  -1.982 1.00 . A A .  28 LEU HD11 1 1 
        7  4100 1 1 28 LEU HD12 H    3.249  -0.912  -2.238 1.00 . A A .  28 LEU HD12 1 1 
        7  4101 1 1 28 LEU HD13 H    2.613  -0.712  -0.606 1.00 . A A .  28 LEU HD13 1 1 
        7  4102 1 1 28 LEU HD21 H    1.325  -2.263  -3.909 1.00 . A A .  28 LEU HD21 1 1 
        7  4103 1 1 28 LEU HD22 H    1.513  -3.830  -3.121 1.00 . A A .  28 LEU HD22 1 1 
        7  4104 1 1 28 LEU HD23 H    2.912  -2.777  -3.335 1.00 . A A .  28 LEU HD23 1 1 
        7  4105 1 1 28 LEU HG   H    0.518  -1.924  -1.738 1.00 . A A .  28 LEU HG   1 1 
        7  4106 1 1 28 LEU N    N    1.645  -3.743   1.706 1.00 . A A .  28 LEU N    1 1 
        7  4107 1 1 28 LEU O    O    0.193  -0.709   0.987 1.00 . A A .  28 LEU O    1 1 
        7  4108 1 1 29 ILE C    C   -2.348  -1.190   1.782 1.00 . A A .  29 ILE C    1 1 
        7  4109 1 1 29 ILE CA   C   -2.148  -2.141   0.607 1.00 . A A .  29 ILE CA   1 1 
        7  4110 1 1 29 ILE CB   C   -3.211  -3.254   0.676 1.00 . A A .  29 ILE CB   1 1 
        7  4111 1 1 29 ILE CD1  C   -3.759  -5.527  -0.329 1.00 . A A .  29 ILE CD1  1 1 
        7  4112 1 1 29 ILE CG1  C   -3.079  -4.191  -0.526 1.00 . A A .  29 ILE CG1  1 1 
        7  4113 1 1 29 ILE CG2  C   -4.606  -2.652   0.735 1.00 . A A .  29 ILE CG2  1 1 
        7  4114 1 1 29 ILE H    H   -0.675  -3.652   0.452 1.00 . A A .  29 ILE H    1 1 
        7  4115 1 1 29 ILE HA   H   -2.289  -1.594  -0.314 1.00 . A A .  29 ILE HA   1 1 
        7  4116 1 1 29 ILE HB   H   -3.050  -3.819   1.582 1.00 . A A .  29 ILE HB   1 1 
        7  4117 1 1 29 ILE HD11 H   -4.733  -5.508  -0.799 1.00 . A A .  29 ILE HD11 1 1 
        7  4118 1 1 29 ILE HD12 H   -3.160  -6.306  -0.777 1.00 . A A .  29 ILE HD12 1 1 
        7  4119 1 1 29 ILE HD13 H   -3.874  -5.721   0.726 1.00 . A A .  29 ILE HD13 1 1 
        7  4120 1 1 29 ILE HG12 H   -3.518  -3.720  -1.391 1.00 . A A .  29 ILE HG12 1 1 
        7  4121 1 1 29 ILE HG13 H   -2.031  -4.376  -0.716 1.00 . A A .  29 ILE HG13 1 1 
        7  4122 1 1 29 ILE HG21 H   -5.289  -3.367   1.170 1.00 . A A .  29 ILE HG21 1 1 
        7  4123 1 1 29 ILE HG22 H   -4.587  -1.759   1.342 1.00 . A A .  29 ILE HG22 1 1 
        7  4124 1 1 29 ILE HG23 H   -4.933  -2.402  -0.263 1.00 . A A .  29 ILE HG23 1 1 
        7  4125 1 1 29 ILE N    N   -0.799  -2.692   0.601 1.00 . A A .  29 ILE N    1 1 
        7  4126 1 1 29 ILE O    O   -2.792  -0.055   1.607 1.00 . A A .  29 ILE O    1 1 
        7  4127 1 1 30 VAL C    C   -1.524   0.525   3.999 1.00 . A A .  30 VAL C    1 1 
        7  4128 1 1 30 VAL CA   C   -2.156  -0.850   4.185 1.00 . A A .  30 VAL CA   1 1 
        7  4129 1 1 30 VAL CB   C   -1.511  -1.538   5.402 1.00 . A A .  30 VAL CB   1 1 
        7  4130 1 1 30 VAL CG1  C   -1.618  -0.654   6.635 1.00 . A A .  30 VAL CG1  1 1 
        7  4131 1 1 30 VAL CG2  C   -2.155  -2.894   5.650 1.00 . A A .  30 VAL CG2  1 1 
        7  4132 1 1 30 VAL H    H   -1.668  -2.572   3.056 1.00 . A A .  30 VAL H    1 1 
        7  4133 1 1 30 VAL HA   H   -3.210  -0.727   4.384 1.00 . A A .  30 VAL HA   1 1 
        7  4134 1 1 30 VAL HB   H   -0.463  -1.695   5.189 1.00 . A A .  30 VAL HB   1 1 
        7  4135 1 1 30 VAL HG11 H   -2.586  -0.794   7.094 1.00 . A A .  30 VAL HG11 1 1 
        7  4136 1 1 30 VAL HG12 H   -0.843  -0.921   7.338 1.00 . A A .  30 VAL HG12 1 1 
        7  4137 1 1 30 VAL HG13 H   -1.504   0.380   6.347 1.00 . A A .  30 VAL HG13 1 1 
        7  4138 1 1 30 VAL HG21 H   -2.986  -3.028   4.973 1.00 . A A .  30 VAL HG21 1 1 
        7  4139 1 1 30 VAL HG22 H   -1.426  -3.674   5.484 1.00 . A A .  30 VAL HG22 1 1 
        7  4140 1 1 30 VAL HG23 H   -2.509  -2.944   6.669 1.00 . A A .  30 VAL HG23 1 1 
        7  4141 1 1 30 VAL N    N   -2.016  -1.659   2.980 1.00 . A A .  30 VAL N    1 1 
        7  4142 1 1 30 VAL O    O   -2.051   1.532   4.474 1.00 . A A .  30 VAL O    1 1 
        7  4143 1 1 31 HIS C    C   -0.439   2.665   2.034 1.00 . A A .  31 HIS C    1 1 
        7  4144 1 1 31 HIS CA   C    0.313   1.814   3.054 1.00 . A A .  31 HIS CA   1 1 
        7  4145 1 1 31 HIS CB   C    1.731   1.536   2.556 1.00 . A A .  31 HIS CB   1 1 
        7  4146 1 1 31 HIS CD2  C    2.905   3.212   0.963 1.00 . A A .  31 HIS CD2  1 1 
        7  4147 1 1 31 HIS CE1  C    3.531   4.690   2.457 1.00 . A A .  31 HIS CE1  1 1 
        7  4148 1 1 31 HIS CG   C    2.485   2.772   2.172 1.00 . A A .  31 HIS CG   1 1 
        7  4149 1 1 31 HIS H    H   -0.021  -0.274   2.951 1.00 . A A .  31 HIS H    1 1 
        7  4150 1 1 31 HIS HA   H    0.367   2.356   3.986 1.00 . A A .  31 HIS HA   1 1 
        7  4151 1 1 31 HIS HB2  H    2.288   1.038   3.337 1.00 . A A .  31 HIS HB2  1 1 
        7  4152 1 1 31 HIS HB3  H    1.683   0.893   1.689 1.00 . A A .  31 HIS HB3  1 1 
        7  4153 1 1 31 HIS HD1  H    2.738   3.685   4.053 1.00 . A A .  31 HIS HD1  1 1 
        7  4154 1 1 31 HIS HD2  H    2.758   2.718   0.013 1.00 . A A .  31 HIS HD2  1 1 
        7  4155 1 1 31 HIS HE1  H    3.962   5.566   2.918 1.00 . A A .  31 HIS HE1  1 1 
        7  4156 1 1 31 HIS N    N   -0.391   0.561   3.304 1.00 . A A .  31 HIS N    1 1 
        7  4157 1 1 31 HIS ND1  N    2.893   3.719   3.087 1.00 . A A .  31 HIS ND1  1 1 
        7  4158 1 1 31 HIS NE2  N    3.552   4.406   1.167 1.00 . A A .  31 HIS NE2  1 1 
        7  4159 1 1 31 HIS O    O   -0.536   3.883   2.181 1.00 . A A .  31 HIS O    1 1 
        7  4160 1 1 32 GLN C    C   -2.893   3.471   0.546 1.00 . A A .  32 GLN C    1 1 
        7  4161 1 1 32 GLN CA   C   -1.707   2.713  -0.042 1.00 . A A .  32 GLN CA   1 1 
        7  4162 1 1 32 GLN CB   C   -2.194   1.723  -1.101 1.00 . A A .  32 GLN CB   1 1 
        7  4163 1 1 32 GLN CD   C   -1.528   0.533  -3.228 1.00 . A A .  32 GLN CD   1 1 
        7  4164 1 1 32 GLN CG   C   -1.068   1.072  -1.888 1.00 . A A .  32 GLN CG   1 1 
        7  4165 1 1 32 GLN H    H   -0.854   1.044   0.941 1.00 . A A .  32 GLN H    1 1 
        7  4166 1 1 32 GLN HA   H   -1.037   3.422  -0.506 1.00 . A A .  32 GLN HA   1 1 
        7  4167 1 1 32 GLN HB2  H   -2.761   0.944  -0.614 1.00 . A A .  32 GLN HB2  1 1 
        7  4168 1 1 32 GLN HB3  H   -2.835   2.244  -1.796 1.00 . A A .  32 GLN HB3  1 1 
        7  4169 1 1 32 GLN HE21 H   -0.001   1.423  -4.139 1.00 . A A .  32 GLN HE21 1 1 
        7  4170 1 1 32 GLN HE22 H   -1.065   0.525  -5.161 1.00 . A A .  32 GLN HE22 1 1 
        7  4171 1 1 32 GLN HG2  H   -0.294   1.805  -2.060 1.00 . A A .  32 GLN HG2  1 1 
        7  4172 1 1 32 GLN HG3  H   -0.665   0.255  -1.307 1.00 . A A .  32 GLN HG3  1 1 
        7  4173 1 1 32 GLN N    N   -0.966   2.015   1.002 1.00 . A A .  32 GLN N    1 1 
        7  4174 1 1 32 GLN NE2  N   -0.791   0.860  -4.283 1.00 . A A .  32 GLN NE2  1 1 
        7  4175 1 1 32 GLN O    O   -3.279   4.526   0.042 1.00 . A A .  32 GLN O    1 1 
        7  4176 1 1 32 GLN OE1  O   -2.536  -0.170  -3.315 1.00 . A A .  32 GLN OE1  1 1 
        7  4177 1 1 33 ARG C    C   -4.304   5.000   2.631 1.00 . A A .  33 ARG C    1 1 
        7  4178 1 1 33 ARG CA   C   -4.610   3.549   2.269 1.00 . A A .  33 ARG CA   1 1 
        7  4179 1 1 33 ARG CB   C   -4.992   2.768   3.527 1.00 . A A .  33 ARG CB   1 1 
        7  4180 1 1 33 ARG CD   C   -5.882   0.612   4.464 1.00 . A A .  33 ARG CD   1 1 
        7  4181 1 1 33 ARG CG   C   -5.199   1.282   3.282 1.00 . A A .  33 ARG CG   1 1 
        7  4182 1 1 33 ARG CZ   C   -5.399   0.226   6.843 1.00 . A A .  33 ARG CZ   1 1 
        7  4183 1 1 33 ARG H    H   -3.113   2.083   1.968 1.00 . A A .  33 ARG H    1 1 
        7  4184 1 1 33 ARG HA   H   -5.439   3.531   1.578 1.00 . A A .  33 ARG HA   1 1 
        7  4185 1 1 33 ARG HB2  H   -4.208   2.883   4.261 1.00 . A A .  33 ARG HB2  1 1 
        7  4186 1 1 33 ARG HB3  H   -5.909   3.176   3.924 1.00 . A A .  33 ARG HB3  1 1 
        7  4187 1 1 33 ARG HD2  H   -6.906   0.952   4.511 1.00 . A A .  33 ARG HD2  1 1 
        7  4188 1 1 33 ARG HD3  H   -5.865  -0.457   4.313 1.00 . A A .  33 ARG HD3  1 1 
        7  4189 1 1 33 ARG HE   H   -4.613   1.693   5.744 1.00 . A A .  33 ARG HE   1 1 
        7  4190 1 1 33 ARG HG2  H   -5.815   1.154   2.404 1.00 . A A .  33 ARG HG2  1 1 
        7  4191 1 1 33 ARG HG3  H   -4.238   0.817   3.121 1.00 . A A .  33 ARG HG3  1 1 
        7  4192 1 1 33 ARG HH11 H   -6.696  -1.083   6.016 1.00 . A A .  33 ARG HH11 1 1 
        7  4193 1 1 33 ARG HH12 H   -6.347  -1.344   7.693 1.00 . A A .  33 ARG HH12 1 1 
        7  4194 1 1 33 ARG HH21 H   -4.145   1.360   7.951 1.00 . A A .  33 ARG HH21 1 1 
        7  4195 1 1 33 ARG HH22 H   -4.896   0.047   8.793 1.00 . A A .  33 ARG HH22 1 1 
        7  4196 1 1 33 ARG N    N   -3.466   2.926   1.613 1.00 . A A .  33 ARG N    1 1 
        7  4197 1 1 33 ARG NE   N   -5.220   0.925   5.727 1.00 . A A .  33 ARG NE   1 1 
        7  4198 1 1 33 ARG NH1  N   -6.215  -0.819   6.851 1.00 . A A .  33 ARG NH1  1 1 
        7  4199 1 1 33 ARG NH2  N   -4.761   0.573   7.954 1.00 . A A .  33 ARG NH2  1 1 
        7  4200 1 1 33 ARG O    O   -5.191   5.854   2.624 1.00 . A A .  33 ARG O    1 1 
        7  4201 1 1 34 THR C    C   -2.643   7.549   2.110 1.00 . A A .  34 THR C    1 1 
        7  4202 1 1 34 THR CA   C   -2.619   6.617   3.316 1.00 . A A .  34 THR CA   1 1 
        7  4203 1 1 34 THR CB   C   -1.202   6.615   3.920 1.00 . A A .  34 THR CB   1 1 
        7  4204 1 1 34 THR CG2  C   -1.113   5.643   5.087 1.00 . A A .  34 THR CG2  1 1 
        7  4205 1 1 34 THR H    H   -2.381   4.548   2.936 1.00 . A A .  34 THR H    1 1 
        7  4206 1 1 34 THR HA   H   -3.306   6.991   4.061 1.00 . A A .  34 THR HA   1 1 
        7  4207 1 1 34 THR HB   H   -0.980   7.610   4.281 1.00 . A A .  34 THR HB   1 1 
        7  4208 1 1 34 THR HG1  H   -0.388   6.786   2.132 1.00 . A A .  34 THR HG1  1 1 
        7  4209 1 1 34 THR HG21 H   -0.082   5.539   5.390 1.00 . A A .  34 THR HG21 1 1 
        7  4210 1 1 34 THR HG22 H   -1.498   4.681   4.784 1.00 . A A .  34 THR HG22 1 1 
        7  4211 1 1 34 THR HG23 H   -1.696   6.020   5.915 1.00 . A A .  34 THR HG23 1 1 
        7  4212 1 1 34 THR N    N   -3.042   5.272   2.949 1.00 . A A .  34 THR N    1 1 
        7  4213 1 1 34 THR O    O   -2.995   8.723   2.227 1.00 . A A .  34 THR O    1 1 
        7  4214 1 1 34 THR OG1  O   -0.243   6.257   2.920 1.00 . A A .  34 THR OG1  1 1 
        7  4215 1 1 35 HIS C    C   -3.666   8.092  -0.763 1.00 . A A .  35 HIS C    1 1 
        7  4216 1 1 35 HIS CA   C   -2.248   7.804  -0.279 1.00 . A A .  35 HIS CA   1 1 
        7  4217 1 1 35 HIS CB   C   -1.466   7.068  -1.367 1.00 . A A .  35 HIS CB   1 1 
        7  4218 1 1 35 HIS CD2  C    0.996   6.470  -0.807 1.00 . A A .  35 HIS CD2  1 1 
        7  4219 1 1 35 HIS CE1  C    1.943   8.315  -1.518 1.00 . A A .  35 HIS CE1  1 1 
        7  4220 1 1 35 HIS CG   C    0.016   7.274  -1.283 1.00 . A A .  35 HIS CG   1 1 
        7  4221 1 1 35 HIS H    H   -1.998   6.077   0.920 1.00 . A A .  35 HIS H    1 1 
        7  4222 1 1 35 HIS HA   H   -1.756   8.741  -0.066 1.00 . A A .  35 HIS HA   1 1 
        7  4223 1 1 35 HIS HB2  H   -1.658   6.008  -1.285 1.00 . A A .  35 HIS HB2  1 1 
        7  4224 1 1 35 HIS HB3  H   -1.795   7.415  -2.336 1.00 . A A .  35 HIS HB3  1 1 
        7  4225 1 1 35 HIS HD1  H    0.199   9.198  -2.120 1.00 . A A .  35 HIS HD1  1 1 
        7  4226 1 1 35 HIS HD2  H    0.868   5.485  -0.382 1.00 . A A .  35 HIS HD2  1 1 
        7  4227 1 1 35 HIS HE1  H    2.684   9.061  -1.763 1.00 . A A .  35 HIS HE1  1 1 
        7  4228 1 1 35 HIS N    N   -2.268   7.019   0.950 1.00 . A A .  35 HIS N    1 1 
        7  4229 1 1 35 HIS ND1  N    0.642   8.422  -1.720 1.00 . A A .  35 HIS ND1  1 1 
        7  4230 1 1 35 HIS NE2  N    2.184   7.140  -0.965 1.00 . A A .  35 HIS NE2  1 1 
        7  4231 1 1 35 HIS O    O   -3.958   9.187  -1.244 1.00 . A A .  35 HIS O    1 1 
        7  4232 1 1 36 SER C    C   -6.614   8.386  -0.307 1.00 . A A .  36 SER C    1 1 
        7  4233 1 1 36 SER CA   C   -5.930   7.248  -1.059 1.00 . A A .  36 SER CA   1 1 
        7  4234 1 1 36 SER CB   C   -6.695   5.942  -0.836 1.00 . A A .  36 SER CB   1 1 
        7  4235 1 1 36 SER H    H   -4.250   6.253  -0.240 1.00 . A A .  36 SER H    1 1 
        7  4236 1 1 36 SER HA   H   -5.929   7.479  -2.114 1.00 . A A .  36 SER HA   1 1 
        7  4237 1 1 36 SER HB2  H   -6.147   5.126  -1.282 1.00 . A A .  36 SER HB2  1 1 
        7  4238 1 1 36 SER HB3  H   -6.801   5.767   0.224 1.00 . A A .  36 SER HB3  1 1 
        7  4239 1 1 36 SER HG   H   -7.905   5.945  -2.377 1.00 . A A .  36 SER HG   1 1 
        7  4240 1 1 36 SER N    N   -4.543   7.103  -0.632 1.00 . A A .  36 SER N    1 1 
        7  4241 1 1 36 SER O    O   -6.361   8.603   0.877 1.00 . A A .  36 SER O    1 1 
        7  4242 1 1 36 SER OG   O   -7.984   6.000  -1.421 1.00 . A A .  36 SER OG   1 1 
        7  4243 1 1 37 GLY C    C   -7.535  11.555  -0.674 1.00 . A A .  37 GLY C    1 1 
        7  4244 1 1 37 GLY CA   C   -8.190  10.218  -0.389 1.00 . A A .  37 GLY CA   1 1 
        7  4245 1 1 37 GLY H    H   -7.644   8.892  -1.947 1.00 . A A .  37 GLY H    1 1 
        7  4246 1 1 37 GLY HA2  H   -9.202  10.237  -0.763 1.00 . A A .  37 GLY HA2  1 1 
        7  4247 1 1 37 GLY HA3  H   -8.215  10.064   0.680 1.00 . A A .  37 GLY HA3  1 1 
        7  4248 1 1 37 GLY N    N   -7.482   9.111  -1.006 1.00 . A A .  37 GLY N    1 1 
        7  4249 1 1 37 GLY O    O   -8.181  12.475  -1.176 1.00 . A A .  37 GLY O    1 1 
        7  4250 1 1 38 GLU C    C   -5.283  13.138  -2.065 1.00 . A A .  38 GLU C    1 1 
        7  4251 1 1 38 GLU CA   C   -5.509  12.900  -0.575 1.00 . A A .  38 GLU CA   1 1 
        7  4252 1 1 38 GLU CB   C   -4.165  12.855   0.155 1.00 . A A .  38 GLU CB   1 1 
        7  4253 1 1 38 GLU CD   C   -4.050  15.299   0.780 1.00 . A A .  38 GLU CD   1 1 
        7  4254 1 1 38 GLU CG   C   -3.376  14.149   0.059 1.00 . A A .  38 GLU CG   1 1 
        7  4255 1 1 38 GLU H    H   -5.790  10.896   0.045 1.00 . A A .  38 GLU H    1 1 
        7  4256 1 1 38 GLU HA   H   -6.096  13.715  -0.178 1.00 . A A .  38 GLU HA   1 1 
        7  4257 1 1 38 GLU HB2  H   -4.343  12.642   1.199 1.00 . A A .  38 GLU HB2  1 1 
        7  4258 1 1 38 GLU HB3  H   -3.567  12.060  -0.267 1.00 . A A .  38 GLU HB3  1 1 
        7  4259 1 1 38 GLU HG2  H   -2.400  13.994   0.494 1.00 . A A .  38 GLU HG2  1 1 
        7  4260 1 1 38 GLU HG3  H   -3.266  14.412  -0.983 1.00 . A A .  38 GLU HG3  1 1 
        7  4261 1 1 38 GLU N    N   -6.250  11.664  -0.352 1.00 . A A .  38 GLU N    1 1 
        7  4262 1 1 38 GLU O    O   -4.827  12.249  -2.784 1.00 . A A .  38 GLU O    1 1 
        7  4263 1 1 38 GLU OE1  O   -3.799  15.470   1.991 1.00 . A A .  38 GLU OE1  1 1 
        7  4264 1 1 38 GLU OE2  O   -4.830  16.029   0.133 1.00 . A A .  38 GLU OE2  1 1 
        7  4265 1 1 39 SER C    C   -4.011  14.441  -4.389 1.00 . A A .  39 SER C    1 1 
        7  4266 1 1 39 SER CA   C   -5.443  14.698  -3.927 1.00 . A A .  39 SER CA   1 1 
        7  4267 1 1 39 SER CB   C   -5.807  16.167  -4.150 1.00 . A A .  39 SER CB   1 1 
        7  4268 1 1 39 SER H    H   -5.965  15.010  -1.899 1.00 . A A .  39 SER H    1 1 
        7  4269 1 1 39 SER HA   H   -6.112  14.078  -4.505 1.00 . A A .  39 SER HA   1 1 
        7  4270 1 1 39 SER HB2  H   -5.861  16.365  -5.210 1.00 . A A .  39 SER HB2  1 1 
        7  4271 1 1 39 SER HB3  H   -6.766  16.370  -3.696 1.00 . A A .  39 SER HB3  1 1 
        7  4272 1 1 39 SER HG   H   -4.147  16.500  -3.164 1.00 . A A .  39 SER HG   1 1 
        7  4273 1 1 39 SER N    N   -5.606  14.344  -2.522 1.00 . A A .  39 SER N    1 1 
        7  4274 1 1 39 SER O    O   -3.125  14.169  -3.580 1.00 . A A .  39 SER O    1 1 
        7  4275 1 1 39 SER OG   O   -4.838  17.026  -3.574 1.00 . A A .  39 SER OG   1 1 
        7  4276 1 1 40 GLY C    C   -2.504  13.521  -7.543 1.00 . A A .  40 GLY C    1 1 
        7  4277 1 1 40 GLY CA   C   -2.469  14.304  -6.246 1.00 . A A .  40 GLY CA   1 1 
        7  4278 1 1 40 GLY H    H   -4.539  14.750  -6.295 1.00 . A A .  40 GLY H    1 1 
        7  4279 1 1 40 GLY HA2  H   -1.999  15.259  -6.427 1.00 . A A .  40 GLY HA2  1 1 
        7  4280 1 1 40 GLY HA3  H   -1.882  13.756  -5.524 1.00 . A A .  40 GLY HA3  1 1 
        7  4281 1 1 40 GLY N    N   -3.794  14.530  -5.698 1.00 . A A .  40 GLY N    1 1 
        7  4282 1 1 40 GLY O    O   -2.266  12.313  -7.571 1.00 . A A .  40 GLY O    1 1 
        7  4283 1 1 41 PRO C    C   -1.514  13.178 -10.499 1.00 . A A .  41 PRO C    1 1 
        7  4284 1 1 41 PRO CA   C   -2.884  13.596  -9.977 1.00 . A A .  41 PRO CA   1 1 
        7  4285 1 1 41 PRO CB   C   -3.475  14.704 -10.852 1.00 . A A .  41 PRO CB   1 1 
        7  4286 1 1 41 PRO CD   C   -3.106  15.657  -8.691 1.00 . A A .  41 PRO CD   1 1 
        7  4287 1 1 41 PRO CG   C   -3.104  15.971 -10.162 1.00 . A A .  41 PRO CG   1 1 
        7  4288 1 1 41 PRO HA   H   -3.545  12.742  -9.980 1.00 . A A .  41 PRO HA   1 1 
        7  4289 1 1 41 PRO HB2  H   -3.044  14.652 -11.842 1.00 . A A .  41 PRO HB2  1 1 
        7  4290 1 1 41 PRO HB3  H   -4.547  14.587 -10.913 1.00 . A A .  41 PRO HB3  1 1 
        7  4291 1 1 41 PRO HD2  H   -2.339  16.222  -8.183 1.00 . A A .  41 PRO HD2  1 1 
        7  4292 1 1 41 PRO HD3  H   -4.076  15.863  -8.263 1.00 . A A .  41 PRO HD3  1 1 
        7  4293 1 1 41 PRO HG2  H   -2.121  16.286 -10.476 1.00 . A A .  41 PRO HG2  1 1 
        7  4294 1 1 41 PRO HG3  H   -3.834  16.736 -10.382 1.00 . A A .  41 PRO HG3  1 1 
        7  4295 1 1 41 PRO N    N   -2.810  14.215  -8.650 1.00 . A A .  41 PRO N    1 1 
        7  4296 1 1 41 PRO O    O   -0.750  14.005 -10.997 1.00 . A A .  41 PRO O    1 1 
        7  4297 1 1 42 SER C    C   -0.057  10.757 -12.234 1.00 . A A .  42 SER C    1 1 
        7  4298 1 1 42 SER CA   C    0.071  11.363 -10.839 1.00 . A A .  42 SER CA   1 1 
        7  4299 1 1 42 SER CB   C    0.593  10.309  -9.860 1.00 . A A .  42 SER CB   1 1 
        7  4300 1 1 42 SER H    H   -1.860  11.279  -9.976 1.00 . A A .  42 SER H    1 1 
        7  4301 1 1 42 SER HA   H    0.772  12.183 -10.879 1.00 . A A .  42 SER HA   1 1 
        7  4302 1 1 42 SER HB2  H    1.505   9.882 -10.247 1.00 . A A .  42 SER HB2  1 1 
        7  4303 1 1 42 SER HB3  H    0.789  10.776  -8.905 1.00 . A A .  42 SER HB3  1 1 
        7  4304 1 1 42 SER HG   H    0.083   8.501  -9.305 1.00 . A A .  42 SER HG   1 1 
        7  4305 1 1 42 SER N    N   -1.209  11.890 -10.382 1.00 . A A .  42 SER N    1 1 
        7  4306 1 1 42 SER O    O   -1.155  10.666 -12.784 1.00 . A A .  42 SER O    1 1 
        7  4307 1 1 42 SER OG   O   -0.354   9.272  -9.675 1.00 . A A .  42 SER OG   1 1 
        7  4308 1 1 43 SER C    C    0.996   8.229 -14.049 1.00 . A A .  43 SER C    1 1 
        7  4309 1 1 43 SER CA   C    1.088   9.750 -14.131 1.00 . A A .  43 SER CA   1 1 
        7  4310 1 1 43 SER CB   C    2.359  10.156 -14.879 1.00 . A A .  43 SER CB   1 1 
        7  4311 1 1 43 SER H    H    1.916  10.443 -12.310 1.00 . A A .  43 SER H    1 1 
        7  4312 1 1 43 SER HA   H    0.229  10.122 -14.670 1.00 . A A .  43 SER HA   1 1 
        7  4313 1 1 43 SER HB2  H    3.214   9.694 -14.408 1.00 . A A .  43 SER HB2  1 1 
        7  4314 1 1 43 SER HB3  H    2.291   9.824 -15.905 1.00 . A A .  43 SER HB3  1 1 
        7  4315 1 1 43 SER HG   H    2.545  11.873 -13.955 1.00 . A A .  43 SER HG   1 1 
        7  4316 1 1 43 SER N    N    1.072  10.343 -12.799 1.00 . A A .  43 SER N    1 1 
        7  4317 1 1 43 SER O    O    1.981   7.551 -13.758 1.00 . A A .  43 SER O    1 1 
        7  4318 1 1 43 SER OG   O    2.533  11.562 -14.863 1.00 . A A .  43 SER OG   1 1 
        7  4319 1 1 44 GLY C    C   -0.833   5.785 -12.887 1.00 . A A .  44 GLY C    1 1 
        7  4320 1 1 44 GLY CA   C   -0.396   6.263 -14.258 1.00 . A A .  44 GLY CA   1 1 
        7  4321 1 1 44 GLY H    H   -0.945   8.289 -14.534 1.00 . A A .  44 GLY H    1 1 
        7  4322 1 1 44 GLY HA2  H   -1.150   5.990 -14.980 1.00 . A A .  44 GLY HA2  1 1 
        7  4323 1 1 44 GLY HA3  H    0.531   5.773 -14.518 1.00 . A A .  44 GLY HA3  1 1 
        7  4324 1 1 44 GLY N    N   -0.196   7.699 -14.307 1.00 . A A .  44 GLY N    1 1 
        7  4325 1 1 44 GLY O    O   -0.210   6.161 -11.895 1.00 . A A .  44 GLY O    1 1 
        7  4326 2 2  1 ZN  ZN   ZN   3.521   5.235  -1.029 1.00 . B A . 201 ZN  ZN   1 1 
        8  4327 1 1  1 GLY C    C   20.222  13.754 -14.520 1.00 . A A .   1 GLY C    1 1 
        8  4328 1 1  1 GLY CA   C   19.458  14.168 -15.761 1.00 . A A .   1 GLY CA   1 1 
        8  4329 1 1  1 GLY H1   H   19.735  13.586 -17.778 1.00 . A A .   1 GLY H1   1 1 
        8  4330 1 1  1 GLY HA2  H   19.238  15.223 -15.700 1.00 . A A .   1 GLY HA2  1 1 
        8  4331 1 1  1 GLY HA3  H   18.529  13.618 -15.799 1.00 . A A .   1 GLY HA3  1 1 
        8  4332 1 1  1 GLY N    N   20.202  13.914 -16.981 1.00 . A A .   1 GLY N    1 1 
        8  4333 1 1  1 GLY O    O   21.341  13.249 -14.611 1.00 . A A .   1 GLY O    1 1 
        8  4334 1 1  2 SER C    C   20.540  12.122 -12.022 1.00 . A A .   2 SER C    1 1 
        8  4335 1 1  2 SER CA   C   20.251  13.619 -12.089 1.00 . A A .   2 SER CA   1 1 
        8  4336 1 1  2 SER CB   C   19.358  14.030 -10.917 1.00 . A A .   2 SER CB   1 1 
        8  4337 1 1  2 SER H    H   18.726  14.375 -13.348 1.00 . A A .   2 SER H    1 1 
        8  4338 1 1  2 SER HA   H   21.185  14.157 -12.026 1.00 . A A .   2 SER HA   1 1 
        8  4339 1 1  2 SER HB2  H   18.345  13.714 -11.112 1.00 . A A .   2 SER HB2  1 1 
        8  4340 1 1  2 SER HB3  H   19.715  13.559 -10.013 1.00 . A A .   2 SER HB3  1 1 
        8  4341 1 1  2 SER HG   H   20.093  15.677 -10.151 1.00 . A A .   2 SER HG   1 1 
        8  4342 1 1  2 SER N    N   19.618  13.969 -13.355 1.00 . A A .   2 SER N    1 1 
        8  4343 1 1  2 SER O    O   21.556  11.699 -11.471 1.00 . A A .   2 SER O    1 1 
        8  4344 1 1  2 SER OG   O   19.371  15.436 -10.736 1.00 . A A .   2 SER OG   1 1 
        8  4345 1 1  3 SER C    C   20.256   9.377 -11.222 1.00 . A A .   3 SER C    1 1 
        8  4346 1 1  3 SER CA   C   19.793   9.876 -12.588 1.00 . A A .   3 SER CA   1 1 
        8  4347 1 1  3 SER CB   C   20.794   9.450 -13.664 1.00 . A A .   3 SER CB   1 1 
        8  4348 1 1  3 SER H    H   18.849  11.723 -13.011 1.00 . A A .   3 SER H    1 1 
        8  4349 1 1  3 SER HA   H   18.831   9.440 -12.810 1.00 . A A .   3 SER HA   1 1 
        8  4350 1 1  3 SER HB2  H   21.523  10.233 -13.805 1.00 . A A .   3 SER HB2  1 1 
        8  4351 1 1  3 SER HB3  H   21.294   8.545 -13.349 1.00 . A A .   3 SER HB3  1 1 
        8  4352 1 1  3 SER HG   H   19.323   9.704 -14.933 1.00 . A A .   3 SER HG   1 1 
        8  4353 1 1  3 SER N    N   19.638  11.326 -12.587 1.00 . A A .   3 SER N    1 1 
        8  4354 1 1  3 SER O    O   21.201   8.596 -11.121 1.00 . A A .   3 SER O    1 1 
        8  4355 1 1  3 SER OG   O   20.142   9.205 -14.898 1.00 . A A .   3 SER OG   1 1 
        8  4356 1 1  4 GLY C    C   19.139   8.227  -8.355 1.00 . A A .   4 GLY C    1 1 
        8  4357 1 1  4 GLY CA   C   19.936   9.427  -8.826 1.00 . A A .   4 GLY CA   1 1 
        8  4358 1 1  4 GLY H    H   18.836  10.457 -10.313 1.00 . A A .   4 GLY H    1 1 
        8  4359 1 1  4 GLY HA2  H   20.987   9.181  -8.802 1.00 . A A .   4 GLY HA2  1 1 
        8  4360 1 1  4 GLY HA3  H   19.754  10.252  -8.152 1.00 . A A .   4 GLY HA3  1 1 
        8  4361 1 1  4 GLY N    N   19.581   9.836 -10.172 1.00 . A A .   4 GLY N    1 1 
        8  4362 1 1  4 GLY O    O   18.430   8.298  -7.352 1.00 . A A .   4 GLY O    1 1 
        8  4363 1 1  5 SER C    C   19.469   4.694  -8.757 1.00 . A A .   5 SER C    1 1 
        8  4364 1 1  5 SER CA   C   18.535   5.900  -8.737 1.00 . A A .   5 SER CA   1 1 
        8  4365 1 1  5 SER CB   C   17.373   5.676  -9.707 1.00 . A A .   5 SER CB   1 1 
        8  4366 1 1  5 SER H    H   19.836   7.126  -9.872 1.00 . A A .   5 SER H    1 1 
        8  4367 1 1  5 SER HA   H   18.141   6.019  -7.739 1.00 . A A .   5 SER HA   1 1 
        8  4368 1 1  5 SER HB2  H   16.925   4.713  -9.512 1.00 . A A .   5 SER HB2  1 1 
        8  4369 1 1  5 SER HB3  H   16.635   6.452  -9.566 1.00 . A A .   5 SER HB3  1 1 
        8  4370 1 1  5 SER HG   H   18.746   5.463 -11.088 1.00 . A A .   5 SER HG   1 1 
        8  4371 1 1  5 SER N    N   19.255   7.120  -9.083 1.00 . A A .   5 SER N    1 1 
        8  4372 1 1  5 SER O    O   19.929   4.268  -9.817 1.00 . A A .   5 SER O    1 1 
        8  4373 1 1  5 SER OG   O   17.819   5.707 -11.052 1.00 . A A .   5 SER OG   1 1 
        8  4374 1 1  6 SER C    C   20.132   2.040  -6.374 1.00 . A A .   6 SER C    1 1 
        8  4375 1 1  6 SER CA   C   20.628   2.993  -7.458 1.00 . A A .   6 SER CA   1 1 
        8  4376 1 1  6 SER CB   C   22.055   3.445  -7.141 1.00 . A A .   6 SER CB   1 1 
        8  4377 1 1  6 SER H    H   19.348   4.532  -6.768 1.00 . A A .   6 SER H    1 1 
        8  4378 1 1  6 SER HA   H   20.626   2.474  -8.405 1.00 . A A .   6 SER HA   1 1 
        8  4379 1 1  6 SER HB2  H   22.020   4.325  -6.516 1.00 . A A .   6 SER HB2  1 1 
        8  4380 1 1  6 SER HB3  H   22.573   2.653  -6.620 1.00 . A A .   6 SER HB3  1 1 
        8  4381 1 1  6 SER HG   H   22.463   3.188  -9.040 1.00 . A A .   6 SER HG   1 1 
        8  4382 1 1  6 SER N    N   19.746   4.148  -7.578 1.00 . A A .   6 SER N    1 1 
        8  4383 1 1  6 SER O    O   19.270   2.392  -5.570 1.00 . A A .   6 SER O    1 1 
        8  4384 1 1  6 SER OG   O   22.767   3.755  -8.327 1.00 . A A .   6 SER OG   1 1 
        8  4385 1 1  7 GLY C    C   18.858  -0.623  -5.563 1.00 . A A .   7 GLY C    1 1 
        8  4386 1 1  7 GLY CA   C   20.287  -0.155  -5.372 1.00 . A A .   7 GLY CA   1 1 
        8  4387 1 1  7 GLY H    H   21.368   0.606  -7.026 1.00 . A A .   7 GLY H    1 1 
        8  4388 1 1  7 GLY HA2  H   20.946  -1.007  -5.443 1.00 . A A .   7 GLY HA2  1 1 
        8  4389 1 1  7 GLY HA3  H   20.382   0.280  -4.388 1.00 . A A .   7 GLY HA3  1 1 
        8  4390 1 1  7 GLY N    N   20.684   0.831  -6.360 1.00 . A A .   7 GLY N    1 1 
        8  4391 1 1  7 GLY O    O   17.915   0.041  -5.130 1.00 . A A .   7 GLY O    1 1 
        8  4392 1 1  8 THR C    C   16.735  -2.834  -5.176 1.00 . A A .   8 THR C    1 1 
        8  4393 1 1  8 THR CA   C   17.370  -2.325  -6.465 1.00 . A A .   8 THR CA   1 1 
        8  4394 1 1  8 THR CB   C   17.428  -3.478  -7.486 1.00 . A A .   8 THR CB   1 1 
        8  4395 1 1  8 THR CG2  C   18.261  -4.632  -6.951 1.00 . A A .   8 THR CG2  1 1 
        8  4396 1 1  8 THR H    H   19.484  -2.253  -6.536 1.00 . A A .   8 THR H    1 1 
        8  4397 1 1  8 THR HA   H   16.751  -1.540  -6.875 1.00 . A A .   8 THR HA   1 1 
        8  4398 1 1  8 THR HB   H   17.886  -3.112  -8.393 1.00 . A A .   8 THR HB   1 1 
        8  4399 1 1  8 THR HG1  H   15.861  -4.632  -7.168 1.00 . A A .   8 THR HG1  1 1 
        8  4400 1 1  8 THR HG21 H   17.783  -5.046  -6.076 1.00 . A A .   8 THR HG21 1 1 
        8  4401 1 1  8 THR HG22 H   19.246  -4.274  -6.687 1.00 . A A .   8 THR HG22 1 1 
        8  4402 1 1  8 THR HG23 H   18.347  -5.396  -7.710 1.00 . A A .   8 THR HG23 1 1 
        8  4403 1 1  8 THR N    N   18.694  -1.770  -6.215 1.00 . A A .   8 THR N    1 1 
        8  4404 1 1  8 THR O    O   17.376  -3.531  -4.390 1.00 . A A .   8 THR O    1 1 
        8  4405 1 1  8 THR OG1  O   16.104  -3.935  -7.783 1.00 . A A .   8 THR OG1  1 1 
        8  4406 1 1  9 ARG C    C   14.475  -4.404  -3.803 1.00 . A A .   9 ARG C    1 1 
        8  4407 1 1  9 ARG CA   C   14.749  -2.903  -3.772 1.00 . A A .   9 ARG CA   1 1 
        8  4408 1 1  9 ARG CB   C   13.431  -2.136  -3.649 1.00 . A A .   9 ARG CB   1 1 
        8  4409 1 1  9 ARG CD   C   14.373  -0.489  -2.001 1.00 . A A .   9 ARG CD   1 1 
        8  4410 1 1  9 ARG CG   C   13.611  -0.666  -3.305 1.00 . A A .   9 ARG CG   1 1 
        8  4411 1 1  9 ARG CZ   C   13.320   1.513  -1.040 1.00 . A A .   9 ARG CZ   1 1 
        8  4412 1 1  9 ARG H    H   15.013  -1.925  -5.630 1.00 . A A .   9 ARG H    1 1 
        8  4413 1 1  9 ARG HA   H   15.366  -2.679  -2.915 1.00 . A A .   9 ARG HA   1 1 
        8  4414 1 1  9 ARG HB2  H   12.902  -2.200  -4.589 1.00 . A A .   9 ARG HB2  1 1 
        8  4415 1 1  9 ARG HB3  H   12.832  -2.593  -2.876 1.00 . A A .   9 ARG HB3  1 1 
        8  4416 1 1  9 ARG HD2  H   13.907  -1.098  -1.241 1.00 . A A .   9 ARG HD2  1 1 
        8  4417 1 1  9 ARG HD3  H   15.392  -0.816  -2.148 1.00 . A A .   9 ARG HD3  1 1 
        8  4418 1 1  9 ARG HE   H   15.217   1.403  -1.646 1.00 . A A .   9 ARG HE   1 1 
        8  4419 1 1  9 ARG HG2  H   14.163  -0.185  -4.099 1.00 . A A .   9 ARG HG2  1 1 
        8  4420 1 1  9 ARG HG3  H   12.639  -0.207  -3.209 1.00 . A A .   9 ARG HG3  1 1 
        8  4421 1 1  9 ARG HH11 H   12.107  -0.095  -1.192 1.00 . A A .   9 ARG HH11 1 1 
        8  4422 1 1  9 ARG HH12 H   11.377   1.323  -0.516 1.00 . A A .   9 ARG HH12 1 1 
        8  4423 1 1  9 ARG HH21 H   14.267   3.277  -0.757 1.00 . A A .   9 ARG HH21 1 1 
        8  4424 1 1  9 ARG HH22 H   12.606   3.241  -0.270 1.00 . A A .   9 ARG HH22 1 1 
        8  4425 1 1  9 ARG N    N   15.471  -2.482  -4.966 1.00 . A A .   9 ARG N    1 1 
        8  4426 1 1  9 ARG NE   N   14.380   0.902  -1.556 1.00 . A A .   9 ARG NE   1 1 
        8  4427 1 1  9 ARG NH1  N   12.174   0.860  -0.905 1.00 . A A .   9 ARG NH1  1 1 
        8  4428 1 1  9 ARG NH2  N   13.404   2.781  -0.657 1.00 . A A .   9 ARG NH2  1 1 
        8  4429 1 1  9 ARG O    O   14.003  -4.937  -4.806 1.00 . A A .   9 ARG O    1 1 
        8  4430 1 1 10 GLU C    C   13.073  -6.843  -2.531 1.00 . A A .  10 GLU C    1 1 
        8  4431 1 1 10 GLU CA   C   14.562  -6.517  -2.599 1.00 . A A .  10 GLU CA   1 1 
        8  4432 1 1 10 GLU CB   C   15.275  -7.078  -1.367 1.00 . A A .  10 GLU CB   1 1 
        8  4433 1 1 10 GLU CD   C   15.676  -9.135   0.043 1.00 . A A .  10 GLU CD   1 1 
        8  4434 1 1 10 GLU CG   C   15.323  -8.596  -1.329 1.00 . A A .  10 GLU CG   1 1 
        8  4435 1 1 10 GLU H    H   15.148  -4.596  -1.930 1.00 . A A .  10 GLU H    1 1 
        8  4436 1 1 10 GLU HA   H   14.979  -6.975  -3.483 1.00 . A A .  10 GLU HA   1 1 
        8  4437 1 1 10 GLU HB2  H   16.288  -6.705  -1.351 1.00 . A A .  10 GLU HB2  1 1 
        8  4438 1 1 10 GLU HB3  H   14.761  -6.733  -0.481 1.00 . A A .  10 GLU HB3  1 1 
        8  4439 1 1 10 GLU HG2  H   14.355  -8.981  -1.613 1.00 . A A .  10 GLU HG2  1 1 
        8  4440 1 1 10 GLU HG3  H   16.066  -8.937  -2.036 1.00 . A A .  10 GLU HG3  1 1 
        8  4441 1 1 10 GLU N    N   14.775  -5.078  -2.697 1.00 . A A .  10 GLU N    1 1 
        8  4442 1 1 10 GLU O    O   12.601  -7.779  -3.178 1.00 . A A .  10 GLU O    1 1 
        8  4443 1 1 10 GLU OE1  O   14.931  -8.845   1.003 1.00 . A A .  10 GLU OE1  1 1 
        8  4444 1 1 10 GLU OE2  O   16.695  -9.846   0.158 1.00 . A A .  10 GLU OE2  1 1 
        8  4445 1 1 11 LYS C    C   10.201  -6.242  -2.944 1.00 . A A .  11 LYS C    1 1 
        8  4446 1 1 11 LYS CA   C   10.903  -6.270  -1.590 1.00 . A A .  11 LYS CA   1 1 
        8  4447 1 1 11 LYS CB   C   10.309  -5.197  -0.674 1.00 . A A .  11 LYS CB   1 1 
        8  4448 1 1 11 LYS CD   C   11.584  -5.411   1.479 1.00 . A A .  11 LYS CD   1 1 
        8  4449 1 1 11 LYS CE   C   11.700  -4.018   2.079 1.00 . A A .  11 LYS CE   1 1 
        8  4450 1 1 11 LYS CG   C   10.247  -5.610   0.786 1.00 . A A .  11 LYS CG   1 1 
        8  4451 1 1 11 LYS H    H   12.772  -5.336  -1.253 1.00 . A A .  11 LYS H    1 1 
        8  4452 1 1 11 LYS HA   H   10.751  -7.239  -1.140 1.00 . A A .  11 LYS HA   1 1 
        8  4453 1 1 11 LYS HB2  H   10.912  -4.304  -0.749 1.00 . A A .  11 LYS HB2  1 1 
        8  4454 1 1 11 LYS HB3  H    9.306  -4.973  -1.006 1.00 . A A .  11 LYS HB3  1 1 
        8  4455 1 1 11 LYS HD2  H   11.683  -6.140   2.270 1.00 . A A .  11 LYS HD2  1 1 
        8  4456 1 1 11 LYS HD3  H   12.378  -5.550   0.758 1.00 . A A .  11 LYS HD3  1 1 
        8  4457 1 1 11 LYS HE2  H   11.359  -3.298   1.351 1.00 . A A .  11 LYS HE2  1 1 
        8  4458 1 1 11 LYS HE3  H   11.073  -3.966   2.957 1.00 . A A .  11 LYS HE3  1 1 
        8  4459 1 1 11 LYS HG2  H    9.501  -5.013   1.288 1.00 . A A .  11 LYS HG2  1 1 
        8  4460 1 1 11 LYS HG3  H    9.974  -6.654   0.844 1.00 . A A .  11 LYS HG3  1 1 
        8  4461 1 1 11 LYS HZ1  H   13.116  -3.203   3.380 1.00 . A A .  11 LYS HZ1  1 1 
        8  4462 1 1 11 LYS HZ2  H   13.535  -3.079   1.745 1.00 . A A .  11 LYS HZ2  1 1 
        8  4463 1 1 11 LYS HZ3  H   13.662  -4.566   2.540 1.00 . A A .  11 LYS HZ3  1 1 
        8  4464 1 1 11 LYS N    N   12.338  -6.066  -1.743 1.00 . A A .  11 LYS N    1 1 
        8  4465 1 1 11 LYS NZ   N   13.101  -3.694   2.463 1.00 . A A .  11 LYS NZ   1 1 
        8  4466 1 1 11 LYS O    O   10.379  -5.322  -3.743 1.00 . A A .  11 LYS O    1 1 
        8  4467 1 1 12 PRO C    C    7.527  -6.350  -4.578 1.00 . A A .  12 PRO C    1 1 
        8  4468 1 1 12 PRO CA   C    8.639  -7.387  -4.467 1.00 . A A .  12 PRO CA   1 1 
        8  4469 1 1 12 PRO CB   C    8.049  -8.798  -4.402 1.00 . A A .  12 PRO CB   1 1 
        8  4470 1 1 12 PRO CD   C    9.126  -8.404  -2.304 1.00 . A A .  12 PRO CD   1 1 
        8  4471 1 1 12 PRO CG   C    7.961  -9.105  -2.947 1.00 . A A .  12 PRO CG   1 1 
        8  4472 1 1 12 PRO HA   H    9.291  -7.307  -5.324 1.00 . A A .  12 PRO HA   1 1 
        8  4473 1 1 12 PRO HB2  H    7.074  -8.805  -4.868 1.00 . A A .  12 PRO HB2  1 1 
        8  4474 1 1 12 PRO HB3  H    8.703  -9.489  -4.912 1.00 . A A .  12 PRO HB3  1 1 
        8  4475 1 1 12 PRO HD2  H    8.859  -8.055  -1.318 1.00 . A A .  12 PRO HD2  1 1 
        8  4476 1 1 12 PRO HD3  H    9.982  -9.061  -2.255 1.00 . A A .  12 PRO HD3  1 1 
        8  4477 1 1 12 PRO HG2  H    7.031  -8.729  -2.548 1.00 . A A .  12 PRO HG2  1 1 
        8  4478 1 1 12 PRO HG3  H    8.034 -10.171  -2.792 1.00 . A A .  12 PRO HG3  1 1 
        8  4479 1 1 12 PRO N    N    9.385  -7.272  -3.210 1.00 . A A .  12 PRO N    1 1 
        8  4480 1 1 12 PRO O    O    7.425  -5.639  -5.579 1.00 . A A .  12 PRO O    1 1 
        8  4481 1 1 13 TYR C    C    6.102  -3.888  -3.378 1.00 . A A .  13 TYR C    1 1 
        8  4482 1 1 13 TYR CA   C    5.590  -5.317  -3.528 1.00 . A A .  13 TYR CA   1 1 
        8  4483 1 1 13 TYR CB   C    4.624  -5.647  -2.389 1.00 . A A .  13 TYR CB   1 1 
        8  4484 1 1 13 TYR CD1  C    2.907  -7.254  -3.309 1.00 . A A .  13 TYR CD1  1 1 
        8  4485 1 1 13 TYR CD2  C    4.533  -8.097  -1.784 1.00 . A A .  13 TYR CD2  1 1 
        8  4486 1 1 13 TYR CE1  C    2.342  -8.510  -3.409 1.00 . A A .  13 TYR CE1  1 1 
        8  4487 1 1 13 TYR CE2  C    3.975  -9.358  -1.879 1.00 . A A .  13 TYR CE2  1 1 
        8  4488 1 1 13 TYR CG   C    4.010  -7.025  -2.496 1.00 . A A .  13 TYR CG   1 1 
        8  4489 1 1 13 TYR CZ   C    2.880  -9.559  -2.693 1.00 . A A .  13 TYR CZ   1 1 
        8  4490 1 1 13 TYR H    H    6.828  -6.860  -2.776 1.00 . A A .  13 TYR H    1 1 
        8  4491 1 1 13 TYR HA   H    5.065  -5.402  -4.468 1.00 . A A .  13 TYR HA   1 1 
        8  4492 1 1 13 TYR HB2  H    5.154  -5.593  -1.450 1.00 . A A .  13 TYR HB2  1 1 
        8  4493 1 1 13 TYR HB3  H    3.821  -4.925  -2.386 1.00 . A A .  13 TYR HB3  1 1 
        8  4494 1 1 13 TYR HD1  H    2.488  -6.430  -3.869 1.00 . A A .  13 TYR HD1  1 1 
        8  4495 1 1 13 TYR HD2  H    5.391  -7.937  -1.148 1.00 . A A .  13 TYR HD2  1 1 
        8  4496 1 1 13 TYR HE1  H    1.484  -8.668  -4.047 1.00 . A A .  13 TYR HE1  1 1 
        8  4497 1 1 13 TYR HE2  H    4.396 -10.179  -1.318 1.00 . A A .  13 TYR HE2  1 1 
        8  4498 1 1 13 TYR HH   H    2.088 -11.129  -1.915 1.00 . A A .  13 TYR HH   1 1 
        8  4499 1 1 13 TYR N    N    6.696  -6.267  -3.545 1.00 . A A .  13 TYR N    1 1 
        8  4500 1 1 13 TYR O    O    6.861  -3.583  -2.459 1.00 . A A .  13 TYR O    1 1 
        8  4501 1 1 13 TYR OH   O    2.320 -10.812  -2.791 1.00 . A A .  13 TYR OH   1 1 
        8  4502 1 1 14 GLU C    C    4.883  -0.690  -4.297 1.00 . A A .  14 GLU C    1 1 
        8  4503 1 1 14 GLU CA   C    6.093  -1.618  -4.257 1.00 . A A .  14 GLU CA   1 1 
        8  4504 1 1 14 GLU CB   C    7.023  -1.313  -5.433 1.00 . A A .  14 GLU CB   1 1 
        8  4505 1 1 14 GLU CD   C    9.333  -1.891  -6.275 1.00 . A A .  14 GLU CD   1 1 
        8  4506 1 1 14 GLU CG   C    8.498  -1.441  -5.092 1.00 . A A .  14 GLU CG   1 1 
        8  4507 1 1 14 GLU H    H    5.073  -3.319  -4.996 1.00 . A A .  14 GLU H    1 1 
        8  4508 1 1 14 GLU HA   H    6.629  -1.452  -3.334 1.00 . A A .  14 GLU HA   1 1 
        8  4509 1 1 14 GLU HB2  H    6.800  -1.997  -6.239 1.00 . A A .  14 GLU HB2  1 1 
        8  4510 1 1 14 GLU HB3  H    6.839  -0.303  -5.769 1.00 . A A .  14 GLU HB3  1 1 
        8  4511 1 1 14 GLU HG2  H    8.862  -0.480  -4.759 1.00 . A A .  14 GLU HG2  1 1 
        8  4512 1 1 14 GLU HG3  H    8.609  -2.162  -4.296 1.00 . A A .  14 GLU HG3  1 1 
        8  4513 1 1 14 GLU N    N    5.678  -3.016  -4.287 1.00 . A A .  14 GLU N    1 1 
        8  4514 1 1 14 GLU O    O    3.839  -1.035  -4.852 1.00 . A A .  14 GLU O    1 1 
        8  4515 1 1 14 GLU OE1  O    8.868  -2.771  -7.030 1.00 . A A .  14 GLU OE1  1 1 
        8  4516 1 1 14 GLU OE2  O   10.452  -1.364  -6.445 1.00 . A A .  14 GLU OE2  1 1 
        8  4517 1 1 15 CYS C    C    3.890   2.258  -4.974 1.00 . A A .  15 CYS C    1 1 
        8  4518 1 1 15 CYS CA   C    3.950   1.469  -3.670 1.00 . A A .  15 CYS CA   1 1 
        8  4519 1 1 15 CYS CB   C    4.137   2.425  -2.490 1.00 . A A .  15 CYS CB   1 1 
        8  4520 1 1 15 CYS H    H    5.886   0.708  -3.278 1.00 . A A .  15 CYS H    1 1 
        8  4521 1 1 15 CYS HA   H    3.021   0.934  -3.544 1.00 . A A .  15 CYS HA   1 1 
        8  4522 1 1 15 CYS HB2  H    4.242   1.849  -1.582 1.00 . A A .  15 CYS HB2  1 1 
        8  4523 1 1 15 CYS HB3  H    5.034   3.006  -2.647 1.00 . A A .  15 CYS HB3  1 1 
        8  4524 1 1 15 CYS N    N    5.030   0.490  -3.704 1.00 . A A .  15 CYS N    1 1 
        8  4525 1 1 15 CYS O    O    4.909   2.744  -5.465 1.00 . A A .  15 CYS O    1 1 
        8  4526 1 1 15 CYS SG   S    2.756   3.589  -2.250 1.00 . A A .  15 CYS SG   1 1 
        8  4527 1 1 16 SER C    C    2.248   4.590  -6.513 1.00 . A A .  16 SER C    1 1 
        8  4528 1 1 16 SER CA   C    2.496   3.109  -6.779 1.00 . A A .  16 SER CA   1 1 
        8  4529 1 1 16 SER CB   C    1.323   2.517  -7.563 1.00 . A A .  16 SER CB   1 1 
        8  4530 1 1 16 SER H    H    1.915   1.971  -5.091 1.00 . A A .  16 SER H    1 1 
        8  4531 1 1 16 SER HA   H    3.397   3.006  -7.365 1.00 . A A .  16 SER HA   1 1 
        8  4532 1 1 16 SER HB2  H    1.259   1.457  -7.365 1.00 . A A .  16 SER HB2  1 1 
        8  4533 1 1 16 SER HB3  H    0.406   2.997  -7.251 1.00 . A A .  16 SER HB3  1 1 
        8  4534 1 1 16 SER HG   H    0.832   3.335  -9.273 1.00 . A A .  16 SER HG   1 1 
        8  4535 1 1 16 SER N    N    2.689   2.382  -5.530 1.00 . A A .  16 SER N    1 1 
        8  4536 1 1 16 SER O    O    1.759   5.314  -7.380 1.00 . A A .  16 SER O    1 1 
        8  4537 1 1 16 SER OG   O    1.490   2.712  -8.956 1.00 . A A .  16 SER OG   1 1 
        8  4538 1 1 17 GLU C    C    3.745   7.104  -4.662 1.00 . A A .  17 GLU C    1 1 
        8  4539 1 1 17 GLU CA   C    2.403   6.428  -4.925 1.00 . A A .  17 GLU CA   1 1 
        8  4540 1 1 17 GLU CB   C    1.517   6.526  -3.681 1.00 . A A .  17 GLU CB   1 1 
        8  4541 1 1 17 GLU CD   C   -0.902   6.323  -4.378 1.00 . A A .  17 GLU CD   1 1 
        8  4542 1 1 17 GLU CG   C    0.288   5.635  -3.738 1.00 . A A .  17 GLU CG   1 1 
        8  4543 1 1 17 GLU H    H    2.974   4.408  -4.658 1.00 . A A .  17 GLU H    1 1 
        8  4544 1 1 17 GLU HA   H    1.914   6.934  -5.744 1.00 . A A .  17 GLU HA   1 1 
        8  4545 1 1 17 GLU HB2  H    2.100   6.247  -2.816 1.00 . A A .  17 GLU HB2  1 1 
        8  4546 1 1 17 GLU HB3  H    1.189   7.549  -3.568 1.00 . A A .  17 GLU HB3  1 1 
        8  4547 1 1 17 GLU HG2  H    0.525   4.752  -4.311 1.00 . A A .  17 GLU HG2  1 1 
        8  4548 1 1 17 GLU HG3  H    0.020   5.348  -2.731 1.00 . A A .  17 GLU HG3  1 1 
        8  4549 1 1 17 GLU N    N    2.589   5.033  -5.307 1.00 . A A .  17 GLU N    1 1 
        8  4550 1 1 17 GLU O    O    3.960   8.254  -5.046 1.00 . A A .  17 GLU O    1 1 
        8  4551 1 1 17 GLU OE1  O   -0.699   7.357  -5.048 1.00 . A A .  17 GLU OE1  1 1 
        8  4552 1 1 17 GLU OE2  O   -2.036   5.827  -4.210 1.00 . A A .  17 GLU OE2  1 1 
        8  4553 1 1 18 CYS C    C    7.062   5.998  -4.230 1.00 . A A .  18 CYS C    1 1 
        8  4554 1 1 18 CYS CA   C    5.966   6.911  -3.685 1.00 . A A .  18 CYS CA   1 1 
        8  4555 1 1 18 CYS CB   C    6.125   7.070  -2.172 1.00 . A A .  18 CYS CB   1 1 
        8  4556 1 1 18 CYS H    H    4.415   5.471  -3.721 1.00 . A A .  18 CYS H    1 1 
        8  4557 1 1 18 CYS HA   H    6.057   7.880  -4.152 1.00 . A A .  18 CYS HA   1 1 
        8  4558 1 1 18 CYS HB2  H    7.123   7.424  -1.958 1.00 . A A .  18 CYS HB2  1 1 
        8  4559 1 1 18 CYS HB3  H    5.408   7.794  -1.816 1.00 . A A .  18 CYS HB3  1 1 
        8  4560 1 1 18 CYS N    N    4.645   6.382  -4.002 1.00 . A A .  18 CYS N    1 1 
        8  4561 1 1 18 CYS O    O    8.075   6.467  -4.747 1.00 . A A .  18 CYS O    1 1 
        8  4562 1 1 18 CYS SG   S    5.873   5.530  -1.232 1.00 . A A .  18 CYS SG   1 1 
        8  4563 1 1 19 GLY C    C    8.344   2.826  -3.495 1.00 . A A .  19 GLY C    1 1 
        8  4564 1 1 19 GLY CA   C    7.827   3.734  -4.594 1.00 . A A .  19 GLY CA   1 1 
        8  4565 1 1 19 GLY H    H    6.023   4.374  -3.688 1.00 . A A .  19 GLY H    1 1 
        8  4566 1 1 19 GLY HA2  H    7.370   3.127  -5.362 1.00 . A A .  19 GLY HA2  1 1 
        8  4567 1 1 19 GLY HA3  H    8.660   4.272  -5.022 1.00 . A A .  19 GLY HA3  1 1 
        8  4568 1 1 19 GLY N    N    6.850   4.691  -4.110 1.00 . A A .  19 GLY N    1 1 
        8  4569 1 1 19 GLY O    O    9.297   2.074  -3.697 1.00 . A A .  19 GLY O    1 1 
        8  4570 1 1 20 LYS C    C    8.181   0.603  -1.580 1.00 . A A .  20 LYS C    1 1 
        8  4571 1 1 20 LYS CA   C    8.116   2.076  -1.191 1.00 . A A .  20 LYS CA   1 1 
        8  4572 1 1 20 LYS CB   C    7.138   2.265  -0.029 1.00 . A A .  20 LYS CB   1 1 
        8  4573 1 1 20 LYS CD   C    7.094   2.876   2.407 1.00 . A A .  20 LYS CD   1 1 
        8  4574 1 1 20 LYS CE   C    7.660   2.575   3.787 1.00 . A A .  20 LYS CE   1 1 
        8  4575 1 1 20 LYS CG   C    7.762   2.030   1.336 1.00 . A A .  20 LYS CG   1 1 
        8  4576 1 1 20 LYS H    H    6.961   3.516  -2.227 1.00 . A A .  20 LYS H    1 1 
        8  4577 1 1 20 LYS HA   H    9.098   2.398  -0.879 1.00 . A A .  20 LYS HA   1 1 
        8  4578 1 1 20 LYS HB2  H    6.754   3.274  -0.057 1.00 . A A .  20 LYS HB2  1 1 
        8  4579 1 1 20 LYS HB3  H    6.317   1.573  -0.149 1.00 . A A .  20 LYS HB3  1 1 
        8  4580 1 1 20 LYS HD2  H    7.257   3.920   2.184 1.00 . A A .  20 LYS HD2  1 1 
        8  4581 1 1 20 LYS HD3  H    6.034   2.668   2.409 1.00 . A A .  20 LYS HD3  1 1 
        8  4582 1 1 20 LYS HE2  H    8.723   2.758   3.774 1.00 . A A .  20 LYS HE2  1 1 
        8  4583 1 1 20 LYS HE3  H    7.191   3.233   4.505 1.00 . A A .  20 LYS HE3  1 1 
        8  4584 1 1 20 LYS HG2  H    7.655   0.988   1.597 1.00 . A A .  20 LYS HG2  1 1 
        8  4585 1 1 20 LYS HG3  H    8.811   2.286   1.290 1.00 . A A .  20 LYS HG3  1 1 
        8  4586 1 1 20 LYS HZ1  H    7.020   0.626   3.393 1.00 . A A .  20 LYS HZ1  1 1 
        8  4587 1 1 20 LYS HZ2  H    6.742   1.130   4.984 1.00 . A A .  20 LYS HZ2  1 1 
        8  4588 1 1 20 LYS HZ3  H    8.306   0.717   4.489 1.00 . A A .  20 LYS HZ3  1 1 
        8  4589 1 1 20 LYS N    N    7.714   2.897  -2.327 1.00 . A A .  20 LYS N    1 1 
        8  4590 1 1 20 LYS NZ   N    7.415   1.163   4.191 1.00 . A A .  20 LYS NZ   1 1 
        8  4591 1 1 20 LYS O    O    7.893   0.239  -2.719 1.00 . A A .  20 LYS O    1 1 
        8  4592 1 1 21 ALA C    C    8.137  -2.470   0.323 1.00 . A A .  21 ALA C    1 1 
        8  4593 1 1 21 ALA CA   C    8.661  -1.674  -0.868 1.00 . A A .  21 ALA CA   1 1 
        8  4594 1 1 21 ALA CB   C   10.101  -2.060  -1.170 1.00 . A A .  21 ALA CB   1 1 
        8  4595 1 1 21 ALA H    H    8.778   0.110   0.264 1.00 . A A .  21 ALA H    1 1 
        8  4596 1 1 21 ALA HA   H    8.062  -1.908  -1.736 1.00 . A A .  21 ALA HA   1 1 
        8  4597 1 1 21 ALA HB1  H   10.621  -1.209  -1.585 1.00 . A A .  21 ALA HB1  1 1 
        8  4598 1 1 21 ALA HB2  H   10.589  -2.369  -0.257 1.00 . A A .  21 ALA HB2  1 1 
        8  4599 1 1 21 ALA HB3  H   10.115  -2.873  -1.879 1.00 . A A .  21 ALA HB3  1 1 
        8  4600 1 1 21 ALA N    N    8.561  -0.240  -0.625 1.00 . A A .  21 ALA N    1 1 
        8  4601 1 1 21 ALA O    O    8.158  -1.994   1.458 1.00 . A A .  21 ALA O    1 1 
        8  4602 1 1 22 PHE C    C    7.347  -6.016   0.762 1.00 . A A .  22 PHE C    1 1 
        8  4603 1 1 22 PHE CA   C    7.134  -4.545   1.106 1.00 . A A .  22 PHE CA   1 1 
        8  4604 1 1 22 PHE CB   C    5.643  -4.270   1.315 1.00 . A A .  22 PHE CB   1 1 
        8  4605 1 1 22 PHE CD1  C    5.263  -1.885   0.633 1.00 . A A .  22 PHE CD1  1 1 
        8  4606 1 1 22 PHE CD2  C    5.128  -2.436   2.949 1.00 . A A .  22 PHE CD2  1 1 
        8  4607 1 1 22 PHE CE1  C    4.982  -0.564   0.927 1.00 . A A .  22 PHE CE1  1 1 
        8  4608 1 1 22 PHE CE2  C    4.846  -1.117   3.249 1.00 . A A .  22 PHE CE2  1 1 
        8  4609 1 1 22 PHE CG   C    5.338  -2.835   1.639 1.00 . A A .  22 PHE CG   1 1 
        8  4610 1 1 22 PHE CZ   C    4.775  -0.179   2.237 1.00 . A A .  22 PHE CZ   1 1 
        8  4611 1 1 22 PHE H    H    7.675  -4.007  -0.869 1.00 . A A .  22 PHE H    1 1 
        8  4612 1 1 22 PHE HA   H    7.664  -4.320   2.018 1.00 . A A .  22 PHE HA   1 1 
        8  4613 1 1 22 PHE HB2  H    5.107  -4.527   0.414 1.00 . A A .  22 PHE HB2  1 1 
        8  4614 1 1 22 PHE HB3  H    5.283  -4.879   2.130 1.00 . A A .  22 PHE HB3  1 1 
        8  4615 1 1 22 PHE HD1  H    5.426  -2.185  -0.393 1.00 . A A .  22 PHE HD1  1 1 
        8  4616 1 1 22 PHE HD2  H    5.185  -3.168   3.741 1.00 . A A .  22 PHE HD2  1 1 
        8  4617 1 1 22 PHE HE1  H    4.927   0.166   0.134 1.00 . A A .  22 PHE HE1  1 1 
        8  4618 1 1 22 PHE HE2  H    4.685  -0.819   4.274 1.00 . A A .  22 PHE HE2  1 1 
        8  4619 1 1 22 PHE HZ   H    4.555   0.852   2.470 1.00 . A A .  22 PHE HZ   1 1 
        8  4620 1 1 22 PHE N    N    7.665  -3.684   0.056 1.00 . A A .  22 PHE N    1 1 
        8  4621 1 1 22 PHE O    O    7.735  -6.353  -0.357 1.00 . A A .  22 PHE O    1 1 
        8  4622 1 1 23 ILE C    C    5.946  -8.969   1.096 1.00 . A A .  23 ILE C    1 1 
        8  4623 1 1 23 ILE CA   C    7.256  -8.322   1.533 1.00 . A A .  23 ILE CA   1 1 
        8  4624 1 1 23 ILE CB   C    7.755  -9.015   2.815 1.00 . A A .  23 ILE CB   1 1 
        8  4625 1 1 23 ILE CD1  C    9.303  -8.478   4.763 1.00 . A A .  23 ILE CD1  1 1 
        8  4626 1 1 23 ILE CG1  C    9.082  -8.403   3.268 1.00 . A A .  23 ILE CG1  1 1 
        8  4627 1 1 23 ILE CG2  C    7.907 -10.511   2.583 1.00 . A A .  23 ILE CG2  1 1 
        8  4628 1 1 23 ILE H    H    6.786  -6.557   2.603 1.00 . A A .  23 ILE H    1 1 
        8  4629 1 1 23 ILE HA   H    7.994  -8.468   0.758 1.00 . A A .  23 ILE HA   1 1 
        8  4630 1 1 23 ILE HB   H    7.016  -8.868   3.588 1.00 . A A .  23 ILE HB   1 1 
        8  4631 1 1 23 ILE HD11 H   10.227  -9.001   4.964 1.00 . A A .  23 ILE HD11 1 1 
        8  4632 1 1 23 ILE HD12 H    9.360  -7.479   5.169 1.00 . A A .  23 ILE HD12 1 1 
        8  4633 1 1 23 ILE HD13 H    8.482  -9.008   5.222 1.00 . A A .  23 ILE HD13 1 1 
        8  4634 1 1 23 ILE HG12 H    9.895  -8.924   2.787 1.00 . A A .  23 ILE HG12 1 1 
        8  4635 1 1 23 ILE HG13 H    9.107  -7.362   2.980 1.00 . A A .  23 ILE HG13 1 1 
        8  4636 1 1 23 ILE HG21 H    6.935 -10.980   2.609 1.00 . A A .  23 ILE HG21 1 1 
        8  4637 1 1 23 ILE HG22 H    8.362 -10.681   1.619 1.00 . A A .  23 ILE HG22 1 1 
        8  4638 1 1 23 ILE HG23 H    8.531 -10.934   3.355 1.00 . A A .  23 ILE HG23 1 1 
        8  4639 1 1 23 ILE N    N    7.092  -6.887   1.733 1.00 . A A .  23 ILE N    1 1 
        8  4640 1 1 23 ILE O    O    5.931  -9.830   0.216 1.00 . A A .  23 ILE O    1 1 
        8  4641 1 1 24 ARG C    C    2.584  -7.973   0.950 1.00 . A A .  24 ARG C    1 1 
        8  4642 1 1 24 ARG CA   C    3.533  -9.084   1.388 1.00 . A A .  24 ARG CA   1 1 
        8  4643 1 1 24 ARG CB   C    2.948  -9.823   2.593 1.00 . A A .  24 ARG CB   1 1 
        8  4644 1 1 24 ARG CD   C    3.052 -11.971   3.893 1.00 . A A .  24 ARG CD   1 1 
        8  4645 1 1 24 ARG CG   C    3.847 -10.926   3.127 1.00 . A A .  24 ARG CG   1 1 
        8  4646 1 1 24 ARG CZ   C    1.188 -13.516   3.463 1.00 . A A .  24 ARG CZ   1 1 
        8  4647 1 1 24 ARG H    H    4.925  -7.858   2.407 1.00 . A A .  24 ARG H    1 1 
        8  4648 1 1 24 ARG HA   H    3.652  -9.782   0.573 1.00 . A A .  24 ARG HA   1 1 
        8  4649 1 1 24 ARG HB2  H    2.776  -9.112   3.388 1.00 . A A .  24 ARG HB2  1 1 
        8  4650 1 1 24 ARG HB3  H    2.005 -10.265   2.306 1.00 . A A .  24 ARG HB3  1 1 
        8  4651 1 1 24 ARG HD2  H    3.742 -12.650   4.373 1.00 . A A .  24 ARG HD2  1 1 
        8  4652 1 1 24 ARG HD3  H    2.458 -11.473   4.644 1.00 . A A .  24 ARG HD3  1 1 
        8  4653 1 1 24 ARG HE   H    2.312 -12.664   2.052 1.00 . A A .  24 ARG HE   1 1 
        8  4654 1 1 24 ARG HG2  H    4.345 -11.405   2.297 1.00 . A A .  24 ARG HG2  1 1 
        8  4655 1 1 24 ARG HG3  H    4.582 -10.490   3.787 1.00 . A A .  24 ARG HG3  1 1 
        8  4656 1 1 24 ARG HH11 H    1.541 -13.133   5.414 1.00 . A A .  24 ARG HH11 1 1 
        8  4657 1 1 24 ARG HH12 H    0.230 -14.219   5.097 1.00 . A A .  24 ARG HH12 1 1 
        8  4658 1 1 24 ARG HH21 H    0.588 -14.094   1.621 1.00 . A A .  24 ARG HH21 1 1 
        8  4659 1 1 24 ARG HH22 H   -0.311 -14.766   2.939 1.00 . A A .  24 ARG HH22 1 1 
        8  4660 1 1 24 ARG N    N    4.848  -8.547   1.714 1.00 . A A .  24 ARG N    1 1 
        8  4661 1 1 24 ARG NE   N    2.168 -12.736   3.018 1.00 . A A .  24 ARG NE   1 1 
        8  4662 1 1 24 ARG NH1  N    0.969 -13.633   4.765 1.00 . A A .  24 ARG NH1  1 1 
        8  4663 1 1 24 ARG NH2  N    0.425 -14.180   2.604 1.00 . A A .  24 ARG NH2  1 1 
        8  4664 1 1 24 ARG O    O    2.550  -6.900   1.551 1.00 . A A .  24 ARG O    1 1 
        8  4665 1 1 25 ASN C    C    0.116  -6.574   0.515 1.00 . A A .  25 ASN C    1 1 
        8  4666 1 1 25 ASN CA   C    0.868  -7.259  -0.621 1.00 . A A .  25 ASN CA   1 1 
        8  4667 1 1 25 ASN CB   C   -0.125  -7.934  -1.570 1.00 . A A .  25 ASN CB   1 1 
        8  4668 1 1 25 ASN CG   C   -0.626  -6.992  -2.648 1.00 . A A .  25 ASN CG   1 1 
        8  4669 1 1 25 ASN H    H    1.889  -9.112  -0.539 1.00 . A A .  25 ASN H    1 1 
        8  4670 1 1 25 ASN HA   H    1.426  -6.515  -1.168 1.00 . A A .  25 ASN HA   1 1 
        8  4671 1 1 25 ASN HB2  H    0.359  -8.773  -2.049 1.00 . A A .  25 ASN HB2  1 1 
        8  4672 1 1 25 ASN HB3  H   -0.973  -8.288  -1.004 1.00 . A A .  25 ASN HB3  1 1 
        8  4673 1 1 25 ASN HD21 H   -0.704  -5.497  -1.339 1.00 . A A .  25 ASN HD21 1 1 
        8  4674 1 1 25 ASN HD22 H   -1.189  -5.110  -2.952 1.00 . A A .  25 ASN HD22 1 1 
        8  4675 1 1 25 ASN N    N    1.816  -8.238  -0.102 1.00 . A A .  25 ASN N    1 1 
        8  4676 1 1 25 ASN ND2  N   -0.864  -5.740  -2.275 1.00 . A A .  25 ASN ND2  1 1 
        8  4677 1 1 25 ASN O    O    0.088  -5.346   0.604 1.00 . A A .  25 ASN O    1 1 
        8  4678 1 1 25 ASN OD1  O   -0.797  -7.386  -3.802 1.00 . A A .  25 ASN OD1  1 1 
        8  4679 1 1 26 SER C    C   -0.543  -5.637   3.119 1.00 . A A .  26 SER C    1 1 
        8  4680 1 1 26 SER CA   C   -1.248  -6.847   2.513 1.00 . A A .  26 SER CA   1 1 
        8  4681 1 1 26 SER CB   C   -1.437  -7.928   3.579 1.00 . A A .  26 SER CB   1 1 
        8  4682 1 1 26 SER H    H   -0.434  -8.346   1.259 1.00 . A A .  26 SER H    1 1 
        8  4683 1 1 26 SER HA   H   -2.217  -6.539   2.149 1.00 . A A .  26 SER HA   1 1 
        8  4684 1 1 26 SER HB2  H   -0.476  -8.195   3.991 1.00 . A A .  26 SER HB2  1 1 
        8  4685 1 1 26 SER HB3  H   -2.073  -7.548   4.365 1.00 . A A .  26 SER HB3  1 1 
        8  4686 1 1 26 SER HG   H   -1.352  -9.669   2.685 1.00 . A A .  26 SER HG   1 1 
        8  4687 1 1 26 SER N    N   -0.493  -7.376   1.384 1.00 . A A .  26 SER N    1 1 
        8  4688 1 1 26 SER O    O   -1.180  -4.638   3.454 1.00 . A A .  26 SER O    1 1 
        8  4689 1 1 26 SER OG   O   -2.035  -9.088   3.028 1.00 . A A .  26 SER OG   1 1 
        8  4690 1 1 27 GLN C    C    1.481  -3.402   2.953 1.00 . A A .  27 GLN C    1 1 
        8  4691 1 1 27 GLN CA   C    1.567  -4.651   3.824 1.00 . A A .  27 GLN CA   1 1 
        8  4692 1 1 27 GLN CB   C    3.027  -5.082   3.976 1.00 . A A .  27 GLN CB   1 1 
        8  4693 1 1 27 GLN CD   C    4.485  -6.585   5.390 1.00 . A A .  27 GLN CD   1 1 
        8  4694 1 1 27 GLN CG   C    3.193  -6.455   4.606 1.00 . A A .  27 GLN CG   1 1 
        8  4695 1 1 27 GLN H    H    1.225  -6.558   2.972 1.00 . A A .  27 GLN H    1 1 
        8  4696 1 1 27 GLN HA   H    1.166  -4.422   4.799 1.00 . A A .  27 GLN HA   1 1 
        8  4697 1 1 27 GLN HB2  H    3.488  -5.099   3.000 1.00 . A A .  27 GLN HB2  1 1 
        8  4698 1 1 27 GLN HB3  H    3.540  -4.361   4.595 1.00 . A A .  27 GLN HB3  1 1 
        8  4699 1 1 27 GLN HE21 H    3.481  -7.217   6.985 1.00 . A A .  27 GLN HE21 1 1 
        8  4700 1 1 27 GLN HE22 H    5.195  -7.105   7.172 1.00 . A A .  27 GLN HE22 1 1 
        8  4701 1 1 27 GLN HG2  H    2.365  -6.633   5.275 1.00 . A A .  27 GLN HG2  1 1 
        8  4702 1 1 27 GLN HG3  H    3.188  -7.199   3.823 1.00 . A A .  27 GLN HG3  1 1 
        8  4703 1 1 27 GLN N    N    0.775  -5.736   3.257 1.00 . A A .  27 GLN N    1 1 
        8  4704 1 1 27 GLN NE2  N    4.377  -7.011   6.642 1.00 . A A .  27 GLN NE2  1 1 
        8  4705 1 1 27 GLN O    O    1.240  -2.301   3.449 1.00 . A A .  27 GLN O    1 1 
        8  4706 1 1 27 GLN OE1  O    5.568  -6.305   4.875 1.00 . A A .  27 GLN OE1  1 1 
        8  4707 1 1 28 LEU C    C    0.262  -1.785   0.751 1.00 . A A .  28 LEU C    1 1 
        8  4708 1 1 28 LEU CA   C    1.626  -2.467   0.710 1.00 . A A .  28 LEU CA   1 1 
        8  4709 1 1 28 LEU CB   C    1.920  -2.958  -0.709 1.00 . A A .  28 LEU CB   1 1 
        8  4710 1 1 28 LEU CD1  C    2.109  -0.694  -1.766 1.00 . A A .  28 LEU CD1  1 1 
        8  4711 1 1 28 LEU CD2  C    1.706  -2.707  -3.194 1.00 . A A .  28 LEU CD2  1 1 
        8  4712 1 1 28 LEU CG   C    1.438  -2.056  -1.845 1.00 . A A .  28 LEU CG   1 1 
        8  4713 1 1 28 LEU H    H    1.868  -4.480   1.315 1.00 . A A .  28 LEU H    1 1 
        8  4714 1 1 28 LEU HA   H    2.381  -1.752   0.998 1.00 . A A .  28 LEU HA   1 1 
        8  4715 1 1 28 LEU HB2  H    2.989  -3.069  -0.805 1.00 . A A .  28 LEU HB2  1 1 
        8  4716 1 1 28 LEU HB3  H    1.447  -3.923  -0.828 1.00 . A A .  28 LEU HB3  1 1 
        8  4717 1 1 28 LEU HD11 H    3.155  -0.793  -2.015 1.00 . A A .  28 LEU HD11 1 1 
        8  4718 1 1 28 LEU HD12 H    2.013  -0.302  -0.764 1.00 . A A .  28 LEU HD12 1 1 
        8  4719 1 1 28 LEU HD13 H    1.635  -0.018  -2.463 1.00 . A A .  28 LEU HD13 1 1 
        8  4720 1 1 28 LEU HD21 H    0.786  -3.115  -3.586 1.00 . A A .  28 LEU HD21 1 1 
        8  4721 1 1 28 LEU HD22 H    2.429  -3.500  -3.073 1.00 . A A .  28 LEU HD22 1 1 
        8  4722 1 1 28 LEU HD23 H    2.095  -1.968  -3.880 1.00 . A A .  28 LEU HD23 1 1 
        8  4723 1 1 28 LEU HG   H    0.371  -1.908  -1.751 1.00 . A A .  28 LEU HG   1 1 
        8  4724 1 1 28 LEU N    N    1.680  -3.580   1.651 1.00 . A A .  28 LEU N    1 1 
        8  4725 1 1 28 LEU O    O    0.171  -0.566   0.899 1.00 . A A .  28 LEU O    1 1 
        8  4726 1 1 29 ILE C    C   -2.341  -1.072   1.802 1.00 . A A .  29 ILE C    1 1 
        8  4727 1 1 29 ILE CA   C   -2.154  -2.052   0.649 1.00 . A A .  29 ILE CA   1 1 
        8  4728 1 1 29 ILE CB   C   -3.194  -3.181   0.777 1.00 . A A .  29 ILE CB   1 1 
        8  4729 1 1 29 ILE CD1  C   -3.779  -5.449  -0.219 1.00 . A A .  29 ILE CD1  1 1 
        8  4730 1 1 29 ILE CG1  C   -3.133  -4.100  -0.445 1.00 . A A .  29 ILE CG1  1 1 
        8  4731 1 1 29 ILE CG2  C   -4.590  -2.600   0.940 1.00 . A A .  29 ILE CG2  1 1 
        8  4732 1 1 29 ILE H    H   -0.658  -3.543   0.508 1.00 . A A .  29 ILE H    1 1 
        8  4733 1 1 29 ILE HA   H   -2.328  -1.533  -0.282 1.00 . A A .  29 ILE HA   1 1 
        8  4734 1 1 29 ILE HB   H   -2.963  -3.755   1.661 1.00 . A A .  29 ILE HB   1 1 
        8  4735 1 1 29 ILE HD11 H   -3.639  -5.747   0.810 1.00 . A A .  29 ILE HD11 1 1 
        8  4736 1 1 29 ILE HD12 H   -4.835  -5.384  -0.433 1.00 . A A .  29 ILE HD12 1 1 
        8  4737 1 1 29 ILE HD13 H   -3.323  -6.181  -0.870 1.00 . A A .  29 ILE HD13 1 1 
        8  4738 1 1 29 ILE HG12 H   -3.639  -3.625  -1.271 1.00 . A A .  29 ILE HG12 1 1 
        8  4739 1 1 29 ILE HG13 H   -2.099  -4.267  -0.710 1.00 . A A .  29 ILE HG13 1 1 
        8  4740 1 1 29 ILE HG21 H   -5.189  -2.855   0.078 1.00 . A A .  29 ILE HG21 1 1 
        8  4741 1 1 29 ILE HG22 H   -5.047  -3.007   1.829 1.00 . A A .  29 ILE HG22 1 1 
        8  4742 1 1 29 ILE HG23 H   -4.525  -1.526   1.028 1.00 . A A .  29 ILE HG23 1 1 
        8  4743 1 1 29 ILE N    N   -0.795  -2.579   0.623 1.00 . A A .  29 ILE N    1 1 
        8  4744 1 1 29 ILE O    O   -2.674   0.095   1.592 1.00 . A A .  29 ILE O    1 1 
        8  4745 1 1 30 VAL C    C   -1.498   0.591   4.055 1.00 . A A .  30 VAL C    1 1 
        8  4746 1 1 30 VAL CA   C   -2.264  -0.718   4.209 1.00 . A A .  30 VAL CA   1 1 
        8  4747 1 1 30 VAL CB   C   -1.763  -1.447   5.470 1.00 . A A .  30 VAL CB   1 1 
        8  4748 1 1 30 VAL CG1  C   -1.820  -0.525   6.678 1.00 . A A .  30 VAL CG1  1 1 
        8  4749 1 1 30 VAL CG2  C   -2.577  -2.709   5.714 1.00 . A A .  30 VAL CG2  1 1 
        8  4750 1 1 30 VAL H    H   -1.859  -2.491   3.126 1.00 . A A .  30 VAL H    1 1 
        8  4751 1 1 30 VAL HA   H   -3.313  -0.497   4.339 1.00 . A A .  30 VAL HA   1 1 
        8  4752 1 1 30 VAL HB   H   -0.734  -1.733   5.312 1.00 . A A .  30 VAL HB   1 1 
        8  4753 1 1 30 VAL HG11 H   -0.991   0.168   6.641 1.00 . A A .  30 VAL HG11 1 1 
        8  4754 1 1 30 VAL HG12 H   -2.750   0.024   6.670 1.00 . A A .  30 VAL HG12 1 1 
        8  4755 1 1 30 VAL HG13 H   -1.756  -1.112   7.583 1.00 . A A .  30 VAL HG13 1 1 
        8  4756 1 1 30 VAL HG21 H   -2.747  -2.829   6.774 1.00 . A A .  30 VAL HG21 1 1 
        8  4757 1 1 30 VAL HG22 H   -3.525  -2.629   5.204 1.00 . A A .  30 VAL HG22 1 1 
        8  4758 1 1 30 VAL HG23 H   -2.036  -3.565   5.337 1.00 . A A .  30 VAL HG23 1 1 
        8  4759 1 1 30 VAL N    N   -2.122  -1.553   3.022 1.00 . A A .  30 VAL N    1 1 
        8  4760 1 1 30 VAL O    O   -1.934   1.638   4.536 1.00 . A A .  30 VAL O    1 1 
        8  4761 1 1 31 HIS C    C   -0.128   2.596   2.075 1.00 . A A .  31 HIS C    1 1 
        8  4762 1 1 31 HIS CA   C    0.472   1.708   3.161 1.00 . A A .  31 HIS CA   1 1 
        8  4763 1 1 31 HIS CB   C    1.893   1.297   2.774 1.00 . A A .  31 HIS CB   1 1 
        8  4764 1 1 31 HIS CD2  C    3.053   2.991   1.188 1.00 . A A .  31 HIS CD2  1 1 
        8  4765 1 1 31 HIS CE1  C    4.152   4.141   2.697 1.00 . A A .  31 HIS CE1  1 1 
        8  4766 1 1 31 HIS CG   C    2.768   2.452   2.397 1.00 . A A .  31 HIS CG   1 1 
        8  4767 1 1 31 HIS H    H   -0.061  -0.337   3.021 1.00 . A A .  31 HIS H    1 1 
        8  4768 1 1 31 HIS HA   H    0.507   2.264   4.085 1.00 . A A .  31 HIS HA   1 1 
        8  4769 1 1 31 HIS HB2  H    2.354   0.790   3.608 1.00 . A A .  31 HIS HB2  1 1 
        8  4770 1 1 31 HIS HB3  H    1.849   0.624   1.929 1.00 . A A .  31 HIS HB3  1 1 
        8  4771 1 1 31 HIS HD1  H    3.474   3.051   4.290 1.00 . A A .  31 HIS HD1  1 1 
        8  4772 1 1 31 HIS HD2  H    2.672   2.658   0.232 1.00 . A A .  31 HIS HD2  1 1 
        8  4773 1 1 31 HIS HE1  H    4.792   4.873   3.165 1.00 . A A .  31 HIS HE1  1 1 
        8  4774 1 1 31 HIS N    N   -0.355   0.526   3.380 1.00 . A A .  31 HIS N    1 1 
        8  4775 1 1 31 HIS ND1  N    3.473   3.195   3.321 1.00 . A A .  31 HIS ND1  1 1 
        8  4776 1 1 31 HIS NE2  N    3.914   4.038   1.401 1.00 . A A .  31 HIS NE2  1 1 
        8  4777 1 1 31 HIS O    O    0.145   3.795   2.022 1.00 . A A .  31 HIS O    1 1 
        8  4778 1 1 32 GLN C    C   -2.860   3.413   0.605 1.00 . A A .  32 GLN C    1 1 
        8  4779 1 1 32 GLN CA   C   -1.579   2.737   0.127 1.00 . A A .  32 GLN CA   1 1 
        8  4780 1 1 32 GLN CB   C   -1.889   1.800  -1.042 1.00 . A A .  32 GLN CB   1 1 
        8  4781 1 1 32 GLN CD   C   -0.978   0.802  -3.177 1.00 . A A .  32 GLN CD   1 1 
        8  4782 1 1 32 GLN CG   C   -0.652   1.342  -1.799 1.00 . A A .  32 GLN CG   1 1 
        8  4783 1 1 32 GLN H    H   -1.121   1.041   1.307 1.00 . A A .  32 GLN H    1 1 
        8  4784 1 1 32 GLN HA   H   -0.888   3.497  -0.206 1.00 . A A .  32 GLN HA   1 1 
        8  4785 1 1 32 GLN HB2  H   -2.397   0.927  -0.663 1.00 . A A .  32 GLN HB2  1 1 
        8  4786 1 1 32 GLN HB3  H   -2.539   2.313  -1.736 1.00 . A A .  32 GLN HB3  1 1 
        8  4787 1 1 32 GLN HE21 H    0.515   1.850  -3.968 1.00 . A A .  32 GLN HE21 1 1 
        8  4788 1 1 32 GLN HE22 H   -0.398   0.890  -5.076 1.00 . A A .  32 GLN HE22 1 1 
        8  4789 1 1 32 GLN HG2  H    0.019   2.181  -1.908 1.00 . A A .  32 GLN HG2  1 1 
        8  4790 1 1 32 GLN HG3  H   -0.165   0.565  -1.229 1.00 . A A .  32 GLN HG3  1 1 
        8  4791 1 1 32 GLN N    N   -0.943   1.999   1.212 1.00 . A A .  32 GLN N    1 1 
        8  4792 1 1 32 GLN NE2  N   -0.210   1.223  -4.175 1.00 . A A .  32 GLN NE2  1 1 
        8  4793 1 1 32 GLN O    O   -3.304   4.403   0.025 1.00 . A A .  32 GLN O    1 1 
        8  4794 1 1 32 GLN OE1  O   -1.910   0.014  -3.343 1.00 . A A .  32 GLN OE1  1 1 
        8  4795 1 1 33 ARG C    C   -4.530   4.913   2.502 1.00 . A A .  33 ARG C    1 1 
        8  4796 1 1 33 ARG CA   C   -4.679   3.420   2.222 1.00 . A A .  33 ARG CA   1 1 
        8  4797 1 1 33 ARG CB   C   -5.056   2.684   3.509 1.00 . A A .  33 ARG CB   1 1 
        8  4798 1 1 33 ARG CD   C   -6.404   0.760   4.401 1.00 . A A .  33 ARG CD   1 1 
        8  4799 1 1 33 ARG CG   C   -5.497   1.248   3.282 1.00 . A A .  33 ARG CG   1 1 
        8  4800 1 1 33 ARG CZ   C   -6.326   0.702   6.858 1.00 . A A .  33 ARG CZ   1 1 
        8  4801 1 1 33 ARG H    H   -3.046   2.081   2.085 1.00 . A A .  33 ARG H    1 1 
        8  4802 1 1 33 ARG HA   H   -5.464   3.279   1.494 1.00 . A A .  33 ARG HA   1 1 
        8  4803 1 1 33 ARG HB2  H   -4.201   2.675   4.168 1.00 . A A .  33 ARG HB2  1 1 
        8  4804 1 1 33 ARG HB3  H   -5.865   3.215   3.988 1.00 . A A .  33 ARG HB3  1 1 
        8  4805 1 1 33 ARG HD2  H   -7.241   1.436   4.489 1.00 . A A .  33 ARG HD2  1 1 
        8  4806 1 1 33 ARG HD3  H   -6.763  -0.227   4.151 1.00 . A A .  33 ARG HD3  1 1 
        8  4807 1 1 33 ARG HE   H   -4.728   0.655   5.666 1.00 . A A .  33 ARG HE   1 1 
        8  4808 1 1 33 ARG HG2  H   -6.035   1.189   2.347 1.00 . A A .  33 ARG HG2  1 1 
        8  4809 1 1 33 ARG HG3  H   -4.623   0.615   3.236 1.00 . A A .  33 ARG HG3  1 1 
        8  4810 1 1 33 ARG HH11 H   -8.183   0.803   6.068 1.00 . A A .  33 ARG HH11 1 1 
        8  4811 1 1 33 ARG HH12 H   -8.114   0.762   7.799 1.00 . A A .  33 ARG HH12 1 1 
        8  4812 1 1 33 ARG HH21 H   -4.624   0.600   7.944 1.00 . A A .  33 ARG HH21 1 1 
        8  4813 1 1 33 ARG HH22 H   -6.089   0.647   8.865 1.00 . A A .  33 ARG HH22 1 1 
        8  4814 1 1 33 ARG N    N   -3.448   2.870   1.666 1.00 . A A .  33 ARG N    1 1 
        8  4815 1 1 33 ARG NE   N   -5.706   0.699   5.683 1.00 . A A .  33 ARG NE   1 1 
        8  4816 1 1 33 ARG NH1  N   -7.650   0.761   6.913 1.00 . A A .  33 ARG NH1  1 1 
        8  4817 1 1 33 ARG NH2  N   -5.622   0.645   7.981 1.00 . A A .  33 ARG NH2  1 1 
        8  4818 1 1 33 ARG O    O   -5.446   5.697   2.253 1.00 . A A .  33 ARG O    1 1 
        8  4819 1 1 34 THR C    C   -2.931   7.524   2.068 1.00 . A A .  34 THR C    1 1 
        8  4820 1 1 34 THR CA   C   -3.100   6.696   3.337 1.00 . A A .  34 THR CA   1 1 
        8  4821 1 1 34 THR CB   C   -1.836   6.843   4.204 1.00 . A A .  34 THR CB   1 1 
        8  4822 1 1 34 THR CG2  C   -0.595   6.435   3.425 1.00 . A A .  34 THR CG2  1 1 
        8  4823 1 1 34 THR H    H   -2.678   4.627   3.197 1.00 . A A .  34 THR H    1 1 
        8  4824 1 1 34 THR HA   H   -3.941   7.080   3.896 1.00 . A A .  34 THR HA   1 1 
        8  4825 1 1 34 THR HB   H   -1.931   6.197   5.065 1.00 . A A .  34 THR HB   1 1 
        8  4826 1 1 34 THR HG1  H   -2.038   8.791   3.973 1.00 . A A .  34 THR HG1  1 1 
        8  4827 1 1 34 THR HG21 H    0.149   6.053   4.108 1.00 . A A .  34 THR HG21 1 1 
        8  4828 1 1 34 THR HG22 H   -0.198   7.293   2.904 1.00 . A A .  34 THR HG22 1 1 
        8  4829 1 1 34 THR HG23 H   -0.855   5.668   2.710 1.00 . A A .  34 THR HG23 1 1 
        8  4830 1 1 34 THR N    N   -3.369   5.299   3.022 1.00 . A A .  34 THR N    1 1 
        8  4831 1 1 34 THR O    O   -3.326   8.689   2.018 1.00 . A A .  34 THR O    1 1 
        8  4832 1 1 34 THR OG1  O   -1.701   8.198   4.649 1.00 . A A .  34 THR OG1  1 1 
        8  4833 1 1 35 HIS C    C   -3.447   7.853  -0.942 1.00 . A A .  35 HIS C    1 1 
        8  4834 1 1 35 HIS CA   C   -2.123   7.596  -0.228 1.00 . A A .  35 HIS CA   1 1 
        8  4835 1 1 35 HIS CB   C   -1.201   6.767  -1.122 1.00 . A A .  35 HIS CB   1 1 
        8  4836 1 1 35 HIS CD2  C    1.241   6.272  -0.399 1.00 . A A .  35 HIS CD2  1 1 
        8  4837 1 1 35 HIS CE1  C    2.128   8.208  -0.923 1.00 . A A .  35 HIS CE1  1 1 
        8  4838 1 1 35 HIS CG   C    0.254   7.048  -0.906 1.00 . A A .  35 HIS CG   1 1 
        8  4839 1 1 35 HIS H    H   -2.051   5.985   1.144 1.00 . A A .  35 HIS H    1 1 
        8  4840 1 1 35 HIS HA   H   -1.651   8.544  -0.018 1.00 . A A .  35 HIS HA   1 1 
        8  4841 1 1 35 HIS HB2  H   -1.368   5.718  -0.926 1.00 . A A .  35 HIS HB2  1 1 
        8  4842 1 1 35 HIS HB3  H   -1.430   6.976  -2.157 1.00 . A A .  35 HIS HB3  1 1 
        8  4843 1 1 35 HIS HD1  H    0.386   9.029  -1.613 1.00 . A A .  35 HIS HD1  1 1 
        8  4844 1 1 35 HIS HD2  H    1.139   5.256  -0.043 1.00 . A A .  35 HIS HD2  1 1 
        8  4845 1 1 35 HIS HE1  H    2.840   9.007  -1.064 1.00 . A A .  35 HIS HE1  1 1 
        8  4846 1 1 35 HIS N    N   -2.343   6.914   1.043 1.00 . A A .  35 HIS N    1 1 
        8  4847 1 1 35 HIS ND1  N    0.842   8.255  -1.224 1.00 . A A .  35 HIS ND1  1 1 
        8  4848 1 1 35 HIS NE2  N    2.395   7.016  -0.421 1.00 . A A .  35 HIS NE2  1 1 
        8  4849 1 1 35 HIS O    O   -3.614   8.873  -1.610 1.00 . A A .  35 HIS O    1 1 
        8  4850 1 1 36 SER C    C   -6.494   8.181  -0.803 1.00 . A A .  36 SER C    1 1 
        8  4851 1 1 36 SER CA   C   -5.690   7.046  -1.431 1.00 . A A .  36 SER CA   1 1 
        8  4852 1 1 36 SER CB   C   -6.465   5.732  -1.314 1.00 . A A .  36 SER CB   1 1 
        8  4853 1 1 36 SER H    H   -4.190   6.131  -0.251 1.00 . A A .  36 SER H    1 1 
        8  4854 1 1 36 SER HA   H   -5.532   7.268  -2.476 1.00 . A A .  36 SER HA   1 1 
        8  4855 1 1 36 SER HB2  H   -6.602   5.489  -0.271 1.00 . A A .  36 SER HB2  1 1 
        8  4856 1 1 36 SER HB3  H   -7.430   5.842  -1.787 1.00 . A A .  36 SER HB3  1 1 
        8  4857 1 1 36 SER HG   H   -6.130   3.831  -1.650 1.00 . A A .  36 SER HG   1 1 
        8  4858 1 1 36 SER N    N   -4.384   6.922  -0.796 1.00 . A A .  36 SER N    1 1 
        8  4859 1 1 36 SER O    O   -7.285   8.842  -1.474 1.00 . A A .  36 SER O    1 1 
        8  4860 1 1 36 SER OG   O   -5.767   4.670  -1.941 1.00 . A A .  36 SER OG   1 1 
        8  4861 1 1 37 GLY C    C   -7.029  10.751   0.403 1.00 . A A .  37 GLY C    1 1 
        8  4862 1 1 37 GLY CA   C   -6.995   9.455   1.190 1.00 . A A .  37 GLY CA   1 1 
        8  4863 1 1 37 GLY H    H   -5.641   7.842   0.976 1.00 . A A .  37 GLY H    1 1 
        8  4864 1 1 37 GLY HA2  H   -8.009   9.131   1.373 1.00 . A A .  37 GLY HA2  1 1 
        8  4865 1 1 37 GLY HA3  H   -6.509   9.635   2.137 1.00 . A A .  37 GLY HA3  1 1 
        8  4866 1 1 37 GLY N    N   -6.284   8.400   0.491 1.00 . A A .  37 GLY N    1 1 
        8  4867 1 1 37 GLY O    O   -7.957  10.991  -0.368 1.00 . A A .  37 GLY O    1 1 
        8  4868 1 1 38 GLU C    C   -5.284  12.701  -1.465 1.00 . A A .  38 GLU C    1 1 
        8  4869 1 1 38 GLU CA   C   -5.934  12.866  -0.095 1.00 . A A .  38 GLU CA   1 1 
        8  4870 1 1 38 GLU CB   C   -5.144  13.877   0.738 1.00 . A A .  38 GLU CB   1 1 
        8  4871 1 1 38 GLU CD   C   -3.012  14.385   1.995 1.00 . A A .  38 GLU CD   1 1 
        8  4872 1 1 38 GLU CG   C   -3.743  13.408   1.095 1.00 . A A .  38 GLU CG   1 1 
        8  4873 1 1 38 GLU H    H   -5.305  11.339   1.228 1.00 . A A .  38 GLU H    1 1 
        8  4874 1 1 38 GLU HA   H   -6.940  13.234  -0.230 1.00 . A A .  38 GLU HA   1 1 
        8  4875 1 1 38 GLU HB2  H   -5.062  14.799   0.182 1.00 . A A .  38 GLU HB2  1 1 
        8  4876 1 1 38 GLU HB3  H   -5.681  14.067   1.656 1.00 . A A .  38 GLU HB3  1 1 
        8  4877 1 1 38 GLU HG2  H   -3.813  12.458   1.604 1.00 . A A .  38 GLU HG2  1 1 
        8  4878 1 1 38 GLU HG3  H   -3.175  13.286   0.184 1.00 . A A .  38 GLU HG3  1 1 
        8  4879 1 1 38 GLU N    N   -6.015  11.587   0.600 1.00 . A A .  38 GLU N    1 1 
        8  4880 1 1 38 GLU O    O   -4.565  13.584  -1.934 1.00 . A A .  38 GLU O    1 1 
        8  4881 1 1 38 GLU OE1  O   -2.773  15.530   1.555 1.00 . A A .  38 GLU OE1  1 1 
        8  4882 1 1 38 GLU OE2  O   -2.678  14.007   3.137 1.00 . A A .  38 GLU OE2  1 1 
        8  4883 1 1 39 SER C    C   -5.283  12.408  -4.395 1.00 . A A .  39 SER C    1 1 
        8  4884 1 1 39 SER CA   C   -4.976  11.278  -3.416 1.00 . A A .  39 SER CA   1 1 
        8  4885 1 1 39 SER CB   C   -5.528   9.957  -3.956 1.00 . A A .  39 SER CB   1 1 
        8  4886 1 1 39 SER H    H   -6.121  10.897  -1.676 1.00 . A A .  39 SER H    1 1 
        8  4887 1 1 39 SER HA   H   -3.906  11.193  -3.307 1.00 . A A .  39 SER HA   1 1 
        8  4888 1 1 39 SER HB2  H   -5.101   9.762  -4.928 1.00 . A A .  39 SER HB2  1 1 
        8  4889 1 1 39 SER HB3  H   -5.263   9.157  -3.280 1.00 . A A .  39 SER HB3  1 1 
        8  4890 1 1 39 SER HG   H   -7.306  10.516  -3.353 1.00 . A A .  39 SER HG   1 1 
        8  4891 1 1 39 SER N    N   -5.540  11.563  -2.102 1.00 . A A .  39 SER N    1 1 
        8  4892 1 1 39 SER O    O   -4.394  12.902  -5.088 1.00 . A A .  39 SER O    1 1 
        8  4893 1 1 39 SER OG   O   -6.939  10.005  -4.078 1.00 . A A .  39 SER OG   1 1 
        8  4894 1 1 40 GLY C    C   -7.814  14.919  -4.654 1.00 . A A .  40 GLY C    1 1 
        8  4895 1 1 40 GLY CA   C   -6.951  13.880  -5.342 1.00 . A A .  40 GLY CA   1 1 
        8  4896 1 1 40 GLY H    H   -7.214  12.381  -3.869 1.00 . A A .  40 GLY H    1 1 
        8  4897 1 1 40 GLY HA2  H   -6.066  14.362  -5.730 1.00 . A A .  40 GLY HA2  1 1 
        8  4898 1 1 40 GLY HA3  H   -7.507  13.454  -6.164 1.00 . A A .  40 GLY HA3  1 1 
        8  4899 1 1 40 GLY N    N   -6.548  12.812  -4.445 1.00 . A A .  40 GLY N    1 1 
        8  4900 1 1 40 GLY O    O   -9.043  14.854  -4.683 1.00 . A A .  40 GLY O    1 1 
        8  4901 1 1 41 PRO C    C   -8.580  17.934  -4.256 1.00 . A A .  41 PRO C    1 1 
        8  4902 1 1 41 PRO CA   C   -7.863  16.981  -3.306 1.00 . A A .  41 PRO CA   1 1 
        8  4903 1 1 41 PRO CB   C   -6.735  17.708  -2.569 1.00 . A A .  41 PRO CB   1 1 
        8  4904 1 1 41 PRO CD   C   -5.702  16.046  -3.942 1.00 . A A .  41 PRO CD   1 1 
        8  4905 1 1 41 PRO CG   C   -5.513  17.425  -3.374 1.00 . A A .  41 PRO CG   1 1 
        8  4906 1 1 41 PRO HA   H   -8.569  16.590  -2.589 1.00 . A A .  41 PRO HA   1 1 
        8  4907 1 1 41 PRO HB2  H   -6.949  18.767  -2.534 1.00 . A A .  41 PRO HB2  1 1 
        8  4908 1 1 41 PRO HB3  H   -6.646  17.319  -1.566 1.00 . A A .  41 PRO HB3  1 1 
        8  4909 1 1 41 PRO HD2  H   -5.257  15.978  -4.924 1.00 . A A .  41 PRO HD2  1 1 
        8  4910 1 1 41 PRO HD3  H   -5.277  15.304  -3.281 1.00 . A A .  41 PRO HD3  1 1 
        8  4911 1 1 41 PRO HG2  H   -5.421  18.149  -4.169 1.00 . A A .  41 PRO HG2  1 1 
        8  4912 1 1 41 PRO HG3  H   -4.641  17.452  -2.737 1.00 . A A .  41 PRO HG3  1 1 
        8  4913 1 1 41 PRO N    N   -7.166  15.905  -4.017 1.00 . A A .  41 PRO N    1 1 
        8  4914 1 1 41 PRO O    O   -7.997  18.909  -4.729 1.00 . A A .  41 PRO O    1 1 
        8  4915 1 1 42 SER C    C  -11.606  19.359  -4.638 1.00 . A A .  42 SER C    1 1 
        8  4916 1 1 42 SER CA   C  -10.644  18.476  -5.427 1.00 . A A .  42 SER CA   1 1 
        8  4917 1 1 42 SER CB   C  -11.426  17.600  -6.408 1.00 . A A .  42 SER CB   1 1 
        8  4918 1 1 42 SER H    H  -10.257  16.854  -4.122 1.00 . A A .  42 SER H    1 1 
        8  4919 1 1 42 SER HA   H   -9.967  19.108  -5.982 1.00 . A A .  42 SER HA   1 1 
        8  4920 1 1 42 SER HB2  H  -11.979  16.854  -5.858 1.00 . A A .  42 SER HB2  1 1 
        8  4921 1 1 42 SER HB3  H  -12.112  18.217  -6.969 1.00 . A A .  42 SER HB3  1 1 
        8  4922 1 1 42 SER HG   H  -10.148  17.595  -7.893 1.00 . A A .  42 SER HG   1 1 
        8  4923 1 1 42 SER N    N   -9.848  17.646  -4.530 1.00 . A A .  42 SER N    1 1 
        8  4924 1 1 42 SER O    O  -12.753  18.984  -4.395 1.00 . A A .  42 SER O    1 1 
        8  4925 1 1 42 SER OG   O  -10.554  16.946  -7.314 1.00 . A A .  42 SER OG   1 1 
        8  4926 1 1 43 SER C    C  -11.830  22.883  -4.046 1.00 . A A .  43 SER C    1 1 
        8  4927 1 1 43 SER CA   C  -11.945  21.472  -3.477 1.00 . A A .  43 SER CA   1 1 
        8  4928 1 1 43 SER CB   C  -11.522  21.467  -2.007 1.00 . A A .  43 SER CB   1 1 
        8  4929 1 1 43 SER H    H  -10.207  20.777  -4.467 1.00 . A A .  43 SER H    1 1 
        8  4930 1 1 43 SER HA   H  -12.974  21.150  -3.548 1.00 . A A .  43 SER HA   1 1 
        8  4931 1 1 43 SER HB2  H  -11.416  20.447  -1.669 1.00 . A A .  43 SER HB2  1 1 
        8  4932 1 1 43 SER HB3  H  -10.577  21.980  -1.906 1.00 . A A .  43 SER HB3  1 1 
        8  4933 1 1 43 SER HG   H  -13.363  21.808  -1.430 1.00 . A A .  43 SER HG   1 1 
        8  4934 1 1 43 SER N    N  -11.130  20.535  -4.242 1.00 . A A .  43 SER N    1 1 
        8  4935 1 1 43 SER O    O  -10.962  23.657  -3.646 1.00 . A A .  43 SER O    1 1 
        8  4936 1 1 43 SER OG   O  -12.485  22.119  -1.197 1.00 . A A .  43 SER OG   1 1 
        8  4937 1 1 44 GLY C    C  -14.077  25.139  -5.695 1.00 . A A .  44 GLY C    1 1 
        8  4938 1 1 44 GLY CA   C  -12.694  24.526  -5.595 1.00 . A A .  44 GLY CA   1 1 
        8  4939 1 1 44 GLY H    H  -13.383  22.551  -5.266 1.00 . A A .  44 GLY H    1 1 
        8  4940 1 1 44 GLY HA2  H  -12.065  25.176  -5.005 1.00 . A A .  44 GLY HA2  1 1 
        8  4941 1 1 44 GLY HA3  H  -12.277  24.444  -6.588 1.00 . A A .  44 GLY HA3  1 1 
        8  4942 1 1 44 GLY N    N  -12.713  23.209  -4.985 1.00 . A A .  44 GLY N    1 1 
        8  4943 1 1 44 GLY O    O  -15.039  24.411  -5.936 1.00 . A A .  44 GLY O    1 1 
        8  4944 2 2  1 ZN  ZN   ZN   3.658   5.075  -0.671 1.00 . B A . 201 ZN  ZN   1 1 
        9  4945 1 1  1 GLY C    C   22.363   9.012 -21.503 1.00 . A A .   1 GLY C    1 1 
        9  4946 1 1  1 GLY CA   C   21.340   9.695 -22.389 1.00 . A A .   1 GLY CA   1 1 
        9  4947 1 1  1 GLY H1   H   21.893   9.009 -24.314 1.00 . A A .   1 GLY H1   1 1 
        9  4948 1 1  1 GLY HA2  H   21.145  10.683 -21.999 1.00 . A A .   1 GLY HA2  1 1 
        9  4949 1 1  1 GLY HA3  H   20.424   9.124 -22.368 1.00 . A A .   1 GLY HA3  1 1 
        9  4950 1 1  1 GLY N    N   21.787   9.813 -23.764 1.00 . A A .   1 GLY N    1 1 
        9  4951 1 1  1 GLY O    O   23.531   8.892 -21.871 1.00 . A A .   1 GLY O    1 1 
        9  4952 1 1  2 SER C    C   22.221   6.559 -18.941 1.00 . A A .   2 SER C    1 1 
        9  4953 1 1  2 SER CA   C   22.811   7.894 -19.388 1.00 . A A .   2 SER CA   1 1 
        9  4954 1 1  2 SER CB   C   23.063   8.786 -18.171 1.00 . A A .   2 SER CB   1 1 
        9  4955 1 1  2 SER H    H   20.981   8.690 -20.095 1.00 . A A .   2 SER H    1 1 
        9  4956 1 1  2 SER HA   H   23.749   7.709 -19.889 1.00 . A A .   2 SER HA   1 1 
        9  4957 1 1  2 SER HB2  H   22.173   9.356 -17.955 1.00 . A A .   2 SER HB2  1 1 
        9  4958 1 1  2 SER HB3  H   23.309   8.167 -17.320 1.00 . A A .   2 SER HB3  1 1 
        9  4959 1 1  2 SER HG   H   24.604   9.845 -17.588 1.00 . A A .   2 SER HG   1 1 
        9  4960 1 1  2 SER N    N   21.924   8.564 -20.331 1.00 . A A .   2 SER N    1 1 
        9  4961 1 1  2 SER O    O   21.010   6.432 -18.763 1.00 . A A .   2 SER O    1 1 
        9  4962 1 1  2 SER OG   O   24.134   9.682 -18.409 1.00 . A A .   2 SER OG   1 1 
        9  4963 1 1  3 SER C    C   22.855   4.054 -16.840 1.00 . A A .   3 SER C    1 1 
        9  4964 1 1  3 SER CA   C   22.653   4.240 -18.341 1.00 . A A .   3 SER CA   1 1 
        9  4965 1 1  3 SER CB   C   23.420   3.162 -19.108 1.00 . A A .   3 SER CB   1 1 
        9  4966 1 1  3 SER H    H   24.040   5.731 -18.921 1.00 . A A .   3 SER H    1 1 
        9  4967 1 1  3 SER HA   H   21.600   4.150 -18.564 1.00 . A A .   3 SER HA   1 1 
        9  4968 1 1  3 SER HB2  H   24.480   3.319 -18.982 1.00 . A A .   3 SER HB2  1 1 
        9  4969 1 1  3 SER HB3  H   23.151   2.189 -18.721 1.00 . A A .   3 SER HB3  1 1 
        9  4970 1 1  3 SER HG   H   23.862   2.879 -20.996 1.00 . A A .   3 SER HG   1 1 
        9  4971 1 1  3 SER N    N   23.087   5.567 -18.763 1.00 . A A .   3 SER N    1 1 
        9  4972 1 1  3 SER O    O   21.956   3.603 -16.132 1.00 . A A .   3 SER O    1 1 
        9  4973 1 1  3 SER OG   O   23.113   3.204 -20.491 1.00 . A A .   3 SER OG   1 1 
        9  4974 1 1  4 GLY C    C   23.908   2.932 -14.388 1.00 . A A .   4 GLY C    1 1 
        9  4975 1 1  4 GLY CA   C   24.346   4.271 -14.949 1.00 . A A .   4 GLY CA   1 1 
        9  4976 1 1  4 GLY H    H   24.724   4.761 -16.973 1.00 . A A .   4 GLY H    1 1 
        9  4977 1 1  4 GLY HA2  H   25.411   4.378 -14.806 1.00 . A A .   4 GLY HA2  1 1 
        9  4978 1 1  4 GLY HA3  H   23.839   5.057 -14.408 1.00 . A A .   4 GLY HA3  1 1 
        9  4979 1 1  4 GLY N    N   24.045   4.406 -16.362 1.00 . A A .   4 GLY N    1 1 
        9  4980 1 1  4 GLY O    O   24.344   1.882 -14.860 1.00 . A A .   4 GLY O    1 1 
        9  4981 1 1  5 SER C    C   21.484   2.067 -11.708 1.00 . A A .   5 SER C    1 1 
        9  4982 1 1  5 SER CA   C   22.552   1.748 -12.749 1.00 . A A .   5 SER CA   1 1 
        9  4983 1 1  5 SER CB   C   23.706   0.985 -12.096 1.00 . A A .   5 SER CB   1 1 
        9  4984 1 1  5 SER H    H   22.734   3.837 -13.047 1.00 . A A .   5 SER H    1 1 
        9  4985 1 1  5 SER HA   H   22.114   1.132 -13.520 1.00 . A A .   5 SER HA   1 1 
        9  4986 1 1  5 SER HB2  H   24.294   0.502 -12.861 1.00 . A A .   5 SER HB2  1 1 
        9  4987 1 1  5 SER HB3  H   24.327   1.678 -11.547 1.00 . A A .   5 SER HB3  1 1 
        9  4988 1 1  5 SER HG   H   22.332  -0.256 -11.455 1.00 . A A .   5 SER HG   1 1 
        9  4989 1 1  5 SER N    N   23.045   2.968 -13.378 1.00 . A A .   5 SER N    1 1 
        9  4990 1 1  5 SER O    O   21.646   2.978 -10.895 1.00 . A A .   5 SER O    1 1 
        9  4991 1 1  5 SER OG   O   23.222  -0.003 -11.202 1.00 . A A .   5 SER OG   1 1 
        9  4992 1 1  6 SER C    C   19.413   0.565  -9.611 1.00 . A A .   6 SER C    1 1 
        9  4993 1 1  6 SER CA   C   19.294   1.514 -10.800 1.00 . A A .   6 SER CA   1 1 
        9  4994 1 1  6 SER CB   C   17.951   1.305 -11.502 1.00 . A A .   6 SER CB   1 1 
        9  4995 1 1  6 SER H    H   20.322   0.600 -12.410 1.00 . A A .   6 SER H    1 1 
        9  4996 1 1  6 SER HA   H   19.349   2.531 -10.441 1.00 . A A .   6 SER HA   1 1 
        9  4997 1 1  6 SER HB2  H   18.063   0.559 -12.274 1.00 . A A .   6 SER HB2  1 1 
        9  4998 1 1  6 SER HB3  H   17.220   0.970 -10.780 1.00 . A A .   6 SER HB3  1 1 
        9  4999 1 1  6 SER HG   H   17.870   3.258 -11.628 1.00 . A A .   6 SER HG   1 1 
        9  5000 1 1  6 SER N    N   20.392   1.311 -11.739 1.00 . A A .   6 SER N    1 1 
        9  5001 1 1  6 SER O    O   19.558   0.999  -8.469 1.00 . A A .   6 SER O    1 1 
        9  5002 1 1  6 SER OG   O   17.491   2.508 -12.092 1.00 . A A .   6 SER OG   1 1 
        9  5003 1 1  7 GLY C    C   18.340  -2.752  -8.895 1.00 . A A .   7 GLY C    1 1 
        9  5004 1 1  7 GLY CA   C   19.452  -1.724  -8.834 1.00 . A A .   7 GLY CA   1 1 
        9  5005 1 1  7 GLY H    H   19.234  -1.021 -10.819 1.00 . A A .   7 GLY H    1 1 
        9  5006 1 1  7 GLY HA2  H   20.402  -2.230  -8.921 1.00 . A A .   7 GLY HA2  1 1 
        9  5007 1 1  7 GLY HA3  H   19.410  -1.221  -7.879 1.00 . A A .   7 GLY HA3  1 1 
        9  5008 1 1  7 GLY N    N   19.350  -0.733  -9.890 1.00 . A A .   7 GLY N    1 1 
        9  5009 1 1  7 GLY O    O   17.410  -2.626  -9.692 1.00 . A A .   7 GLY O    1 1 
        9  5010 1 1  8 THR C    C   16.661  -4.811  -6.699 1.00 . A A .   8 THR C    1 1 
        9  5011 1 1  8 THR CA   C   17.431  -4.831  -8.014 1.00 . A A .   8 THR CA   1 1 
        9  5012 1 1  8 THR CB   C   18.070  -6.221  -8.200 1.00 . A A .   8 THR CB   1 1 
        9  5013 1 1  8 THR CG2  C   17.024  -7.318  -8.075 1.00 . A A .   8 THR CG2  1 1 
        9  5014 1 1  8 THR H    H   19.200  -3.820  -7.440 1.00 . A A .   8 THR H    1 1 
        9  5015 1 1  8 THR HA   H   16.741  -4.664  -8.828 1.00 . A A .   8 THR HA   1 1 
        9  5016 1 1  8 THR HB   H   18.814  -6.364  -7.430 1.00 . A A .   8 THR HB   1 1 
        9  5017 1 1  8 THR HG1  H   18.274  -5.694 -10.089 1.00 . A A .   8 THR HG1  1 1 
        9  5018 1 1  8 THR HG21 H   17.505  -8.243  -7.797 1.00 . A A .   8 THR HG21 1 1 
        9  5019 1 1  8 THR HG22 H   16.521  -7.445  -9.022 1.00 . A A .   8 THR HG22 1 1 
        9  5020 1 1  8 THR HG23 H   16.304  -7.045  -7.318 1.00 . A A .   8 THR HG23 1 1 
        9  5021 1 1  8 THR N    N   18.435  -3.775  -8.051 1.00 . A A .   8 THR N    1 1 
        9  5022 1 1  8 THR O    O   17.090  -5.402  -5.708 1.00 . A A .   8 THR O    1 1 
        9  5023 1 1  8 THR OG1  O   18.703  -6.301  -9.482 1.00 . A A .   8 THR OG1  1 1 
        9  5024 1 1  9 ARG C    C   14.637  -5.366  -4.767 1.00 . A A .   9 ARG C    1 1 
        9  5025 1 1  9 ARG CA   C   14.690  -4.030  -5.503 1.00 . A A .   9 ARG CA   1 1 
        9  5026 1 1  9 ARG CB   C   13.275  -3.584  -5.875 1.00 . A A .   9 ARG CB   1 1 
        9  5027 1 1  9 ARG CD   C   12.816  -4.110  -8.289 1.00 . A A .   9 ARG CD   1 1 
        9  5028 1 1  9 ARG CG   C   12.576  -4.522  -6.845 1.00 . A A .   9 ARG CG   1 1 
        9  5029 1 1  9 ARG CZ   C   14.239  -4.809 -10.168 1.00 . A A .   9 ARG CZ   1 1 
        9  5030 1 1  9 ARG H    H   15.231  -3.678  -7.518 1.00 . A A .   9 ARG H    1 1 
        9  5031 1 1  9 ARG HA   H   15.131  -3.291  -4.851 1.00 . A A .   9 ARG HA   1 1 
        9  5032 1 1  9 ARG HB2  H   12.680  -3.524  -4.975 1.00 . A A .   9 ARG HB2  1 1 
        9  5033 1 1  9 ARG HB3  H   13.327  -2.606  -6.328 1.00 . A A .   9 ARG HB3  1 1 
        9  5034 1 1  9 ARG HD2  H   11.939  -4.354  -8.869 1.00 . A A .   9 ARG HD2  1 1 
        9  5035 1 1  9 ARG HD3  H   12.985  -3.044  -8.322 1.00 . A A .   9 ARG HD3  1 1 
        9  5036 1 1  9 ARG HE   H   14.576  -5.259  -8.255 1.00 . A A .   9 ARG HE   1 1 
        9  5037 1 1  9 ARG HG2  H   12.955  -5.523  -6.700 1.00 . A A .   9 ARG HG2  1 1 
        9  5038 1 1  9 ARG HG3  H   11.515  -4.504  -6.646 1.00 . A A .   9 ARG HG3  1 1 
        9  5039 1 1  9 ARG HH11 H   12.631  -3.700 -10.685 1.00 . A A .   9 ARG HH11 1 1 
        9  5040 1 1  9 ARG HH12 H   13.643  -4.199 -12.001 1.00 . A A .   9 ARG HH12 1 1 
        9  5041 1 1  9 ARG HH21 H   15.915  -5.922  -9.978 1.00 . A A .   9 ARG HH21 1 1 
        9  5042 1 1  9 ARG HH22 H   15.510  -5.464 -11.597 1.00 . A A .   9 ARG HH22 1 1 
        9  5043 1 1  9 ARG N    N   15.521  -4.128  -6.697 1.00 . A A .   9 ARG N    1 1 
        9  5044 1 1  9 ARG NE   N   13.971  -4.792  -8.867 1.00 . A A .   9 ARG NE   1 1 
        9  5045 1 1  9 ARG NH1  N   13.438  -4.185 -11.021 1.00 . A A .   9 ARG NH1  1 1 
        9  5046 1 1  9 ARG NH2  N   15.309  -5.451 -10.618 1.00 . A A .   9 ARG NH2  1 1 
        9  5047 1 1  9 ARG O    O   14.580  -6.426  -5.390 1.00 . A A .   9 ARG O    1 1 
        9  5048 1 1 10 GLU C    C   13.170  -6.948  -2.373 1.00 . A A .  10 GLU C    1 1 
        9  5049 1 1 10 GLU CA   C   14.611  -6.512  -2.620 1.00 . A A .  10 GLU CA   1 1 
        9  5050 1 1 10 GLU CB   C   15.320  -6.274  -1.285 1.00 . A A .  10 GLU CB   1 1 
        9  5051 1 1 10 GLU CD   C   17.511  -5.839  -0.105 1.00 . A A .  10 GLU CD   1 1 
        9  5052 1 1 10 GLU CG   C   16.779  -5.877  -1.433 1.00 . A A .  10 GLU CG   1 1 
        9  5053 1 1 10 GLU H    H   14.702  -4.431  -3.001 1.00 . A A .  10 GLU H    1 1 
        9  5054 1 1 10 GLU HA   H   15.125  -7.296  -3.155 1.00 . A A .  10 GLU HA   1 1 
        9  5055 1 1 10 GLU HB2  H   14.806  -5.488  -0.753 1.00 . A A .  10 GLU HB2  1 1 
        9  5056 1 1 10 GLU HB3  H   15.273  -7.181  -0.701 1.00 . A A .  10 GLU HB3  1 1 
        9  5057 1 1 10 GLU HG2  H   17.270  -6.592  -2.076 1.00 . A A .  10 GLU HG2  1 1 
        9  5058 1 1 10 GLU HG3  H   16.829  -4.896  -1.882 1.00 . A A .  10 GLU HG3  1 1 
        9  5059 1 1 10 GLU N    N   14.656  -5.306  -3.439 1.00 . A A .  10 GLU N    1 1 
        9  5060 1 1 10 GLU O    O   12.862  -8.140  -2.366 1.00 . A A .  10 GLU O    1 1 
        9  5061 1 1 10 GLU OE1  O   17.857  -6.922   0.412 1.00 . A A .  10 GLU OE1  1 1 
        9  5062 1 1 10 GLU OE2  O   17.738  -4.728   0.416 1.00 . A A .  10 GLU OE2  1 1 
        9  5063 1 1 11 LYS C    C   10.104  -6.337  -3.231 1.00 . A A .  11 LYS C    1 1 
        9  5064 1 1 11 LYS CA   C   10.881  -6.255  -1.921 1.00 . A A .  11 LYS CA   1 1 
        9  5065 1 1 11 LYS CB   C   10.274  -5.174  -1.024 1.00 . A A .  11 LYS CB   1 1 
        9  5066 1 1 11 LYS CD   C   11.703  -5.253   1.041 1.00 . A A .  11 LYS CD   1 1 
        9  5067 1 1 11 LYS CE   C   12.604  -6.472   0.908 1.00 . A A .  11 LYS CE   1 1 
        9  5068 1 1 11 LYS CG   C   10.325  -5.513   0.456 1.00 . A A .  11 LYS CG   1 1 
        9  5069 1 1 11 LYS H    H   12.596  -5.042  -2.186 1.00 . A A .  11 LYS H    1 1 
        9  5070 1 1 11 LYS HA   H   10.816  -7.207  -1.417 1.00 . A A .  11 LYS HA   1 1 
        9  5071 1 1 11 LYS HB2  H   10.812  -4.250  -1.179 1.00 . A A .  11 LYS HB2  1 1 
        9  5072 1 1 11 LYS HB3  H    9.240  -5.029  -1.303 1.00 . A A .  11 LYS HB3  1 1 
        9  5073 1 1 11 LYS HD2  H   12.157  -4.425   0.517 1.00 . A A .  11 LYS HD2  1 1 
        9  5074 1 1 11 LYS HD3  H   11.600  -5.005   2.088 1.00 . A A .  11 LYS HD3  1 1 
        9  5075 1 1 11 LYS HE2  H   12.550  -6.833  -0.108 1.00 . A A .  11 LYS HE2  1 1 
        9  5076 1 1 11 LYS HE3  H   13.619  -6.179   1.132 1.00 . A A .  11 LYS HE3  1 1 
        9  5077 1 1 11 LYS HG2  H    9.603  -4.905   0.981 1.00 . A A .  11 LYS HG2  1 1 
        9  5078 1 1 11 LYS HG3  H   10.080  -6.557   0.585 1.00 . A A .  11 LYS HG3  1 1 
        9  5079 1 1 11 LYS HZ1  H   12.500  -7.342   2.804 1.00 . A A .  11 LYS HZ1  1 1 
        9  5080 1 1 11 LYS HZ2  H   12.637  -8.461   1.542 1.00 . A A .  11 LYS HZ2  1 1 
        9  5081 1 1 11 LYS HZ3  H   11.164  -7.679   1.821 1.00 . A A .  11 LYS HZ3  1 1 
        9  5082 1 1 11 LYS N    N   12.290  -5.974  -2.169 1.00 . A A .  11 LYS N    1 1 
        9  5083 1 1 11 LYS NZ   N   12.198  -7.565   1.834 1.00 . A A .  11 LYS NZ   1 1 
        9  5084 1 1 11 LYS O    O   10.231  -5.485  -4.111 1.00 . A A .  11 LYS O    1 1 
        9  5085 1 1 12 PRO C    C    7.342  -6.579  -4.697 1.00 . A A .  12 PRO C    1 1 
        9  5086 1 1 12 PRO CA   C    8.464  -7.604  -4.565 1.00 . A A .  12 PRO CA   1 1 
        9  5087 1 1 12 PRO CB   C    7.887  -9.005  -4.353 1.00 . A A .  12 PRO CB   1 1 
        9  5088 1 1 12 PRO CD   C    9.078  -8.441  -2.359 1.00 . A A .  12 PRO CD   1 1 
        9  5089 1 1 12 PRO CG   C    7.883  -9.193  -2.875 1.00 . A A .  12 PRO CG   1 1 
        9  5090 1 1 12 PRO HA   H    9.067  -7.593  -5.462 1.00 . A A .  12 PRO HA   1 1 
        9  5091 1 1 12 PRO HB2  H    6.887  -9.051  -4.761 1.00 . A A .  12 PRO HB2  1 1 
        9  5092 1 1 12 PRO HB3  H    8.515  -9.735  -4.841 1.00 . A A .  12 PRO HB3  1 1 
        9  5093 1 1 12 PRO HD2  H    8.866  -8.013  -1.390 1.00 . A A .  12 PRO HD2  1 1 
        9  5094 1 1 12 PRO HD3  H    9.939  -9.091  -2.305 1.00 . A A .  12 PRO HD3  1 1 
        9  5095 1 1 12 PRO HG2  H    6.975  -8.787  -2.456 1.00 . A A .  12 PRO HG2  1 1 
        9  5096 1 1 12 PRO HG3  H    7.971 -10.243  -2.639 1.00 . A A .  12 PRO HG3  1 1 
        9  5097 1 1 12 PRO N    N    9.279  -7.386  -3.366 1.00 . A A .  12 PRO N    1 1 
        9  5098 1 1 12 PRO O    O    7.033  -6.121  -5.797 1.00 . A A .  12 PRO O    1 1 
        9  5099 1 1 13 TYR C    C    6.185  -3.832  -3.453 1.00 . A A .  13 TYR C    1 1 
        9  5100 1 1 13 TYR CA   C    5.647  -5.256  -3.559 1.00 . A A .  13 TYR CA   1 1 
        9  5101 1 1 13 TYR CB   C    4.694  -5.540  -2.397 1.00 . A A .  13 TYR CB   1 1 
        9  5102 1 1 13 TYR CD1  C    2.938  -7.165  -3.205 1.00 . A A .  13 TYR CD1  1 1 
        9  5103 1 1 13 TYR CD2  C    4.628  -7.976  -1.733 1.00 . A A .  13 TYR CD2  1 1 
        9  5104 1 1 13 TYR CE1  C    2.368  -8.422  -3.251 1.00 . A A .  13 TYR CE1  1 1 
        9  5105 1 1 13 TYR CE2  C    4.066  -9.237  -1.774 1.00 . A A .  13 TYR CE2  1 1 
        9  5106 1 1 13 TYR CG   C    4.075  -6.919  -2.445 1.00 . A A .  13 TYR CG   1 1 
        9  5107 1 1 13 TYR CZ   C    2.936  -9.455  -2.535 1.00 . A A .  13 TYR CZ   1 1 
        9  5108 1 1 13 TYR H    H    7.028  -6.625  -2.723 1.00 . A A .  13 TYR H    1 1 
        9  5109 1 1 13 TYR HA   H    5.105  -5.356  -4.488 1.00 . A A .  13 TYR HA   1 1 
        9  5110 1 1 13 TYR HB2  H    5.235  -5.453  -1.467 1.00 . A A .  13 TYR HB2  1 1 
        9  5111 1 1 13 TYR HB3  H    3.893  -4.816  -2.411 1.00 . A A .  13 TYR HB3  1 1 
        9  5112 1 1 13 TYR HD1  H    2.496  -6.354  -3.765 1.00 . A A .  13 TYR HD1  1 1 
        9  5113 1 1 13 TYR HD2  H    5.513  -7.802  -1.138 1.00 . A A .  13 TYR HD2  1 1 
        9  5114 1 1 13 TYR HE1  H    1.483  -8.594  -3.847 1.00 . A A .  13 TYR HE1  1 1 
        9  5115 1 1 13 TYR HE2  H    4.510 -10.046  -1.213 1.00 . A A .  13 TYR HE2  1 1 
        9  5116 1 1 13 TYR HH   H    1.550 -10.674  -3.075 1.00 . A A .  13 TYR HH   1 1 
        9  5117 1 1 13 TYR N    N    6.737  -6.225  -3.569 1.00 . A A .  13 TYR N    1 1 
        9  5118 1 1 13 TYR O    O    7.013  -3.533  -2.594 1.00 . A A .  13 TYR O    1 1 
        9  5119 1 1 13 TYR OH   O    2.372 -10.710  -2.580 1.00 . A A .  13 TYR OH   1 1 
        9  5120 1 1 14 GLU C    C    4.950  -0.628  -4.525 1.00 . A A .  14 GLU C    1 1 
        9  5121 1 1 14 GLU CA   C    6.139  -1.566  -4.340 1.00 . A A .  14 GLU CA   1 1 
        9  5122 1 1 14 GLU CB   C    7.164  -1.332  -5.452 1.00 . A A .  14 GLU CB   1 1 
        9  5123 1 1 14 GLU CD   C    9.522  -1.984  -6.084 1.00 . A A .  14 GLU CD   1 1 
        9  5124 1 1 14 GLU CG   C    8.605  -1.472  -4.989 1.00 . A A .  14 GLU CG   1 1 
        9  5125 1 1 14 GLU H    H    5.048  -3.258  -4.995 1.00 . A A .  14 GLU H    1 1 
        9  5126 1 1 14 GLU HA   H    6.601  -1.358  -3.387 1.00 . A A .  14 GLU HA   1 1 
        9  5127 1 1 14 GLU HB2  H    6.990  -2.047  -6.242 1.00 . A A .  14 GLU HB2  1 1 
        9  5128 1 1 14 GLU HB3  H    7.030  -0.335  -5.844 1.00 . A A .  14 GLU HB3  1 1 
        9  5129 1 1 14 GLU HG2  H    8.961  -0.506  -4.666 1.00 . A A .  14 GLU HG2  1 1 
        9  5130 1 1 14 GLU HG3  H    8.638  -2.163  -4.160 1.00 . A A .  14 GLU HG3  1 1 
        9  5131 1 1 14 GLU N    N    5.706  -2.959  -4.334 1.00 . A A .  14 GLU N    1 1 
        9  5132 1 1 14 GLU O    O    4.016  -0.930  -5.268 1.00 . A A .  14 GLU O    1 1 
        9  5133 1 1 14 GLU OE1  O    9.026  -2.675  -6.998 1.00 . A A .  14 GLU OE1  1 1 
        9  5134 1 1 14 GLU OE2  O   10.735  -1.693  -6.025 1.00 . A A .  14 GLU OE2  1 1 
        9  5135 1 1 15 CYS C    C    3.981   2.254  -5.251 1.00 . A A .  15 CYS C    1 1 
        9  5136 1 1 15 CYS CA   C    3.918   1.495  -3.929 1.00 . A A .  15 CYS CA   1 1 
        9  5137 1 1 15 CYS CB   C    4.003   2.478  -2.759 1.00 . A A .  15 CYS CB   1 1 
        9  5138 1 1 15 CYS H    H    5.763   0.696  -3.265 1.00 . A A .  15 CYS H    1 1 
        9  5139 1 1 15 CYS HA   H    2.979   0.966  -3.876 1.00 . A A .  15 CYS HA   1 1 
        9  5140 1 1 15 CYS HB2  H    4.001   1.923  -1.832 1.00 . A A .  15 CYS HB2  1 1 
        9  5141 1 1 15 CYS HB3  H    4.924   3.037  -2.835 1.00 . A A .  15 CYS HB3  1 1 
        9  5142 1 1 15 CYS N    N    4.991   0.512  -3.842 1.00 . A A .  15 CYS N    1 1 
        9  5143 1 1 15 CYS O    O    5.000   2.859  -5.584 1.00 . A A .  15 CYS O    1 1 
        9  5144 1 1 15 CYS SG   S    2.631   3.674  -2.692 1.00 . A A .  15 CYS SG   1 1 
        9  5145 1 1 16 SER C    C    2.545   4.388  -7.101 1.00 . A A .  16 SER C    1 1 
        9  5146 1 1 16 SER CA   C    2.815   2.898  -7.288 1.00 . A A .  16 SER CA   1 1 
        9  5147 1 1 16 SER CB   C    1.724   2.276  -8.161 1.00 . A A .  16 SER CB   1 1 
        9  5148 1 1 16 SER H    H    2.104   1.718  -5.681 1.00 . A A .  16 SER H    1 1 
        9  5149 1 1 16 SER HA   H    3.769   2.777  -7.779 1.00 . A A .  16 SER HA   1 1 
        9  5150 1 1 16 SER HB2  H    0.824   2.157  -7.577 1.00 . A A .  16 SER HB2  1 1 
        9  5151 1 1 16 SER HB3  H    1.525   2.925  -9.001 1.00 . A A .  16 SER HB3  1 1 
        9  5152 1 1 16 SER HG   H    2.538   1.109  -9.507 1.00 . A A .  16 SER HG   1 1 
        9  5153 1 1 16 SER N    N    2.884   2.217  -6.001 1.00 . A A .  16 SER N    1 1 
        9  5154 1 1 16 SER O    O    2.238   5.099  -8.058 1.00 . A A .  16 SER O    1 1 
        9  5155 1 1 16 SER OG   O    2.122   1.006  -8.648 1.00 . A A .  16 SER OG   1 1 
        9  5156 1 1 17 GLU C    C    3.744   6.977  -5.262 1.00 . A A .  17 GLU C    1 1 
        9  5157 1 1 17 GLU CA   C    2.429   6.258  -5.548 1.00 . A A .  17 GLU CA   1 1 
        9  5158 1 1 17 GLU CB   C    1.493   6.387  -4.344 1.00 . A A .  17 GLU CB   1 1 
        9  5159 1 1 17 GLU CD   C   -0.873   6.124  -5.190 1.00 . A A .  17 GLU CD   1 1 
        9  5160 1 1 17 GLU CG   C    0.271   5.487  -4.425 1.00 . A A .  17 GLU CG   1 1 
        9  5161 1 1 17 GLU H    H    2.909   4.237  -5.141 1.00 . A A .  17 GLU H    1 1 
        9  5162 1 1 17 GLU HA   H    1.961   6.716  -6.406 1.00 . A A .  17 GLU HA   1 1 
        9  5163 1 1 17 GLU HB2  H    2.041   6.136  -3.448 1.00 . A A .  17 GLU HB2  1 1 
        9  5164 1 1 17 GLU HB3  H    1.156   7.411  -4.274 1.00 . A A .  17 GLU HB3  1 1 
        9  5165 1 1 17 GLU HG2  H    0.547   4.569  -4.921 1.00 . A A .  17 GLU HG2  1 1 
        9  5166 1 1 17 GLU HG3  H   -0.065   5.267  -3.422 1.00 . A A .  17 GLU HG3  1 1 
        9  5167 1 1 17 GLU N    N    2.662   4.853  -5.861 1.00 . A A .  17 GLU N    1 1 
        9  5168 1 1 17 GLU O    O    3.965   8.098  -5.722 1.00 . A A .  17 GLU O    1 1 
        9  5169 1 1 17 GLU OE1  O   -0.856   6.069  -6.437 1.00 . A A .  17 GLU OE1  1 1 
        9  5170 1 1 17 GLU OE2  O   -1.785   6.679  -4.541 1.00 . A A .  17 GLU OE2  1 1 
        9  5171 1 1 18 CYS C    C    7.046   5.976  -4.574 1.00 . A A .  18 CYS C    1 1 
        9  5172 1 1 18 CYS CA   C    5.908   6.900  -4.150 1.00 . A A .  18 CYS CA   1 1 
        9  5173 1 1 18 CYS CB   C    5.983   7.162  -2.644 1.00 . A A .  18 CYS CB   1 1 
        9  5174 1 1 18 CYS H    H    4.381   5.433  -4.162 1.00 . A A .  18 CYS H    1 1 
        9  5175 1 1 18 CYS HA   H    6.007   7.837  -4.675 1.00 . A A .  18 CYS HA   1 1 
        9  5176 1 1 18 CYS HB2  H    6.953   7.574  -2.407 1.00 . A A .  18 CYS HB2  1 1 
        9  5177 1 1 18 CYS HB3  H    5.219   7.874  -2.372 1.00 . A A .  18 CYS HB3  1 1 
        9  5178 1 1 18 CYS N    N    4.615   6.324  -4.499 1.00 . A A .  18 CYS N    1 1 
        9  5179 1 1 18 CYS O    O    8.082   6.432  -5.058 1.00 . A A .  18 CYS O    1 1 
        9  5180 1 1 18 CYS SG   S    5.748   5.675  -1.618 1.00 . A A .  18 CYS SG   1 1 
        9  5181 1 1 19 GLY C    C    8.301   2.852  -3.587 1.00 . A A .  19 GLY C    1 1 
        9  5182 1 1 19 GLY CA   C    7.863   3.708  -4.758 1.00 . A A .  19 GLY CA   1 1 
        9  5183 1 1 19 GLY H    H    6.000   4.369  -4.000 1.00 . A A .  19 GLY H    1 1 
        9  5184 1 1 19 GLY HA2  H    7.471   3.067  -5.533 1.00 . A A .  19 GLY HA2  1 1 
        9  5185 1 1 19 GLY HA3  H    8.723   4.236  -5.144 1.00 . A A .  19 GLY HA3  1 1 
        9  5186 1 1 19 GLY N    N    6.846   4.675  -4.390 1.00 . A A .  19 GLY N    1 1 
        9  5187 1 1 19 GLY O    O    9.270   2.098  -3.686 1.00 . A A .  19 GLY O    1 1 
        9  5188 1 1 20 LYS C    C    8.047   0.715  -1.603 1.00 . A A .  20 LYS C    1 1 
        9  5189 1 1 20 LYS CA   C    7.906   2.198  -1.275 1.00 . A A .  20 LYS CA   1 1 
        9  5190 1 1 20 LYS CB   C    6.822   2.396  -0.213 1.00 . A A .  20 LYS CB   1 1 
        9  5191 1 1 20 LYS CD   C    6.557   2.882   2.237 1.00 . A A .  20 LYS CD   1 1 
        9  5192 1 1 20 LYS CE   C    7.048   2.564   3.641 1.00 . A A .  20 LYS CE   1 1 
        9  5193 1 1 20 LYS CG   C    7.278   2.045   1.193 1.00 . A A .  20 LYS CG   1 1 
        9  5194 1 1 20 LYS H    H    6.825   3.585  -2.455 1.00 . A A .  20 LYS H    1 1 
        9  5195 1 1 20 LYS HA   H    8.847   2.560  -0.889 1.00 . A A .  20 LYS HA   1 1 
        9  5196 1 1 20 LYS HB2  H    6.511   3.430  -0.221 1.00 . A A .  20 LYS HB2  1 1 
        9  5197 1 1 20 LYS HB3  H    5.975   1.772  -0.460 1.00 . A A .  20 LYS HB3  1 1 
        9  5198 1 1 20 LYS HD2  H    6.736   3.928   2.034 1.00 . A A .  20 LYS HD2  1 1 
        9  5199 1 1 20 LYS HD3  H    5.497   2.678   2.180 1.00 . A A .  20 LYS HD3  1 1 
        9  5200 1 1 20 LYS HE2  H    8.125   2.509   3.628 1.00 . A A .  20 LYS HE2  1 1 
        9  5201 1 1 20 LYS HE3  H    6.736   3.357   4.305 1.00 . A A .  20 LYS HE3  1 1 
        9  5202 1 1 20 LYS HG2  H    7.072   1.002   1.379 1.00 . A A .  20 LYS HG2  1 1 
        9  5203 1 1 20 LYS HG3  H    8.341   2.224   1.272 1.00 . A A .  20 LYS HG3  1 1 
        9  5204 1 1 20 LYS HZ1  H    7.279   0.619   4.367 1.00 . A A .  20 LYS HZ1  1 1 
        9  5205 1 1 20 LYS HZ2  H    5.898   0.835   3.414 1.00 . A A .  20 LYS HZ2  1 1 
        9  5206 1 1 20 LYS HZ3  H    5.935   1.430   4.997 1.00 . A A .  20 LYS HZ3  1 1 
        9  5207 1 1 20 LYS N    N    7.587   2.967  -2.472 1.00 . A A .  20 LYS N    1 1 
        9  5208 1 1 20 LYS NZ   N    6.502   1.271   4.140 1.00 . A A .  20 LYS NZ   1 1 
        9  5209 1 1 20 LYS O    O    7.879   0.305  -2.751 1.00 . A A .  20 LYS O    1 1 
        9  5210 1 1 21 ALA C    C    7.920  -2.292   0.408 1.00 . A A .  21 ALA C    1 1 
        9  5211 1 1 21 ALA CA   C    8.514  -1.522  -0.767 1.00 . A A .  21 ALA CA   1 1 
        9  5212 1 1 21 ALA CB   C    9.984  -1.872  -0.940 1.00 . A A .  21 ALA CB   1 1 
        9  5213 1 1 21 ALA H    H    8.476   0.302   0.305 1.00 . A A .  21 ALA H    1 1 
        9  5214 1 1 21 ALA HA   H    7.993  -1.805  -1.670 1.00 . A A .  21 ALA HA   1 1 
        9  5215 1 1 21 ALA HB1  H   10.583  -0.981  -0.822 1.00 . A A .  21 ALA HB1  1 1 
        9  5216 1 1 21 ALA HB2  H   10.271  -2.600  -0.194 1.00 . A A .  21 ALA HB2  1 1 
        9  5217 1 1 21 ALA HB3  H   10.142  -2.285  -1.925 1.00 . A A .  21 ALA HB3  1 1 
        9  5218 1 1 21 ALA N    N    8.355  -0.085  -0.587 1.00 . A A .  21 ALA N    1 1 
        9  5219 1 1 21 ALA O    O    7.730  -1.740   1.492 1.00 . A A .  21 ALA O    1 1 
        9  5220 1 1 22 PHE C    C    7.365  -5.885   0.966 1.00 . A A .  22 PHE C    1 1 
        9  5221 1 1 22 PHE CA   C    7.052  -4.414   1.225 1.00 . A A .  22 PHE CA   1 1 
        9  5222 1 1 22 PHE CB   C    5.538  -4.209   1.300 1.00 . A A .  22 PHE CB   1 1 
        9  5223 1 1 22 PHE CD1  C    5.178  -1.866   0.476 1.00 . A A .  22 PHE CD1  1 1 
        9  5224 1 1 22 PHE CD2  C    4.719  -2.345   2.766 1.00 . A A .  22 PHE CD2  1 1 
        9  5225 1 1 22 PHE CE1  C    4.809  -0.549   0.673 1.00 . A A .  22 PHE CE1  1 1 
        9  5226 1 1 22 PHE CE2  C    4.349  -1.029   2.970 1.00 . A A .  22 PHE CE2  1 1 
        9  5227 1 1 22 PHE CG   C    5.137  -2.778   1.518 1.00 . A A .  22 PHE CG   1 1 
        9  5228 1 1 22 PHE CZ   C    4.395  -0.129   1.922 1.00 . A A .  22 PHE CZ   1 1 
        9  5229 1 1 22 PHE H    H    7.801  -3.952  -0.701 1.00 . A A .  22 PHE H    1 1 
        9  5230 1 1 22 PHE HA   H    7.493  -4.125   2.167 1.00 . A A .  22 PHE HA   1 1 
        9  5231 1 1 22 PHE HB2  H    5.091  -4.541   0.375 1.00 . A A .  22 PHE HB2  1 1 
        9  5232 1 1 22 PHE HB3  H    5.142  -4.794   2.116 1.00 . A A .  22 PHE HB3  1 1 
        9  5233 1 1 22 PHE HD1  H    5.502  -2.193  -0.502 1.00 . A A .  22 PHE HD1  1 1 
        9  5234 1 1 22 PHE HD2  H    4.683  -3.046   3.586 1.00 . A A .  22 PHE HD2  1 1 
        9  5235 1 1 22 PHE HE1  H    4.847   0.151  -0.148 1.00 . A A .  22 PHE HE1  1 1 
        9  5236 1 1 22 PHE HE2  H    4.025  -0.703   3.947 1.00 . A A .  22 PHE HE2  1 1 
        9  5237 1 1 22 PHE HZ   H    4.106   0.899   2.079 1.00 . A A .  22 PHE HZ   1 1 
        9  5238 1 1 22 PHE N    N    7.627  -3.569   0.185 1.00 . A A .  22 PHE N    1 1 
        9  5239 1 1 22 PHE O    O    7.867  -6.245  -0.100 1.00 . A A .  22 PHE O    1 1 
        9  5240 1 1 23 ILE C    C    6.060  -8.900   1.379 1.00 . A A .  23 ILE C    1 1 
        9  5241 1 1 23 ILE CA   C    7.316  -8.160   1.825 1.00 . A A .  23 ILE CA   1 1 
        9  5242 1 1 23 ILE CB   C    7.807  -8.761   3.155 1.00 . A A .  23 ILE CB   1 1 
        9  5243 1 1 23 ILE CD1  C    8.662  -6.850   4.603 1.00 . A A .  23 ILE CD1  1 1 
        9  5244 1 1 23 ILE CG1  C    9.022  -7.987   3.672 1.00 . A A .  23 ILE CG1  1 1 
        9  5245 1 1 23 ILE CG2  C    8.147 -10.233   2.977 1.00 . A A .  23 ILE CG2  1 1 
        9  5246 1 1 23 ILE H    H    6.669  -6.382   2.772 1.00 . A A .  23 ILE H    1 1 
        9  5247 1 1 23 ILE HA   H    8.088  -8.302   1.082 1.00 . A A .  23 ILE HA   1 1 
        9  5248 1 1 23 ILE HB   H    7.008  -8.686   3.876 1.00 . A A .  23 ILE HB   1 1 
        9  5249 1 1 23 ILE HD11 H    7.664  -6.504   4.379 1.00 . A A .  23 ILE HD11 1 1 
        9  5250 1 1 23 ILE HD12 H    8.700  -7.196   5.626 1.00 . A A .  23 ILE HD12 1 1 
        9  5251 1 1 23 ILE HD13 H    9.362  -6.040   4.470 1.00 . A A .  23 ILE HD13 1 1 
        9  5252 1 1 23 ILE HG12 H    9.669  -8.662   4.209 1.00 . A A .  23 ILE HG12 1 1 
        9  5253 1 1 23 ILE HG13 H    9.559  -7.572   2.832 1.00 . A A .  23 ILE HG13 1 1 
        9  5254 1 1 23 ILE HG21 H    8.375 -10.427   1.940 1.00 . A A .  23 ILE HG21 1 1 
        9  5255 1 1 23 ILE HG22 H    9.004 -10.481   3.586 1.00 . A A .  23 ILE HG22 1 1 
        9  5256 1 1 23 ILE HG23 H    7.304 -10.837   3.280 1.00 . A A .  23 ILE HG23 1 1 
        9  5257 1 1 23 ILE N    N    7.067  -6.729   1.947 1.00 . A A .  23 ILE N    1 1 
        9  5258 1 1 23 ILE O    O    6.135  -9.883   0.641 1.00 . A A .  23 ILE O    1 1 
        9  5259 1 1 24 ARG C    C    2.637  -7.988   0.988 1.00 . A A .  24 ARG C    1 1 
        9  5260 1 1 24 ARG CA   C    3.632  -9.037   1.477 1.00 . A A .  24 ARG CA   1 1 
        9  5261 1 1 24 ARG CB   C    3.052  -9.785   2.679 1.00 . A A .  24 ARG CB   1 1 
        9  5262 1 1 24 ARG CD   C    3.238 -11.977   3.894 1.00 . A A .  24 ARG CD   1 1 
        9  5263 1 1 24 ARG CG   C    3.998 -10.818   3.268 1.00 . A A .  24 ARG CG   1 1 
        9  5264 1 1 24 ARG CZ   C    3.491 -13.904   2.389 1.00 . A A .  24 ARG CZ   1 1 
        9  5265 1 1 24 ARG H    H    4.910  -7.635   2.415 1.00 . A A .  24 ARG H    1 1 
        9  5266 1 1 24 ARG HA   H    3.814  -9.742   0.679 1.00 . A A .  24 ARG HA   1 1 
        9  5267 1 1 24 ARG HB2  H    2.810  -9.069   3.451 1.00 . A A .  24 ARG HB2  1 1 
        9  5268 1 1 24 ARG HB3  H    2.149 -10.290   2.371 1.00 . A A .  24 ARG HB3  1 1 
        9  5269 1 1 24 ARG HD2  H    3.897 -12.496   4.574 1.00 . A A .  24 ARG HD2  1 1 
        9  5270 1 1 24 ARG HD3  H    2.395 -11.582   4.442 1.00 . A A .  24 ARG HD3  1 1 
        9  5271 1 1 24 ARG HE   H    1.832 -12.813   2.575 1.00 . A A .  24 ARG HE   1 1 
        9  5272 1 1 24 ARG HG2  H    4.633 -11.201   2.483 1.00 . A A .  24 ARG HG2  1 1 
        9  5273 1 1 24 ARG HG3  H    4.605 -10.345   4.026 1.00 . A A .  24 ARG HG3  1 1 
        9  5274 1 1 24 ARG HH11 H    5.130 -13.459   3.484 1.00 . A A .  24 ARG HH11 1 1 
        9  5275 1 1 24 ARG HH12 H    5.295 -14.815   2.419 1.00 . A A .  24 ARG HH12 1 1 
        9  5276 1 1 24 ARG HH21 H    2.037 -14.597   1.168 1.00 . A A .  24 ARG HH21 1 1 
        9  5277 1 1 24 ARG HH22 H    3.535 -15.461   1.101 1.00 . A A .  24 ARG HH22 1 1 
        9  5278 1 1 24 ARG N    N    4.905  -8.421   1.830 1.00 . A A .  24 ARG N    1 1 
        9  5279 1 1 24 ARG NE   N    2.753 -12.920   2.890 1.00 . A A .  24 ARG NE   1 1 
        9  5280 1 1 24 ARG NH1  N    4.742 -14.073   2.797 1.00 . A A .  24 ARG NH1  1 1 
        9  5281 1 1 24 ARG NH2  N    2.979 -14.721   1.478 1.00 . A A .  24 ARG NH2  1 1 
        9  5282 1 1 24 ARG O    O    2.606  -6.867   1.493 1.00 . A A .  24 ARG O    1 1 
        9  5283 1 1 25 ASN C    C    0.082  -6.721   0.554 1.00 . A A .  25 ASN C    1 1 
        9  5284 1 1 25 ASN CA   C    0.833  -7.452  -0.554 1.00 . A A .  25 ASN CA   1 1 
        9  5285 1 1 25 ASN CB   C   -0.156  -8.222  -1.433 1.00 . A A .  25 ASN CB   1 1 
        9  5286 1 1 25 ASN CG   C   -0.713  -7.371  -2.558 1.00 . A A .  25 ASN CG   1 1 
        9  5287 1 1 25 ASN H    H    1.901  -9.269  -0.358 1.00 . A A .  25 ASN H    1 1 
        9  5288 1 1 25 ASN HA   H    1.351  -6.726  -1.162 1.00 . A A .  25 ASN HA   1 1 
        9  5289 1 1 25 ASN HB2  H    0.346  -9.074  -1.868 1.00 . A A .  25 ASN HB2  1 1 
        9  5290 1 1 25 ASN HB3  H   -0.979  -8.565  -0.824 1.00 . A A .  25 ASN HB3  1 1 
        9  5291 1 1 25 ASN HD21 H   -0.940  -5.834  -1.316 1.00 . A A .  25 ASN HD21 1 1 
        9  5292 1 1 25 ASN HD22 H   -1.424  -5.556  -2.951 1.00 . A A .  25 ASN HD22 1 1 
        9  5293 1 1 25 ASN N    N    1.827  -8.361   0.003 1.00 . A A .  25 ASN N    1 1 
        9  5294 1 1 25 ASN ND2  N   -1.061  -6.128  -2.243 1.00 . A A .  25 ASN ND2  1 1 
        9  5295 1 1 25 ASN O    O    0.082  -5.491   0.611 1.00 . A A .  25 ASN O    1 1 
        9  5296 1 1 25 ASN OD1  O   -0.830  -7.825  -3.696 1.00 . A A .  25 ASN OD1  1 1 
        9  5297 1 1 26 SER C    C   -0.549  -5.757   3.179 1.00 . A A .  26 SER C    1 1 
        9  5298 1 1 26 SER CA   C   -1.313  -6.912   2.540 1.00 . A A .  26 SER CA   1 1 
        9  5299 1 1 26 SER CB   C   -1.615  -7.982   3.590 1.00 . A A .  26 SER CB   1 1 
        9  5300 1 1 26 SER H    H   -0.519  -8.461   1.335 1.00 . A A .  26 SER H    1 1 
        9  5301 1 1 26 SER HA   H   -2.245  -6.536   2.143 1.00 . A A .  26 SER HA   1 1 
        9  5302 1 1 26 SER HB2  H   -2.109  -7.526   4.434 1.00 . A A .  26 SER HB2  1 1 
        9  5303 1 1 26 SER HB3  H   -2.260  -8.734   3.159 1.00 . A A .  26 SER HB3  1 1 
        9  5304 1 1 26 SER HG   H   -0.627  -9.484   4.369 1.00 . A A .  26 SER HG   1 1 
        9  5305 1 1 26 SER N    N   -0.556  -7.486   1.434 1.00 . A A .  26 SER N    1 1 
        9  5306 1 1 26 SER O    O   -1.142  -4.764   3.600 1.00 . A A .  26 SER O    1 1 
        9  5307 1 1 26 SER OG   O   -0.424  -8.605   4.040 1.00 . A A .  26 SER OG   1 1 
        9  5308 1 1 27 GLN C    C    1.607  -3.600   2.986 1.00 . A A .  27 GLN C    1 1 
        9  5309 1 1 27 GLN CA   C    1.617  -4.865   3.838 1.00 . A A .  27 GLN CA   1 1 
        9  5310 1 1 27 GLN CB   C    3.050  -5.378   3.993 1.00 . A A .  27 GLN CB   1 1 
        9  5311 1 1 27 GLN CD   C    3.305  -6.478   6.253 1.00 . A A .  27 GLN CD   1 1 
        9  5312 1 1 27 GLN CG   C    3.148  -6.687   4.760 1.00 . A A .  27 GLN CG   1 1 
        9  5313 1 1 27 GLN H    H    1.185  -6.710   2.896 1.00 . A A .  27 GLN H    1 1 
        9  5314 1 1 27 GLN HA   H    1.222  -4.629   4.814 1.00 . A A .  27 GLN HA   1 1 
        9  5315 1 1 27 GLN HB2  H    3.474  -5.528   3.011 1.00 . A A .  27 GLN HB2  1 1 
        9  5316 1 1 27 GLN HB3  H    3.632  -4.634   4.517 1.00 . A A .  27 GLN HB3  1 1 
        9  5317 1 1 27 GLN HE21 H    4.730  -7.862   6.321 1.00 . A A .  27 GLN HE21 1 1 
        9  5318 1 1 27 GLN HE22 H    4.340  -7.111   7.827 1.00 . A A .  27 GLN HE22 1 1 
        9  5319 1 1 27 GLN HG2  H    2.249  -7.260   4.585 1.00 . A A .  27 GLN HG2  1 1 
        9  5320 1 1 27 GLN HG3  H    4.002  -7.239   4.396 1.00 . A A .  27 GLN HG3  1 1 
        9  5321 1 1 27 GLN N    N    0.771  -5.896   3.249 1.00 . A A .  27 GLN N    1 1 
        9  5322 1 1 27 GLN NE2  N    4.217  -7.226   6.863 1.00 . A A .  27 GLN NE2  1 1 
        9  5323 1 1 27 GLN O    O    1.579  -2.485   3.510 1.00 . A A .  27 GLN O    1 1 
        9  5324 1 1 27 GLN OE1  O    2.615  -5.652   6.852 1.00 . A A .  27 GLN OE1  1 1 
        9  5325 1 1 28 LEU C    C    0.282  -1.929   0.775 1.00 . A A .  28 LEU C    1 1 
        9  5326 1 1 28 LEU CA   C    1.625  -2.651   0.744 1.00 . A A .  28 LEU CA   1 1 
        9  5327 1 1 28 LEU CB   C    1.927  -3.131  -0.677 1.00 . A A .  28 LEU CB   1 1 
        9  5328 1 1 28 LEU CD1  C    2.321  -0.843  -1.622 1.00 . A A .  28 LEU CD1  1 1 
        9  5329 1 1 28 LEU CD2  C    1.897  -2.771  -3.158 1.00 . A A .  28 LEU CD2  1 1 
        9  5330 1 1 28 LEU CG   C    1.577  -2.157  -1.803 1.00 . A A .  28 LEU CG   1 1 
        9  5331 1 1 28 LEU H    H    1.653  -4.690   1.311 1.00 . A A .  28 LEU H    1 1 
        9  5332 1 1 28 LEU HA   H    2.397  -1.963   1.055 1.00 . A A .  28 LEU HA   1 1 
        9  5333 1 1 28 LEU HB2  H    2.983  -3.341  -0.738 1.00 . A A .  28 LEU HB2  1 1 
        9  5334 1 1 28 LEU HB3  H    1.370  -4.043  -0.842 1.00 . A A .  28 LEU HB3  1 1 
        9  5335 1 1 28 LEU HD11 H    1.635  -0.085  -1.276 1.00 . A A .  28 LEU HD11 1 1 
        9  5336 1 1 28 LEU HD12 H    2.748  -0.538  -2.566 1.00 . A A .  28 LEU HD12 1 1 
        9  5337 1 1 28 LEU HD13 H    3.110  -0.973  -0.896 1.00 . A A .  28 LEU HD13 1 1 
        9  5338 1 1 28 LEU HD21 H    2.726  -2.244  -3.605 1.00 . A A .  28 LEU HD21 1 1 
        9  5339 1 1 28 LEU HD22 H    1.032  -2.694  -3.800 1.00 . A A .  28 LEU HD22 1 1 
        9  5340 1 1 28 LEU HD23 H    2.158  -3.811  -3.029 1.00 . A A .  28 LEU HD23 1 1 
        9  5341 1 1 28 LEU HG   H    0.517  -1.946  -1.772 1.00 . A A .  28 LEU HG   1 1 
        9  5342 1 1 28 LEU N    N    1.631  -3.779   1.670 1.00 . A A .  28 LEU N    1 1 
        9  5343 1 1 28 LEU O    O    0.223  -0.717   0.982 1.00 . A A .  28 LEU O    1 1 
        9  5344 1 1 29 ILE C    C   -2.329  -1.174   1.762 1.00 . A A .  29 ILE C    1 1 
        9  5345 1 1 29 ILE CA   C   -2.136  -2.113   0.576 1.00 . A A .  29 ILE CA   1 1 
        9  5346 1 1 29 ILE CB   C   -3.213  -3.213   0.626 1.00 . A A .  29 ILE CB   1 1 
        9  5347 1 1 29 ILE CD1  C   -3.801  -5.462  -0.411 1.00 . A A .  29 ILE CD1  1 1 
        9  5348 1 1 29 ILE CG1  C   -3.079  -4.144  -0.581 1.00 . A A .  29 ILE CG1  1 1 
        9  5349 1 1 29 ILE CG2  C   -4.601  -2.594   0.673 1.00 . A A .  29 ILE CG2  1 1 
        9  5350 1 1 29 ILE H    H   -0.682  -3.642   0.408 1.00 . A A .  29 ILE H    1 1 
        9  5351 1 1 29 ILE HA   H   -2.265  -1.552  -0.339 1.00 . A A .  29 ILE HA   1 1 
        9  5352 1 1 29 ILE HB   H   -3.069  -3.785   1.530 1.00 . A A .  29 ILE HB   1 1 
        9  5353 1 1 29 ILE HD11 H   -3.556  -5.884   0.553 1.00 . A A .  29 ILE HD11 1 1 
        9  5354 1 1 29 ILE HD12 H   -4.867  -5.300  -0.470 1.00 . A A .  29 ILE HD12 1 1 
        9  5355 1 1 29 ILE HD13 H   -3.495  -6.144  -1.190 1.00 . A A .  29 ILE HD13 1 1 
        9  5356 1 1 29 ILE HG12 H   -3.486  -3.654  -1.452 1.00 . A A .  29 ILE HG12 1 1 
        9  5357 1 1 29 ILE HG13 H   -2.033  -4.356  -0.748 1.00 . A A .  29 ILE HG13 1 1 
        9  5358 1 1 29 ILE HG21 H   -5.012  -2.555  -0.325 1.00 . A A .  29 ILE HG21 1 1 
        9  5359 1 1 29 ILE HG22 H   -5.242  -3.193   1.302 1.00 . A A .  29 ILE HG22 1 1 
        9  5360 1 1 29 ILE HG23 H   -4.536  -1.593   1.075 1.00 . A A .  29 ILE HG23 1 1 
        9  5361 1 1 29 ILE N    N   -0.794  -2.682   0.569 1.00 . A A .  29 ILE N    1 1 
        9  5362 1 1 29 ILE O    O   -2.747  -0.028   1.598 1.00 . A A .  29 ILE O    1 1 
        9  5363 1 1 30 VAL C    C   -1.522   0.504   4.000 1.00 . A A .  30 VAL C    1 1 
        9  5364 1 1 30 VAL CA   C   -2.155  -0.872   4.171 1.00 . A A .  30 VAL CA   1 1 
        9  5365 1 1 30 VAL CB   C   -1.509  -1.576   5.379 1.00 . A A .  30 VAL CB   1 1 
        9  5366 1 1 30 VAL CG1  C   -1.566  -0.684   6.610 1.00 . A A .  30 VAL CG1  1 1 
        9  5367 1 1 30 VAL CG2  C   -2.190  -2.910   5.644 1.00 . A A .  30 VAL CG2  1 1 
        9  5368 1 1 30 VAL H    H   -1.691  -2.588   3.023 1.00 . A A .  30 VAL H    1 1 
        9  5369 1 1 30 VAL HA   H   -3.209  -0.749   4.374 1.00 . A A .  30 VAL HA   1 1 
        9  5370 1 1 30 VAL HB   H   -0.471  -1.765   5.147 1.00 . A A .  30 VAL HB   1 1 
        9  5371 1 1 30 VAL HG11 H   -2.298   0.095   6.456 1.00 . A A .  30 VAL HG11 1 1 
        9  5372 1 1 30 VAL HG12 H   -1.843  -1.276   7.470 1.00 . A A .  30 VAL HG12 1 1 
        9  5373 1 1 30 VAL HG13 H   -0.596  -0.238   6.776 1.00 . A A .  30 VAL HG13 1 1 
        9  5374 1 1 30 VAL HG21 H   -2.921  -3.101   4.873 1.00 . A A .  30 VAL HG21 1 1 
        9  5375 1 1 30 VAL HG22 H   -1.451  -3.697   5.644 1.00 . A A .  30 VAL HG22 1 1 
        9  5376 1 1 30 VAL HG23 H   -2.682  -2.878   6.606 1.00 . A A .  30 VAL HG23 1 1 
        9  5377 1 1 30 VAL N    N   -2.019  -1.667   2.957 1.00 . A A .  30 VAL N    1 1 
        9  5378 1 1 30 VAL O    O   -2.039   1.504   4.499 1.00 . A A .  30 VAL O    1 1 
        9  5379 1 1 31 HIS C    C   -0.436   2.658   2.031 1.00 . A A .  31 HIS C    1 1 
        9  5380 1 1 31 HIS CA   C    0.307   1.803   3.053 1.00 . A A .  31 HIS CA   1 1 
        9  5381 1 1 31 HIS CB   C    1.730   1.529   2.567 1.00 . A A .  31 HIS CB   1 1 
        9  5382 1 1 31 HIS CD2  C    2.848   3.131   0.861 1.00 . A A .  31 HIS CD2  1 1 
        9  5383 1 1 31 HIS CE1  C    3.454   4.711   2.255 1.00 . A A .  31 HIS CE1  1 1 
        9  5384 1 1 31 HIS CG   C    2.451   2.756   2.099 1.00 . A A .  31 HIS CG   1 1 
        9  5385 1 1 31 HIS H    H   -0.035  -0.282   2.919 1.00 . A A .  31 HIS H    1 1 
        9  5386 1 1 31 HIS HA   H    0.352   2.341   3.988 1.00 . A A .  31 HIS HA   1 1 
        9  5387 1 1 31 HIS HB2  H    2.302   1.097   3.375 1.00 . A A .  31 HIS HB2  1 1 
        9  5388 1 1 31 HIS HB3  H    1.694   0.830   1.744 1.00 . A A .  31 HIS HB3  1 1 
        9  5389 1 1 31 HIS HD1  H    2.701   3.789   3.918 1.00 . A A .  31 HIS HD1  1 1 
        9  5390 1 1 31 HIS HD2  H    2.704   2.575  -0.055 1.00 . A A .  31 HIS HD2  1 1 
        9  5391 1 1 31 HIS HE1  H    3.869   5.624   2.656 1.00 . A A .  31 HIS HE1  1 1 
        9  5392 1 1 31 HIS N    N   -0.398   0.549   3.291 1.00 . A A .  31 HIS N    1 1 
        9  5393 1 1 31 HIS ND1  N    2.846   3.767   2.950 1.00 . A A .  31 HIS ND1  1 1 
        9  5394 1 1 31 HIS NE2  N    3.469   4.349   0.984 1.00 . A A .  31 HIS NE2  1 1 
        9  5395 1 1 31 HIS O    O   -0.475   3.883   2.144 1.00 . A A .  31 HIS O    1 1 
        9  5396 1 1 32 GLN C    C   -2.973   3.428   0.575 1.00 . A A .  32 GLN C    1 1 
        9  5397 1 1 32 GLN CA   C   -1.764   2.705  -0.008 1.00 . A A .  32 GLN CA   1 1 
        9  5398 1 1 32 GLN CB   C   -2.215   1.723  -1.091 1.00 . A A .  32 GLN CB   1 1 
        9  5399 1 1 32 GLN CD   C   -1.516   0.426  -3.144 1.00 . A A .  32 GLN CD   1 1 
        9  5400 1 1 32 GLN CG   C   -1.065   1.093  -1.859 1.00 . A A .  32 GLN CG   1 1 
        9  5401 1 1 32 GLN H    H   -0.957   1.027   0.999 1.00 . A A .  32 GLN H    1 1 
        9  5402 1 1 32 GLN HA   H   -1.103   3.434  -0.450 1.00 . A A .  32 GLN HA   1 1 
        9  5403 1 1 32 GLN HB2  H   -2.786   0.932  -0.628 1.00 . A A .  32 GLN HB2  1 1 
        9  5404 1 1 32 GLN HB3  H   -2.845   2.246  -1.795 1.00 . A A .  32 GLN HB3  1 1 
        9  5405 1 1 32 GLN HE21 H   -0.122   1.403  -4.170 1.00 . A A .  32 GLN HE21 1 1 
        9  5406 1 1 32 GLN HE22 H   -1.125   0.339  -5.091 1.00 . A A .  32 GLN HE22 1 1 
        9  5407 1 1 32 GLN HG2  H   -0.348   1.863  -2.105 1.00 . A A .  32 GLN HG2  1 1 
        9  5408 1 1 32 GLN HG3  H   -0.593   0.351  -1.232 1.00 . A A .  32 GLN HG3  1 1 
        9  5409 1 1 32 GLN N    N   -1.024   2.004   1.034 1.00 . A A .  32 GLN N    1 1 
        9  5410 1 1 32 GLN NE2  N   -0.855   0.756  -4.247 1.00 . A A .  32 GLN NE2  1 1 
        9  5411 1 1 32 GLN O    O   -3.475   4.389  -0.008 1.00 . A A .  32 GLN O    1 1 
        9  5412 1 1 32 GLN OE1  O   -2.449  -0.378  -3.144 1.00 . A A .  32 GLN OE1  1 1 
        9  5413 1 1 33 ARG C    C   -4.326   5.029   2.711 1.00 . A A .  33 ARG C    1 1 
        9  5414 1 1 33 ARG CA   C   -4.588   3.560   2.391 1.00 . A A .  33 ARG CA   1 1 
        9  5415 1 1 33 ARG CB   C   -4.921   2.799   3.675 1.00 . A A .  33 ARG CB   1 1 
        9  5416 1 1 33 ARG CD   C   -5.778   0.657   4.672 1.00 . A A .  33 ARG CD   1 1 
        9  5417 1 1 33 ARG CG   C   -5.123   1.307   3.463 1.00 . A A .  33 ARG CG   1 1 
        9  5418 1 1 33 ARG CZ   C   -7.291   2.275   5.738 1.00 . A A .  33 ARG CZ   1 1 
        9  5419 1 1 33 ARG H    H   -2.994   2.190   2.145 1.00 . A A .  33 ARG H    1 1 
        9  5420 1 1 33 ARG HA   H   -5.429   3.496   1.717 1.00 . A A .  33 ARG HA   1 1 
        9  5421 1 1 33 ARG HB2  H   -4.113   2.933   4.379 1.00 . A A .  33 ARG HB2  1 1 
        9  5422 1 1 33 ARG HB3  H   -5.827   3.207   4.097 1.00 . A A .  33 ARG HB3  1 1 
        9  5423 1 1 33 ARG HD2  H   -5.885  -0.401   4.482 1.00 . A A .  33 ARG HD2  1 1 
        9  5424 1 1 33 ARG HD3  H   -5.143   0.805   5.532 1.00 . A A .  33 ARG HD3  1 1 
        9  5425 1 1 33 ARG HE   H   -7.871   0.797   4.532 1.00 . A A .  33 ARG HE   1 1 
        9  5426 1 1 33 ARG HG2  H   -5.757   1.158   2.601 1.00 . A A .  33 ARG HG2  1 1 
        9  5427 1 1 33 ARG HG3  H   -4.163   0.844   3.292 1.00 . A A .  33 ARG HG3  1 1 
        9  5428 1 1 33 ARG HH11 H   -5.334   2.531   6.166 1.00 . A A .  33 ARG HH11 1 1 
        9  5429 1 1 33 ARG HH12 H   -6.411   3.666   6.912 1.00 . A A .  33 ARG HH12 1 1 
        9  5430 1 1 33 ARG HH21 H   -9.299   2.284   5.507 1.00 . A A .  33 ARG HH21 1 1 
        9  5431 1 1 33 ARG HH22 H   -8.666   3.524   6.537 1.00 . A A .  33 ARG HH22 1 1 
        9  5432 1 1 33 ARG N    N   -3.437   2.959   1.729 1.00 . A A .  33 ARG N    1 1 
        9  5433 1 1 33 ARG NE   N   -7.095   1.223   4.951 1.00 . A A .  33 ARG NE   1 1 
        9  5434 1 1 33 ARG NH1  N   -6.260   2.873   6.320 1.00 . A A .  33 ARG NH1  1 1 
        9  5435 1 1 33 ARG NH2  N   -8.520   2.732   5.944 1.00 . A A .  33 ARG NH2  1 1 
        9  5436 1 1 33 ARG O    O   -5.245   5.848   2.721 1.00 . A A .  33 ARG O    1 1 
        9  5437 1 1 34 THR C    C   -2.705   7.609   2.055 1.00 . A A .  34 THR C    1 1 
        9  5438 1 1 34 THR CA   C   -2.680   6.724   3.296 1.00 . A A .  34 THR CA   1 1 
        9  5439 1 1 34 THR CB   C   -1.275   6.781   3.924 1.00 . A A .  34 THR CB   1 1 
        9  5440 1 1 34 THR CG2  C   -1.150   5.775   5.059 1.00 . A A .  34 THR CG2  1 1 
        9  5441 1 1 34 THR H    H   -2.376   4.659   2.949 1.00 . A A .  34 THR H    1 1 
        9  5442 1 1 34 THR HA   H   -3.389   7.109   4.014 1.00 . A A .  34 THR HA   1 1 
        9  5443 1 1 34 THR HB   H   -1.115   7.772   4.323 1.00 . A A .  34 THR HB   1 1 
        9  5444 1 1 34 THR HG1  H   -0.419   5.631   2.570 1.00 . A A .  34 THR HG1  1 1 
        9  5445 1 1 34 THR HG21 H   -1.467   4.803   4.714 1.00 . A A .  34 THR HG21 1 1 
        9  5446 1 1 34 THR HG22 H   -1.773   6.085   5.885 1.00 . A A .  34 THR HG22 1 1 
        9  5447 1 1 34 THR HG23 H   -0.121   5.725   5.383 1.00 . A A .  34 THR HG23 1 1 
        9  5448 1 1 34 THR N    N   -3.064   5.356   2.973 1.00 . A A .  34 THR N    1 1 
        9  5449 1 1 34 THR O    O   -3.130   8.763   2.111 1.00 . A A .  34 THR O    1 1 
        9  5450 1 1 34 THR OG1  O   -0.282   6.511   2.929 1.00 . A A .  34 THR OG1  1 1 
        9  5451 1 1 35 HIS C    C   -3.632   8.101  -0.810 1.00 . A A .  35 HIS C    1 1 
        9  5452 1 1 35 HIS CA   C   -2.218   7.802  -0.323 1.00 . A A .  35 HIS CA   1 1 
        9  5453 1 1 35 HIS CB   C   -1.456   7.011  -1.388 1.00 . A A .  35 HIS CB   1 1 
        9  5454 1 1 35 HIS CD2  C    1.051   6.487  -0.977 1.00 . A A .  35 HIS CD2  1 1 
        9  5455 1 1 35 HIS CE1  C    1.896   8.376  -1.700 1.00 . A A .  35 HIS CE1  1 1 
        9  5456 1 1 35 HIS CG   C    0.020   7.265  -1.381 1.00 . A A .  35 HIS CG   1 1 
        9  5457 1 1 35 HIS H    H   -1.921   6.137   0.952 1.00 . A A .  35 HIS H    1 1 
        9  5458 1 1 35 HIS HA   H   -1.706   8.735  -0.146 1.00 . A A .  35 HIS HA   1 1 
        9  5459 1 1 35 HIS HB2  H   -1.611   5.955  -1.222 1.00 . A A .  35 HIS HB2  1 1 
        9  5460 1 1 35 HIS HB3  H   -1.835   7.277  -2.364 1.00 . A A .  35 HIS HB3  1 1 
        9  5461 1 1 35 HIS HD1  H    0.092   9.211  -2.186 1.00 . A A .  35 HIS HD1  1 1 
        9  5462 1 1 35 HIS HD2  H    0.979   5.489  -0.567 1.00 . A A .  35 HIS HD2  1 1 
        9  5463 1 1 35 HIS HE1  H    2.597   9.151  -1.970 1.00 . A A .  35 HIS HE1  1 1 
        9  5464 1 1 35 HIS N    N   -2.247   7.061   0.933 1.00 . A A .  35 HIS N    1 1 
        9  5465 1 1 35 HIS ND1  N    0.582   8.442  -1.828 1.00 . A A .  35 HIS ND1  1 1 
        9  5466 1 1 35 HIS NE2  N    2.206   7.199  -1.186 1.00 . A A .  35 HIS NE2  1 1 
        9  5467 1 1 35 HIS O    O   -3.907   9.189  -1.317 1.00 . A A .  35 HIS O    1 1 
        9  5468 1 1 36 SER C    C   -6.569   8.463  -0.365 1.00 . A A .  36 SER C    1 1 
        9  5469 1 1 36 SER CA   C   -5.910   7.288  -1.081 1.00 . A A .  36 SER CA   1 1 
        9  5470 1 1 36 SER CB   C   -6.699   6.005  -0.811 1.00 . A A .  36 SER CB   1 1 
        9  5471 1 1 36 SER H    H   -4.245   6.285  -0.242 1.00 . A A .  36 SER H    1 1 
        9  5472 1 1 36 SER HA   H   -5.909   7.484  -2.142 1.00 . A A .  36 SER HA   1 1 
        9  5473 1 1 36 SER HB2  H   -6.801   5.865   0.254 1.00 . A A .  36 SER HB2  1 1 
        9  5474 1 1 36 SER HB3  H   -7.679   6.088  -1.259 1.00 . A A .  36 SER HB3  1 1 
        9  5475 1 1 36 SER HG   H   -6.677   4.173  -1.504 1.00 . A A .  36 SER HG   1 1 
        9  5476 1 1 36 SER N    N   -4.525   7.130  -0.653 1.00 . A A .  36 SER N    1 1 
        9  5477 1 1 36 SER O    O   -6.594   8.522   0.864 1.00 . A A .  36 SER O    1 1 
        9  5478 1 1 36 SER OG   O   -6.041   4.877  -1.360 1.00 . A A .  36 SER OG   1 1 
        9  5479 1 1 37 GLY C    C   -7.588  11.802  -1.423 1.00 . A A .  37 GLY C    1 1 
        9  5480 1 1 37 GLY CA   C   -7.753  10.562  -0.568 1.00 . A A .  37 GLY CA   1 1 
        9  5481 1 1 37 GLY H    H   -7.052   9.301  -2.118 1.00 . A A .  37 GLY H    1 1 
        9  5482 1 1 37 GLY HA2  H   -8.807  10.352  -0.456 1.00 . A A .  37 GLY HA2  1 1 
        9  5483 1 1 37 GLY HA3  H   -7.329  10.752   0.407 1.00 . A A .  37 GLY HA3  1 1 
        9  5484 1 1 37 GLY N    N   -7.102   9.400  -1.144 1.00 . A A .  37 GLY N    1 1 
        9  5485 1 1 37 GLY O    O   -8.242  11.943  -2.456 1.00 . A A .  37 GLY O    1 1 
        9  5486 1 1 38 GLU C    C   -5.636  13.675  -2.975 1.00 . A A .  38 GLU C    1 1 
        9  5487 1 1 38 GLU CA   C   -6.467  13.941  -1.724 1.00 . A A .  38 GLU CA   1 1 
        9  5488 1 1 38 GLU CB   C   -5.753  14.957  -0.830 1.00 . A A .  38 GLU CB   1 1 
        9  5489 1 1 38 GLU CD   C   -4.549  17.178  -0.813 1.00 . A A .  38 GLU CD   1 1 
        9  5490 1 1 38 GLU CG   C   -5.642  16.341  -1.448 1.00 . A A .  38 GLU CG   1 1 
        9  5491 1 1 38 GLU H    H   -6.223  12.536  -0.160 1.00 . A A .  38 GLU H    1 1 
        9  5492 1 1 38 GLU HA   H   -7.423  14.347  -2.021 1.00 . A A .  38 GLU HA   1 1 
        9  5493 1 1 38 GLU HB2  H   -6.294  15.043   0.101 1.00 . A A .  38 GLU HB2  1 1 
        9  5494 1 1 38 GLU HB3  H   -4.755  14.597  -0.623 1.00 . A A .  38 GLU HB3  1 1 
        9  5495 1 1 38 GLU HG2  H   -5.427  16.234  -2.501 1.00 . A A .  38 GLU HG2  1 1 
        9  5496 1 1 38 GLU HG3  H   -6.585  16.852  -1.324 1.00 . A A .  38 GLU HG3  1 1 
        9  5497 1 1 38 GLU N    N   -6.713  12.705  -0.991 1.00 . A A .  38 GLU N    1 1 
        9  5498 1 1 38 GLU O    O   -6.073  13.948  -4.093 1.00 . A A .  38 GLU O    1 1 
        9  5499 1 1 38 GLU OE1  O   -3.365  16.958  -1.142 1.00 . A A .  38 GLU OE1  1 1 
        9  5500 1 1 38 GLU OE2  O   -4.879  18.053   0.015 1.00 . A A .  38 GLU OE2  1 1 
        9  5501 1 1 39 SER C    C   -3.624  13.925  -4.962 1.00 . A A .  39 SER C    1 1 
        9  5502 1 1 39 SER CA   C   -3.539  12.843  -3.890 1.00 . A A .  39 SER CA   1 1 
        9  5503 1 1 39 SER CB   C   -3.881  11.480  -4.496 1.00 . A A .  39 SER CB   1 1 
        9  5504 1 1 39 SER H    H   -4.143  12.947  -1.863 1.00 . A A .  39 SER H    1 1 
        9  5505 1 1 39 SER HA   H   -2.531  12.813  -3.504 1.00 . A A .  39 SER HA   1 1 
        9  5506 1 1 39 SER HB2  H   -3.194  11.264  -5.299 1.00 . A A .  39 SER HB2  1 1 
        9  5507 1 1 39 SER HB3  H   -3.797  10.719  -3.734 1.00 . A A .  39 SER HB3  1 1 
        9  5508 1 1 39 SER HG   H   -5.181  11.642  -5.953 1.00 . A A .  39 SER HG   1 1 
        9  5509 1 1 39 SER N    N   -4.434  13.142  -2.778 1.00 . A A .  39 SER N    1 1 
        9  5510 1 1 39 SER O    O   -3.735  13.629  -6.151 1.00 . A A .  39 SER O    1 1 
        9  5511 1 1 39 SER OG   O   -5.202  11.468  -5.009 1.00 . A A .  39 SER OG   1 1 
        9  5512 1 1 40 GLY C    C   -2.273  16.757  -5.918 1.00 . A A .  40 GLY C    1 1 
        9  5513 1 1 40 GLY CA   C   -3.642  16.290  -5.465 1.00 . A A .  40 GLY CA   1 1 
        9  5514 1 1 40 GLY H    H   -3.481  15.358  -3.571 1.00 . A A .  40 GLY H    1 1 
        9  5515 1 1 40 GLY HA2  H   -4.210  15.981  -6.330 1.00 . A A .  40 GLY HA2  1 1 
        9  5516 1 1 40 GLY HA3  H   -4.151  17.115  -4.989 1.00 . A A .  40 GLY HA3  1 1 
        9  5517 1 1 40 GLY N    N   -3.570  15.182  -4.531 1.00 . A A .  40 GLY N    1 1 
        9  5518 1 1 40 GLY O    O   -1.247  16.390  -5.344 1.00 . A A .  40 GLY O    1 1 
        9  5519 1 1 41 PRO C    C   -0.334  19.126  -6.595 1.00 . A A .  41 PRO C    1 1 
        9  5520 1 1 41 PRO CA   C   -0.997  18.118  -7.527 1.00 . A A .  41 PRO CA   1 1 
        9  5521 1 1 41 PRO CB   C   -1.447  18.802  -8.820 1.00 . A A .  41 PRO CB   1 1 
        9  5522 1 1 41 PRO CD   C   -3.428  18.062  -7.707 1.00 . A A .  41 PRO CD   1 1 
        9  5523 1 1 41 PRO CG   C   -2.877  19.149  -8.588 1.00 . A A .  41 PRO CG   1 1 
        9  5524 1 1 41 PRO HA   H   -0.296  17.330  -7.759 1.00 . A A .  41 PRO HA   1 1 
        9  5525 1 1 41 PRO HB2  H   -0.847  19.685  -8.991 1.00 . A A .  41 PRO HB2  1 1 
        9  5526 1 1 41 PRO HB3  H   -1.336  18.119  -9.650 1.00 . A A .  41 PRO HB3  1 1 
        9  5527 1 1 41 PRO HD2  H   -4.166  18.465  -7.028 1.00 . A A .  41 PRO HD2  1 1 
        9  5528 1 1 41 PRO HD3  H   -3.855  17.271  -8.306 1.00 . A A .  41 PRO HD3  1 1 
        9  5529 1 1 41 PRO HG2  H   -2.947  20.105  -8.093 1.00 . A A .  41 PRO HG2  1 1 
        9  5530 1 1 41 PRO HG3  H   -3.406  19.172  -9.529 1.00 . A A .  41 PRO HG3  1 1 
        9  5531 1 1 41 PRO N    N   -2.244  17.584  -6.973 1.00 . A A .  41 PRO N    1 1 
        9  5532 1 1 41 PRO O    O    0.698  19.710  -6.928 1.00 . A A .  41 PRO O    1 1 
        9  5533 1 1 42 SER C    C    1.124  20.287  -4.483 1.00 . A A .  42 SER C    1 1 
        9  5534 1 1 42 SER CA   C   -0.401  20.266  -4.445 1.00 . A A .  42 SER CA   1 1 
        9  5535 1 1 42 SER CB   C   -0.882  19.899  -3.040 1.00 . A A .  42 SER CB   1 1 
        9  5536 1 1 42 SER H    H   -1.752  18.830  -5.216 1.00 . A A .  42 SER H    1 1 
        9  5537 1 1 42 SER HA   H   -0.769  21.250  -4.696 1.00 . A A .  42 SER HA   1 1 
        9  5538 1 1 42 SER HB2  H   -0.627  20.693  -2.355 1.00 . A A .  42 SER HB2  1 1 
        9  5539 1 1 42 SER HB3  H   -1.954  19.765  -3.053 1.00 . A A .  42 SER HB3  1 1 
        9  5540 1 1 42 SER HG   H    0.624  18.877  -2.314 1.00 . A A .  42 SER HG   1 1 
        9  5541 1 1 42 SER N    N   -0.932  19.326  -5.424 1.00 . A A .  42 SER N    1 1 
        9  5542 1 1 42 SER O    O    1.783  19.421  -3.907 1.00 . A A .  42 SER O    1 1 
        9  5543 1 1 42 SER OG   O   -0.278  18.698  -2.592 1.00 . A A .  42 SER OG   1 1 
        9  5544 1 1 43 SER C    C    3.715  20.258  -6.085 1.00 . A A .  43 SER C    1 1 
        9  5545 1 1 43 SER CA   C    3.127  21.416  -5.284 1.00 . A A .  43 SER CA   1 1 
        9  5546 1 1 43 SER CB   C    3.770  21.469  -3.896 1.00 . A A .  43 SER CB   1 1 
        9  5547 1 1 43 SER H    H    1.102  21.943  -5.603 1.00 . A A .  43 SER H    1 1 
        9  5548 1 1 43 SER HA   H    3.334  22.340  -5.803 1.00 . A A .  43 SER HA   1 1 
        9  5549 1 1 43 SER HB2  H    3.077  21.913  -3.198 1.00 . A A .  43 SER HB2  1 1 
        9  5550 1 1 43 SER HB3  H    4.012  20.466  -3.576 1.00 . A A .  43 SER HB3  1 1 
        9  5551 1 1 43 SER HG   H    5.687  21.716  -3.577 1.00 . A A .  43 SER HG   1 1 
        9  5552 1 1 43 SER N    N    1.680  21.283  -5.166 1.00 . A A .  43 SER N    1 1 
        9  5553 1 1 43 SER O    O    4.676  19.619  -5.659 1.00 . A A .  43 SER O    1 1 
        9  5554 1 1 43 SER OG   O    4.958  22.242  -3.914 1.00 . A A .  43 SER OG   1 1 
        9  5555 1 1 44 GLY C    C    3.772  19.338  -9.539 1.00 . A A .  44 GLY C    1 1 
        9  5556 1 1 44 GLY CA   C    3.608  18.915  -8.093 1.00 . A A .  44 GLY CA   1 1 
        9  5557 1 1 44 GLY H    H    2.367  20.538  -7.538 1.00 . A A .  44 GLY H    1 1 
        9  5558 1 1 44 GLY HA2  H    4.562  18.576  -7.718 1.00 . A A .  44 GLY HA2  1 1 
        9  5559 1 1 44 GLY HA3  H    2.903  18.098  -8.047 1.00 . A A .  44 GLY HA3  1 1 
        9  5560 1 1 44 GLY N    N    3.130  19.995  -7.249 1.00 . A A .  44 GLY N    1 1 
        9  5561 1 1 44 GLY O    O    2.866  19.105 -10.338 1.00 . A A .  44 GLY O    1 1 
        9  5562 2 2  1 ZN  ZN   ZN   3.499   5.262  -1.163 1.00 . B A . 201 ZN  ZN   1 1 
       10  5563 1 1  1 GLY C    C   30.294  11.651  -7.677 1.00 . A A .   1 GLY C    1 1 
       10  5564 1 1  1 GLY CA   C   30.012  13.097  -8.034 1.00 . A A .   1 GLY CA   1 1 
       10  5565 1 1  1 GLY H1   H   29.045  13.391  -9.895 1.00 . A A .   1 GLY H1   1 1 
       10  5566 1 1  1 GLY HA2  H   30.803  13.716  -7.639 1.00 . A A .   1 GLY HA2  1 1 
       10  5567 1 1  1 GLY HA3  H   29.077  13.392  -7.581 1.00 . A A .   1 GLY HA3  1 1 
       10  5568 1 1  1 GLY N    N   29.923  13.307  -9.468 1.00 . A A .   1 GLY N    1 1 
       10  5569 1 1  1 GLY O    O   31.425  11.183  -7.803 1.00 . A A .   1 GLY O    1 1 
       10  5570 1 1  2 SER C    C   28.956   8.621  -7.975 1.00 . A A .   2 SER C    1 1 
       10  5571 1 1  2 SER CA   C   29.407   9.542  -6.845 1.00 . A A .   2 SER CA   1 1 
       10  5572 1 1  2 SER CB   C   28.597   9.252  -5.580 1.00 . A A .   2 SER CB   1 1 
       10  5573 1 1  2 SER H    H   28.386  11.372  -7.150 1.00 . A A .   2 SER H    1 1 
       10  5574 1 1  2 SER HA   H   30.452   9.360  -6.643 1.00 . A A .   2 SER HA   1 1 
       10  5575 1 1  2 SER HB2  H   27.544   9.330  -5.804 1.00 . A A .   2 SER HB2  1 1 
       10  5576 1 1  2 SER HB3  H   28.819   8.252  -5.237 1.00 . A A .   2 SER HB3  1 1 
       10  5577 1 1  2 SER HG   H   29.180  11.008  -4.936 1.00 . A A .   2 SER HG   1 1 
       10  5578 1 1  2 SER N    N   29.263  10.942  -7.228 1.00 . A A .   2 SER N    1 1 
       10  5579 1 1  2 SER O    O   27.992   8.915  -8.682 1.00 . A A .   2 SER O    1 1 
       10  5580 1 1  2 SER OG   O   28.915  10.170  -4.549 1.00 . A A .   2 SER OG   1 1 
       10  5581 1 1  3 SER C    C   28.226   5.600  -8.727 1.00 . A A .   3 SER C    1 1 
       10  5582 1 1  3 SER CA   C   29.335   6.543  -9.183 1.00 . A A .   3 SER CA   1 1 
       10  5583 1 1  3 SER CB   C   30.578   5.738  -9.568 1.00 . A A .   3 SER CB   1 1 
       10  5584 1 1  3 SER H    H   30.418   7.328  -7.541 1.00 . A A .   3 SER H    1 1 
       10  5585 1 1  3 SER HA   H   28.992   7.093 -10.046 1.00 . A A .   3 SER HA   1 1 
       10  5586 1 1  3 SER HB2  H   30.407   5.247 -10.514 1.00 . A A .   3 SER HB2  1 1 
       10  5587 1 1  3 SER HB3  H   31.423   6.406  -9.656 1.00 . A A .   3 SER HB3  1 1 
       10  5588 1 1  3 SER HG   H   30.930   3.893  -9.009 1.00 . A A .   3 SER HG   1 1 
       10  5589 1 1  3 SER N    N   29.660   7.506  -8.137 1.00 . A A .   3 SER N    1 1 
       10  5590 1 1  3 SER O    O   27.928   5.502  -7.538 1.00 . A A .   3 SER O    1 1 
       10  5591 1 1  3 SER OG   O   30.872   4.755  -8.590 1.00 . A A .   3 SER OG   1 1 
       10  5592 1 1  4 GLY C    C   25.332   4.168 -10.250 1.00 . A A .   4 GLY C    1 1 
       10  5593 1 1  4 GLY CA   C   26.547   3.980  -9.363 1.00 . A A .   4 GLY CA   1 1 
       10  5594 1 1  4 GLY H    H   27.896   5.025 -10.617 1.00 . A A .   4 GLY H    1 1 
       10  5595 1 1  4 GLY HA2  H   26.912   2.971  -9.479 1.00 . A A .   4 GLY HA2  1 1 
       10  5596 1 1  4 GLY HA3  H   26.253   4.130  -8.334 1.00 . A A .   4 GLY HA3  1 1 
       10  5597 1 1  4 GLY N    N   27.617   4.906  -9.685 1.00 . A A .   4 GLY N    1 1 
       10  5598 1 1  4 GLY O    O   24.990   5.292 -10.617 1.00 . A A .   4 GLY O    1 1 
       10  5599 1 1  5 SER C    C   22.249   2.701 -10.675 1.00 . A A .   5 SER C    1 1 
       10  5600 1 1  5 SER CA   C   23.497   3.111 -11.451 1.00 . A A .   5 SER CA   1 1 
       10  5601 1 1  5 SER CB   C   23.682   2.196 -12.663 1.00 . A A .   5 SER CB   1 1 
       10  5602 1 1  5 SER H    H   25.000   2.196 -10.272 1.00 . A A .   5 SER H    1 1 
       10  5603 1 1  5 SER HA   H   23.376   4.128 -11.793 1.00 . A A .   5 SER HA   1 1 
       10  5604 1 1  5 SER HB2  H   23.914   1.198 -12.326 1.00 . A A .   5 SER HB2  1 1 
       10  5605 1 1  5 SER HB3  H   22.768   2.178 -13.239 1.00 . A A .   5 SER HB3  1 1 
       10  5606 1 1  5 SER HG   H   24.560   3.559 -13.763 1.00 . A A .   5 SER HG   1 1 
       10  5607 1 1  5 SER N    N   24.678   3.064 -10.597 1.00 . A A .   5 SER N    1 1 
       10  5608 1 1  5 SER O    O   21.300   3.475 -10.550 1.00 . A A .   5 SER O    1 1 
       10  5609 1 1  5 SER OG   O   24.735   2.655 -13.493 1.00 . A A .   5 SER OG   1 1 
       10  5610 1 1  6 SER C    C   21.522  -0.283  -8.608 1.00 . A A .   6 SER C    1 1 
       10  5611 1 1  6 SER CA   C   21.125   0.962  -9.396 1.00 . A A .   6 SER CA   1 1 
       10  5612 1 1  6 SER CB   C   19.960   0.637 -10.332 1.00 . A A .   6 SER CB   1 1 
       10  5613 1 1  6 SER H    H   23.044   0.907 -10.290 1.00 . A A .   6 SER H    1 1 
       10  5614 1 1  6 SER HA   H   20.815   1.729  -8.702 1.00 . A A .   6 SER HA   1 1 
       10  5615 1 1  6 SER HB2  H   19.669   1.530 -10.864 1.00 . A A .   6 SER HB2  1 1 
       10  5616 1 1  6 SER HB3  H   20.271  -0.118 -11.040 1.00 . A A .   6 SER HB3  1 1 
       10  5617 1 1  6 SER HG   H   18.693  -0.770  -9.831 1.00 . A A .   6 SER HG   1 1 
       10  5618 1 1  6 SER N    N   22.258   1.478 -10.156 1.00 . A A .   6 SER N    1 1 
       10  5619 1 1  6 SER O    O   22.564  -0.886  -8.861 1.00 . A A .   6 SER O    1 1 
       10  5620 1 1  6 SER OG   O   18.844   0.151  -9.608 1.00 . A A .   6 SER OG   1 1 
       10  5621 1 1  7 GLY C    C   20.064  -3.005  -7.185 1.00 . A A .   7 GLY C    1 1 
       10  5622 1 1  7 GLY CA   C   20.961  -1.833  -6.839 1.00 . A A .   7 GLY CA   1 1 
       10  5623 1 1  7 GLY H    H   19.865  -0.143  -7.493 1.00 . A A .   7 GLY H    1 1 
       10  5624 1 1  7 GLY HA2  H   21.990  -2.124  -6.989 1.00 . A A .   7 GLY HA2  1 1 
       10  5625 1 1  7 GLY HA3  H   20.817  -1.579  -5.799 1.00 . A A .   7 GLY HA3  1 1 
       10  5626 1 1  7 GLY N    N   20.682  -0.663  -7.650 1.00 . A A .   7 GLY N    1 1 
       10  5627 1 1  7 GLY O    O   19.983  -3.415  -8.343 1.00 . A A .   7 GLY O    1 1 
       10  5628 1 1  8 THR C    C   17.227  -4.539  -5.546 1.00 . A A .   8 THR C    1 1 
       10  5629 1 1  8 THR CA   C   18.496  -4.683  -6.379 1.00 . A A .   8 THR CA   1 1 
       10  5630 1 1  8 THR CB   C   19.185  -6.012  -6.019 1.00 . A A .   8 THR CB   1 1 
       10  5631 1 1  8 THR CG2  C   18.294  -7.196  -6.366 1.00 . A A .   8 THR CG2  1 1 
       10  5632 1 1  8 THR H    H   19.495  -3.178  -5.276 1.00 . A A .   8 THR H    1 1 
       10  5633 1 1  8 THR HA   H   18.226  -4.713  -7.425 1.00 . A A .   8 THR HA   1 1 
       10  5634 1 1  8 THR HB   H   19.377  -6.024  -4.955 1.00 . A A .   8 THR HB   1 1 
       10  5635 1 1  8 THR HG1  H   21.144  -5.827  -6.150 1.00 . A A .   8 THR HG1  1 1 
       10  5636 1 1  8 THR HG21 H   17.384  -6.838  -6.824 1.00 . A A .   8 THR HG21 1 1 
       10  5637 1 1  8 THR HG22 H   18.053  -7.741  -5.465 1.00 . A A .   8 THR HG22 1 1 
       10  5638 1 1  8 THR HG23 H   18.812  -7.847  -7.054 1.00 . A A .   8 THR HG23 1 1 
       10  5639 1 1  8 THR N    N   19.389  -3.549  -6.177 1.00 . A A .   8 THR N    1 1 
       10  5640 1 1  8 THR O    O   17.288  -4.248  -4.351 1.00 . A A .   8 THR O    1 1 
       10  5641 1 1  8 THR OG1  O   20.429  -6.124  -6.718 1.00 . A A .   8 THR OG1  1 1 
       10  5642 1 1  9 ARG C    C   14.741  -5.577  -4.297 1.00 . A A .   9 ARG C    1 1 
       10  5643 1 1  9 ARG CA   C   14.796  -4.639  -5.500 1.00 . A A .   9 ARG CA   1 1 
       10  5644 1 1  9 ARG CB   C   13.653  -4.960  -6.463 1.00 . A A .   9 ARG CB   1 1 
       10  5645 1 1  9 ARG CD   C   12.143  -4.136  -8.296 1.00 . A A .   9 ARG CD   1 1 
       10  5646 1 1  9 ARG CG   C   13.427  -3.890  -7.519 1.00 . A A .   9 ARG CG   1 1 
       10  5647 1 1  9 ARG CZ   C   10.658  -2.881  -9.800 1.00 . A A .   9 ARG CZ   1 1 
       10  5648 1 1  9 ARG H    H   16.096  -4.975  -7.136 1.00 . A A .   9 ARG H    1 1 
       10  5649 1 1  9 ARG HA   H   14.688  -3.622  -5.153 1.00 . A A .   9 ARG HA   1 1 
       10  5650 1 1  9 ARG HB2  H   13.872  -5.890  -6.967 1.00 . A A .   9 ARG HB2  1 1 
       10  5651 1 1  9 ARG HB3  H   12.741  -5.073  -5.896 1.00 . A A .   9 ARG HB3  1 1 
       10  5652 1 1  9 ARG HD2  H   12.253  -5.045  -8.868 1.00 . A A .   9 ARG HD2  1 1 
       10  5653 1 1  9 ARG HD3  H   11.330  -4.247  -7.595 1.00 . A A .   9 ARG HD3  1 1 
       10  5654 1 1  9 ARG HE   H   12.544  -2.383  -9.386 1.00 . A A .   9 ARG HE   1 1 
       10  5655 1 1  9 ARG HG2  H   13.363  -2.927  -7.035 1.00 . A A .   9 ARG HG2  1 1 
       10  5656 1 1  9 ARG HG3  H   14.260  -3.895  -8.206 1.00 . A A .   9 ARG HG3  1 1 
       10  5657 1 1  9 ARG HH11 H    9.830  -4.522  -8.963 1.00 . A A .   9 ARG HH11 1 1 
       10  5658 1 1  9 ARG HH12 H    8.794  -3.628 -10.025 1.00 . A A .   9 ARG HH12 1 1 
       10  5659 1 1  9 ARG HH21 H   11.189  -1.198 -10.786 1.00 . A A .   9 ARG HH21 1 1 
       10  5660 1 1  9 ARG HH22 H    9.568  -1.738 -11.063 1.00 . A A .   9 ARG HH22 1 1 
       10  5661 1 1  9 ARG N    N   16.080  -4.746  -6.183 1.00 . A A .   9 ARG N    1 1 
       10  5662 1 1  9 ARG NE   N   11.836  -3.036  -9.207 1.00 . A A .   9 ARG NE   1 1 
       10  5663 1 1  9 ARG NH1  N    9.681  -3.749  -9.578 1.00 . A A .   9 ARG NH1  1 1 
       10  5664 1 1  9 ARG NH2  N   10.455  -1.855 -10.617 1.00 . A A .   9 ARG NH2  1 1 
       10  5665 1 1  9 ARG O    O   14.654  -6.794  -4.452 1.00 . A A .   9 ARG O    1 1 
       10  5666 1 1 10 GLU C    C   13.375  -6.425  -1.684 1.00 . A A .  10 GLU C    1 1 
       10  5667 1 1 10 GLU CA   C   14.748  -5.785  -1.872 1.00 . A A .  10 GLU CA   1 1 
       10  5668 1 1 10 GLU CB   C   15.083  -4.905  -0.666 1.00 . A A .  10 GLU CB   1 1 
       10  5669 1 1 10 GLU CD   C   15.690  -4.815   1.784 1.00 . A A .  10 GLU CD   1 1 
       10  5670 1 1 10 GLU CG   C   15.521  -5.691   0.558 1.00 . A A .  10 GLU CG   1 1 
       10  5671 1 1 10 GLU H    H   14.859  -4.024  -3.042 1.00 . A A .  10 GLU H    1 1 
       10  5672 1 1 10 GLU HA   H   15.488  -6.567  -1.952 1.00 . A A .  10 GLU HA   1 1 
       10  5673 1 1 10 GLU HB2  H   15.880  -4.229  -0.939 1.00 . A A .  10 GLU HB2  1 1 
       10  5674 1 1 10 GLU HB3  H   14.208  -4.328  -0.403 1.00 . A A .  10 GLU HB3  1 1 
       10  5675 1 1 10 GLU HG2  H   14.776  -6.444   0.772 1.00 . A A .  10 GLU HG2  1 1 
       10  5676 1 1 10 GLU HG3  H   16.464  -6.171   0.343 1.00 . A A .  10 GLU HG3  1 1 
       10  5677 1 1 10 GLU N    N   14.791  -5.000  -3.100 1.00 . A A .  10 GLU N    1 1 
       10  5678 1 1 10 GLU O    O   13.264  -7.634  -1.480 1.00 . A A .  10 GLU O    1 1 
       10  5679 1 1 10 GLU OE1  O   16.780  -4.231   1.951 1.00 . A A .  10 GLU OE1  1 1 
       10  5680 1 1 10 GLU OE2  O   14.730  -4.715   2.577 1.00 . A A .  10 GLU OE2  1 1 
       10  5681 1 1 11 LYS C    C   10.265  -6.201  -2.940 1.00 . A A .  11 LYS C    1 1 
       10  5682 1 1 11 LYS CA   C   10.966  -6.088  -1.590 1.00 . A A .  11 LYS CA   1 1 
       10  5683 1 1 11 LYS CB   C   10.178  -5.151  -0.672 1.00 . A A .  11 LYS CB   1 1 
       10  5684 1 1 11 LYS CD   C   11.464  -4.946   1.476 1.00 . A A .  11 LYS CD   1 1 
       10  5685 1 1 11 LYS CE   C   11.258  -4.818   2.978 1.00 . A A .  11 LYS CE   1 1 
       10  5686 1 1 11 LYS CG   C   10.243  -5.541   0.795 1.00 . A A .  11 LYS CG   1 1 
       10  5687 1 1 11 LYS H    H   12.485  -4.650  -1.917 1.00 . A A .  11 LYS H    1 1 
       10  5688 1 1 11 LYS HA   H   11.012  -7.067  -1.138 1.00 . A A .  11 LYS HA   1 1 
       10  5689 1 1 11 LYS HB2  H   10.570  -4.151  -0.775 1.00 . A A .  11 LYS HB2  1 1 
       10  5690 1 1 11 LYS HB3  H    9.141  -5.155  -0.978 1.00 . A A .  11 LYS HB3  1 1 
       10  5691 1 1 11 LYS HD2  H   12.315  -5.586   1.294 1.00 . A A .  11 LYS HD2  1 1 
       10  5692 1 1 11 LYS HD3  H   11.654  -3.965   1.063 1.00 . A A .  11 LYS HD3  1 1 
       10  5693 1 1 11 LYS HE2  H   11.010  -5.789   3.378 1.00 . A A .  11 LYS HE2  1 1 
       10  5694 1 1 11 LYS HE3  H   12.177  -4.469   3.425 1.00 . A A .  11 LYS HE3  1 1 
       10  5695 1 1 11 LYS HG2  H    9.356  -5.182   1.294 1.00 . A A .  11 LYS HG2  1 1 
       10  5696 1 1 11 LYS HG3  H   10.290  -6.618   0.870 1.00 . A A .  11 LYS HG3  1 1 
       10  5697 1 1 11 LYS HZ1  H    9.441  -4.336   3.887 1.00 . A A .  11 LYS HZ1  1 1 
       10  5698 1 1 11 LYS HZ2  H    9.720  -3.514   2.435 1.00 . A A .  11 LYS HZ2  1 1 
       10  5699 1 1 11 LYS HZ3  H   10.544  -3.055   3.839 1.00 . A A .  11 LYS HZ3  1 1 
       10  5700 1 1 11 LYS N    N   12.332  -5.604  -1.752 1.00 . A A .  11 LYS N    1 1 
       10  5701 1 1 11 LYS NZ   N   10.164  -3.864   3.308 1.00 . A A .  11 LYS NZ   1 1 
       10  5702 1 1 11 LYS O    O   10.428  -5.359  -3.824 1.00 . A A .  11 LYS O    1 1 
       10  5703 1 1 12 PRO C    C    7.594  -6.510  -4.554 1.00 . A A .  12 PRO C    1 1 
       10  5704 1 1 12 PRO CA   C    8.723  -7.513  -4.345 1.00 . A A .  12 PRO CA   1 1 
       10  5705 1 1 12 PRO CB   C    8.157  -8.921  -4.144 1.00 . A A .  12 PRO CB   1 1 
       10  5706 1 1 12 PRO CD   C    9.226  -8.310  -2.095 1.00 . A A .  12 PRO CD   1 1 
       10  5707 1 1 12 PRO CG   C    8.073  -9.088  -2.666 1.00 . A A .  12 PRO CG   1 1 
       10  5708 1 1 12 PRO HA   H    9.375  -7.505  -5.206 1.00 . A A .  12 PRO HA   1 1 
       10  5709 1 1 12 PRO HB2  H    7.182  -8.989  -4.606 1.00 . A A .  12 PRO HB2  1 1 
       10  5710 1 1 12 PRO HB3  H    8.823  -9.647  -4.586 1.00 . A A .  12 PRO HB3  1 1 
       10  5711 1 1 12 PRO HD2  H    8.953  -7.872  -1.146 1.00 . A A .  12 PRO HD2  1 1 
       10  5712 1 1 12 PRO HD3  H   10.093  -8.945  -1.984 1.00 . A A .  12 PRO HD3  1 1 
       10  5713 1 1 12 PRO HG2  H    7.137  -8.692  -2.304 1.00 . A A .  12 PRO HG2  1 1 
       10  5714 1 1 12 PRO HG3  H    8.164 -10.134  -2.410 1.00 . A A .  12 PRO HG3  1 1 
       10  5715 1 1 12 PRO N    N    9.466  -7.266  -3.106 1.00 . A A .  12 PRO N    1 1 
       10  5716 1 1 12 PRO O    O    7.425  -5.970  -5.647 1.00 . A A .  12 PRO O    1 1 
       10  5717 1 1 13 TYR C    C    6.195  -3.890  -3.406 1.00 . A A .  13 TYR C    1 1 
       10  5718 1 1 13 TYR CA   C    5.709  -5.327  -3.568 1.00 . A A .  13 TYR CA   1 1 
       10  5719 1 1 13 TYR CB   C    4.675  -5.652  -2.489 1.00 . A A .  13 TYR CB   1 1 
       10  5720 1 1 13 TYR CD1  C    3.079  -7.336  -3.485 1.00 . A A .  13 TYR CD1  1 1 
       10  5721 1 1 13 TYR CD2  C    4.599  -8.083  -1.808 1.00 . A A .  13 TYR CD2  1 1 
       10  5722 1 1 13 TYR CE1  C    2.556  -8.611  -3.585 1.00 . A A .  13 TYR CE1  1 1 
       10  5723 1 1 13 TYR CE2  C    4.084  -9.361  -1.903 1.00 . A A .  13 TYR CE2  1 1 
       10  5724 1 1 13 TYR CG   C    4.107  -7.049  -2.596 1.00 . A A .  13 TYR CG   1 1 
       10  5725 1 1 13 TYR CZ   C    3.062  -9.620  -2.792 1.00 . A A .  13 TYR CZ   1 1 
       10  5726 1 1 13 TYR H    H    7.009  -6.726  -2.655 1.00 . A A .  13 TYR H    1 1 
       10  5727 1 1 13 TYR HA   H    5.247  -5.432  -4.539 1.00 . A A .  13 TYR HA   1 1 
       10  5728 1 1 13 TYR HB2  H    5.136  -5.556  -1.518 1.00 . A A .  13 TYR HB2  1 1 
       10  5729 1 1 13 TYR HB3  H    3.855  -4.953  -2.564 1.00 . A A .  13 TYR HB3  1 1 
       10  5730 1 1 13 TYR HD1  H    2.685  -6.544  -4.105 1.00 . A A .  13 TYR HD1  1 1 
       10  5731 1 1 13 TYR HD2  H    5.400  -7.877  -1.112 1.00 . A A .  13 TYR HD2  1 1 
       10  5732 1 1 13 TYR HE1  H    1.756  -8.814  -4.282 1.00 . A A .  13 TYR HE1  1 1 
       10  5733 1 1 13 TYR HE2  H    4.479 -10.151  -1.282 1.00 . A A .  13 TYR HE2  1 1 
       10  5734 1 1 13 TYR HH   H    1.698 -10.928  -2.440 1.00 . A A .  13 TYR HH   1 1 
       10  5735 1 1 13 TYR N    N    6.824  -6.265  -3.499 1.00 . A A .  13 TYR N    1 1 
       10  5736 1 1 13 TYR O    O    6.953  -3.580  -2.488 1.00 . A A .  13 TYR O    1 1 
       10  5737 1 1 13 TYR OH   O    2.545 -10.892  -2.890 1.00 . A A .  13 TYR OH   1 1 
       10  5738 1 1 14 GLU C    C    4.917  -0.707  -4.339 1.00 . A A .  14 GLU C    1 1 
       10  5739 1 1 14 GLU CA   C    6.142  -1.613  -4.264 1.00 . A A .  14 GLU CA   1 1 
       10  5740 1 1 14 GLU CB   C    7.099  -1.292  -5.413 1.00 . A A .  14 GLU CB   1 1 
       10  5741 1 1 14 GLU CD   C    9.452  -1.814  -6.170 1.00 . A A .  14 GLU CD   1 1 
       10  5742 1 1 14 GLU CG   C    8.566  -1.367  -5.023 1.00 . A A .  14 GLU CG   1 1 
       10  5743 1 1 14 GLU H    H    5.150  -3.326  -5.015 1.00 . A A .  14 GLU H    1 1 
       10  5744 1 1 14 GLU HA   H    6.648  -1.438  -3.327 1.00 . A A .  14 GLU HA   1 1 
       10  5745 1 1 14 GLU HB2  H    6.925  -1.991  -6.218 1.00 . A A .  14 GLU HB2  1 1 
       10  5746 1 1 14 GLU HB3  H    6.894  -0.292  -5.767 1.00 . A A .  14 GLU HB3  1 1 
       10  5747 1 1 14 GLU HG2  H    8.890  -0.390  -4.698 1.00 . A A .  14 GLU HG2  1 1 
       10  5748 1 1 14 GLU HG3  H    8.673  -2.070  -4.210 1.00 . A A .  14 GLU HG3  1 1 
       10  5749 1 1 14 GLU N    N    5.752  -3.018  -4.306 1.00 . A A .  14 GLU N    1 1 
       10  5750 1 1 14 GLU O    O    3.852  -1.119  -4.801 1.00 . A A .  14 GLU O    1 1 
       10  5751 1 1 14 GLU OE1  O    9.839  -0.954  -6.989 1.00 . A A .  14 GLU OE1  1 1 
       10  5752 1 1 14 GLU OE2  O    9.759  -3.022  -6.248 1.00 . A A .  14 GLU OE2  1 1 
       10  5753 1 1 15 CYS C    C    3.962   2.276  -5.208 1.00 . A A .  15 CYS C    1 1 
       10  5754 1 1 15 CYS CA   C    3.984   1.497  -3.895 1.00 . A A .  15 CYS CA   1 1 
       10  5755 1 1 15 CYS CB   C    4.117   2.465  -2.718 1.00 . A A .  15 CYS CB   1 1 
       10  5756 1 1 15 CYS H    H    5.949   0.801  -3.526 1.00 . A A .  15 CYS H    1 1 
       10  5757 1 1 15 CYS HA   H    3.057   0.953  -3.799 1.00 . A A .  15 CYS HA   1 1 
       10  5758 1 1 15 CYS HB2  H    4.276   1.898  -1.812 1.00 . A A .  15 CYS HB2  1 1 
       10  5759 1 1 15 CYS HB3  H    4.967   3.110  -2.886 1.00 . A A .  15 CYS HB3  1 1 
       10  5760 1 1 15 CYS N    N    5.075   0.531  -3.882 1.00 . A A .  15 CYS N    1 1 
       10  5761 1 1 15 CYS O    O    4.964   2.870  -5.605 1.00 . A A .  15 CYS O    1 1 
       10  5762 1 1 15 CYS SG   S    2.659   3.525  -2.458 1.00 . A A .  15 CYS SG   1 1 
       10  5763 1 1 16 SER C    C    2.321   4.438  -6.916 1.00 . A A .  16 SER C    1 1 
       10  5764 1 1 16 SER CA   C    2.662   2.968  -7.145 1.00 . A A .  16 SER CA   1 1 
       10  5765 1 1 16 SER CB   C    1.572   2.306  -7.991 1.00 . A A .  16 SER CB   1 1 
       10  5766 1 1 16 SER H    H    2.050   1.774  -5.507 1.00 . A A .  16 SER H    1 1 
       10  5767 1 1 16 SER HA   H    3.602   2.906  -7.672 1.00 . A A .  16 SER HA   1 1 
       10  5768 1 1 16 SER HB2  H    1.823   1.268  -8.148 1.00 . A A .  16 SER HB2  1 1 
       10  5769 1 1 16 SER HB3  H    0.627   2.374  -7.472 1.00 . A A .  16 SER HB3  1 1 
       10  5770 1 1 16 SER HG   H    2.304   2.962  -9.685 1.00 . A A .  16 SER HG   1 1 
       10  5771 1 1 16 SER N    N    2.813   2.267  -5.876 1.00 . A A .  16 SER N    1 1 
       10  5772 1 1 16 SER O    O    1.776   5.103  -7.796 1.00 . A A .  16 SER O    1 1 
       10  5773 1 1 16 SER OG   O    1.448   2.942  -9.251 1.00 . A A .  16 SER OG   1 1 
       10  5774 1 1 17 GLU C    C    3.671   7.080  -5.100 1.00 . A A .  17 GLU C    1 1 
       10  5775 1 1 17 GLU CA   C    2.375   6.326  -5.382 1.00 . A A .  17 GLU CA   1 1 
       10  5776 1 1 17 GLU CB   C    1.453   6.401  -4.163 1.00 . A A .  17 GLU CB   1 1 
       10  5777 1 1 17 GLU CD   C   -0.932   6.097  -4.939 1.00 . A A .  17 GLU CD   1 1 
       10  5778 1 1 17 GLU CG   C    0.259   5.465  -4.245 1.00 . A A .  17 GLU CG   1 1 
       10  5779 1 1 17 GLU H    H    3.079   4.355  -5.068 1.00 . A A .  17 GLU H    1 1 
       10  5780 1 1 17 GLU HA   H    1.881   6.786  -6.224 1.00 . A A .  17 GLU HA   1 1 
       10  5781 1 1 17 GLU HB2  H    2.022   6.150  -3.280 1.00 . A A .  17 GLU HB2  1 1 
       10  5782 1 1 17 GLU HB3  H    1.085   7.412  -4.068 1.00 . A A .  17 GLU HB3  1 1 
       10  5783 1 1 17 GLU HG2  H    0.548   4.581  -4.793 1.00 . A A .  17 GLU HG2  1 1 
       10  5784 1 1 17 GLU HG3  H   -0.033   5.186  -3.243 1.00 . A A .  17 GLU HG3  1 1 
       10  5785 1 1 17 GLU N    N    2.647   4.936  -5.727 1.00 . A A .  17 GLU N    1 1 
       10  5786 1 1 17 GLU O    O    3.835   8.231  -5.509 1.00 . A A .  17 GLU O    1 1 
       10  5787 1 1 17 GLU OE1  O   -1.171   7.304  -4.724 1.00 . A A .  17 GLU OE1  1 1 
       10  5788 1 1 17 GLU OE2  O   -1.625   5.386  -5.696 1.00 . A A .  17 GLU OE2  1 1 
       10  5789 1 1 18 CYS C    C    7.026   6.103  -4.425 1.00 . A A .  18 CYS C    1 1 
       10  5790 1 1 18 CYS CA   C    5.871   7.032  -4.061 1.00 . A A .  18 CYS CA   1 1 
       10  5791 1 1 18 CYS CB   C    5.923   7.366  -2.569 1.00 . A A .  18 CYS CB   1 1 
       10  5792 1 1 18 CYS H    H    4.401   5.509  -4.101 1.00 . A A .  18 CYS H    1 1 
       10  5793 1 1 18 CYS HA   H    5.967   7.944  -4.629 1.00 . A A .  18 CYS HA   1 1 
       10  5794 1 1 18 CYS HB2  H    6.887   7.795  -2.337 1.00 . A A .  18 CYS HB2  1 1 
       10  5795 1 1 18 CYS HB3  H    5.150   8.086  -2.342 1.00 . A A .  18 CYS HB3  1 1 
       10  5796 1 1 18 CYS N    N    4.590   6.425  -4.399 1.00 . A A .  18 CYS N    1 1 
       10  5797 1 1 18 CYS O    O    8.056   6.545  -4.931 1.00 . A A .  18 CYS O    1 1 
       10  5798 1 1 18 CYS SG   S    5.680   5.929  -1.476 1.00 . A A .  18 CYS SG   1 1 
       10  5799 1 1 19 GLY C    C    8.159   2.906  -3.310 1.00 . A A .  19 GLY C    1 1 
       10  5800 1 1 19 GLY CA   C    7.879   3.841  -4.470 1.00 . A A .  19 GLY CA   1 1 
       10  5801 1 1 19 GLY H    H    6.003   4.516  -3.759 1.00 . A A .  19 GLY H    1 1 
       10  5802 1 1 19 GLY HA2  H    7.567   3.256  -5.323 1.00 . A A .  19 GLY HA2  1 1 
       10  5803 1 1 19 GLY HA3  H    8.788   4.367  -4.720 1.00 . A A .  19 GLY HA3  1 1 
       10  5804 1 1 19 GLY N    N    6.845   4.812  -4.163 1.00 . A A .  19 GLY N    1 1 
       10  5805 1 1 19 GLY O    O    9.027   2.037  -3.398 1.00 . A A .  19 GLY O    1 1 
       10  5806 1 1 20 LYS C    C    7.761   0.785  -1.420 1.00 . A A .  20 LYS C    1 1 
       10  5807 1 1 20 LYS CA   C    7.597   2.252  -1.034 1.00 . A A .  20 LYS CA   1 1 
       10  5808 1 1 20 LYS CB   C    6.401   2.412  -0.093 1.00 . A A .  20 LYS CB   1 1 
       10  5809 1 1 20 LYS CD   C    7.084   3.643   1.987 1.00 . A A .  20 LYS CD   1 1 
       10  5810 1 1 20 LYS CE   C    8.105   3.522   3.108 1.00 . A A .  20 LYS CE   1 1 
       10  5811 1 1 20 LYS CG   C    6.763   2.289   1.377 1.00 . A A .  20 LYS CG   1 1 
       10  5812 1 1 20 LYS H    H    6.748   3.795  -2.208 1.00 . A A .  20 LYS H    1 1 
       10  5813 1 1 20 LYS HA   H    8.491   2.579  -0.525 1.00 . A A .  20 LYS HA   1 1 
       10  5814 1 1 20 LYS HB2  H    5.959   3.384  -0.254 1.00 . A A .  20 LYS HB2  1 1 
       10  5815 1 1 20 LYS HB3  H    5.670   1.651  -0.327 1.00 . A A .  20 LYS HB3  1 1 
       10  5816 1 1 20 LYS HD2  H    7.485   4.289   1.220 1.00 . A A .  20 LYS HD2  1 1 
       10  5817 1 1 20 LYS HD3  H    6.175   4.074   2.384 1.00 . A A .  20 LYS HD3  1 1 
       10  5818 1 1 20 LYS HE2  H    8.174   4.470   3.619 1.00 . A A .  20 LYS HE2  1 1 
       10  5819 1 1 20 LYS HE3  H    7.770   2.764   3.801 1.00 . A A .  20 LYS HE3  1 1 
       10  5820 1 1 20 LYS HG2  H    5.929   1.856   1.909 1.00 . A A .  20 LYS HG2  1 1 
       10  5821 1 1 20 LYS HG3  H    7.626   1.647   1.474 1.00 . A A .  20 LYS HG3  1 1 
       10  5822 1 1 20 LYS HZ1  H    9.689   2.178   2.886 1.00 . A A .  20 LYS HZ1  1 1 
       10  5823 1 1 20 LYS HZ2  H   10.170   3.798   2.971 1.00 . A A .  20 LYS HZ2  1 1 
       10  5824 1 1 20 LYS HZ3  H    9.464   3.199   1.556 1.00 . A A .  20 LYS HZ3  1 1 
       10  5825 1 1 20 LYS N    N    7.424   3.085  -2.218 1.00 . A A .  20 LYS N    1 1 
       10  5826 1 1 20 LYS NZ   N    9.451   3.147   2.594 1.00 . A A .  20 LYS NZ   1 1 
       10  5827 1 1 20 LYS O    O    7.457   0.393  -2.546 1.00 . A A .  20 LYS O    1 1 
       10  5828 1 1 21 ALA C    C    7.816  -2.282   0.391 1.00 . A A .  21 ALA C    1 1 
       10  5829 1 1 21 ALA CA   C    8.441  -1.444  -0.719 1.00 . A A .  21 ALA CA   1 1 
       10  5830 1 1 21 ALA CB   C    9.925  -1.754  -0.845 1.00 . A A .  21 ALA CB   1 1 
       10  5831 1 1 21 ALA H    H    8.464   0.352   0.401 1.00 . A A .  21 ALA H    1 1 
       10  5832 1 1 21 ALA HA   H    7.965  -1.694  -1.656 1.00 . A A .  21 ALA HA   1 1 
       10  5833 1 1 21 ALA HB1  H   10.082  -2.435  -1.669 1.00 . A A .  21 ALA HB1  1 1 
       10  5834 1 1 21 ALA HB2  H   10.469  -0.838  -1.026 1.00 . A A .  21 ALA HB2  1 1 
       10  5835 1 1 21 ALA HB3  H   10.277  -2.208   0.069 1.00 . A A .  21 ALA HB3  1 1 
       10  5836 1 1 21 ALA N    N    8.241  -0.020  -0.478 1.00 . A A .  21 ALA N    1 1 
       10  5837 1 1 21 ALA O    O    7.650  -1.813   1.518 1.00 . A A .  21 ALA O    1 1 
       10  5838 1 1 22 PHE C    C    7.101  -5.882   0.648 1.00 . A A .  22 PHE C    1 1 
       10  5839 1 1 22 PHE CA   C    6.861  -4.426   1.035 1.00 . A A .  22 PHE CA   1 1 
       10  5840 1 1 22 PHE CB   C    5.359  -4.156   1.143 1.00 . A A .  22 PHE CB   1 1 
       10  5841 1 1 22 PHE CD1  C    4.926  -1.907   0.117 1.00 . A A .  22 PHE CD1  1 1 
       10  5842 1 1 22 PHE CD2  C    4.792  -2.116   2.489 1.00 . A A .  22 PHE CD2  1 1 
       10  5843 1 1 22 PHE CE1  C    4.612  -0.565   0.214 1.00 . A A .  22 PHE CE1  1 1 
       10  5844 1 1 22 PHE CE2  C    4.478  -0.774   2.591 1.00 . A A .  22 PHE CE2  1 1 
       10  5845 1 1 22 PHE CG   C    5.019  -2.697   1.251 1.00 . A A .  22 PHE CG   1 1 
       10  5846 1 1 22 PHE CZ   C    4.389   0.003   1.453 1.00 . A A .  22 PHE CZ   1 1 
       10  5847 1 1 22 PHE H    H    7.628  -3.839  -0.849 1.00 . A A .  22 PHE H    1 1 
       10  5848 1 1 22 PHE HA   H    7.321  -4.241   1.994 1.00 . A A .  22 PHE HA   1 1 
       10  5849 1 1 22 PHE HB2  H    4.867  -4.546   0.265 1.00 . A A .  22 PHE HB2  1 1 
       10  5850 1 1 22 PHE HB3  H    4.973  -4.655   2.019 1.00 . A A .  22 PHE HB3  1 1 
       10  5851 1 1 22 PHE HD1  H    5.101  -2.351  -0.853 1.00 . A A .  22 PHE HD1  1 1 
       10  5852 1 1 22 PHE HD2  H    4.862  -2.721   3.380 1.00 . A A .  22 PHE HD2  1 1 
       10  5853 1 1 22 PHE HE1  H    4.544   0.040  -0.679 1.00 . A A .  22 PHE HE1  1 1 
       10  5854 1 1 22 PHE HE2  H    4.304  -0.332   3.561 1.00 . A A .  22 PHE HE2  1 1 
       10  5855 1 1 22 PHE HZ   H    4.143   1.052   1.530 1.00 . A A .  22 PHE HZ   1 1 
       10  5856 1 1 22 PHE N    N    7.470  -3.523   0.066 1.00 . A A .  22 PHE N    1 1 
       10  5857 1 1 22 PHE O    O    7.271  -6.203  -0.529 1.00 . A A .  22 PHE O    1 1 
       10  5858 1 1 23 ILE C    C    6.023  -8.895   1.099 1.00 . A A .  23 ILE C    1 1 
       10  5859 1 1 23 ILE CA   C    7.334  -8.181   1.410 1.00 . A A .  23 ILE CA   1 1 
       10  5860 1 1 23 ILE CB   C    7.998  -8.857   2.624 1.00 . A A .  23 ILE CB   1 1 
       10  5861 1 1 23 ILE CD1  C    9.708  -8.361   4.443 1.00 . A A .  23 ILE CD1  1 1 
       10  5862 1 1 23 ILE CG1  C    9.276  -8.112   3.014 1.00 . A A .  23 ILE CG1  1 1 
       10  5863 1 1 23 ILE CG2  C    8.302 -10.316   2.316 1.00 . A A .  23 ILE CG2  1 1 
       10  5864 1 1 23 ILE H    H    6.974  -6.443   2.562 1.00 . A A .  23 ILE H    1 1 
       10  5865 1 1 23 ILE HA   H    7.995  -8.280   0.561 1.00 . A A .  23 ILE HA   1 1 
       10  5866 1 1 23 ILE HB   H    7.304  -8.826   3.450 1.00 . A A .  23 ILE HB   1 1 
       10  5867 1 1 23 ILE HD11 H   10.695  -8.801   4.448 1.00 . A A .  23 ILE HD11 1 1 
       10  5868 1 1 23 ILE HD12 H    9.730  -7.425   4.981 1.00 . A A .  23 ILE HD12 1 1 
       10  5869 1 1 23 ILE HD13 H    9.011  -9.035   4.918 1.00 . A A .  23 ILE HD13 1 1 
       10  5870 1 1 23 ILE HG12 H   10.080  -8.424   2.366 1.00 . A A .  23 ILE HG12 1 1 
       10  5871 1 1 23 ILE HG13 H    9.115  -7.050   2.896 1.00 . A A .  23 ILE HG13 1 1 
       10  5872 1 1 23 ILE HG21 H    7.454 -10.764   1.820 1.00 . A A .  23 ILE HG21 1 1 
       10  5873 1 1 23 ILE HG22 H    9.167 -10.375   1.673 1.00 . A A .  23 ILE HG22 1 1 
       10  5874 1 1 23 ILE HG23 H    8.501 -10.844   3.237 1.00 . A A .  23 ILE HG23 1 1 
       10  5875 1 1 23 ILE N    N    7.115  -6.759   1.646 1.00 . A A .  23 ILE N    1 1 
       10  5876 1 1 23 ILE O    O    5.985  -9.820   0.288 1.00 . A A .  23 ILE O    1 1 
       10  5877 1 1 24 ARG C    C    2.629  -8.005   1.074 1.00 . A A .  24 ARG C    1 1 
       10  5878 1 1 24 ARG CA   C    3.635  -9.053   1.541 1.00 . A A .  24 ARG CA   1 1 
       10  5879 1 1 24 ARG CB   C    3.140  -9.711   2.830 1.00 . A A .  24 ARG CB   1 1 
       10  5880 1 1 24 ARG CD   C    3.749 -12.148   2.750 1.00 . A A .  24 ARG CD   1 1 
       10  5881 1 1 24 ARG CG   C    4.070 -10.791   3.358 1.00 . A A .  24 ARG CG   1 1 
       10  5882 1 1 24 ARG CZ   C    5.346 -13.612   3.912 1.00 . A A .  24 ARG CZ   1 1 
       10  5883 1 1 24 ARG H    H    5.042  -7.715   2.382 1.00 . A A .  24 ARG H    1 1 
       10  5884 1 1 24 ARG HA   H    3.730  -9.809   0.775 1.00 . A A .  24 ARG HA   1 1 
       10  5885 1 1 24 ARG HB2  H    3.038  -8.952   3.592 1.00 . A A .  24 ARG HB2  1 1 
       10  5886 1 1 24 ARG HB3  H    2.174 -10.156   2.645 1.00 . A A .  24 ARG HB3  1 1 
       10  5887 1 1 24 ARG HD2  H    2.691 -12.191   2.538 1.00 . A A .  24 ARG HD2  1 1 
       10  5888 1 1 24 ARG HD3  H    4.305 -12.256   1.832 1.00 . A A .  24 ARG HD3  1 1 
       10  5889 1 1 24 ARG HE   H    3.362 -13.733   4.075 1.00 . A A .  24 ARG HE   1 1 
       10  5890 1 1 24 ARG HG2  H    5.088 -10.530   3.110 1.00 . A A .  24 ARG HG2  1 1 
       10  5891 1 1 24 ARG HG3  H    3.963 -10.852   4.431 1.00 . A A .  24 ARG HG3  1 1 
       10  5892 1 1 24 ARG HH11 H    6.186 -12.210   2.725 1.00 . A A .  24 ARG HH11 1 1 
       10  5893 1 1 24 ARG HH12 H    7.301 -13.249   3.549 1.00 . A A .  24 ARG HH12 1 1 
       10  5894 1 1 24 ARG HH21 H    4.820 -15.107   5.166 1.00 . A A .  24 ARG HH21 1 1 
       10  5895 1 1 24 ARG HH22 H    6.523 -14.897   4.937 1.00 . A A .  24 ARG HH22 1 1 
       10  5896 1 1 24 ARG N    N    4.949  -8.457   1.748 1.00 . A A .  24 ARG N    1 1 
       10  5897 1 1 24 ARG NE   N    4.097 -13.246   3.648 1.00 . A A .  24 ARG NE   1 1 
       10  5898 1 1 24 ARG NH1  N    6.361 -12.971   3.349 1.00 . A A .  24 ARG NH1  1 1 
       10  5899 1 1 24 ARG NH2  N    5.582 -14.622   4.740 1.00 . A A .  24 ARG NH2  1 1 
       10  5900 1 1 24 ARG O    O    2.534  -6.922   1.650 1.00 . A A .  24 ARG O    1 1 
       10  5901 1 1 25 ASN C    C    0.103  -6.738   0.599 1.00 . A A .  25 ASN C    1 1 
       10  5902 1 1 25 ASN CA   C    0.883  -7.421  -0.519 1.00 . A A .  25 ASN CA   1 1 
       10  5903 1 1 25 ASN CB   C   -0.078  -8.174  -1.441 1.00 . A A .  25 ASN CB   1 1 
       10  5904 1 1 25 ASN CG   C   -0.662  -7.282  -2.519 1.00 . A A .  25 ASN CG   1 1 
       10  5905 1 1 25 ASN H    H    2.003  -9.213  -0.391 1.00 . A A .  25 ASN H    1 1 
       10  5906 1 1 25 ASN HA   H    1.402  -6.668  -1.093 1.00 . A A .  25 ASN HA   1 1 
       10  5907 1 1 25 ASN HB2  H    0.452  -8.984  -1.920 1.00 . A A .  25 ASN HB2  1 1 
       10  5908 1 1 25 ASN HB3  H   -0.889  -8.577  -0.854 1.00 . A A .  25 ASN HB3  1 1 
       10  5909 1 1 25 ASN HD21 H   -0.607  -5.719  -1.291 1.00 . A A .  25 ASN HD21 1 1 
       10  5910 1 1 25 ASN HD22 H   -1.229  -5.410  -2.873 1.00 . A A .  25 ASN HD22 1 1 
       10  5911 1 1 25 ASN N    N    1.881  -8.335   0.026 1.00 . A A .  25 ASN N    1 1 
       10  5912 1 1 25 ASN ND2  N   -0.852  -6.008  -2.195 1.00 . A A .  25 ASN ND2  1 1 
       10  5913 1 1 25 ASN O    O    0.061  -5.510   0.681 1.00 . A A .  25 ASN O    1 1 
       10  5914 1 1 25 ASN OD1  O   -0.940  -7.733  -3.631 1.00 . A A .  25 ASN OD1  1 1 
       10  5915 1 1 26 SER C    C   -0.588  -5.828   3.220 1.00 . A A .  26 SER C    1 1 
       10  5916 1 1 26 SER CA   C   -1.295  -7.015   2.572 1.00 . A A .  26 SER CA   1 1 
       10  5917 1 1 26 SER CB   C   -1.540  -8.108   3.615 1.00 . A A .  26 SER CB   1 1 
       10  5918 1 1 26 SER H    H   -0.443  -8.512   1.342 1.00 . A A .  26 SER H    1 1 
       10  5919 1 1 26 SER HA   H   -2.246  -6.683   2.182 1.00 . A A .  26 SER HA   1 1 
       10  5920 1 1 26 SER HB2  H   -0.594  -8.528   3.921 1.00 . A A .  26 SER HB2  1 1 
       10  5921 1 1 26 SER HB3  H   -2.038  -7.679   4.472 1.00 . A A .  26 SER HB3  1 1 
       10  5922 1 1 26 SER HG   H   -3.114  -8.762   2.649 1.00 . A A .  26 SER HG   1 1 
       10  5923 1 1 26 SER N    N   -0.513  -7.542   1.460 1.00 . A A .  26 SER N    1 1 
       10  5924 1 1 26 SER O    O   -1.231  -4.881   3.672 1.00 . A A .  26 SER O    1 1 
       10  5925 1 1 26 SER OG   O   -2.349  -9.144   3.087 1.00 . A A .  26 SER OG   1 1 
       10  5926 1 1 27 GLN C    C    1.482  -3.561   2.992 1.00 . A A .  27 GLN C    1 1 
       10  5927 1 1 27 GLN CA   C    1.534  -4.819   3.852 1.00 . A A .  27 GLN CA   1 1 
       10  5928 1 1 27 GLN CB   C    2.985  -5.272   4.028 1.00 . A A .  27 GLN CB   1 1 
       10  5929 1 1 27 GLN CD   C    3.257  -6.381   6.281 1.00 . A A .  27 GLN CD   1 1 
       10  5930 1 1 27 GLN CG   C    3.126  -6.582   4.784 1.00 . A A .  27 GLN CG   1 1 
       10  5931 1 1 27 GLN H    H    1.194  -6.670   2.883 1.00 . A A .  27 GLN H    1 1 
       10  5932 1 1 27 GLN HA   H    1.117  -4.595   4.822 1.00 . A A .  27 GLN HA   1 1 
       10  5933 1 1 27 GLN HB2  H    3.432  -5.393   3.053 1.00 . A A .  27 GLN HB2  1 1 
       10  5934 1 1 27 GLN HB3  H    3.524  -4.509   4.570 1.00 . A A .  27 GLN HB3  1 1 
       10  5935 1 1 27 GLN HE21 H    4.707  -7.738   6.362 1.00 . A A .  27 GLN HE21 1 1 
       10  5936 1 1 27 GLN HE22 H    4.279  -7.006   7.867 1.00 . A A .  27 GLN HE22 1 1 
       10  5937 1 1 27 GLN HG2  H    2.254  -7.190   4.593 1.00 . A A .  27 GLN HG2  1 1 
       10  5938 1 1 27 GLN HG3  H    4.007  -7.096   4.427 1.00 . A A .  27 GLN HG3  1 1 
       10  5939 1 1 27 GLN N    N    0.739  -5.888   3.260 1.00 . A A .  27 GLN N    1 1 
       10  5940 1 1 27 GLN NE2  N    4.173  -7.117   6.900 1.00 . A A .  27 GLN NE2  1 1 
       10  5941 1 1 27 GLN O    O    1.225  -2.465   3.492 1.00 . A A .  27 GLN O    1 1 
       10  5942 1 1 27 GLN OE1  O    2.541  -5.574   6.875 1.00 . A A .  27 GLN OE1  1 1 
       10  5943 1 1 28 LEU C    C    0.356  -1.896   0.792 1.00 . A A .  28 LEU C    1 1 
       10  5944 1 1 28 LEU CA   C    1.708  -2.602   0.766 1.00 . A A .  28 LEU CA   1 1 
       10  5945 1 1 28 LEU CB   C    2.017  -3.084  -0.652 1.00 . A A .  28 LEU CB   1 1 
       10  5946 1 1 28 LEU CD1  C    2.350  -0.868  -1.774 1.00 . A A .  28 LEU CD1  1 1 
       10  5947 1 1 28 LEU CD2  C    1.705  -2.868  -3.130 1.00 . A A .  28 LEU CD2  1 1 
       10  5948 1 1 28 LEU CG   C    1.560  -2.167  -1.787 1.00 . A A .  28 LEU CG   1 1 
       10  5949 1 1 28 LEU H    H    1.925  -4.623   1.357 1.00 . A A .  28 LEU H    1 1 
       10  5950 1 1 28 LEU HA   H    2.471  -1.904   1.075 1.00 . A A .  28 LEU HA   1 1 
       10  5951 1 1 28 LEU HB2  H    3.086  -3.205  -0.735 1.00 . A A .  28 LEU HB2  1 1 
       10  5952 1 1 28 LEU HB3  H    1.536  -4.043  -0.786 1.00 . A A .  28 LEU HB3  1 1 
       10  5953 1 1 28 LEU HD11 H    2.202  -0.366  -0.830 1.00 . A A .  28 LEU HD11 1 1 
       10  5954 1 1 28 LEU HD12 H    2.009  -0.231  -2.577 1.00 . A A .  28 LEU HD12 1 1 
       10  5955 1 1 28 LEU HD13 H    3.400  -1.084  -1.907 1.00 . A A .  28 LEU HD13 1 1 
       10  5956 1 1 28 LEU HD21 H    2.637  -3.413  -3.153 1.00 . A A .  28 LEU HD21 1 1 
       10  5957 1 1 28 LEU HD22 H    1.698  -2.133  -3.922 1.00 . A A .  28 LEU HD22 1 1 
       10  5958 1 1 28 LEU HD23 H    0.882  -3.554  -3.269 1.00 . A A .  28 LEU HD23 1 1 
       10  5959 1 1 28 LEU HG   H    0.516  -1.924  -1.647 1.00 . A A .  28 LEU HG   1 1 
       10  5960 1 1 28 LEU N    N    1.726  -3.725   1.697 1.00 . A A .  28 LEU N    1 1 
       10  5961 1 1 28 LEU O    O    0.280  -0.686   1.010 1.00 . A A .  28 LEU O    1 1 
       10  5962 1 1 29 ILE C    C   -2.264  -1.163   1.753 1.00 . A A .  29 ILE C    1 1 
       10  5963 1 1 29 ILE CA   C   -2.058  -2.108   0.574 1.00 . A A .  29 ILE CA   1 1 
       10  5964 1 1 29 ILE CB   C   -3.122  -3.220   0.629 1.00 . A A .  29 ILE CB   1 1 
       10  5965 1 1 29 ILE CD1  C   -3.680  -5.470  -0.421 1.00 . A A .  29 ILE CD1  1 1 
       10  5966 1 1 29 ILE CG1  C   -3.007  -4.127  -0.598 1.00 . A A .  29 ILE CG1  1 1 
       10  5967 1 1 29 ILE CG2  C   -4.515  -2.616   0.721 1.00 . A A .  29 ILE CG2  1 1 
       10  5968 1 1 29 ILE H    H   -0.585  -3.617   0.405 1.00 . A A .  29 ILE H    1 1 
       10  5969 1 1 29 ILE HA   H   -2.192  -1.554  -0.345 1.00 . A A .  29 ILE HA   1 1 
       10  5970 1 1 29 ILE HB   H   -2.951  -3.807   1.519 1.00 . A A .  29 ILE HB   1 1 
       10  5971 1 1 29 ILE HD11 H   -2.991  -6.159   0.044 1.00 . A A .  29 ILE HD11 1 1 
       10  5972 1 1 29 ILE HD12 H   -4.553  -5.357   0.205 1.00 . A A .  29 ILE HD12 1 1 
       10  5973 1 1 29 ILE HD13 H   -3.976  -5.854  -1.386 1.00 . A A .  29 ILE HD13 1 1 
       10  5974 1 1 29 ILE HG12 H   -3.463  -3.637  -1.444 1.00 . A A .  29 ILE HG12 1 1 
       10  5975 1 1 29 ILE HG13 H   -1.963  -4.303  -0.809 1.00 . A A .  29 ILE HG13 1 1 
       10  5976 1 1 29 ILE HG21 H   -4.741  -2.092  -0.196 1.00 . A A .  29 ILE HG21 1 1 
       10  5977 1 1 29 ILE HG22 H   -5.239  -3.403   0.872 1.00 . A A .  29 ILE HG22 1 1 
       10  5978 1 1 29 ILE HG23 H   -4.555  -1.926   1.550 1.00 . A A .  29 ILE HG23 1 1 
       10  5979 1 1 29 ILE N    N   -0.709  -2.660   0.572 1.00 . A A .  29 ILE N    1 1 
       10  5980 1 1 29 ILE O    O   -2.685  -0.019   1.580 1.00 . A A .  29 ILE O    1 1 
       10  5981 1 1 30 VAL C    C   -1.479   0.528   3.991 1.00 . A A .  30 VAL C    1 1 
       10  5982 1 1 30 VAL CA   C   -2.112  -0.848   4.162 1.00 . A A .  30 VAL CA   1 1 
       10  5983 1 1 30 VAL CB   C   -1.477  -1.546   5.380 1.00 . A A .  30 VAL CB   1 1 
       10  5984 1 1 30 VAL CG1  C   -1.620  -0.684   6.624 1.00 . A A .  30 VAL CG1  1 1 
       10  5985 1 1 30 VAL CG2  C   -2.103  -2.916   5.595 1.00 . A A .  30 VAL CG2  1 1 
       10  5986 1 1 30 VAL H    H   -1.632  -2.569   3.027 1.00 . A A .  30 VAL H    1 1 
       10  5987 1 1 30 VAL HA   H   -3.168  -0.727   4.354 1.00 . A A .  30 VAL HA   1 1 
       10  5988 1 1 30 VAL HB   H   -0.424  -1.682   5.182 1.00 . A A .  30 VAL HB   1 1 
       10  5989 1 1 30 VAL HG11 H   -0.731  -0.777   7.231 1.00 . A A .  30 VAL HG11 1 1 
       10  5990 1 1 30 VAL HG12 H   -1.753   0.348   6.334 1.00 . A A .  30 VAL HG12 1 1 
       10  5991 1 1 30 VAL HG13 H   -2.479  -1.012   7.192 1.00 . A A .  30 VAL HG13 1 1 
       10  5992 1 1 30 VAL HG21 H   -1.374  -3.580   6.034 1.00 . A A .  30 VAL HG21 1 1 
       10  5993 1 1 30 VAL HG22 H   -2.951  -2.823   6.257 1.00 . A A .  30 VAL HG22 1 1 
       10  5994 1 1 30 VAL HG23 H   -2.430  -3.316   4.646 1.00 . A A .  30 VAL HG23 1 1 
       10  5995 1 1 30 VAL N    N   -1.963  -1.650   2.953 1.00 . A A .  30 VAL N    1 1 
       10  5996 1 1 30 VAL O    O   -1.993   1.527   4.494 1.00 . A A .  30 VAL O    1 1 
       10  5997 1 1 31 HIS C    C   -0.395   2.680   2.013 1.00 . A A .  31 HIS C    1 1 
       10  5998 1 1 31 HIS CA   C    0.347   1.827   3.039 1.00 . A A .  31 HIS CA   1 1 
       10  5999 1 1 31 HIS CB   C    1.771   1.553   2.557 1.00 . A A .  31 HIS CB   1 1 
       10  6000 1 1 31 HIS CD2  C    2.936   3.170   0.896 1.00 . A A .  31 HIS CD2  1 1 
       10  6001 1 1 31 HIS CE1  C    3.499   4.740   2.319 1.00 . A A .  31 HIS CE1  1 1 
       10  6002 1 1 31 HIS CG   C    2.503   2.785   2.120 1.00 . A A .  31 HIS CG   1 1 
       10  6003 1 1 31 HIS H    H    0.004  -0.257   2.903 1.00 . A A .  31 HIS H    1 1 
       10  6004 1 1 31 HIS HA   H    0.389   2.367   3.973 1.00 . A A .  31 HIS HA   1 1 
       10  6005 1 1 31 HIS HB2  H    2.335   1.101   3.360 1.00 . A A .  31 HIS HB2  1 1 
       10  6006 1 1 31 HIS HB3  H    1.737   0.872   1.720 1.00 . A A .  31 HIS HB3  1 1 
       10  6007 1 1 31 HIS HD1  H    2.700   3.804   3.953 1.00 . A A .  31 HIS HD1  1 1 
       10  6008 1 1 31 HIS HD2  H    2.819   2.621  -0.028 1.00 . A A .  31 HIS HD2  1 1 
       10  6009 1 1 31 HIS HE1  H    3.901   5.650   2.739 1.00 . A A .  31 HIS HE1  1 1 
       10  6010 1 1 31 HIS N    N   -0.358   0.573   3.278 1.00 . A A .  31 HIS N    1 1 
       10  6011 1 1 31 HIS ND1  N    2.873   3.789   2.989 1.00 . A A .  31 HIS ND1  1 1 
       10  6012 1 1 31 HIS NE2  N    3.551   4.388   1.047 1.00 . A A .  31 HIS NE2  1 1 
       10  6013 1 1 31 HIS O    O   -0.472   3.901   2.147 1.00 . A A .  31 HIS O    1 1 
       10  6014 1 1 32 GLN C    C   -2.878   3.458   0.516 1.00 . A A .  32 GLN C    1 1 
       10  6015 1 1 32 GLN CA   C   -1.670   2.726  -0.059 1.00 . A A .  32 GLN CA   1 1 
       10  6016 1 1 32 GLN CB   C   -2.122   1.741  -1.138 1.00 . A A .  32 GLN CB   1 1 
       10  6017 1 1 32 GLN CD   C   -1.439   0.585  -3.279 1.00 . A A .  32 GLN CD   1 1 
       10  6018 1 1 32 GLN CG   C   -0.977   1.170  -1.959 1.00 . A A .  32 GLN CG   1 1 
       10  6019 1 1 32 GLN H    H   -0.841   1.054   0.939 1.00 . A A .  32 GLN H    1 1 
       10  6020 1 1 32 GLN HA   H   -1.004   3.451  -0.503 1.00 . A A .  32 GLN HA   1 1 
       10  6021 1 1 32 GLN HB2  H   -2.642   0.921  -0.665 1.00 . A A .  32 GLN HB2  1 1 
       10  6022 1 1 32 GLN HB3  H   -2.800   2.247  -1.810 1.00 . A A .  32 GLN HB3  1 1 
       10  6023 1 1 32 GLN HE21 H    0.181   1.292  -4.188 1.00 . A A .  32 GLN HE21 1 1 
       10  6024 1 1 32 GLN HE22 H   -0.921   0.419  -5.190 1.00 . A A .  32 GLN HE22 1 1 
       10  6025 1 1 32 GLN HG2  H   -0.267   1.958  -2.161 1.00 . A A .  32 GLN HG2  1 1 
       10  6026 1 1 32 GLN HG3  H   -0.494   0.391  -1.386 1.00 . A A .  32 GLN HG3  1 1 
       10  6027 1 1 32 GLN N    N   -0.937   2.027   0.990 1.00 . A A .  32 GLN N    1 1 
       10  6028 1 1 32 GLN NE2  N   -0.647   0.786  -4.325 1.00 . A A .  32 GLN NE2  1 1 
       10  6029 1 1 32 GLN O    O   -3.323   4.468  -0.030 1.00 . A A .  32 GLN O    1 1 
       10  6030 1 1 32 GLN OE1  O   -2.497  -0.040  -3.357 1.00 . A A .  32 GLN OE1  1 1 
       10  6031 1 1 33 ARG C    C   -4.301   5.013   2.594 1.00 . A A .  33 ARG C    1 1 
       10  6032 1 1 33 ARG CA   C   -4.563   3.545   2.270 1.00 . A A .  33 ARG CA   1 1 
       10  6033 1 1 33 ARG CB   C   -4.912   2.783   3.550 1.00 . A A .  33 ARG CB   1 1 
       10  6034 1 1 33 ARG CD   C   -6.041   0.724   4.447 1.00 . A A .  33 ARG CD   1 1 
       10  6035 1 1 33 ARG CG   C   -5.202   1.308   3.321 1.00 . A A .  33 ARG CG   1 1 
       10  6036 1 1 33 ARG CZ   C   -8.379   0.741   5.207 1.00 . A A .  33 ARG CZ   1 1 
       10  6037 1 1 33 ARG H    H   -3.007   2.135   2.010 1.00 . A A .  33 ARG H    1 1 
       10  6038 1 1 33 ARG HA   H   -5.397   3.483   1.586 1.00 . A A .  33 ARG HA   1 1 
       10  6039 1 1 33 ARG HB2  H   -4.085   2.862   4.239 1.00 . A A .  33 ARG HB2  1 1 
       10  6040 1 1 33 ARG HB3  H   -5.786   3.234   3.996 1.00 . A A .  33 ARG HB3  1 1 
       10  6041 1 1 33 ARG HD2  H   -6.021  -0.352   4.372 1.00 . A A .  33 ARG HD2  1 1 
       10  6042 1 1 33 ARG HD3  H   -5.613   1.027   5.391 1.00 . A A .  33 ARG HD3  1 1 
       10  6043 1 1 33 ARG HE   H   -7.660   1.841   3.705 1.00 . A A .  33 ARG HE   1 1 
       10  6044 1 1 33 ARG HG2  H   -5.740   1.197   2.392 1.00 . A A .  33 ARG HG2  1 1 
       10  6045 1 1 33 ARG HG3  H   -4.267   0.772   3.265 1.00 . A A .  33 ARG HG3  1 1 
       10  6046 1 1 33 ARG HH11 H   -7.162  -0.503   6.231 1.00 . A A .  33 ARG HH11 1 1 
       10  6047 1 1 33 ARG HH12 H   -8.813  -0.481   6.757 1.00 . A A .  33 ARG HH12 1 1 
       10  6048 1 1 33 ARG HH21 H   -9.837   1.878   4.388 1.00 . A A .  33 ARG HH21 1 1 
       10  6049 1 1 33 ARG HH22 H  -10.333   0.873   5.707 1.00 . A A .  33 ARG HH22 1 1 
       10  6050 1 1 33 ARG N    N   -3.405   2.941   1.622 1.00 . A A .  33 ARG N    1 1 
       10  6051 1 1 33 ARG NE   N   -7.428   1.178   4.389 1.00 . A A .  33 ARG NE   1 1 
       10  6052 1 1 33 ARG NH1  N   -8.095  -0.155   6.141 1.00 . A A .  33 ARG NH1  1 1 
       10  6053 1 1 33 ARG NH2  N   -9.618   1.202   5.091 1.00 . A A .  33 ARG NH2  1 1 
       10  6054 1 1 33 ARG O    O   -5.192   5.855   2.477 1.00 . A A .  33 ARG O    1 1 
       10  6055 1 1 34 THR C    C   -2.739   7.585   2.122 1.00 . A A .  34 THR C    1 1 
       10  6056 1 1 34 THR CA   C   -2.693   6.677   3.346 1.00 . A A .  34 THR CA   1 1 
       10  6057 1 1 34 THR CB   C   -1.281   6.731   3.958 1.00 . A A .  34 THR CB   1 1 
       10  6058 1 1 34 THR CG2  C   -1.166   5.778   5.138 1.00 . A A .  34 THR CG2  1 1 
       10  6059 1 1 34 THR H    H   -2.406   4.598   3.076 1.00 . A A .  34 THR H    1 1 
       10  6060 1 1 34 THR HA   H   -3.395   7.044   4.081 1.00 . A A .  34 THR HA   1 1 
       10  6061 1 1 34 THR HB   H   -1.094   7.737   4.308 1.00 . A A .  34 THR HB   1 1 
       10  6062 1 1 34 THR HG1  H   -0.128   5.448   3.002 1.00 . A A .  34 THR HG1  1 1 
       10  6063 1 1 34 THR HG21 H   -0.136   5.725   5.459 1.00 . A A .  34 THR HG21 1 1 
       10  6064 1 1 34 THR HG22 H   -1.501   4.795   4.841 1.00 . A A .  34 THR HG22 1 1 
       10  6065 1 1 34 THR HG23 H   -1.778   6.137   5.952 1.00 . A A .  34 THR HG23 1 1 
       10  6066 1 1 34 THR N    N   -3.073   5.313   3.003 1.00 . A A .  34 THR N    1 1 
       10  6067 1 1 34 THR O    O   -3.160   8.739   2.208 1.00 . A A .  34 THR O    1 1 
       10  6068 1 1 34 THR OG1  O   -0.304   6.392   2.968 1.00 . A A .  34 THR OG1  1 1 
       10  6069 1 1 35 HIS C    C   -3.719   8.136  -0.712 1.00 . A A .  35 HIS C    1 1 
       10  6070 1 1 35 HIS CA   C   -2.296   7.819  -0.260 1.00 . A A .  35 HIS CA   1 1 
       10  6071 1 1 35 HIS CB   C   -1.562   7.045  -1.355 1.00 . A A .  35 HIS CB   1 1 
       10  6072 1 1 35 HIS CD2  C    0.952   6.497  -1.027 1.00 . A A .  35 HIS CD2  1 1 
       10  6073 1 1 35 HIS CE1  C    1.787   8.408  -1.704 1.00 . A A .  35 HIS CE1  1 1 
       10  6074 1 1 35 HIS CG   C   -0.085   7.293  -1.377 1.00 . A A .  35 HIS CG   1 1 
       10  6075 1 1 35 HIS H    H   -1.980   6.131   0.978 1.00 . A A .  35 HIS H    1 1 
       10  6076 1 1 35 HIS HA   H   -1.776   8.747  -0.077 1.00 . A A .  35 HIS HA   1 1 
       10  6077 1 1 35 HIS HB2  H   -1.717   5.986  -1.203 1.00 . A A .  35 HIS HB2  1 1 
       10  6078 1 1 35 HIS HB3  H   -1.962   7.328  -2.318 1.00 . A A .  35 HIS HB3  1 1 
       10  6079 1 1 35 HIS HD1  H   -0.025   9.267  -2.113 1.00 . A A .  35 HIS HD1  1 1 
       10  6080 1 1 35 HIS HD2  H    0.887   5.486  -0.651 1.00 . A A .  35 HIS HD2  1 1 
       10  6081 1 1 35 HIS HE1  H    2.485   9.191  -1.963 1.00 . A A .  35 HIS HE1  1 1 
       10  6082 1 1 35 HIS N    N   -2.304   7.056   0.983 1.00 . A A .  35 HIS N    1 1 
       10  6083 1 1 35 HIS ND1  N    0.471   8.484  -1.795 1.00 . A A .  35 HIS ND1  1 1 
       10  6084 1 1 35 HIS NE2  N    2.104   7.213  -1.240 1.00 . A A .  35 HIS NE2  1 1 
       10  6085 1 1 35 HIS O    O   -3.992   9.223  -1.220 1.00 . A A .  35 HIS O    1 1 
       10  6086 1 1 36 SER C    C   -6.551   8.697  -0.431 1.00 . A A .  36 SER C    1 1 
       10  6087 1 1 36 SER CA   C   -6.015   7.353  -0.916 1.00 . A A .  36 SER CA   1 1 
       10  6088 1 1 36 SER CB   C   -6.871   6.217  -0.354 1.00 . A A .  36 SER CB   1 1 
       10  6089 1 1 36 SER H    H   -4.342   6.333  -0.113 1.00 . A A .  36 SER H    1 1 
       10  6090 1 1 36 SER HA   H   -6.061   7.328  -1.994 1.00 . A A .  36 SER HA   1 1 
       10  6091 1 1 36 SER HB2  H   -6.276   5.319  -0.290 1.00 . A A .  36 SER HB2  1 1 
       10  6092 1 1 36 SER HB3  H   -7.222   6.487   0.631 1.00 . A A .  36 SER HB3  1 1 
       10  6093 1 1 36 SER HG   H   -8.351   5.097  -0.982 1.00 . A A .  36 SER HG   1 1 
       10  6094 1 1 36 SER N    N   -4.621   7.178  -0.524 1.00 . A A .  36 SER N    1 1 
       10  6095 1 1 36 SER O    O   -6.160   9.189   0.626 1.00 . A A .  36 SER O    1 1 
       10  6096 1 1 36 SER OG   O   -7.991   5.964  -1.185 1.00 . A A .  36 SER OG   1 1 
       10  6097 1 1 37 GLY C    C   -6.993  11.673  -0.796 1.00 . A A .  37 GLY C    1 1 
       10  6098 1 1 37 GLY CA   C   -8.027  10.566  -0.848 1.00 . A A .  37 GLY CA   1 1 
       10  6099 1 1 37 GLY H    H   -7.726   8.846  -2.045 1.00 . A A .  37 GLY H    1 1 
       10  6100 1 1 37 GLY HA2  H   -8.783  10.828  -1.573 1.00 . A A .  37 GLY HA2  1 1 
       10  6101 1 1 37 GLY HA3  H   -8.490  10.476   0.123 1.00 . A A .  37 GLY HA3  1 1 
       10  6102 1 1 37 GLY N    N   -7.451   9.285  -1.213 1.00 . A A .  37 GLY N    1 1 
       10  6103 1 1 37 GLY O    O   -7.023  12.517   0.099 1.00 . A A .  37 GLY O    1 1 
       10  6104 1 1 38 GLU C    C   -4.636  12.979  -3.259 1.00 . A A .  38 GLU C    1 1 
       10  6105 1 1 38 GLU CA   C   -5.025  12.679  -1.814 1.00 . A A .  38 GLU CA   1 1 
       10  6106 1 1 38 GLU CB   C   -3.796  12.215  -1.030 1.00 . A A .  38 GLU CB   1 1 
       10  6107 1 1 38 GLU CD   C   -1.557  12.838  -0.039 1.00 . A A .  38 GLU CD   1 1 
       10  6108 1 1 38 GLU CG   C   -2.697  13.261  -0.945 1.00 . A A .  38 GLU CG   1 1 
       10  6109 1 1 38 GLU H    H   -6.103  10.969  -2.443 1.00 . A A .  38 GLU H    1 1 
       10  6110 1 1 38 GLU HA   H   -5.408  13.582  -1.363 1.00 . A A .  38 GLU HA   1 1 
       10  6111 1 1 38 GLU HB2  H   -4.100  11.960  -0.025 1.00 . A A .  38 GLU HB2  1 1 
       10  6112 1 1 38 GLU HB3  H   -3.390  11.335  -1.507 1.00 . A A .  38 GLU HB3  1 1 
       10  6113 1 1 38 GLU HG2  H   -2.303  13.432  -1.936 1.00 . A A .  38 GLU HG2  1 1 
       10  6114 1 1 38 GLU HG3  H   -3.119  14.179  -0.563 1.00 . A A .  38 GLU HG3  1 1 
       10  6115 1 1 38 GLU N    N   -6.074  11.668  -1.757 1.00 . A A .  38 GLU N    1 1 
       10  6116 1 1 38 GLU O    O   -4.396  12.067  -4.050 1.00 . A A .  38 GLU O    1 1 
       10  6117 1 1 38 GLU OE1  O   -1.674  13.032   1.190 1.00 . A A .  38 GLU OE1  1 1 
       10  6118 1 1 38 GLU OE2  O   -0.549  12.314  -0.557 1.00 . A A .  38 GLU OE2  1 1 
       10  6119 1 1 39 SER C    C   -2.796  14.263  -5.289 1.00 . A A .  39 SER C    1 1 
       10  6120 1 1 39 SER CA   C   -4.222  14.684  -4.946 1.00 . A A .  39 SER CA   1 1 
       10  6121 1 1 39 SER CB   C   -4.365  16.201  -5.085 1.00 . A A .  39 SER CB   1 1 
       10  6122 1 1 39 SER H    H   -4.779  14.944  -2.920 1.00 . A A .  39 SER H    1 1 
       10  6123 1 1 39 SER HA   H   -4.902  14.202  -5.633 1.00 . A A .  39 SER HA   1 1 
       10  6124 1 1 39 SER HB2  H   -3.639  16.688  -4.451 1.00 . A A .  39 SER HB2  1 1 
       10  6125 1 1 39 SER HB3  H   -4.192  16.483  -6.113 1.00 . A A .  39 SER HB3  1 1 
       10  6126 1 1 39 SER HG   H   -5.963  16.109  -3.954 1.00 . A A .  39 SER HG   1 1 
       10  6127 1 1 39 SER N    N   -4.577  14.263  -3.596 1.00 . A A .  39 SER N    1 1 
       10  6128 1 1 39 SER O    O   -1.833  14.760  -4.707 1.00 . A A .  39 SER O    1 1 
       10  6129 1 1 39 SER OG   O   -5.662  16.627  -4.705 1.00 . A A .  39 SER OG   1 1 
       10  6130 1 1 40 GLY C    C   -1.297  12.523  -8.119 1.00 . A A .  40 GLY C    1 1 
       10  6131 1 1 40 GLY CA   C   -1.359  12.868  -6.644 1.00 . A A .  40 GLY CA   1 1 
       10  6132 1 1 40 GLY H    H   -3.473  12.981  -6.669 1.00 . A A .  40 GLY H    1 1 
       10  6133 1 1 40 GLY HA2  H   -0.630  13.637  -6.435 1.00 . A A .  40 GLY HA2  1 1 
       10  6134 1 1 40 GLY HA3  H   -1.114  11.987  -6.070 1.00 . A A .  40 GLY HA3  1 1 
       10  6135 1 1 40 GLY N    N   -2.670  13.342  -6.239 1.00 . A A .  40 GLY N    1 1 
       10  6136 1 1 40 GLY O    O   -1.074  13.382  -8.971 1.00 . A A .  40 GLY O    1 1 
       10  6137 1 1 41 PRO C    C   -2.661  11.236 -10.633 1.00 . A A .  41 PRO C    1 1 
       10  6138 1 1 41 PRO CA   C   -1.468  10.748  -9.820 1.00 . A A .  41 PRO CA   1 1 
       10  6139 1 1 41 PRO CB   C   -1.516   9.226  -9.661 1.00 . A A .  41 PRO CB   1 1 
       10  6140 1 1 41 PRO CD   C   -1.769  10.156  -7.473 1.00 . A A .  41 PRO CD   1 1 
       10  6141 1 1 41 PRO CG   C   -2.182   9.004  -8.347 1.00 . A A .  41 PRO CG   1 1 
       10  6142 1 1 41 PRO HA   H   -0.553  11.030 -10.320 1.00 . A A .  41 PRO HA   1 1 
       10  6143 1 1 41 PRO HB2  H   -2.086   8.795 -10.471 1.00 . A A .  41 PRO HB2  1 1 
       10  6144 1 1 41 PRO HB3  H   -0.512   8.828  -9.667 1.00 . A A .  41 PRO HB3  1 1 
       10  6145 1 1 41 PRO HD2  H   -2.573  10.429  -6.805 1.00 . A A .  41 PRO HD2  1 1 
       10  6146 1 1 41 PRO HD3  H   -0.880   9.906  -6.914 1.00 . A A .  41 PRO HD3  1 1 
       10  6147 1 1 41 PRO HG2  H   -3.253   8.995  -8.475 1.00 . A A .  41 PRO HG2  1 1 
       10  6148 1 1 41 PRO HG3  H   -1.846   8.071  -7.919 1.00 . A A .  41 PRO HG3  1 1 
       10  6149 1 1 41 PRO N    N   -1.498  11.235  -8.438 1.00 . A A .  41 PRO N    1 1 
       10  6150 1 1 41 PRO O    O   -3.716  11.547 -10.079 1.00 . A A .  41 PRO O    1 1 
       10  6151 1 1 42 SER C    C   -4.830  10.958 -12.608 1.00 . A A .  42 SER C    1 1 
       10  6152 1 1 42 SER CA   C   -3.551  11.756 -12.838 1.00 . A A .  42 SER CA   1 1 
       10  6153 1 1 42 SER CB   C   -3.113  11.629 -14.298 1.00 . A A .  42 SER CB   1 1 
       10  6154 1 1 42 SER H    H   -1.624  11.041 -12.331 1.00 . A A .  42 SER H    1 1 
       10  6155 1 1 42 SER HA   H   -3.745  12.796 -12.619 1.00 . A A .  42 SER HA   1 1 
       10  6156 1 1 42 SER HB2  H   -2.122  12.041 -14.411 1.00 . A A .  42 SER HB2  1 1 
       10  6157 1 1 42 SER HB3  H   -3.103  10.585 -14.578 1.00 . A A .  42 SER HB3  1 1 
       10  6158 1 1 42 SER HG   H   -4.417  13.040 -14.676 1.00 . A A .  42 SER HG   1 1 
       10  6159 1 1 42 SER N    N   -2.488  11.302 -11.949 1.00 . A A .  42 SER N    1 1 
       10  6160 1 1 42 SER O    O   -4.843   9.734 -12.737 1.00 . A A .  42 SER O    1 1 
       10  6161 1 1 42 SER OG   O   -3.998  12.325 -15.159 1.00 . A A .  42 SER OG   1 1 
       10  6162 1 1 43 SER C    C   -8.291  12.058 -11.831 1.00 . A A .  43 SER C    1 1 
       10  6163 1 1 43 SER CA   C   -7.190  11.018 -12.013 1.00 . A A .  43 SER CA   1 1 
       10  6164 1 1 43 SER CB   C   -7.104  10.128 -10.772 1.00 . A A .  43 SER CB   1 1 
       10  6165 1 1 43 SER H    H   -5.832  12.634 -12.179 1.00 . A A .  43 SER H    1 1 
       10  6166 1 1 43 SER HA   H   -7.428  10.405 -12.870 1.00 . A A .  43 SER HA   1 1 
       10  6167 1 1 43 SER HB2  H   -7.957   9.467 -10.746 1.00 . A A .  43 SER HB2  1 1 
       10  6168 1 1 43 SER HB3  H   -6.197   9.542 -10.815 1.00 . A A .  43 SER HB3  1 1 
       10  6169 1 1 43 SER HG   H   -6.801  10.360  -8.851 1.00 . A A .  43 SER HG   1 1 
       10  6170 1 1 43 SER N    N   -5.906  11.660 -12.266 1.00 . A A .  43 SER N    1 1 
       10  6171 1 1 43 SER O    O   -8.173  12.967 -11.011 1.00 . A A .  43 SER O    1 1 
       10  6172 1 1 43 SER OG   O   -7.090  10.904  -9.587 1.00 . A A .  43 SER OG   1 1 
       10  6173 1 1 44 GLY C    C  -10.958  13.036 -11.090 1.00 . A A .  44 GLY C    1 1 
       10  6174 1 1 44 GLY CA   C  -10.472  12.850 -12.514 1.00 . A A .  44 GLY CA   1 1 
       10  6175 1 1 44 GLY H    H   -9.404  11.173 -13.240 1.00 . A A .  44 GLY H    1 1 
       10  6176 1 1 44 GLY HA2  H  -10.155  13.807 -12.902 1.00 . A A .  44 GLY HA2  1 1 
       10  6177 1 1 44 GLY HA3  H  -11.289  12.481 -13.116 1.00 . A A .  44 GLY HA3  1 1 
       10  6178 1 1 44 GLY N    N   -9.364  11.917 -12.604 1.00 . A A .  44 GLY N    1 1 
       10  6179 1 1 44 GLY O    O  -11.235  14.168 -10.695 1.00 . A A .  44 GLY O    1 1 
       10  6180 2 2  1 ZN  ZN   ZN   3.458   5.319  -1.130 1.00 . B A . 201 ZN  ZN   1 1 
       11  6181 1 1  1 GLY C    C   23.622  12.474 -11.005 1.00 . A A .   1 GLY C    1 1 
       11  6182 1 1  1 GLY CA   C   22.752  13.693 -11.241 1.00 . A A .   1 GLY CA   1 1 
       11  6183 1 1  1 GLY H1   H   20.766  14.048 -11.884 1.00 . A A .   1 GLY H1   1 1 
       11  6184 1 1  1 GLY HA2  H   23.244  14.341 -11.951 1.00 . A A .   1 GLY HA2  1 1 
       11  6185 1 1  1 GLY HA3  H   22.634  14.223 -10.307 1.00 . A A .   1 GLY HA3  1 1 
       11  6186 1 1  1 GLY N    N   21.439  13.348 -11.753 1.00 . A A .   1 GLY N    1 1 
       11  6187 1 1  1 GLY O    O   23.626  11.542 -11.809 1.00 . A A .   1 GLY O    1 1 
       11  6188 1 1  2 SER C    C   25.205  11.081  -8.067 1.00 . A A .   2 SER C    1 1 
       11  6189 1 1  2 SER CA   C   25.244  11.370  -9.564 1.00 . A A .   2 SER CA   1 1 
       11  6190 1 1  2 SER CB   C   26.678  11.680  -9.999 1.00 . A A .   2 SER CB   1 1 
       11  6191 1 1  2 SER H    H   24.315  13.254  -9.300 1.00 . A A .   2 SER H    1 1 
       11  6192 1 1  2 SER HA   H   24.896  10.498 -10.097 1.00 . A A .   2 SER HA   1 1 
       11  6193 1 1  2 SER HB2  H   27.335  10.903  -9.641 1.00 . A A .   2 SER HB2  1 1 
       11  6194 1 1  2 SER HB3  H   26.723  11.721 -11.078 1.00 . A A .   2 SER HB3  1 1 
       11  6195 1 1  2 SER HG   H   27.928  12.797  -8.986 1.00 . A A .   2 SER HG   1 1 
       11  6196 1 1  2 SER N    N   24.362  12.482  -9.901 1.00 . A A .   2 SER N    1 1 
       11  6197 1 1  2 SER O    O   25.212  11.998  -7.246 1.00 . A A .   2 SER O    1 1 
       11  6198 1 1  2 SER OG   O   27.112  12.923  -9.476 1.00 . A A .   2 SER OG   1 1 
       11  6199 1 1  3 SER C    C   25.895   8.088  -6.113 1.00 . A A .   3 SER C    1 1 
       11  6200 1 1  3 SER CA   C   25.122   9.386  -6.321 1.00 . A A .   3 SER CA   1 1 
       11  6201 1 1  3 SER CB   C   23.673   9.209  -5.865 1.00 . A A .   3 SER CB   1 1 
       11  6202 1 1  3 SER H    H   25.162   9.113  -8.421 1.00 . A A .   3 SER H    1 1 
       11  6203 1 1  3 SER HA   H   25.583  10.165  -5.732 1.00 . A A .   3 SER HA   1 1 
       11  6204 1 1  3 SER HB2  H   23.651   9.055  -4.797 1.00 . A A .   3 SER HB2  1 1 
       11  6205 1 1  3 SER HB3  H   23.109  10.096  -6.113 1.00 . A A .   3 SER HB3  1 1 
       11  6206 1 1  3 SER HG   H   23.698   7.367  -6.532 1.00 . A A .   3 SER HG   1 1 
       11  6207 1 1  3 SER N    N   25.165   9.798  -7.719 1.00 . A A .   3 SER N    1 1 
       11  6208 1 1  3 SER O    O   26.327   7.449  -7.072 1.00 . A A .   3 SER O    1 1 
       11  6209 1 1  3 SER OG   O   23.071   8.093  -6.499 1.00 . A A .   3 SER OG   1 1 
       11  6210 1 1  4 GLY C    C   26.043   5.607  -3.552 1.00 . A A .   4 GLY C    1 1 
       11  6211 1 1  4 GLY CA   C   26.788   6.484  -4.540 1.00 . A A .   4 GLY CA   1 1 
       11  6212 1 1  4 GLY H    H   25.700   8.253  -4.128 1.00 . A A .   4 GLY H    1 1 
       11  6213 1 1  4 GLY HA2  H   26.945   5.928  -5.452 1.00 . A A .   4 GLY HA2  1 1 
       11  6214 1 1  4 GLY HA3  H   27.748   6.744  -4.119 1.00 . A A .   4 GLY HA3  1 1 
       11  6215 1 1  4 GLY N    N   26.066   7.703  -4.852 1.00 . A A .   4 GLY N    1 1 
       11  6216 1 1  4 GLY O    O   25.576   4.523  -3.904 1.00 . A A .   4 GLY O    1 1 
       11  6217 1 1  5 SER C    C   23.830   4.957  -1.708 1.00 . A A .   5 SER C    1 1 
       11  6218 1 1  5 SER CA   C   25.246   5.322  -1.270 1.00 . A A .   5 SER CA   1 1 
       11  6219 1 1  5 SER CB   C   25.197   6.134   0.026 1.00 . A A .   5 SER CB   1 1 
       11  6220 1 1  5 SER H    H   26.328   6.945  -2.095 1.00 . A A .   5 SER H    1 1 
       11  6221 1 1  5 SER HA   H   25.802   4.413  -1.095 1.00 . A A .   5 SER HA   1 1 
       11  6222 1 1  5 SER HB2  H   25.006   7.170  -0.208 1.00 . A A .   5 SER HB2  1 1 
       11  6223 1 1  5 SER HB3  H   24.406   5.754   0.656 1.00 . A A .   5 SER HB3  1 1 
       11  6224 1 1  5 SER HG   H   27.150   5.998   0.103 1.00 . A A .   5 SER HG   1 1 
       11  6225 1 1  5 SER N    N   25.934   6.074  -2.313 1.00 . A A .   5 SER N    1 1 
       11  6226 1 1  5 SER O    O   23.391   3.820  -1.539 1.00 . A A .   5 SER O    1 1 
       11  6227 1 1  5 SER OG   O   26.424   6.044   0.729 1.00 . A A .   5 SER OG   1 1 
       11  6228 1 1  6 SER C    C   21.609   4.338  -3.371 1.00 . A A .   6 SER C    1 1 
       11  6229 1 1  6 SER CA   C   21.755   5.714  -2.730 1.00 . A A .   6 SER CA   1 1 
       11  6230 1 1  6 SER CB   C   21.352   6.800  -3.729 1.00 . A A .   6 SER CB   1 1 
       11  6231 1 1  6 SER H    H   23.528   6.816  -2.378 1.00 . A A .   6 SER H    1 1 
       11  6232 1 1  6 SER HA   H   21.104   5.768  -1.870 1.00 . A A .   6 SER HA   1 1 
       11  6233 1 1  6 SER HB2  H   21.399   7.765  -3.247 1.00 . A A .   6 SER HB2  1 1 
       11  6234 1 1  6 SER HB3  H   22.032   6.783  -4.569 1.00 . A A .   6 SER HB3  1 1 
       11  6235 1 1  6 SER HG   H   19.542   6.067  -3.568 1.00 . A A .   6 SER HG   1 1 
       11  6236 1 1  6 SER N    N   23.122   5.931  -2.271 1.00 . A A .   6 SER N    1 1 
       11  6237 1 1  6 SER O    O   22.519   3.853  -4.043 1.00 . A A .   6 SER O    1 1 
       11  6238 1 1  6 SER OG   O   20.034   6.592  -4.205 1.00 . A A .   6 SER OG   1 1 
       11  6239 1 1  7 GLY C    C   18.731   2.107  -3.894 1.00 . A A .   7 GLY C    1 1 
       11  6240 1 1  7 GLY CA   C   20.209   2.397  -3.722 1.00 . A A .   7 GLY CA   1 1 
       11  6241 1 1  7 GLY H    H   19.765   4.147  -2.616 1.00 . A A .   7 GLY H    1 1 
       11  6242 1 1  7 GLY HA2  H   20.692   2.334  -4.686 1.00 . A A .   7 GLY HA2  1 1 
       11  6243 1 1  7 GLY HA3  H   20.637   1.652  -3.067 1.00 . A A .   7 GLY HA3  1 1 
       11  6244 1 1  7 GLY N    N   20.455   3.712  -3.159 1.00 . A A .   7 GLY N    1 1 
       11  6245 1 1  7 GLY O    O   17.953   2.993  -4.249 1.00 . A A .   7 GLY O    1 1 
       11  6246 1 1  8 THR C    C   16.644  -0.759  -2.905 1.00 . A A .   8 THR C    1 1 
       11  6247 1 1  8 THR CA   C   16.948   0.455  -3.775 1.00 . A A .   8 THR CA   1 1 
       11  6248 1 1  8 THR CB   C   16.594   0.126  -5.238 1.00 . A A .   8 THR CB   1 1 
       11  6249 1 1  8 THR CG2  C   17.396  -1.068  -5.732 1.00 . A A .   8 THR CG2  1 1 
       11  6250 1 1  8 THR H    H   19.008   0.200  -3.364 1.00 . A A .   8 THR H    1 1 
       11  6251 1 1  8 THR HA   H   16.329   1.280  -3.454 1.00 . A A .   8 THR HA   1 1 
       11  6252 1 1  8 THR HB   H   16.835   0.982  -5.852 1.00 . A A .   8 THR HB   1 1 
       11  6253 1 1  8 THR HG1  H   14.990  -0.965  -4.884 1.00 . A A .   8 THR HG1  1 1 
       11  6254 1 1  8 THR HG21 H   16.784  -1.956  -5.688 1.00 . A A .   8 THR HG21 1 1 
       11  6255 1 1  8 THR HG22 H   18.268  -1.201  -5.108 1.00 . A A .   8 THR HG22 1 1 
       11  6256 1 1  8 THR HG23 H   17.707  -0.896  -6.752 1.00 . A A .   8 THR HG23 1 1 
       11  6257 1 1  8 THR N    N   18.341   0.861  -3.643 1.00 . A A .   8 THR N    1 1 
       11  6258 1 1  8 THR O    O   17.554  -1.459  -2.460 1.00 . A A .   8 THR O    1 1 
       11  6259 1 1  8 THR OG1  O   15.195  -0.153  -5.353 1.00 . A A .   8 THR OG1  1 1 
       11  6260 1 1  9 ARG C    C   14.646  -3.355  -2.717 1.00 . A A .   9 ARG C    1 1 
       11  6261 1 1  9 ARG CA   C   14.937  -2.135  -1.849 1.00 . A A .   9 ARG CA   1 1 
       11  6262 1 1  9 ARG CB   C   13.695  -1.767  -1.035 1.00 . A A .   9 ARG CB   1 1 
       11  6263 1 1  9 ARG CD   C   12.751  -0.818   1.092 1.00 . A A .   9 ARG CD   1 1 
       11  6264 1 1  9 ARG CG   C   14.011  -1.076   0.281 1.00 . A A .   9 ARG CG   1 1 
       11  6265 1 1  9 ARG CZ   C   12.453   1.608   0.829 1.00 . A A .   9 ARG CZ   1 1 
       11  6266 1 1  9 ARG H    H   14.681  -0.410  -3.049 1.00 . A A .   9 ARG H    1 1 
       11  6267 1 1  9 ARG HA   H   15.743  -2.374  -1.171 1.00 . A A .   9 ARG HA   1 1 
       11  6268 1 1  9 ARG HB2  H   13.076  -1.105  -1.624 1.00 . A A .   9 ARG HB2  1 1 
       11  6269 1 1  9 ARG HB3  H   13.141  -2.668  -0.820 1.00 . A A .   9 ARG HB3  1 1 
       11  6270 1 1  9 ARG HD2  H   12.103  -1.677   1.008 1.00 . A A .   9 ARG HD2  1 1 
       11  6271 1 1  9 ARG HD3  H   13.028  -0.675   2.126 1.00 . A A .   9 ARG HD3  1 1 
       11  6272 1 1  9 ARG HE   H   11.197   0.224   0.134 1.00 . A A .   9 ARG HE   1 1 
       11  6273 1 1  9 ARG HG2  H   14.673  -1.706   0.857 1.00 . A A .   9 ARG HG2  1 1 
       11  6274 1 1  9 ARG HG3  H   14.496  -0.134   0.075 1.00 . A A .   9 ARG HG3  1 1 
       11  6275 1 1  9 ARG HH11 H   14.118   1.060   1.833 1.00 . A A .   9 ARG HH11 1 1 
       11  6276 1 1  9 ARG HH12 H   13.895   2.768   1.641 1.00 . A A .   9 ARG HH12 1 1 
       11  6277 1 1  9 ARG HH21 H   10.893   2.469  -0.125 1.00 . A A .   9 ARG HH21 1 1 
       11  6278 1 1  9 ARG HH22 H   12.060   3.568   0.528 1.00 . A A .   9 ARG HH22 1 1 
       11  6279 1 1  9 ARG N    N   15.360  -1.004  -2.667 1.00 . A A .   9 ARG N    1 1 
       11  6280 1 1  9 ARG NE   N   12.033   0.365   0.624 1.00 . A A .   9 ARG NE   1 1 
       11  6281 1 1  9 ARG NH1  N   13.581   1.830   1.490 1.00 . A A .   9 ARG NH1  1 1 
       11  6282 1 1  9 ARG NH2  N   11.744   2.633   0.373 1.00 . A A .   9 ARG NH2  1 1 
       11  6283 1 1  9 ARG O    O   14.213  -3.225  -3.861 1.00 . A A .   9 ARG O    1 1 
       11  6284 1 1 10 GLU C    C   13.187  -6.192  -2.807 1.00 . A A .  10 GLU C    1 1 
       11  6285 1 1 10 GLU CA   C   14.654  -5.783  -2.890 1.00 . A A .  10 GLU CA   1 1 
       11  6286 1 1 10 GLU CB   C   15.539  -6.900  -2.332 1.00 . A A .  10 GLU CB   1 1 
       11  6287 1 1 10 GLU CD   C   16.727  -7.633  -4.438 1.00 . A A .  10 GLU CD   1 1 
       11  6288 1 1 10 GLU CG   C   15.786  -8.030  -3.317 1.00 . A A .  10 GLU CG   1 1 
       11  6289 1 1 10 GLU H    H   15.235  -4.579  -1.249 1.00 . A A .  10 GLU H    1 1 
       11  6290 1 1 10 GLU HA   H   14.911  -5.616  -3.925 1.00 . A A .  10 GLU HA   1 1 
       11  6291 1 1 10 GLU HB2  H   16.494  -6.480  -2.051 1.00 . A A .  10 GLU HB2  1 1 
       11  6292 1 1 10 GLU HB3  H   15.066  -7.313  -1.454 1.00 . A A .  10 GLU HB3  1 1 
       11  6293 1 1 10 GLU HG2  H   16.216  -8.866  -2.786 1.00 . A A .  10 GLU HG2  1 1 
       11  6294 1 1 10 GLU HG3  H   14.841  -8.327  -3.749 1.00 . A A .  10 GLU HG3  1 1 
       11  6295 1 1 10 GLU N    N   14.889  -4.540  -2.165 1.00 . A A .  10 GLU N    1 1 
       11  6296 1 1 10 GLU O    O   12.676  -6.896  -3.679 1.00 . A A .  10 GLU O    1 1 
       11  6297 1 1 10 GLU OE1  O   17.641  -6.820  -4.184 1.00 . A A .  10 GLU OE1  1 1 
       11  6298 1 1 10 GLU OE2  O   16.550  -8.134  -5.568 1.00 . A A .  10 GLU OE2  1 1 
       11  6299 1 1 11 LYS C    C   10.372  -6.152  -2.887 1.00 . A A .  11 LYS C    1 1 
       11  6300 1 1 11 LYS CA   C   11.105  -6.066  -1.552 1.00 . A A .  11 LYS CA   1 1 
       11  6301 1 1 11 LYS CB   C   10.443  -5.011  -0.662 1.00 . A A .  11 LYS CB   1 1 
       11  6302 1 1 11 LYS CD   C   11.776  -4.917   1.465 1.00 . A A .  11 LYS CD   1 1 
       11  6303 1 1 11 LYS CE   C   12.844  -5.994   1.356 1.00 . A A .  11 LYS CE   1 1 
       11  6304 1 1 11 LYS CG   C   10.474  -5.357   0.816 1.00 . A A .  11 LYS CG   1 1 
       11  6305 1 1 11 LYS H    H   12.976  -5.191  -1.090 1.00 . A A .  11 LYS H    1 1 
       11  6306 1 1 11 LYS HA   H   11.047  -7.026  -1.061 1.00 . A A .  11 LYS HA   1 1 
       11  6307 1 1 11 LYS HB2  H   10.953  -4.069  -0.801 1.00 . A A .  11 LYS HB2  1 1 
       11  6308 1 1 11 LYS HB3  H    9.411  -4.900  -0.963 1.00 . A A .  11 LYS HB3  1 1 
       11  6309 1 1 11 LYS HD2  H   12.130  -4.024   0.972 1.00 . A A .  11 LYS HD2  1 1 
       11  6310 1 1 11 LYS HD3  H   11.594  -4.706   2.509 1.00 . A A .  11 LYS HD3  1 1 
       11  6311 1 1 11 LYS HE2  H   12.655  -6.747   2.105 1.00 . A A .  11 LYS HE2  1 1 
       11  6312 1 1 11 LYS HE3  H   12.788  -6.441   0.375 1.00 . A A .  11 LYS HE3  1 1 
       11  6313 1 1 11 LYS HG2  H    9.652  -4.860   1.310 1.00 . A A .  11 LYS HG2  1 1 
       11  6314 1 1 11 LYS HG3  H   10.370  -6.427   0.929 1.00 . A A .  11 LYS HG3  1 1 
       11  6315 1 1 11 LYS HZ1  H   14.862  -6.196   1.857 1.00 . A A .  11 LYS HZ1  1 1 
       11  6316 1 1 11 LYS HZ2  H   14.194  -4.704   2.293 1.00 . A A .  11 LYS HZ2  1 1 
       11  6317 1 1 11 LYS HZ3  H   14.564  -5.024   0.674 1.00 . A A .  11 LYS HZ3  1 1 
       11  6318 1 1 11 LYS N    N   12.514  -5.748  -1.751 1.00 . A A .  11 LYS N    1 1 
       11  6319 1 1 11 LYS NZ   N   14.212  -5.441   1.559 1.00 . A A .  11 LYS NZ   1 1 
       11  6320 1 1 11 LYS O    O   10.503  -5.284  -3.751 1.00 . A A .  11 LYS O    1 1 
       11  6321 1 1 12 PRO C    C    7.666  -6.449  -4.443 1.00 . A A .  12 PRO C    1 1 
       11  6322 1 1 12 PRO CA   C    8.811  -7.444  -4.289 1.00 . A A .  12 PRO CA   1 1 
       11  6323 1 1 12 PRO CB   C    8.267  -8.864  -4.113 1.00 . A A .  12 PRO CB   1 1 
       11  6324 1 1 12 PRO CD   C    9.378  -8.295  -2.075 1.00 . A A .  12 PRO CD   1 1 
       11  6325 1 1 12 PRO CG   C    8.221  -9.072  -2.639 1.00 . A A .  12 PRO CG   1 1 
       11  6326 1 1 12 PRO HA   H    9.441  -7.404  -5.166 1.00 . A A .  12 PRO HA   1 1 
       11  6327 1 1 12 PRO HB2  H    7.282  -8.931  -4.553 1.00 . A A .  12 PRO HB2  1 1 
       11  6328 1 1 12 PRO HB3  H    8.930  -9.569  -4.591 1.00 . A A .  12 PRO HB3  1 1 
       11  6329 1 1 12 PRO HD2  H    9.124  -7.887  -1.108 1.00 . A A .  12 PRO HD2  1 1 
       11  6330 1 1 12 PRO HD3  H   10.255  -8.922  -2.003 1.00 . A A .  12 PRO HD3  1 1 
       11  6331 1 1 12 PRO HG2  H    7.290  -8.697  -2.244 1.00 . A A .  12 PRO HG2  1 1 
       11  6332 1 1 12 PRO HG3  H    8.331 -10.123  -2.413 1.00 . A A .  12 PRO HG3  1 1 
       11  6333 1 1 12 PRO N    N    9.582  -7.221  -3.062 1.00 . A A .  12 PRO N    1 1 
       11  6334 1 1 12 PRO O    O    7.520  -5.812  -5.487 1.00 . A A .  12 PRO O    1 1 
       11  6335 1 1 13 TYR C    C    6.190  -3.956  -3.330 1.00 . A A .  13 TYR C    1 1 
       11  6336 1 1 13 TYR CA   C    5.722  -5.405  -3.418 1.00 . A A .  13 TYR CA   1 1 
       11  6337 1 1 13 TYR CB   C    4.768  -5.715  -2.264 1.00 . A A .  13 TYR CB   1 1 
       11  6338 1 1 13 TYR CD1  C    3.061  -7.382  -3.093 1.00 . A A .  13 TYR CD1  1 1 
       11  6339 1 1 13 TYR CD2  C    4.753  -8.152  -1.600 1.00 . A A .  13 TYR CD2  1 1 
       11  6340 1 1 13 TYR CE1  C    2.523  -8.654  -3.146 1.00 . A A .  13 TYR CE1  1 1 
       11  6341 1 1 13 TYR CE2  C    4.222  -9.426  -1.648 1.00 . A A .  13 TYR CE2  1 1 
       11  6342 1 1 13 TYR CG   C    4.183  -7.109  -2.320 1.00 . A A .  13 TYR CG   1 1 
       11  6343 1 1 13 TYR CZ   C    3.107  -9.672  -2.422 1.00 . A A .  13 TYR CZ   1 1 
       11  6344 1 1 13 TYR H    H    7.023  -6.856  -2.594 1.00 . A A .  13 TYR H    1 1 
       11  6345 1 1 13 TYR HA   H    5.198  -5.545  -4.353 1.00 . A A .  13 TYR HA   1 1 
       11  6346 1 1 13 TYR HB2  H    5.299  -5.617  -1.330 1.00 . A A .  13 TYR HB2  1 1 
       11  6347 1 1 13 TYR HB3  H    3.949  -5.011  -2.283 1.00 . A A .  13 TYR HB3  1 1 
       11  6348 1 1 13 TYR HD1  H    2.606  -6.582  -3.658 1.00 . A A .  13 TYR HD1  1 1 
       11  6349 1 1 13 TYR HD2  H    5.626  -7.956  -0.995 1.00 . A A .  13 TYR HD2  1 1 
       11  6350 1 1 13 TYR HE1  H    1.650  -8.846  -3.752 1.00 . A A .  13 TYR HE1  1 1 
       11  6351 1 1 13 TYR HE2  H    4.679 -10.224  -1.082 1.00 . A A .  13 TYR HE2  1 1 
       11  6352 1 1 13 TYR HH   H    1.648 -10.908  -2.227 1.00 . A A .  13 TYR HH   1 1 
       11  6353 1 1 13 TYR N    N    6.856  -6.321  -3.398 1.00 . A A .  13 TYR N    1 1 
       11  6354 1 1 13 TYR O    O    6.916  -3.582  -2.409 1.00 . A A .  13 TYR O    1 1 
       11  6355 1 1 13 TYR OH   O    2.575 -10.940  -2.474 1.00 . A A .  13 TYR OH   1 1 
       11  6356 1 1 14 GLU C    C    4.916  -0.848  -4.494 1.00 . A A .  14 GLU C    1 1 
       11  6357 1 1 14 GLU CA   C    6.145  -1.736  -4.326 1.00 . A A .  14 GLU CA   1 1 
       11  6358 1 1 14 GLU CB   C    7.135  -1.475  -5.463 1.00 . A A .  14 GLU CB   1 1 
       11  6359 1 1 14 GLU CD   C    9.496  -2.059  -6.148 1.00 . A A .  14 GLU CD   1 1 
       11  6360 1 1 14 GLU CG   C    8.591  -1.565  -5.036 1.00 . A A .  14 GLU CG   1 1 
       11  6361 1 1 14 GLU H    H    5.192  -3.501  -5.002 1.00 . A A .  14 GLU H    1 1 
       11  6362 1 1 14 GLU HA   H    6.620  -1.498  -3.386 1.00 . A A .  14 GLU HA   1 1 
       11  6363 1 1 14 GLU HB2  H    6.965  -2.199  -6.246 1.00 . A A .  14 GLU HB2  1 1 
       11  6364 1 1 14 GLU HB3  H    6.959  -0.485  -5.857 1.00 . A A .  14 GLU HB3  1 1 
       11  6365 1 1 14 GLU HG2  H    8.924  -0.585  -4.729 1.00 . A A .  14 GLU HG2  1 1 
       11  6366 1 1 14 GLU HG3  H    8.666  -2.247  -4.201 1.00 . A A .  14 GLU HG3  1 1 
       11  6367 1 1 14 GLU N    N    5.769  -3.144  -4.295 1.00 . A A .  14 GLU N    1 1 
       11  6368 1 1 14 GLU O    O    3.931  -1.243  -5.120 1.00 . A A .  14 GLU O    1 1 
       11  6369 1 1 14 GLU OE1  O    9.253  -3.170  -6.663 1.00 . A A .  14 GLU OE1  1 1 
       11  6370 1 1 14 GLU OE2  O   10.448  -1.332  -6.503 1.00 . A A .  14 GLU OE2  1 1 
       11  6371 1 1 15 CYS C    C    3.805   1.934  -5.402 1.00 . A A .  15 CYS C    1 1 
       11  6372 1 1 15 CYS CA   C    3.873   1.299  -4.016 1.00 . A A .  15 CYS CA   1 1 
       11  6373 1 1 15 CYS CB   C    4.021   2.388  -2.951 1.00 . A A .  15 CYS CB   1 1 
       11  6374 1 1 15 CYS H    H    5.792   0.612  -3.445 1.00 . A A .  15 CYS H    1 1 
       11  6375 1 1 15 CYS HA   H    2.958   0.756  -3.838 1.00 . A A .  15 CYS HA   1 1 
       11  6376 1 1 15 CYS HB2  H    4.124   1.921  -1.982 1.00 . A A .  15 CYS HB2  1 1 
       11  6377 1 1 15 CYS HB3  H    4.908   2.967  -3.161 1.00 . A A .  15 CYS HB3  1 1 
       11  6378 1 1 15 CYS N    N    4.980   0.354  -3.931 1.00 . A A .  15 CYS N    1 1 
       11  6379 1 1 15 CYS O    O    4.804   2.442  -5.913 1.00 . A A .  15 CYS O    1 1 
       11  6380 1 1 15 CYS SG   S    2.612   3.539  -2.864 1.00 . A A .  15 CYS SG   1 1 
       11  6381 1 1 16 SER C    C    2.105   3.960  -7.243 1.00 . A A .  16 SER C    1 1 
       11  6382 1 1 16 SER CA   C    2.423   2.471  -7.332 1.00 . A A .  16 SER CA   1 1 
       11  6383 1 1 16 SER CB   C    1.294   1.739  -8.061 1.00 . A A .  16 SER CB   1 1 
       11  6384 1 1 16 SER H    H    1.863   1.483  -5.545 1.00 . A A .  16 SER H    1 1 
       11  6385 1 1 16 SER HA   H    3.340   2.343  -7.888 1.00 . A A .  16 SER HA   1 1 
       11  6386 1 1 16 SER HB2  H    1.275   2.050  -9.094 1.00 . A A .  16 SER HB2  1 1 
       11  6387 1 1 16 SER HB3  H    1.466   0.674  -8.008 1.00 . A A .  16 SER HB3  1 1 
       11  6388 1 1 16 SER HG   H   -0.420   1.208  -7.276 1.00 . A A .  16 SER HG   1 1 
       11  6389 1 1 16 SER N    N    2.621   1.902  -6.004 1.00 . A A .  16 SER N    1 1 
       11  6390 1 1 16 SER O    O    1.436   4.516  -8.114 1.00 . A A .  16 SER O    1 1 
       11  6391 1 1 16 SER OG   O    0.037   2.028  -7.474 1.00 . A A .  16 SER OG   1 1 
       11  6392 1 1 17 GLU C    C    3.662   6.752  -5.675 1.00 . A A .  17 GLU C    1 1 
       11  6393 1 1 17 GLU CA   C    2.356   6.025  -5.980 1.00 . A A .  17 GLU CA   1 1 
       11  6394 1 1 17 GLU CB   C    1.359   6.244  -4.840 1.00 . A A .  17 GLU CB   1 1 
       11  6395 1 1 17 GLU CD   C   -1.095   5.974  -4.306 1.00 . A A .  17 GLU CD   1 1 
       11  6396 1 1 17 GLU CG   C    0.140   5.340  -4.916 1.00 . A A .  17 GLU CG   1 1 
       11  6397 1 1 17 GLU H    H    3.115   4.103  -5.524 1.00 . A A .  17 GLU H    1 1 
       11  6398 1 1 17 GLU HA   H    1.939   6.427  -6.892 1.00 . A A .  17 GLU HA   1 1 
       11  6399 1 1 17 GLU HB2  H    1.860   6.061  -3.900 1.00 . A A .  17 GLU HB2  1 1 
       11  6400 1 1 17 GLU HB3  H    1.022   7.270  -4.864 1.00 . A A .  17 GLU HB3  1 1 
       11  6401 1 1 17 GLU HG2  H   -0.063   5.117  -5.952 1.00 . A A .  17 GLU HG2  1 1 
       11  6402 1 1 17 GLU HG3  H    0.354   4.423  -4.387 1.00 . A A .  17 GLU HG3  1 1 
       11  6403 1 1 17 GLU N    N    2.589   4.600  -6.184 1.00 . A A .  17 GLU N    1 1 
       11  6404 1 1 17 GLU O    O    3.927   7.830  -6.210 1.00 . A A .  17 GLU O    1 1 
       11  6405 1 1 17 GLU OE1  O   -1.305   7.187  -4.520 1.00 . A A .  17 GLU OE1  1 1 
       11  6406 1 1 17 GLU OE2  O   -1.851   5.259  -3.616 1.00 . A A .  17 GLU OE2  1 1 
       11  6407 1 1 18 CYS C    C    6.913   5.837  -4.833 1.00 . A A .  18 CYS C    1 1 
       11  6408 1 1 18 CYS CA   C    5.755   6.745  -4.431 1.00 . A A .  18 CYS CA   1 1 
       11  6409 1 1 18 CYS CB   C    5.794   7.003  -2.923 1.00 . A A .  18 CYS CB   1 1 
       11  6410 1 1 18 CYS H    H    4.210   5.298  -4.416 1.00 . A A .  18 CYS H    1 1 
       11  6411 1 1 18 CYS HA   H    5.854   7.686  -4.951 1.00 . A A .  18 CYS HA   1 1 
       11  6412 1 1 18 CYS HB2  H    6.756   7.421  -2.662 1.00 . A A .  18 CYS HB2  1 1 
       11  6413 1 1 18 CYS HB3  H    5.019   7.709  -2.666 1.00 . A A .  18 CYS HB3  1 1 
       11  6414 1 1 18 CYS N    N    4.476   6.156  -4.810 1.00 . A A .  18 CYS N    1 1 
       11  6415 1 1 18 CYS O    O    7.962   6.308  -5.270 1.00 . A A .  18 CYS O    1 1 
       11  6416 1 1 18 CYS SG   S    5.547   5.511  -1.907 1.00 . A A .  18 CYS SG   1 1 
       11  6417 1 1 19 GLY C    C    8.237   2.783  -3.840 1.00 . A A .  19 GLY C    1 1 
       11  6418 1 1 19 GLY CA   C    7.749   3.578  -5.035 1.00 . A A .  19 GLY CA   1 1 
       11  6419 1 1 19 GLY H    H    5.857   4.213  -4.330 1.00 . A A .  19 GLY H    1 1 
       11  6420 1 1 19 GLY HA2  H    7.358   2.894  -5.773 1.00 . A A .  19 GLY HA2  1 1 
       11  6421 1 1 19 GLY HA3  H    8.585   4.112  -5.462 1.00 . A A .  19 GLY HA3  1 1 
       11  6422 1 1 19 GLY N    N    6.714   4.531  -4.683 1.00 . A A .  19 GLY N    1 1 
       11  6423 1 1 19 GLY O    O    9.251   2.089  -3.917 1.00 . A A .  19 GLY O    1 1 
       11  6424 1 1 20 LYS C    C    8.056   0.681  -1.786 1.00 . A A .  20 LYS C    1 1 
       11  6425 1 1 20 LYS CA   C    7.878   2.171  -1.511 1.00 . A A .  20 LYS CA   1 1 
       11  6426 1 1 20 LYS CB   C    6.809   2.378  -0.436 1.00 . A A .  20 LYS CB   1 1 
       11  6427 1 1 20 LYS CD   C    6.577   3.042   1.976 1.00 . A A .  20 LYS CD   1 1 
       11  6428 1 1 20 LYS CE   C    7.120   2.865   3.385 1.00 . A A .  20 LYS CE   1 1 
       11  6429 1 1 20 LYS CG   C    7.321   2.169   0.979 1.00 . A A .  20 LYS CG   1 1 
       11  6430 1 1 20 LYS H    H    6.716   3.454  -2.729 1.00 . A A .  20 LYS H    1 1 
       11  6431 1 1 20 LYS HA   H    8.815   2.574  -1.158 1.00 . A A .  20 LYS HA   1 1 
       11  6432 1 1 20 LYS HB2  H    6.428   3.385  -0.513 1.00 . A A .  20 LYS HB2  1 1 
       11  6433 1 1 20 LYS HB3  H    6.001   1.682  -0.610 1.00 . A A .  20 LYS HB3  1 1 
       11  6434 1 1 20 LYS HD2  H    6.686   4.077   1.687 1.00 . A A .  20 LYS HD2  1 1 
       11  6435 1 1 20 LYS HD3  H    5.530   2.772   1.966 1.00 . A A .  20 LYS HD3  1 1 
       11  6436 1 1 20 LYS HE2  H    6.410   3.277   4.085 1.00 . A A .  20 LYS HE2  1 1 
       11  6437 1 1 20 LYS HE3  H    7.246   1.810   3.579 1.00 . A A .  20 LYS HE3  1 1 
       11  6438 1 1 20 LYS HG2  H    7.186   1.133   1.252 1.00 . A A .  20 LYS HG2  1 1 
       11  6439 1 1 20 LYS HG3  H    8.373   2.418   1.012 1.00 . A A .  20 LYS HG3  1 1 
       11  6440 1 1 20 LYS HZ1  H    8.384   4.516   3.181 1.00 . A A .  20 LYS HZ1  1 1 
       11  6441 1 1 20 LYS HZ2  H    9.178   3.026   3.067 1.00 . A A .  20 LYS HZ2  1 1 
       11  6442 1 1 20 LYS HZ3  H    8.672   3.601   4.575 1.00 . A A .  20 LYS HZ3  1 1 
       11  6443 1 1 20 LYS N    N    7.514   2.885  -2.729 1.00 . A A .  20 LYS N    1 1 
       11  6444 1 1 20 LYS NZ   N    8.430   3.551   3.565 1.00 . A A .  20 LYS NZ   1 1 
       11  6445 1 1 20 LYS O    O    7.897   0.226  -2.918 1.00 . A A .  20 LYS O    1 1 
       11  6446 1 1 21 ALA C    C    8.001  -2.254   0.327 1.00 . A A .  21 ALA C    1 1 
       11  6447 1 1 21 ALA CA   C    8.581  -1.512  -0.872 1.00 . A A .  21 ALA CA   1 1 
       11  6448 1 1 21 ALA CB   C   10.061  -1.831  -1.027 1.00 . A A .  21 ALA CB   1 1 
       11  6449 1 1 21 ALA H    H    8.499   0.348   0.135 1.00 . A A .  21 ALA H    1 1 
       11  6450 1 1 21 ALA HA   H    8.072  -1.839  -1.767 1.00 . A A .  21 ALA HA   1 1 
       11  6451 1 1 21 ALA HB1  H   10.602  -0.926  -1.257 1.00 . A A .  21 ALA HB1  1 1 
       11  6452 1 1 21 ALA HB2  H   10.436  -2.252  -0.106 1.00 . A A .  21 ALA HB2  1 1 
       11  6453 1 1 21 ALA HB3  H   10.193  -2.543  -1.828 1.00 . A A .  21 ALA HB3  1 1 
       11  6454 1 1 21 ALA N    N    8.386  -0.073  -0.743 1.00 . A A .  21 ALA N    1 1 
       11  6455 1 1 21 ALA O    O    7.880  -1.695   1.417 1.00 . A A .  21 ALA O    1 1 
       11  6456 1 1 22 PHE C    C    7.373  -5.814   0.950 1.00 . A A .  22 PHE C    1 1 
       11  6457 1 1 22 PHE CA   C    7.073  -4.336   1.182 1.00 . A A .  22 PHE CA   1 1 
       11  6458 1 1 22 PHE CB   C    5.561  -4.118   1.268 1.00 . A A .  22 PHE CB   1 1 
       11  6459 1 1 22 PHE CD1  C    5.121  -1.833   0.330 1.00 . A A .  22 PHE CD1  1 1 
       11  6460 1 1 22 PHE CD2  C    4.855  -2.165   2.676 1.00 . A A .  22 PHE CD2  1 1 
       11  6461 1 1 22 PHE CE1  C    4.762  -0.506   0.474 1.00 . A A .  22 PHE CE1  1 1 
       11  6462 1 1 22 PHE CE2  C    4.496  -0.839   2.826 1.00 . A A .  22 PHE CE2  1 1 
       11  6463 1 1 22 PHE CG   C    5.171  -2.676   1.428 1.00 . A A .  22 PHE CG   1 1 
       11  6464 1 1 22 PHE CZ   C    4.450  -0.008   1.724 1.00 . A A .  22 PHE CZ   1 1 
       11  6465 1 1 22 PHE H    H    7.763  -3.907  -0.773 1.00 . A A .  22 PHE H    1 1 
       11  6466 1 1 22 PHE HA   H    7.525  -4.031   2.112 1.00 . A A .  22 PHE HA   1 1 
       11  6467 1 1 22 PHE HB2  H    5.099  -4.488   0.364 1.00 . A A .  22 PHE HB2  1 1 
       11  6468 1 1 22 PHE HB3  H    5.174  -4.664   2.115 1.00 . A A .  22 PHE HB3  1 1 
       11  6469 1 1 22 PHE HD1  H    5.365  -2.221  -0.649 1.00 . A A .  22 PHE HD1  1 1 
       11  6470 1 1 22 PHE HD2  H    4.892  -2.813   3.539 1.00 . A A .  22 PHE HD2  1 1 
       11  6471 1 1 22 PHE HE1  H    4.727   0.141  -0.391 1.00 . A A .  22 PHE HE1  1 1 
       11  6472 1 1 22 PHE HE2  H    4.252  -0.452   3.804 1.00 . A A .  22 PHE HE2  1 1 
       11  6473 1 1 22 PHE HZ   H    4.169   1.028   1.838 1.00 . A A .  22 PHE HZ   1 1 
       11  6474 1 1 22 PHE N    N    7.643  -3.517   0.118 1.00 . A A .  22 PHE N    1 1 
       11  6475 1 1 22 PHE O    O    7.866  -6.199  -0.111 1.00 . A A .  22 PHE O    1 1 
       11  6476 1 1 23 ILE C    C    6.069  -8.801   1.350 1.00 . A A .  23 ILE C    1 1 
       11  6477 1 1 23 ILE CA   C    7.309  -8.071   1.855 1.00 . A A .  23 ILE CA   1 1 
       11  6478 1 1 23 ILE CB   C    7.722  -8.665   3.215 1.00 . A A .  23 ILE CB   1 1 
       11  6479 1 1 23 ILE CD1  C   10.208  -8.132   3.090 1.00 . A A .  23 ILE CD1  1 1 
       11  6480 1 1 23 ILE CG1  C    8.897  -7.881   3.802 1.00 . A A .  23 ILE CG1  1 1 
       11  6481 1 1 23 ILE CG2  C    8.082 -10.135   3.064 1.00 . A A .  23 ILE CG2  1 1 
       11  6482 1 1 23 ILE H    H    6.682  -6.269   2.769 1.00 . A A .  23 ILE H    1 1 
       11  6483 1 1 23 ILE HA   H    8.117  -8.230   1.155 1.00 . A A .  23 ILE HA   1 1 
       11  6484 1 1 23 ILE HB   H    6.879  -8.592   3.885 1.00 . A A .  23 ILE HB   1 1 
       11  6485 1 1 23 ILE HD11 H   10.037  -8.162   2.023 1.00 . A A .  23 ILE HD11 1 1 
       11  6486 1 1 23 ILE HD12 H   10.901  -7.337   3.320 1.00 . A A .  23 ILE HD12 1 1 
       11  6487 1 1 23 ILE HD13 H   10.619  -9.076   3.414 1.00 . A A .  23 ILE HD13 1 1 
       11  6488 1 1 23 ILE HG12 H    8.684  -6.825   3.741 1.00 . A A .  23 ILE HG12 1 1 
       11  6489 1 1 23 ILE HG13 H    9.023  -8.159   4.839 1.00 . A A .  23 ILE HG13 1 1 
       11  6490 1 1 23 ILE HG21 H    8.945 -10.230   2.422 1.00 . A A .  23 ILE HG21 1 1 
       11  6491 1 1 23 ILE HG22 H    8.308 -10.551   4.034 1.00 . A A .  23 ILE HG22 1 1 
       11  6492 1 1 23 ILE HG23 H    7.249 -10.667   2.628 1.00 . A A .  23 ILE HG23 1 1 
       11  6493 1 1 23 ILE N    N    7.072  -6.636   1.949 1.00 . A A .  23 ILE N    1 1 
       11  6494 1 1 23 ILE O    O    6.161  -9.690   0.503 1.00 . A A .  23 ILE O    1 1 
       11  6495 1 1 24 ARG C    C    2.663  -7.983   0.976 1.00 . A A .  24 ARG C    1 1 
       11  6496 1 1 24 ARG CA   C    3.650  -9.035   1.476 1.00 . A A .  24 ARG CA   1 1 
       11  6497 1 1 24 ARG CB   C    3.041  -9.804   2.649 1.00 . A A .  24 ARG CB   1 1 
       11  6498 1 1 24 ARG CD   C    4.071 -12.085   2.427 1.00 . A A .  24 ARG CD   1 1 
       11  6499 1 1 24 ARG CG   C    3.987 -10.821   3.267 1.00 . A A .  24 ARG CG   1 1 
       11  6500 1 1 24 ARG CZ   C    2.650 -14.065   2.103 1.00 . A A .  24 ARG CZ   1 1 
       11  6501 1 1 24 ARG H    H    4.900  -7.703   2.545 1.00 . A A .  24 ARG H    1 1 
       11  6502 1 1 24 ARG HA   H    3.858  -9.726   0.673 1.00 . A A .  24 ARG HA   1 1 
       11  6503 1 1 24 ARG HB2  H    2.754  -9.100   3.416 1.00 . A A .  24 ARG HB2  1 1 
       11  6504 1 1 24 ARG HB3  H    2.161 -10.326   2.304 1.00 . A A .  24 ARG HB3  1 1 
       11  6505 1 1 24 ARG HD2  H    4.409 -11.821   1.436 1.00 . A A .  24 ARG HD2  1 1 
       11  6506 1 1 24 ARG HD3  H    4.784 -12.757   2.882 1.00 . A A .  24 ARG HD3  1 1 
       11  6507 1 1 24 ARG HE   H    1.974 -12.216   2.424 1.00 . A A .  24 ARG HE   1 1 
       11  6508 1 1 24 ARG HG2  H    4.972 -10.384   3.341 1.00 . A A .  24 ARG HG2  1 1 
       11  6509 1 1 24 ARG HG3  H    3.630 -11.077   4.254 1.00 . A A .  24 ARG HG3  1 1 
       11  6510 1 1 24 ARG HH11 H    4.637 -14.423   2.025 1.00 . A A .  24 ARG HH11 1 1 
       11  6511 1 1 24 ARG HH12 H    3.623 -15.810   1.799 1.00 . A A .  24 ARG HH12 1 1 
       11  6512 1 1 24 ARG HH21 H    0.629 -14.035   2.127 1.00 . A A .  24 ARG HH21 1 1 
       11  6513 1 1 24 ARG HH22 H    1.344 -15.588   1.856 1.00 . A A .  24 ARG HH22 1 1 
       11  6514 1 1 24 ARG N    N    4.909  -8.418   1.874 1.00 . A A .  24 ARG N    1 1 
       11  6515 1 1 24 ARG NE   N    2.781 -12.762   2.324 1.00 . A A .  24 ARG NE   1 1 
       11  6516 1 1 24 ARG NH1  N    3.725 -14.828   1.963 1.00 . A A .  24 ARG NH1  1 1 
       11  6517 1 1 24 ARG NH2  N    1.442 -14.607   2.022 1.00 . A A .  24 ARG NH2  1 1 
       11  6518 1 1 24 ARG O    O    2.596  -6.877   1.511 1.00 . A A .  24 ARG O    1 1 
       11  6519 1 1 25 ASN C    C    0.117  -6.729   0.471 1.00 . A A .  25 ASN C    1 1 
       11  6520 1 1 25 ASN CA   C    0.917  -7.424  -0.625 1.00 . A A .  25 ASN CA   1 1 
       11  6521 1 1 25 ASN CB   C   -0.028  -8.180  -1.561 1.00 . A A .  25 ASN CB   1 1 
       11  6522 1 1 25 ASN CG   C   -0.559  -7.303  -2.678 1.00 . A A .  25 ASN CG   1 1 
       11  6523 1 1 25 ASN H    H    1.999  -9.234  -0.436 1.00 . A A .  25 ASN H    1 1 
       11  6524 1 1 25 ASN HA   H    1.451  -6.677  -1.194 1.00 . A A .  25 ASN HA   1 1 
       11  6525 1 1 25 ASN HB2  H    0.502  -9.011  -2.003 1.00 . A A .  25 ASN HB2  1 1 
       11  6526 1 1 25 ASN HB3  H   -0.866  -8.554  -0.992 1.00 . A A .  25 ASN HB3  1 1 
       11  6527 1 1 25 ASN HD21 H   -0.681  -5.754  -1.437 1.00 . A A .  25 ASN HD21 1 1 
       11  6528 1 1 25 ASN HD22 H   -1.180  -5.454  -3.064 1.00 . A A .  25 ASN HD22 1 1 
       11  6529 1 1 25 ASN N    N    1.900  -8.337  -0.053 1.00 . A A .  25 ASN N    1 1 
       11  6530 1 1 25 ASN ND2  N   -0.834  -6.043  -2.361 1.00 . A A .  25 ASN ND2  1 1 
       11  6531 1 1 25 ASN O    O   -0.022  -5.506   0.472 1.00 . A A .  25 ASN O    1 1 
       11  6532 1 1 25 ASN OD1  O   -0.720  -7.753  -3.813 1.00 . A A .  25 ASN OD1  1 1 
       11  6533 1 1 26 SER C    C   -0.516  -5.757   3.115 1.00 . A A .  26 SER C    1 1 
       11  6534 1 1 26 SER CA   C   -1.197  -6.978   2.506 1.00 . A A .  26 SER CA   1 1 
       11  6535 1 1 26 SER CB   C   -1.409  -8.047   3.580 1.00 . A A .  26 SER CB   1 1 
       11  6536 1 1 26 SER H    H   -0.261  -8.485   1.349 1.00 . A A .  26 SER H    1 1 
       11  6537 1 1 26 SER HA   H   -2.157  -6.681   2.111 1.00 . A A .  26 SER HA   1 1 
       11  6538 1 1 26 SER HB2  H   -2.105  -8.787   3.215 1.00 . A A .  26 SER HB2  1 1 
       11  6539 1 1 26 SER HB3  H   -0.464  -8.521   3.803 1.00 . A A .  26 SER HB3  1 1 
       11  6540 1 1 26 SER HG   H   -2.446  -8.136   5.239 1.00 . A A .  26 SER HG   1 1 
       11  6541 1 1 26 SER N    N   -0.407  -7.517   1.404 1.00 . A A .  26 SER N    1 1 
       11  6542 1 1 26 SER O    O   -1.171  -4.768   3.442 1.00 . A A .  26 SER O    1 1 
       11  6543 1 1 26 SER OG   O   -1.928  -7.478   4.769 1.00 . A A .  26 SER OG   1 1 
       11  6544 1 1 27 GLN C    C    1.472  -3.490   2.961 1.00 . A A .  27 GLN C    1 1 
       11  6545 1 1 27 GLN CA   C    1.572  -4.736   3.835 1.00 . A A .  27 GLN CA   1 1 
       11  6546 1 1 27 GLN CB   C    3.038  -5.143   3.998 1.00 . A A .  27 GLN CB   1 1 
       11  6547 1 1 27 GLN CD   C    4.501  -6.497   5.550 1.00 . A A .  27 GLN CD   1 1 
       11  6548 1 1 27 GLN CG   C    3.225  -6.461   4.732 1.00 . A A .  27 GLN CG   1 1 
       11  6549 1 1 27 GLN H    H    1.268  -6.650   2.984 1.00 . A A .  27 GLN H    1 1 
       11  6550 1 1 27 GLN HA   H    1.160  -4.512   4.807 1.00 . A A .  27 GLN HA   1 1 
       11  6551 1 1 27 GLN HB2  H    3.485  -5.233   3.019 1.00 . A A .  27 GLN HB2  1 1 
       11  6552 1 1 27 GLN HB3  H    3.554  -4.371   4.551 1.00 . A A .  27 GLN HB3  1 1 
       11  6553 1 1 27 GLN HE21 H    5.510  -5.651   4.060 1.00 . A A .  27 GLN HE21 1 1 
       11  6554 1 1 27 GLN HE22 H    6.428  -6.016   5.477 1.00 . A A .  27 GLN HE22 1 1 
       11  6555 1 1 27 GLN HG2  H    2.386  -6.612   5.395 1.00 . A A .  27 GLN HG2  1 1 
       11  6556 1 1 27 GLN HG3  H    3.257  -7.260   4.006 1.00 . A A .  27 GLN HG3  1 1 
       11  6557 1 1 27 GLN N    N    0.802  -5.835   3.264 1.00 . A A .  27 GLN N    1 1 
       11  6558 1 1 27 GLN NE2  N    5.590  -6.006   4.971 1.00 . A A .  27 GLN NE2  1 1 
       11  6559 1 1 27 GLN O    O    1.233  -2.388   3.458 1.00 . A A .  27 GLN O    1 1 
       11  6560 1 1 27 GLN OE1  O    4.507  -6.961   6.690 1.00 . A A .  27 GLN OE1  1 1 
       11  6561 1 1 28 LEU C    C    0.210  -1.908   0.741 1.00 . A A .  28 LEU C    1 1 
       11  6562 1 1 28 LEU CA   C    1.588  -2.560   0.715 1.00 . A A .  28 LEU CA   1 1 
       11  6563 1 1 28 LEU CB   C    1.908  -3.047  -0.700 1.00 . A A .  28 LEU CB   1 1 
       11  6564 1 1 28 LEU CD1  C    2.245  -0.758  -1.665 1.00 . A A .  28 LEU CD1  1 1 
       11  6565 1 1 28 LEU CD2  C    1.884  -2.712  -3.184 1.00 . A A .  28 LEU CD2  1 1 
       11  6566 1 1 28 LEU CG   C    1.539  -2.094  -1.837 1.00 . A A .  28 LEU CG   1 1 
       11  6567 1 1 28 LEU H    H    1.845  -4.571   1.322 1.00 . A A .  28 LEU H    1 1 
       11  6568 1 1 28 LEU HA   H    2.325  -1.828   1.010 1.00 . A A .  28 LEU HA   1 1 
       11  6569 1 1 28 LEU HB2  H    2.970  -3.230  -0.754 1.00 . A A .  28 LEU HB2  1 1 
       11  6570 1 1 28 LEU HB3  H    1.376  -3.974  -0.858 1.00 . A A .  28 LEU HB3  1 1 
       11  6571 1 1 28 LEU HD11 H    2.079  -0.389  -0.664 1.00 . A A .  28 LEU HD11 1 1 
       11  6572 1 1 28 LEU HD12 H    1.854  -0.049  -2.380 1.00 . A A .  28 LEU HD12 1 1 
       11  6573 1 1 28 LEU HD13 H    3.305  -0.887  -1.830 1.00 . A A .  28 LEU HD13 1 1 
       11  6574 1 1 28 LEU HD21 H    2.210  -1.937  -3.863 1.00 . A A .  28 LEU HD21 1 1 
       11  6575 1 1 28 LEU HD22 H    1.011  -3.202  -3.589 1.00 . A A .  28 LEU HD22 1 1 
       11  6576 1 1 28 LEU HD23 H    2.676  -3.436  -3.056 1.00 . A A .  28 LEU HD23 1 1 
       11  6577 1 1 28 LEU HG   H    0.473  -1.912  -1.815 1.00 . A A .  28 LEU HG   1 1 
       11  6578 1 1 28 LEU N    N    1.657  -3.670   1.658 1.00 . A A .  28 LEU N    1 1 
       11  6579 1 1 28 LEU O    O    0.088  -0.698   0.932 1.00 . A A .  28 LEU O    1 1 
       11  6580 1 1 29 ILE C    C   -2.425  -1.254   1.712 1.00 . A A .  29 ILE C    1 1 
       11  6581 1 1 29 ILE CA   C   -2.196  -2.220   0.555 1.00 . A A .  29 ILE CA   1 1 
       11  6582 1 1 29 ILE CB   C   -3.213  -3.372   0.653 1.00 . A A .  29 ILE CB   1 1 
       11  6583 1 1 29 ILE CD1  C   -3.742  -5.662  -0.326 1.00 . A A .  29 ILE CD1  1 1 
       11  6584 1 1 29 ILE CG1  C   -3.040  -4.336  -0.523 1.00 . A A .  29 ILE CG1  1 1 
       11  6585 1 1 29 ILE CG2  C   -4.632  -2.824   0.691 1.00 . A A .  29 ILE CG2  1 1 
       11  6586 1 1 29 ILE H    H   -0.665  -3.673   0.403 1.00 . A A .  29 ILE H    1 1 
       11  6587 1 1 29 ILE HA   H   -2.363  -1.697  -0.376 1.00 . A A .  29 ILE HA   1 1 
       11  6588 1 1 29 ILE HB   H   -3.033  -3.904   1.575 1.00 . A A .  29 ILE HB   1 1 
       11  6589 1 1 29 ILE HD11 H   -3.943  -5.809   0.726 1.00 . A A .  29 ILE HD11 1 1 
       11  6590 1 1 29 ILE HD12 H   -4.673  -5.661  -0.873 1.00 . A A .  29 ILE HD12 1 1 
       11  6591 1 1 29 ILE HD13 H   -3.111  -6.460  -0.686 1.00 . A A .  29 ILE HD13 1 1 
       11  6592 1 1 29 ILE HG12 H   -3.439  -3.880  -1.415 1.00 . A A .  29 ILE HG12 1 1 
       11  6593 1 1 29 ILE HG13 H   -1.988  -4.534  -0.664 1.00 . A A .  29 ILE HG13 1 1 
       11  6594 1 1 29 ILE HG21 H   -5.027  -2.778  -0.313 1.00 . A A .  29 ILE HG21 1 1 
       11  6595 1 1 29 ILE HG22 H   -5.252  -3.473   1.292 1.00 . A A .  29 ILE HG22 1 1 
       11  6596 1 1 29 ILE HG23 H   -4.624  -1.834   1.121 1.00 . A A .  29 ILE HG23 1 1 
       11  6597 1 1 29 ILE N    N   -0.826  -2.718   0.550 1.00 . A A .  29 ILE N    1 1 
       11  6598 1 1 29 ILE O    O   -2.875  -0.126   1.513 1.00 . A A .  29 ILE O    1 1 
       11  6599 1 1 30 VAL C    C   -1.641   0.492   3.926 1.00 . A A .  30 VAL C    1 1 
       11  6600 1 1 30 VAL CA   C   -2.281  -0.880   4.113 1.00 . A A .  30 VAL CA   1 1 
       11  6601 1 1 30 VAL CB   C   -1.669  -1.554   5.355 1.00 . A A .  30 VAL CB   1 1 
       11  6602 1 1 30 VAL CG1  C   -1.800  -0.652   6.572 1.00 . A A .  30 VAL CG1  1 1 
       11  6603 1 1 30 VAL CG2  C   -2.328  -2.902   5.607 1.00 . A A .  30 VAL CG2  1 1 
       11  6604 1 1 30 VAL H    H   -1.757  -2.613   3.018 1.00 . A A .  30 VAL H    1 1 
       11  6605 1 1 30 VAL HA   H   -3.340  -0.752   4.283 1.00 . A A .  30 VAL HA   1 1 
       11  6606 1 1 30 VAL HB   H   -0.618  -1.720   5.169 1.00 . A A .  30 VAL HB   1 1 
       11  6607 1 1 30 VAL HG11 H   -1.033  -0.902   7.290 1.00 . A A .  30 VAL HG11 1 1 
       11  6608 1 1 30 VAL HG12 H   -1.690   0.379   6.270 1.00 . A A .  30 VAL HG12 1 1 
       11  6609 1 1 30 VAL HG13 H   -2.772  -0.793   7.022 1.00 . A A .  30 VAL HG13 1 1 
       11  6610 1 1 30 VAL HG21 H   -3.236  -2.973   5.028 1.00 . A A .  30 VAL HG21 1 1 
       11  6611 1 1 30 VAL HG22 H   -1.652  -3.692   5.316 1.00 . A A .  30 VAL HG22 1 1 
       11  6612 1 1 30 VAL HG23 H   -2.562  -2.998   6.658 1.00 . A A .  30 VAL HG23 1 1 
       11  6613 1 1 30 VAL N    N   -2.112  -1.705   2.923 1.00 . A A .  30 VAL N    1 1 
       11  6614 1 1 30 VAL O    O   -2.199   1.510   4.336 1.00 . A A .  30 VAL O    1 1 
       11  6615 1 1 31 HIS C    C   -0.505   2.633   2.066 1.00 . A A .  31 HIS C    1 1 
       11  6616 1 1 31 HIS CA   C    0.250   1.758   3.062 1.00 . A A .  31 HIS CA   1 1 
       11  6617 1 1 31 HIS CB   C    1.658   1.470   2.540 1.00 . A A .  31 HIS CB   1 1 
       11  6618 1 1 31 HIS CD2  C    2.670   3.092   0.788 1.00 . A A .  31 HIS CD2  1 1 
       11  6619 1 1 31 HIS CE1  C    3.457   4.603   2.169 1.00 . A A .  31 HIS CE1  1 1 
       11  6620 1 1 31 HIS CG   C    2.375   2.688   2.046 1.00 . A A .  31 HIS CG   1 1 
       11  6621 1 1 31 HIS H    H   -0.072  -0.333   3.001 1.00 . A A .  31 HIS H    1 1 
       11  6622 1 1 31 HIS HA   H    0.325   2.286   4.001 1.00 . A A .  31 HIS HA   1 1 
       11  6623 1 1 31 HIS HB2  H    2.247   1.038   3.335 1.00 . A A .  31 HIS HB2  1 1 
       11  6624 1 1 31 HIS HB3  H    1.594   0.766   1.722 1.00 . A A .  31 HIS HB3  1 1 
       11  6625 1 1 31 HIS HD1  H    2.828   3.649   3.865 1.00 . A A .  31 HIS HD1  1 1 
       11  6626 1 1 31 HIS HD2  H    2.422   2.574  -0.127 1.00 . A A .  31 HIS HD2  1 1 
       11  6627 1 1 31 HIS HE1  H    3.940   5.487   2.558 1.00 . A A .  31 HIS HE1  1 1 
       11  6628 1 1 31 HIS N    N   -0.466   0.511   3.304 1.00 . A A .  31 HIS N    1 1 
       11  6629 1 1 31 HIS ND1  N    2.883   3.655   2.887 1.00 . A A .  31 HIS ND1  1 1 
       11  6630 1 1 31 HIS NE2  N    3.343   4.285   0.892 1.00 . A A .  31 HIS NE2  1 1 
       11  6631 1 1 31 HIS O    O   -0.584   3.850   2.231 1.00 . A A .  31 HIS O    1 1 
       11  6632 1 1 32 GLN C    C   -2.944   3.528   0.632 1.00 . A A .  32 GLN C    1 1 
       11  6633 1 1 32 GLN CA   C   -1.804   2.727   0.010 1.00 . A A .  32 GLN CA   1 1 
       11  6634 1 1 32 GLN CB   C   -2.358   1.753  -1.030 1.00 . A A .  32 GLN CB   1 1 
       11  6635 1 1 32 GLN CD   C   -1.792   0.649  -3.231 1.00 . A A .  32 GLN CD   1 1 
       11  6636 1 1 32 GLN CG   C   -1.283   1.084  -1.871 1.00 . A A .  32 GLN CG   1 1 
       11  6637 1 1 32 GLN H    H   -0.960   1.033   0.957 1.00 . A A .  32 GLN H    1 1 
       11  6638 1 1 32 GLN HA   H   -1.124   3.411  -0.476 1.00 . A A .  32 GLN HA   1 1 
       11  6639 1 1 32 GLN HB2  H   -2.919   0.983  -0.522 1.00 . A A .  32 GLN HB2  1 1 
       11  6640 1 1 32 GLN HB3  H   -3.020   2.291  -1.693 1.00 . A A .  32 GLN HB3  1 1 
       11  6641 1 1 32 GLN HE21 H   -0.004   0.984  -4.035 1.00 . A A .  32 GLN HE21 1 1 
       11  6642 1 1 32 GLN HE22 H   -1.219   0.407  -5.119 1.00 . A A .  32 GLN HE22 1 1 
       11  6643 1 1 32 GLN HG2  H   -0.471   1.781  -2.015 1.00 . A A .  32 GLN HG2  1 1 
       11  6644 1 1 32 GLN HG3  H   -0.920   0.215  -1.343 1.00 . A A .  32 GLN HG3  1 1 
       11  6645 1 1 32 GLN N    N   -1.057   2.005   1.033 1.00 . A A .  32 GLN N    1 1 
       11  6646 1 1 32 GLN NE2  N   -0.917   0.684  -4.230 1.00 . A A .  32 GLN NE2  1 1 
       11  6647 1 1 32 GLN O    O   -3.314   4.590   0.132 1.00 . A A .  32 GLN O    1 1 
       11  6648 1 1 32 GLN OE1  O   -2.958   0.285  -3.383 1.00 . A A .  32 GLN OE1  1 1 
       11  6649 1 1 33 ARG C    C   -4.254   5.138   2.695 1.00 . A A .  33 ARG C    1 1 
       11  6650 1 1 33 ARG CA   C   -4.595   3.678   2.414 1.00 . A A .  33 ARG CA   1 1 
       11  6651 1 1 33 ARG CB   C   -4.915   2.956   3.724 1.00 . A A .  33 ARG CB   1 1 
       11  6652 1 1 33 ARG CD   C   -6.016   0.958   4.779 1.00 . A A .  33 ARG CD   1 1 
       11  6653 1 1 33 ARG CG   C   -5.336   1.508   3.535 1.00 . A A .  33 ARG CG   1 1 
       11  6654 1 1 33 ARG CZ   C   -5.515   0.852   7.183 1.00 . A A .  33 ARG CZ   1 1 
       11  6655 1 1 33 ARG H    H   -3.157   2.161   2.076 1.00 . A A .  33 ARG H    1 1 
       11  6656 1 1 33 ARG HA   H   -5.461   3.640   1.771 1.00 . A A .  33 ARG HA   1 1 
       11  6657 1 1 33 ARG HB2  H   -4.039   2.974   4.355 1.00 . A A .  33 ARG HB2  1 1 
       11  6658 1 1 33 ARG HB3  H   -5.718   3.479   4.222 1.00 . A A .  33 ARG HB3  1 1 
       11  6659 1 1 33 ARG HD2  H   -6.851   1.596   5.028 1.00 . A A .  33 ARG HD2  1 1 
       11  6660 1 1 33 ARG HD3  H   -6.375  -0.038   4.566 1.00 . A A .  33 ARG HD3  1 1 
       11  6661 1 1 33 ARG HE   H   -4.145   0.902   5.735 1.00 . A A .  33 ARG HE   1 1 
       11  6662 1 1 33 ARG HG2  H   -6.025   1.448   2.705 1.00 . A A .  33 ARG HG2  1 1 
       11  6663 1 1 33 ARG HG3  H   -4.460   0.914   3.321 1.00 . A A .  33 ARG HG3  1 1 
       11  6664 1 1 33 ARG HH11 H   -7.482   0.888   6.726 1.00 . A A .  33 ARG HH11 1 1 
       11  6665 1 1 33 ARG HH12 H   -7.115   0.813   8.417 1.00 . A A .  33 ARG HH12 1 1 
       11  6666 1 1 33 ARG HH21 H   -3.649   0.803   7.959 1.00 . A A .  33 ARG HH21 1 1 
       11  6667 1 1 33 ARG HH22 H   -4.934   0.766   9.118 1.00 . A A .  33 ARG HH22 1 1 
       11  6668 1 1 33 ARG N    N   -3.496   3.011   1.725 1.00 . A A .  33 ARG N    1 1 
       11  6669 1 1 33 ARG NE   N   -5.107   0.902   5.920 1.00 . A A .  33 ARG NE   1 1 
       11  6670 1 1 33 ARG NH1  N   -6.810   0.851   7.465 1.00 . A A .  33 ARG NH1  1 1 
       11  6671 1 1 33 ARG NH2  N   -4.626   0.803   8.168 1.00 . A A .  33 ARG NH2  1 1 
       11  6672 1 1 33 ARG O    O   -5.107   6.020   2.580 1.00 . A A .  33 ARG O    1 1 
       11  6673 1 1 34 THR C    C   -2.621   7.631   2.128 1.00 . A A .  34 THR C    1 1 
       11  6674 1 1 34 THR CA   C   -2.548   6.740   3.363 1.00 . A A .  34 THR CA   1 1 
       11  6675 1 1 34 THR CB   C   -1.104   6.743   3.900 1.00 . A A .  34 THR CB   1 1 
       11  6676 1 1 34 THR CG2  C   -0.964   5.794   5.080 1.00 . A A .  34 THR CG2  1 1 
       11  6677 1 1 34 THR H    H   -2.369   4.644   3.137 1.00 . A A .  34 THR H    1 1 
       11  6678 1 1 34 THR HA   H   -3.195   7.148   4.127 1.00 . A A .  34 THR HA   1 1 
       11  6679 1 1 34 THR HB   H   -0.861   7.743   4.230 1.00 . A A .  34 THR HB   1 1 
       11  6680 1 1 34 THR HG1  H    0.706   6.529   3.147 1.00 . A A .  34 THR HG1  1 1 
       11  6681 1 1 34 THR HG21 H    0.078   5.701   5.344 1.00 . A A .  34 THR HG21 1 1 
       11  6682 1 1 34 THR HG22 H   -1.355   4.824   4.810 1.00 . A A .  34 THR HG22 1 1 
       11  6683 1 1 34 THR HG23 H   -1.516   6.183   5.922 1.00 . A A .  34 THR HG23 1 1 
       11  6684 1 1 34 THR N    N   -3.002   5.388   3.064 1.00 . A A .  34 THR N    1 1 
       11  6685 1 1 34 THR O    O   -2.976   8.806   2.217 1.00 . A A .  34 THR O    1 1 
       11  6686 1 1 34 THR OG1  O   -0.195   6.360   2.862 1.00 . A A .  34 THR OG1  1 1 
       11  6687 1 1 35 HIS C    C   -3.735   8.230  -0.629 1.00 . A A .  35 HIS C    1 1 
       11  6688 1 1 35 HIS CA   C   -2.312   7.806  -0.281 1.00 . A A .  35 HIS CA   1 1 
       11  6689 1 1 35 HIS CB   C   -1.729   6.959  -1.413 1.00 . A A .  35 HIS CB   1 1 
       11  6690 1 1 35 HIS CD2  C    0.769   6.260  -1.368 1.00 . A A .  35 HIS CD2  1 1 
       11  6691 1 1 35 HIS CE1  C    1.641   8.142  -2.078 1.00 . A A .  35 HIS CE1  1 1 
       11  6692 1 1 35 HIS CG   C   -0.250   7.125  -1.584 1.00 . A A .  35 HIS CG   1 1 
       11  6693 1 1 35 HIS H    H   -2.009   6.122   0.967 1.00 . A A .  35 HIS H    1 1 
       11  6694 1 1 35 HIS HA   H   -1.706   8.690  -0.156 1.00 . A A .  35 HIS HA   1 1 
       11  6695 1 1 35 HIS HB2  H   -1.924   5.916  -1.210 1.00 . A A .  35 HIS HB2  1 1 
       11  6696 1 1 35 HIS HB3  H   -2.205   7.235  -2.343 1.00 . A A .  35 HIS HB3  1 1 
       11  6697 1 1 35 HIS HD1  H   -0.149   9.114  -2.270 1.00 . A A .  35 HIS HD1  1 1 
       11  6698 1 1 35 HIS HD2  H    0.682   5.242  -1.014 1.00 . A A .  35 HIS HD2  1 1 
       11  6699 1 1 35 HIS HE1  H    2.353   8.892  -2.389 1.00 . A A .  35 HIS HE1  1 1 
       11  6700 1 1 35 HIS N    N   -2.283   7.063   0.974 1.00 . A A .  35 HIS N    1 1 
       11  6701 1 1 35 HIS ND1  N    0.329   8.295  -2.027 1.00 . A A .  35 HIS ND1  1 1 
       11  6702 1 1 35 HIS NE2  N    1.933   6.917  -1.682 1.00 . A A .  35 HIS NE2  1 1 
       11  6703 1 1 35 HIS O    O   -3.964   9.345  -1.098 1.00 . A A .  35 HIS O    1 1 
       11  6704 1 1 36 SER C    C   -6.443   9.053  -0.328 1.00 . A A .  36 SER C    1 1 
       11  6705 1 1 36 SER CA   C   -6.089   7.614  -0.690 1.00 . A A .  36 SER CA   1 1 
       11  6706 1 1 36 SER CB   C   -6.996   6.646   0.074 1.00 . A A .  36 SER CB   1 1 
       11  6707 1 1 36 SER H    H   -4.443   6.462  -0.022 1.00 . A A .  36 SER H    1 1 
       11  6708 1 1 36 SER HA   H   -6.241   7.474  -1.750 1.00 . A A .  36 SER HA   1 1 
       11  6709 1 1 36 SER HB2  H   -6.711   5.631  -0.158 1.00 . A A .  36 SER HB2  1 1 
       11  6710 1 1 36 SER HB3  H   -6.886   6.817   1.135 1.00 . A A .  36 SER HB3  1 1 
       11  6711 1 1 36 SER HG   H   -8.785   7.385   0.376 1.00 . A A .  36 SER HG   1 1 
       11  6712 1 1 36 SER N    N   -4.689   7.333  -0.397 1.00 . A A .  36 SER N    1 1 
       11  6713 1 1 36 SER O    O   -6.837   9.842  -1.186 1.00 . A A .  36 SER O    1 1 
       11  6714 1 1 36 SER OG   O   -8.355   6.832  -0.281 1.00 . A A .  36 SER OG   1 1 
       11  6715 1 1 37 GLY C    C   -5.467  11.700   1.163 1.00 . A A .  37 GLY C    1 1 
       11  6716 1 1 37 GLY CA   C   -6.607  10.731   1.406 1.00 . A A .  37 GLY CA   1 1 
       11  6717 1 1 37 GLY H    H   -5.980   8.717   1.591 1.00 . A A .  37 GLY H    1 1 
       11  6718 1 1 37 GLY HA2  H   -7.483  11.084   0.883 1.00 . A A .  37 GLY HA2  1 1 
       11  6719 1 1 37 GLY HA3  H   -6.819  10.700   2.464 1.00 . A A .  37 GLY HA3  1 1 
       11  6720 1 1 37 GLY N    N   -6.299   9.387   0.951 1.00 . A A .  37 GLY N    1 1 
       11  6721 1 1 37 GLY O    O   -4.630  11.478   0.289 1.00 . A A .  37 GLY O    1 1 
       11  6722 1 1 38 GLU C    C   -4.108  14.081   0.329 1.00 . A A .  38 GLU C    1 1 
       11  6723 1 1 38 GLU CA   C   -4.391  13.788   1.800 1.00 . A A .  38 GLU CA   1 1 
       11  6724 1 1 38 GLU CB   C   -3.109  13.325   2.495 1.00 . A A .  38 GLU CB   1 1 
       11  6725 1 1 38 GLU CD   C   -4.502  12.849   4.548 1.00 . A A .  38 GLU CD   1 1 
       11  6726 1 1 38 GLU CG   C   -3.186  13.378   4.012 1.00 . A A .  38 GLU CG   1 1 
       11  6727 1 1 38 GLU H    H   -6.131  12.902   2.617 1.00 . A A .  38 GLU H    1 1 
       11  6728 1 1 38 GLU HA   H   -4.740  14.694   2.274 1.00 . A A .  38 GLU HA   1 1 
       11  6729 1 1 38 GLU HB2  H   -2.902  12.307   2.201 1.00 . A A .  38 GLU HB2  1 1 
       11  6730 1 1 38 GLU HB3  H   -2.293  13.956   2.175 1.00 . A A .  38 GLU HB3  1 1 
       11  6731 1 1 38 GLU HG2  H   -2.383  12.783   4.421 1.00 . A A .  38 GLU HG2  1 1 
       11  6732 1 1 38 GLU HG3  H   -3.071  14.404   4.330 1.00 . A A .  38 GLU HG3  1 1 
       11  6733 1 1 38 GLU N    N   -5.436  12.780   1.938 1.00 . A A .  38 GLU N    1 1 
       11  6734 1 1 38 GLU O    O   -2.953  14.201  -0.079 1.00 . A A .  38 GLU O    1 1 
       11  6735 1 1 38 GLU OE1  O   -5.488  13.615   4.561 1.00 . A A .  38 GLU OE1  1 1 
       11  6736 1 1 38 GLU OE2  O   -4.546  11.669   4.955 1.00 . A A .  38 GLU OE2  1 1 
       11  6737 1 1 39 SER C    C   -5.705  15.792  -2.250 1.00 . A A .  39 SER C    1 1 
       11  6738 1 1 39 SER CA   C   -5.038  14.469  -1.887 1.00 . A A .  39 SER CA   1 1 
       11  6739 1 1 39 SER CB   C   -5.653  13.332  -2.706 1.00 . A A .  39 SER CB   1 1 
       11  6740 1 1 39 SER H    H   -6.066  14.089  -0.075 1.00 . A A .  39 SER H    1 1 
       11  6741 1 1 39 SER HA   H   -3.984  14.536  -2.114 1.00 . A A .  39 SER HA   1 1 
       11  6742 1 1 39 SER HB2  H   -5.295  12.386  -2.329 1.00 . A A .  39 SER HB2  1 1 
       11  6743 1 1 39 SER HB3  H   -6.729  13.371  -2.618 1.00 . A A .  39 SER HB3  1 1 
       11  6744 1 1 39 SER HG   H   -5.470  12.606  -4.516 1.00 . A A .  39 SER HG   1 1 
       11  6745 1 1 39 SER N    N   -5.171  14.194  -0.461 1.00 . A A .  39 SER N    1 1 
       11  6746 1 1 39 SER O    O   -5.097  16.653  -2.883 1.00 . A A .  39 SER O    1 1 
       11  6747 1 1 39 SER OG   O   -5.301  13.441  -4.074 1.00 . A A .  39 SER OG   1 1 
       11  6748 1 1 40 GLY C    C   -8.804  16.948  -3.143 1.00 . A A .  40 GLY C    1 1 
       11  6749 1 1 40 GLY CA   C   -7.692  17.164  -2.136 1.00 . A A .  40 GLY CA   1 1 
       11  6750 1 1 40 GLY H    H   -7.397  15.223  -1.343 1.00 . A A .  40 GLY H    1 1 
       11  6751 1 1 40 GLY HA2  H   -8.120  17.543  -1.219 1.00 . A A .  40 GLY HA2  1 1 
       11  6752 1 1 40 GLY HA3  H   -7.004  17.897  -2.530 1.00 . A A .  40 GLY HA3  1 1 
       11  6753 1 1 40 GLY N    N   -6.962  15.945  -1.844 1.00 . A A .  40 GLY N    1 1 
       11  6754 1 1 40 GLY O    O   -9.436  15.892  -3.185 1.00 . A A .  40 GLY O    1 1 
       11  6755 1 1 41 PRO C    C   -9.753  16.940  -6.132 1.00 . A A .  41 PRO C    1 1 
       11  6756 1 1 41 PRO CA   C  -10.102  17.906  -5.006 1.00 . A A .  41 PRO CA   1 1 
       11  6757 1 1 41 PRO CB   C  -10.164  19.342  -5.533 1.00 . A A .  41 PRO CB   1 1 
       11  6758 1 1 41 PRO CD   C   -8.343  19.253  -3.986 1.00 . A A .  41 PRO CD   1 1 
       11  6759 1 1 41 PRO CG   C   -8.812  19.905  -5.258 1.00 . A A .  41 PRO CG   1 1 
       11  6760 1 1 41 PRO HA   H  -11.058  17.634  -4.583 1.00 . A A .  41 PRO HA   1 1 
       11  6761 1 1 41 PRO HB2  H  -10.380  19.330  -6.592 1.00 . A A .  41 PRO HB2  1 1 
       11  6762 1 1 41 PRO HB3  H  -10.933  19.889  -5.009 1.00 . A A .  41 PRO HB3  1 1 
       11  6763 1 1 41 PRO HD2  H   -7.274  19.101  -4.012 1.00 . A A .  41 PRO HD2  1 1 
       11  6764 1 1 41 PRO HD3  H   -8.620  19.852  -3.131 1.00 . A A .  41 PRO HD3  1 1 
       11  6765 1 1 41 PRO HG2  H   -8.143  19.666  -6.070 1.00 . A A .  41 PRO HG2  1 1 
       11  6766 1 1 41 PRO HG3  H   -8.880  20.975  -5.127 1.00 . A A .  41 PRO HG3  1 1 
       11  6767 1 1 41 PRO N    N   -9.057  17.966  -3.979 1.00 . A A .  41 PRO N    1 1 
       11  6768 1 1 41 PRO O    O   -8.641  16.414  -6.190 1.00 . A A .  41 PRO O    1 1 
       11  6769 1 1 42 SER C    C  -11.511  16.079  -9.262 1.00 . A A .  42 SER C    1 1 
       11  6770 1 1 42 SER CA   C  -10.503  15.804  -8.150 1.00 . A A .  42 SER CA   1 1 
       11  6771 1 1 42 SER CB   C  -10.621  14.350  -7.688 1.00 . A A .  42 SER CB   1 1 
       11  6772 1 1 42 SER H    H  -11.575  17.159  -6.926 1.00 . A A .  42 SER H    1 1 
       11  6773 1 1 42 SER HA   H   -9.508  15.972  -8.533 1.00 . A A .  42 SER HA   1 1 
       11  6774 1 1 42 SER HB2  H  -10.417  13.693  -8.520 1.00 . A A .  42 SER HB2  1 1 
       11  6775 1 1 42 SER HB3  H   -9.904  14.167  -6.901 1.00 . A A .  42 SER HB3  1 1 
       11  6776 1 1 42 SER HG   H  -12.469  13.740  -7.910 1.00 . A A .  42 SER HG   1 1 
       11  6777 1 1 42 SER N    N  -10.709  16.710  -7.027 1.00 . A A .  42 SER N    1 1 
       11  6778 1 1 42 SER O    O  -12.719  15.934  -9.070 1.00 . A A .  42 SER O    1 1 
       11  6779 1 1 42 SER OG   O  -11.921  14.075  -7.197 1.00 . A A .  42 SER OG   1 1 
       11  6780 1 1 43 SER C    C  -12.324  15.495 -12.251 1.00 . A A .  43 SER C    1 1 
       11  6781 1 1 43 SER CA   C  -11.862  16.778 -11.567 1.00 . A A .  43 SER CA   1 1 
       11  6782 1 1 43 SER CB   C  -11.119  17.664 -12.569 1.00 . A A .  43 SER CB   1 1 
       11  6783 1 1 43 SER H    H  -10.035  16.575 -10.516 1.00 . A A .  43 SER H    1 1 
       11  6784 1 1 43 SER HA   H  -12.728  17.309 -11.202 1.00 . A A .  43 SER HA   1 1 
       11  6785 1 1 43 SER HB2  H  -10.596  18.445 -12.036 1.00 . A A .  43 SER HB2  1 1 
       11  6786 1 1 43 SER HB3  H  -10.408  17.064 -13.118 1.00 . A A .  43 SER HB3  1 1 
       11  6787 1 1 43 SER HG   H  -11.804  17.975 -14.377 1.00 . A A .  43 SER HG   1 1 
       11  6788 1 1 43 SER N    N  -11.006  16.478 -10.425 1.00 . A A .  43 SER N    1 1 
       11  6789 1 1 43 SER O    O  -11.582  14.516 -12.327 1.00 . A A .  43 SER O    1 1 
       11  6790 1 1 43 SER OG   O  -12.018  18.262 -13.486 1.00 . A A .  43 SER OG   1 1 
       11  6791 1 1 44 GLY C    C  -15.177  13.654 -12.610 1.00 . A A .  44 GLY C    1 1 
       11  6792 1 1 44 GLY CA   C  -14.097  14.341 -13.421 1.00 . A A .  44 GLY CA   1 1 
       11  6793 1 1 44 GLY H    H  -14.103  16.317 -12.660 1.00 . A A .  44 GLY H    1 1 
       11  6794 1 1 44 GLY HA2  H  -14.514  14.646 -14.370 1.00 . A A .  44 GLY HA2  1 1 
       11  6795 1 1 44 GLY HA3  H  -13.296  13.639 -13.600 1.00 . A A .  44 GLY HA3  1 1 
       11  6796 1 1 44 GLY N    N  -13.556  15.508 -12.750 1.00 . A A .  44 GLY N    1 1 
       11  6797 1 1 44 GLY O    O  -16.358  13.884 -12.867 1.00 . A A .  44 GLY O    1 1 
       11  6798 2 2  1 ZN  ZN   ZN   3.338   5.100  -1.291 1.00 . B A . 201 ZN  ZN   1 1 
       12  6799 1 1  1 GLY C    C   23.093   5.486 -22.712 1.00 . A A .   1 GLY C    1 1 
       12  6800 1 1  1 GLY CA   C   22.601   5.064 -24.082 1.00 . A A .   1 GLY CA   1 1 
       12  6801 1 1  1 GLY H1   H   23.540   4.441 -25.875 1.00 . A A .   1 GLY H1   1 1 
       12  6802 1 1  1 GLY HA2  H   21.889   5.793 -24.439 1.00 . A A .   1 GLY HA2  1 1 
       12  6803 1 1  1 GLY HA3  H   22.108   4.107 -23.995 1.00 . A A .   1 GLY HA3  1 1 
       12  6804 1 1  1 GLY N    N   23.678   4.949 -25.048 1.00 . A A .   1 GLY N    1 1 
       12  6805 1 1  1 GLY O    O   23.696   6.549 -22.562 1.00 . A A .   1 GLY O    1 1 
       12  6806 1 1  2 SER C    C   23.136   3.710 -19.460 1.00 . A A .   2 SER C    1 1 
       12  6807 1 1  2 SER CA   C   23.251   4.949 -20.343 1.00 . A A .   2 SER CA   1 1 
       12  6808 1 1  2 SER CB   C   22.403   6.083 -19.764 1.00 . A A .   2 SER CB   1 1 
       12  6809 1 1  2 SER H    H   22.350   3.821 -21.892 1.00 . A A .   2 SER H    1 1 
       12  6810 1 1  2 SER HA   H   24.284   5.262 -20.372 1.00 . A A .   2 SER HA   1 1 
       12  6811 1 1  2 SER HB2  H   22.632   7.002 -20.281 1.00 . A A .   2 SER HB2  1 1 
       12  6812 1 1  2 SER HB3  H   21.356   5.848 -19.893 1.00 . A A .   2 SER HB3  1 1 
       12  6813 1 1  2 SER HG   H   23.540   6.633 -18.267 1.00 . A A .   2 SER HG   1 1 
       12  6814 1 1  2 SER N    N   22.834   4.654 -21.709 1.00 . A A .   2 SER N    1 1 
       12  6815 1 1  2 SER O    O   22.132   2.999 -19.497 1.00 . A A .   2 SER O    1 1 
       12  6816 1 1  2 SER OG   O   22.664   6.260 -18.382 1.00 . A A .   2 SER OG   1 1 
       12  6817 1 1  3 SER C    C   22.933   2.262 -16.916 1.00 . A A .   3 SER C    1 1 
       12  6818 1 1  3 SER CA   C   24.191   2.304 -17.777 1.00 . A A .   3 SER CA   1 1 
       12  6819 1 1  3 SER CB   C   25.433   2.342 -16.884 1.00 . A A .   3 SER CB   1 1 
       12  6820 1 1  3 SER H    H   24.944   4.063 -18.683 1.00 . A A .   3 SER H    1 1 
       12  6821 1 1  3 SER HA   H   24.225   1.415 -18.388 1.00 . A A .   3 SER HA   1 1 
       12  6822 1 1  3 SER HB2  H   26.305   2.528 -17.492 1.00 . A A .   3 SER HB2  1 1 
       12  6823 1 1  3 SER HB3  H   25.326   3.133 -16.156 1.00 . A A .   3 SER HB3  1 1 
       12  6824 1 1  3 SER HG   H   24.757   0.677 -16.103 1.00 . A A .   3 SER HG   1 1 
       12  6825 1 1  3 SER N    N   24.173   3.459 -18.667 1.00 . A A .   3 SER N    1 1 
       12  6826 1 1  3 SER O    O   22.387   3.299 -16.542 1.00 . A A .   3 SER O    1 1 
       12  6827 1 1  3 SER OG   O   25.607   1.113 -16.200 1.00 . A A .   3 SER OG   1 1 
       12  6828 1 1  4 GLY C    C   21.404   1.595 -14.449 1.00 . A A .   4 GLY C    1 1 
       12  6829 1 1  4 GLY CA   C   21.286   0.896 -15.789 1.00 . A A .   4 GLY CA   1 1 
       12  6830 1 1  4 GLY H    H   22.953   0.260 -16.929 1.00 . A A .   4 GLY H    1 1 
       12  6831 1 1  4 GLY HA2  H   20.441   1.304 -16.323 1.00 . A A .   4 GLY HA2  1 1 
       12  6832 1 1  4 GLY HA3  H   21.117  -0.158 -15.618 1.00 . A A .   4 GLY HA3  1 1 
       12  6833 1 1  4 GLY N    N   22.477   1.052 -16.604 1.00 . A A .   4 GLY N    1 1 
       12  6834 1 1  4 GLY O    O   22.507   1.795 -13.941 1.00 . A A .   4 GLY O    1 1 
       12  6835 1 1  5 SER C    C   19.550   1.806 -11.532 1.00 . A A .   5 SER C    1 1 
       12  6836 1 1  5 SER CA   C   20.245   2.656 -12.591 1.00 . A A .   5 SER CA   1 1 
       12  6837 1 1  5 SER CB   C   19.539   4.008 -12.720 1.00 . A A .   5 SER CB   1 1 
       12  6838 1 1  5 SER H    H   19.417   1.782 -14.332 1.00 . A A .   5 SER H    1 1 
       12  6839 1 1  5 SER HA   H   21.268   2.822 -12.288 1.00 . A A .   5 SER HA   1 1 
       12  6840 1 1  5 SER HB2  H   19.951   4.547 -13.560 1.00 . A A .   5 SER HB2  1 1 
       12  6841 1 1  5 SER HB3  H   18.483   3.845 -12.880 1.00 . A A .   5 SER HB3  1 1 
       12  6842 1 1  5 SER HG   H   19.424   4.281 -10.784 1.00 . A A .   5 SER HG   1 1 
       12  6843 1 1  5 SER N    N   20.264   1.970 -13.877 1.00 . A A .   5 SER N    1 1 
       12  6844 1 1  5 SER O    O   18.367   1.994 -11.247 1.00 . A A .   5 SER O    1 1 
       12  6845 1 1  5 SER OG   O   19.709   4.787 -11.549 1.00 . A A .   5 SER OG   1 1 
       12  6846 1 1  6 SER C    C   19.402   0.770  -8.664 1.00 . A A .   6 SER C    1 1 
       12  6847 1 1  6 SER CA   C   19.749  -0.013  -9.926 1.00 . A A .   6 SER CA   1 1 
       12  6848 1 1  6 SER CB   C   20.749  -1.122  -9.594 1.00 . A A .   6 SER CB   1 1 
       12  6849 1 1  6 SER H    H   21.230   0.769 -11.222 1.00 . A A .   6 SER H    1 1 
       12  6850 1 1  6 SER HA   H   18.847  -0.459 -10.318 1.00 . A A .   6 SER HA   1 1 
       12  6851 1 1  6 SER HB2  H   20.395  -1.678  -8.740 1.00 . A A .   6 SER HB2  1 1 
       12  6852 1 1  6 SER HB3  H   20.842  -1.785 -10.443 1.00 . A A .   6 SER HB3  1 1 
       12  6853 1 1  6 SER HG   H   22.677  -1.289  -9.288 1.00 . A A .   6 SER HG   1 1 
       12  6854 1 1  6 SER N    N   20.293   0.870 -10.952 1.00 . A A .   6 SER N    1 1 
       12  6855 1 1  6 SER O    O   20.095   1.719  -8.298 1.00 . A A .   6 SER O    1 1 
       12  6856 1 1  6 SER OG   O   22.025  -0.584  -9.293 1.00 . A A .   6 SER OG   1 1 
       12  6857 1 1  7 GLY C    C   18.078   0.173  -5.553 1.00 . A A .   7 GLY C    1 1 
       12  6858 1 1  7 GLY CA   C   17.903   1.038  -6.786 1.00 . A A .   7 GLY CA   1 1 
       12  6859 1 1  7 GLY H    H   17.809  -0.398  -8.339 1.00 . A A .   7 GLY H    1 1 
       12  6860 1 1  7 GLY HA2  H   18.485   1.939  -6.667 1.00 . A A .   7 GLY HA2  1 1 
       12  6861 1 1  7 GLY HA3  H   16.860   1.305  -6.879 1.00 . A A .   7 GLY HA3  1 1 
       12  6862 1 1  7 GLY N    N   18.323   0.364  -8.001 1.00 . A A .   7 GLY N    1 1 
       12  6863 1 1  7 GLY O    O   18.996  -0.644  -5.484 1.00 . A A .   7 GLY O    1 1 
       12  6864 1 1  8 THR C    C   15.900  -1.015  -2.995 1.00 . A A .   8 THR C    1 1 
       12  6865 1 1  8 THR CA   C   17.258  -0.413  -3.338 1.00 . A A .   8 THR CA   1 1 
       12  6866 1 1  8 THR CB   C   17.734   0.458  -2.160 1.00 . A A .   8 THR CB   1 1 
       12  6867 1 1  8 THR CG2  C   18.000  -0.395  -0.929 1.00 . A A .   8 THR CG2  1 1 
       12  6868 1 1  8 THR H    H   16.486   1.020  -4.690 1.00 . A A .   8 THR H    1 1 
       12  6869 1 1  8 THR HA   H   17.971  -1.213  -3.477 1.00 . A A .   8 THR HA   1 1 
       12  6870 1 1  8 THR HB   H   16.957   1.172  -1.924 1.00 . A A .   8 THR HB   1 1 
       12  6871 1 1  8 THR HG1  H   19.367   1.476  -1.730 1.00 . A A .   8 THR HG1  1 1 
       12  6872 1 1  8 THR HG21 H   17.365  -0.067  -0.120 1.00 . A A .   8 THR HG21 1 1 
       12  6873 1 1  8 THR HG22 H   19.035  -0.294  -0.638 1.00 . A A .   8 THR HG22 1 1 
       12  6874 1 1  8 THR HG23 H   17.790  -1.430  -1.156 1.00 . A A .   8 THR HG23 1 1 
       12  6875 1 1  8 THR N    N   17.195   0.354  -4.575 1.00 . A A .   8 THR N    1 1 
       12  6876 1 1  8 THR O    O   15.472  -0.987  -1.841 1.00 . A A .   8 THR O    1 1 
       12  6877 1 1  8 THR OG1  O   18.924   1.165  -2.523 1.00 . A A .   8 THR OG1  1 1 
       12  6878 1 1  9 ARG C    C   13.998  -3.686  -3.937 1.00 . A A .   9 ARG C    1 1 
       12  6879 1 1  9 ARG CA   C   13.917  -2.168  -3.807 1.00 . A A .   9 ARG CA   1 1 
       12  6880 1 1  9 ARG CB   C   12.916  -1.611  -4.822 1.00 . A A .   9 ARG CB   1 1 
       12  6881 1 1  9 ARG CD   C   11.910   0.458  -5.832 1.00 . A A .   9 ARG CD   1 1 
       12  6882 1 1  9 ARG CG   C   12.589  -0.142  -4.611 1.00 . A A .   9 ARG CG   1 1 
       12  6883 1 1  9 ARG CZ   C   12.588   1.766  -7.800 1.00 . A A .   9 ARG CZ   1 1 
       12  6884 1 1  9 ARG H    H   15.621  -1.551  -4.901 1.00 . A A .   9 ARG H    1 1 
       12  6885 1 1  9 ARG HA   H   13.582  -1.921  -2.811 1.00 . A A .   9 ARG HA   1 1 
       12  6886 1 1  9 ARG HB2  H   13.325  -1.727  -5.815 1.00 . A A .   9 ARG HB2  1 1 
       12  6887 1 1  9 ARG HB3  H   11.999  -2.176  -4.751 1.00 . A A .   9 ARG HB3  1 1 
       12  6888 1 1  9 ARG HD2  H   11.267  -0.289  -6.274 1.00 . A A .   9 ARG HD2  1 1 
       12  6889 1 1  9 ARG HD3  H   11.316   1.303  -5.518 1.00 . A A .   9 ARG HD3  1 1 
       12  6890 1 1  9 ARG HE   H   13.784   0.538  -6.780 1.00 . A A .   9 ARG HE   1 1 
       12  6891 1 1  9 ARG HG2  H   11.927  -0.048  -3.763 1.00 . A A .   9 ARG HG2  1 1 
       12  6892 1 1  9 ARG HG3  H   13.504   0.397  -4.417 1.00 . A A .   9 ARG HG3  1 1 
       12  6893 1 1  9 ARG HH11 H   10.663   2.010  -7.239 1.00 . A A .   9 ARG HH11 1 1 
       12  6894 1 1  9 ARG HH12 H   11.154   2.927  -8.625 1.00 . A A .   9 ARG HH12 1 1 
       12  6895 1 1  9 ARG HH21 H   14.443   1.740  -8.603 1.00 . A A .   9 ARG HH21 1 1 
       12  6896 1 1  9 ARG HH22 H   13.304   2.772  -9.400 1.00 . A A .   9 ARG HH22 1 1 
       12  6897 1 1  9 ARG N    N   15.227  -1.560  -4.003 1.00 . A A .   9 ARG N    1 1 
       12  6898 1 1  9 ARG NE   N   12.876   0.903  -6.833 1.00 . A A .   9 ARG NE   1 1 
       12  6899 1 1  9 ARG NH1  N   11.368   2.276  -7.896 1.00 . A A .   9 ARG NH1  1 1 
       12  6900 1 1  9 ARG NH2  N   13.522   2.122  -8.673 1.00 . A A .   9 ARG NH2  1 1 
       12  6901 1 1  9 ARG O    O   13.636  -4.250  -4.969 1.00 . A A .   9 ARG O    1 1 
       12  6902 1 1 10 GLU C    C   13.234  -6.460  -2.790 1.00 . A A .  10 GLU C    1 1 
       12  6903 1 1 10 GLU CA   C   14.603  -5.793  -2.879 1.00 . A A .  10 GLU CA   1 1 
       12  6904 1 1 10 GLU CB   C   15.481  -6.247  -1.711 1.00 . A A .  10 GLU CB   1 1 
       12  6905 1 1 10 GLU CD   C   17.159  -7.924  -0.842 1.00 . A A .  10 GLU CD   1 1 
       12  6906 1 1 10 GLU CG   C   16.249  -7.528  -1.989 1.00 . A A .  10 GLU CG   1 1 
       12  6907 1 1 10 GLU H    H   14.746  -3.835  -2.088 1.00 . A A .  10 GLU H    1 1 
       12  6908 1 1 10 GLU HA   H   15.073  -6.086  -3.806 1.00 . A A .  10 GLU HA   1 1 
       12  6909 1 1 10 GLU HB2  H   16.193  -5.466  -1.487 1.00 . A A .  10 GLU HB2  1 1 
       12  6910 1 1 10 GLU HB3  H   14.854  -6.408  -0.847 1.00 . A A .  10 GLU HB3  1 1 
       12  6911 1 1 10 GLU HG2  H   15.542  -8.327  -2.159 1.00 . A A .  10 GLU HG2  1 1 
       12  6912 1 1 10 GLU HG3  H   16.851  -7.388  -2.875 1.00 . A A .  10 GLU HG3  1 1 
       12  6913 1 1 10 GLU N    N   14.474  -4.340  -2.882 1.00 . A A .  10 GLU N    1 1 
       12  6914 1 1 10 GLU O    O   13.016  -7.534  -3.353 1.00 . A A .  10 GLU O    1 1 
       12  6915 1 1 10 GLU OE1  O   16.838  -7.579   0.314 1.00 . A A .  10 GLU OE1  1 1 
       12  6916 1 1 10 GLU OE2  O   18.192  -8.576  -1.101 1.00 . A A .  10 GLU OE2  1 1 
       12  6917 1 1 11 LYS C    C   10.214  -6.342  -3.242 1.00 . A A .  11 LYS C    1 1 
       12  6918 1 1 11 LYS CA   C   10.966  -6.347  -1.914 1.00 . A A .  11 LYS CA   1 1 
       12  6919 1 1 11 LYS CB   C   10.196  -5.526  -0.877 1.00 . A A .  11 LYS CB   1 1 
       12  6920 1 1 11 LYS CD   C   11.568  -5.465   1.226 1.00 . A A .  11 LYS CD   1 1 
       12  6921 1 1 11 LYS CE   C   12.803  -6.315   0.975 1.00 . A A .  11 LYS CE   1 1 
       12  6922 1 1 11 LYS CG   C   10.342  -6.047   0.542 1.00 . A A .  11 LYS CG   1 1 
       12  6923 1 1 11 LYS H    H   12.549  -4.966  -1.653 1.00 . A A .  11 LYS H    1 1 
       12  6924 1 1 11 LYS HA   H   11.049  -7.365  -1.565 1.00 . A A .  11 LYS HA   1 1 
       12  6925 1 1 11 LYS HB2  H   10.555  -4.507  -0.903 1.00 . A A .  11 LYS HB2  1 1 
       12  6926 1 1 11 LYS HB3  H    9.147  -5.535  -1.135 1.00 . A A .  11 LYS HB3  1 1 
       12  6927 1 1 11 LYS HD2  H   11.745  -4.471   0.844 1.00 . A A .  11 LYS HD2  1 1 
       12  6928 1 1 11 LYS HD3  H   11.386  -5.416   2.290 1.00 . A A .  11 LYS HD3  1 1 
       12  6929 1 1 11 LYS HE2  H   12.741  -6.732  -0.019 1.00 . A A .  11 LYS HE2  1 1 
       12  6930 1 1 11 LYS HE3  H   13.678  -5.686   1.047 1.00 . A A .  11 LYS HE3  1 1 
       12  6931 1 1 11 LYS HG2  H    9.464  -5.775   1.108 1.00 . A A .  11 LYS HG2  1 1 
       12  6932 1 1 11 LYS HG3  H   10.435  -7.124   0.512 1.00 . A A .  11 LYS HG3  1 1 
       12  6933 1 1 11 LYS HZ1  H   13.689  -8.071   1.680 1.00 . A A .  11 LYS HZ1  1 1 
       12  6934 1 1 11 LYS HZ2  H   12.032  -7.961   2.004 1.00 . A A .  11 LYS HZ2  1 1 
       12  6935 1 1 11 LYS HZ3  H   13.132  -7.045   2.904 1.00 . A A .  11 LYS HZ3  1 1 
       12  6936 1 1 11 LYS N    N   12.314  -5.818  -2.078 1.00 . A A .  11 LYS N    1 1 
       12  6937 1 1 11 LYS NZ   N   12.923  -7.426   1.960 1.00 . A A .  11 LYS NZ   1 1 
       12  6938 1 1 11 LYS O    O   10.363  -5.437  -4.064 1.00 . A A .  11 LYS O    1 1 
       12  6939 1 1 12 PRO C    C    7.480  -6.471  -4.772 1.00 . A A .  12 PRO C    1 1 
       12  6940 1 1 12 PRO CA   C    8.592  -7.510  -4.683 1.00 . A A .  12 PRO CA   1 1 
       12  6941 1 1 12 PRO CB   C    8.002  -8.918  -4.569 1.00 . A A .  12 PRO CB   1 1 
       12  6942 1 1 12 PRO CD   C    9.158  -8.488  -2.522 1.00 . A A .  12 PRO CD   1 1 
       12  6943 1 1 12 PRO CG   C    7.968  -9.197  -3.106 1.00 . A A .  12 PRO CG   1 1 
       12  6944 1 1 12 PRO HA   H    9.212  -7.448  -5.566 1.00 . A A .  12 PRO HA   1 1 
       12  6945 1 1 12 PRO HB2  H    7.010  -8.930  -4.998 1.00 . A A .  12 PRO HB2  1 1 
       12  6946 1 1 12 PRO HB3  H    8.635  -9.620  -5.091 1.00 . A A .  12 PRO HB3  1 1 
       12  6947 1 1 12 PRO HD2  H    8.929  -8.120  -1.532 1.00 . A A .  12 PRO HD2  1 1 
       12  6948 1 1 12 PRO HD3  H   10.013  -9.147  -2.493 1.00 . A A .  12 PRO HD3  1 1 
       12  6949 1 1 12 PRO HG2  H    7.055  -8.811  -2.680 1.00 . A A .  12 PRO HG2  1 1 
       12  6950 1 1 12 PRO HG3  H    8.044 -10.261  -2.935 1.00 . A A .  12 PRO HG3  1 1 
       12  6951 1 1 12 PRO N    N    9.385  -7.374  -3.458 1.00 . A A .  12 PRO N    1 1 
       12  6952 1 1 12 PRO O    O    7.243  -5.889  -5.831 1.00 . A A .  12 PRO O    1 1 
       12  6953 1 1 13 TYR C    C    6.249  -3.853  -3.480 1.00 . A A .  13 TYR C    1 1 
       12  6954 1 1 13 TYR CA   C    5.710  -5.275  -3.606 1.00 . A A .  13 TYR CA   1 1 
       12  6955 1 1 13 TYR CB   C    4.776  -5.584  -2.435 1.00 . A A .  13 TYR CB   1 1 
       12  6956 1 1 13 TYR CD1  C    2.932  -7.047  -3.347 1.00 . A A .  13 TYR CD1  1 1 
       12  6957 1 1 13 TYR CD2  C    4.537  -8.038  -1.890 1.00 . A A .  13 TYR CD2  1 1 
       12  6958 1 1 13 TYR CE1  C    2.281  -8.260  -3.463 1.00 . A A .  13 TYR CE1  1 1 
       12  6959 1 1 13 TYR CE2  C    3.893  -9.256  -2.001 1.00 . A A .  13 TYR CE2  1 1 
       12  6960 1 1 13 TYR CG   C    4.068  -6.914  -2.559 1.00 . A A .  13 TYR CG   1 1 
       12  6961 1 1 13 TYR CZ   C    2.766  -9.362  -2.789 1.00 . A A .  13 TYR CZ   1 1 
       12  6962 1 1 13 TYR H    H    7.034  -6.738  -2.841 1.00 . A A .  13 TYR H    1 1 
       12  6963 1 1 13 TYR HA   H    5.154  -5.356  -4.528 1.00 . A A .  13 TYR HA   1 1 
       12  6964 1 1 13 TYR HB2  H    5.349  -5.599  -1.521 1.00 . A A .  13 TYR HB2  1 1 
       12  6965 1 1 13 TYR HB3  H    4.024  -4.812  -2.370 1.00 . A A .  13 TYR HB3  1 1 
       12  6966 1 1 13 TYR HD1  H    2.555  -6.183  -3.875 1.00 . A A .  13 TYR HD1  1 1 
       12  6967 1 1 13 TYR HD2  H    5.420  -7.952  -1.274 1.00 . A A .  13 TYR HD2  1 1 
       12  6968 1 1 13 TYR HE1  H    1.399  -8.344  -4.080 1.00 . A A .  13 TYR HE1  1 1 
       12  6969 1 1 13 TYR HE2  H    4.272 -10.118  -1.473 1.00 . A A .  13 TYR HE2  1 1 
       12  6970 1 1 13 TYR HH   H    1.347 -10.577  -2.336 1.00 . A A .  13 TYR HH   1 1 
       12  6971 1 1 13 TYR N    N    6.800  -6.243  -3.654 1.00 . A A .  13 TYR N    1 1 
       12  6972 1 1 13 TYR O    O    7.125  -3.581  -2.660 1.00 . A A .  13 TYR O    1 1 
       12  6973 1 1 13 TYR OH   O    2.122 -10.572  -2.903 1.00 . A A .  13 TYR OH   1 1 
       12  6974 1 1 14 GLU C    C    4.943  -0.619  -4.336 1.00 . A A .  14 GLU C    1 1 
       12  6975 1 1 14 GLU CA   C    6.145  -1.557  -4.279 1.00 . A A .  14 GLU CA   1 1 
       12  6976 1 1 14 GLU CB   C    7.084  -1.272  -5.453 1.00 . A A .  14 GLU CB   1 1 
       12  6977 1 1 14 GLU CD   C    9.391  -1.878  -6.284 1.00 . A A .  14 GLU CD   1 1 
       12  6978 1 1 14 GLU CG   C    8.556  -1.419  -5.105 1.00 . A A .  14 GLU CG   1 1 
       12  6979 1 1 14 GLU H    H    5.022  -3.229  -4.931 1.00 . A A .  14 GLU H    1 1 
       12  6980 1 1 14 GLU HA   H    6.677  -1.386  -3.356 1.00 . A A .  14 GLU HA   1 1 
       12  6981 1 1 14 GLU HB2  H    6.855  -1.957  -6.257 1.00 . A A .  14 GLU HB2  1 1 
       12  6982 1 1 14 GLU HB3  H    6.916  -0.262  -5.795 1.00 . A A .  14 GLU HB3  1 1 
       12  6983 1 1 14 GLU HG2  H    8.930  -0.464  -4.769 1.00 . A A .  14 GLU HG2  1 1 
       12  6984 1 1 14 GLU HG3  H    8.654  -2.143  -4.310 1.00 . A A .  14 GLU HG3  1 1 
       12  6985 1 1 14 GLU N    N    5.718  -2.951  -4.299 1.00 . A A .  14 GLU N    1 1 
       12  6986 1 1 14 GLU O    O    3.927  -0.929  -4.958 1.00 . A A .  14 GLU O    1 1 
       12  6987 1 1 14 GLU OE1  O    9.176  -1.361  -7.401 1.00 . A A .  14 GLU OE1  1 1 
       12  6988 1 1 14 GLU OE2  O   10.260  -2.754  -6.091 1.00 . A A .  14 GLU OE2  1 1 
       12  6989 1 1 15 CYS C    C    3.967   2.329  -4.945 1.00 . A A .  15 CYS C    1 1 
       12  6990 1 1 15 CYS CA   C    3.992   1.516  -3.654 1.00 . A A .  15 CYS CA   1 1 
       12  6991 1 1 15 CYS CB   C    4.157   2.450  -2.454 1.00 . A A .  15 CYS CB   1 1 
       12  6992 1 1 15 CYS H    H    5.902   0.722  -3.203 1.00 . A A .  15 CYS H    1 1 
       12  6993 1 1 15 CYS HA   H    3.057   0.984  -3.560 1.00 . A A .  15 CYS HA   1 1 
       12  6994 1 1 15 CYS HB2  H    4.322   1.857  -1.566 1.00 . A A .  15 CYS HB2  1 1 
       12  6995 1 1 15 CYS HB3  H    5.013   3.087  -2.619 1.00 . A A .  15 CYS HB3  1 1 
       12  6996 1 1 15 CYS N    N    5.067   0.531  -3.681 1.00 . A A .  15 CYS N    1 1 
       12  6997 1 1 15 CYS O    O    4.971   2.922  -5.337 1.00 . A A .  15 CYS O    1 1 
       12  6998 1 1 15 CYS SG   S    2.718   3.522  -2.142 1.00 . A A .  15 CYS SG   1 1 
       12  6999 1 1 16 SER C    C    2.399   4.566  -6.580 1.00 . A A .  16 SER C    1 1 
       12  7000 1 1 16 SER CA   C    2.655   3.087  -6.851 1.00 . A A .  16 SER CA   1 1 
       12  7001 1 1 16 SER CB   C    1.507   2.501  -7.674 1.00 . A A .  16 SER CB   1 1 
       12  7002 1 1 16 SER H    H    2.046   1.857  -5.239 1.00 . A A .  16 SER H    1 1 
       12  7003 1 1 16 SER HA   H    3.574   2.989  -7.410 1.00 . A A .  16 SER HA   1 1 
       12  7004 1 1 16 SER HB2  H    1.602   2.821  -8.700 1.00 . A A .  16 SER HB2  1 1 
       12  7005 1 1 16 SER HB3  H    1.549   1.422  -7.627 1.00 . A A .  16 SER HB3  1 1 
       12  7006 1 1 16 SER HG   H   -0.316   2.169  -7.035 1.00 . A A .  16 SER HG   1 1 
       12  7007 1 1 16 SER N    N    2.811   2.350  -5.602 1.00 . A A .  16 SER N    1 1 
       12  7008 1 1 16 SER O    O    1.933   5.296  -7.455 1.00 . A A .  16 SER O    1 1 
       12  7009 1 1 16 SER OG   O    0.252   2.931  -7.176 1.00 . A A .  16 SER OG   1 1 
       12  7010 1 1 17 GLU C    C    3.845   7.079  -4.708 1.00 . A A .  17 GLU C    1 1 
       12  7011 1 1 17 GLU CA   C    2.508   6.393  -4.976 1.00 . A A .  17 GLU CA   1 1 
       12  7012 1 1 17 GLU CB   C    1.620   6.479  -3.733 1.00 . A A .  17 GLU CB   1 1 
       12  7013 1 1 17 GLU CD   C   -0.795   6.372  -4.466 1.00 . A A .  17 GLU CD   1 1 
       12  7014 1 1 17 GLU CG   C    0.363   5.632  -3.823 1.00 . A A .  17 GLU CG   1 1 
       12  7015 1 1 17 GLU H    H    3.075   4.371  -4.708 1.00 . A A .  17 GLU H    1 1 
       12  7016 1 1 17 GLU HA   H    2.016   6.897  -5.794 1.00 . A A .  17 GLU HA   1 1 
       12  7017 1 1 17 GLU HB2  H    2.190   6.152  -2.875 1.00 . A A .  17 GLU HB2  1 1 
       12  7018 1 1 17 GLU HB3  H    1.326   7.508  -3.587 1.00 . A A .  17 GLU HB3  1 1 
       12  7019 1 1 17 GLU HG2  H    0.578   4.752  -4.412 1.00 . A A .  17 GLU HG2  1 1 
       12  7020 1 1 17 GLU HG3  H    0.072   5.334  -2.827 1.00 . A A .  17 GLU HG3  1 1 
       12  7021 1 1 17 GLU N    N    2.706   5.001  -5.362 1.00 . A A .  17 GLU N    1 1 
       12  7022 1 1 17 GLU O    O    4.090   8.191  -5.177 1.00 . A A .  17 GLU O    1 1 
       12  7023 1 1 17 GLU OE1  O   -0.537   7.309  -5.250 1.00 . A A .  17 GLU OE1  1 1 
       12  7024 1 1 17 GLU OE2  O   -1.957   6.014  -4.184 1.00 . A A .  17 GLU OE2  1 1 
       12  7025 1 1 18 CYS C    C    7.129   6.031  -4.114 1.00 . A A .  18 CYS C    1 1 
       12  7026 1 1 18 CYS CA   C    6.018   6.951  -3.618 1.00 . A A .  18 CYS CA   1 1 
       12  7027 1 1 18 CYS CB   C    6.142   7.150  -2.106 1.00 . A A .  18 CYS CB   1 1 
       12  7028 1 1 18 CYS H    H    4.453   5.525  -3.606 1.00 . A A .  18 CYS H    1 1 
       12  7029 1 1 18 CYS HA   H    6.114   7.908  -4.108 1.00 . A A .  18 CYS HA   1 1 
       12  7030 1 1 18 CYS HB2  H    7.132   7.520  -1.880 1.00 . A A .  18 CYS HB2  1 1 
       12  7031 1 1 18 CYS HB3  H    5.410   7.877  -1.785 1.00 . A A .  18 CYS HB3  1 1 
       12  7032 1 1 18 CYS N    N    4.706   6.408  -3.950 1.00 . A A .  18 CYS N    1 1 
       12  7033 1 1 18 CYS O    O    8.187   6.491  -4.541 1.00 . A A .  18 CYS O    1 1 
       12  7034 1 1 18 CYS SG   S    5.882   5.633  -1.132 1.00 . A A .  18 CYS SG   1 1 
       12  7035 1 1 19 GLY C    C    8.320   2.836  -3.387 1.00 . A A .  19 GLY C    1 1 
       12  7036 1 1 19 GLY CA   C    7.868   3.761  -4.501 1.00 . A A .  19 GLY CA   1 1 
       12  7037 1 1 19 GLY H    H    6.019   4.416  -3.705 1.00 . A A .  19 GLY H    1 1 
       12  7038 1 1 19 GLY HA2  H    7.443   3.169  -5.297 1.00 . A A .  19 GLY HA2  1 1 
       12  7039 1 1 19 GLY HA3  H    8.728   4.293  -4.881 1.00 . A A .  19 GLY HA3  1 1 
       12  7040 1 1 19 GLY N    N    6.880   4.726  -4.055 1.00 . A A .  19 GLY N    1 1 
       12  7041 1 1 19 GLY O    O    9.230   2.028  -3.572 1.00 . A A .  19 GLY O    1 1 
       12  7042 1 1 20 LYS C    C    8.098   0.653  -1.475 1.00 . A A .  20 LYS C    1 1 
       12  7043 1 1 20 LYS CA   C    8.023   2.124  -1.079 1.00 . A A .  20 LYS CA   1 1 
       12  7044 1 1 20 LYS CB   C    6.991   2.311   0.036 1.00 . A A .  20 LYS CB   1 1 
       12  7045 1 1 20 LYS CD   C    6.839   2.702   2.513 1.00 . A A .  20 LYS CD   1 1 
       12  7046 1 1 20 LYS CE   C    7.615   3.977   2.805 1.00 . A A .  20 LYS CE   1 1 
       12  7047 1 1 20 LYS CG   C    7.494   1.892   1.407 1.00 . A A .  20 LYS CG   1 1 
       12  7048 1 1 20 LYS H    H    6.965   3.618  -2.142 1.00 . A A .  20 LYS H    1 1 
       12  7049 1 1 20 LYS HA   H    8.991   2.437  -0.718 1.00 . A A .  20 LYS HA   1 1 
       12  7050 1 1 20 LYS HB2  H    6.713   3.354   0.081 1.00 . A A .  20 LYS HB2  1 1 
       12  7051 1 1 20 LYS HB3  H    6.116   1.723  -0.198 1.00 . A A .  20 LYS HB3  1 1 
       12  7052 1 1 20 LYS HD2  H    5.837   2.967   2.208 1.00 . A A .  20 LYS HD2  1 1 
       12  7053 1 1 20 LYS HD3  H    6.798   2.102   3.411 1.00 . A A .  20 LYS HD3  1 1 
       12  7054 1 1 20 LYS HE2  H    7.388   4.300   3.809 1.00 . A A .  20 LYS HE2  1 1 
       12  7055 1 1 20 LYS HE3  H    8.672   3.766   2.725 1.00 . A A .  20 LYS HE3  1 1 
       12  7056 1 1 20 LYS HG2  H    7.269   0.847   1.559 1.00 . A A .  20 LYS HG2  1 1 
       12  7057 1 1 20 LYS HG3  H    8.564   2.041   1.449 1.00 . A A .  20 LYS HG3  1 1 
       12  7058 1 1 20 LYS HZ1  H    7.430   5.995   2.298 1.00 . A A .  20 LYS HZ1  1 1 
       12  7059 1 1 20 LYS HZ2  H    6.265   4.999   1.582 1.00 . A A .  20 LYS HZ2  1 1 
       12  7060 1 1 20 LYS HZ3  H    7.852   4.999   0.998 1.00 . A A .  20 LYS HZ3  1 1 
       12  7061 1 1 20 LYS N    N    7.683   2.955  -2.227 1.00 . A A .  20 LYS N    1 1 
       12  7062 1 1 20 LYS NZ   N    7.266   5.069   1.854 1.00 . A A .  20 LYS NZ   1 1 
       12  7063 1 1 20 LYS O    O    7.869   0.299  -2.631 1.00 . A A .  20 LYS O    1 1 
       12  7064 1 1 21 ALA C    C    7.816  -2.430   0.338 1.00 . A A .  21 ALA C    1 1 
       12  7065 1 1 21 ALA CA   C    8.520  -1.633  -0.755 1.00 . A A .  21 ALA CA   1 1 
       12  7066 1 1 21 ALA CB   C    9.980  -2.049  -0.857 1.00 . A A .  21 ALA CB   1 1 
       12  7067 1 1 21 ALA H    H    8.590   0.142   0.394 1.00 . A A .  21 ALA H    1 1 
       12  7068 1 1 21 ALA HA   H    8.044  -1.843  -1.702 1.00 . A A .  21 ALA HA   1 1 
       12  7069 1 1 21 ALA HB1  H   10.148  -2.538  -1.805 1.00 . A A .  21 ALA HB1  1 1 
       12  7070 1 1 21 ALA HB2  H   10.608  -1.174  -0.787 1.00 . A A .  21 ALA HB2  1 1 
       12  7071 1 1 21 ALA HB3  H   10.217  -2.729  -0.053 1.00 . A A .  21 ALA HB3  1 1 
       12  7072 1 1 21 ALA N    N    8.419  -0.200  -0.507 1.00 . A A .  21 ALA N    1 1 
       12  7073 1 1 21 ALA O    O    7.567  -1.919   1.431 1.00 . A A .  21 ALA O    1 1 
       12  7074 1 1 22 PHE C    C    7.028  -6.021   0.639 1.00 . A A .  22 PHE C    1 1 
       12  7075 1 1 22 PHE CA   C    6.819  -4.552   0.995 1.00 . A A .  22 PHE CA   1 1 
       12  7076 1 1 22 PHE CB   C    5.324  -4.232   1.035 1.00 . A A .  22 PHE CB   1 1 
       12  7077 1 1 22 PHE CD1  C    5.070  -1.879   0.201 1.00 . A A .  22 PHE CD1  1 1 
       12  7078 1 1 22 PHE CD2  C    4.706  -2.305   2.519 1.00 . A A .  22 PHE CD2  1 1 
       12  7079 1 1 22 PHE CE1  C    4.797  -0.539   0.401 1.00 . A A .  22 PHE CE1  1 1 
       12  7080 1 1 22 PHE CE2  C    4.432  -0.967   2.725 1.00 . A A .  22 PHE CE2  1 1 
       12  7081 1 1 22 PHE CG   C    5.027  -2.776   1.256 1.00 . A A .  22 PHE CG   1 1 
       12  7082 1 1 22 PHE CZ   C    4.479  -0.082   1.665 1.00 . A A .  22 PHE CZ   1 1 
       12  7083 1 1 22 PHE H    H    7.721  -4.035  -0.850 1.00 . A A .  22 PHE H    1 1 
       12  7084 1 1 22 PHE HA   H    7.245  -4.365   1.968 1.00 . A A .  22 PHE HA   1 1 
       12  7085 1 1 22 PHE HB2  H    4.875  -4.523   0.097 1.00 . A A .  22 PHE HB2  1 1 
       12  7086 1 1 22 PHE HB3  H    4.865  -4.791   1.836 1.00 . A A .  22 PHE HB3  1 1 
       12  7087 1 1 22 PHE HD1  H    5.319  -2.236  -0.788 1.00 . A A .  22 PHE HD1  1 1 
       12  7088 1 1 22 PHE HD2  H    4.670  -2.996   3.349 1.00 . A A .  22 PHE HD2  1 1 
       12  7089 1 1 22 PHE HE1  H    4.835   0.150  -0.430 1.00 . A A .  22 PHE HE1  1 1 
       12  7090 1 1 22 PHE HE2  H    4.184  -0.612   3.714 1.00 . A A .  22 PHE HE2  1 1 
       12  7091 1 1 22 PHE HZ   H    4.265   0.964   1.824 1.00 . A A .  22 PHE HZ   1 1 
       12  7092 1 1 22 PHE N    N    7.497  -3.684   0.037 1.00 . A A .  22 PHE N    1 1 
       12  7093 1 1 22 PHE O    O    7.199  -6.369  -0.529 1.00 . A A .  22 PHE O    1 1 
       12  7094 1 1 23 ILE C    C    5.884  -8.988   1.088 1.00 . A A .  23 ILE C    1 1 
       12  7095 1 1 23 ILE CA   C    7.200  -8.308   1.451 1.00 . A A .  23 ILE CA   1 1 
       12  7096 1 1 23 ILE CB   C    7.786  -8.984   2.705 1.00 . A A .  23 ILE CB   1 1 
       12  7097 1 1 23 ILE CD1  C    8.923  -7.127   4.023 1.00 . A A .  23 ILE CD1  1 1 
       12  7098 1 1 23 ILE CG1  C    9.103  -8.315   3.104 1.00 . A A .  23 ILE CG1  1 1 
       12  7099 1 1 23 ILE CG2  C    7.994 -10.470   2.457 1.00 . A A .  23 ILE CG2  1 1 
       12  7100 1 1 23 ILE H    H    6.873  -6.538   2.564 1.00 . A A .  23 ILE H    1 1 
       12  7101 1 1 23 ILE HA   H    7.898  -8.439   0.637 1.00 . A A .  23 ILE HA   1 1 
       12  7102 1 1 23 ILE HB   H    7.076  -8.874   3.511 1.00 . A A .  23 ILE HB   1 1 
       12  7103 1 1 23 ILE HD11 H    8.850  -6.224   3.434 1.00 . A A .  23 ILE HD11 1 1 
       12  7104 1 1 23 ILE HD12 H    8.019  -7.252   4.601 1.00 . A A .  23 ILE HD12 1 1 
       12  7105 1 1 23 ILE HD13 H    9.770  -7.055   4.689 1.00 . A A .  23 ILE HD13 1 1 
       12  7106 1 1 23 ILE HG12 H    9.726  -9.035   3.610 1.00 . A A .  23 ILE HG12 1 1 
       12  7107 1 1 23 ILE HG13 H    9.608  -7.972   2.212 1.00 . A A .  23 ILE HG13 1 1 
       12  7108 1 1 23 ILE HG21 H    7.036 -10.953   2.335 1.00 . A A .  23 ILE HG21 1 1 
       12  7109 1 1 23 ILE HG22 H    8.581 -10.606   1.560 1.00 . A A .  23 ILE HG22 1 1 
       12  7110 1 1 23 ILE HG23 H    8.513 -10.907   3.297 1.00 . A A .  23 ILE HG23 1 1 
       12  7111 1 1 23 ILE N    N    7.013  -6.877   1.656 1.00 . A A .  23 ILE N    1 1 
       12  7112 1 1 23 ILE O    O    5.866  -9.980   0.360 1.00 . A A .  23 ILE O    1 1 
       12  7113 1 1 24 ARG C    C    2.496  -7.907   0.881 1.00 . A A .  24 ARG C    1 1 
       12  7114 1 1 24 ARG CA   C    3.462  -8.999   1.329 1.00 . A A .  24 ARG CA   1 1 
       12  7115 1 1 24 ARG CB   C    2.915  -9.700   2.575 1.00 . A A .  24 ARG CB   1 1 
       12  7116 1 1 24 ARG CD   C    3.073 -11.795   3.952 1.00 . A A .  24 ARG CD   1 1 
       12  7117 1 1 24 ARG CG   C    3.838 -10.775   3.124 1.00 . A A .  24 ARG CG   1 1 
       12  7118 1 1 24 ARG CZ   C    4.552 -12.173   5.880 1.00 . A A .  24 ARG CZ   1 1 
       12  7119 1 1 24 ARG H    H    4.862  -7.655   2.174 1.00 . A A .  24 ARG H    1 1 
       12  7120 1 1 24 ARG HA   H    3.562  -9.723   0.535 1.00 . A A .  24 ARG HA   1 1 
       12  7121 1 1 24 ARG HB2  H    2.757  -8.962   3.348 1.00 . A A .  24 ARG HB2  1 1 
       12  7122 1 1 24 ARG HB3  H    1.970 -10.159   2.328 1.00 . A A .  24 ARG HB3  1 1 
       12  7123 1 1 24 ARG HD2  H    2.384 -11.272   4.598 1.00 . A A .  24 ARG HD2  1 1 
       12  7124 1 1 24 ARG HD3  H    2.522 -12.440   3.284 1.00 . A A .  24 ARG HD3  1 1 
       12  7125 1 1 24 ARG HE   H    4.130 -13.533   4.483 1.00 . A A .  24 ARG HE   1 1 
       12  7126 1 1 24 ARG HG2  H    4.316 -11.282   2.299 1.00 . A A .  24 ARG HG2  1 1 
       12  7127 1 1 24 ARG HG3  H    4.588 -10.309   3.746 1.00 . A A .  24 ARG HG3  1 1 
       12  7128 1 1 24 ARG HH11 H    3.744 -10.325   5.777 1.00 . A A .  24 ARG HH11 1 1 
       12  7129 1 1 24 ARG HH12 H    4.788 -10.604   7.132 1.00 . A A .  24 ARG HH12 1 1 
       12  7130 1 1 24 ARG HH21 H    5.507 -13.914   6.261 1.00 . A A .  24 ARG HH21 1 1 
       12  7131 1 1 24 ARG HH22 H    5.791 -12.646   7.405 1.00 . A A .  24 ARG HH22 1 1 
       12  7132 1 1 24 ARG N    N    4.784  -8.446   1.600 1.00 . A A .  24 ARG N    1 1 
       12  7133 1 1 24 ARG NE   N    3.963 -12.612   4.773 1.00 . A A .  24 ARG NE   1 1 
       12  7134 1 1 24 ARG NH1  N    4.345 -10.932   6.297 1.00 . A A .  24 ARG NH1  1 1 
       12  7135 1 1 24 ARG NH2  N    5.348 -12.977   6.573 1.00 . A A .  24 ARG NH2  1 1 
       12  7136 1 1 24 ARG O    O    2.486  -6.808   1.434 1.00 . A A .  24 ARG O    1 1 
       12  7137 1 1 25 ASN C    C   -0.028  -6.565   0.485 1.00 . A A .  25 ASN C    1 1 
       12  7138 1 1 25 ASN CA   C    0.717  -7.261  -0.650 1.00 . A A .  25 ASN CA   1 1 
       12  7139 1 1 25 ASN CB   C   -0.280  -7.967  -1.571 1.00 . A A .  25 ASN CB   1 1 
       12  7140 1 1 25 ASN CG   C   -0.837  -7.043  -2.637 1.00 . A A .  25 ASN CG   1 1 
       12  7141 1 1 25 ASN H    H    1.741  -9.110  -0.526 1.00 . A A .  25 ASN H    1 1 
       12  7142 1 1 25 ASN HA   H    1.257  -6.520  -1.219 1.00 . A A .  25 ASN HA   1 1 
       12  7143 1 1 25 ASN HB2  H    0.216  -8.793  -2.062 1.00 . A A .  25 ASN HB2  1 1 
       12  7144 1 1 25 ASN HB3  H   -1.102  -8.345  -0.982 1.00 . A A .  25 ASN HB3  1 1 
       12  7145 1 1 25 ASN HD21 H   -0.723  -5.498  -1.390 1.00 . A A .  25 ASN HD21 1 1 
       12  7146 1 1 25 ASN HD22 H   -1.339  -5.148  -2.966 1.00 . A A .  25 ASN HD22 1 1 
       12  7147 1 1 25 ASN N    N    1.686  -8.217  -0.126 1.00 . A A .  25 ASN N    1 1 
       12  7148 1 1 25 ASN ND2  N   -0.980  -5.767  -2.296 1.00 . A A .  25 ASN ND2  1 1 
       12  7149 1 1 25 ASN O    O   -0.048  -5.337   0.566 1.00 . A A .  25 ASN O    1 1 
       12  7150 1 1 25 ASN OD1  O   -1.134  -7.471  -3.752 1.00 . A A .  25 ASN OD1  1 1 
       12  7151 1 1 26 SER C    C   -0.610  -5.697   3.169 1.00 . A A .  26 SER C    1 1 
       12  7152 1 1 26 SER CA   C   -1.388  -6.818   2.488 1.00 . A A .  26 SER CA   1 1 
       12  7153 1 1 26 SER CB   C   -1.699  -7.925   3.497 1.00 . A A .  26 SER CB   1 1 
       12  7154 1 1 26 SER H    H   -0.587  -8.330   1.240 1.00 . A A .  26 SER H    1 1 
       12  7155 1 1 26 SER HA   H   -2.316  -6.418   2.108 1.00 . A A .  26 SER HA   1 1 
       12  7156 1 1 26 SER HB2  H   -0.909  -8.660   3.476 1.00 . A A .  26 SER HB2  1 1 
       12  7157 1 1 26 SER HB3  H   -1.767  -7.497   4.487 1.00 . A A .  26 SER HB3  1 1 
       12  7158 1 1 26 SER HG   H   -2.753  -9.455   2.874 1.00 . A A .  26 SER HG   1 1 
       12  7159 1 1 26 SER N    N   -0.639  -7.358   1.359 1.00 . A A .  26 SER N    1 1 
       12  7160 1 1 26 SER O    O   -1.189  -4.700   3.601 1.00 . A A .  26 SER O    1 1 
       12  7161 1 1 26 SER OG   O   -2.926  -8.565   3.190 1.00 . A A .  26 SER OG   1 1 
       12  7162 1 1 27 GLN C    C    1.567  -3.574   3.091 1.00 . A A .  27 GLN C    1 1 
       12  7163 1 1 27 GLN CA   C    1.562  -4.871   3.892 1.00 . A A .  27 GLN CA   1 1 
       12  7164 1 1 27 GLN CB   C    2.988  -5.407   4.027 1.00 . A A .  27 GLN CB   1 1 
       12  7165 1 1 27 GLN CD   C    3.230  -6.615   6.233 1.00 . A A .  27 GLN CD   1 1 
       12  7166 1 1 27 GLN CG   C    3.069  -6.752   4.731 1.00 . A A .  27 GLN CG   1 1 
       12  7167 1 1 27 GLN H    H    1.106  -6.684   2.899 1.00 . A A .  27 GLN H    1 1 
       12  7168 1 1 27 GLN HA   H    1.168  -4.670   4.877 1.00 . A A .  27 GLN HA   1 1 
       12  7169 1 1 27 GLN HB2  H    3.414  -5.515   3.041 1.00 . A A .  27 GLN HB2  1 1 
       12  7170 1 1 27 GLN HB3  H    3.576  -4.695   4.588 1.00 . A A .  27 GLN HB3  1 1 
       12  7171 1 1 27 GLN HE21 H    4.637  -8.020   6.235 1.00 . A A .  27 GLN HE21 1 1 
       12  7172 1 1 27 GLN HE22 H    4.256  -7.336   7.775 1.00 . A A .  27 GLN HE22 1 1 
       12  7173 1 1 27 GLN HG2  H    2.163  -7.304   4.531 1.00 . A A .  27 GLN HG2  1 1 
       12  7174 1 1 27 GLN HG3  H    3.916  -7.297   4.341 1.00 . A A .  27 GLN HG3  1 1 
       12  7175 1 1 27 GLN N    N    0.704  -5.868   3.262 1.00 . A A .  27 GLN N    1 1 
       12  7176 1 1 27 GLN NE2  N    4.131  -7.404   6.806 1.00 . A A .  27 GLN NE2  1 1 
       12  7177 1 1 27 GLN O    O    1.410  -2.487   3.649 1.00 . A A .  27 GLN O    1 1 
       12  7178 1 1 27 GLN OE1  O    2.551  -5.810   6.870 1.00 . A A .  27 GLN OE1  1 1 
       12  7179 1 1 28 LEU C    C    0.438  -1.794   0.933 1.00 . A A .  28 LEU C    1 1 
       12  7180 1 1 28 LEU CA   C    1.774  -2.530   0.901 1.00 . A A .  28 LEU CA   1 1 
       12  7181 1 1 28 LEU CB   C    2.102  -2.955  -0.531 1.00 . A A .  28 LEU CB   1 1 
       12  7182 1 1 28 LEU CD1  C    2.471  -0.643  -1.425 1.00 . A A .  28 LEU CD1  1 1 
       12  7183 1 1 28 LEU CD2  C    2.039  -2.536  -3.002 1.00 . A A .  28 LEU CD2  1 1 
       12  7184 1 1 28 LEU CG   C    1.733  -1.957  -1.629 1.00 . A A .  28 LEU CG   1 1 
       12  7185 1 1 28 LEU H    H    1.867  -4.586   1.394 1.00 . A A .  28 LEU H    1 1 
       12  7186 1 1 28 LEU HA   H    2.547  -1.864   1.256 1.00 . A A .  28 LEU HA   1 1 
       12  7187 1 1 28 LEU HB2  H    3.165  -3.132  -0.589 1.00 . A A .  28 LEU HB2  1 1 
       12  7188 1 1 28 LEU HB3  H    1.574  -3.877  -0.730 1.00 . A A .  28 LEU HB3  1 1 
       12  7189 1 1 28 LEU HD11 H    2.397  -0.345  -0.391 1.00 . A A .  28 LEU HD11 1 1 
       12  7190 1 1 28 LEU HD12 H    2.031   0.118  -2.052 1.00 . A A .  28 LEU HD12 1 1 
       12  7191 1 1 28 LEU HD13 H    3.511  -0.770  -1.691 1.00 . A A .  28 LEU HD13 1 1 
       12  7192 1 1 28 LEU HD21 H    2.348  -1.743  -3.666 1.00 . A A .  28 LEU HD21 1 1 
       12  7193 1 1 28 LEU HD22 H    1.154  -3.012  -3.397 1.00 . A A .  28 LEU HD22 1 1 
       12  7194 1 1 28 LEU HD23 H    2.832  -3.265  -2.916 1.00 . A A .  28 LEU HD23 1 1 
       12  7195 1 1 28 LEU HG   H    0.672  -1.753  -1.580 1.00 . A A .  28 LEU HG   1 1 
       12  7196 1 1 28 LEU N    N    1.748  -3.694   1.780 1.00 . A A .  28 LEU N    1 1 
       12  7197 1 1 28 LEU O    O    0.384  -0.600   1.228 1.00 . A A .  28 LEU O    1 1 
       12  7198 1 1 29 ILE C    C   -2.171  -1.009   1.824 1.00 . A A .  29 ILE C    1 1 
       12  7199 1 1 29 ILE CA   C   -1.971  -1.931   0.625 1.00 . A A .  29 ILE CA   1 1 
       12  7200 1 1 29 ILE CB   C   -3.061  -3.019   0.642 1.00 . A A .  29 ILE CB   1 1 
       12  7201 1 1 29 ILE CD1  C   -3.724  -5.189  -0.511 1.00 . A A .  29 ILE CD1  1 1 
       12  7202 1 1 29 ILE CG1  C   -2.970  -3.882  -0.618 1.00 . A A .  29 ILE CG1  1 1 
       12  7203 1 1 29 ILE CG2  C   -4.440  -2.385   0.757 1.00 . A A .  29 ILE CG2  1 1 
       12  7204 1 1 29 ILE H    H   -0.527  -3.462   0.402 1.00 . A A .  29 ILE H    1 1 
       12  7205 1 1 29 ILE HA   H   -2.080  -1.354  -0.281 1.00 . A A .  29 ILE HA   1 1 
       12  7206 1 1 29 ILE HB   H   -2.904  -3.642   1.509 1.00 . A A .  29 ILE HB   1 1 
       12  7207 1 1 29 ILE HD11 H   -4.357  -5.311  -1.378 1.00 . A A .  29 ILE HD11 1 1 
       12  7208 1 1 29 ILE HD12 H   -3.021  -6.008  -0.463 1.00 . A A .  29 ILE HD12 1 1 
       12  7209 1 1 29 ILE HD13 H   -4.332  -5.182   0.380 1.00 . A A .  29 ILE HD13 1 1 
       12  7210 1 1 29 ILE HG12 H   -3.375  -3.333  -1.453 1.00 . A A .  29 ILE HG12 1 1 
       12  7211 1 1 29 ILE HG13 H   -1.932  -4.112  -0.813 1.00 . A A .  29 ILE HG13 1 1 
       12  7212 1 1 29 ILE HG21 H   -4.594  -2.041   1.769 1.00 . A A .  29 ILE HG21 1 1 
       12  7213 1 1 29 ILE HG22 H   -4.509  -1.549   0.079 1.00 . A A .  29 ILE HG22 1 1 
       12  7214 1 1 29 ILE HG23 H   -5.194  -3.116   0.507 1.00 . A A .  29 ILE HG23 1 1 
       12  7215 1 1 29 ILE N    N   -0.636  -2.515   0.629 1.00 . A A .  29 ILE N    1 1 
       12  7216 1 1 29 ILE O    O   -2.597   0.136   1.675 1.00 . A A .  29 ILE O    1 1 
       12  7217 1 1 30 VAL C    C   -1.317   0.619   4.107 1.00 . A A .  30 VAL C    1 1 
       12  7218 1 1 30 VAL CA   C   -2.000  -0.737   4.237 1.00 . A A .  30 VAL CA   1 1 
       12  7219 1 1 30 VAL CB   C   -1.410  -1.484   5.448 1.00 . A A .  30 VAL CB   1 1 
       12  7220 1 1 30 VAL CG1  C   -1.560  -0.653   6.713 1.00 . A A .  30 VAL CG1  1 1 
       12  7221 1 1 30 VAL CG2  C   -2.073  -2.843   5.611 1.00 . A A .  30 VAL CG2  1 1 
       12  7222 1 1 30 VAL H    H   -1.523  -2.435   3.066 1.00 . A A .  30 VAL H    1 1 
       12  7223 1 1 30 VAL HA   H   -3.055  -0.584   4.414 1.00 . A A .  30 VAL HA   1 1 
       12  7224 1 1 30 VAL HB   H   -0.356  -1.640   5.270 1.00 . A A .  30 VAL HB   1 1 
       12  7225 1 1 30 VAL HG11 H   -1.847   0.355   6.449 1.00 . A A .  30 VAL HG11 1 1 
       12  7226 1 1 30 VAL HG12 H   -2.320  -1.091   7.344 1.00 . A A .  30 VAL HG12 1 1 
       12  7227 1 1 30 VAL HG13 H   -0.620  -0.631   7.243 1.00 . A A .  30 VAL HG13 1 1 
       12  7228 1 1 30 VAL HG21 H   -2.430  -3.187   4.652 1.00 . A A .  30 VAL HG21 1 1 
       12  7229 1 1 30 VAL HG22 H   -1.356  -3.548   6.003 1.00 . A A .  30 VAL HG22 1 1 
       12  7230 1 1 30 VAL HG23 H   -2.905  -2.758   6.295 1.00 . A A .  30 VAL HG23 1 1 
       12  7231 1 1 30 VAL N    N   -1.858  -1.516   3.012 1.00 . A A .  30 VAL N    1 1 
       12  7232 1 1 30 VAL O    O   -1.817   1.628   4.607 1.00 . A A .  30 VAL O    1 1 
       12  7233 1 1 31 HIS C    C   -0.041   2.716   2.127 1.00 . A A .  31 HIS C    1 1 
       12  7234 1 1 31 HIS CA   C    0.580   1.872   3.237 1.00 . A A .  31 HIS CA   1 1 
       12  7235 1 1 31 HIS CB   C    2.038   1.558   2.899 1.00 . A A .  31 HIS CB   1 1 
       12  7236 1 1 31 HIS CD2  C    3.205   3.244   1.310 1.00 . A A .  31 HIS CD2  1 1 
       12  7237 1 1 31 HIS CE1  C    4.020   4.601   2.826 1.00 . A A .  31 HIS CE1  1 1 
       12  7238 1 1 31 HIS CG   C    2.839   2.766   2.523 1.00 . A A .  31 HIS CG   1 1 
       12  7239 1 1 31 HIS H    H    0.175  -0.198   3.058 1.00 . A A .  31 HIS H    1 1 
       12  7240 1 1 31 HIS HA   H    0.546   2.432   4.159 1.00 . A A .  31 HIS HA   1 1 
       12  7241 1 1 31 HIS HB2  H    2.509   1.102   3.757 1.00 . A A .  31 HIS HB2  1 1 
       12  7242 1 1 31 HIS HB3  H    2.068   0.867   2.069 1.00 . A A .  31 HIS HB3  1 1 
       12  7243 1 1 31 HIS HD1  H    3.274   3.564   4.424 1.00 . A A .  31 HIS HD1  1 1 
       12  7244 1 1 31 HIS HD2  H    2.965   2.808   0.350 1.00 . A A .  31 HIS HD2  1 1 
       12  7245 1 1 31 HIS HE1  H    4.534   5.426   3.297 1.00 . A A .  31 HIS HE1  1 1 
       12  7246 1 1 31 HIS N    N   -0.172   0.638   3.433 1.00 . A A .  31 HIS N    1 1 
       12  7247 1 1 31 HIS ND1  N    3.366   3.638   3.452 1.00 . A A .  31 HIS ND1  1 1 
       12  7248 1 1 31 HIS NE2  N    3.937   4.385   1.526 1.00 . A A .  31 HIS NE2  1 1 
       12  7249 1 1 31 HIS O    O    0.194   3.921   2.047 1.00 . A A .  31 HIS O    1 1 
       12  7250 1 1 32 GLN C    C   -2.818   3.359   0.610 1.00 . A A .  32 GLN C    1 1 
       12  7251 1 1 32 GLN CA   C   -1.485   2.765   0.169 1.00 . A A .  32 GLN CA   1 1 
       12  7252 1 1 32 GLN CB   C   -1.702   1.807  -1.003 1.00 . A A .  32 GLN CB   1 1 
       12  7253 1 1 32 GLN CD   C   -0.643   0.587  -2.945 1.00 . A A .  32 GLN CD   1 1 
       12  7254 1 1 32 GLN CG   C   -0.411   1.320  -1.639 1.00 . A A .  32 GLN CG   1 1 
       12  7255 1 1 32 GLN H    H   -0.980   1.112   1.390 1.00 . A A .  32 GLN H    1 1 
       12  7256 1 1 32 GLN HA   H   -0.836   3.567  -0.150 1.00 . A A .  32 GLN HA   1 1 
       12  7257 1 1 32 GLN HB2  H   -2.252   0.946  -0.652 1.00 . A A .  32 GLN HB2  1 1 
       12  7258 1 1 32 GLN HB3  H   -2.284   2.311  -1.761 1.00 . A A .  32 GLN HB3  1 1 
       12  7259 1 1 32 GLN HE21 H    0.570   1.842  -3.896 1.00 . A A .  32 GLN HE21 1 1 
       12  7260 1 1 32 GLN HE22 H   -0.139   0.603  -4.868 1.00 . A A .  32 GLN HE22 1 1 
       12  7261 1 1 32 GLN HG2  H    0.224   2.172  -1.832 1.00 . A A .  32 GLN HG2  1 1 
       12  7262 1 1 32 GLN HG3  H    0.085   0.651  -0.951 1.00 . A A .  32 GLN HG3  1 1 
       12  7263 1 1 32 GLN N    N   -0.832   2.073   1.274 1.00 . A A .  32 GLN N    1 1 
       12  7264 1 1 32 GLN NE2  N   -0.007   1.058  -4.011 1.00 . A A .  32 GLN NE2  1 1 
       12  7265 1 1 32 GLN O    O   -3.331   4.289  -0.013 1.00 . A A .  32 GLN O    1 1 
       12  7266 1 1 32 GLN OE1  O   -1.387  -0.394  -2.996 1.00 . A A .  32 GLN OE1  1 1 
       12  7267 1 1 33 ARG C    C   -4.604   4.794   2.471 1.00 . A A .  33 ARG C    1 1 
       12  7268 1 1 33 ARG CA   C   -4.650   3.291   2.211 1.00 . A A .  33 ARG CA   1 1 
       12  7269 1 1 33 ARG CB   C   -5.003   2.550   3.502 1.00 . A A .  33 ARG CB   1 1 
       12  7270 1 1 33 ARG CD   C   -6.139   0.498   4.405 1.00 . A A .  33 ARG CD   1 1 
       12  7271 1 1 33 ARG CG   C   -5.261   1.066   3.301 1.00 . A A .  33 ARG CG   1 1 
       12  7272 1 1 33 ARG CZ   C   -8.195   1.819   4.682 1.00 . A A .  33 ARG CZ   1 1 
       12  7273 1 1 33 ARG H    H   -2.917   2.077   2.141 1.00 . A A .  33 ARG H    1 1 
       12  7274 1 1 33 ARG HA   H   -5.409   3.089   1.471 1.00 . A A .  33 ARG HA   1 1 
       12  7275 1 1 33 ARG HB2  H   -4.188   2.660   4.202 1.00 . A A .  33 ARG HB2  1 1 
       12  7276 1 1 33 ARG HB3  H   -5.892   2.994   3.925 1.00 . A A .  33 ARG HB3  1 1 
       12  7277 1 1 33 ARG HD2  H   -5.991  -0.570   4.451 1.00 . A A .  33 ARG HD2  1 1 
       12  7278 1 1 33 ARG HD3  H   -5.845   0.943   5.344 1.00 . A A .  33 ARG HD3  1 1 
       12  7279 1 1 33 ARG HE   H   -8.052   0.142   3.611 1.00 . A A .  33 ARG HE   1 1 
       12  7280 1 1 33 ARG HG2  H   -5.757   0.921   2.352 1.00 . A A .  33 ARG HG2  1 1 
       12  7281 1 1 33 ARG HG3  H   -4.316   0.543   3.299 1.00 . A A .  33 ARG HG3  1 1 
       12  7282 1 1 33 ARG HH11 H   -6.576   2.555   5.640 1.00 . A A .  33 ARG HH11 1 1 
       12  7283 1 1 33 ARG HH12 H   -8.032   3.476   5.827 1.00 . A A .  33 ARG HH12 1 1 
       12  7284 1 1 33 ARG HH21 H   -9.975   1.346   3.849 1.00 . A A .  33 ARG HH21 1 1 
       12  7285 1 1 33 ARG HH22 H   -9.964   2.787   4.808 1.00 . A A .  33 ARG HH22 1 1 
       12  7286 1 1 33 ARG N    N   -3.375   2.816   1.688 1.00 . A A .  33 ARG N    1 1 
       12  7287 1 1 33 ARG NE   N   -7.555   0.771   4.173 1.00 . A A .  33 ARG NE   1 1 
       12  7288 1 1 33 ARG NH1  N   -7.548   2.687   5.446 1.00 . A A .  33 ARG NH1  1 1 
       12  7289 1 1 33 ARG NH2  N   -9.484   1.999   4.425 1.00 . A A .  33 ARG NH2  1 1 
       12  7290 1 1 33 ARG O    O   -5.589   5.503   2.258 1.00 . A A .  33 ARG O    1 1 
       12  7291 1 1 34 THR C    C   -3.098   7.498   1.943 1.00 . A A .  34 THR C    1 1 
       12  7292 1 1 34 THR CA   C   -3.281   6.693   3.224 1.00 . A A .  34 THR CA   1 1 
       12  7293 1 1 34 THR CB   C   -2.070   6.933   4.145 1.00 . A A .  34 THR CB   1 1 
       12  7294 1 1 34 THR CG2  C   -0.777   6.521   3.458 1.00 . A A .  34 THR CG2  1 1 
       12  7295 1 1 34 THR H    H   -2.706   4.661   3.083 1.00 . A A .  34 THR H    1 1 
       12  7296 1 1 34 THR HA   H   -4.168   7.040   3.733 1.00 . A A .  34 THR HA   1 1 
       12  7297 1 1 34 THR HB   H   -2.192   6.336   5.038 1.00 . A A .  34 THR HB   1 1 
       12  7298 1 1 34 THR HG1  H   -2.890   8.665   4.611 1.00 . A A .  34 THR HG1  1 1 
       12  7299 1 1 34 THR HG21 H   -0.017   6.338   4.202 1.00 . A A .  34 THR HG21 1 1 
       12  7300 1 1 34 THR HG22 H   -0.451   7.312   2.799 1.00 . A A .  34 THR HG22 1 1 
       12  7301 1 1 34 THR HG23 H   -0.945   5.621   2.885 1.00 . A A .  34 THR HG23 1 1 
       12  7302 1 1 34 THR N    N   -3.454   5.275   2.933 1.00 . A A .  34 THR N    1 1 
       12  7303 1 1 34 THR O    O   -3.558   8.636   1.842 1.00 . A A .  34 THR O    1 1 
       12  7304 1 1 34 THR OG1  O   -2.001   8.315   4.513 1.00 . A A .  34 THR OG1  1 1 
       12  7305 1 1 35 HIS C    C   -3.492   7.805  -1.056 1.00 . A A .  35 HIS C    1 1 
       12  7306 1 1 35 HIS CA   C   -2.182   7.564  -0.312 1.00 . A A .  35 HIS CA   1 1 
       12  7307 1 1 35 HIS CB   C   -1.238   6.726  -1.174 1.00 . A A .  35 HIS CB   1 1 
       12  7308 1 1 35 HIS CD2  C    1.195   6.289  -0.389 1.00 . A A .  35 HIS CD2  1 1 
       12  7309 1 1 35 HIS CE1  C    2.074   8.206  -0.987 1.00 . A A .  35 HIS CE1  1 1 
       12  7310 1 1 35 HIS CG   C    0.211   7.031  -0.948 1.00 . A A .  35 HIS CG   1 1 
       12  7311 1 1 35 HIS H    H   -2.082   5.994   1.105 1.00 . A A .  35 HIS H    1 1 
       12  7312 1 1 35 HIS HA   H   -1.718   8.517  -0.108 1.00 . A A .  35 HIS HA   1 1 
       12  7313 1 1 35 HIS HB2  H   -1.394   5.680  -0.955 1.00 . A A .  35 HIS HB2  1 1 
       12  7314 1 1 35 HIS HB3  H   -1.457   6.907  -2.217 1.00 . A A .  35 HIS HB3  1 1 
       12  7315 1 1 35 HIS HD1  H    0.337   8.978  -1.743 1.00 . A A .  35 HIS HD1  1 1 
       12  7316 1 1 35 HIS HD2  H    1.097   5.289   0.011 1.00 . A A .  35 HIS HD2  1 1 
       12  7317 1 1 35 HIS HE1  H    2.781   9.005  -1.153 1.00 . A A .  35 HIS HE1  1 1 
       12  7318 1 1 35 HIS N    N   -2.424   6.901   0.965 1.00 . A A .  35 HIS N    1 1 
       12  7319 1 1 35 HIS ND1  N    0.794   8.227  -1.311 1.00 . A A .  35 HIS ND1  1 1 
       12  7320 1 1 35 HIS NE2  N    2.343   7.041  -0.426 1.00 . A A .  35 HIS NE2  1 1 
       12  7321 1 1 35 HIS O    O   -3.667   8.835  -1.706 1.00 . A A .  35 HIS O    1 1 
       12  7322 1 1 36 SER C    C   -6.711   7.675  -0.741 1.00 . A A .  36 SER C    1 1 
       12  7323 1 1 36 SER CA   C   -5.699   6.952  -1.625 1.00 . A A .  36 SER CA   1 1 
       12  7324 1 1 36 SER CB   C   -6.225   5.562  -1.989 1.00 . A A .  36 SER CB   1 1 
       12  7325 1 1 36 SER H    H   -4.208   6.048  -0.425 1.00 . A A .  36 SER H    1 1 
       12  7326 1 1 36 SER HA   H   -5.559   7.523  -2.531 1.00 . A A .  36 SER HA   1 1 
       12  7327 1 1 36 SER HB2  H   -6.443   5.015  -1.085 1.00 . A A .  36 SER HB2  1 1 
       12  7328 1 1 36 SER HB3  H   -7.127   5.663  -2.575 1.00 . A A .  36 SER HB3  1 1 
       12  7329 1 1 36 SER HG   H   -4.733   5.448  -3.253 1.00 . A A .  36 SER HG   1 1 
       12  7330 1 1 36 SER N    N   -4.407   6.846  -0.958 1.00 . A A .  36 SER N    1 1 
       12  7331 1 1 36 SER O    O   -6.469   7.896   0.445 1.00 . A A .  36 SER O    1 1 
       12  7332 1 1 36 SER OG   O   -5.269   4.837  -2.742 1.00 . A A .  36 SER OG   1 1 
       12  7333 1 1 37 GLY C    C   -9.681   9.687  -1.445 1.00 . A A .  37 GLY C    1 1 
       12  7334 1 1 37 GLY CA   C   -8.878   8.736  -0.580 1.00 . A A .  37 GLY CA   1 1 
       12  7335 1 1 37 GLY H    H   -7.984   7.839  -2.277 1.00 . A A .  37 GLY H    1 1 
       12  7336 1 1 37 GLY HA2  H   -9.546   8.006  -0.148 1.00 . A A .  37 GLY HA2  1 1 
       12  7337 1 1 37 GLY HA3  H   -8.412   9.298   0.216 1.00 . A A .  37 GLY HA3  1 1 
       12  7338 1 1 37 GLY N    N   -7.846   8.042  -1.328 1.00 . A A .  37 GLY N    1 1 
       12  7339 1 1 37 GLY O    O  -10.907   9.605  -1.493 1.00 . A A .  37 GLY O    1 1 
       12  7340 1 1 38 GLU C    C   -9.262  11.339  -4.454 1.00 . A A .  38 GLU C    1 1 
       12  7341 1 1 38 GLU CA   C   -9.645  11.563  -2.994 1.00 . A A .  38 GLU CA   1 1 
       12  7342 1 1 38 GLU CB   C   -9.276  12.987  -2.572 1.00 . A A .  38 GLU CB   1 1 
       12  7343 1 1 38 GLU CD   C  -11.530  14.128  -2.609 1.00 . A A .  38 GLU CD   1 1 
       12  7344 1 1 38 GLU CG   C  -10.142  14.057  -3.216 1.00 . A A .  38 GLU CG   1 1 
       12  7345 1 1 38 GLU H    H   -8.010  10.606  -2.049 1.00 . A A .  38 GLU H    1 1 
       12  7346 1 1 38 GLU HA   H  -10.711  11.432  -2.889 1.00 . A A .  38 GLU HA   1 1 
       12  7347 1 1 38 GLU HB2  H   -9.377  13.070  -1.499 1.00 . A A .  38 GLU HB2  1 1 
       12  7348 1 1 38 GLU HB3  H   -8.248  13.175  -2.843 1.00 . A A .  38 GLU HB3  1 1 
       12  7349 1 1 38 GLU HG2  H   -9.661  15.015  -3.091 1.00 . A A .  38 GLU HG2  1 1 
       12  7350 1 1 38 GLU HG3  H  -10.237  13.838  -4.270 1.00 . A A .  38 GLU HG3  1 1 
       12  7351 1 1 38 GLU N    N   -8.987  10.592  -2.128 1.00 . A A .  38 GLU N    1 1 
       12  7352 1 1 38 GLU O    O   -8.261  11.871  -4.933 1.00 . A A .  38 GLU O    1 1 
       12  7353 1 1 38 GLU OE1  O  -12.389  13.308  -2.996 1.00 . A A .  38 GLU OE1  1 1 
       12  7354 1 1 38 GLU OE2  O  -11.757  15.004  -1.749 1.00 . A A .  38 GLU OE2  1 1 
       12  7355 1 1 39 SER C    C  -10.957  10.742  -7.438 1.00 . A A .  39 SER C    1 1 
       12  7356 1 1 39 SER CA   C   -9.811  10.248  -6.559 1.00 . A A .  39 SER CA   1 1 
       12  7357 1 1 39 SER CB   C   -9.617   8.743  -6.755 1.00 . A A .  39 SER CB   1 1 
       12  7358 1 1 39 SER H    H  -10.850  10.153  -4.717 1.00 . A A .  39 SER H    1 1 
       12  7359 1 1 39 SER HA   H   -8.905  10.760  -6.848 1.00 . A A .  39 SER HA   1 1 
       12  7360 1 1 39 SER HB2  H  -10.534   8.229  -6.512 1.00 . A A .  39 SER HB2  1 1 
       12  7361 1 1 39 SER HB3  H   -9.357   8.548  -7.785 1.00 . A A .  39 SER HB3  1 1 
       12  7362 1 1 39 SER HG   H   -7.760   8.700  -6.130 1.00 . A A .  39 SER HG   1 1 
       12  7363 1 1 39 SER N    N  -10.067  10.547  -5.155 1.00 . A A .  39 SER N    1 1 
       12  7364 1 1 39 SER O    O  -11.870   9.988  -7.769 1.00 . A A .  39 SER O    1 1 
       12  7365 1 1 39 SER OG   O   -8.582   8.250  -5.921 1.00 . A A .  39 SER OG   1 1 
       12  7366 1 1 40 GLY C    C  -11.984  14.104  -8.557 1.00 . A A .  40 GLY C    1 1 
       12  7367 1 1 40 GLY CA   C  -11.938  12.592  -8.647 1.00 . A A .  40 GLY CA   1 1 
       12  7368 1 1 40 GLY H    H  -10.148  12.572  -7.517 1.00 . A A .  40 GLY H    1 1 
       12  7369 1 1 40 GLY HA2  H  -11.757  12.308  -9.673 1.00 . A A .  40 GLY HA2  1 1 
       12  7370 1 1 40 GLY HA3  H  -12.894  12.196  -8.338 1.00 . A A .  40 GLY HA3  1 1 
       12  7371 1 1 40 GLY N    N  -10.900  12.017  -7.811 1.00 . A A .  40 GLY N    1 1 
       12  7372 1 1 40 GLY O    O  -12.769  14.679  -7.804 1.00 . A A .  40 GLY O    1 1 
       12  7373 1 1 41 PRO C    C  -12.278  16.871 -10.004 1.00 . A A .  41 PRO C    1 1 
       12  7374 1 1 41 PRO CA   C  -11.048  16.237  -9.362 1.00 . A A .  41 PRO CA   1 1 
       12  7375 1 1 41 PRO CB   C   -9.801  16.516 -10.204 1.00 . A A .  41 PRO CB   1 1 
       12  7376 1 1 41 PRO CD   C  -10.158  14.153 -10.262 1.00 . A A .  41 PRO CD   1 1 
       12  7377 1 1 41 PRO CG   C   -9.655  15.315 -11.073 1.00 . A A .  41 PRO CG   1 1 
       12  7378 1 1 41 PRO HA   H  -10.913  16.643  -8.370 1.00 . A A .  41 PRO HA   1 1 
       12  7379 1 1 41 PRO HB2  H   -9.952  17.412 -10.789 1.00 . A A .  41 PRO HB2  1 1 
       12  7380 1 1 41 PRO HB3  H   -8.946  16.641  -9.557 1.00 . A A .  41 PRO HB3  1 1 
       12  7381 1 1 41 PRO HD2  H  -10.644  13.430 -10.900 1.00 . A A .  41 PRO HD2  1 1 
       12  7382 1 1 41 PRO HD3  H   -9.346  13.693  -9.717 1.00 . A A .  41 PRO HD3  1 1 
       12  7383 1 1 41 PRO HG2  H  -10.249  15.433 -11.967 1.00 . A A .  41 PRO HG2  1 1 
       12  7384 1 1 41 PRO HG3  H   -8.616  15.171 -11.328 1.00 . A A .  41 PRO HG3  1 1 
       12  7385 1 1 41 PRO N    N  -11.123  14.774  -9.339 1.00 . A A .  41 PRO N    1 1 
       12  7386 1 1 41 PRO O    O  -12.857  17.813  -9.463 1.00 . A A .  41 PRO O    1 1 
       12  7387 1 1 42 SER C    C  -14.323  15.857 -12.913 1.00 . A A .  42 SER C    1 1 
       12  7388 1 1 42 SER CA   C  -13.830  16.865 -11.879 1.00 . A A .  42 SER CA   1 1 
       12  7389 1 1 42 SER CB   C  -13.483  18.188 -12.565 1.00 . A A .  42 SER CB   1 1 
       12  7390 1 1 42 SER H    H  -12.168  15.598 -11.542 1.00 . A A .  42 SER H    1 1 
       12  7391 1 1 42 SER HA   H  -14.616  17.038 -11.159 1.00 . A A .  42 SER HA   1 1 
       12  7392 1 1 42 SER HB2  H  -14.371  18.597 -13.021 1.00 . A A .  42 SER HB2  1 1 
       12  7393 1 1 42 SER HB3  H  -13.104  18.883 -11.829 1.00 . A A .  42 SER HB3  1 1 
       12  7394 1 1 42 SER HG   H  -12.546  17.101 -13.898 1.00 . A A .  42 SER HG   1 1 
       12  7395 1 1 42 SER N    N  -12.671  16.348 -11.161 1.00 . A A .  42 SER N    1 1 
       12  7396 1 1 42 SER O    O  -13.531  15.277 -13.657 1.00 . A A .  42 SER O    1 1 
       12  7397 1 1 42 SER OG   O  -12.499  18.001 -13.567 1.00 . A A .  42 SER OG   1 1 
       12  7398 1 1 43 SER C    C  -15.506  13.374 -13.861 1.00 . A A .  43 SER C    1 1 
       12  7399 1 1 43 SER CA   C  -16.235  14.714 -13.893 1.00 . A A .  43 SER CA   1 1 
       12  7400 1 1 43 SER CB   C  -16.206  15.288 -15.311 1.00 . A A .  43 SER CB   1 1 
       12  7401 1 1 43 SER H    H  -16.215  16.147 -12.335 1.00 . A A .  43 SER H    1 1 
       12  7402 1 1 43 SER HA   H  -17.262  14.559 -13.598 1.00 . A A .  43 SER HA   1 1 
       12  7403 1 1 43 SER HB2  H  -15.248  15.751 -15.490 1.00 . A A .  43 SER HB2  1 1 
       12  7404 1 1 43 SER HB3  H  -16.360  14.490 -16.023 1.00 . A A .  43 SER HB3  1 1 
       12  7405 1 1 43 SER HG   H  -17.210  16.875 -14.751 1.00 . A A .  43 SER HG   1 1 
       12  7406 1 1 43 SER N    N  -15.636  15.654 -12.954 1.00 . A A .  43 SER N    1 1 
       12  7407 1 1 43 SER O    O  -15.250  12.768 -14.901 1.00 . A A .  43 SER O    1 1 
       12  7408 1 1 43 SER OG   O  -17.223  16.260 -15.488 1.00 . A A .  43 SER OG   1 1 
       12  7409 1 1 44 GLY C    C  -13.004  11.834 -12.204 1.00 . A A .  44 GLY C    1 1 
       12  7410 1 1 44 GLY CA   C  -14.477  11.652 -12.510 1.00 . A A .  44 GLY CA   1 1 
       12  7411 1 1 44 GLY H    H  -15.403  13.443 -11.863 1.00 . A A .  44 GLY H    1 1 
       12  7412 1 1 44 GLY HA2  H  -14.934  11.093 -11.707 1.00 . A A .  44 GLY HA2  1 1 
       12  7413 1 1 44 GLY HA3  H  -14.575  11.091 -13.428 1.00 . A A .  44 GLY HA3  1 1 
       12  7414 1 1 44 GLY N    N  -15.174  12.917 -12.657 1.00 . A A .  44 GLY N    1 1 
       12  7415 1 1 44 GLY O    O  -12.608  12.923 -11.790 1.00 . A A .  44 GLY O    1 1 
       12  7416 2 2  1 ZN  ZN   ZN   3.649   5.128  -0.687 1.00 . B A . 201 ZN  ZN   1 1 
       13  7417 1 1  1 GLY C    C   25.790   4.704 -10.970 1.00 . A A .   1 GLY C    1 1 
       13  7418 1 1  1 GLY CA   C   26.171   6.128 -11.325 1.00 . A A .   1 GLY CA   1 1 
       13  7419 1 1  1 GLY H1   H   28.168   6.618 -11.832 1.00 . A A .   1 GLY H1   1 1 
       13  7420 1 1  1 GLY HA2  H   26.362   6.676 -10.414 1.00 . A A .   1 GLY HA2  1 1 
       13  7421 1 1  1 GLY HA3  H   25.345   6.590 -11.845 1.00 . A A .   1 GLY HA3  1 1 
       13  7422 1 1  1 GLY N    N   27.350   6.193 -12.168 1.00 . A A .   1 GLY N    1 1 
       13  7423 1 1  1 GLY O    O   25.139   4.015 -11.755 1.00 . A A .   1 GLY O    1 1 
       13  7424 1 1  2 SER C    C   24.405   2.737  -9.078 1.00 . A A .   2 SER C    1 1 
       13  7425 1 1  2 SER CA   C   25.900   2.909  -9.330 1.00 . A A .   2 SER CA   1 1 
       13  7426 1 1  2 SER CB   C   26.683   2.594  -8.054 1.00 . A A .   2 SER CB   1 1 
       13  7427 1 1  2 SER H    H   26.714   4.860  -9.204 1.00 . A A .   2 SER H    1 1 
       13  7428 1 1  2 SER HA   H   26.204   2.224 -10.107 1.00 . A A .   2 SER HA   1 1 
       13  7429 1 1  2 SER HB2  H   26.392   1.621  -7.687 1.00 . A A .   2 SER HB2  1 1 
       13  7430 1 1  2 SER HB3  H   27.741   2.593  -8.275 1.00 . A A .   2 SER HB3  1 1 
       13  7431 1 1  2 SER HG   H   26.665   3.196  -6.190 1.00 . A A .   2 SER HG   1 1 
       13  7432 1 1  2 SER N    N   26.198   4.262  -9.785 1.00 . A A .   2 SER N    1 1 
       13  7433 1 1  2 SER O    O   23.684   3.712  -8.868 1.00 . A A .   2 SER O    1 1 
       13  7434 1 1  2 SER OG   O   26.427   3.558  -7.047 1.00 . A A .   2 SER OG   1 1 
       13  7435 1 1  3 SER C    C   22.367  -0.208  -8.289 1.00 . A A .   3 SER C    1 1 
       13  7436 1 1  3 SER CA   C   22.538   1.188  -8.880 1.00 . A A .   3 SER CA   1 1 
       13  7437 1 1  3 SER CB   C   21.759   1.297 -10.193 1.00 . A A .   3 SER CB   1 1 
       13  7438 1 1  3 SER H    H   24.573   0.754  -9.274 1.00 . A A .   3 SER H    1 1 
       13  7439 1 1  3 SER HA   H   22.150   1.913  -8.180 1.00 . A A .   3 SER HA   1 1 
       13  7440 1 1  3 SER HB2  H   20.753   0.937 -10.042 1.00 . A A .   3 SER HB2  1 1 
       13  7441 1 1  3 SER HB3  H   21.728   2.331 -10.504 1.00 . A A .   3 SER HB3  1 1 
       13  7442 1 1  3 SER HG   H   22.157  -0.397 -11.091 1.00 . A A .   3 SER HG   1 1 
       13  7443 1 1  3 SER N    N   23.948   1.489  -9.102 1.00 . A A .   3 SER N    1 1 
       13  7444 1 1  3 SER O    O   23.012  -1.161  -8.723 1.00 . A A .   3 SER O    1 1 
       13  7445 1 1  3 SER OG   O   22.372   0.530 -11.214 1.00 . A A .   3 SER OG   1 1 
       13  7446 1 1  4 GLY C    C   21.785  -1.655  -5.241 1.00 . A A .   4 GLY C    1 1 
       13  7447 1 1  4 GLY CA   C   21.251  -1.601  -6.658 1.00 . A A .   4 GLY CA   1 1 
       13  7448 1 1  4 GLY H    H   21.006   0.476  -6.989 1.00 . A A .   4 GLY H    1 1 
       13  7449 1 1  4 GLY HA2  H   20.187  -1.787  -6.639 1.00 . A A .   4 GLY HA2  1 1 
       13  7450 1 1  4 GLY HA3  H   21.730  -2.375  -7.241 1.00 . A A .   4 GLY HA3  1 1 
       13  7451 1 1  4 GLY N    N   21.492  -0.319  -7.294 1.00 . A A .   4 GLY N    1 1 
       13  7452 1 1  4 GLY O    O   21.033  -1.890  -4.295 1.00 . A A .   4 GLY O    1 1 
       13  7453 1 1  5 SER C    C   23.773  -0.073  -3.168 1.00 . A A .   5 SER C    1 1 
       13  7454 1 1  5 SER CA   C   23.724  -1.469  -3.781 1.00 . A A .   5 SER CA   1 1 
       13  7455 1 1  5 SER CB   C   25.139  -2.041  -3.889 1.00 . A A .   5 SER CB   1 1 
       13  7456 1 1  5 SER H    H   23.636  -1.257  -5.885 1.00 . A A .   5 SER H    1 1 
       13  7457 1 1  5 SER HA   H   23.134  -2.109  -3.141 1.00 . A A .   5 SER HA   1 1 
       13  7458 1 1  5 SER HB2  H   25.638  -1.600  -4.739 1.00 . A A .   5 SER HB2  1 1 
       13  7459 1 1  5 SER HB3  H   25.688  -1.808  -2.988 1.00 . A A .   5 SER HB3  1 1 
       13  7460 1 1  5 SER HG   H   24.291  -3.796  -3.695 1.00 . A A .   5 SER HG   1 1 
       13  7461 1 1  5 SER N    N   23.088  -1.439  -5.093 1.00 . A A .   5 SER N    1 1 
       13  7462 1 1  5 SER O    O   24.781   0.327  -2.587 1.00 . A A .   5 SER O    1 1 
       13  7463 1 1  5 SER OG   O   25.109  -3.447  -4.056 1.00 . A A .   5 SER OG   1 1 
       13  7464 1 1  6 SER C    C   21.442   2.139  -1.773 1.00 . A A .   6 SER C    1 1 
       13  7465 1 1  6 SER CA   C   22.593   2.018  -2.768 1.00 . A A .   6 SER CA   1 1 
       13  7466 1 1  6 SER CB   C   22.409   3.028  -3.902 1.00 . A A .   6 SER CB   1 1 
       13  7467 1 1  6 SER H    H   21.903   0.290  -3.778 1.00 . A A .   6 SER H    1 1 
       13  7468 1 1  6 SER HA   H   23.520   2.229  -2.256 1.00 . A A .   6 SER HA   1 1 
       13  7469 1 1  6 SER HB2  H   22.204   4.002  -3.484 1.00 . A A .   6 SER HB2  1 1 
       13  7470 1 1  6 SER HB3  H   23.314   3.073  -4.490 1.00 . A A .   6 SER HB3  1 1 
       13  7471 1 1  6 SER HG   H   20.597   3.259  -4.610 1.00 . A A .   6 SER HG   1 1 
       13  7472 1 1  6 SER N    N   22.675   0.665  -3.304 1.00 . A A .   6 SER N    1 1 
       13  7473 1 1  6 SER O    O   21.635   2.561  -0.633 1.00 . A A .   6 SER O    1 1 
       13  7474 1 1  6 SER OG   O   21.333   2.658  -4.746 1.00 . A A .   6 SER OG   1 1 
       13  7475 1 1  7 GLY C    C   18.663   0.481  -0.823 1.00 . A A .   7 GLY C    1 1 
       13  7476 1 1  7 GLY CA   C   19.081   1.840  -1.350 1.00 . A A .   7 GLY CA   1 1 
       13  7477 1 1  7 GLY H    H   20.151   1.437  -3.132 1.00 . A A .   7 GLY H    1 1 
       13  7478 1 1  7 GLY HA2  H   19.306   2.485  -0.515 1.00 . A A .   7 GLY HA2  1 1 
       13  7479 1 1  7 GLY HA3  H   18.259   2.264  -1.909 1.00 . A A .   7 GLY HA3  1 1 
       13  7480 1 1  7 GLY N    N   20.245   1.766  -2.213 1.00 . A A .   7 GLY N    1 1 
       13  7481 1 1  7 GLY O    O   19.359  -0.116  -0.001 1.00 . A A .   7 GLY O    1 1 
       13  7482 1 1  8 THR C    C   15.834  -1.746  -1.727 1.00 . A A .   8 THR C    1 1 
       13  7483 1 1  8 THR CA   C   17.008  -1.303  -0.863 1.00 . A A .   8 THR CA   1 1 
       13  7484 1 1  8 THR CB   C   16.562  -1.269   0.611 1.00 . A A .   8 THR CB   1 1 
       13  7485 1 1  8 THR CG2  C   15.426  -0.276   0.809 1.00 . A A .   8 THR CG2  1 1 
       13  7486 1 1  8 THR H    H   17.010   0.515  -1.946 1.00 . A A .   8 THR H    1 1 
       13  7487 1 1  8 THR HA   H   17.806  -2.026  -0.958 1.00 . A A .   8 THR HA   1 1 
       13  7488 1 1  8 THR HB   H   17.401  -0.959   1.218 1.00 . A A .   8 THR HB   1 1 
       13  7489 1 1  8 THR HG1  H   16.364  -2.702   1.952 1.00 . A A .   8 THR HG1  1 1 
       13  7490 1 1  8 THR HG21 H   14.500  -0.813   0.946 1.00 . A A .   8 THR HG21 1 1 
       13  7491 1 1  8 THR HG22 H   15.348   0.360  -0.060 1.00 . A A .   8 THR HG22 1 1 
       13  7492 1 1  8 THR HG23 H   15.625   0.328   1.682 1.00 . A A .   8 THR HG23 1 1 
       13  7493 1 1  8 THR N    N   17.520  -0.009  -1.294 1.00 . A A .   8 THR N    1 1 
       13  7494 1 1  8 THR O    O   14.794  -1.087  -1.763 1.00 . A A .   8 THR O    1 1 
       13  7495 1 1  8 THR OG1  O   16.141  -2.573   1.027 1.00 . A A .   8 THR OG1  1 1 
       13  7496 1 1  9 ARG C    C   14.782  -4.897  -3.070 1.00 . A A .   9 ARG C    1 1 
       13  7497 1 1  9 ARG CA   C   14.958  -3.396  -3.287 1.00 . A A .   9 ARG CA   1 1 
       13  7498 1 1  9 ARG CB   C   15.289  -3.118  -4.754 1.00 . A A .   9 ARG CB   1 1 
       13  7499 1 1  9 ARG CD   C   16.664  -5.013  -5.669 1.00 . A A .   9 ARG CD   1 1 
       13  7500 1 1  9 ARG CG   C   16.679  -3.579  -5.163 1.00 . A A .   9 ARG CG   1 1 
       13  7501 1 1  9 ARG CZ   C   19.009  -5.251  -6.366 1.00 . A A .   9 ARG CZ   1 1 
       13  7502 1 1  9 ARG H    H   16.856  -3.347  -2.351 1.00 . A A .   9 ARG H    1 1 
       13  7503 1 1  9 ARG HA   H   14.035  -2.897  -3.034 1.00 . A A .   9 ARG HA   1 1 
       13  7504 1 1  9 ARG HB2  H   14.568  -3.626  -5.377 1.00 . A A .   9 ARG HB2  1 1 
       13  7505 1 1  9 ARG HB3  H   15.220  -2.055  -4.930 1.00 . A A .   9 ARG HB3  1 1 
       13  7506 1 1  9 ARG HD2  H   16.810  -5.678  -4.831 1.00 . A A .   9 ARG HD2  1 1 
       13  7507 1 1  9 ARG HD3  H   15.703  -5.210  -6.121 1.00 . A A .   9 ARG HD3  1 1 
       13  7508 1 1  9 ARG HE   H   17.435  -5.431  -7.578 1.00 . A A .   9 ARG HE   1 1 
       13  7509 1 1  9 ARG HG2  H   17.045  -2.935  -5.949 1.00 . A A .   9 ARG HG2  1 1 
       13  7510 1 1  9 ARG HG3  H   17.335  -3.514  -4.307 1.00 . A A .   9 ARG HG3  1 1 
       13  7511 1 1  9 ARG HH11 H   18.742  -4.843  -4.406 1.00 . A A .   9 ARG HH11 1 1 
       13  7512 1 1  9 ARG HH12 H   20.391  -5.014  -4.910 1.00 . A A .   9 ARG HH12 1 1 
       13  7513 1 1  9 ARG HH21 H   19.602  -5.658  -8.255 1.00 . A A .   9 ARG HH21 1 1 
       13  7514 1 1  9 ARG HH22 H   20.879  -5.477  -7.100 1.00 . A A .   9 ARG HH22 1 1 
       13  7515 1 1  9 ARG N    N   16.005  -2.866  -2.422 1.00 . A A .   9 ARG N    1 1 
       13  7516 1 1  9 ARG NE   N   17.713  -5.256  -6.655 1.00 . A A .   9 ARG NE   1 1 
       13  7517 1 1  9 ARG NH1  N   19.414  -5.016  -5.126 1.00 . A A .   9 ARG NH1  1 1 
       13  7518 1 1  9 ARG NH2  N   19.903  -5.481  -7.319 1.00 . A A .   9 ARG NH2  1 1 
       13  7519 1 1  9 ARG O    O   14.548  -5.646  -4.017 1.00 . A A .   9 ARG O    1 1 
       13  7520 1 1 10 GLU C    C   13.282  -7.097  -1.269 1.00 . A A .  10 GLU C    1 1 
       13  7521 1 1 10 GLU CA   C   14.750  -6.736  -1.477 1.00 . A A .  10 GLU CA   1 1 
       13  7522 1 1 10 GLU CB   C   15.551  -7.065  -0.216 1.00 . A A .  10 GLU CB   1 1 
       13  7523 1 1 10 GLU CD   C   17.917  -7.681  -0.852 1.00 . A A .  10 GLU CD   1 1 
       13  7524 1 1 10 GLU CG   C   17.001  -6.616  -0.282 1.00 . A A .  10 GLU CG   1 1 
       13  7525 1 1 10 GLU H    H   15.082  -4.679  -1.105 1.00 . A A .  10 GLU H    1 1 
       13  7526 1 1 10 GLU HA   H   15.137  -7.317  -2.300 1.00 . A A .  10 GLU HA   1 1 
       13  7527 1 1 10 GLU HB2  H   15.083  -6.583   0.629 1.00 . A A .  10 GLU HB2  1 1 
       13  7528 1 1 10 GLU HB3  H   15.534  -8.134  -0.063 1.00 . A A .  10 GLU HB3  1 1 
       13  7529 1 1 10 GLU HG2  H   17.064  -5.737  -0.905 1.00 . A A .  10 GLU HG2  1 1 
       13  7530 1 1 10 GLU HG3  H   17.334  -6.372   0.717 1.00 . A A .  10 GLU HG3  1 1 
       13  7531 1 1 10 GLU N    N   14.895  -5.326  -1.817 1.00 . A A .  10 GLU N    1 1 
       13  7532 1 1 10 GLU O    O   12.961  -8.163  -0.744 1.00 . A A .  10 GLU O    1 1 
       13  7533 1 1 10 GLU OE1  O   17.791  -8.854  -0.443 1.00 . A A .  10 GLU OE1  1 1 
       13  7534 1 1 10 GLU OE2  O   18.760  -7.340  -1.709 1.00 . A A .  10 GLU OE2  1 1 
       13  7535 1 1 11 LYS C    C   10.270  -6.395  -2.905 1.00 . A A .  11 LYS C    1 1 
       13  7536 1 1 11 LYS CA   C   10.959  -6.422  -1.545 1.00 . A A .  11 LYS CA   1 1 
       13  7537 1 1 11 LYS CB   C   10.345  -5.360  -0.629 1.00 . A A .  11 LYS CB   1 1 
       13  7538 1 1 11 LYS CD   C   11.605  -5.779   1.503 1.00 . A A .  11 LYS CD   1 1 
       13  7539 1 1 11 LYS CE   C   11.950  -4.394   2.030 1.00 . A A .  11 LYS CE   1 1 
       13  7540 1 1 11 LYS CG   C   10.246  -5.793   0.823 1.00 . A A .  11 LYS CG   1 1 
       13  7541 1 1 11 LYS H    H   12.711  -5.368  -2.095 1.00 . A A .  11 LYS H    1 1 
       13  7542 1 1 11 LYS HA   H   10.815  -7.395  -1.100 1.00 . A A .  11 LYS HA   1 1 
       13  7543 1 1 11 LYS HB2  H   10.950  -4.467  -0.677 1.00 . A A .  11 LYS HB2  1 1 
       13  7544 1 1 11 LYS HB3  H    9.350  -5.129  -0.983 1.00 . A A .  11 LYS HB3  1 1 
       13  7545 1 1 11 LYS HD2  H   11.591  -6.473   2.330 1.00 . A A .  11 LYS HD2  1 1 
       13  7546 1 1 11 LYS HD3  H   12.358  -6.081   0.789 1.00 . A A .  11 LYS HD3  1 1 
       13  7547 1 1 11 LYS HE2  H   13.023  -4.276   2.017 1.00 . A A .  11 LYS HE2  1 1 
       13  7548 1 1 11 LYS HE3  H   11.499  -3.655   1.384 1.00 . A A .  11 LYS HE3  1 1 
       13  7549 1 1 11 LYS HG2  H    9.586  -5.117   1.347 1.00 . A A .  11 LYS HG2  1 1 
       13  7550 1 1 11 LYS HG3  H    9.843  -6.795   0.864 1.00 . A A .  11 LYS HG3  1 1 
       13  7551 1 1 11 LYS HZ1  H   11.037  -5.070   3.783 1.00 . A A .  11 LYS HZ1  1 1 
       13  7552 1 1 11 LYS HZ2  H   10.733  -3.442   3.435 1.00 . A A .  11 LYS HZ2  1 1 
       13  7553 1 1 11 LYS HZ3  H   12.241  -3.910   4.040 1.00 . A A .  11 LYS HZ3  1 1 
       13  7554 1 1 11 LYS N    N   12.394  -6.200  -1.684 1.00 . A A .  11 LYS N    1 1 
       13  7555 1 1 11 LYS NZ   N   11.456  -4.190   3.419 1.00 . A A .  11 LYS NZ   1 1 
       13  7556 1 1 11 LYS O    O   10.476  -5.491  -3.715 1.00 . A A .  11 LYS O    1 1 
       13  7557 1 1 12 PRO C    C    7.607  -6.461  -4.560 1.00 . A A .  12 PRO C    1 1 
       13  7558 1 1 12 PRO CA   C    8.692  -7.523  -4.425 1.00 . A A .  12 PRO CA   1 1 
       13  7559 1 1 12 PRO CB   C    8.067  -8.919  -4.345 1.00 . A A .  12 PRO CB   1 1 
       13  7560 1 1 12 PRO CD   C    9.136  -8.521  -2.244 1.00 . A A .  12 PRO CD   1 1 
       13  7561 1 1 12 PRO CG   C    7.960  -9.203  -2.887 1.00 . A A .  12 PRO CG   1 1 
       13  7562 1 1 12 PRO HA   H    9.353  -7.471  -5.278 1.00 . A A .  12 PRO HA   1 1 
       13  7563 1 1 12 PRO HB2  H    7.096  -8.908  -4.819 1.00 . A A .  12 PRO HB2  1 1 
       13  7564 1 1 12 PRO HB3  H    8.708  -9.633  -4.840 1.00 . A A .  12 PRO HB3  1 1 
       13  7565 1 1 12 PRO HD2  H    8.870  -8.152  -1.265 1.00 . A A .  12 PRO HD2  1 1 
       13  7566 1 1 12 PRO HD3  H    9.975  -9.198  -2.179 1.00 . A A .  12 PRO HD3  1 1 
       13  7567 1 1 12 PRO HG2  H    7.036  -8.799  -2.501 1.00 . A A .  12 PRO HG2  1 1 
       13  7568 1 1 12 PRO HG3  H    8.006 -10.268  -2.716 1.00 . A A .  12 PRO HG3  1 1 
       13  7569 1 1 12 PRO N    N    9.430  -7.409  -3.164 1.00 . A A .  12 PRO N    1 1 
       13  7570 1 1 12 PRO O    O    7.517  -5.778  -5.580 1.00 . A A .  12 PRO O    1 1 
       13  7571 1 1 13 TYR C    C    6.256  -3.926  -3.472 1.00 . A A .  13 TYR C    1 1 
       13  7572 1 1 13 TYR CA   C    5.705  -5.347  -3.529 1.00 . A A .  13 TYR CA   1 1 
       13  7573 1 1 13 TYR CB   C    4.765  -5.589  -2.346 1.00 . A A .  13 TYR CB   1 1 
       13  7574 1 1 13 TYR CD1  C    2.910  -7.083  -3.187 1.00 . A A .  13 TYR CD1  1 1 
       13  7575 1 1 13 TYR CD2  C    4.507  -8.012  -1.681 1.00 . A A .  13 TYR CD2  1 1 
       13  7576 1 1 13 TYR CE1  C    2.250  -8.295  -3.243 1.00 . A A .  13 TYR CE1  1 1 
       13  7577 1 1 13 TYR CE2  C    3.855  -9.229  -1.733 1.00 . A A .  13 TYR CE2  1 1 
       13  7578 1 1 13 TYR CG   C    4.047  -6.919  -2.406 1.00 . A A .  13 TYR CG   1 1 
       13  7579 1 1 13 TYR CZ   C    2.727  -9.365  -2.515 1.00 . A A .  13 TYR CZ   1 1 
       13  7580 1 1 13 TYR H    H    6.908  -6.900  -2.739 1.00 . A A .  13 TYR H    1 1 
       13  7581 1 1 13 TYR HA   H    5.150  -5.470  -4.448 1.00 . A A .  13 TYR HA   1 1 
       13  7582 1 1 13 TYR HB2  H    5.335  -5.562  -1.431 1.00 . A A .  13 TYR HB2  1 1 
       13  7583 1 1 13 TYR HB3  H    4.018  -4.809  -2.324 1.00 . A A .  13 TYR HB3  1 1 
       13  7584 1 1 13 TYR HD1  H    2.539  -6.242  -3.757 1.00 . A A .  13 TYR HD1  1 1 
       13  7585 1 1 13 TYR HD2  H    5.391  -7.902  -1.070 1.00 . A A .  13 TYR HD2  1 1 
       13  7586 1 1 13 TYR HE1  H    1.367  -8.402  -3.856 1.00 . A A .  13 TYR HE1  1 1 
       13  7587 1 1 13 TYR HE2  H    4.227 -10.067  -1.162 1.00 . A A .  13 TYR HE2  1 1 
       13  7588 1 1 13 TYR HH   H    2.147 -11.017  -1.720 1.00 . A A .  13 TYR HH   1 1 
       13  7589 1 1 13 TYR N    N    6.785  -6.326  -3.525 1.00 . A A .  13 TYR N    1 1 
       13  7590 1 1 13 TYR O    O    7.183  -3.639  -2.715 1.00 . A A .  13 TYR O    1 1 
       13  7591 1 1 13 TYR OH   O    2.073 -10.575  -2.570 1.00 . A A .  13 TYR OH   1 1 
       13  7592 1 1 14 GLU C    C    4.915  -0.709  -4.414 1.00 . A A .  14 GLU C    1 1 
       13  7593 1 1 14 GLU CA   C    6.112  -1.650  -4.320 1.00 . A A .  14 GLU CA   1 1 
       13  7594 1 1 14 GLU CB   C    7.050  -1.420  -5.508 1.00 . A A .  14 GLU CB   1 1 
       13  7595 1 1 14 GLU CD   C    9.359  -2.067  -6.300 1.00 . A A .  14 GLU CD   1 1 
       13  7596 1 1 14 GLU CG   C    8.522  -1.537  -5.152 1.00 . A A .  14 GLU CG   1 1 
       13  7597 1 1 14 GLU H    H    4.945  -3.331  -4.859 1.00 . A A .  14 GLU H    1 1 
       13  7598 1 1 14 GLU HA   H    6.647  -1.442  -3.406 1.00 . A A .  14 GLU HA   1 1 
       13  7599 1 1 14 GLU HB2  H    6.826  -2.148  -6.274 1.00 . A A .  14 GLU HB2  1 1 
       13  7600 1 1 14 GLU HB3  H    6.874  -0.430  -5.903 1.00 . A A .  14 GLU HB3  1 1 
       13  7601 1 1 14 GLU HG2  H    8.892  -0.560  -4.879 1.00 . A A .  14 GLU HG2  1 1 
       13  7602 1 1 14 GLU HG3  H    8.625  -2.207  -4.311 1.00 . A A .  14 GLU HG3  1 1 
       13  7603 1 1 14 GLU N    N    5.679  -3.041  -4.278 1.00 . A A .  14 GLU N    1 1 
       13  7604 1 1 14 GLU O    O    3.951  -0.982  -5.131 1.00 . A A .  14 GLU O    1 1 
       13  7605 1 1 14 GLU OE1  O    9.243  -1.525  -7.419 1.00 . A A .  14 GLU OE1  1 1 
       13  7606 1 1 14 GLU OE2  O   10.130  -3.025  -6.080 1.00 . A A .  14 GLU OE2  1 1 
       13  7607 1 1 15 CYS C    C    3.849   2.130  -5.013 1.00 . A A .  15 CYS C    1 1 
       13  7608 1 1 15 CYS CA   C    3.904   1.382  -3.684 1.00 . A A .  15 CYS CA   1 1 
       13  7609 1 1 15 CYS CB   C    4.091   2.374  -2.535 1.00 . A A .  15 CYS CB   1 1 
       13  7610 1 1 15 CYS H    H    5.777   0.562  -3.134 1.00 . A A .  15 CYS H    1 1 
       13  7611 1 1 15 CYS HA   H    2.974   0.853  -3.544 1.00 . A A .  15 CYS HA   1 1 
       13  7612 1 1 15 CYS HB2  H    4.264   1.825  -1.621 1.00 . A A .  15 CYS HB2  1 1 
       13  7613 1 1 15 CYS HB3  H    4.948   2.997  -2.743 1.00 . A A .  15 CYS HB3  1 1 
       13  7614 1 1 15 CYS N    N    4.982   0.400  -3.685 1.00 . A A .  15 CYS N    1 1 
       13  7615 1 1 15 CYS O    O    4.863   2.635  -5.496 1.00 . A A .  15 CYS O    1 1 
       13  7616 1 1 15 CYS SG   S    2.662   3.470  -2.259 1.00 . A A .  15 CYS SG   1 1 
       13  7617 1 1 16 SER C    C    2.281   4.380  -6.663 1.00 . A A .  16 SER C    1 1 
       13  7618 1 1 16 SER CA   C    2.470   2.881  -6.873 1.00 . A A .  16 SER CA   1 1 
       13  7619 1 1 16 SER CB   C    1.263   2.302  -7.614 1.00 . A A .  16 SER CB   1 1 
       13  7620 1 1 16 SER H    H    1.887   1.775  -5.165 1.00 . A A .  16 SER H    1 1 
       13  7621 1 1 16 SER HA   H    3.357   2.722  -7.468 1.00 . A A .  16 SER HA   1 1 
       13  7622 1 1 16 SER HB2  H    1.170   1.252  -7.380 1.00 . A A .  16 SER HB2  1 1 
       13  7623 1 1 16 SER HB3  H    0.369   2.821  -7.301 1.00 . A A .  16 SER HB3  1 1 
       13  7624 1 1 16 SER HG   H    1.402   3.378  -9.245 1.00 . A A .  16 SER HG   1 1 
       13  7625 1 1 16 SER N    N    2.658   2.197  -5.599 1.00 . A A .  16 SER N    1 1 
       13  7626 1 1 16 SER O    O    2.022   5.122  -7.610 1.00 . A A .  16 SER O    1 1 
       13  7627 1 1 16 SER OG   O    1.409   2.445  -9.016 1.00 . A A .  16 SER OG   1 1 
       13  7628 1 1 17 GLU C    C    3.612   6.899  -4.900 1.00 . A A .  17 GLU C    1 1 
       13  7629 1 1 17 GLU CA   C    2.253   6.228  -5.079 1.00 . A A .  17 GLU CA   1 1 
       13  7630 1 1 17 GLU CB   C    1.424   6.381  -3.803 1.00 . A A .  17 GLU CB   1 1 
       13  7631 1 1 17 GLU CD   C   -1.010   6.568  -4.454 1.00 . A A .  17 GLU CD   1 1 
       13  7632 1 1 17 GLU CG   C    0.074   5.686  -3.866 1.00 . A A .  17 GLU CG   1 1 
       13  7633 1 1 17 GLU H    H    2.617   4.177  -4.702 1.00 . A A .  17 GLU H    1 1 
       13  7634 1 1 17 GLU HA   H    1.733   6.706  -5.895 1.00 . A A .  17 GLU HA   1 1 
       13  7635 1 1 17 GLU HB2  H    1.980   5.969  -2.974 1.00 . A A .  17 GLU HB2  1 1 
       13  7636 1 1 17 GLU HB3  H    1.255   7.433  -3.623 1.00 . A A .  17 GLU HB3  1 1 
       13  7637 1 1 17 GLU HG2  H    0.168   4.801  -4.478 1.00 . A A .  17 GLU HG2  1 1 
       13  7638 1 1 17 GLU HG3  H   -0.217   5.401  -2.866 1.00 . A A .  17 GLU HG3  1 1 
       13  7639 1 1 17 GLU N    N    2.411   4.817  -5.414 1.00 . A A .  17 GLU N    1 1 
       13  7640 1 1 17 GLU O    O    3.880   7.949  -5.487 1.00 . A A .  17 GLU O    1 1 
       13  7641 1 1 17 GLU OE1  O   -0.665   7.540  -5.159 1.00 . A A .  17 GLU OE1  1 1 
       13  7642 1 1 17 GLU OE2  O   -2.201   6.288  -4.209 1.00 . A A .  17 GLU OE2  1 1 
       13  7643 1 1 18 CYS C    C    6.873   5.907  -4.396 1.00 . A A .  18 CYS C    1 1 
       13  7644 1 1 18 CYS CA   C    5.795   6.825  -3.828 1.00 . A A .  18 CYS CA   1 1 
       13  7645 1 1 18 CYS CB   C    6.010   7.012  -2.324 1.00 . A A .  18 CYS CB   1 1 
       13  7646 1 1 18 CYS H    H    4.193   5.454  -3.647 1.00 . A A .  18 CYS H    1 1 
       13  7647 1 1 18 CYS HA   H    5.865   7.786  -4.314 1.00 . A A .  18 CYS HA   1 1 
       13  7648 1 1 18 CYS HB2  H    7.025   7.340  -2.151 1.00 . A A .  18 CYS HB2  1 1 
       13  7649 1 1 18 CYS HB3  H    5.327   7.766  -1.962 1.00 . A A .  18 CYS HB3  1 1 
       13  7650 1 1 18 CYS N    N    4.465   6.288  -4.086 1.00 . A A .  18 CYS N    1 1 
       13  7651 1 1 18 CYS O    O    7.865   6.369  -4.958 1.00 . A A .  18 CYS O    1 1 
       13  7652 1 1 18 CYS SG   S    5.743   5.501  -1.342 1.00 . A A .  18 CYS SG   1 1 
       13  7653 1 1 19 GLY C    C    8.203   2.761  -3.652 1.00 . A A .  19 GLY C    1 1 
       13  7654 1 1 19 GLY CA   C    7.632   3.638  -4.749 1.00 . A A .  19 GLY CA   1 1 
       13  7655 1 1 19 GLY H    H    5.861   4.290  -3.789 1.00 . A A .  19 GLY H    1 1 
       13  7656 1 1 19 GLY HA2  H    7.147   3.011  -5.482 1.00 . A A .  19 GLY HA2  1 1 
       13  7657 1 1 19 GLY HA3  H    8.442   4.171  -5.225 1.00 . A A .  19 GLY HA3  1 1 
       13  7658 1 1 19 GLY N    N    6.670   4.601  -4.246 1.00 . A A .  19 GLY N    1 1 
       13  7659 1 1 19 GLY O    O    9.125   1.980  -3.888 1.00 . A A .  19 GLY O    1 1 
       13  7660 1 1 20 LYS C    C    8.177   0.622  -1.662 1.00 . A A .  20 LYS C    1 1 
       13  7661 1 1 20 LYS CA   C    8.115   2.104  -1.310 1.00 . A A .  20 LYS CA   1 1 
       13  7662 1 1 20 LYS CB   C    7.188   2.316  -0.110 1.00 . A A .  20 LYS CB   1 1 
       13  7663 1 1 20 LYS CD   C    7.287   2.978   2.311 1.00 . A A .  20 LYS CD   1 1 
       13  7664 1 1 20 LYS CE   C    8.036   4.299   2.398 1.00 . A A .  20 LYS CE   1 1 
       13  7665 1 1 20 LYS CG   C    7.864   2.080   1.229 1.00 . A A .  20 LYS CG   1 1 
       13  7666 1 1 20 LYS H    H    6.923   3.531  -2.323 1.00 . A A .  20 LYS H    1 1 
       13  7667 1 1 20 LYS HA   H    9.107   2.443  -1.052 1.00 . A A .  20 LYS HA   1 1 
       13  7668 1 1 20 LYS HB2  H    6.819   3.331  -0.130 1.00 . A A .  20 LYS HB2  1 1 
       13  7669 1 1 20 LYS HB3  H    6.352   1.636  -0.192 1.00 . A A .  20 LYS HB3  1 1 
       13  7670 1 1 20 LYS HD2  H    6.250   3.180   2.084 1.00 . A A .  20 LYS HD2  1 1 
       13  7671 1 1 20 LYS HD3  H    7.357   2.471   3.263 1.00 . A A .  20 LYS HD3  1 1 
       13  7672 1 1 20 LYS HE2  H    9.086   4.113   2.235 1.00 . A A .  20 LYS HE2  1 1 
       13  7673 1 1 20 LYS HE3  H    7.663   4.960   1.629 1.00 . A A .  20 LYS HE3  1 1 
       13  7674 1 1 20 LYS HG2  H    7.721   1.050   1.518 1.00 . A A .  20 LYS HG2  1 1 
       13  7675 1 1 20 LYS HG3  H    8.921   2.286   1.130 1.00 . A A .  20 LYS HG3  1 1 
       13  7676 1 1 20 LYS HZ1  H    8.661   5.582   3.923 1.00 . A A .  20 LYS HZ1  1 1 
       13  7677 1 1 20 LYS HZ2  H    7.807   4.229   4.473 1.00 . A A .  20 LYS HZ2  1 1 
       13  7678 1 1 20 LYS HZ3  H    6.981   5.508   3.736 1.00 . A A .  20 LYS HZ3  1 1 
       13  7679 1 1 20 LYS N    N    7.655   2.891  -2.448 1.00 . A A .  20 LYS N    1 1 
       13  7680 1 1 20 LYS NZ   N    7.859   4.950   3.725 1.00 . A A .  20 LYS NZ   1 1 
       13  7681 1 1 20 LYS O    O    7.903   0.232  -2.796 1.00 . A A .  20 LYS O    1 1 
       13  7682 1 1 21 ALA C    C    8.034  -2.404   0.289 1.00 . A A .  21 ALA C    1 1 
       13  7683 1 1 21 ALA CA   C    8.632  -1.640  -0.888 1.00 . A A .  21 ALA CA   1 1 
       13  7684 1 1 21 ALA CB   C   10.082  -2.049  -1.103 1.00 . A A .  21 ALA CB   1 1 
       13  7685 1 1 21 ALA H    H    8.744   0.171   0.201 1.00 . A A .  21 ALA H    1 1 
       13  7686 1 1 21 ALA HA   H    8.078  -1.886  -1.783 1.00 . A A .  21 ALA HA   1 1 
       13  7687 1 1 21 ALA HB1  H   10.597  -1.273  -1.649 1.00 . A A .  21 ALA HB1  1 1 
       13  7688 1 1 21 ALA HB2  H   10.560  -2.193  -0.145 1.00 . A A .  21 ALA HB2  1 1 
       13  7689 1 1 21 ALA HB3  H   10.117  -2.969  -1.666 1.00 . A A .  21 ALA HB3  1 1 
       13  7690 1 1 21 ALA N    N    8.538  -0.200  -0.682 1.00 . A A .  21 ALA N    1 1 
       13  7691 1 1 21 ALA O    O    7.945  -1.881   1.400 1.00 . A A .  21 ALA O    1 1 
       13  7692 1 1 22 PHE C    C    7.266  -5.957   0.783 1.00 . A A .  22 PHE C    1 1 
       13  7693 1 1 22 PHE CA   C    7.034  -4.478   1.077 1.00 . A A .  22 PHE CA   1 1 
       13  7694 1 1 22 PHE CB   C    5.535  -4.198   1.193 1.00 . A A .  22 PHE CB   1 1 
       13  7695 1 1 22 PHE CD1  C    5.261  -1.855   0.338 1.00 . A A .  22 PHE CD1  1 1 
       13  7696 1 1 22 PHE CD2  C    4.854  -2.272   2.650 1.00 . A A .  22 PHE CD2  1 1 
       13  7697 1 1 22 PHE CE1  C    4.962  -0.519   0.522 1.00 . A A .  22 PHE CE1  1 1 
       13  7698 1 1 22 PHE CE2  C    4.554  -0.936   2.840 1.00 . A A .  22 PHE CE2  1 1 
       13  7699 1 1 22 PHE CG   C    5.210  -2.746   1.398 1.00 . A A .  22 PHE CG   1 1 
       13  7700 1 1 22 PHE CZ   C    4.609  -0.058   1.775 1.00 . A A .  22 PHE CZ   1 1 
       13  7701 1 1 22 PHE H    H    7.724  -4.004  -0.868 1.00 . A A .  22 PHE H    1 1 
       13  7702 1 1 22 PHE HA   H    7.512  -4.230   2.012 1.00 . A A .  22 PHE HA   1 1 
       13  7703 1 1 22 PHE HB2  H    5.044  -4.524   0.289 1.00 . A A .  22 PHE HB2  1 1 
       13  7704 1 1 22 PHE HB3  H    5.137  -4.750   2.032 1.00 . A A .  22 PHE HB3  1 1 
       13  7705 1 1 22 PHE HD1  H    5.537  -2.215  -0.644 1.00 . A A .  22 PHE HD1  1 1 
       13  7706 1 1 22 PHE HD2  H    4.811  -2.957   3.484 1.00 . A A .  22 PHE HD2  1 1 
       13  7707 1 1 22 PHE HE1  H    5.006   0.165  -0.313 1.00 . A A .  22 PHE HE1  1 1 
       13  7708 1 1 22 PHE HE2  H    4.278  -0.579   3.821 1.00 . A A .  22 PHE HE2  1 1 
       13  7709 1 1 22 PHE HZ   H    4.375   0.986   1.921 1.00 . A A .  22 PHE HZ   1 1 
       13  7710 1 1 22 PHE N    N    7.626  -3.643   0.038 1.00 . A A .  22 PHE N    1 1 
       13  7711 1 1 22 PHE O    O    7.636  -6.329  -0.331 1.00 . A A .  22 PHE O    1 1 
       13  7712 1 1 23 ILE C    C    5.927  -8.916   1.236 1.00 . A A .  23 ILE C    1 1 
       13  7713 1 1 23 ILE CA   C    7.230  -8.234   1.640 1.00 . A A .  23 ILE CA   1 1 
       13  7714 1 1 23 ILE CB   C    7.749  -8.874   2.941 1.00 . A A .  23 ILE CB   1 1 
       13  7715 1 1 23 ILE CD1  C    8.706  -6.958   4.316 1.00 . A A .  23 ILE CD1  1 1 
       13  7716 1 1 23 ILE CG1  C    9.004  -8.145   3.427 1.00 . A A .  23 ILE CG1  1 1 
       13  7717 1 1 23 ILE CG2  C    8.039 -10.352   2.725 1.00 . A A .  23 ILE CG2  1 1 
       13  7718 1 1 23 ILE H    H    6.752  -6.439   2.654 1.00 . A A .  23 ILE H    1 1 
       13  7719 1 1 23 ILE HA   H    7.964  -8.397   0.864 1.00 . A A .  23 ILE HA   1 1 
       13  7720 1 1 23 ILE HB   H    6.978  -8.788   3.691 1.00 . A A .  23 ILE HB   1 1 
       13  7721 1 1 23 ILE HD11 H    7.641  -6.891   4.483 1.00 . A A .  23 ILE HD11 1 1 
       13  7722 1 1 23 ILE HD12 H    9.210  -7.082   5.264 1.00 . A A .  23 ILE HD12 1 1 
       13  7723 1 1 23 ILE HD13 H    9.053  -6.054   3.839 1.00 . A A .  23 ILE HD13 1 1 
       13  7724 1 1 23 ILE HG12 H    9.617  -8.833   3.988 1.00 . A A .  23 ILE HG12 1 1 
       13  7725 1 1 23 ILE HG13 H    9.559  -7.789   2.572 1.00 . A A .  23 ILE HG13 1 1 
       13  7726 1 1 23 ILE HG21 H    7.873 -10.603   1.688 1.00 . A A .  23 ILE HG21 1 1 
       13  7727 1 1 23 ILE HG22 H    9.066 -10.559   2.985 1.00 . A A .  23 ILE HG22 1 1 
       13  7728 1 1 23 ILE HG23 H    7.383 -10.942   3.348 1.00 . A A .  23 ILE HG23 1 1 
       13  7729 1 1 23 ILE N    N    7.046  -6.796   1.790 1.00 . A A .  23 ILE N    1 1 
       13  7730 1 1 23 ILE O    O    5.922  -9.830   0.411 1.00 . A A .  23 ILE O    1 1 
       13  7731 1 1 24 ARG C    C    2.560  -7.954   1.011 1.00 . A A .  24 ARG C    1 1 
       13  7732 1 1 24 ARG CA   C    3.513  -9.030   1.523 1.00 . A A .  24 ARG CA   1 1 
       13  7733 1 1 24 ARG CB   C    2.925  -9.696   2.768 1.00 . A A .  24 ARG CB   1 1 
       13  7734 1 1 24 ARG CD   C    3.047 -11.726   4.245 1.00 . A A .  24 ARG CD   1 1 
       13  7735 1 1 24 ARG CG   C    3.831 -10.754   3.378 1.00 . A A .  24 ARG CG   1 1 
       13  7736 1 1 24 ARG CZ   C    2.223 -13.355   2.599 1.00 . A A .  24 ARG CZ   1 1 
       13  7737 1 1 24 ARG H    H    4.891  -7.733   2.471 1.00 . A A .  24 ARG H    1 1 
       13  7738 1 1 24 ARG HA   H    3.641  -9.776   0.753 1.00 . A A .  24 ARG HA   1 1 
       13  7739 1 1 24 ARG HB2  H    2.741  -8.938   3.516 1.00 . A A .  24 ARG HB2  1 1 
       13  7740 1 1 24 ARG HB3  H    1.989 -10.164   2.504 1.00 . A A .  24 ARG HB3  1 1 
       13  7741 1 1 24 ARG HD2  H    3.727 -12.467   4.637 1.00 . A A .  24 ARG HD2  1 1 
       13  7742 1 1 24 ARG HD3  H    2.601 -11.179   5.062 1.00 . A A .  24 ARG HD3  1 1 
       13  7743 1 1 24 ARG HE   H    1.067 -12.130   3.667 1.00 . A A .  24 ARG HE   1 1 
       13  7744 1 1 24 ARG HG2  H    4.311 -11.305   2.583 1.00 . A A .  24 ARG HG2  1 1 
       13  7745 1 1 24 ARG HG3  H    4.580 -10.267   3.984 1.00 . A A .  24 ARG HG3  1 1 
       13  7746 1 1 24 ARG HH11 H    4.230 -13.319   2.828 1.00 . A A .  24 ARG HH11 1 1 
       13  7747 1 1 24 ARG HH12 H    3.635 -14.463   1.670 1.00 . A A .  24 ARG HH12 1 1 
       13  7748 1 1 24 ARG HH21 H    0.272 -13.632   2.146 1.00 . A A .  24 ARG HH21 1 1 
       13  7749 1 1 24 ARG HH22 H    1.384 -14.639   1.282 1.00 . A A .  24 ARG HH22 1 1 
       13  7750 1 1 24 ARG N    N    4.823  -8.464   1.822 1.00 . A A .  24 ARG N    1 1 
       13  7751 1 1 24 ARG NE   N    1.992 -12.401   3.494 1.00 . A A .  24 ARG NE   1 1 
       13  7752 1 1 24 ARG NH1  N    3.465 -13.744   2.344 1.00 . A A .  24 ARG NH1  1 1 
       13  7753 1 1 24 ARG NH2  N    1.210 -13.922   1.956 1.00 . A A .  24 ARG NH2  1 1 
       13  7754 1 1 24 ARG O    O    2.524  -6.842   1.537 1.00 . A A .  24 ARG O    1 1 
       13  7755 1 1 25 ASN C    C    0.066  -6.615   0.487 1.00 . A A .  25 ASN C    1 1 
       13  7756 1 1 25 ASN CA   C    0.837  -7.355  -0.601 1.00 . A A .  25 ASN CA   1 1 
       13  7757 1 1 25 ASN CB   C   -0.138  -8.093  -1.521 1.00 . A A .  25 ASN CB   1 1 
       13  7758 1 1 25 ASN CG   C   -0.660  -7.210  -2.637 1.00 . A A .  25 ASN CG   1 1 
       13  7759 1 1 25 ASN H    H    1.864  -9.195  -0.394 1.00 . A A .  25 ASN H    1 1 
       13  7760 1 1 25 ASN HA   H    1.394  -6.637  -1.184 1.00 . A A .  25 ASN HA   1 1 
       13  7761 1 1 25 ASN HB2  H    0.365  -8.940  -1.964 1.00 . A A .  25 ASN HB2  1 1 
       13  7762 1 1 25 ASN HB3  H   -0.978  -8.442  -0.939 1.00 . A A .  25 ASN HB3  1 1 
       13  7763 1 1 25 ASN HD21 H   -0.847  -5.684  -1.376 1.00 . A A .  25 ASN HD21 1 1 
       13  7764 1 1 25 ASN HD22 H   -1.311  -5.369  -3.010 1.00 . A A .  25 ASN HD22 1 1 
       13  7765 1 1 25 ASN N    N    1.790  -8.293  -0.018 1.00 . A A .  25 ASN N    1 1 
       13  7766 1 1 25 ASN ND2  N   -0.971  -5.962  -2.308 1.00 . A A .  25 ASN ND2  1 1 
       13  7767 1 1 25 ASN O    O    0.100  -5.387   0.560 1.00 . A A .  25 ASN O    1 1 
       13  7768 1 1 25 ASN OD1  O   -0.783  -7.646  -3.782 1.00 . A A .  25 ASN OD1  1 1 
       13  7769 1 1 26 SER C    C   -0.635  -5.666   3.102 1.00 . A A .  26 SER C    1 1 
       13  7770 1 1 26 SER CA   C   -1.409  -6.787   2.416 1.00 . A A .  26 SER CA   1 1 
       13  7771 1 1 26 SER CB   C   -1.787  -7.862   3.437 1.00 . A A .  26 SER CB   1 1 
       13  7772 1 1 26 SER H    H   -0.614  -8.345   1.223 1.00 . A A .  26 SER H    1 1 
       13  7773 1 1 26 SER HA   H   -2.312  -6.376   1.988 1.00 . A A .  26 SER HA   1 1 
       13  7774 1 1 26 SER HB2  H   -0.899  -8.400   3.734 1.00 . A A .  26 SER HB2  1 1 
       13  7775 1 1 26 SER HB3  H   -2.229  -7.391   4.304 1.00 . A A .  26 SER HB3  1 1 
       13  7776 1 1 26 SER HG   H   -2.258  -9.579   2.621 1.00 . A A .  26 SER HG   1 1 
       13  7777 1 1 26 SER N    N   -0.627  -7.371   1.332 1.00 . A A .  26 SER N    1 1 
       13  7778 1 1 26 SER O    O   -1.208  -4.648   3.489 1.00 . A A .  26 SER O    1 1 
       13  7779 1 1 26 SER OG   O   -2.717  -8.780   2.891 1.00 . A A .  26 SER OG   1 1 
       13  7780 1 1 27 GLN C    C    1.552  -3.574   3.083 1.00 . A A .  27 GLN C    1 1 
       13  7781 1 1 27 GLN CA   C    1.525  -4.868   3.889 1.00 . A A .  27 GLN CA   1 1 
       13  7782 1 1 27 GLN CB   C    2.946  -5.413   4.050 1.00 . A A .  27 GLN CB   1 1 
       13  7783 1 1 27 GLN CD   C    3.140  -6.622   6.260 1.00 . A A .  27 GLN CD   1 1 
       13  7784 1 1 27 GLN CG   C    3.006  -6.758   4.756 1.00 . A A .  27 GLN CG   1 1 
       13  7785 1 1 27 GLN H    H    1.070  -6.694   2.920 1.00 . A A .  27 GLN H    1 1 
       13  7786 1 1 27 GLN HA   H    1.117  -4.661   4.866 1.00 . A A .  27 GLN HA   1 1 
       13  7787 1 1 27 GLN HB2  H    3.389  -5.524   3.071 1.00 . A A .  27 GLN HB2  1 1 
       13  7788 1 1 27 GLN HB3  H    3.527  -4.705   4.621 1.00 . A A .  27 GLN HB3  1 1 
       13  7789 1 1 27 GLN HE21 H    4.511  -8.061   6.292 1.00 . A A .  27 GLN HE21 1 1 
       13  7790 1 1 27 GLN HE22 H    4.118  -7.364   7.823 1.00 . A A .  27 GLN HE22 1 1 
       13  7791 1 1 27 GLN HG2  H    2.100  -7.305   4.539 1.00 . A A .  27 GLN HG2  1 1 
       13  7792 1 1 27 GLN HG3  H    3.856  -7.309   4.381 1.00 . A A .  27 GLN HG3  1 1 
       13  7793 1 1 27 GLN N    N    0.672  -5.862   3.249 1.00 . A A .  27 GLN N    1 1 
       13  7794 1 1 27 GLN NE2  N    4.010  -7.431   6.852 1.00 . A A .  27 GLN NE2  1 1 
       13  7795 1 1 27 GLN O    O    1.473  -2.480   3.643 1.00 . A A .  27 GLN O    1 1 
       13  7796 1 1 27 GLN OE1  O    2.468  -5.799   6.883 1.00 . A A .  27 GLN OE1  1 1 
       13  7797 1 1 28 LEU C    C    0.363  -1.818   0.880 1.00 . A A .  28 LEU C    1 1 
       13  7798 1 1 28 LEU CA   C    1.704  -2.545   0.882 1.00 . A A .  28 LEU CA   1 1 
       13  7799 1 1 28 LEU CB   C    2.066  -2.975  -0.540 1.00 . A A .  28 LEU CB   1 1 
       13  7800 1 1 28 LEU CD1  C    2.441  -0.665  -1.437 1.00 . A A .  28 LEU CD1  1 1 
       13  7801 1 1 28 LEU CD2  C    2.057  -2.568  -3.014 1.00 . A A .  28 LEU CD2  1 1 
       13  7802 1 1 28 LEU CG   C    1.715  -1.984  -1.651 1.00 . A A .  28 LEU CG   1 1 
       13  7803 1 1 28 LEU H    H    1.725  -4.602   1.378 1.00 . A A .  28 LEU H    1 1 
       13  7804 1 1 28 LEU HA   H    2.464  -1.873   1.251 1.00 . A A .  28 LEU HA   1 1 
       13  7805 1 1 28 LEU HB2  H    3.131  -3.145  -0.573 1.00 . A A .  28 LEU HB2  1 1 
       13  7806 1 1 28 LEU HB3  H    1.548  -3.901  -0.747 1.00 . A A .  28 LEU HB3  1 1 
       13  7807 1 1 28 LEU HD11 H    2.614  -0.516  -0.382 1.00 . A A .  28 LEU HD11 1 1 
       13  7808 1 1 28 LEU HD12 H    1.837   0.145  -1.820 1.00 . A A .  28 LEU HD12 1 1 
       13  7809 1 1 28 LEU HD13 H    3.386  -0.685  -1.959 1.00 . A A .  28 LEU HD13 1 1 
       13  7810 1 1 28 LEU HD21 H    1.146  -2.821  -3.535 1.00 . A A .  28 LEU HD21 1 1 
       13  7811 1 1 28 LEU HD22 H    2.657  -3.456  -2.884 1.00 . A A .  28 LEU HD22 1 1 
       13  7812 1 1 28 LEU HD23 H    2.610  -1.840  -3.589 1.00 . A A .  28 LEU HD23 1 1 
       13  7813 1 1 28 LEU HG   H    0.652  -1.787  -1.627 1.00 . A A .  28 LEU HG   1 1 
       13  7814 1 1 28 LEU N    N    1.666  -3.705   1.766 1.00 . A A .  28 LEU N    1 1 
       13  7815 1 1 28 LEU O    O    0.298  -0.616   1.139 1.00 . A A .  28 LEU O    1 1 
       13  7816 1 1 29 ILE C    C   -2.273  -1.056   1.748 1.00 . A A .  29 ILE C    1 1 
       13  7817 1 1 29 ILE CA   C   -2.043  -1.980   0.557 1.00 . A A .  29 ILE CA   1 1 
       13  7818 1 1 29 ILE CB   C   -3.125  -3.076   0.555 1.00 . A A .  29 ILE CB   1 1 
       13  7819 1 1 29 ILE CD1  C   -3.719  -5.287  -0.558 1.00 . A A .  29 ILE CD1  1 1 
       13  7820 1 1 29 ILE CG1  C   -2.962  -3.982  -0.668 1.00 . A A .  29 ILE CG1  1 1 
       13  7821 1 1 29 ILE CG2  C   -4.512  -2.450   0.576 1.00 . A A .  29 ILE CG2  1 1 
       13  7822 1 1 29 ILE H    H   -0.587  -3.507   0.392 1.00 . A A .  29 ILE H    1 1 
       13  7823 1 1 29 ILE HA   H   -2.137  -1.407  -0.353 1.00 . A A .  29 ILE HA   1 1 
       13  7824 1 1 29 ILE HB   H   -3.010  -3.667   1.450 1.00 . A A .  29 ILE HB   1 1 
       13  7825 1 1 29 ILE HD11 H   -3.018  -6.110  -0.556 1.00 . A A .  29 ILE HD11 1 1 
       13  7826 1 1 29 ILE HD12 H   -4.287  -5.298   0.361 1.00 . A A .  29 ILE HD12 1 1 
       13  7827 1 1 29 ILE HD13 H   -4.389  -5.387  -1.398 1.00 . A A .  29 ILE HD13 1 1 
       13  7828 1 1 29 ILE HG12 H   -3.322  -3.463  -1.543 1.00 . A A .  29 ILE HG12 1 1 
       13  7829 1 1 29 ILE HG13 H   -1.915  -4.214  -0.797 1.00 . A A .  29 ILE HG13 1 1 
       13  7830 1 1 29 ILE HG21 H   -4.586  -1.767   1.409 1.00 . A A .  29 ILE HG21 1 1 
       13  7831 1 1 29 ILE HG22 H   -4.678  -1.912  -0.345 1.00 . A A .  29 ILE HG22 1 1 
       13  7832 1 1 29 ILE HG23 H   -5.256  -3.226   0.680 1.00 . A A .  29 ILE HG23 1 1 
       13  7833 1 1 29 ILE N    N   -0.704  -2.555   0.589 1.00 . A A .  29 ILE N    1 1 
       13  7834 1 1 29 ILE O    O   -2.743   0.071   1.592 1.00 . A A .  29 ILE O    1 1 
       13  7835 1 1 30 VAL C    C   -1.404   0.591   4.045 1.00 . A A .  30 VAL C    1 1 
       13  7836 1 1 30 VAL CA   C   -2.105  -0.758   4.158 1.00 . A A .  30 VAL CA   1 1 
       13  7837 1 1 30 VAL CB   C   -1.556  -1.507   5.387 1.00 . A A .  30 VAL CB   1 1 
       13  7838 1 1 30 VAL CG1  C   -1.664  -0.642   6.633 1.00 . A A .  30 VAL CG1  1 1 
       13  7839 1 1 30 VAL CG2  C   -2.289  -2.826   5.578 1.00 . A A .  30 VAL CG2  1 1 
       13  7840 1 1 30 VAL H    H   -1.568  -2.446   3.001 1.00 . A A .  30 VAL H    1 1 
       13  7841 1 1 30 VAL HA   H   -3.162  -0.593   4.307 1.00 . A A .  30 VAL HA   1 1 
       13  7842 1 1 30 VAL HB   H   -0.511  -1.722   5.215 1.00 . A A .  30 VAL HB   1 1 
       13  7843 1 1 30 VAL HG11 H   -2.560  -0.041   6.577 1.00 . A A .  30 VAL HG11 1 1 
       13  7844 1 1 30 VAL HG12 H   -1.707  -1.274   7.508 1.00 . A A .  30 VAL HG12 1 1 
       13  7845 1 1 30 VAL HG13 H   -0.802   0.005   6.698 1.00 . A A .  30 VAL HG13 1 1 
       13  7846 1 1 30 VAL HG21 H   -1.609  -3.646   5.403 1.00 . A A .  30 VAL HG21 1 1 
       13  7847 1 1 30 VAL HG22 H   -2.670  -2.882   6.587 1.00 . A A .  30 VAL HG22 1 1 
       13  7848 1 1 30 VAL HG23 H   -3.112  -2.885   4.880 1.00 . A A .  30 VAL HG23 1 1 
       13  7849 1 1 30 VAL N    N   -1.937  -1.541   2.940 1.00 . A A .  30 VAL N    1 1 
       13  7850 1 1 30 VAL O    O   -1.896   1.603   4.547 1.00 . A A .  30 VAL O    1 1 
       13  7851 1 1 31 HIS C    C   -0.099   2.698   2.110 1.00 . A A .  31 HIS C    1 1 
       13  7852 1 1 31 HIS CA   C    0.517   1.827   3.201 1.00 . A A .  31 HIS CA   1 1 
       13  7853 1 1 31 HIS CB   C    1.967   1.497   2.849 1.00 . A A .  31 HIS CB   1 1 
       13  7854 1 1 31 HIS CD2  C    3.144   3.123   1.206 1.00 . A A .  31 HIS CD2  1 1 
       13  7855 1 1 31 HIS CE1  C    3.942   4.541   2.676 1.00 . A A .  31 HIS CE1  1 1 
       13  7856 1 1 31 HIS CG   C    2.769   2.692   2.433 1.00 . A A .  31 HIS CG   1 1 
       13  7857 1 1 31 HIS H    H    0.088  -0.238   3.005 1.00 . A A .  31 HIS H    1 1 
       13  7858 1 1 31 HIS HA   H    0.496   2.371   4.133 1.00 . A A .  31 HIS HA   1 1 
       13  7859 1 1 31 HIS HB2  H    2.449   1.058   3.710 1.00 . A A .  31 HIS HB2  1 1 
       13  7860 1 1 31 HIS HB3  H    1.981   0.787   2.034 1.00 . A A .  31 HIS HB3  1 1 
       13  7861 1 1 31 HIS HD1  H    3.184   3.564   4.305 1.00 . A A .  31 HIS HD1  1 1 
       13  7862 1 1 31 HIS HD2  H    2.915   2.650   0.261 1.00 . A A .  31 HIS HD2  1 1 
       13  7863 1 1 31 HIS HE1  H    4.450   5.385   3.119 1.00 . A A .  31 HIS HE1  1 1 
       13  7864 1 1 31 HIS N    N   -0.252   0.600   3.382 1.00 . A A .  31 HIS N    1 1 
       13  7865 1 1 31 HIS ND1  N    3.285   3.601   3.332 1.00 . A A .  31 HIS ND1  1 1 
       13  7866 1 1 31 HIS NE2  N    3.872   4.274   1.384 1.00 . A A .  31 HIS NE2  1 1 
       13  7867 1 1 31 HIS O    O    0.152   3.901   2.049 1.00 . A A .  31 HIS O    1 1 
       13  7868 1 1 32 GLN C    C   -2.846   3.458   0.638 1.00 . A A .  32 GLN C    1 1 
       13  7869 1 1 32 GLN CA   C   -1.554   2.801   0.162 1.00 . A A .  32 GLN CA   1 1 
       13  7870 1 1 32 GLN CB   C   -1.849   1.852  -1.000 1.00 . A A .  32 GLN CB   1 1 
       13  7871 1 1 32 GLN CD   C   -0.903   0.554  -2.951 1.00 . A A .  32 GLN CD   1 1 
       13  7872 1 1 32 GLN CG   C   -0.599   1.301  -1.667 1.00 . A A .  32 GLN CG   1 1 
       13  7873 1 1 32 GLN H    H   -1.066   1.121   1.352 1.00 . A A .  32 GLN H    1 1 
       13  7874 1 1 32 GLN HA   H   -0.877   3.571  -0.176 1.00 . A A .  32 GLN HA   1 1 
       13  7875 1 1 32 GLN HB2  H   -2.431   1.021  -0.632 1.00 . A A .  32 GLN HB2  1 1 
       13  7876 1 1 32 GLN HB3  H   -2.424   2.382  -1.745 1.00 . A A .  32 GLN HB3  1 1 
       13  7877 1 1 32 GLN HE21 H    0.066   1.929  -4.010 1.00 . A A .  32 GLN HE21 1 1 
       13  7878 1 1 32 GLN HE22 H   -0.622   0.630  -4.917 1.00 . A A .  32 GLN HE22 1 1 
       13  7879 1 1 32 GLN HG2  H    0.064   2.122  -1.896 1.00 . A A .  32 GLN HG2  1 1 
       13  7880 1 1 32 GLN HG3  H   -0.109   0.625  -0.982 1.00 . A A .  32 GLN HG3  1 1 
       13  7881 1 1 32 GLN N    N   -0.905   2.081   1.252 1.00 . A A .  32 GLN N    1 1 
       13  7882 1 1 32 GLN NE2  N   -0.441   1.092  -4.073 1.00 . A A .  32 GLN NE2  1 1 
       13  7883 1 1 32 GLN O    O   -3.290   4.458   0.074 1.00 . A A .  32 GLN O    1 1 
       13  7884 1 1 32 GLN OE1  O   -1.547  -0.495  -2.934 1.00 . A A .  32 GLN OE1  1 1 
       13  7885 1 1 33 ARG C    C   -4.573   4.918   2.485 1.00 . A A .  33 ARG C    1 1 
       13  7886 1 1 33 ARG CA   C   -4.687   3.418   2.229 1.00 . A A .  33 ARG CA   1 1 
       13  7887 1 1 33 ARG CB   C   -5.043   2.694   3.529 1.00 . A A .  33 ARG CB   1 1 
       13  7888 1 1 33 ARG CD   C   -6.237   0.715   4.519 1.00 . A A .  33 ARG CD   1 1 
       13  7889 1 1 33 ARG CG   C   -5.456   1.245   3.326 1.00 . A A .  33 ARG CG   1 1 
       13  7890 1 1 33 ARG CZ   C   -7.898  -0.718   3.410 1.00 . A A .  33 ARG CZ   1 1 
       13  7891 1 1 33 ARG H    H   -3.043   2.093   2.086 1.00 . A A .  33 ARG H    1 1 
       13  7892 1 1 33 ARG HA   H   -5.470   3.246   1.506 1.00 . A A .  33 ARG HA   1 1 
       13  7893 1 1 33 ARG HB2  H   -4.185   2.711   4.184 1.00 . A A .  33 ARG HB2  1 1 
       13  7894 1 1 33 ARG HB3  H   -5.860   3.215   4.005 1.00 . A A .  33 ARG HB3  1 1 
       13  7895 1 1 33 ARG HD2  H   -5.559   0.597   5.351 1.00 . A A .  33 ARG HD2  1 1 
       13  7896 1 1 33 ARG HD3  H   -7.002   1.432   4.777 1.00 . A A .  33 ARG HD3  1 1 
       13  7897 1 1 33 ARG HE   H   -6.501  -1.364   4.678 1.00 . A A .  33 ARG HE   1 1 
       13  7898 1 1 33 ARG HG2  H   -6.078   1.178   2.445 1.00 . A A .  33 ARG HG2  1 1 
       13  7899 1 1 33 ARG HG3  H   -4.570   0.643   3.190 1.00 . A A .  33 ARG HG3  1 1 
       13  7900 1 1 33 ARG HH11 H   -8.024   1.245   2.947 1.00 . A A .  33 ARG HH11 1 1 
       13  7901 1 1 33 ARG HH12 H   -9.190   0.224   2.172 1.00 . A A .  33 ARG HH12 1 1 
       13  7902 1 1 33 ARG HH21 H   -8.031  -2.718   3.664 1.00 . A A .  33 ARG HH21 1 1 
       13  7903 1 1 33 ARG HH22 H   -9.193  -2.030   2.582 1.00 . A A .  33 ARG HH22 1 1 
       13  7904 1 1 33 ARG N    N   -3.445   2.888   1.679 1.00 . A A .  33 ARG N    1 1 
       13  7905 1 1 33 ARG NE   N   -6.866  -0.571   4.233 1.00 . A A .  33 ARG NE   1 1 
       13  7906 1 1 33 ARG NH1  N   -8.413   0.337   2.793 1.00 . A A .  33 ARG NH1  1 1 
       13  7907 1 1 33 ARG NH2  N   -8.417  -1.921   3.201 1.00 . A A .  33 ARG NH2  1 1 
       13  7908 1 1 33 ARG O    O   -5.493   5.681   2.190 1.00 . A A .  33 ARG O    1 1 
       13  7909 1 1 34 THR C    C   -3.046   7.555   2.053 1.00 . A A .  34 THR C    1 1 
       13  7910 1 1 34 THR CA   C   -3.202   6.741   3.333 1.00 . A A .  34 THR CA   1 1 
       13  7911 1 1 34 THR CB   C   -1.946   6.930   4.204 1.00 . A A .  34 THR CB   1 1 
       13  7912 1 1 34 THR CG2  C   -0.693   6.532   3.439 1.00 . A A .  34 THR CG2  1 1 
       13  7913 1 1 34 THR H    H   -2.741   4.678   3.247 1.00 . A A .  34 THR H    1 1 
       13  7914 1 1 34 THR HA   H   -4.055   7.113   3.882 1.00 . A A .  34 THR HA   1 1 
       13  7915 1 1 34 THR HB   H   -2.034   6.298   5.076 1.00 . A A .  34 THR HB   1 1 
       13  7916 1 1 34 THR HG1  H   -2.219   8.867   3.951 1.00 . A A .  34 THR HG1  1 1 
       13  7917 1 1 34 THR HG21 H   -0.382   7.351   2.808 1.00 . A A .  34 THR HG21 1 1 
       13  7918 1 1 34 THR HG22 H   -0.903   5.667   2.829 1.00 . A A .  34 THR HG22 1 1 
       13  7919 1 1 34 THR HG23 H    0.096   6.297   4.139 1.00 . A A .  34 THR HG23 1 1 
       13  7920 1 1 34 THR N    N   -3.437   5.334   3.036 1.00 . A A .  34 THR N    1 1 
       13  7921 1 1 34 THR O    O   -3.481   8.705   1.979 1.00 . A A .  34 THR O    1 1 
       13  7922 1 1 34 THR OG1  O   -1.842   8.295   4.624 1.00 . A A .  34 THR OG1  1 1 
       13  7923 1 1 35 HIS C    C   -3.541   7.899  -0.927 1.00 . A A .  35 HIS C    1 1 
       13  7924 1 1 35 HIS CA   C   -2.211   7.620  -0.233 1.00 . A A .  35 HIS CA   1 1 
       13  7925 1 1 35 HIS CB   C   -1.320   6.768  -1.137 1.00 . A A .  35 HIS CB   1 1 
       13  7926 1 1 35 HIS CD2  C    1.131   6.300  -0.429 1.00 . A A .  35 HIS CD2  1 1 
       13  7927 1 1 35 HIS CE1  C    2.027   8.181  -1.113 1.00 . A A .  35 HIS CE1  1 1 
       13  7928 1 1 35 HIS CG   C    0.143   7.048  -0.972 1.00 . A A .  35 HIS CG   1 1 
       13  7929 1 1 35 HIS H    H   -2.099   6.034   1.165 1.00 . A A .  35 HIS H    1 1 
       13  7930 1 1 35 HIS HA   H   -1.717   8.560  -0.038 1.00 . A A .  35 HIS HA   1 1 
       13  7931 1 1 35 HIS HB2  H   -1.484   5.724  -0.913 1.00 . A A .  35 HIS HB2  1 1 
       13  7932 1 1 35 HIS HB3  H   -1.580   6.955  -2.168 1.00 . A A .  35 HIS HB3  1 1 
       13  7933 1 1 35 HIS HD1  H    0.279   8.969  -1.826 1.00 . A A .  35 HIS HD1  1 1 
       13  7934 1 1 35 HIS HD2  H    1.028   5.314   0.003 1.00 . A A .  35 HIS HD2  1 1 
       13  7935 1 1 35 HIS HE1  H    2.744   8.959  -1.326 1.00 . A A .  35 HIS HE1  1 1 
       13  7936 1 1 35 HIS N    N   -2.423   6.951   1.046 1.00 . A A .  35 HIS N    1 1 
       13  7937 1 1 35 HIS ND1  N    0.736   8.220  -1.390 1.00 . A A .  35 HIS ND1  1 1 
       13  7938 1 1 35 HIS NE2  N    2.293   7.026  -0.529 1.00 . A A .  35 HIS NE2  1 1 
       13  7939 1 1 35 HIS O    O   -3.703   8.924  -1.590 1.00 . A A .  35 HIS O    1 1 
       13  7940 1 1 36 SER C    C   -6.694   8.044  -0.556 1.00 . A A .  36 SER C    1 1 
       13  7941 1 1 36 SER CA   C   -5.802   7.126  -1.387 1.00 . A A .  36 SER CA   1 1 
       13  7942 1 1 36 SER CB   C   -6.468   5.758  -1.548 1.00 . A A .  36 SER CB   1 1 
       13  7943 1 1 36 SER H    H   -4.298   6.185  -0.231 1.00 . A A .  36 SER H    1 1 
       13  7944 1 1 36 SER HA   H   -5.664   7.566  -2.364 1.00 . A A .  36 SER HA   1 1 
       13  7945 1 1 36 SER HB2  H   -7.358   5.861  -2.150 1.00 . A A .  36 SER HB2  1 1 
       13  7946 1 1 36 SER HB3  H   -5.781   5.081  -2.034 1.00 . A A .  36 SER HB3  1 1 
       13  7947 1 1 36 SER HG   H   -7.597   4.649  -0.392 1.00 . A A .  36 SER HG   1 1 
       13  7948 1 1 36 SER N    N   -4.488   6.981  -0.772 1.00 . A A .  36 SER N    1 1 
       13  7949 1 1 36 SER O    O   -7.864   7.746  -0.322 1.00 . A A .  36 SER O    1 1 
       13  7950 1 1 36 SER OG   O   -6.829   5.216  -0.289 1.00 . A A .  36 SER OG   1 1 
       13  7951 1 1 37 GLY C    C   -7.171  11.398  -0.052 1.00 . A A .  37 GLY C    1 1 
       13  7952 1 1 37 GLY CA   C   -6.886  10.107   0.689 1.00 . A A .  37 GLY CA   1 1 
       13  7953 1 1 37 GLY H    H   -5.192   9.348  -0.329 1.00 . A A .  37 GLY H    1 1 
       13  7954 1 1 37 GLY HA2  H   -7.823   9.652   0.973 1.00 . A A .  37 GLY HA2  1 1 
       13  7955 1 1 37 GLY HA3  H   -6.323  10.336   1.583 1.00 . A A .  37 GLY HA3  1 1 
       13  7956 1 1 37 GLY N    N   -6.129   9.162  -0.111 1.00 . A A .  37 GLY N    1 1 
       13  7957 1 1 37 GLY O    O   -8.302  11.883  -0.055 1.00 . A A .  37 GLY O    1 1 
       13  7958 1 1 38 GLU C    C   -6.154  12.955  -2.929 1.00 . A A .  38 GLU C    1 1 
       13  7959 1 1 38 GLU CA   C   -6.289  13.201  -1.429 1.00 . A A .  38 GLU CA   1 1 
       13  7960 1 1 38 GLU CB   C   -5.243  14.221  -0.973 1.00 . A A .  38 GLU CB   1 1 
       13  7961 1 1 38 GLU CD   C   -5.410  14.323   1.546 1.00 . A A .  38 GLU CD   1 1 
       13  7962 1 1 38 GLU CG   C   -5.675  15.037   0.234 1.00 . A A .  38 GLU CG   1 1 
       13  7963 1 1 38 GLU H    H   -5.265  11.522  -0.644 1.00 . A A .  38 GLU H    1 1 
       13  7964 1 1 38 GLU HA   H   -7.274  13.594  -1.227 1.00 . A A .  38 GLU HA   1 1 
       13  7965 1 1 38 GLU HB2  H   -4.333  13.698  -0.721 1.00 . A A .  38 GLU HB2  1 1 
       13  7966 1 1 38 GLU HB3  H   -5.043  14.901  -1.787 1.00 . A A .  38 GLU HB3  1 1 
       13  7967 1 1 38 GLU HG2  H   -5.133  15.971   0.234 1.00 . A A .  38 GLU HG2  1 1 
       13  7968 1 1 38 GLU HG3  H   -6.734  15.237   0.157 1.00 . A A .  38 GLU HG3  1 1 
       13  7969 1 1 38 GLU N    N   -6.142  11.957  -0.682 1.00 . A A .  38 GLU N    1 1 
       13  7970 1 1 38 GLU O    O   -5.235  12.270  -3.376 1.00 . A A .  38 GLU O    1 1 
       13  7971 1 1 38 GLU OE1  O   -4.344  13.686   1.670 1.00 . A A .  38 GLU OE1  1 1 
       13  7972 1 1 38 GLU OE2  O   -6.270  14.404   2.448 1.00 . A A .  38 GLU OE2  1 1 
       13  7973 1 1 39 SER C    C   -7.095  14.712  -5.847 1.00 . A A .  39 SER C    1 1 
       13  7974 1 1 39 SER CA   C   -7.068  13.356  -5.149 1.00 . A A .  39 SER CA   1 1 
       13  7975 1 1 39 SER CB   C   -8.263  12.514  -5.599 1.00 . A A .  39 SER CB   1 1 
       13  7976 1 1 39 SER H    H   -7.788  14.052  -3.283 1.00 . A A .  39 SER H    1 1 
       13  7977 1 1 39 SER HA   H   -6.156  12.844  -5.418 1.00 . A A .  39 SER HA   1 1 
       13  7978 1 1 39 SER HB2  H   -8.147  11.505  -5.235 1.00 . A A .  39 SER HB2  1 1 
       13  7979 1 1 39 SER HB3  H   -9.171  12.940  -5.197 1.00 . A A .  39 SER HB3  1 1 
       13  7980 1 1 39 SER HG   H   -9.115  11.946  -7.269 1.00 . A A .  39 SER HG   1 1 
       13  7981 1 1 39 SER N    N   -7.079  13.518  -3.700 1.00 . A A .  39 SER N    1 1 
       13  7982 1 1 39 SER O    O   -8.080  15.444  -5.768 1.00 . A A .  39 SER O    1 1 
       13  7983 1 1 39 SER OG   O   -8.361  12.482  -7.012 1.00 . A A .  39 SER OG   1 1 
       13  7984 1 1 40 GLY C    C   -4.572  16.979  -7.063 1.00 . A A .  40 GLY C    1 1 
       13  7985 1 1 40 GLY CA   C   -5.920  16.309  -7.233 1.00 . A A .  40 GLY CA   1 1 
       13  7986 1 1 40 GLY H    H   -5.247  14.418  -6.558 1.00 . A A .  40 GLY H    1 1 
       13  7987 1 1 40 GLY HA2  H   -6.095  16.137  -8.284 1.00 . A A .  40 GLY HA2  1 1 
       13  7988 1 1 40 GLY HA3  H   -6.687  16.968  -6.853 1.00 . A A .  40 GLY HA3  1 1 
       13  7989 1 1 40 GLY N    N   -6.003  15.041  -6.531 1.00 . A A .  40 GLY N    1 1 
       13  7990 1 1 40 GLY O    O   -4.426  17.947  -6.316 1.00 . A A .  40 GLY O    1 1 
       13  7991 1 1 41 PRO C    C   -2.081  18.367  -8.368 1.00 . A A .  41 PRO C    1 1 
       13  7992 1 1 41 PRO CA   C   -2.193  16.998  -7.705 1.00 . A A .  41 PRO CA   1 1 
       13  7993 1 1 41 PRO CB   C   -1.367  15.963  -8.473 1.00 . A A .  41 PRO CB   1 1 
       13  7994 1 1 41 PRO CD   C   -3.657  15.306  -8.676 1.00 . A A .  41 PRO CD   1 1 
       13  7995 1 1 41 PRO CG   C   -2.338  15.315  -9.399 1.00 . A A .  41 PRO CG   1 1 
       13  7996 1 1 41 PRO HA   H   -1.837  17.062  -6.688 1.00 . A A .  41 PRO HA   1 1 
       13  7997 1 1 41 PRO HB2  H   -0.575  16.461  -9.015 1.00 . A A .  41 PRO HB2  1 1 
       13  7998 1 1 41 PRO HB3  H   -0.945  15.249  -7.782 1.00 . A A .  41 PRO HB3  1 1 
       13  7999 1 1 41 PRO HD2  H   -4.471  15.436  -9.374 1.00 . A A .  41 PRO HD2  1 1 
       13  8000 1 1 41 PRO HD3  H   -3.777  14.388  -8.121 1.00 . A A .  41 PRO HD3  1 1 
       13  8001 1 1 41 PRO HG2  H   -2.414  15.888 -10.311 1.00 . A A .  41 PRO HG2  1 1 
       13  8002 1 1 41 PRO HG3  H   -2.022  14.305  -9.614 1.00 . A A .  41 PRO HG3  1 1 
       13  8003 1 1 41 PRO N    N   -3.555  16.459  -7.767 1.00 . A A .  41 PRO N    1 1 
       13  8004 1 1 41 PRO O    O   -1.026  19.000  -8.332 1.00 . A A .  41 PRO O    1 1 
       13  8005 1 1 42 SER C    C   -4.356  20.967  -9.141 1.00 . A A .  42 SER C    1 1 
       13  8006 1 1 42 SER CA   C   -3.198  20.111  -9.646 1.00 . A A .  42 SER CA   1 1 
       13  8007 1 1 42 SER CB   C   -3.314  19.919 -11.160 1.00 . A A .  42 SER CB   1 1 
       13  8008 1 1 42 SER H    H   -3.986  18.267  -8.967 1.00 . A A .  42 SER H    1 1 
       13  8009 1 1 42 SER HA   H   -2.270  20.617  -9.426 1.00 . A A .  42 SER HA   1 1 
       13  8010 1 1 42 SER HB2  H   -3.963  19.082 -11.365 1.00 . A A .  42 SER HB2  1 1 
       13  8011 1 1 42 SER HB3  H   -3.728  20.814 -11.603 1.00 . A A .  42 SER HB3  1 1 
       13  8012 1 1 42 SER HG   H   -2.011  20.060 -12.616 1.00 . A A .  42 SER HG   1 1 
       13  8013 1 1 42 SER N    N   -3.175  18.818  -8.972 1.00 . A A .  42 SER N    1 1 
       13  8014 1 1 42 SER O    O   -5.406  21.049  -9.778 1.00 . A A .  42 SER O    1 1 
       13  8015 1 1 42 SER OG   O   -2.046  19.668 -11.740 1.00 . A A .  42 SER OG   1 1 
       13  8016 1 1 43 SER C    C   -4.651  23.159  -6.155 1.00 . A A .  43 SER C    1 1 
       13  8017 1 1 43 SER CA   C   -5.183  22.449  -7.396 1.00 . A A .  43 SER CA   1 1 
       13  8018 1 1 43 SER CB   C   -6.413  21.615  -7.032 1.00 . A A .  43 SER CB   1 1 
       13  8019 1 1 43 SER H    H   -3.297  21.496  -7.530 1.00 . A A .  43 SER H    1 1 
       13  8020 1 1 43 SER HA   H   -5.466  23.190  -8.128 1.00 . A A .  43 SER HA   1 1 
       13  8021 1 1 43 SER HB2  H   -7.159  22.254  -6.584 1.00 . A A .  43 SER HB2  1 1 
       13  8022 1 1 43 SER HB3  H   -6.816  21.163  -7.927 1.00 . A A .  43 SER HB3  1 1 
       13  8023 1 1 43 SER HG   H   -6.044  20.954  -5.225 1.00 . A A .  43 SER HG   1 1 
       13  8024 1 1 43 SER N    N   -4.156  21.602  -7.991 1.00 . A A .  43 SER N    1 1 
       13  8025 1 1 43 SER O    O   -4.332  22.524  -5.151 1.00 . A A .  43 SER O    1 1 
       13  8026 1 1 43 SER OG   O   -6.080  20.589  -6.112 1.00 . A A .  43 SER OG   1 1 
       13  8027 1 1 44 GLY C    C   -2.550  25.269  -5.035 1.00 . A A .  44 GLY C    1 1 
       13  8028 1 1 44 GLY CA   C   -4.064  25.260  -5.111 1.00 . A A .  44 GLY CA   1 1 
       13  8029 1 1 44 GLY H    H   -4.827  24.937  -7.060 1.00 . A A .  44 GLY H    1 1 
       13  8030 1 1 44 GLY HA2  H   -4.415  26.276  -5.208 1.00 . A A .  44 GLY HA2  1 1 
       13  8031 1 1 44 GLY HA3  H   -4.456  24.839  -4.197 1.00 . A A .  44 GLY HA3  1 1 
       13  8032 1 1 44 GLY N    N   -4.558  24.483  -6.234 1.00 . A A .  44 GLY N    1 1 
       13  8033 1 1 44 GLY O    O   -1.960  26.346  -4.960 1.00 . A A .  44 GLY O    1 1 
       13  8034 2 2  1 ZN  ZN   ZN   3.521   5.066  -0.795 1.00 . B A . 201 ZN  ZN   1 1 
       14  8035 1 1  1 GLY C    C   24.658  14.432   2.487 1.00 . A A .   1 GLY C    1 1 
       14  8036 1 1  1 GLY CA   C   25.105  15.400   3.564 1.00 . A A .   1 GLY CA   1 1 
       14  8037 1 1  1 GLY H1   H   23.423  16.444   4.315 1.00 . A A .   1 GLY H1   1 1 
       14  8038 1 1  1 GLY HA2  H   26.084  15.778   3.310 1.00 . A A .   1 GLY HA2  1 1 
       14  8039 1 1  1 GLY HA3  H   25.166  14.871   4.504 1.00 . A A .   1 GLY HA3  1 1 
       14  8040 1 1  1 GLY N    N   24.195  16.520   3.716 1.00 . A A .   1 GLY N    1 1 
       14  8041 1 1  1 GLY O    O   24.573  14.794   1.313 1.00 . A A .   1 GLY O    1 1 
       14  8042 1 1  2 SER C    C   22.574  11.613   2.340 1.00 . A A .   2 SER C    1 1 
       14  8043 1 1  2 SER CA   C   23.938  12.171   1.944 1.00 . A A .   2 SER CA   1 1 
       14  8044 1 1  2 SER CB   C   24.965  11.039   1.879 1.00 . A A .   2 SER CB   1 1 
       14  8045 1 1  2 SER H    H   24.460  12.968   3.835 1.00 . A A .   2 SER H    1 1 
       14  8046 1 1  2 SER HA   H   23.857  12.628   0.969 1.00 . A A .   2 SER HA   1 1 
       14  8047 1 1  2 SER HB2  H   24.627  10.289   1.180 1.00 . A A .   2 SER HB2  1 1 
       14  8048 1 1  2 SER HB3  H   25.914  11.437   1.549 1.00 . A A .   2 SER HB3  1 1 
       14  8049 1 1  2 SER HG   H   25.728  10.974   3.682 1.00 . A A .   2 SER HG   1 1 
       14  8050 1 1  2 SER N    N   24.373  13.196   2.885 1.00 . A A .   2 SER N    1 1 
       14  8051 1 1  2 SER O    O   22.044  11.936   3.403 1.00 . A A .   2 SER O    1 1 
       14  8052 1 1  2 SER OG   O   25.139  10.435   3.149 1.00 . A A .   2 SER OG   1 1 
       14  8053 1 1  3 SER C    C   20.789   8.650   1.671 1.00 . A A .   3 SER C    1 1 
       14  8054 1 1  3 SER CA   C   20.708  10.172   1.734 1.00 . A A .   3 SER CA   1 1 
       14  8055 1 1  3 SER CB   C   19.680  10.682   0.722 1.00 . A A .   3 SER CB   1 1 
       14  8056 1 1  3 SER H    H   22.484  10.554   0.647 1.00 . A A .   3 SER H    1 1 
       14  8057 1 1  3 SER HA   H   20.398  10.464   2.727 1.00 . A A .   3 SER HA   1 1 
       14  8058 1 1  3 SER HB2  H   18.759  10.131   0.841 1.00 . A A .   3 SER HB2  1 1 
       14  8059 1 1  3 SER HB3  H   19.497  11.732   0.897 1.00 . A A .   3 SER HB3  1 1 
       14  8060 1 1  3 SER HG   H   21.087  10.696  -0.641 1.00 . A A .   3 SER HG   1 1 
       14  8061 1 1  3 SER N    N   22.012  10.773   1.477 1.00 . A A .   3 SER N    1 1 
       14  8062 1 1  3 SER O    O   21.619   8.091   0.955 1.00 . A A .   3 SER O    1 1 
       14  8063 1 1  3 SER OG   O   20.145  10.514  -0.606 1.00 . A A .   3 SER OG   1 1 
       14  8064 1 1  4 GLY C    C   18.570   5.969   2.871 1.00 . A A .   4 GLY C    1 1 
       14  8065 1 1  4 GLY CA   C   19.910   6.534   2.445 1.00 . A A .   4 GLY CA   1 1 
       14  8066 1 1  4 GLY H    H   19.282   8.485   2.979 1.00 . A A .   4 GLY H    1 1 
       14  8067 1 1  4 GLY HA2  H   20.144   6.172   1.455 1.00 . A A .   4 GLY HA2  1 1 
       14  8068 1 1  4 GLY HA3  H   20.668   6.188   3.132 1.00 . A A .   4 GLY HA3  1 1 
       14  8069 1 1  4 GLY N    N   19.921   7.985   2.428 1.00 . A A .   4 GLY N    1 1 
       14  8070 1 1  4 GLY O    O   18.445   5.400   3.955 1.00 . A A .   4 GLY O    1 1 
       14  8071 1 1  5 SER C    C   15.718   4.731   1.191 1.00 . A A .   5 SER C    1 1 
       14  8072 1 1  5 SER CA   C   16.225   5.633   2.312 1.00 . A A .   5 SER CA   1 1 
       14  8073 1 1  5 SER CB   C   15.260   6.803   2.517 1.00 . A A .   5 SER CB   1 1 
       14  8074 1 1  5 SER H    H   17.727   6.590   1.167 1.00 . A A .   5 SER H    1 1 
       14  8075 1 1  5 SER HA   H   16.278   5.058   3.225 1.00 . A A .   5 SER HA   1 1 
       14  8076 1 1  5 SER HB2  H   15.235   7.406   1.622 1.00 . A A .   5 SER HB2  1 1 
       14  8077 1 1  5 SER HB3  H   14.271   6.419   2.721 1.00 . A A .   5 SER HB3  1 1 
       14  8078 1 1  5 SER HG   H   15.487   8.537   3.400 1.00 . A A .   5 SER HG   1 1 
       14  8079 1 1  5 SER N    N   17.564   6.127   2.016 1.00 . A A .   5 SER N    1 1 
       14  8080 1 1  5 SER O    O   15.360   3.576   1.421 1.00 . A A .   5 SER O    1 1 
       14  8081 1 1  5 SER OG   O   15.668   7.616   3.603 1.00 . A A .   5 SER OG   1 1 
       14  8082 1 1  6 SER C    C   16.393   3.860  -1.912 1.00 . A A .   6 SER C    1 1 
       14  8083 1 1  6 SER CA   C   15.224   4.515  -1.183 1.00 . A A .   6 SER CA   1 1 
       14  8084 1 1  6 SER CB   C   14.460   5.432  -2.141 1.00 . A A .   6 SER CB   1 1 
       14  8085 1 1  6 SER H    H   15.988   6.194  -0.145 1.00 . A A .   6 SER H    1 1 
       14  8086 1 1  6 SER HA   H   14.558   3.742  -0.829 1.00 . A A .   6 SER HA   1 1 
       14  8087 1 1  6 SER HB2  H   15.123   6.204  -2.501 1.00 . A A .   6 SER HB2  1 1 
       14  8088 1 1  6 SER HB3  H   14.096   4.851  -2.976 1.00 . A A .   6 SER HB3  1 1 
       14  8089 1 1  6 SER HG   H   12.543   5.628  -1.788 1.00 . A A .   6 SER HG   1 1 
       14  8090 1 1  6 SER N    N   15.690   5.268  -0.025 1.00 . A A .   6 SER N    1 1 
       14  8091 1 1  6 SER O    O   16.972   4.441  -2.829 1.00 . A A .   6 SER O    1 1 
       14  8092 1 1  6 SER OG   O   13.358   6.042  -1.492 1.00 . A A .   6 SER OG   1 1 
       14  8093 1 1  7 GLY C    C   17.434   0.546  -2.590 1.00 . A A .   7 GLY C    1 1 
       14  8094 1 1  7 GLY CA   C   17.835   1.930  -2.118 1.00 . A A .   7 GLY CA   1 1 
       14  8095 1 1  7 GLY H    H   16.240   2.230  -0.759 1.00 . A A .   7 GLY H    1 1 
       14  8096 1 1  7 GLY HA2  H   18.187   2.500  -2.965 1.00 . A A .   7 GLY HA2  1 1 
       14  8097 1 1  7 GLY HA3  H   18.639   1.834  -1.403 1.00 . A A .   7 GLY HA3  1 1 
       14  8098 1 1  7 GLY N    N   16.737   2.645  -1.495 1.00 . A A .   7 GLY N    1 1 
       14  8099 1 1  7 GLY O    O   16.588   0.404  -3.474 1.00 . A A .   7 GLY O    1 1 
       14  8100 1 1  8 THR C    C   16.278  -2.189  -2.119 1.00 . A A .   8 THR C    1 1 
       14  8101 1 1  8 THR CA   C   17.745  -1.857  -2.367 1.00 . A A .   8 THR CA   1 1 
       14  8102 1 1  8 THR CB   C   18.624  -2.849  -1.581 1.00 . A A .   8 THR CB   1 1 
       14  8103 1 1  8 THR CG2  C   18.322  -4.282  -1.991 1.00 . A A .   8 THR CG2  1 1 
       14  8104 1 1  8 THR H    H   18.707  -0.300  -1.303 1.00 . A A .   8 THR H    1 1 
       14  8105 1 1  8 THR HA   H   17.959  -1.976  -3.419 1.00 . A A .   8 THR HA   1 1 
       14  8106 1 1  8 THR HB   H   18.410  -2.739  -0.527 1.00 . A A .   8 THR HB   1 1 
       14  8107 1 1  8 THR HG1  H   20.130  -2.266  -2.713 1.00 . A A .   8 THR HG1  1 1 
       14  8108 1 1  8 THR HG21 H   17.673  -4.737  -1.258 1.00 . A A .   8 THR HG21 1 1 
       14  8109 1 1  8 THR HG22 H   19.244  -4.841  -2.052 1.00 . A A .   8 THR HG22 1 1 
       14  8110 1 1  8 THR HG23 H   17.834  -4.285  -2.955 1.00 . A A .   8 THR HG23 1 1 
       14  8111 1 1  8 THR N    N   18.042  -0.478  -2.000 1.00 . A A .   8 THR N    1 1 
       14  8112 1 1  8 THR O    O   15.873  -2.443  -0.985 1.00 . A A .   8 THR O    1 1 
       14  8113 1 1  8 THR OG1  O   20.009  -2.564  -1.808 1.00 . A A .   8 THR OG1  1 1 
       14  8114 1 1  9 ARG C    C   13.788  -3.941  -3.442 1.00 . A A .   9 ARG C    1 1 
       14  8115 1 1  9 ARG CA   C   14.064  -2.484  -3.085 1.00 . A A .   9 ARG CA   1 1 
       14  8116 1 1  9 ARG CB   C   13.259  -1.562  -4.002 1.00 . A A .   9 ARG CB   1 1 
       14  8117 1 1  9 ARG CD   C   13.399  -0.424  -6.239 1.00 . A A .   9 ARG CD   1 1 
       14  8118 1 1  9 ARG CG   C   13.595  -1.724  -5.476 1.00 . A A .   9 ARG CG   1 1 
       14  8119 1 1  9 ARG CZ   C   15.097  -0.583  -8.009 1.00 . A A .   9 ARG CZ   1 1 
       14  8120 1 1  9 ARG H    H   15.869  -1.973  -4.065 1.00 . A A .   9 ARG H    1 1 
       14  8121 1 1  9 ARG HA   H   13.762  -2.313  -2.062 1.00 . A A .   9 ARG HA   1 1 
       14  8122 1 1  9 ARG HB2  H   12.208  -1.770  -3.871 1.00 . A A .   9 ARG HB2  1 1 
       14  8123 1 1  9 ARG HB3  H   13.453  -0.537  -3.722 1.00 . A A .   9 ARG HB3  1 1 
       14  8124 1 1  9 ARG HD2  H   12.352  -0.162  -6.213 1.00 . A A .   9 ARG HD2  1 1 
       14  8125 1 1  9 ARG HD3  H   13.976   0.351  -5.757 1.00 . A A .   9 ARG HD3  1 1 
       14  8126 1 1  9 ARG HE   H   13.127  -0.580  -8.317 1.00 . A A .   9 ARG HE   1 1 
       14  8127 1 1  9 ARG HG2  H   14.627  -2.031  -5.569 1.00 . A A .   9 ARG HG2  1 1 
       14  8128 1 1  9 ARG HG3  H   12.953  -2.482  -5.900 1.00 . A A .   9 ARG HG3  1 1 
       14  8129 1 1  9 ARG HH11 H   15.835  -0.451  -6.133 1.00 . A A .   9 ARG HH11 1 1 
       14  8130 1 1  9 ARG HH12 H   17.021  -0.564  -7.391 1.00 . A A .   9 ARG HH12 1 1 
       14  8131 1 1  9 ARG HH21 H   14.679  -0.729  -9.982 1.00 . A A .   9 ARG HH21 1 1 
       14  8132 1 1  9 ARG HH22 H   16.363  -0.722  -9.579 1.00 . A A .   9 ARG HH22 1 1 
       14  8133 1 1  9 ARG N    N   15.487  -2.184  -3.187 1.00 . A A .   9 ARG N    1 1 
       14  8134 1 1  9 ARG NE   N   13.825  -0.537  -7.632 1.00 . A A .   9 ARG NE   1 1 
       14  8135 1 1  9 ARG NH1  N   16.064  -0.528  -7.104 1.00 . A A .   9 ARG NH1  1 1 
       14  8136 1 1  9 ARG NH2  N   15.405  -0.687  -9.296 1.00 . A A .   9 ARG NH2  1 1 
       14  8137 1 1  9 ARG O    O   12.884  -4.238  -4.221 1.00 . A A .   9 ARG O    1 1 
       14  8138 1 1 10 GLU C    C   12.953  -6.686  -3.011 1.00 . A A .  10 GLU C    1 1 
       14  8139 1 1 10 GLU CA   C   14.417  -6.271  -3.127 1.00 . A A .  10 GLU CA   1 1 
       14  8140 1 1 10 GLU CB   C   15.268  -7.088  -2.153 1.00 . A A .  10 GLU CB   1 1 
       14  8141 1 1 10 GLU CD   C   15.340  -8.022   0.193 1.00 . A A .  10 GLU CD   1 1 
       14  8142 1 1 10 GLU CG   C   14.898  -6.875  -0.695 1.00 . A A .  10 GLU CG   1 1 
       14  8143 1 1 10 GLU H    H   15.280  -4.547  -2.255 1.00 . A A .  10 GLU H    1 1 
       14  8144 1 1 10 GLU HA   H   14.754  -6.465  -4.134 1.00 . A A .  10 GLU HA   1 1 
       14  8145 1 1 10 GLU HB2  H   15.152  -8.137  -2.383 1.00 . A A .  10 GLU HB2  1 1 
       14  8146 1 1 10 GLU HB3  H   16.305  -6.814  -2.283 1.00 . A A .  10 GLU HB3  1 1 
       14  8147 1 1 10 GLU HG2  H   15.369  -5.968  -0.346 1.00 . A A .  10 GLU HG2  1 1 
       14  8148 1 1 10 GLU HG3  H   13.825  -6.774  -0.620 1.00 . A A .  10 GLU HG3  1 1 
       14  8149 1 1 10 GLU N    N   14.576  -4.846  -2.868 1.00 . A A .  10 GLU N    1 1 
       14  8150 1 1 10 GLU O    O   12.492  -7.585  -3.715 1.00 . A A .  10 GLU O    1 1 
       14  8151 1 1 10 GLU OE1  O   16.487  -7.982   0.685 1.00 . A A .  10 GLU OE1  1 1 
       14  8152 1 1 10 GLU OE2  O   14.540  -8.959   0.395 1.00 . A A .  10 GLU OE2  1 1 
       14  8153 1 1 11 LYS C    C   10.062  -6.353  -3.233 1.00 . A A .  11 LYS C    1 1 
       14  8154 1 1 11 LYS CA   C   10.814  -6.321  -1.906 1.00 . A A .  11 LYS CA   1 1 
       14  8155 1 1 11 LYS CB   C   10.186  -5.281  -0.976 1.00 . A A .  11 LYS CB   1 1 
       14  8156 1 1 11 LYS CD   C   11.524  -5.130   1.145 1.00 . A A .  11 LYS CD   1 1 
       14  8157 1 1 11 LYS CE   C   11.948  -5.996   2.321 1.00 . A A .  11 LYS CE   1 1 
       14  8158 1 1 11 LYS CG   C   10.256  -5.658   0.494 1.00 . A A .  11 LYS CG   1 1 
       14  8159 1 1 11 LYS H    H   12.650  -5.317  -1.585 1.00 . A A .  11 LYS H    1 1 
       14  8160 1 1 11 LYS HA   H   10.745  -7.294  -1.444 1.00 . A A .  11 LYS HA   1 1 
       14  8161 1 1 11 LYS HB2  H   10.699  -4.340  -1.110 1.00 . A A .  11 LYS HB2  1 1 
       14  8162 1 1 11 LYS HB3  H    9.147  -5.156  -1.245 1.00 . A A .  11 LYS HB3  1 1 
       14  8163 1 1 11 LYS HD2  H   12.318  -5.123   0.413 1.00 . A A .  11 LYS HD2  1 1 
       14  8164 1 1 11 LYS HD3  H   11.346  -4.123   1.495 1.00 . A A .  11 LYS HD3  1 1 
       14  8165 1 1 11 LYS HE2  H   11.067  -6.294   2.868 1.00 . A A .  11 LYS HE2  1 1 
       14  8166 1 1 11 LYS HE3  H   12.451  -6.873   1.943 1.00 . A A .  11 LYS HE3  1 1 
       14  8167 1 1 11 LYS HG2  H    9.402  -5.240   1.005 1.00 . A A .  11 LYS HG2  1 1 
       14  8168 1 1 11 LYS HG3  H   10.239  -6.735   0.581 1.00 . A A .  11 LYS HG3  1 1 
       14  8169 1 1 11 LYS HZ1  H   13.250  -4.425   2.771 1.00 . A A .  11 LYS HZ1  1 1 
       14  8170 1 1 11 LYS HZ2  H   13.656  -5.887   3.518 1.00 . A A .  11 LYS HZ2  1 1 
       14  8171 1 1 11 LYS HZ3  H   12.355  -4.975   4.098 1.00 . A A .  11 LYS HZ3  1 1 
       14  8172 1 1 11 LYS N    N   12.226  -6.024  -2.117 1.00 . A A .  11 LYS N    1 1 
       14  8173 1 1 11 LYS NZ   N   12.867  -5.269   3.241 1.00 . A A .  11 LYS NZ   1 1 
       14  8174 1 1 11 LYS O    O   10.247  -5.499  -4.100 1.00 . A A .  11 LYS O    1 1 
       14  8175 1 1 12 PRO C    C    7.322  -6.447  -4.756 1.00 . A A .  12 PRO C    1 1 
       14  8176 1 1 12 PRO CA   C    8.391  -7.525  -4.613 1.00 . A A .  12 PRO CA   1 1 
       14  8177 1 1 12 PRO CB   C    7.743  -8.899  -4.428 1.00 . A A .  12 PRO CB   1 1 
       14  8178 1 1 12 PRO CD   C    8.918  -8.414  -2.404 1.00 . A A .  12 PRO CD   1 1 
       14  8179 1 1 12 PRO CG   C    7.699  -9.102  -2.953 1.00 . A A .  12 PRO CG   1 1 
       14  8180 1 1 12 PRO HA   H    9.011  -7.534  -5.497 1.00 . A A .  12 PRO HA   1 1 
       14  8181 1 1 12 PRO HB2  H    6.750  -8.893  -4.856 1.00 . A A .  12 PRO HB2  1 1 
       14  8182 1 1 12 PRO HB3  H    8.345  -9.653  -4.912 1.00 . A A .  12 PRO HB3  1 1 
       14  8183 1 1 12 PRO HD2  H    8.707  -7.986  -1.435 1.00 . A A .  12 PRO HD2  1 1 
       14  8184 1 1 12 PRO HD3  H    9.746  -9.105  -2.341 1.00 . A A .  12 PRO HD3  1 1 
       14  8185 1 1 12 PRO HG2  H    6.803  -8.657  -2.547 1.00 . A A .  12 PRO HG2  1 1 
       14  8186 1 1 12 PRO HG3  H    7.732 -10.157  -2.726 1.00 . A A .  12 PRO HG3  1 1 
       14  8187 1 1 12 PRO N    N    9.190  -7.360  -3.396 1.00 . A A .  12 PRO N    1 1 
       14  8188 1 1 12 PRO O    O    7.145  -5.873  -5.830 1.00 . A A .  12 PRO O    1 1 
       14  8189 1 1 13 TYR C    C    6.145  -3.768  -3.515 1.00 . A A .  13 TYR C    1 1 
       14  8190 1 1 13 TYR CA   C    5.559  -5.168  -3.670 1.00 . A A .  13 TYR CA   1 1 
       14  8191 1 1 13 TYR CB   C    4.557  -5.442  -2.547 1.00 . A A .  13 TYR CB   1 1 
       14  8192 1 1 13 TYR CD1  C    2.744  -6.981  -3.397 1.00 . A A .  13 TYR CD1  1 1 
       14  8193 1 1 13 TYR CD2  C    4.425  -7.899  -1.979 1.00 . A A .  13 TYR CD2  1 1 
       14  8194 1 1 13 TYR CE1  C    2.137  -8.218  -3.486 1.00 . A A .  13 TYR CE1  1 1 
       14  8195 1 1 13 TYR CE2  C    3.826  -9.140  -2.063 1.00 . A A .  13 TYR CE2  1 1 
       14  8196 1 1 13 TYR CG   C    3.897  -6.798  -2.643 1.00 . A A .  13 TYR CG   1 1 
       14  8197 1 1 13 TYR CZ   C    2.681  -9.295  -2.817 1.00 . A A .  13 TYR CZ   1 1 
       14  8198 1 1 13 TYR H    H    6.800  -6.668  -2.839 1.00 . A A .  13 TYR H    1 1 
       14  8199 1 1 13 TYR HA   H    5.046  -5.228  -4.619 1.00 . A A .  13 TYR HA   1 1 
       14  8200 1 1 13 TYR HB2  H    5.068  -5.388  -1.598 1.00 . A A .  13 TYR HB2  1 1 
       14  8201 1 1 13 TYR HB3  H    3.781  -4.691  -2.576 1.00 . A A .  13 TYR HB3  1 1 
       14  8202 1 1 13 TYR HD1  H    2.320  -6.135  -3.920 1.00 . A A .  13 TYR HD1  1 1 
       14  8203 1 1 13 TYR HD2  H    5.322  -7.774  -1.388 1.00 . A A .  13 TYR HD2  1 1 
       14  8204 1 1 13 TYR HE1  H    1.241  -8.339  -4.077 1.00 . A A .  13 TYR HE1  1 1 
       14  8205 1 1 13 TYR HE2  H    4.252  -9.984  -1.540 1.00 . A A .  13 TYR HE2  1 1 
       14  8206 1 1 13 TYR HH   H    1.562 -10.577  -3.712 1.00 . A A .  13 TYR HH   1 1 
       14  8207 1 1 13 TYR N    N    6.612  -6.177  -3.666 1.00 . A A .  13 TYR N    1 1 
       14  8208 1 1 13 TYR O    O    6.998  -3.532  -2.660 1.00 . A A .  13 TYR O    1 1 
       14  8209 1 1 13 TYR OH   O    2.080 -10.529  -2.905 1.00 . A A .  13 TYR OH   1 1 
       14  8210 1 1 14 GLU C    C    4.990  -0.483  -4.366 1.00 . A A .  14 GLU C    1 1 
       14  8211 1 1 14 GLU CA   C    6.156  -1.466  -4.304 1.00 . A A .  14 GLU CA   1 1 
       14  8212 1 1 14 GLU CB   C    7.123  -1.200  -5.459 1.00 . A A .  14 GLU CB   1 1 
       14  8213 1 1 14 GLU CD   C    9.423  -1.880  -6.251 1.00 . A A .  14 GLU CD   1 1 
       14  8214 1 1 14 GLU CG   C    8.584  -1.392  -5.087 1.00 . A A .  14 GLU CG   1 1 
       14  8215 1 1 14 GLU H    H    4.999  -3.092  -5.008 1.00 . A A .  14 GLU H    1 1 
       14  8216 1 1 14 GLU HA   H    6.679  -1.326  -3.370 1.00 . A A .  14 GLU HA   1 1 
       14  8217 1 1 14 GLU HB2  H    6.888  -1.873  -6.271 1.00 . A A .  14 GLU HB2  1 1 
       14  8218 1 1 14 GLU HB3  H    6.990  -0.183  -5.797 1.00 . A A .  14 GLU HB3  1 1 
       14  8219 1 1 14 GLU HG2  H    8.982  -0.447  -4.747 1.00 . A A .  14 GLU HG2  1 1 
       14  8220 1 1 14 GLU HG3  H    8.646  -2.116  -4.288 1.00 . A A .  14 GLU HG3  1 1 
       14  8221 1 1 14 GLU N    N    5.679  -2.843  -4.348 1.00 . A A .  14 GLU N    1 1 
       14  8222 1 1 14 GLU O    O    3.976  -0.746  -5.012 1.00 . A A .  14 GLU O    1 1 
       14  8223 1 1 14 GLU OE1  O    8.892  -2.637  -7.090 1.00 . A A .  14 GLU OE1  1 1 
       14  8224 1 1 14 GLU OE2  O   10.612  -1.504  -6.323 1.00 . A A .  14 GLU OE2  1 1 
       14  8225 1 1 15 CYS C    C    4.105   2.480  -4.958 1.00 . A A .  15 CYS C    1 1 
       14  8226 1 1 15 CYS CA   C    4.103   1.672  -3.664 1.00 . A A .  15 CYS CA   1 1 
       14  8227 1 1 15 CYS CB   C    4.303   2.604  -2.467 1.00 . A A .  15 CYS CB   1 1 
       14  8228 1 1 15 CYS H    H    5.974   0.802  -3.191 1.00 . A A .  15 CYS H    1 1 
       14  8229 1 1 15 CYS HA   H    3.150   1.174  -3.566 1.00 . A A .  15 CYS HA   1 1 
       14  8230 1 1 15 CYS HB2  H    4.509   2.010  -1.589 1.00 . A A .  15 CYS HB2  1 1 
       14  8231 1 1 15 CYS HB3  H    5.144   3.252  -2.662 1.00 . A A .  15 CYS HB3  1 1 
       14  8232 1 1 15 CYS N    N    5.142   0.650  -3.688 1.00 . A A .  15 CYS N    1 1 
       14  8233 1 1 15 CYS O    O    5.132   3.027  -5.359 1.00 . A A .  15 CYS O    1 1 
       14  8234 1 1 15 CYS SG   S    2.863   3.657  -2.096 1.00 . A A .  15 CYS SG   1 1 
       14  8235 1 1 16 SER C    C    2.586   4.774  -6.591 1.00 . A A .  16 SER C    1 1 
       14  8236 1 1 16 SER CA   C    2.815   3.289  -6.858 1.00 . A A .  16 SER CA   1 1 
       14  8237 1 1 16 SER CB   C    1.661   2.725  -7.689 1.00 . A A .  16 SER CB   1 1 
       14  8238 1 1 16 SER H    H    2.163   2.093  -5.237 1.00 . A A .  16 SER H    1 1 
       14  8239 1 1 16 SER HA   H    3.736   3.172  -7.410 1.00 . A A .  16 SER HA   1 1 
       14  8240 1 1 16 SER HB2  H    0.794   2.601  -7.058 1.00 . A A .  16 SER HB2  1 1 
       14  8241 1 1 16 SER HB3  H    1.429   3.411  -8.490 1.00 . A A .  16 SER HB3  1 1 
       14  8242 1 1 16 SER HG   H    2.574   1.600  -9.008 1.00 . A A .  16 SER HG   1 1 
       14  8243 1 1 16 SER N    N    2.947   2.551  -5.607 1.00 . A A .  16 SER N    1 1 
       14  8244 1 1 16 SER O    O    2.161   5.515  -7.476 1.00 . A A .  16 SER O    1 1 
       14  8245 1 1 16 SER OG   O    2.002   1.468  -8.248 1.00 . A A .  16 SER OG   1 1 
       14  8246 1 1 17 GLU C    C    4.038   7.243  -4.658 1.00 . A A .  17 GLU C    1 1 
       14  8247 1 1 17 GLU CA   C    2.695   6.594  -4.980 1.00 . A A .  17 GLU CA   1 1 
       14  8248 1 1 17 GLU CB   C    1.762   6.700  -3.771 1.00 . A A .  17 GLU CB   1 1 
       14  8249 1 1 17 GLU CD   C   -0.620   6.582  -4.602 1.00 . A A .  17 GLU CD   1 1 
       14  8250 1 1 17 GLU CG   C    0.507   5.854  -3.896 1.00 . A A .  17 GLU CG   1 1 
       14  8251 1 1 17 GLU H    H    3.207   4.559  -4.702 1.00 . A A .  17 GLU H    1 1 
       14  8252 1 1 17 GLU HA   H    2.249   7.114  -5.814 1.00 . A A .  17 GLU HA   1 1 
       14  8253 1 1 17 GLU HB2  H    2.299   6.385  -2.889 1.00 . A A .  17 GLU HB2  1 1 
       14  8254 1 1 17 GLU HB3  H    1.465   7.732  -3.651 1.00 . A A .  17 GLU HB3  1 1 
       14  8255 1 1 17 GLU HG2  H    0.744   4.961  -4.455 1.00 . A A .  17 GLU HG2  1 1 
       14  8256 1 1 17 GLU HG3  H    0.174   5.579  -2.906 1.00 . A A .  17 GLU HG3  1 1 
       14  8257 1 1 17 GLU N    N    2.871   5.199  -5.364 1.00 . A A .  17 GLU N    1 1 
       14  8258 1 1 17 GLU O    O    4.311   8.371  -5.071 1.00 . A A .  17 GLU O    1 1 
       14  8259 1 1 17 GLU OE1  O   -0.649   7.829  -4.542 1.00 . A A .  17 GLU OE1  1 1 
       14  8260 1 1 17 GLU OE2  O   -1.473   5.905  -5.214 1.00 . A A .  17 GLU OE2  1 1 
       14  8261 1 1 18 CYS C    C    7.291   6.096  -4.031 1.00 . A A .  18 CYS C    1 1 
       14  8262 1 1 18 CYS CA   C    6.188   7.027  -3.537 1.00 . A A .  18 CYS CA   1 1 
       14  8263 1 1 18 CYS CB   C    6.279   7.182  -2.017 1.00 . A A .  18 CYS CB   1 1 
       14  8264 1 1 18 CYS H    H    4.600   5.631  -3.617 1.00 . A A .  18 CYS H    1 1 
       14  8265 1 1 18 CYS HA   H    6.318   7.995  -3.997 1.00 . A A .  18 CYS HA   1 1 
       14  8266 1 1 18 CYS HB2  H    7.249   7.582  -1.761 1.00 . A A .  18 CYS HB2  1 1 
       14  8267 1 1 18 CYS HB3  H    5.514   7.870  -1.687 1.00 . A A .  18 CYS HB3  1 1 
       14  8268 1 1 18 CYS N    N    4.874   6.523  -3.916 1.00 . A A .  18 CYS N    1 1 
       14  8269 1 1 18 CYS O    O    8.371   6.544  -4.414 1.00 . A A .  18 CYS O    1 1 
       14  8270 1 1 18 CYS SG   S    6.061   5.625  -1.097 1.00 . A A .  18 CYS SG   1 1 
       14  8271 1 1 19 GLY C    C    8.440   2.899  -3.354 1.00 . A A .  19 GLY C    1 1 
       14  8272 1 1 19 GLY CA   C    7.988   3.822  -4.468 1.00 . A A .  19 GLY CA   1 1 
       14  8273 1 1 19 GLY H    H    6.132   4.497  -3.703 1.00 . A A .  19 GLY H    1 1 
       14  8274 1 1 19 GLY HA2  H    7.552   3.229  -5.258 1.00 . A A .  19 GLY HA2  1 1 
       14  8275 1 1 19 GLY HA3  H    8.849   4.346  -4.857 1.00 . A A .  19 GLY HA3  1 1 
       14  8276 1 1 19 GLY N    N    7.010   4.796  -4.019 1.00 . A A .  19 GLY N    1 1 
       14  8277 1 1 19 GLY O    O    9.410   2.157  -3.508 1.00 . A A .  19 GLY O    1 1 
       14  8278 1 1 20 LYS C    C    8.167   0.641  -1.490 1.00 . A A .  20 LYS C    1 1 
       14  8279 1 1 20 LYS CA   C    8.071   2.107  -1.082 1.00 . A A .  20 LYS CA   1 1 
       14  8280 1 1 20 LYS CB   C    7.022   2.273   0.020 1.00 . A A .  20 LYS CB   1 1 
       14  8281 1 1 20 LYS CD   C    6.839   2.624   2.501 1.00 . A A .  20 LYS CD   1 1 
       14  8282 1 1 20 LYS CE   C    7.652   2.573   3.786 1.00 . A A .  20 LYS CE   1 1 
       14  8283 1 1 20 LYS CG   C    7.504   1.828   1.390 1.00 . A A .  20 LYS CG   1 1 
       14  8284 1 1 20 LYS H    H    6.974   3.558  -2.165 1.00 . A A .  20 LYS H    1 1 
       14  8285 1 1 20 LYS HA   H    9.031   2.427  -0.705 1.00 . A A .  20 LYS HA   1 1 
       14  8286 1 1 20 LYS HB2  H    6.743   3.315   0.081 1.00 . A A .  20 LYS HB2  1 1 
       14  8287 1 1 20 LYS HB3  H    6.150   1.690  -0.238 1.00 . A A .  20 LYS HB3  1 1 
       14  8288 1 1 20 LYS HD2  H    6.746   3.653   2.189 1.00 . A A .  20 LYS HD2  1 1 
       14  8289 1 1 20 LYS HD3  H    5.858   2.212   2.689 1.00 . A A .  20 LYS HD3  1 1 
       14  8290 1 1 20 LYS HE2  H    7.481   1.622   4.267 1.00 . A A .  20 LYS HE2  1 1 
       14  8291 1 1 20 LYS HE3  H    8.698   2.668   3.539 1.00 . A A .  20 LYS HE3  1 1 
       14  8292 1 1 20 LYS HG2  H    7.270   0.782   1.522 1.00 . A A .  20 LYS HG2  1 1 
       14  8293 1 1 20 LYS HG3  H    8.574   1.970   1.449 1.00 . A A .  20 LYS HG3  1 1 
       14  8294 1 1 20 LYS HZ1  H    7.712   3.505   5.654 1.00 . A A .  20 LYS HZ1  1 1 
       14  8295 1 1 20 LYS HZ2  H    6.240   3.695   4.841 1.00 . A A .  20 LYS HZ2  1 1 
       14  8296 1 1 20 LYS HZ3  H    7.596   4.582   4.354 1.00 . A A .  20 LYS HZ3  1 1 
       14  8297 1 1 20 LYS N    N    7.737   2.945  -2.228 1.00 . A A .  20 LYS N    1 1 
       14  8298 1 1 20 LYS NZ   N    7.274   3.665   4.725 1.00 . A A .  20 LYS NZ   1 1 
       14  8299 1 1 20 LYS O    O    7.954   0.295  -2.652 1.00 . A A .  20 LYS O    1 1 
       14  8300 1 1 21 ALA C    C    8.025  -2.463   0.363 1.00 . A A .  21 ALA C    1 1 
       14  8301 1 1 21 ALA CA   C    8.607  -1.647  -0.786 1.00 . A A .  21 ALA CA   1 1 
       14  8302 1 1 21 ALA CB   C   10.064  -2.021  -1.017 1.00 . A A .  21 ALA CB   1 1 
       14  8303 1 1 21 ALA H    H    8.644   0.119   0.380 1.00 . A A .  21 ALA H    1 1 
       14  8304 1 1 21 ALA HA   H    8.056  -1.870  -1.688 1.00 . A A .  21 ALA HA   1 1 
       14  8305 1 1 21 ALA HB1  H   10.424  -2.599  -0.180 1.00 . A A .  21 ALA HB1  1 1 
       14  8306 1 1 21 ALA HB2  H   10.145  -2.607  -1.921 1.00 . A A .  21 ALA HB2  1 1 
       14  8307 1 1 21 ALA HB3  H   10.654  -1.122  -1.116 1.00 . A A .  21 ALA HB3  1 1 
       14  8308 1 1 21 ALA N    N    8.487  -0.217  -0.527 1.00 . A A .  21 ALA N    1 1 
       14  8309 1 1 21 ALA O    O    7.968  -1.999   1.502 1.00 . A A .  21 ALA O    1 1 
       14  8310 1 1 22 PHE C    C    7.211  -6.029   0.683 1.00 . A A .  22 PHE C    1 1 
       14  8311 1 1 22 PHE CA   C    7.015  -4.564   1.064 1.00 . A A .  22 PHE CA   1 1 
       14  8312 1 1 22 PHE CB   C    5.525  -4.265   1.237 1.00 . A A .  22 PHE CB   1 1 
       14  8313 1 1 22 PHE CD1  C    5.214  -1.917   0.408 1.00 . A A .  22 PHE CD1  1 1 
       14  8314 1 1 22 PHE CD2  C    4.961  -2.338   2.742 1.00 . A A .  22 PHE CD2  1 1 
       14  8315 1 1 22 PHE CE1  C    4.941  -0.579   0.616 1.00 . A A .  22 PHE CE1  1 1 
       14  8316 1 1 22 PHE CE2  C    4.687  -1.000   2.956 1.00 . A A .  22 PHE CE2  1 1 
       14  8317 1 1 22 PHE CG   C    5.227  -2.811   1.467 1.00 . A A .  22 PHE CG   1 1 
       14  8318 1 1 22 PHE CZ   C    4.678  -0.119   1.892 1.00 . A A .  22 PHE CZ   1 1 
       14  8319 1 1 22 PHE H    H    7.667  -3.997  -0.869 1.00 . A A .  22 PHE H    1 1 
       14  8320 1 1 22 PHE HA   H    7.522  -4.377   1.998 1.00 . A A .  22 PHE HA   1 1 
       14  8321 1 1 22 PHE HB2  H    4.997  -4.575   0.348 1.00 . A A .  22 PHE HB2  1 1 
       14  8322 1 1 22 PHE HB3  H    5.150  -4.820   2.084 1.00 . A A .  22 PHE HB3  1 1 
       14  8323 1 1 22 PHE HD1  H    5.420  -2.276  -0.591 1.00 . A A .  22 PHE HD1  1 1 
       14  8324 1 1 22 PHE HD2  H    4.969  -3.025   3.575 1.00 . A A .  22 PHE HD2  1 1 
       14  8325 1 1 22 PHE HE1  H    4.934   0.107  -0.218 1.00 . A A .  22 PHE HE1  1 1 
       14  8326 1 1 22 PHE HE2  H    4.482  -0.644   3.954 1.00 . A A .  22 PHE HE2  1 1 
       14  8327 1 1 22 PHE HZ   H    4.463   0.926   2.056 1.00 . A A .  22 PHE HZ   1 1 
       14  8328 1 1 22 PHE N    N    7.594  -3.683   0.057 1.00 . A A .  22 PHE N    1 1 
       14  8329 1 1 22 PHE O    O    7.471  -6.349  -0.477 1.00 . A A .  22 PHE O    1 1 
       14  8330 1 1 23 ILE C    C    5.943  -8.973   0.958 1.00 . A A .  23 ILE C    1 1 
       14  8331 1 1 23 ILE CA   C    7.247  -8.342   1.436 1.00 . A A .  23 ILE CA   1 1 
       14  8332 1 1 23 ILE CB   C    7.720  -9.068   2.709 1.00 . A A .  23 ILE CB   1 1 
       14  8333 1 1 23 ILE CD1  C   10.213  -8.888   2.230 1.00 . A A .  23 ILE CD1  1 1 
       14  8334 1 1 23 ILE CG1  C    9.077  -8.523   3.159 1.00 . A A .  23 ILE CG1  1 1 
       14  8335 1 1 23 ILE CG2  C    7.800 -10.568   2.464 1.00 . A A .  23 ILE CG2  1 1 
       14  8336 1 1 23 ILE H    H    6.876  -6.595   2.571 1.00 . A A .  23 ILE H    1 1 
       14  8337 1 1 23 ILE HA   H    7.999  -8.472   0.671 1.00 . A A .  23 ILE HA   1 1 
       14  8338 1 1 23 ILE HB   H    6.993  -8.893   3.487 1.00 . A A .  23 ILE HB   1 1 
       14  8339 1 1 23 ILE HD11 H   11.057  -8.240   2.422 1.00 . A A .  23 ILE HD11 1 1 
       14  8340 1 1 23 ILE HD12 H   10.502  -9.914   2.400 1.00 . A A .  23 ILE HD12 1 1 
       14  8341 1 1 23 ILE HD13 H    9.894  -8.768   1.206 1.00 . A A .  23 ILE HD13 1 1 
       14  8342 1 1 23 ILE HG12 H    9.025  -7.448   3.214 1.00 . A A .  23 ILE HG12 1 1 
       14  8343 1 1 23 ILE HG13 H    9.308  -8.919   4.138 1.00 . A A .  23 ILE HG13 1 1 
       14  8344 1 1 23 ILE HG21 H    8.676 -10.790   1.873 1.00 . A A .  23 ILE HG21 1 1 
       14  8345 1 1 23 ILE HG22 H    7.864 -11.083   3.410 1.00 . A A .  23 ILE HG22 1 1 
       14  8346 1 1 23 ILE HG23 H    6.917 -10.894   1.935 1.00 . A A .  23 ILE HG23 1 1 
       14  8347 1 1 23 ILE N    N    7.084  -6.912   1.667 1.00 . A A .  23 ILE N    1 1 
       14  8348 1 1 23 ILE O    O    5.942  -9.810   0.055 1.00 . A A .  23 ILE O    1 1 
       14  8349 1 1 24 ARG C    C    2.572  -7.958   0.829 1.00 . A A .  24 ARG C    1 1 
       14  8350 1 1 24 ARG CA   C    3.525  -9.089   1.205 1.00 . A A .  24 ARG CA   1 1 
       14  8351 1 1 24 ARG CB   C    2.939  -9.901   2.362 1.00 . A A .  24 ARG CB   1 1 
       14  8352 1 1 24 ARG CD   C    3.282 -11.683   4.100 1.00 . A A .  24 ARG CD   1 1 
       14  8353 1 1 24 ARG CG   C    3.906 -10.919   2.943 1.00 . A A .  24 ARG CG   1 1 
       14  8354 1 1 24 ARG CZ   C    2.048 -13.545   3.073 1.00 . A A .  24 ARG CZ   1 1 
       14  8355 1 1 24 ARG H    H    4.902  -7.894   2.281 1.00 . A A .  24 ARG H    1 1 
       14  8356 1 1 24 ARG HA   H    3.652  -9.736   0.350 1.00 . A A .  24 ARG HA   1 1 
       14  8357 1 1 24 ARG HB2  H    2.647  -9.223   3.151 1.00 . A A .  24 ARG HB2  1 1 
       14  8358 1 1 24 ARG HB3  H    2.065 -10.427   2.009 1.00 . A A .  24 ARG HB3  1 1 
       14  8359 1 1 24 ARG HD2  H    3.995 -12.410   4.460 1.00 . A A .  24 ARG HD2  1 1 
       14  8360 1 1 24 ARG HD3  H    3.049 -10.986   4.890 1.00 . A A .  24 ARG HD3  1 1 
       14  8361 1 1 24 ARG HE   H    1.205 -11.946   3.915 1.00 . A A .  24 ARG HE   1 1 
       14  8362 1 1 24 ARG HG2  H    4.183 -11.621   2.170 1.00 . A A .  24 ARG HG2  1 1 
       14  8363 1 1 24 ARG HG3  H    4.787 -10.404   3.296 1.00 . A A .  24 ARG HG3  1 1 
       14  8364 1 1 24 ARG HH11 H    4.059 -13.726   3.019 1.00 . A A .  24 ARG HH11 1 1 
       14  8365 1 1 24 ARG HH12 H    3.177 -15.032   2.299 1.00 . A A .  24 ARG HH12 1 1 
       14  8366 1 1 24 ARG HH21 H    0.032 -13.659   2.970 1.00 . A A .  24 ARG HH21 1 1 
       14  8367 1 1 24 ARG HH22 H    0.887 -14.992   2.271 1.00 . A A .  24 ARG HH22 1 1 
       14  8368 1 1 24 ARG N    N    4.836  -8.564   1.569 1.00 . A A .  24 ARG N    1 1 
       14  8369 1 1 24 ARG NE   N    2.059 -12.375   3.702 1.00 . A A .  24 ARG NE   1 1 
       14  8370 1 1 24 ARG NH1  N    3.188 -14.151   2.772 1.00 . A A .  24 ARG NH1  1 1 
       14  8371 1 1 24 ARG NH2  N    0.894 -14.112   2.744 1.00 . A A .  24 ARG NH2  1 1 
       14  8372 1 1 24 ARG O    O    2.595  -6.887   1.433 1.00 . A A .  24 ARG O    1 1 
       14  8373 1 1 25 ASN C    C    0.031  -6.588   0.547 1.00 . A A .  25 ASN C    1 1 
       14  8374 1 1 25 ASN CA   C    0.775  -7.208  -0.632 1.00 . A A .  25 ASN CA   1 1 
       14  8375 1 1 25 ASN CB   C   -0.223  -7.839  -1.604 1.00 . A A .  25 ASN CB   1 1 
       14  8376 1 1 25 ASN CG   C   -0.747  -6.844  -2.621 1.00 . A A .  25 ASN CG   1 1 
       14  8377 1 1 25 ASN H    H    1.765  -9.079  -0.617 1.00 . A A .  25 ASN H    1 1 
       14  8378 1 1 25 ASN HA   H    1.323  -6.432  -1.145 1.00 . A A .  25 ASN HA   1 1 
       14  8379 1 1 25 ASN HB2  H    0.261  -8.646  -2.135 1.00 . A A .  25 ASN HB2  1 1 
       14  8380 1 1 25 ASN HB3  H   -1.060  -8.232  -1.047 1.00 . A A .  25 ASN HB3  1 1 
       14  8381 1 1 25 ASN HD21 H   -0.565  -5.365  -1.305 1.00 . A A .  25 ASN HD21 1 1 
       14  8382 1 1 25 ASN HD22 H   -1.174  -4.918  -2.859 1.00 . A A .  25 ASN HD22 1 1 
       14  8383 1 1 25 ASN N    N    1.736  -8.205  -0.174 1.00 . A A .  25 ASN N    1 1 
       14  8384 1 1 25 ASN ND2  N   -0.838  -5.581  -2.221 1.00 . A A .  25 ASN ND2  1 1 
       14  8385 1 1 25 ASN O    O    0.022  -5.368   0.716 1.00 . A A .  25 ASN O    1 1 
       14  8386 1 1 25 ASN OD1  O   -1.067  -7.208  -3.753 1.00 . A A .  25 ASN OD1  1 1 
       14  8387 1 1 26 SER C    C   -0.619  -5.813   3.206 1.00 . A A .  26 SER C    1 1 
       14  8388 1 1 26 SER CA   C   -1.339  -6.971   2.522 1.00 . A A .  26 SER CA   1 1 
       14  8389 1 1 26 SER CB   C   -1.543  -8.117   3.515 1.00 . A A .  26 SER CB   1 1 
       14  8390 1 1 26 SER H    H   -0.545  -8.397   1.173 1.00 . A A .  26 SER H    1 1 
       14  8391 1 1 26 SER HA   H   -2.303  -6.628   2.179 1.00 . A A .  26 SER HA   1 1 
       14  8392 1 1 26 SER HB2  H   -1.660  -9.043   2.973 1.00 . A A .  26 SER HB2  1 1 
       14  8393 1 1 26 SER HB3  H   -0.682  -8.185   4.164 1.00 . A A .  26 SER HB3  1 1 
       14  8394 1 1 26 SER HG   H   -2.883  -6.964   4.360 1.00 . A A .  26 SER HG   1 1 
       14  8395 1 1 26 SER N    N   -0.590  -7.436   1.361 1.00 . A A .  26 SER N    1 1 
       14  8396 1 1 26 SER O    O   -1.252  -4.894   3.723 1.00 . A A .  26 SER O    1 1 
       14  8397 1 1 26 SER OG   O   -2.697  -7.904   4.309 1.00 . A A .  26 SER OG   1 1 
       14  8398 1 1 27 GLN C    C    1.423  -3.521   3.034 1.00 . A A .  27 GLN C    1 1 
       14  8399 1 1 27 GLN CA   C    1.517  -4.822   3.823 1.00 . A A .  27 GLN CA   1 1 
       14  8400 1 1 27 GLN CB   C    2.976  -5.268   3.922 1.00 . A A .  27 GLN CB   1 1 
       14  8401 1 1 27 GLN CD   C    4.450  -6.778   5.312 1.00 . A A .  27 GLN CD   1 1 
       14  8402 1 1 27 GLN CG   C    3.151  -6.645   4.542 1.00 . A A .  27 GLN CG   1 1 
       14  8403 1 1 27 GLN H    H    1.157  -6.625   2.774 1.00 . A A .  27 GLN H    1 1 
       14  8404 1 1 27 GLN HA   H    1.133  -4.654   4.818 1.00 . A A .  27 GLN HA   1 1 
       14  8405 1 1 27 GLN HB2  H    3.403  -5.287   2.930 1.00 . A A .  27 GLN HB2  1 1 
       14  8406 1 1 27 GLN HB3  H    3.518  -4.555   4.525 1.00 . A A .  27 GLN HB3  1 1 
       14  8407 1 1 27 GLN HE21 H    5.427  -5.800   3.883 1.00 . A A .  27 GLN HE21 1 1 
       14  8408 1 1 27 GLN HE22 H    6.381  -6.315   5.227 1.00 . A A .  27 GLN HE22 1 1 
       14  8409 1 1 27 GLN HG2  H    2.330  -6.829   5.218 1.00 . A A .  27 GLN HG2  1 1 
       14  8410 1 1 27 GLN HG3  H    3.140  -7.384   3.754 1.00 . A A .  27 GLN HG3  1 1 
       14  8411 1 1 27 GLN N    N    0.709  -5.866   3.203 1.00 . A A .  27 GLN N    1 1 
       14  8412 1 1 27 GLN NE2  N    5.529  -6.245   4.751 1.00 . A A .  27 GLN NE2  1 1 
       14  8413 1 1 27 GLN O    O    1.096  -2.469   3.587 1.00 . A A .  27 GLN O    1 1 
       14  8414 1 1 27 GLN OE1  O    4.484  -7.354   6.400 1.00 . A A .  27 GLN OE1  1 1 
       14  8415 1 1 28 LEU C    C    0.298  -1.743   0.960 1.00 . A A .  28 LEU C    1 1 
       14  8416 1 1 28 LEU CA   C    1.659  -2.424   0.873 1.00 . A A .  28 LEU CA   1 1 
       14  8417 1 1 28 LEU CB   C    1.952  -2.822  -0.574 1.00 . A A .  28 LEU CB   1 1 
       14  8418 1 1 28 LEU CD1  C    2.275  -0.501  -1.463 1.00 . A A .  28 LEU CD1  1 1 
       14  8419 1 1 28 LEU CD2  C    1.777  -2.381  -3.036 1.00 . A A .  28 LEU CD2  1 1 
       14  8420 1 1 28 LEU CG   C    1.531  -1.815  -1.645 1.00 . A A .  28 LEU CG   1 1 
       14  8421 1 1 28 LEU H    H    1.965  -4.462   1.356 1.00 . A A .  28 LEU H    1 1 
       14  8422 1 1 28 LEU HA   H    2.417  -1.732   1.208 1.00 . A A .  28 LEU HA   1 1 
       14  8423 1 1 28 LEU HB2  H    3.016  -2.977  -0.666 1.00 . A A .  28 LEU HB2  1 1 
       14  8424 1 1 28 LEU HB3  H    1.437  -3.751  -0.772 1.00 . A A .  28 LEU HB3  1 1 
       14  8425 1 1 28 LEU HD11 H    1.966   0.196  -2.227 1.00 . A A .  28 LEU HD11 1 1 
       14  8426 1 1 28 LEU HD12 H    3.338  -0.674  -1.543 1.00 . A A .  28 LEU HD12 1 1 
       14  8427 1 1 28 LEU HD13 H    2.049  -0.091  -0.489 1.00 . A A .  28 LEU HD13 1 1 
       14  8428 1 1 28 LEU HD21 H    2.204  -1.615  -3.666 1.00 . A A .  28 LEU HD21 1 1 
       14  8429 1 1 28 LEU HD22 H    0.841  -2.716  -3.459 1.00 . A A .  28 LEU HD22 1 1 
       14  8430 1 1 28 LEU HD23 H    2.461  -3.215  -2.969 1.00 . A A .  28 LEU HD23 1 1 
       14  8431 1 1 28 LEU HG   H    0.473  -1.615  -1.547 1.00 . A A .  28 LEU HG   1 1 
       14  8432 1 1 28 LEU N    N    1.711  -3.597   1.740 1.00 . A A .  28 LEU N    1 1 
       14  8433 1 1 28 LEU O    O    0.208  -0.549   1.250 1.00 . A A .  28 LEU O    1 1 
       14  8434 1 1 29 ILE C    C   -2.289  -1.028   1.943 1.00 . A A .  29 ILE C    1 1 
       14  8435 1 1 29 ILE CA   C   -2.115  -1.979   0.763 1.00 . A A .  29 ILE CA   1 1 
       14  8436 1 1 29 ILE CB   C   -3.157  -3.109   0.872 1.00 . A A .  29 ILE CB   1 1 
       14  8437 1 1 29 ILE CD1  C   -3.753  -5.366  -0.141 1.00 . A A .  29 ILE CD1  1 1 
       14  8438 1 1 29 ILE CG1  C   -3.067  -4.033  -0.344 1.00 . A A .  29 ILE CG1  1 1 
       14  8439 1 1 29 ILE CG2  C   -4.557  -2.528   1.000 1.00 . A A .  29 ILE CG2  1 1 
       14  8440 1 1 29 ILE H    H   -0.622  -3.452   0.484 1.00 . A A .  29 ILE H    1 1 
       14  8441 1 1 29 ILE HA   H   -2.297  -1.436  -0.153 1.00 . A A .  29 ILE HA   1 1 
       14  8442 1 1 29 ILE HB   H   -2.946  -3.678   1.764 1.00 . A A .  29 ILE HB   1 1 
       14  8443 1 1 29 ILE HD11 H   -4.819  -5.247  -0.274 1.00 . A A .  29 ILE HD11 1 1 
       14  8444 1 1 29 ILE HD12 H   -3.379  -6.077  -0.864 1.00 . A A .  29 ILE HD12 1 1 
       14  8445 1 1 29 ILE HD13 H   -3.553  -5.727   0.856 1.00 . A A .  29 ILE HD13 1 1 
       14  8446 1 1 29 ILE HG12 H   -3.528  -3.550  -1.191 1.00 . A A .  29 ILE HG12 1 1 
       14  8447 1 1 29 ILE HG13 H   -2.027  -4.224  -0.566 1.00 . A A .  29 ILE HG13 1 1 
       14  8448 1 1 29 ILE HG21 H   -5.078  -2.633   0.060 1.00 . A A .  29 ILE HG21 1 1 
       14  8449 1 1 29 ILE HG22 H   -5.097  -3.057   1.771 1.00 . A A .  29 ILE HG22 1 1 
       14  8450 1 1 29 ILE HG23 H   -4.491  -1.482   1.260 1.00 . A A .  29 ILE HG23 1 1 
       14  8451 1 1 29 ILE N    N   -0.759  -2.509   0.710 1.00 . A A .  29 ILE N    1 1 
       14  8452 1 1 29 ILE O    O   -2.681   0.126   1.771 1.00 . A A .  29 ILE O    1 1 
       14  8453 1 1 30 VAL C    C   -1.383   0.617   4.197 1.00 . A A .  30 VAL C    1 1 
       14  8454 1 1 30 VAL CA   C   -2.110  -0.714   4.350 1.00 . A A .  30 VAL CA   1 1 
       14  8455 1 1 30 VAL CB   C   -1.548  -1.456   5.577 1.00 . A A .  30 VAL CB   1 1 
       14  8456 1 1 30 VAL CG1  C   -1.603  -0.567   6.810 1.00 . A A .  30 VAL CG1  1 1 
       14  8457 1 1 30 VAL CG2  C   -2.309  -2.752   5.811 1.00 . A A .  30 VAL CG2  1 1 
       14  8458 1 1 30 VAL H    H   -1.683  -2.448   3.214 1.00 . A A .  30 VAL H    1 1 
       14  8459 1 1 30 VAL HA   H   -3.160  -0.522   4.521 1.00 . A A .  30 VAL HA   1 1 
       14  8460 1 1 30 VAL HB   H   -0.514  -1.700   5.382 1.00 . A A .  30 VAL HB   1 1 
       14  8461 1 1 30 VAL HG11 H   -1.314   0.439   6.541 1.00 . A A .  30 VAL HG11 1 1 
       14  8462 1 1 30 VAL HG12 H   -2.607  -0.561   7.206 1.00 . A A .  30 VAL HG12 1 1 
       14  8463 1 1 30 VAL HG13 H   -0.923  -0.947   7.558 1.00 . A A .  30 VAL HG13 1 1 
       14  8464 1 1 30 VAL HG21 H   -1.788  -3.349   6.544 1.00 . A A .  30 VAL HG21 1 1 
       14  8465 1 1 30 VAL HG22 H   -3.302  -2.526   6.170 1.00 . A A .  30 VAL HG22 1 1 
       14  8466 1 1 30 VAL HG23 H   -2.379  -3.301   4.883 1.00 . A A .  30 VAL HG23 1 1 
       14  8467 1 1 30 VAL N    N   -1.991  -1.521   3.141 1.00 . A A .  30 VAL N    1 1 
       14  8468 1 1 30 VAL O    O   -1.834   1.645   4.703 1.00 . A A .  30 VAL O    1 1 
       14  8469 1 1 31 HIS C    C   -0.046   2.626   2.133 1.00 . A A .  31 HIS C    1 1 
       14  8470 1 1 31 HIS CA   C    0.536   1.796   3.274 1.00 . A A .  31 HIS CA   1 1 
       14  8471 1 1 31 HIS CB   C    1.988   1.430   2.964 1.00 . A A .  31 HIS CB   1 1 
       14  8472 1 1 31 HIS CD2  C    3.176   3.118   1.393 1.00 . A A .  31 HIS CD2  1 1 
       14  8473 1 1 31 HIS CE1  C    4.132   4.362   2.924 1.00 . A A .  31 HIS CE1  1 1 
       14  8474 1 1 31 HIS CG   C    2.839   2.608   2.601 1.00 . A A .  31 HIS CG   1 1 
       14  8475 1 1 31 HIS H    H    0.054  -0.259   3.116 1.00 . A A .  31 HIS H    1 1 
       14  8476 1 1 31 HIS HA   H    0.508   2.383   4.180 1.00 . A A .  31 HIS HA   1 1 
       14  8477 1 1 31 HIS HB2  H    2.427   0.960   3.831 1.00 . A A .  31 HIS HB2  1 1 
       14  8478 1 1 31 HIS HB3  H    2.009   0.737   2.135 1.00 . A A .  31 HIS HB3  1 1 
       14  8479 1 1 31 HIS HD1  H    3.400   3.298   4.510 1.00 . A A .  31 HIS HD1  1 1 
       14  8480 1 1 31 HIS HD2  H    2.870   2.738   0.428 1.00 . A A .  31 HIS HD2  1 1 
       14  8481 1 1 31 HIS HE1  H    4.712   5.136   3.404 1.00 . A A .  31 HIS HE1  1 1 
       14  8482 1 1 31 HIS N    N   -0.254   0.591   3.495 1.00 . A A .  31 HIS N    1 1 
       14  8483 1 1 31 HIS ND1  N    3.454   3.410   3.539 1.00 . A A .  31 HIS ND1  1 1 
       14  8484 1 1 31 HIS NE2  N    3.980   4.207   1.621 1.00 . A A .  31 HIS NE2  1 1 
       14  8485 1 1 31 HIS O    O    0.234   3.819   2.016 1.00 . A A .  31 HIS O    1 1 
       14  8486 1 1 32 GLN C    C   -2.789   3.323   0.577 1.00 . A A .  32 GLN C    1 1 
       14  8487 1 1 32 GLN CA   C   -1.476   2.666   0.165 1.00 . A A .  32 GLN CA   1 1 
       14  8488 1 1 32 GLN CB   C   -1.723   1.679  -0.977 1.00 . A A .  32 GLN CB   1 1 
       14  8489 1 1 32 GLN CD   C   -0.694   0.477  -2.947 1.00 . A A .  32 GLN CD   1 1 
       14  8490 1 1 32 GLN CG   C   -0.446   1.153  -1.613 1.00 . A A .  32 GLN CG   1 1 
       14  8491 1 1 32 GLN H    H   -1.041   1.036   1.442 1.00 . A A .  32 GLN H    1 1 
       14  8492 1 1 32 GLN HA   H   -0.796   3.432  -0.175 1.00 . A A .  32 GLN HA   1 1 
       14  8493 1 1 32 GLN HB2  H   -2.283   0.839  -0.596 1.00 . A A .  32 GLN HB2  1 1 
       14  8494 1 1 32 GLN HB3  H   -2.304   2.171  -1.743 1.00 . A A .  32 GLN HB3  1 1 
       14  8495 1 1 32 GLN HE21 H    0.659   1.644  -3.818 1.00 . A A .  32 GLN HE21 1 1 
       14  8496 1 1 32 GLN HE22 H   -0.119   0.498  -4.850 1.00 . A A .  32 GLN HE22 1 1 
       14  8497 1 1 32 GLN HG2  H    0.232   1.979  -1.766 1.00 . A A .  32 GLN HG2  1 1 
       14  8498 1 1 32 GLN HG3  H    0.006   0.437  -0.942 1.00 . A A .  32 GLN HG3  1 1 
       14  8499 1 1 32 GLN N    N   -0.856   1.987   1.296 1.00 . A A .  32 GLN N    1 1 
       14  8500 1 1 32 GLN NE2  N    0.020   0.918  -3.976 1.00 . A A .  32 GLN NE2  1 1 
       14  8501 1 1 32 GLN O    O   -3.238   4.282  -0.050 1.00 . A A .  32 GLN O    1 1 
       14  8502 1 1 32 GLN OE1  O   -1.518  -0.432  -3.052 1.00 . A A .  32 GLN OE1  1 1 
       14  8503 1 1 33 ARG C    C   -4.555   4.837   2.382 1.00 . A A .  33 ARG C    1 1 
       14  8504 1 1 33 ARG CA   C   -4.662   3.336   2.130 1.00 . A A .  33 ARG CA   1 1 
       14  8505 1 1 33 ARG CB   C   -5.074   2.620   3.418 1.00 . A A .  33 ARG CB   1 1 
       14  8506 1 1 33 ARG CD   C   -6.136   0.574   4.420 1.00 . A A .  33 ARG CD   1 1 
       14  8507 1 1 33 ARG CG   C   -5.400   1.148   3.219 1.00 . A A .  33 ARG CG   1 1 
       14  8508 1 1 33 ARG CZ   C   -7.960   2.073   5.105 1.00 . A A .  33 ARG CZ   1 1 
       14  8509 1 1 33 ARG H    H   -2.992   2.036   2.094 1.00 . A A .  33 ARG H    1 1 
       14  8510 1 1 33 ARG HA   H   -5.415   3.162   1.376 1.00 . A A .  33 ARG HA   1 1 
       14  8511 1 1 33 ARG HB2  H   -4.267   2.694   4.132 1.00 . A A .  33 ARG HB2  1 1 
       14  8512 1 1 33 ARG HB3  H   -5.948   3.108   3.823 1.00 . A A .  33 ARG HB3  1 1 
       14  8513 1 1 33 ARG HD2  H   -6.096  -0.504   4.368 1.00 . A A .  33 ARG HD2  1 1 
       14  8514 1 1 33 ARG HD3  H   -5.644   0.909   5.321 1.00 . A A .  33 ARG HD3  1 1 
       14  8515 1 1 33 ARG HE   H   -8.186   0.445   3.976 1.00 . A A .  33 ARG HE   1 1 
       14  8516 1 1 33 ARG HG2  H   -6.024   1.042   2.344 1.00 . A A .  33 ARG HG2  1 1 
       14  8517 1 1 33 ARG HG3  H   -4.480   0.602   3.077 1.00 . A A .  33 ARG HG3  1 1 
       14  8518 1 1 33 ARG HH11 H   -6.128   2.600   5.776 1.00 . A A .  33 ARG HH11 1 1 
       14  8519 1 1 33 ARG HH12 H   -7.423   3.649   6.252 1.00 . A A .  33 ARG HH12 1 1 
       14  8520 1 1 33 ARG HH21 H   -9.899   1.818   4.596 1.00 . A A .  33 ARG HH21 1 1 
       14  8521 1 1 33 ARG HH22 H   -9.567   3.202   5.581 1.00 . A A .  33 ARG HH22 1 1 
       14  8522 1 1 33 ARG N    N   -3.400   2.801   1.635 1.00 . A A .  33 ARG N    1 1 
       14  8523 1 1 33 ARG NE   N   -7.534   0.994   4.458 1.00 . A A .  33 ARG NE   1 1 
       14  8524 1 1 33 ARG NH1  N   -7.100   2.836   5.766 1.00 . A A .  33 ARG NH1  1 1 
       14  8525 1 1 33 ARG NH2  N   -9.248   2.391   5.093 1.00 . A A .  33 ARG NH2  1 1 
       14  8526 1 1 33 ARG O    O   -5.496   5.590   2.126 1.00 . A A .  33 ARG O    1 1 
       14  8527 1 1 34 THR C    C   -2.988   7.477   1.892 1.00 . A A .  34 THR C    1 1 
       14  8528 1 1 34 THR CA   C   -3.173   6.676   3.175 1.00 . A A .  34 THR CA   1 1 
       14  8529 1 1 34 THR CB   C   -1.935   6.872   4.071 1.00 . A A .  34 THR CB   1 1 
       14  8530 1 1 34 THR CG2  C   -0.670   6.430   3.351 1.00 . A A .  34 THR CG2  1 1 
       14  8531 1 1 34 THR H    H   -2.691   4.618   3.070 1.00 . A A .  34 THR H    1 1 
       14  8532 1 1 34 THR HA   H   -4.037   7.054   3.703 1.00 . A A .  34 THR HA   1 1 
       14  8533 1 1 34 THR HB   H   -2.054   6.269   4.961 1.00 . A A .  34 THR HB   1 1 
       14  8534 1 1 34 THR HG1  H   -1.422   8.746   3.732 1.00 . A A .  34 THR HG1  1 1 
       14  8535 1 1 34 THR HG21 H    0.087   6.175   4.077 1.00 . A A .  34 THR HG21 1 1 
       14  8536 1 1 34 THR HG22 H   -0.312   7.234   2.725 1.00 . A A .  34 THR HG22 1 1 
       14  8537 1 1 34 THR HG23 H   -0.887   5.567   2.739 1.00 . A A .  34 THR HG23 1 1 
       14  8538 1 1 34 THR N    N   -3.403   5.266   2.887 1.00 . A A .  34 THR N    1 1 
       14  8539 1 1 34 THR O    O   -3.447   8.615   1.786 1.00 . A A .  34 THR O    1 1 
       14  8540 1 1 34 THR OG1  O   -1.818   8.247   4.451 1.00 . A A .  34 THR OG1  1 1 
       14  8541 1 1 35 HIS C    C   -3.378   7.752  -1.119 1.00 . A A .  35 HIS C    1 1 
       14  8542 1 1 35 HIS CA   C   -2.071   7.534  -0.363 1.00 . A A .  35 HIS CA   1 1 
       14  8543 1 1 35 HIS CB   C   -1.109   6.703  -1.212 1.00 . A A .  35 HIS CB   1 1 
       14  8544 1 1 35 HIS CD2  C    1.326   6.299  -0.417 1.00 . A A .  35 HIS CD2  1 1 
       14  8545 1 1 35 HIS CE1  C    2.179   8.233  -0.999 1.00 . A A .  35 HIS CE1  1 1 
       14  8546 1 1 35 HIS CG   C    0.334   7.029  -0.976 1.00 . A A .  35 HIS CG   1 1 
       14  8547 1 1 35 HIS H    H   -1.974   5.969   1.060 1.00 . A A .  35 HIS H    1 1 
       14  8548 1 1 35 HIS HA   H   -1.621   8.494  -0.161 1.00 . A A .  35 HIS HA   1 1 
       14  8549 1 1 35 HIS HB2  H   -1.253   5.656  -0.988 1.00 . A A .  35 HIS HB2  1 1 
       14  8550 1 1 35 HIS HB3  H   -1.322   6.875  -2.258 1.00 . A A .  35 HIS HB3  1 1 
       14  8551 1 1 35 HIS HD1  H    0.434   8.982  -1.760 1.00 . A A .  35 HIS HD1  1 1 
       14  8552 1 1 35 HIS HD2  H    1.241   5.295  -0.023 1.00 . A A .  35 HIS HD2  1 1 
       14  8553 1 1 35 HIS HE1  H    2.875   9.043  -1.156 1.00 . A A .  35 HIS HE1  1 1 
       14  8554 1 1 35 HIS N    N   -2.314   6.876   0.916 1.00 . A A .  35 HIS N    1 1 
       14  8555 1 1 35 HIS ND1  N    0.900   8.236  -1.329 1.00 . A A .  35 HIS ND1  1 1 
       14  8556 1 1 35 HIS NE2  N    2.463   7.069  -0.443 1.00 . A A .  35 HIS NE2  1 1 
       14  8557 1 1 35 HIS O    O   -3.546   8.757  -1.809 1.00 . A A .  35 HIS O    1 1 
       14  8558 1 1 36 SER C    C   -6.613   7.605  -0.783 1.00 . A A .  36 SER C    1 1 
       14  8559 1 1 36 SER CA   C   -5.589   6.890  -1.659 1.00 . A A .  36 SER CA   1 1 
       14  8560 1 1 36 SER CB   C   -6.095   5.492  -2.019 1.00 . A A .  36 SER CB   1 1 
       14  8561 1 1 36 SER H    H   -4.105   6.026  -0.421 1.00 . A A .  36 SER H    1 1 
       14  8562 1 1 36 SER HA   H   -5.451   7.458  -2.567 1.00 . A A .  36 SER HA   1 1 
       14  8563 1 1 36 SER HB2  H   -5.254   4.853  -2.242 1.00 . A A .  36 SER HB2  1 1 
       14  8564 1 1 36 SER HB3  H   -6.644   5.085  -1.182 1.00 . A A .  36 SER HB3  1 1 
       14  8565 1 1 36 SER HG   H   -6.859   4.719  -3.649 1.00 . A A .  36 SER HG   1 1 
       14  8566 1 1 36 SER N    N   -4.299   6.804  -0.985 1.00 . A A .  36 SER N    1 1 
       14  8567 1 1 36 SER O    O   -7.495   6.975  -0.200 1.00 . A A .  36 SER O    1 1 
       14  8568 1 1 36 SER OG   O   -6.950   5.533  -3.149 1.00 . A A .  36 SER OG   1 1 
       14  8569 1 1 37 GLY C    C   -6.753  10.274   1.354 1.00 . A A .  37 GLY C    1 1 
       14  8570 1 1 37 GLY CA   C   -7.410   9.705   0.111 1.00 . A A .  37 GLY CA   1 1 
       14  8571 1 1 37 GLY H    H   -5.766   9.374  -1.182 1.00 . A A .  37 GLY H    1 1 
       14  8572 1 1 37 GLY HA2  H   -7.793  10.519  -0.485 1.00 . A A .  37 GLY HA2  1 1 
       14  8573 1 1 37 GLY HA3  H   -8.232   9.073   0.411 1.00 . A A .  37 GLY HA3  1 1 
       14  8574 1 1 37 GLY N    N   -6.489   8.926  -0.695 1.00 . A A .  37 GLY N    1 1 
       14  8575 1 1 37 GLY O    O   -6.439   9.539   2.289 1.00 . A A .  37 GLY O    1 1 
       14  8576 1 1 38 GLU C    C   -6.716  13.484   2.915 1.00 . A A .  38 GLU C    1 1 
       14  8577 1 1 38 GLU CA   C   -5.918  12.252   2.498 1.00 . A A .  38 GLU CA   1 1 
       14  8578 1 1 38 GLU CB   C   -4.482  12.654   2.155 1.00 . A A .  38 GLU CB   1 1 
       14  8579 1 1 38 GLU CD   C   -2.516  13.976   3.033 1.00 . A A .  38 GLU CD   1 1 
       14  8580 1 1 38 GLU CG   C   -3.645  13.021   3.369 1.00 . A A .  38 GLU CG   1 1 
       14  8581 1 1 38 GLU H    H   -6.816  12.120   0.586 1.00 . A A .  38 GLU H    1 1 
       14  8582 1 1 38 GLU HA   H   -5.899  11.555   3.322 1.00 . A A .  38 GLU HA   1 1 
       14  8583 1 1 38 GLU HB2  H   -4.002  11.830   1.648 1.00 . A A .  38 GLU HB2  1 1 
       14  8584 1 1 38 GLU HB3  H   -4.508  13.506   1.492 1.00 . A A .  38 GLU HB3  1 1 
       14  8585 1 1 38 GLU HG2  H   -4.284  13.488   4.103 1.00 . A A .  38 GLU HG2  1 1 
       14  8586 1 1 38 GLU HG3  H   -3.221  12.118   3.785 1.00 . A A .  38 GLU HG3  1 1 
       14  8587 1 1 38 GLU N    N   -6.544  11.587   1.362 1.00 . A A .  38 GLU N    1 1 
       14  8588 1 1 38 GLU O    O   -7.123  14.287   2.075 1.00 . A A .  38 GLU O    1 1 
       14  8589 1 1 38 GLU OE1  O   -1.446  13.500   2.599 1.00 . A A .  38 GLU OE1  1 1 
       14  8590 1 1 38 GLU OE2  O   -2.702  15.199   3.204 1.00 . A A .  38 GLU OE2  1 1 
       14  8591 1 1 39 SER C    C   -6.890  16.051   4.616 1.00 . A A .  39 SER C    1 1 
       14  8592 1 1 39 SER CA   C   -7.689  14.758   4.747 1.00 . A A .  39 SER CA   1 1 
       14  8593 1 1 39 SER CB   C   -8.053  14.515   6.213 1.00 . A A .  39 SER CB   1 1 
       14  8594 1 1 39 SER H    H   -6.586  12.954   4.838 1.00 . A A .  39 SER H    1 1 
       14  8595 1 1 39 SER HA   H   -8.598  14.850   4.170 1.00 . A A .  39 SER HA   1 1 
       14  8596 1 1 39 SER HB2  H   -8.578  15.376   6.598 1.00 . A A .  39 SER HB2  1 1 
       14  8597 1 1 39 SER HB3  H   -8.688  13.644   6.284 1.00 . A A .  39 SER HB3  1 1 
       14  8598 1 1 39 SER HG   H   -6.697  15.091   7.505 1.00 . A A .  39 SER HG   1 1 
       14  8599 1 1 39 SER N    N   -6.936  13.627   4.218 1.00 . A A .  39 SER N    1 1 
       14  8600 1 1 39 SER O    O   -6.413  16.602   5.607 1.00 . A A .  39 SER O    1 1 
       14  8601 1 1 39 SER OG   O   -6.893  14.300   6.997 1.00 . A A .  39 SER OG   1 1 
       14  8602 1 1 40 GLY C    C   -6.837  18.997   3.411 1.00 . A A .  40 GLY C    1 1 
       14  8603 1 1 40 GLY CA   C   -6.008  17.756   3.145 1.00 . A A .  40 GLY CA   1 1 
       14  8604 1 1 40 GLY H    H   -7.153  16.050   2.631 1.00 . A A .  40 GLY H    1 1 
       14  8605 1 1 40 GLY HA2  H   -5.141  17.770   3.789 1.00 . A A .  40 GLY HA2  1 1 
       14  8606 1 1 40 GLY HA3  H   -5.680  17.769   2.116 1.00 . A A .  40 GLY HA3  1 1 
       14  8607 1 1 40 GLY N    N   -6.750  16.531   3.384 1.00 . A A .  40 GLY N    1 1 
       14  8608 1 1 40 GLY O    O   -6.720  19.636   4.456 1.00 . A A .  40 GLY O    1 1 
       14  8609 1 1 41 PRO C    C   -9.661  20.347   3.602 1.00 . A A .  41 PRO C    1 1 
       14  8610 1 1 41 PRO CA   C   -8.566  20.531   2.557 1.00 . A A .  41 PRO CA   1 1 
       14  8611 1 1 41 PRO CB   C   -9.176  20.655   1.159 1.00 . A A .  41 PRO CB   1 1 
       14  8612 1 1 41 PRO CD   C   -7.890  18.640   1.174 1.00 . A A .  41 PRO CD   1 1 
       14  8613 1 1 41 PRO CG   C   -9.127  19.275   0.601 1.00 . A A .  41 PRO CG   1 1 
       14  8614 1 1 41 PRO HA   H   -7.999  21.423   2.785 1.00 . A A .  41 PRO HA   1 1 
       14  8615 1 1 41 PRO HB2  H  -10.192  21.015   1.238 1.00 . A A .  41 PRO HB2  1 1 
       14  8616 1 1 41 PRO HB3  H   -8.590  21.341   0.566 1.00 . A A .  41 PRO HB3  1 1 
       14  8617 1 1 41 PRO HD2  H   -8.052  17.586   1.345 1.00 . A A .  41 PRO HD2  1 1 
       14  8618 1 1 41 PRO HD3  H   -7.048  18.793   0.515 1.00 . A A .  41 PRO HD3  1 1 
       14  8619 1 1 41 PRO HG2  H  -10.006  18.725   0.904 1.00 . A A .  41 PRO HG2  1 1 
       14  8620 1 1 41 PRO HG3  H   -9.062  19.317  -0.476 1.00 . A A .  41 PRO HG3  1 1 
       14  8621 1 1 41 PRO N    N   -7.698  19.355   2.446 1.00 . A A .  41 PRO N    1 1 
       14  8622 1 1 41 PRO O    O   -9.751  19.300   4.243 1.00 . A A .  41 PRO O    1 1 
       14  8623 1 1 42 SER C    C  -12.381  20.033   4.592 1.00 . A A .  42 SER C    1 1 
       14  8624 1 1 42 SER CA   C  -11.580  21.323   4.739 1.00 . A A .  42 SER CA   1 1 
       14  8625 1 1 42 SER CB   C  -12.501  22.532   4.564 1.00 . A A .  42 SER CB   1 1 
       14  8626 1 1 42 SER H    H  -10.369  22.179   3.227 1.00 . A A .  42 SER H    1 1 
       14  8627 1 1 42 SER HA   H  -11.145  21.353   5.726 1.00 . A A .  42 SER HA   1 1 
       14  8628 1 1 42 SER HB2  H  -13.254  22.522   5.337 1.00 . A A .  42 SER HB2  1 1 
       14  8629 1 1 42 SER HB3  H  -11.919  23.439   4.639 1.00 . A A .  42 SER HB3  1 1 
       14  8630 1 1 42 SER HG   H  -12.521  22.764   2.619 1.00 . A A .  42 SER HG   1 1 
       14  8631 1 1 42 SER N    N  -10.492  21.371   3.769 1.00 . A A .  42 SER N    1 1 
       14  8632 1 1 42 SER O    O  -13.184  19.889   3.670 1.00 . A A .  42 SER O    1 1 
       14  8633 1 1 42 SER OG   O  -13.144  22.504   3.301 1.00 . A A .  42 SER OG   1 1 
       14  8634 1 1 43 SER C    C  -13.777  17.675   6.689 1.00 . A A .  43 SER C    1 1 
       14  8635 1 1 43 SER CA   C  -12.854  17.817   5.482 1.00 . A A .  43 SER CA   1 1 
       14  8636 1 1 43 SER CB   C  -11.848  16.665   5.456 1.00 . A A .  43 SER CB   1 1 
       14  8637 1 1 43 SER H    H  -11.505  19.272   6.220 1.00 . A A .  43 SER H    1 1 
       14  8638 1 1 43 SER HA   H  -13.450  17.783   4.582 1.00 . A A .  43 SER HA   1 1 
       14  8639 1 1 43 SER HB2  H  -12.367  15.734   5.629 1.00 . A A .  43 SER HB2  1 1 
       14  8640 1 1 43 SER HB3  H  -11.365  16.634   4.490 1.00 . A A .  43 SER HB3  1 1 
       14  8641 1 1 43 SER HG   H  -10.617  15.971   6.813 1.00 . A A .  43 SER HG   1 1 
       14  8642 1 1 43 SER N    N  -12.157  19.097   5.509 1.00 . A A .  43 SER N    1 1 
       14  8643 1 1 43 SER O    O  -13.926  16.588   7.245 1.00 . A A .  43 SER O    1 1 
       14  8644 1 1 43 SER OG   O  -10.859  16.829   6.457 1.00 . A A .  43 SER OG   1 1 
       14  8645 1 1 44 GLY C    C  -15.890  20.124   8.520 1.00 . A A .  44 GLY C    1 1 
       14  8646 1 1 44 GLY CA   C  -15.295  18.761   8.226 1.00 . A A .  44 GLY CA   1 1 
       14  8647 1 1 44 GLY H    H  -14.237  19.621   6.605 1.00 . A A .  44 GLY H    1 1 
       14  8648 1 1 44 GLY HA2  H  -16.096  18.066   8.024 1.00 . A A .  44 GLY HA2  1 1 
       14  8649 1 1 44 GLY HA3  H  -14.749  18.424   9.095 1.00 . A A .  44 GLY HA3  1 1 
       14  8650 1 1 44 GLY N    N  -14.394  18.783   7.088 1.00 . A A .  44 GLY N    1 1 
       14  8651 1 1 44 GLY O    O  -17.000  20.192   9.044 1.00 . A A .  44 GLY O    1 1 
       14  8652 2 2  1 ZN  ZN   ZN   3.812   5.171  -0.537 1.00 . B A . 201 ZN  ZN   1 1 
       15  8653 1 1  1 GLY C    C   27.552  12.778  -8.336 1.00 . A A .   1 GLY C    1 1 
       15  8654 1 1  1 GLY CA   C   27.979  13.223  -9.720 1.00 . A A .   1 GLY CA   1 1 
       15  8655 1 1  1 GLY H1   H   29.679  14.387 -10.209 1.00 . A A .   1 GLY H1   1 1 
       15  8656 1 1  1 GLY HA2  H   27.099  13.464 -10.298 1.00 . A A .   1 GLY HA2  1 1 
       15  8657 1 1  1 GLY HA3  H   28.502  12.409 -10.202 1.00 . A A .   1 GLY HA3  1 1 
       15  8658 1 1  1 GLY N    N   28.850  14.384  -9.686 1.00 . A A .   1 GLY N    1 1 
       15  8659 1 1  1 GLY O    O   28.339  12.188  -7.596 1.00 . A A .   1 GLY O    1 1 
       15  8660 1 1  2 SER C    C   25.010  11.374  -6.752 1.00 . A A .   2 SER C    1 1 
       15  8661 1 1  2 SER CA   C   25.773  12.693  -6.676 1.00 . A A .   2 SER CA   1 1 
       15  8662 1 1  2 SER CB   C   24.857  13.796  -6.142 1.00 . A A .   2 SER CB   1 1 
       15  8663 1 1  2 SER H    H   25.723  13.535  -8.618 1.00 . A A .   2 SER H    1 1 
       15  8664 1 1  2 SER HA   H   26.609  12.573  -6.002 1.00 . A A .   2 SER HA   1 1 
       15  8665 1 1  2 SER HB2  H   24.551  13.551  -5.137 1.00 . A A .   2 SER HB2  1 1 
       15  8666 1 1  2 SER HB3  H   25.393  14.734  -6.137 1.00 . A A .   2 SER HB3  1 1 
       15  8667 1 1  2 SER HG   H   23.896  13.634  -7.842 1.00 . A A .   2 SER HG   1 1 
       15  8668 1 1  2 SER N    N   26.302  13.063  -7.984 1.00 . A A .   2 SER N    1 1 
       15  8669 1 1  2 SER O    O   23.938  11.230  -6.164 1.00 . A A .   2 SER O    1 1 
       15  8670 1 1  2 SER OG   O   23.701  13.934  -6.950 1.00 . A A .   2 SER OG   1 1 
       15  8671 1 1  3 SER C    C   25.002   8.316  -6.337 1.00 . A A .   3 SER C    1 1 
       15  8672 1 1  3 SER CA   C   24.941   9.109  -7.639 1.00 . A A .   3 SER CA   1 1 
       15  8673 1 1  3 SER CB   C   25.623   8.322  -8.760 1.00 . A A .   3 SER CB   1 1 
       15  8674 1 1  3 SER H    H   26.425  10.591  -7.927 1.00 . A A .   3 SER H    1 1 
       15  8675 1 1  3 SER HA   H   23.906   9.269  -7.902 1.00 . A A .   3 SER HA   1 1 
       15  8676 1 1  3 SER HB2  H   25.867   8.993  -9.570 1.00 . A A .   3 SER HB2  1 1 
       15  8677 1 1  3 SER HB3  H   26.529   7.872  -8.381 1.00 . A A .   3 SER HB3  1 1 
       15  8678 1 1  3 SER HG   H   25.067   7.038 -10.131 1.00 . A A .   3 SER HG   1 1 
       15  8679 1 1  3 SER N    N   25.570  10.415  -7.482 1.00 . A A .   3 SER N    1 1 
       15  8680 1 1  3 SER O    O   25.965   8.419  -5.579 1.00 . A A .   3 SER O    1 1 
       15  8681 1 1  3 SER OG   O   24.776   7.299  -9.254 1.00 . A A .   3 SER OG   1 1 
       15  8682 1 1  4 GLY C    C   23.891   5.237  -5.162 1.00 . A A .   4 GLY C    1 1 
       15  8683 1 1  4 GLY CA   C   23.918   6.725  -4.874 1.00 . A A .   4 GLY CA   1 1 
       15  8684 1 1  4 GLY H    H   23.223   7.482  -6.725 1.00 . A A .   4 GLY H    1 1 
       15  8685 1 1  4 GLY HA2  H   24.787   6.950  -4.274 1.00 . A A .   4 GLY HA2  1 1 
       15  8686 1 1  4 GLY HA3  H   23.030   6.988  -4.316 1.00 . A A .   4 GLY HA3  1 1 
       15  8687 1 1  4 GLY N    N   23.964   7.524  -6.084 1.00 . A A .   4 GLY N    1 1 
       15  8688 1 1  4 GLY O    O   24.889   4.665  -5.599 1.00 . A A .   4 GLY O    1 1 
       15  8689 1 1  5 SER C    C   21.127   2.810  -5.340 1.00 . A A .   5 SER C    1 1 
       15  8690 1 1  5 SER CA   C   22.595   3.177  -5.145 1.00 . A A .   5 SER CA   1 1 
       15  8691 1 1  5 SER CB   C   23.179   2.386  -3.973 1.00 . A A .   5 SER CB   1 1 
       15  8692 1 1  5 SER H    H   21.985   5.121  -4.567 1.00 . A A .   5 SER H    1 1 
       15  8693 1 1  5 SER HA   H   23.138   2.927  -6.044 1.00 . A A .   5 SER HA   1 1 
       15  8694 1 1  5 SER HB2  H   22.933   1.341  -4.089 1.00 . A A .   5 SER HB2  1 1 
       15  8695 1 1  5 SER HB3  H   24.253   2.504  -3.963 1.00 . A A .   5 SER HB3  1 1 
       15  8696 1 1  5 SER HG   H   22.604   3.802  -2.748 1.00 . A A .   5 SER HG   1 1 
       15  8697 1 1  5 SER N    N   22.746   4.609  -4.915 1.00 . A A .   5 SER N    1 1 
       15  8698 1 1  5 SER O    O   20.340   2.829  -4.393 1.00 . A A .   5 SER O    1 1 
       15  8699 1 1  5 SER OG   O   22.657   2.844  -2.738 1.00 . A A .   5 SER OG   1 1 
       15  8700 1 1  6 SER C    C   19.276   0.609  -7.151 1.00 . A A .   6 SER C    1 1 
       15  8701 1 1  6 SER CA   C   19.391   2.108  -6.896 1.00 . A A .   6 SER CA   1 1 
       15  8702 1 1  6 SER CB   C   18.906   2.885  -8.122 1.00 . A A .   6 SER CB   1 1 
       15  8703 1 1  6 SER H    H   21.439   2.480  -7.287 1.00 . A A .   6 SER H    1 1 
       15  8704 1 1  6 SER HA   H   18.772   2.366  -6.049 1.00 . A A .   6 SER HA   1 1 
       15  8705 1 1  6 SER HB2  H   19.578   2.704  -8.948 1.00 . A A .   6 SER HB2  1 1 
       15  8706 1 1  6 SER HB3  H   17.913   2.551  -8.386 1.00 . A A .   6 SER HB3  1 1 
       15  8707 1 1  6 SER HG   H   18.205   4.689  -8.421 1.00 . A A .   6 SER HG   1 1 
       15  8708 1 1  6 SER N    N   20.765   2.476  -6.575 1.00 . A A .   6 SER N    1 1 
       15  8709 1 1  6 SER O    O   20.280  -0.096  -7.243 1.00 . A A .   6 SER O    1 1 
       15  8710 1 1  6 SER OG   O   18.867   4.277  -7.861 1.00 . A A .   6 SER OG   1 1 
       15  8711 1 1  7 GLY C    C   17.876  -2.110  -6.237 1.00 . A A .   7 GLY C    1 1 
       15  8712 1 1  7 GLY CA   C   17.816  -1.286  -7.508 1.00 . A A .   7 GLY CA   1 1 
       15  8713 1 1  7 GLY H    H   17.278   0.736  -7.183 1.00 . A A .   7 GLY H    1 1 
       15  8714 1 1  7 GLY HA2  H   16.844  -1.411  -7.961 1.00 . A A .   7 GLY HA2  1 1 
       15  8715 1 1  7 GLY HA3  H   18.570  -1.646  -8.192 1.00 . A A .   7 GLY HA3  1 1 
       15  8716 1 1  7 GLY N    N   18.042   0.127  -7.265 1.00 . A A .   7 GLY N    1 1 
       15  8717 1 1  7 GLY O    O   17.169  -3.109  -6.102 1.00 . A A .   7 GLY O    1 1 
       15  8718 1 1  8 THR C    C   17.542  -2.969  -3.562 1.00 . A A .   8 THR C    1 1 
       15  8719 1 1  8 THR CA   C   18.874  -2.399  -4.037 1.00 . A A .   8 THR CA   1 1 
       15  8720 1 1  8 THR CB   C   19.444  -1.478  -2.942 1.00 . A A .   8 THR CB   1 1 
       15  8721 1 1  8 THR CG2  C   19.596  -2.228  -1.628 1.00 . A A .   8 THR CG2  1 1 
       15  8722 1 1  8 THR H    H   19.258  -0.888  -5.468 1.00 . A A .   8 THR H    1 1 
       15  8723 1 1  8 THR HA   H   19.568  -3.213  -4.191 1.00 . A A .   8 THR HA   1 1 
       15  8724 1 1  8 THR HB   H   18.759  -0.655  -2.793 1.00 . A A .   8 THR HB   1 1 
       15  8725 1 1  8 THR HG1  H   21.241  -0.754  -2.575 1.00 . A A .   8 THR HG1  1 1 
       15  8726 1 1  8 THR HG21 H   18.657  -2.216  -1.096 1.00 . A A .   8 THR HG21 1 1 
       15  8727 1 1  8 THR HG22 H   20.356  -1.751  -1.026 1.00 . A A .   8 THR HG22 1 1 
       15  8728 1 1  8 THR HG23 H   19.884  -3.249  -1.828 1.00 . A A .   8 THR HG23 1 1 
       15  8729 1 1  8 THR N    N   18.723  -1.692  -5.302 1.00 . A A .   8 THR N    1 1 
       15  8730 1 1  8 THR O    O   17.467  -4.120  -3.132 1.00 . A A .   8 THR O    1 1 
       15  8731 1 1  8 THR OG1  O   20.715  -0.959  -3.351 1.00 . A A .   8 THR OG1  1 1 
       15  8732 1 1  9 ARG C    C   14.921  -4.045  -3.580 1.00 . A A .   9 ARG C    1 1 
       15  8733 1 1  9 ARG CA   C   15.164  -2.581  -3.224 1.00 . A A .   9 ARG CA   1 1 
       15  8734 1 1  9 ARG CB   C   14.094  -1.703  -3.876 1.00 . A A .   9 ARG CB   1 1 
       15  8735 1 1  9 ARG CD   C   13.338   0.665  -4.247 1.00 . A A .   9 ARG CD   1 1 
       15  8736 1 1  9 ARG CG   C   14.016  -0.302  -3.290 1.00 . A A .   9 ARG CG   1 1 
       15  8737 1 1  9 ARG CZ   C   13.737   1.433  -6.549 1.00 . A A .   9 ARG CZ   1 1 
       15  8738 1 1  9 ARG H    H   16.617  -1.251  -3.997 1.00 . A A .   9 ARG H    1 1 
       15  8739 1 1  9 ARG HA   H   15.104  -2.469  -2.151 1.00 . A A .   9 ARG HA   1 1 
       15  8740 1 1  9 ARG HB2  H   14.311  -1.616  -4.930 1.00 . A A .   9 ARG HB2  1 1 
       15  8741 1 1  9 ARG HB3  H   13.132  -2.176  -3.752 1.00 . A A .   9 ARG HB3  1 1 
       15  8742 1 1  9 ARG HD2  H   12.434   0.208  -4.621 1.00 . A A .   9 ARG HD2  1 1 
       15  8743 1 1  9 ARG HD3  H   13.089   1.568  -3.709 1.00 . A A .   9 ARG HD3  1 1 
       15  8744 1 1  9 ARG HE   H   15.165   0.917  -5.256 1.00 . A A .   9 ARG HE   1 1 
       15  8745 1 1  9 ARG HG2  H   13.449  -0.338  -2.371 1.00 . A A .   9 ARG HG2  1 1 
       15  8746 1 1  9 ARG HG3  H   15.016   0.048  -3.084 1.00 . A A .   9 ARG HG3  1 1 
       15  8747 1 1  9 ARG HH11 H   11.793   1.348  -6.005 1.00 . A A .   9 ARG HH11 1 1 
       15  8748 1 1  9 ARG HH12 H   12.087   1.887  -7.625 1.00 . A A .   9 ARG HH12 1 1 
       15  8749 1 1  9 ARG HH21 H   15.566   1.626  -7.387 1.00 . A A .   9 ARG HH21 1 1 
       15  8750 1 1  9 ARG HH22 H   14.234   2.044  -8.410 1.00 . A A .   9 ARG HH22 1 1 
       15  8751 1 1  9 ARG N    N   16.493  -2.157  -3.645 1.00 . A A .   9 ARG N    1 1 
       15  8752 1 1  9 ARG NE   N   14.197   1.008  -5.377 1.00 . A A .   9 ARG NE   1 1 
       15  8753 1 1  9 ARG NH1  N   12.432   1.566  -6.742 1.00 . A A .   9 ARG NH1  1 1 
       15  8754 1 1  9 ARG NH2  N   14.582   1.725  -7.529 1.00 . A A .   9 ARG NH2  1 1 
       15  8755 1 1  9 ARG O    O   14.838  -4.402  -4.754 1.00 . A A .   9 ARG O    1 1 
       15  8756 1 1 10 GLU C    C   13.089  -6.636  -2.697 1.00 . A A .  10 GLU C    1 1 
       15  8757 1 1 10 GLU CA   C   14.579  -6.311  -2.763 1.00 . A A .  10 GLU CA   1 1 
       15  8758 1 1 10 GLU CB   C   15.337  -7.131  -1.716 1.00 . A A .  10 GLU CB   1 1 
       15  8759 1 1 10 GLU CD   C   17.431  -7.770  -2.977 1.00 . A A .  10 GLU CD   1 1 
       15  8760 1 1 10 GLU CG   C   16.847  -6.993  -1.813 1.00 . A A .  10 GLU CG   1 1 
       15  8761 1 1 10 GLU H    H   14.885  -4.542  -1.643 1.00 . A A .  10 GLU H    1 1 
       15  8762 1 1 10 GLU HA   H   14.948  -6.569  -3.744 1.00 . A A .  10 GLU HA   1 1 
       15  8763 1 1 10 GLU HB2  H   15.029  -6.809  -0.732 1.00 . A A .  10 GLU HB2  1 1 
       15  8764 1 1 10 GLU HB3  H   15.083  -8.173  -1.840 1.00 . A A .  10 GLU HB3  1 1 
       15  8765 1 1 10 GLU HG2  H   17.093  -5.949  -1.938 1.00 . A A .  10 GLU HG2  1 1 
       15  8766 1 1 10 GLU HG3  H   17.289  -7.359  -0.898 1.00 . A A .  10 GLU HG3  1 1 
       15  8767 1 1 10 GLU N    N   14.810  -4.887  -2.557 1.00 . A A .  10 GLU N    1 1 
       15  8768 1 1 10 GLU O    O   12.582  -7.441  -3.478 1.00 . A A .  10 GLU O    1 1 
       15  8769 1 1 10 GLU OE1  O   16.930  -7.605  -4.110 1.00 . A A .  10 GLU OE1  1 1 
       15  8770 1 1 10 GLU OE2  O   18.387  -8.542  -2.756 1.00 . A A .  10 GLU OE2  1 1 
       15  8771 1 1 11 LYS C    C   10.256  -6.285  -2.940 1.00 . A A .  11 LYS C    1 1 
       15  8772 1 1 11 LYS CA   C   10.961  -6.223  -1.588 1.00 . A A .  11 LYS CA   1 1 
       15  8773 1 1 11 LYS CB   C   10.352  -5.110  -0.733 1.00 . A A .  11 LYS CB   1 1 
       15  8774 1 1 11 LYS CD   C   11.655  -5.311   1.404 1.00 . A A .  11 LYS CD   1 1 
       15  8775 1 1 11 LYS CE   C   11.875  -3.910   1.955 1.00 . A A .  11 LYS CE   1 1 
       15  8776 1 1 11 LYS CG   C   10.292  -5.444   0.747 1.00 . A A .  11 LYS CG   1 1 
       15  8777 1 1 11 LYS H    H   12.854  -5.374  -1.165 1.00 . A A .  11 LYS H    1 1 
       15  8778 1 1 11 LYS HA   H   10.828  -7.168  -1.083 1.00 . A A .  11 LYS HA   1 1 
       15  8779 1 1 11 LYS HB2  H   10.943  -4.214  -0.856 1.00 . A A .  11 LYS HB2  1 1 
       15  8780 1 1 11 LYS HB3  H    9.346  -4.917  -1.078 1.00 . A A .  11 LYS HB3  1 1 
       15  8781 1 1 11 LYS HD2  H   11.725  -6.019   2.217 1.00 . A A .  11 LYS HD2  1 1 
       15  8782 1 1 11 LYS HD3  H   12.421  -5.524   0.672 1.00 . A A .  11 LYS HD3  1 1 
       15  8783 1 1 11 LYS HE2  H   10.917  -3.486   2.215 1.00 . A A .  11 LYS HE2  1 1 
       15  8784 1 1 11 LYS HE3  H   12.491  -3.978   2.839 1.00 . A A .  11 LYS HE3  1 1 
       15  8785 1 1 11 LYS HG2  H    9.603  -4.768   1.232 1.00 . A A .  11 LYS HG2  1 1 
       15  8786 1 1 11 LYS HG3  H    9.944  -6.460   0.864 1.00 . A A .  11 LYS HG3  1 1 
       15  8787 1 1 11 LYS HZ1  H   12.138  -2.067   1.007 1.00 . A A .  11 LYS HZ1  1 1 
       15  8788 1 1 11 LYS HZ2  H   12.415  -3.400   0.003 1.00 . A A .  11 LYS HZ2  1 1 
       15  8789 1 1 11 LYS HZ3  H   13.563  -2.965   1.167 1.00 . A A .  11 LYS HZ3  1 1 
       15  8790 1 1 11 LYS N    N   12.393  -6.004  -1.758 1.00 . A A .  11 LYS N    1 1 
       15  8791 1 1 11 LYS NZ   N   12.545  -3.023   0.964 1.00 . A A .  11 LYS NZ   1 1 
       15  8792 1 1 11 LYS O    O   10.445  -5.430  -3.805 1.00 . A A .  11 LYS O    1 1 
       15  8793 1 1 12 PRO C    C    7.575  -6.472  -4.555 1.00 . A A .  12 PRO C    1 1 
       15  8794 1 1 12 PRO CA   C    8.671  -7.515  -4.370 1.00 . A A .  12 PRO CA   1 1 
       15  8795 1 1 12 PRO CB   C    8.060  -8.908  -4.199 1.00 . A A .  12 PRO CB   1 1 
       15  8796 1 1 12 PRO CD   C    9.150  -8.376  -2.139 1.00 . A A .  12 PRO CD   1 1 
       15  8797 1 1 12 PRO CG   C    7.972  -9.105  -2.725 1.00 . A A .  12 PRO CG   1 1 
       15  8798 1 1 12 PRO HA   H    9.322  -7.509  -5.232 1.00 . A A .  12 PRO HA   1 1 
       15  8799 1 1 12 PRO HB2  H    7.083  -8.935  -4.661 1.00 . A A .  12 PRO HB2  1 1 
       15  8800 1 1 12 PRO HB3  H    8.702  -9.646  -4.658 1.00 . A A .  12 PRO HB3  1 1 
       15  8801 1 1 12 PRO HD2  H    8.891  -7.951  -1.180 1.00 . A A .  12 PRO HD2  1 1 
       15  8802 1 1 12 PRO HD3  H    9.995  -9.041  -2.043 1.00 . A A .  12 PRO HD3  1 1 
       15  8803 1 1 12 PRO HG2  H    7.049  -8.686  -2.353 1.00 . A A .  12 PRO HG2  1 1 
       15  8804 1 1 12 PRO HG3  H    8.029 -10.158  -2.491 1.00 . A A .  12 PRO HG3  1 1 
       15  8805 1 1 12 PRO N    N    9.423  -7.319  -3.127 1.00 . A A .  12 PRO N    1 1 
       15  8806 1 1 12 PRO O    O    7.462  -5.858  -5.617 1.00 . A A .  12 PRO O    1 1 
       15  8807 1 1 13 TYR C    C    6.216  -3.880  -3.475 1.00 . A A .  13 TYR C    1 1 
       15  8808 1 1 13 TYR CA   C    5.682  -5.306  -3.567 1.00 . A A .  13 TYR CA   1 1 
       15  8809 1 1 13 TYR CB   C    4.689  -5.565  -2.432 1.00 . A A .  13 TYR CB   1 1 
       15  8810 1 1 13 TYR CD1  C    2.957  -7.186  -3.296 1.00 . A A .  13 TYR CD1  1 1 
       15  8811 1 1 13 TYR CD2  C    4.555  -7.983  -1.717 1.00 . A A .  13 TYR CD2  1 1 
       15  8812 1 1 13 TYR CE1  C    2.374  -8.437  -3.344 1.00 . A A .  13 TYR CE1  1 1 
       15  8813 1 1 13 TYR CE2  C    3.979  -9.238  -1.760 1.00 . A A .  13 TYR CE2  1 1 
       15  8814 1 1 13 TYR CG   C    4.055  -6.936  -2.482 1.00 . A A .  13 TYR CG   1 1 
       15  8815 1 1 13 TYR CZ   C    2.889  -9.460  -2.575 1.00 . A A .  13 TYR CZ   1 1 
       15  8816 1 1 13 TYR H    H    6.911  -6.794  -2.698 1.00 . A A .  13 TYR H    1 1 
       15  8817 1 1 13 TYR HA   H    5.172  -5.428  -4.511 1.00 . A A .  13 TYR HA   1 1 
       15  8818 1 1 13 TYR HB2  H    5.202  -5.472  -1.487 1.00 . A A .  13 TYR HB2  1 1 
       15  8819 1 1 13 TYR HB3  H    3.898  -4.831  -2.480 1.00 . A A .  13 TYR HB3  1 1 
       15  8820 1 1 13 TYR HD1  H    2.556  -6.383  -3.897 1.00 . A A .  13 TYR HD1  1 1 
       15  8821 1 1 13 TYR HD2  H    5.409  -7.806  -1.080 1.00 . A A .  13 TYR HD2  1 1 
       15  8822 1 1 13 TYR HE1  H    1.520  -8.611  -3.983 1.00 . A A .  13 TYR HE1  1 1 
       15  8823 1 1 13 TYR HE2  H    4.382 -10.039  -1.158 1.00 . A A .  13 TYR HE2  1 1 
       15  8824 1 1 13 TYR HH   H    2.264 -11.005  -3.534 1.00 . A A .  13 TYR HH   1 1 
       15  8825 1 1 13 TYR N    N    6.771  -6.275  -3.517 1.00 . A A .  13 TYR N    1 1 
       15  8826 1 1 13 TYR O    O    7.052  -3.573  -2.626 1.00 . A A .  13 TYR O    1 1 
       15  8827 1 1 13 TYR OH   O    2.311 -10.708  -2.622 1.00 . A A .  13 TYR OH   1 1 
       15  8828 1 1 14 GLU C    C    4.955  -0.684  -4.476 1.00 . A A .  14 GLU C    1 1 
       15  8829 1 1 14 GLU CA   C    6.156  -1.620  -4.376 1.00 . A A .  14 GLU CA   1 1 
       15  8830 1 1 14 GLU CB   C    7.108  -1.373  -5.548 1.00 . A A .  14 GLU CB   1 1 
       15  8831 1 1 14 GLU CD   C    9.414  -2.026  -6.346 1.00 . A A .  14 GLU CD   1 1 
       15  8832 1 1 14 GLU CG   C    8.575  -1.531  -5.184 1.00 . A A .  14 GLU CG   1 1 
       15  8833 1 1 14 GLU H    H    5.063  -3.320  -5.010 1.00 . A A .  14 GLU H    1 1 
       15  8834 1 1 14 GLU HA   H    6.677  -1.421  -3.453 1.00 . A A .  14 GLU HA   1 1 
       15  8835 1 1 14 GLU HB2  H    6.877  -2.072  -6.338 1.00 . A A .  14 GLU HB2  1 1 
       15  8836 1 1 14 GLU HB3  H    6.956  -0.368  -5.913 1.00 . A A .  14 GLU HB3  1 1 
       15  8837 1 1 14 GLU HG2  H    8.959  -0.574  -4.865 1.00 . A A .  14 GLU HG2  1 1 
       15  8838 1 1 14 GLU HG3  H    8.657  -2.239  -4.373 1.00 . A A .  14 GLU HG3  1 1 
       15  8839 1 1 14 GLU N    N    5.727  -3.014  -4.357 1.00 . A A .  14 GLU N    1 1 
       15  8840 1 1 14 GLU O    O    3.947  -1.012  -5.102 1.00 . A A .  14 GLU O    1 1 
       15  8841 1 1 14 GLU OE1  O    9.545  -1.283  -7.342 1.00 . A A .  14 GLU OE1  1 1 
       15  8842 1 1 14 GLU OE2  O    9.940  -3.155  -6.261 1.00 . A A .  14 GLU OE2  1 1 
       15  8843 1 1 15 CYS C    C    3.962   2.216  -5.199 1.00 . A A .  15 CYS C    1 1 
       15  8844 1 1 15 CYS CA   C    3.997   1.470  -3.869 1.00 . A A .  15 CYS CA   1 1 
       15  8845 1 1 15 CYS CB   C    4.171   2.464  -2.719 1.00 . A A .  15 CYS CB   1 1 
       15  8846 1 1 15 CYS H    H    5.900   0.689  -3.370 1.00 . A A .  15 CYS H    1 1 
       15  8847 1 1 15 CYS HA   H    3.062   0.945  -3.741 1.00 . A A .  15 CYS HA   1 1 
       15  8848 1 1 15 CYS HB2  H    4.347   1.916  -1.804 1.00 . A A .  15 CYS HB2  1 1 
       15  8849 1 1 15 CYS HB3  H    5.023   3.095  -2.924 1.00 . A A .  15 CYS HB3  1 1 
       15  8850 1 1 15 CYS N    N    5.071   0.485  -3.853 1.00 . A A .  15 CYS N    1 1 
       15  8851 1 1 15 CYS O    O    4.969   2.773  -5.636 1.00 . A A .  15 CYS O    1 1 
       15  8852 1 1 15 CYS SG   S    2.731   3.546  -2.447 1.00 . A A .  15 CYS SG   1 1 
       15  8853 1 1 16 SER C    C    2.379   4.387  -6.922 1.00 . A A .  16 SER C    1 1 
       15  8854 1 1 16 SER CA   C    2.632   2.896  -7.121 1.00 . A A .  16 SER CA   1 1 
       15  8855 1 1 16 SER CB   C    1.476   2.271  -7.904 1.00 . A A .  16 SER CB   1 1 
       15  8856 1 1 16 SER H    H    2.031   1.759  -5.439 1.00 . A A .  16 SER H    1 1 
       15  8857 1 1 16 SER HA   H    3.546   2.770  -7.682 1.00 . A A .  16 SER HA   1 1 
       15  8858 1 1 16 SER HB2  H    1.396   2.751  -8.868 1.00 . A A .  16 SER HB2  1 1 
       15  8859 1 1 16 SER HB3  H    1.667   1.217  -8.042 1.00 . A A .  16 SER HB3  1 1 
       15  8860 1 1 16 SER HG   H    0.423   2.615  -6.289 1.00 . A A .  16 SER HG   1 1 
       15  8861 1 1 16 SER N    N    2.797   2.222  -5.839 1.00 . A A .  16 SER N    1 1 
       15  8862 1 1 16 SER O    O    1.975   5.088  -7.850 1.00 . A A .  16 SER O    1 1 
       15  8863 1 1 16 SER OG   O    0.248   2.427  -7.214 1.00 . A A .  16 SER OG   1 1 
       15  8864 1 1 17 GLU C    C    3.751   6.974  -5.145 1.00 . A A .  17 GLU C    1 1 
       15  8865 1 1 17 GLU CA   C    2.417   6.273  -5.384 1.00 . A A .  17 GLU CA   1 1 
       15  8866 1 1 17 GLU CB   C    1.526   6.414  -4.148 1.00 . A A .  17 GLU CB   1 1 
       15  8867 1 1 17 GLU CD   C   -0.899   6.307  -4.846 1.00 . A A .  17 GLU CD   1 1 
       15  8868 1 1 17 GLU CG   C    0.263   5.571  -4.209 1.00 . A A .  17 GLU CG   1 1 
       15  8869 1 1 17 GLU H    H    2.941   4.256  -5.007 1.00 . A A .  17 GLU H    1 1 
       15  8870 1 1 17 GLU HA   H    1.926   6.738  -6.225 1.00 . A A .  17 GLU HA   1 1 
       15  8871 1 1 17 GLU HB2  H    2.090   6.117  -3.276 1.00 . A A .  17 GLU HB2  1 1 
       15  8872 1 1 17 GLU HB3  H    1.238   7.449  -4.044 1.00 . A A .  17 GLU HB3  1 1 
       15  8873 1 1 17 GLU HG2  H    0.466   4.682  -4.787 1.00 . A A .  17 GLU HG2  1 1 
       15  8874 1 1 17 GLU HG3  H   -0.016   5.290  -3.204 1.00 . A A .  17 GLU HG3  1 1 
       15  8875 1 1 17 GLU N    N    2.620   4.865  -5.705 1.00 . A A .  17 GLU N    1 1 
       15  8876 1 1 17 GLU O    O    3.977   8.085  -5.625 1.00 . A A .  17 GLU O    1 1 
       15  8877 1 1 17 GLU OE1  O   -0.694   6.934  -5.907 1.00 . A A .  17 GLU OE1  1 1 
       15  8878 1 1 17 GLU OE2  O   -2.014   6.257  -4.285 1.00 . A A .  17 GLU OE2  1 1 
       15  8879 1 1 18 CYS C    C    7.056   5.932  -4.546 1.00 . A A .  18 CYS C    1 1 
       15  8880 1 1 18 CYS CA   C    5.945   6.875  -4.094 1.00 . A A .  18 CYS CA   1 1 
       15  8881 1 1 18 CYS CB   C    6.070   7.147  -2.594 1.00 . A A .  18 CYS CB   1 1 
       15  8882 1 1 18 CYS H    H    4.396   5.434  -4.044 1.00 . A A .  18 CYS H    1 1 
       15  8883 1 1 18 CYS HA   H    6.041   7.808  -4.629 1.00 . A A .  18 CYS HA   1 1 
       15  8884 1 1 18 CYS HB2  H    7.046   7.565  -2.392 1.00 . A A .  18 CYS HB2  1 1 
       15  8885 1 1 18 CYS HB3  H    5.312   7.857  -2.299 1.00 . A A .  18 CYS HB3  1 1 
       15  8886 1 1 18 CYS N    N    4.633   6.317  -4.399 1.00 . A A .  18 CYS N    1 1 
       15  8887 1 1 18 CYS O    O    8.108   6.372  -5.009 1.00 . A A .  18 CYS O    1 1 
       15  8888 1 1 18 CYS SG   S    5.878   5.665  -1.551 1.00 . A A .  18 CYS SG   1 1 
       15  8889 1 1 19 GLY C    C    8.269   2.792  -3.647 1.00 . A A .  19 GLY C    1 1 
       15  8890 1 1 19 GLY CA   C    7.802   3.647  -4.808 1.00 . A A .  19 GLY CA   1 1 
       15  8891 1 1 19 GLY H    H    5.956   4.339  -4.034 1.00 . A A .  19 GLY H    1 1 
       15  8892 1 1 19 GLY HA2  H    7.371   3.006  -5.563 1.00 . A A .  19 GLY HA2  1 1 
       15  8893 1 1 19 GLY HA3  H    8.655   4.160  -5.229 1.00 . A A .  19 GLY HA3  1 1 
       15  8894 1 1 19 GLY N    N    6.813   4.632  -4.409 1.00 . A A .  19 GLY N    1 1 
       15  8895 1 1 19 GLY O    O    9.230   2.032  -3.773 1.00 . A A .  19 GLY O    1 1 
       15  8896 1 1 20 LYS C    C    8.101   0.669  -1.657 1.00 . A A .  20 LYS C    1 1 
       15  8897 1 1 20 LYS CA   C    7.941   2.149  -1.322 1.00 . A A .  20 LYS CA   1 1 
       15  8898 1 1 20 LYS CB   C    6.871   2.326  -0.243 1.00 . A A .  20 LYS CB   1 1 
       15  8899 1 1 20 LYS CD   C    6.629   2.921   2.186 1.00 . A A .  20 LYS CD   1 1 
       15  8900 1 1 20 LYS CE   C    6.950   2.489   3.609 1.00 . A A .  20 LYS CE   1 1 
       15  8901 1 1 20 LYS CG   C    7.383   2.083   1.167 1.00 . A A .  20 LYS CG   1 1 
       15  8902 1 1 20 LYS H    H    6.834   3.539  -2.473 1.00 . A A .  20 LYS H    1 1 
       15  8903 1 1 20 LYS HA   H    8.882   2.525  -0.950 1.00 . A A .  20 LYS HA   1 1 
       15  8904 1 1 20 LYS HB2  H    6.488   3.335  -0.295 1.00 . A A .  20 LYS HB2  1 1 
       15  8905 1 1 20 LYS HB3  H    6.065   1.633  -0.435 1.00 . A A .  20 LYS HB3  1 1 
       15  8906 1 1 20 LYS HD2  H    6.908   3.957   2.065 1.00 . A A .  20 LYS HD2  1 1 
       15  8907 1 1 20 LYS HD3  H    5.568   2.809   2.016 1.00 . A A .  20 LYS HD3  1 1 
       15  8908 1 1 20 LYS HE2  H    6.147   2.805   4.257 1.00 . A A .  20 LYS HE2  1 1 
       15  8909 1 1 20 LYS HE3  H    7.031   1.412   3.634 1.00 . A A .  20 LYS HE3  1 1 
       15  8910 1 1 20 LYS HG2  H    7.257   1.039   1.411 1.00 . A A .  20 LYS HG2  1 1 
       15  8911 1 1 20 LYS HG3  H    8.432   2.341   1.208 1.00 . A A .  20 LYS HG3  1 1 
       15  8912 1 1 20 LYS HZ1  H    8.560   3.808   3.427 1.00 . A A .  20 LYS HZ1  1 1 
       15  8913 1 1 20 LYS HZ2  H    8.954   2.344   4.179 1.00 . A A .  20 LYS HZ2  1 1 
       15  8914 1 1 20 LYS HZ3  H    8.085   3.522   5.026 1.00 . A A .  20 LYS HZ3  1 1 
       15  8915 1 1 20 LYS N    N    7.590   2.916  -2.512 1.00 . A A .  20 LYS N    1 1 
       15  8916 1 1 20 LYS NZ   N    8.227   3.082   4.094 1.00 . A A .  20 LYS NZ   1 1 
       15  8917 1 1 20 LYS O    O    7.934   0.262  -2.806 1.00 . A A .  20 LYS O    1 1 
       15  8918 1 1 21 ALA C    C    8.075  -2.343   0.370 1.00 . A A .  21 ALA C    1 1 
       15  8919 1 1 21 ALA CA   C    8.600  -1.564  -0.831 1.00 . A A .  21 ALA CA   1 1 
       15  8920 1 1 21 ALA CB   C   10.068  -1.887  -1.070 1.00 . A A .  21 ALA CB   1 1 
       15  8921 1 1 21 ALA H    H    8.541   0.255   0.249 1.00 . A A .  21 ALA H    1 1 
       15  8922 1 1 21 ALA HA   H    8.045  -1.858  -1.709 1.00 . A A .  21 ALA HA   1 1 
       15  8923 1 1 21 ALA HB1  H   10.516  -2.228  -0.149 1.00 . A A .  21 ALA HB1  1 1 
       15  8924 1 1 21 ALA HB2  H   10.147  -2.663  -1.818 1.00 . A A .  21 ALA HB2  1 1 
       15  8925 1 1 21 ALA HB3  H   10.580  -1.001  -1.414 1.00 . A A .  21 ALA HB3  1 1 
       15  8926 1 1 21 ALA N    N    8.422  -0.130  -0.645 1.00 . A A .  21 ALA N    1 1 
       15  8927 1 1 21 ALA O    O    8.066  -1.840   1.494 1.00 . A A .  21 ALA O    1 1 
       15  8928 1 1 22 PHE C    C    7.386  -5.894   0.897 1.00 . A A .  22 PHE C    1 1 
       15  8929 1 1 22 PHE CA   C    7.106  -4.422   1.187 1.00 . A A .  22 PHE CA   1 1 
       15  8930 1 1 22 PHE CB   C    5.601  -4.198   1.344 1.00 . A A .  22 PHE CB   1 1 
       15  8931 1 1 22 PHE CD1  C    5.149  -1.847   0.593 1.00 . A A .  22 PHE CD1  1 1 
       15  8932 1 1 22 PHE CD2  C    4.971  -2.348   2.917 1.00 . A A .  22 PHE CD2  1 1 
       15  8933 1 1 22 PHE CE1  C    4.810  -0.531   0.847 1.00 . A A .  22 PHE CE1  1 1 
       15  8934 1 1 22 PHE CE2  C    4.631  -1.034   3.177 1.00 . A A .  22 PHE CE2  1 1 
       15  8935 1 1 22 PHE CG   C    5.233  -2.769   1.624 1.00 . A A .  22 PHE CG   1 1 
       15  8936 1 1 22 PHE CZ   C    4.552  -0.124   2.141 1.00 . A A .  22 PHE CZ   1 1 
       15  8937 1 1 22 PHE H    H    7.668  -3.919  -0.792 1.00 . A A .  22 PHE H    1 1 
       15  8938 1 1 22 PHE HA   H    7.600  -4.148   2.106 1.00 . A A .  22 PHE HA   1 1 
       15  8939 1 1 22 PHE HB2  H    5.103  -4.496   0.434 1.00 . A A .  22 PHE HB2  1 1 
       15  8940 1 1 22 PHE HB3  H    5.238  -4.802   2.162 1.00 . A A .  22 PHE HB3  1 1 
       15  8941 1 1 22 PHE HD1  H    5.351  -2.165  -0.420 1.00 . A A .  22 PHE HD1  1 1 
       15  8942 1 1 22 PHE HD2  H    5.034  -3.058   3.729 1.00 . A A .  22 PHE HD2  1 1 
       15  8943 1 1 22 PHE HE1  H    4.749   0.177   0.034 1.00 . A A .  22 PHE HE1  1 1 
       15  8944 1 1 22 PHE HE2  H    4.430  -0.718   4.190 1.00 . A A .  22 PHE HE2  1 1 
       15  8945 1 1 22 PHE HZ   H    4.286   0.903   2.342 1.00 . A A .  22 PHE HZ   1 1 
       15  8946 1 1 22 PHE N    N    7.636  -3.574   0.125 1.00 . A A .  22 PHE N    1 1 
       15  8947 1 1 22 PHE O    O    7.845  -6.247  -0.189 1.00 . A A .  22 PHE O    1 1 
       15  8948 1 1 23 ILE C    C    6.037  -8.898   1.347 1.00 . A A .  23 ILE C    1 1 
       15  8949 1 1 23 ILE CA   C    7.327  -8.179   1.728 1.00 . A A .  23 ILE CA   1 1 
       15  8950 1 1 23 ILE CB   C    7.884  -8.801   3.023 1.00 . A A .  23 ILE CB   1 1 
       15  8951 1 1 23 ILE CD1  C    9.616  -8.401   4.844 1.00 . A A .  23 ILE CD1  1 1 
       15  8952 1 1 23 ILE CG1  C    9.195  -8.118   3.419 1.00 . A A .  23 ILE CG1  1 1 
       15  8953 1 1 23 ILE CG2  C    8.093 -10.297   2.845 1.00 . A A .  23 ILE CG2  1 1 
       15  8954 1 1 23 ILE H    H    6.743  -6.404   2.720 1.00 . A A .  23 ILE H    1 1 
       15  8955 1 1 23 ILE HA   H    8.054  -8.324   0.941 1.00 . A A .  23 ILE HA   1 1 
       15  8956 1 1 23 ILE HB   H    7.158  -8.654   3.807 1.00 . A A .  23 ILE HB   1 1 
       15  8957 1 1 23 ILE HD11 H   10.170  -7.556   5.230 1.00 . A A .  23 ILE HD11 1 1 
       15  8958 1 1 23 ILE HD12 H    8.740  -8.563   5.454 1.00 . A A .  23 ILE HD12 1 1 
       15  8959 1 1 23 ILE HD13 H   10.241  -9.281   4.868 1.00 . A A .  23 ILE HD13 1 1 
       15  8960 1 1 23 ILE HG12 H    9.983  -8.460   2.767 1.00 . A A .  23 ILE HG12 1 1 
       15  8961 1 1 23 ILE HG13 H    9.082  -7.049   3.311 1.00 . A A .  23 ILE HG13 1 1 
       15  8962 1 1 23 ILE HG21 H    8.915 -10.623   3.465 1.00 . A A .  23 ILE HG21 1 1 
       15  8963 1 1 23 ILE HG22 H    7.195 -10.822   3.134 1.00 . A A .  23 ILE HG22 1 1 
       15  8964 1 1 23 ILE HG23 H    8.317 -10.509   1.810 1.00 . A A .  23 ILE HG23 1 1 
       15  8965 1 1 23 ILE N    N    7.107  -6.746   1.877 1.00 . A A .  23 ILE N    1 1 
       15  8966 1 1 23 ILE O    O    6.050  -9.837   0.551 1.00 . A A .  23 ILE O    1 1 
       15  8967 1 1 24 ARG C    C    2.645  -8.000   1.119 1.00 . A A .  24 ARG C    1 1 
       15  8968 1 1 24 ARG CA   C    3.626  -9.047   1.638 1.00 . A A .  24 ARG CA   1 1 
       15  8969 1 1 24 ARG CB   C    3.063  -9.710   2.897 1.00 . A A .  24 ARG CB   1 1 
       15  8970 1 1 24 ARG CD   C    3.236 -11.814   4.260 1.00 . A A .  24 ARG CD   1 1 
       15  8971 1 1 24 ARG CG   C    4.003 -10.729   3.520 1.00 . A A .  24 ARG CG   1 1 
       15  8972 1 1 24 ARG CZ   C    4.257 -13.864   3.366 1.00 . A A .  24 ARG CZ   1 1 
       15  8973 1 1 24 ARG H    H    4.979  -7.696   2.544 1.00 . A A .  24 ARG H    1 1 
       15  8974 1 1 24 ARG HA   H    3.765  -9.801   0.877 1.00 . A A .  24 ARG HA   1 1 
       15  8975 1 1 24 ARG HB2  H    2.859  -8.945   3.631 1.00 . A A .  24 ARG HB2  1 1 
       15  8976 1 1 24 ARG HB3  H    2.141 -10.210   2.644 1.00 . A A .  24 ARG HB3  1 1 
       15  8977 1 1 24 ARG HD2  H    2.992 -11.454   5.248 1.00 . A A .  24 ARG HD2  1 1 
       15  8978 1 1 24 ARG HD3  H    2.326 -12.025   3.719 1.00 . A A .  24 ARG HD3  1 1 
       15  8979 1 1 24 ARG HE   H    4.366 -13.272   5.268 1.00 . A A .  24 ARG HE   1 1 
       15  8980 1 1 24 ARG HG2  H    4.591 -11.188   2.739 1.00 . A A .  24 ARG HG2  1 1 
       15  8981 1 1 24 ARG HG3  H    4.656 -10.223   4.216 1.00 . A A .  24 ARG HG3  1 1 
       15  8982 1 1 24 ARG HH11 H    3.253 -12.753   2.010 1.00 . A A .  24 ARG HH11 1 1 
       15  8983 1 1 24 ARG HH12 H    3.978 -14.201   1.393 1.00 . A A .  24 ARG HH12 1 1 
       15  8984 1 1 24 ARG HH21 H    5.325 -15.180   4.467 1.00 . A A .  24 ARG HH21 1 1 
       15  8985 1 1 24 ARG HH22 H    5.155 -15.581   2.792 1.00 . A A .  24 ARG HH22 1 1 
       15  8986 1 1 24 ARG N    N    4.925  -8.448   1.918 1.00 . A A .  24 ARG N    1 1 
       15  8987 1 1 24 ARG NE   N    4.012 -13.045   4.383 1.00 . A A .  24 ARG NE   1 1 
       15  8988 1 1 24 ARG NH1  N    3.790 -13.583   2.157 1.00 . A A .  24 ARG NH1  1 1 
       15  8989 1 1 24 ARG NH2  N    4.971 -14.966   3.557 1.00 . A A .  24 ARG NH2  1 1 
       15  8990 1 1 24 ARG O    O    2.558  -6.897   1.656 1.00 . A A .  24 ARG O    1 1 
       15  8991 1 1 25 ASN C    C    0.135  -6.724   0.561 1.00 . A A .  25 ASN C    1 1 
       15  8992 1 1 25 ASN CA   C    0.934  -7.445  -0.521 1.00 . A A .  25 ASN CA   1 1 
       15  8993 1 1 25 ASN CB   C   -0.014  -8.211  -1.446 1.00 . A A .  25 ASN CB   1 1 
       15  8994 1 1 25 ASN CG   C   -0.567  -7.340  -2.558 1.00 . A A .  25 ASN CG   1 1 
       15  8995 1 1 25 ASN H    H    2.022  -9.248  -0.314 1.00 . A A .  25 ASN H    1 1 
       15  8996 1 1 25 ASN HA   H    1.474  -6.712  -1.101 1.00 . A A .  25 ASN HA   1 1 
       15  8997 1 1 25 ASN HB2  H    0.519  -9.037  -1.893 1.00 . A A .  25 ASN HB2  1 1 
       15  8998 1 1 25 ASN HB3  H   -0.842  -8.593  -0.867 1.00 . A A .  25 ASN HB3  1 1 
       15  8999 1 1 25 ASN HD21 H   -0.747  -5.809  -1.302 1.00 . A A .  25 ASN HD21 1 1 
       15  9000 1 1 25 ASN HD22 H   -1.245  -5.509  -2.929 1.00 . A A .  25 ASN HD22 1 1 
       15  9001 1 1 25 ASN N    N    1.908  -8.354   0.071 1.00 . A A .  25 ASN N    1 1 
       15  9002 1 1 25 ASN ND2  N   -0.885  -6.094  -2.230 1.00 . A A .  25 ASN ND2  1 1 
       15  9003 1 1 25 ASN O    O    0.085  -5.495   0.595 1.00 . A A .  25 ASN O    1 1 
       15  9004 1 1 25 ASN OD1  O   -0.705  -7.784  -3.698 1.00 . A A .  25 ASN OD1  1 1 
       15  9005 1 1 26 SER C    C   -0.575  -5.747   3.164 1.00 . A A .  26 SER C    1 1 
       15  9006 1 1 26 SER CA   C   -1.287  -6.935   2.525 1.00 . A A .  26 SER CA   1 1 
       15  9007 1 1 26 SER CB   C   -1.576  -8.001   3.584 1.00 . A A .  26 SER CB   1 1 
       15  9008 1 1 26 SER H    H   -0.410  -8.473   1.364 1.00 . A A .  26 SER H    1 1 
       15  9009 1 1 26 SER HA   H   -2.222  -6.595   2.104 1.00 . A A .  26 SER HA   1 1 
       15  9010 1 1 26 SER HB2  H   -0.684  -8.585   3.755 1.00 . A A .  26 SER HB2  1 1 
       15  9011 1 1 26 SER HB3  H   -1.872  -7.519   4.504 1.00 . A A .  26 SER HB3  1 1 
       15  9012 1 1 26 SER HG   H   -3.175  -8.413   2.530 1.00 . A A .  26 SER HG   1 1 
       15  9013 1 1 26 SER N    N   -0.488  -7.499   1.444 1.00 . A A .  26 SER N    1 1 
       15  9014 1 1 26 SER O    O   -1.210  -4.771   3.562 1.00 . A A .  26 SER O    1 1 
       15  9015 1 1 26 SER OG   O   -2.616  -8.867   3.165 1.00 . A A .  26 SER OG   1 1 
       15  9016 1 1 27 GLN C    C    1.482  -3.508   2.999 1.00 . A A .  27 GLN C    1 1 
       15  9017 1 1 27 GLN CA   C    1.546  -4.771   3.850 1.00 . A A .  27 GLN CA   1 1 
       15  9018 1 1 27 GLN CB   C    3.000  -5.221   4.008 1.00 . A A .  27 GLN CB   1 1 
       15  9019 1 1 27 GLN CD   C    3.319  -6.252   6.293 1.00 . A A .  27 GLN CD   1 1 
       15  9020 1 1 27 GLN CG   C    3.156  -6.505   4.807 1.00 . A A .  27 GLN CG   1 1 
       15  9021 1 1 27 GLN H    H    1.196  -6.642   2.923 1.00 . A A .  27 GLN H    1 1 
       15  9022 1 1 27 GLN HA   H    1.139  -4.554   4.826 1.00 . A A .  27 GLN HA   1 1 
       15  9023 1 1 27 GLN HB2  H    3.424  -5.379   3.027 1.00 . A A .  27 GLN HB2  1 1 
       15  9024 1 1 27 GLN HB3  H    3.553  -4.441   4.510 1.00 . A A .  27 GLN HB3  1 1 
       15  9025 1 1 27 GLN HE21 H    4.775  -7.602   6.388 1.00 . A A .  27 GLN HE21 1 1 
       15  9026 1 1 27 GLN HE22 H    4.378  -6.819   7.876 1.00 . A A .  27 GLN HE22 1 1 
       15  9027 1 1 27 GLN HG2  H    2.279  -7.117   4.657 1.00 . A A .  27 GLN HG2  1 1 
       15  9028 1 1 27 GLN HG3  H    4.027  -7.033   4.449 1.00 . A A .  27 GLN HG3  1 1 
       15  9029 1 1 27 GLN N    N    0.747  -5.838   3.259 1.00 . A A .  27 GLN N    1 1 
       15  9030 1 1 27 GLN NE2  N    4.251  -6.963   6.916 1.00 . A A .  27 GLN NE2  1 1 
       15  9031 1 1 27 GLN O    O    1.309  -2.404   3.519 1.00 . A A .  27 GLN O    1 1 
       15  9032 1 1 27 GLN OE1  O    2.615  -5.425   6.874 1.00 . A A .  27 GLN OE1  1 1 
       15  9033 1 1 28 LEU C    C    0.210  -1.883   0.777 1.00 . A A .  28 LEU C    1 1 
       15  9034 1 1 28 LEU CA   C    1.583  -2.547   0.764 1.00 . A A .  28 LEU CA   1 1 
       15  9035 1 1 28 LEU CB   C    1.925  -3.011  -0.653 1.00 . A A .  28 LEU CB   1 1 
       15  9036 1 1 28 LEU CD1  C    2.111  -0.737  -1.690 1.00 . A A .  28 LEU CD1  1 1 
       15  9037 1 1 28 LEU CD2  C    1.742  -2.743  -3.138 1.00 . A A .  28 LEU CD2  1 1 
       15  9038 1 1 28 LEU CG   C    1.451  -2.104  -1.789 1.00 . A A .  28 LEU CG   1 1 
       15  9039 1 1 28 LEU H    H    1.760  -4.578   1.334 1.00 . A A .  28 LEU H    1 1 
       15  9040 1 1 28 LEU HA   H    2.321  -1.828   1.087 1.00 . A A .  28 LEU HA   1 1 
       15  9041 1 1 28 LEU HB2  H    2.998  -3.096  -0.723 1.00 . A A .  28 LEU HB2  1 1 
       15  9042 1 1 28 LEU HB3  H    1.478  -3.985  -0.798 1.00 . A A .  28 LEU HB3  1 1 
       15  9043 1 1 28 LEU HD11 H    1.877  -0.160  -2.572 1.00 . A A .  28 LEU HD11 1 1 
       15  9044 1 1 28 LEU HD12 H    3.182  -0.859  -1.613 1.00 . A A .  28 LEU HD12 1 1 
       15  9045 1 1 28 LEU HD13 H    1.744  -0.222  -0.815 1.00 . A A .  28 LEU HD13 1 1 
       15  9046 1 1 28 LEU HD21 H    0.828  -3.142  -3.552 1.00 . A A .  28 LEU HD21 1 1 
       15  9047 1 1 28 LEU HD22 H    2.459  -3.540  -3.011 1.00 . A A .  28 LEU HD22 1 1 
       15  9048 1 1 28 LEU HD23 H    2.147  -1.999  -3.809 1.00 . A A .  28 LEU HD23 1 1 
       15  9049 1 1 28 LEU HG   H    0.382  -1.964  -1.707 1.00 . A A .  28 LEU HG   1 1 
       15  9050 1 1 28 LEU N    N    1.624  -3.675   1.689 1.00 . A A .  28 LEU N    1 1 
       15  9051 1 1 28 LEU O    O    0.094  -0.680   1.015 1.00 . A A .  28 LEU O    1 1 
       15  9052 1 1 29 ILE C    C   -2.435  -1.212   1.674 1.00 . A A .  29 ILE C    1 1 
       15  9053 1 1 29 ILE CA   C   -2.192  -2.163   0.507 1.00 . A A .  29 ILE CA   1 1 
       15  9054 1 1 29 ILE CB   C   -3.222  -3.306   0.568 1.00 . A A .  29 ILE CB   1 1 
       15  9055 1 1 29 ILE CD1  C   -3.747  -5.569  -0.471 1.00 . A A .  29 ILE CD1  1 1 
       15  9056 1 1 29 ILE CG1  C   -3.059  -4.233  -0.639 1.00 . A A .  29 ILE CG1  1 1 
       15  9057 1 1 29 ILE CG2  C   -4.634  -2.744   0.624 1.00 . A A .  29 ILE CG2  1 1 
       15  9058 1 1 29 ILE H    H   -0.670  -3.623   0.340 1.00 . A A .  29 ILE H    1 1 
       15  9059 1 1 29 ILE HA   H   -2.335  -1.624  -0.418 1.00 . A A .  29 ILE HA   1 1 
       15  9060 1 1 29 ILE HB   H   -3.048  -3.870   1.471 1.00 . A A .  29 ILE HB   1 1 
       15  9061 1 1 29 ILE HD11 H   -4.042  -5.695   0.561 1.00 . A A .  29 ILE HD11 1 1 
       15  9062 1 1 29 ILE HD12 H   -4.622  -5.606  -1.102 1.00 . A A .  29 ILE HD12 1 1 
       15  9063 1 1 29 ILE HD13 H   -3.068  -6.361  -0.750 1.00 . A A .  29 ILE HD13 1 1 
       15  9064 1 1 29 ILE HG12 H   -3.475  -3.754  -1.512 1.00 . A A .  29 ILE HG12 1 1 
       15  9065 1 1 29 ILE HG13 H   -2.007  -4.418  -0.802 1.00 . A A .  29 ILE HG13 1 1 
       15  9066 1 1 29 ILE HG21 H   -5.331  -3.542   0.830 1.00 . A A .  29 ILE HG21 1 1 
       15  9067 1 1 29 ILE HG22 H   -4.695  -2.003   1.407 1.00 . A A .  29 ILE HG22 1 1 
       15  9068 1 1 29 ILE HG23 H   -4.879  -2.288  -0.324 1.00 . A A .  29 ILE HG23 1 1 
       15  9069 1 1 29 ILE N    N   -0.827  -2.674   0.522 1.00 . A A .  29 ILE N    1 1 
       15  9070 1 1 29 ILE O    O   -2.949  -0.108   1.493 1.00 . A A .  29 ILE O    1 1 
       15  9071 1 1 30 VAL C    C   -1.549   0.520   3.921 1.00 . A A .  30 VAL C    1 1 
       15  9072 1 1 30 VAL CA   C   -2.235  -0.834   4.071 1.00 . A A .  30 VAL CA   1 1 
       15  9073 1 1 30 VAL CB   C   -1.677  -1.544   5.318 1.00 . A A .  30 VAL CB   1 1 
       15  9074 1 1 30 VAL CG1  C   -1.870  -0.682   6.555 1.00 . A A .  30 VAL CG1  1 1 
       15  9075 1 1 30 VAL CG2  C   -2.337  -2.903   5.497 1.00 . A A .  30 VAL CG2  1 1 
       15  9076 1 1 30 VAL H    H   -1.656  -2.536   2.954 1.00 . A A .  30 VAL H    1 1 
       15  9077 1 1 30 VAL HA   H   -3.293  -0.676   4.215 1.00 . A A .  30 VAL HA   1 1 
       15  9078 1 1 30 VAL HB   H   -0.617  -1.699   5.176 1.00 . A A .  30 VAL HB   1 1 
       15  9079 1 1 30 VAL HG11 H   -1.970   0.353   6.260 1.00 . A A .  30 VAL HG11 1 1 
       15  9080 1 1 30 VAL HG12 H   -2.761  -0.996   7.079 1.00 . A A .  30 VAL HG12 1 1 
       15  9081 1 1 30 VAL HG13 H   -1.014  -0.788   7.205 1.00 . A A .  30 VAL HG13 1 1 
       15  9082 1 1 30 VAL HG21 H   -2.567  -3.323   4.529 1.00 . A A .  30 VAL HG21 1 1 
       15  9083 1 1 30 VAL HG22 H   -1.666  -3.562   6.026 1.00 . A A .  30 VAL HG22 1 1 
       15  9084 1 1 30 VAL HG23 H   -3.250  -2.788   6.064 1.00 . A A .  30 VAL HG23 1 1 
       15  9085 1 1 30 VAL N    N   -2.060  -1.647   2.873 1.00 . A A .  30 VAL N    1 1 
       15  9086 1 1 30 VAL O    O   -2.066   1.543   4.370 1.00 . A A .  30 VAL O    1 1 
       15  9087 1 1 31 HIS C    C   -0.277   2.610   2.001 1.00 . A A .  31 HIS C    1 1 
       15  9088 1 1 31 HIS CA   C    0.377   1.746   3.075 1.00 . A A .  31 HIS CA   1 1 
       15  9089 1 1 31 HIS CB   C    1.817   1.421   2.677 1.00 . A A .  31 HIS CB   1 1 
       15  9090 1 1 31 HIS CD2  C    2.954   3.041   1.002 1.00 . A A .  31 HIS CD2  1 1 
       15  9091 1 1 31 HIS CE1  C    3.764   4.479   2.445 1.00 . A A .  31 HIS CE1  1 1 
       15  9092 1 1 31 HIS CG   C    2.602   2.618   2.238 1.00 . A A .  31 HIS CG   1 1 
       15  9093 1 1 31 HIS H    H   -0.021  -0.329   2.951 1.00 . A A .  31 HIS H    1 1 
       15  9094 1 1 31 HIS HA   H    0.384   2.295   4.005 1.00 . A A .  31 HIS HA   1 1 
       15  9095 1 1 31 HIS HB2  H    2.326   0.982   3.523 1.00 . A A .  31 HIS HB2  1 1 
       15  9096 1 1 31 HIS HB3  H    1.807   0.712   1.862 1.00 . A A .  31 HIS HB3  1 1 
       15  9097 1 1 31 HIS HD1  H    3.041   3.510   4.096 1.00 . A A .  31 HIS HD1  1 1 
       15  9098 1 1 31 HIS HD2  H    2.712   2.559   0.065 1.00 . A A .  31 HIS HD2  1 1 
       15  9099 1 1 31 HIS HE1  H    4.272   5.330   2.873 1.00 . A A .  31 HIS HE1  1 1 
       15  9100 1 1 31 HIS N    N   -0.381   0.518   3.286 1.00 . A A .  31 HIS N    1 1 
       15  9101 1 1 31 HIS ND1  N    3.126   3.539   3.120 1.00 . A A .  31 HIS ND1  1 1 
       15  9102 1 1 31 HIS NE2  N    3.675   4.200   1.157 1.00 . A A .  31 HIS NE2  1 1 
       15  9103 1 1 31 HIS O    O   -0.048   3.818   1.939 1.00 . A A .  31 HIS O    1 1 
       15  9104 1 1 32 GLN C    C   -3.010   3.418   0.614 1.00 . A A .  32 GLN C    1 1 
       15  9105 1 1 32 GLN CA   C   -1.776   2.695   0.085 1.00 . A A .  32 GLN CA   1 1 
       15  9106 1 1 32 GLN CB   C   -2.177   1.723  -1.026 1.00 . A A .  32 GLN CB   1 1 
       15  9107 1 1 32 GLN CD   C   -1.415   0.588  -3.151 1.00 . A A .  32 GLN CD   1 1 
       15  9108 1 1 32 GLN CG   C   -0.997   1.193  -1.825 1.00 . A A .  32 GLN CG   1 1 
       15  9109 1 1 32 GLN H    H   -1.233   1.019   1.258 1.00 . A A .  32 GLN H    1 1 
       15  9110 1 1 32 GLN HA   H   -1.091   3.426  -0.318 1.00 . A A .  32 GLN HA   1 1 
       15  9111 1 1 32 GLN HB2  H   -2.692   0.884  -0.585 1.00 . A A .  32 GLN HB2  1 1 
       15  9112 1 1 32 GLN HB3  H   -2.846   2.230  -1.706 1.00 . A A .  32 GLN HB3  1 1 
       15  9113 1 1 32 GLN HE21 H    0.007   1.608  -4.093 1.00 . A A .  32 GLN HE21 1 1 
       15  9114 1 1 32 GLN HE22 H   -0.973   0.592  -5.088 1.00 . A A .  32 GLN HE22 1 1 
       15  9115 1 1 32 GLN HG2  H   -0.314   2.007  -2.018 1.00 . A A .  32 GLN HG2  1 1 
       15  9116 1 1 32 GLN HG3  H   -0.496   0.435  -1.241 1.00 . A A .  32 GLN HG3  1 1 
       15  9117 1 1 32 GLN N    N   -1.091   1.983   1.158 1.00 . A A .  32 GLN N    1 1 
       15  9118 1 1 32 GLN NE2  N   -0.725   0.968  -4.219 1.00 . A A .  32 GLN NE2  1 1 
       15  9119 1 1 32 GLN O    O   -3.535   4.325  -0.033 1.00 . A A .  32 GLN O    1 1 
       15  9120 1 1 32 GLN OE1  O   -2.349  -0.213  -3.214 1.00 . A A .  32 GLN OE1  1 1 
       15  9121 1 1 33 ARG C    C   -4.396   5.096   2.706 1.00 . A A .  33 ARG C    1 1 
       15  9122 1 1 33 ARG CA   C   -4.642   3.620   2.408 1.00 . A A .  33 ARG CA   1 1 
       15  9123 1 1 33 ARG CB   C   -5.009   2.882   3.698 1.00 . A A .  33 ARG CB   1 1 
       15  9124 1 1 33 ARG CD   C   -5.995   0.810   4.721 1.00 . A A .  33 ARG CD   1 1 
       15  9125 1 1 33 ARG CG   C   -5.349   1.417   3.485 1.00 . A A .  33 ARG CG   1 1 
       15  9126 1 1 33 ARG CZ   C   -7.980   2.115   5.355 1.00 . A A .  33 ARG CZ   1 1 
       15  9127 1 1 33 ARG H    H   -3.007   2.284   2.261 1.00 . A A .  33 ARG H    1 1 
       15  9128 1 1 33 ARG HA   H   -5.462   3.537   1.711 1.00 . A A .  33 ARG HA   1 1 
       15  9129 1 1 33 ARG HB2  H   -4.174   2.940   4.381 1.00 . A A .  33 ARG HB2  1 1 
       15  9130 1 1 33 ARG HB3  H   -5.863   3.367   4.144 1.00 . A A .  33 ARG HB3  1 1 
       15  9131 1 1 33 ARG HD2  H   -5.824  -0.256   4.714 1.00 . A A .  33 ARG HD2  1 1 
       15  9132 1 1 33 ARG HD3  H   -5.538   1.242   5.598 1.00 . A A .  33 ARG HD3  1 1 
       15  9133 1 1 33 ARG HE   H   -8.020   0.403   4.332 1.00 . A A .  33 ARG HE   1 1 
       15  9134 1 1 33 ARG HG2  H   -6.036   1.333   2.656 1.00 . A A .  33 ARG HG2  1 1 
       15  9135 1 1 33 ARG HG3  H   -4.443   0.875   3.260 1.00 . A A .  33 ARG HG3  1 1 
       15  9136 1 1 33 ARG HH11 H   -6.218   2.903   5.950 1.00 . A A .  33 ARG HH11 1 1 
       15  9137 1 1 33 ARG HH12 H   -7.625   3.814   6.391 1.00 . A A .  33 ARG HH12 1 1 
       15  9138 1 1 33 ARG HH21 H   -9.880   1.593   4.906 1.00 . A A .  33 ARG HH21 1 1 
       15  9139 1 1 33 ARG HH22 H   -9.707   3.067   5.797 1.00 . A A .  33 ARG HH22 1 1 
       15  9140 1 1 33 ARG N    N   -3.468   3.011   1.793 1.00 . A A .  33 ARG N    1 1 
       15  9141 1 1 33 ARG NE   N   -7.434   1.058   4.764 1.00 . A A .  33 ARG NE   1 1 
       15  9142 1 1 33 ARG NH1  N   -7.211   3.018   5.948 1.00 . A A .  33 ARG NH1  1 1 
       15  9143 1 1 33 ARG NH2  N   -9.297   2.271   5.352 1.00 . A A .  33 ARG NH2  1 1 
       15  9144 1 1 33 ARG O    O   -5.308   5.919   2.621 1.00 . A A .  33 ARG O    1 1 
       15  9145 1 1 34 THR C    C   -2.704   7.647   2.105 1.00 . A A .  34 THR C    1 1 
       15  9146 1 1 34 THR CA   C   -2.791   6.801   3.370 1.00 . A A .  34 THR CA   1 1 
       15  9147 1 1 34 THR CB   C   -1.443   6.869   4.113 1.00 . A A .  34 THR CB   1 1 
       15  9148 1 1 34 THR CG2  C   -0.300   6.449   3.201 1.00 . A A .  34 THR CG2  1 1 
       15  9149 1 1 34 THR H    H   -2.473   4.724   3.108 1.00 . A A .  34 THR H    1 1 
       15  9150 1 1 34 THR HA   H   -3.555   7.211   4.014 1.00 . A A .  34 THR HA   1 1 
       15  9151 1 1 34 THR HB   H   -1.479   6.192   4.955 1.00 . A A .  34 THR HB   1 1 
       15  9152 1 1 34 THR HG1  H   -0.270   8.373   4.614 1.00 . A A .  34 THR HG1  1 1 
       15  9153 1 1 34 THR HG21 H   -0.693   5.881   2.371 1.00 . A A .  34 THR HG21 1 1 
       15  9154 1 1 34 THR HG22 H    0.398   5.839   3.755 1.00 . A A .  34 THR HG22 1 1 
       15  9155 1 1 34 THR HG23 H    0.205   7.328   2.829 1.00 . A A .  34 THR HG23 1 1 
       15  9156 1 1 34 THR N    N   -3.157   5.425   3.057 1.00 . A A .  34 THR N    1 1 
       15  9157 1 1 34 THR O    O   -2.997   8.843   2.125 1.00 . A A .  34 THR O    1 1 
       15  9158 1 1 34 THR OG1  O   -1.214   8.199   4.592 1.00 . A A .  34 THR OG1  1 1 
       15  9159 1 1 35 HIS C    C   -3.550   8.042  -0.848 1.00 . A A .  35 HIS C    1 1 
       15  9160 1 1 35 HIS CA   C   -2.175   7.716  -0.271 1.00 . A A .  35 HIS CA   1 1 
       15  9161 1 1 35 HIS CB   C   -1.380   6.868  -1.264 1.00 . A A .  35 HIS CB   1 1 
       15  9162 1 1 35 HIS CD2  C    1.117   6.326  -0.817 1.00 . A A .  35 HIS CD2  1 1 
       15  9163 1 1 35 HIS CE1  C    1.980   8.235  -1.462 1.00 . A A .  35 HIS CE1  1 1 
       15  9164 1 1 35 HIS CG   C    0.096   7.119  -1.218 1.00 . A A .  35 HIS CG   1 1 
       15  9165 1 1 35 HIS H    H   -2.080   6.066   1.052 1.00 . A A .  35 HIS H    1 1 
       15  9166 1 1 35 HIS HA   H   -1.645   8.640  -0.094 1.00 . A A .  35 HIS HA   1 1 
       15  9167 1 1 35 HIS HB2  H   -1.545   5.823  -1.047 1.00 . A A .  35 HIS HB2  1 1 
       15  9168 1 1 35 HIS HB3  H   -1.723   7.082  -2.266 1.00 . A A .  35 HIS HB3  1 1 
       15  9169 1 1 35 HIS HD1  H    0.188   9.089  -1.959 1.00 . A A .  35 HIS HD1  1 1 
       15  9170 1 1 35 HIS HD2  H    1.035   5.315  -0.441 1.00 . A A .  35 HIS HD2  1 1 
       15  9171 1 1 35 HIS HE1  H    2.688   9.017  -1.692 1.00 . A A .  35 HIS HE1  1 1 
       15  9172 1 1 35 HIS N    N   -2.300   7.020   1.005 1.00 . A A .  35 HIS N    1 1 
       15  9173 1 1 35 HIS ND1  N    0.670   8.308  -1.615 1.00 . A A .  35 HIS ND1  1 1 
       15  9174 1 1 35 HIS NE2  N    2.277   7.042  -0.979 1.00 . A A .  35 HIS NE2  1 1 
       15  9175 1 1 35 HIS O    O   -3.735   9.076  -1.489 1.00 . A A .  35 HIS O    1 1 
       15  9176 1 1 36 SER C    C   -6.503   8.584  -0.502 1.00 . A A .  36 SER C    1 1 
       15  9177 1 1 36 SER CA   C   -5.865   7.342  -1.118 1.00 . A A .  36 SER CA   1 1 
       15  9178 1 1 36 SER CB   C   -6.722   6.111  -0.814 1.00 . A A .  36 SER CB   1 1 
       15  9179 1 1 36 SER H    H   -4.299   6.346  -0.099 1.00 . A A .  36 SER H    1 1 
       15  9180 1 1 36 SER HA   H   -5.808   7.474  -2.188 1.00 . A A .  36 SER HA   1 1 
       15  9181 1 1 36 SER HB2  H   -6.375   5.651   0.099 1.00 . A A .  36 SER HB2  1 1 
       15  9182 1 1 36 SER HB3  H   -7.752   6.413  -0.696 1.00 . A A .  36 SER HB3  1 1 
       15  9183 1 1 36 SER HG   H   -7.361   5.307  -2.482 1.00 . A A .  36 SER HG   1 1 
       15  9184 1 1 36 SER N    N   -4.509   7.151  -0.617 1.00 . A A .  36 SER N    1 1 
       15  9185 1 1 36 SER O    O   -5.911   9.238   0.356 1.00 . A A .  36 SER O    1 1 
       15  9186 1 1 36 SER OG   O   -6.641   5.162  -1.863 1.00 . A A .  36 SER OG   1 1 
       15  9187 1 1 37 GLY C    C   -8.654  11.117  -1.492 1.00 . A A .  37 GLY C    1 1 
       15  9188 1 1 37 GLY CA   C   -8.414  10.063  -0.429 1.00 . A A .  37 GLY CA   1 1 
       15  9189 1 1 37 GLY H    H   -8.138   8.342  -1.631 1.00 . A A .  37 GLY H    1 1 
       15  9190 1 1 37 GLY HA2  H   -9.365   9.748  -0.027 1.00 . A A .  37 GLY HA2  1 1 
       15  9191 1 1 37 GLY HA3  H   -7.825  10.498   0.366 1.00 . A A .  37 GLY HA3  1 1 
       15  9192 1 1 37 GLY N    N   -7.715   8.901  -0.946 1.00 . A A .  37 GLY N    1 1 
       15  9193 1 1 37 GLY O    O   -8.846  10.792  -2.663 1.00 . A A .  37 GLY O    1 1 
       15  9194 1 1 38 GLU C    C   -7.656  13.684  -2.918 1.00 . A A .  38 GLU C    1 1 
       15  9195 1 1 38 GLU CA   C   -8.866  13.485  -2.010 1.00 . A A .  38 GLU CA   1 1 
       15  9196 1 1 38 GLU CB   C   -9.157  14.776  -1.241 1.00 . A A .  38 GLU CB   1 1 
       15  9197 1 1 38 GLU CD   C  -10.662  15.517  -3.130 1.00 . A A .  38 GLU CD   1 1 
       15  9198 1 1 38 GLU CG   C   -9.599  15.927  -2.129 1.00 . A A .  38 GLU CG   1 1 
       15  9199 1 1 38 GLU H    H   -8.486  12.577  -0.136 1.00 . A A .  38 GLU H    1 1 
       15  9200 1 1 38 GLU HA   H   -9.722  13.240  -2.619 1.00 . A A .  38 GLU HA   1 1 
       15  9201 1 1 38 GLU HB2  H   -9.939  14.583  -0.521 1.00 . A A .  38 GLU HB2  1 1 
       15  9202 1 1 38 GLU HB3  H   -8.263  15.077  -0.715 1.00 . A A .  38 GLU HB3  1 1 
       15  9203 1 1 38 GLU HG2  H   -9.997  16.713  -1.505 1.00 . A A .  38 GLU HG2  1 1 
       15  9204 1 1 38 GLU HG3  H   -8.740  16.298  -2.669 1.00 . A A .  38 GLU HG3  1 1 
       15  9205 1 1 38 GLU N    N   -8.645  12.381  -1.083 1.00 . A A .  38 GLU N    1 1 
       15  9206 1 1 38 GLU O    O   -7.766  13.608  -4.142 1.00 . A A .  38 GLU O    1 1 
       15  9207 1 1 38 GLU OE1  O  -11.756  15.101  -2.697 1.00 . A A .  38 GLU OE1  1 1 
       15  9208 1 1 38 GLU OE2  O  -10.398  15.613  -4.347 1.00 . A A .  38 GLU OE2  1 1 
       15  9209 1 1 39 SER C    C   -4.208  13.133  -2.667 1.00 . A A .  39 SER C    1 1 
       15  9210 1 1 39 SER CA   C   -5.272  14.153  -3.062 1.00 . A A .  39 SER CA   1 1 
       15  9211 1 1 39 SER CB   C   -4.746  15.571  -2.829 1.00 . A A .  39 SER CB   1 1 
       15  9212 1 1 39 SER H    H   -6.479  13.987  -1.330 1.00 . A A .  39 SER H    1 1 
       15  9213 1 1 39 SER HA   H   -5.499  14.031  -4.111 1.00 . A A .  39 SER HA   1 1 
       15  9214 1 1 39 SER HB2  H   -3.936  15.769  -3.514 1.00 . A A .  39 SER HB2  1 1 
       15  9215 1 1 39 SER HB3  H   -5.544  16.280  -3.000 1.00 . A A .  39 SER HB3  1 1 
       15  9216 1 1 39 SER HG   H   -4.713  15.097  -0.928 1.00 . A A .  39 SER HG   1 1 
       15  9217 1 1 39 SER N    N   -6.502  13.939  -2.309 1.00 . A A .  39 SER N    1 1 
       15  9218 1 1 39 SER O    O   -3.881  12.985  -1.490 1.00 . A A .  39 SER O    1 1 
       15  9219 1 1 39 SER OG   O   -4.272  15.727  -1.503 1.00 . A A .  39 SER OG   1 1 
       15  9220 1 1 40 GLY C    C   -1.838  11.097  -4.631 1.00 . A A .  40 GLY C    1 1 
       15  9221 1 1 40 GLY CA   C   -2.651  11.433  -3.397 1.00 . A A .  40 GLY CA   1 1 
       15  9222 1 1 40 GLY H    H   -3.972  12.592  -4.580 1.00 . A A .  40 GLY H    1 1 
       15  9223 1 1 40 GLY HA2  H   -1.988  11.806  -2.632 1.00 . A A .  40 GLY HA2  1 1 
       15  9224 1 1 40 GLY HA3  H   -3.128  10.533  -3.039 1.00 . A A .  40 GLY HA3  1 1 
       15  9225 1 1 40 GLY N    N   -3.672  12.431  -3.660 1.00 . A A .  40 GLY N    1 1 
       15  9226 1 1 40 GLY O    O   -0.645  11.392  -4.714 1.00 . A A .  40 GLY O    1 1 
       15  9227 1 1 41 PRO C    C   -1.483  11.272  -7.742 1.00 . A A .  41 PRO C    1 1 
       15  9228 1 1 41 PRO CA   C   -1.835  10.071  -6.871 1.00 . A A .  41 PRO CA   1 1 
       15  9229 1 1 41 PRO CB   C   -2.888   9.200  -7.562 1.00 . A A .  41 PRO CB   1 1 
       15  9230 1 1 41 PRO CD   C   -3.909  10.080  -5.588 1.00 . A A .  41 PRO CD   1 1 
       15  9231 1 1 41 PRO CG   C   -4.189   9.666  -7.006 1.00 . A A .  41 PRO CG   1 1 
       15  9232 1 1 41 PRO HA   H   -0.945   9.486  -6.689 1.00 . A A .  41 PRO HA   1 1 
       15  9233 1 1 41 PRO HB2  H   -2.838   9.350  -8.631 1.00 . A A .  41 PRO HB2  1 1 
       15  9234 1 1 41 PRO HB3  H   -2.709   8.161  -7.330 1.00 . A A .  41 PRO HB3  1 1 
       15  9235 1 1 41 PRO HD2  H   -4.529  10.920  -5.310 1.00 . A A .  41 PRO HD2  1 1 
       15  9236 1 1 41 PRO HD3  H   -4.070   9.251  -4.914 1.00 . A A .  41 PRO HD3  1 1 
       15  9237 1 1 41 PRO HG2  H   -4.552  10.507  -7.577 1.00 . A A .  41 PRO HG2  1 1 
       15  9238 1 1 41 PRO HG3  H   -4.906   8.859  -7.026 1.00 . A A .  41 PRO HG3  1 1 
       15  9239 1 1 41 PRO N    N   -2.488  10.463  -5.618 1.00 . A A .  41 PRO N    1 1 
       15  9240 1 1 41 PRO O    O   -2.313  11.758  -8.511 1.00 . A A .  41 PRO O    1 1 
       15  9241 1 1 42 SER C    C    1.039  12.443  -9.590 1.00 . A A .  42 SER C    1 1 
       15  9242 1 1 42 SER CA   C    0.212  12.894  -8.390 1.00 . A A .  42 SER CA   1 1 
       15  9243 1 1 42 SER CB   C    1.041  13.831  -7.509 1.00 . A A .  42 SER CB   1 1 
       15  9244 1 1 42 SER H    H    0.367  11.317  -6.986 1.00 . A A .  42 SER H    1 1 
       15  9245 1 1 42 SER HA   H   -0.658  13.425  -8.746 1.00 . A A .  42 SER HA   1 1 
       15  9246 1 1 42 SER HB2  H    1.810  13.263  -7.008 1.00 . A A .  42 SER HB2  1 1 
       15  9247 1 1 42 SER HB3  H    1.498  14.590  -8.126 1.00 . A A .  42 SER HB3  1 1 
       15  9248 1 1 42 SER HG   H    0.789  14.877  -5.871 1.00 . A A .  42 SER HG   1 1 
       15  9249 1 1 42 SER N    N   -0.248  11.747  -7.616 1.00 . A A .  42 SER N    1 1 
       15  9250 1 1 42 SER O    O    2.268  12.408  -9.533 1.00 . A A .  42 SER O    1 1 
       15  9251 1 1 42 SER OG   O    0.230  14.462  -6.533 1.00 . A A .  42 SER OG   1 1 
       15  9252 1 1 43 SER C    C    0.709  12.573 -13.062 1.00 . A A .  43 SER C    1 1 
       15  9253 1 1 43 SER CA   C    1.024  11.647 -11.891 1.00 . A A .  43 SER CA   1 1 
       15  9254 1 1 43 SER CB   C    0.602  10.216 -12.228 1.00 . A A .  43 SER CB   1 1 
       15  9255 1 1 43 SER H    H   -0.624  12.150 -10.660 1.00 . A A .  43 SER H    1 1 
       15  9256 1 1 43 SER HA   H    2.088  11.666 -11.709 1.00 . A A .  43 SER HA   1 1 
       15  9257 1 1 43 SER HB2  H    0.609   9.620 -11.329 1.00 . A A .  43 SER HB2  1 1 
       15  9258 1 1 43 SER HB3  H   -0.395  10.227 -12.645 1.00 . A A .  43 SER HB3  1 1 
       15  9259 1 1 43 SER HG   H    1.010   9.450 -13.984 1.00 . A A .  43 SER HG   1 1 
       15  9260 1 1 43 SER N    N    0.355  12.100 -10.677 1.00 . A A .  43 SER N    1 1 
       15  9261 1 1 43 SER O    O   -0.222  13.375 -13.001 1.00 . A A .  43 SER O    1 1 
       15  9262 1 1 43 SER OG   O    1.485   9.633 -13.170 1.00 . A A .  43 SER OG   1 1 
       15  9263 1 1 44 GLY C    C    2.121  12.844 -16.483 1.00 . A A .  44 GLY C    1 1 
       15  9264 1 1 44 GLY CA   C    1.281  13.285 -15.301 1.00 . A A .  44 GLY CA   1 1 
       15  9265 1 1 44 GLY H    H    2.219  11.796 -14.122 1.00 . A A .  44 GLY H    1 1 
       15  9266 1 1 44 GLY HA2  H    0.238  13.241 -15.577 1.00 . A A .  44 GLY HA2  1 1 
       15  9267 1 1 44 GLY HA3  H    1.536  14.305 -15.054 1.00 . A A .  44 GLY HA3  1 1 
       15  9268 1 1 44 GLY N    N    1.492  12.454 -14.130 1.00 . A A .  44 GLY N    1 1 
       15  9269 1 1 44 GLY O    O    3.315  12.603 -16.313 1.00 . A A .  44 GLY O    1 1 
       15  9270 2 2  1 ZN  ZN   ZN   3.659   5.166  -0.986 1.00 . B A . 201 ZN  ZN   1 1 
       16  9271 1 1  1 GLY C    C   25.675  18.334   4.938 1.00 . A A .   1 GLY C    1 1 
       16  9272 1 1  1 GLY CA   C   25.381  19.414   5.959 1.00 . A A .   1 GLY CA   1 1 
       16  9273 1 1  1 GLY H1   H   26.885  20.716   5.234 1.00 . A A .   1 GLY H1   1 1 
       16  9274 1 1  1 GLY HA2  H   25.764  19.101   6.919 1.00 . A A .   1 GLY HA2  1 1 
       16  9275 1 1  1 GLY HA3  H   24.310  19.540   6.034 1.00 . A A .   1 GLY HA3  1 1 
       16  9276 1 1  1 GLY N    N   25.979  20.688   5.608 1.00 . A A .   1 GLY N    1 1 
       16  9277 1 1  1 GLY O    O   26.210  18.614   3.865 1.00 . A A .   1 GLY O    1 1 
       16  9278 1 1  2 SER C    C   24.261  15.508   3.728 1.00 . A A .   2 SER C    1 1 
       16  9279 1 1  2 SER CA   C   25.563  15.968   4.377 1.00 . A A .   2 SER CA   1 1 
       16  9280 1 1  2 SER CB   C   26.201  14.807   5.142 1.00 . A A .   2 SER CB   1 1 
       16  9281 1 1  2 SER H    H   24.904  16.935   6.141 1.00 . A A .   2 SER H    1 1 
       16  9282 1 1  2 SER HA   H   26.241  16.294   3.603 1.00 . A A .   2 SER HA   1 1 
       16  9283 1 1  2 SER HB2  H   25.838  14.806   6.159 1.00 . A A .   2 SER HB2  1 1 
       16  9284 1 1  2 SER HB3  H   25.936  13.875   4.664 1.00 . A A .   2 SER HB3  1 1 
       16  9285 1 1  2 SER HG   H   28.003  14.074   5.377 1.00 . A A .   2 SER HG   1 1 
       16  9286 1 1  2 SER N    N   25.327  17.095   5.272 1.00 . A A .   2 SER N    1 1 
       16  9287 1 1  2 SER O    O   23.181  15.992   4.067 1.00 . A A .   2 SER O    1 1 
       16  9288 1 1  2 SER OG   O   27.613  14.925   5.162 1.00 . A A .   2 SER OG   1 1 
       16  9289 1 1  3 SER C    C   23.473  12.641   1.564 1.00 . A A .   3 SER C    1 1 
       16  9290 1 1  3 SER CA   C   23.205  14.048   2.091 1.00 . A A .   3 SER CA   1 1 
       16  9291 1 1  3 SER CB   C   22.821  14.973   0.935 1.00 . A A .   3 SER CB   1 1 
       16  9292 1 1  3 SER H    H   25.261  14.225   2.566 1.00 . A A .   3 SER H    1 1 
       16  9293 1 1  3 SER HA   H   22.387  14.006   2.795 1.00 . A A .   3 SER HA   1 1 
       16  9294 1 1  3 SER HB2  H   23.716  15.347   0.463 1.00 . A A .   3 SER HB2  1 1 
       16  9295 1 1  3 SER HB3  H   22.237  14.420   0.214 1.00 . A A .   3 SER HB3  1 1 
       16  9296 1 1  3 SER HG   H   21.339  16.246   0.779 1.00 . A A .   3 SER HG   1 1 
       16  9297 1 1  3 SER N    N   24.372  14.571   2.792 1.00 . A A .   3 SER N    1 1 
       16  9298 1 1  3 SER O    O   24.255  12.454   0.633 1.00 . A A .   3 SER O    1 1 
       16  9299 1 1  3 SER OG   O   22.055  16.073   1.396 1.00 . A A .   3 SER OG   1 1 
       16  9300 1 1  4 GLY C    C   21.809   9.749   0.970 1.00 . A A .   4 GLY C    1 1 
       16  9301 1 1  4 GLY CA   C   22.998  10.278   1.748 1.00 . A A .   4 GLY CA   1 1 
       16  9302 1 1  4 GLY H    H   22.207  11.864   2.906 1.00 . A A .   4 GLY H    1 1 
       16  9303 1 1  4 GLY HA2  H   23.878  10.215   1.126 1.00 . A A .   4 GLY HA2  1 1 
       16  9304 1 1  4 GLY HA3  H   23.143   9.662   2.623 1.00 . A A .   4 GLY HA3  1 1 
       16  9305 1 1  4 GLY N    N   22.817  11.655   2.168 1.00 . A A .   4 GLY N    1 1 
       16  9306 1 1  4 GLY O    O   20.693  10.249   1.113 1.00 . A A .   4 GLY O    1 1 
       16  9307 1 1  5 SER C    C   21.165   6.630  -0.766 1.00 . A A .   5 SER C    1 1 
       16  9308 1 1  5 SER CA   C   20.989   8.142  -0.664 1.00 . A A .   5 SER CA   1 1 
       16  9309 1 1  5 SER CB   C   20.978   8.761  -2.064 1.00 . A A .   5 SER CB   1 1 
       16  9310 1 1  5 SER H    H   22.959   8.380   0.074 1.00 . A A .   5 SER H    1 1 
       16  9311 1 1  5 SER HA   H   20.046   8.351  -0.181 1.00 . A A .   5 SER HA   1 1 
       16  9312 1 1  5 SER HB2  H   21.969   8.702  -2.488 1.00 . A A .   5 SER HB2  1 1 
       16  9313 1 1  5 SER HB3  H   20.285   8.217  -2.689 1.00 . A A .   5 SER HB3  1 1 
       16  9314 1 1  5 SER HG   H   20.022  10.265  -1.250 1.00 . A A .   5 SER HG   1 1 
       16  9315 1 1  5 SER N    N   22.048   8.736   0.143 1.00 . A A .   5 SER N    1 1 
       16  9316 1 1  5 SER O    O   22.167   6.079  -0.310 1.00 . A A .   5 SER O    1 1 
       16  9317 1 1  5 SER OG   O   20.581  10.120  -2.017 1.00 . A A .   5 SER OG   1 1 
       16  9318 1 1  6 SER C    C   19.407   4.077  -2.734 1.00 . A A .   6 SER C    1 1 
       16  9319 1 1  6 SER CA   C   20.227   4.516  -1.525 1.00 . A A .   6 SER CA   1 1 
       16  9320 1 1  6 SER CB   C   19.705   3.828  -0.262 1.00 . A A .   6 SER CB   1 1 
       16  9321 1 1  6 SER H    H   19.410   6.461  -1.709 1.00 . A A .   6 SER H    1 1 
       16  9322 1 1  6 SER HA   H   21.257   4.230  -1.681 1.00 . A A .   6 SER HA   1 1 
       16  9323 1 1  6 SER HB2  H   18.867   4.384   0.127 1.00 . A A .   6 SER HB2  1 1 
       16  9324 1 1  6 SER HB3  H   19.388   2.824  -0.508 1.00 . A A .   6 SER HB3  1 1 
       16  9325 1 1  6 SER HG   H   21.574   3.712   0.315 1.00 . A A .   6 SER HG   1 1 
       16  9326 1 1  6 SER N    N   20.184   5.965  -1.367 1.00 . A A .   6 SER N    1 1 
       16  9327 1 1  6 SER O    O   18.545   4.812  -3.214 1.00 . A A .   6 SER O    1 1 
       16  9328 1 1  6 SER OG   O   20.711   3.758   0.734 1.00 . A A .   6 SER OG   1 1 
       16  9329 1 1  7 GLY C    C   19.004   0.840  -4.447 1.00 . A A .   7 GLY C    1 1 
       16  9330 1 1  7 GLY CA   C   18.962   2.353  -4.370 1.00 . A A .   7 GLY CA   1 1 
       16  9331 1 1  7 GLY H    H   20.380   2.328  -2.798 1.00 . A A .   7 GLY H    1 1 
       16  9332 1 1  7 GLY HA2  H   17.932   2.671  -4.309 1.00 . A A .   7 GLY HA2  1 1 
       16  9333 1 1  7 GLY HA3  H   19.401   2.760  -5.269 1.00 . A A .   7 GLY HA3  1 1 
       16  9334 1 1  7 GLY N    N   19.682   2.871  -3.222 1.00 . A A .   7 GLY N    1 1 
       16  9335 1 1  7 GLY O    O   19.208   0.270  -5.520 1.00 . A A .   7 GLY O    1 1 
       16  9336 1 1  8 THR C    C   17.460  -1.826  -2.883 1.00 . A A .   8 THR C    1 1 
       16  9337 1 1  8 THR CA   C   18.832  -1.271  -3.248 1.00 . A A .   8 THR CA   1 1 
       16  9338 1 1  8 THR CB   C   19.867  -1.778  -2.226 1.00 . A A .   8 THR CB   1 1 
       16  9339 1 1  8 THR CG2  C   19.892  -3.299  -2.191 1.00 . A A .   8 THR CG2  1 1 
       16  9340 1 1  8 THR H    H   18.654   0.695  -2.485 1.00 . A A .   8 THR H    1 1 
       16  9341 1 1  8 THR HA   H   19.111  -1.640  -4.225 1.00 . A A .   8 THR HA   1 1 
       16  9342 1 1  8 THR HB   H   19.591  -1.415  -1.247 1.00 . A A .   8 THR HB   1 1 
       16  9343 1 1  8 THR HG1  H   21.119  -0.337  -2.719 1.00 . A A .   8 THR HG1  1 1 
       16  9344 1 1  8 THR HG21 H   20.708  -3.659  -2.798 1.00 . A A .   8 THR HG21 1 1 
       16  9345 1 1  8 THR HG22 H   18.960  -3.684  -2.576 1.00 . A A .   8 THR HG22 1 1 
       16  9346 1 1  8 THR HG23 H   20.026  -3.633  -1.173 1.00 . A A .   8 THR HG23 1 1 
       16  9347 1 1  8 THR N    N   18.812   0.185  -3.306 1.00 . A A .   8 THR N    1 1 
       16  9348 1 1  8 THR O    O   17.141  -1.992  -1.705 1.00 . A A .   8 THR O    1 1 
       16  9349 1 1  8 THR OG1  O   21.168  -1.282  -2.560 1.00 . A A .   8 THR OG1  1 1 
       16  9350 1 1  9 ARG C    C   15.306  -4.166  -3.829 1.00 . A A .   9 ARG C    1 1 
       16  9351 1 1  9 ARG CA   C   15.314  -2.647  -3.684 1.00 . A A .   9 ARG CA   1 1 
       16  9352 1 1  9 ARG CB   C   14.327  -2.024  -4.673 1.00 . A A .   9 ARG CB   1 1 
       16  9353 1 1  9 ARG CD   C   13.604   0.082  -5.838 1.00 . A A .   9 ARG CD   1 1 
       16  9354 1 1  9 ARG CG   C   14.273  -0.507  -4.605 1.00 . A A .   9 ARG CG   1 1 
       16  9355 1 1  9 ARG CZ   C   12.621   2.230  -6.520 1.00 . A A .   9 ARG CZ   1 1 
       16  9356 1 1  9 ARG H    H   16.964  -1.957  -4.815 1.00 . A A .   9 ARG H    1 1 
       16  9357 1 1  9 ARG HA   H   15.012  -2.392  -2.679 1.00 . A A .   9 ARG HA   1 1 
       16  9358 1 1  9 ARG HB2  H   14.612  -2.308  -5.675 1.00 . A A .   9 ARG HB2  1 1 
       16  9359 1 1  9 ARG HB3  H   13.339  -2.407  -4.466 1.00 . A A .   9 ARG HB3  1 1 
       16  9360 1 1  9 ARG HD2  H   14.343   0.184  -6.618 1.00 . A A .   9 ARG HD2  1 1 
       16  9361 1 1  9 ARG HD3  H   12.826  -0.591  -6.164 1.00 . A A .   9 ARG HD3  1 1 
       16  9362 1 1  9 ARG HE   H   12.914   1.659  -4.632 1.00 . A A .   9 ARG HE   1 1 
       16  9363 1 1  9 ARG HG2  H   13.712  -0.214  -3.730 1.00 . A A .   9 ARG HG2  1 1 
       16  9364 1 1  9 ARG HG3  H   15.280  -0.123  -4.535 1.00 . A A .   9 ARG HG3  1 1 
       16  9365 1 1  9 ARG HH11 H   13.143   1.011  -8.044 1.00 . A A .   9 ARG HH11 1 1 
       16  9366 1 1  9 ARG HH12 H   12.449   2.528  -8.512 1.00 . A A .   9 ARG HH12 1 1 
       16  9367 1 1  9 ARG HH21 H   11.998   3.659  -5.234 1.00 . A A .   9 ARG HH21 1 1 
       16  9368 1 1  9 ARG HH22 H   11.798   4.034  -6.913 1.00 . A A .   9 ARG HH22 1 1 
       16  9369 1 1  9 ARG N    N   16.652  -2.111  -3.899 1.00 . A A .   9 ARG N    1 1 
       16  9370 1 1  9 ARG NE   N   13.017   1.392  -5.568 1.00 . A A .   9 ARG NE   1 1 
       16  9371 1 1  9 ARG NH1  N   12.749   1.896  -7.797 1.00 . A A .   9 ARG NH1  1 1 
       16  9372 1 1  9 ARG NH2  N   12.096   3.404  -6.196 1.00 . A A .   9 ARG NH2  1 1 
       16  9373 1 1  9 ARG O    O   15.938  -4.715  -4.731 1.00 . A A .   9 ARG O    1 1 
       16  9374 1 1 10 GLU C    C   13.047  -6.752  -2.875 1.00 . A A .  10 GLU C    1 1 
       16  9375 1 1 10 GLU CA   C   14.500  -6.293  -2.965 1.00 . A A .  10 GLU CA   1 1 
       16  9376 1 1 10 GLU CB   C   15.309  -6.898  -1.816 1.00 . A A .  10 GLU CB   1 1 
       16  9377 1 1 10 GLU CD   C   16.281  -9.002  -0.811 1.00 . A A .  10 GLU CD   1 1 
       16  9378 1 1 10 GLU CG   C   15.268  -8.416  -1.776 1.00 . A A .  10 GLU CG   1 1 
       16  9379 1 1 10 GLU H    H   14.106  -4.343  -2.240 1.00 . A A .  10 GLU H    1 1 
       16  9380 1 1 10 GLU HA   H   14.914  -6.631  -3.902 1.00 . A A .  10 GLU HA   1 1 
       16  9381 1 1 10 GLU HB2  H   16.339  -6.588  -1.914 1.00 . A A .  10 GLU HB2  1 1 
       16  9382 1 1 10 GLU HB3  H   14.918  -6.524  -0.881 1.00 . A A .  10 GLU HB3  1 1 
       16  9383 1 1 10 GLU HG2  H   14.281  -8.730  -1.472 1.00 . A A .  10 GLU HG2  1 1 
       16  9384 1 1 10 GLU HG3  H   15.475  -8.795  -2.766 1.00 . A A .  10 GLU HG3  1 1 
       16  9385 1 1 10 GLU N    N   14.587  -4.838  -2.935 1.00 . A A .  10 GLU N    1 1 
       16  9386 1 1 10 GLU O    O   12.633  -7.680  -3.570 1.00 . A A .  10 GLU O    1 1 
       16  9387 1 1 10 GLU OE1  O   16.045  -8.927   0.413 1.00 . A A .  10 GLU OE1  1 1 
       16  9388 1 1 10 GLU OE2  O   17.308  -9.536  -1.280 1.00 . A A .  10 GLU OE2  1 1 
       16  9389 1 1 11 LYS C    C   10.138  -6.453  -3.170 1.00 . A A .  11 LYS C    1 1 
       16  9390 1 1 11 LYS CA   C   10.871  -6.434  -1.832 1.00 . A A .  11 LYS CA   1 1 
       16  9391 1 1 11 LYS CB   C   10.202  -5.433  -0.886 1.00 . A A .  11 LYS CB   1 1 
       16  9392 1 1 11 LYS CD   C   11.531  -5.341   1.243 1.00 . A A .  11 LYS CD   1 1 
       16  9393 1 1 11 LYS CE   C   11.577  -5.728   2.714 1.00 . A A .  11 LYS CE   1 1 
       16  9394 1 1 11 LYS CG   C   10.262  -5.843   0.575 1.00 . A A .  11 LYS CG   1 1 
       16  9395 1 1 11 LYS H    H   12.665  -5.365  -1.487 1.00 . A A .  11 LYS H    1 1 
       16  9396 1 1 11 LYS HA   H   10.820  -7.419  -1.393 1.00 . A A .  11 LYS HA   1 1 
       16  9397 1 1 11 LYS HB2  H   10.691  -4.476  -0.991 1.00 . A A .  11 LYS HB2  1 1 
       16  9398 1 1 11 LYS HB3  H    9.164  -5.330  -1.167 1.00 . A A .  11 LYS HB3  1 1 
       16  9399 1 1 11 LYS HD2  H   12.386  -5.771   0.743 1.00 . A A .  11 LYS HD2  1 1 
       16  9400 1 1 11 LYS HD3  H   11.568  -4.264   1.162 1.00 . A A .  11 LYS HD3  1 1 
       16  9401 1 1 11 LYS HE2  H   11.037  -4.988   3.284 1.00 . A A .  11 LYS HE2  1 1 
       16  9402 1 1 11 LYS HE3  H   11.103  -6.691   2.834 1.00 . A A .  11 LYS HE3  1 1 
       16  9403 1 1 11 LYS HG2  H    9.408  -5.430   1.091 1.00 . A A .  11 LYS HG2  1 1 
       16  9404 1 1 11 LYS HG3  H   10.236  -6.922   0.638 1.00 . A A .  11 LYS HG3  1 1 
       16  9405 1 1 11 LYS HZ1  H   13.038  -6.517   3.981 1.00 . A A .  11 LYS HZ1  1 1 
       16  9406 1 1 11 LYS HZ2  H   13.271  -4.885   3.598 1.00 . A A .  11 LYS HZ2  1 1 
       16  9407 1 1 11 LYS HZ3  H   13.619  -6.081   2.453 1.00 . A A .  11 LYS HZ3  1 1 
       16  9408 1 1 11 LYS N    N   12.277  -6.096  -2.014 1.00 . A A .  11 LYS N    1 1 
       16  9409 1 1 11 LYS NZ   N   12.974  -5.809   3.222 1.00 . A A .  11 LYS NZ   1 1 
       16  9410 1 1 11 LYS O    O   10.302  -5.566  -4.007 1.00 . A A .  11 LYS O    1 1 
       16  9411 1 1 12 PRO C    C    7.426  -6.605  -4.736 1.00 . A A .  12 PRO C    1 1 
       16  9412 1 1 12 PRO CA   C    8.534  -7.645  -4.611 1.00 . A A .  12 PRO CA   1 1 
       16  9413 1 1 12 PRO CB   C    7.938  -9.049  -4.478 1.00 . A A .  12 PRO CB   1 1 
       16  9414 1 1 12 PRO CD   C    9.065  -8.582  -2.422 1.00 . A A .  12 PRO CD   1 1 
       16  9415 1 1 12 PRO CG   C    7.882  -9.299  -3.010 1.00 . A A .  12 PRO CG   1 1 
       16  9416 1 1 12 PRO HA   H    9.167  -7.602  -5.485 1.00 . A A .  12 PRO HA   1 1 
       16  9417 1 1 12 PRO HB2  H    6.952  -9.067  -4.921 1.00 . A A .  12 PRO HB2  1 1 
       16  9418 1 1 12 PRO HB3  H    8.576  -9.763  -4.976 1.00 . A A .  12 PRO HB3  1 1 
       16  9419 1 1 12 PRO HD2  H    8.824  -8.194  -1.444 1.00 . A A .  12 PRO HD2  1 1 
       16  9420 1 1 12 PRO HD3  H    9.918  -9.242  -2.368 1.00 . A A .  12 PRO HD3  1 1 
       16  9421 1 1 12 PRO HG2  H    6.964  -8.903  -2.605 1.00 . A A .  12 PRO HG2  1 1 
       16  9422 1 1 12 PRO HG3  H    7.952 -10.359  -2.816 1.00 . A A .  12 PRO HG3  1 1 
       16  9423 1 1 12 PRO N    N    9.310  -7.487  -3.377 1.00 . A A .  12 PRO N    1 1 
       16  9424 1 1 12 PRO O    O    7.149  -6.108  -5.828 1.00 . A A .  12 PRO O    1 1 
       16  9425 1 1 13 TYR C    C    6.267  -3.885  -3.460 1.00 . A A .  13 TYR C    1 1 
       16  9426 1 1 13 TYR CA   C    5.716  -5.301  -3.597 1.00 . A A .  13 TYR CA   1 1 
       16  9427 1 1 13 TYR CB   C    4.747  -5.597  -2.451 1.00 . A A .  13 TYR CB   1 1 
       16  9428 1 1 13 TYR CD1  C    2.949  -7.166  -3.276 1.00 . A A .  13 TYR CD1  1 1 
       16  9429 1 1 13 TYR CD2  C    4.663  -8.054  -1.876 1.00 . A A .  13 TYR CD2  1 1 
       16  9430 1 1 13 TYR CE1  C    2.361  -8.414  -3.355 1.00 . A A .  13 TYR CE1  1 1 
       16  9431 1 1 13 TYR CE2  C    4.082  -9.306  -1.952 1.00 . A A .  13 TYR CE2  1 1 
       16  9432 1 1 13 TYR CG   C    4.108  -6.964  -2.536 1.00 . A A .  13 TYR CG   1 1 
       16  9433 1 1 13 TYR CZ   C    2.931  -9.480  -2.692 1.00 . A A .  13 TYR CZ   1 1 
       16  9434 1 1 13 TYR H    H    7.062  -6.712  -2.773 1.00 . A A .  13 TYR H    1 1 
       16  9435 1 1 13 TYR HA   H    5.184  -5.379  -4.534 1.00 . A A .  13 TYR HA   1 1 
       16  9436 1 1 13 TYR HB2  H    5.280  -5.538  -1.514 1.00 . A A .  13 TYR HB2  1 1 
       16  9437 1 1 13 TYR HB3  H    3.958  -4.860  -2.457 1.00 . A A .  13 TYR HB3  1 1 
       16  9438 1 1 13 TYR HD1  H    2.506  -6.329  -3.794 1.00 . A A .  13 TYR HD1  1 1 
       16  9439 1 1 13 TYR HD2  H    5.564  -7.914  -1.298 1.00 . A A .  13 TYR HD2  1 1 
       16  9440 1 1 13 TYR HE1  H    1.460  -8.551  -3.935 1.00 . A A .  13 TYR HE1  1 1 
       16  9441 1 1 13 TYR HE2  H    4.528 -10.141  -1.432 1.00 . A A .  13 TYR HE2  1 1 
       16  9442 1 1 13 TYR HH   H    2.947 -11.381  -2.402 1.00 . A A .  13 TYR HH   1 1 
       16  9443 1 1 13 TYR N    N    6.796  -6.281  -3.612 1.00 . A A .  13 TYR N    1 1 
       16  9444 1 1 13 TYR O    O    7.122  -3.620  -2.616 1.00 . A A .  13 TYR O    1 1 
       16  9445 1 1 13 TYR OH   O    2.349 -10.725  -2.770 1.00 . A A .  13 TYR OH   1 1 
       16  9446 1 1 14 GLU C    C    5.021  -0.639  -4.344 1.00 . A A .  14 GLU C    1 1 
       16  9447 1 1 14 GLU CA   C    6.212  -1.591  -4.269 1.00 . A A .  14 GLU CA   1 1 
       16  9448 1 1 14 GLU CB   C    7.172  -1.316  -5.428 1.00 . A A .  14 GLU CB   1 1 
       16  9449 1 1 14 GLU CD   C    9.484  -1.955  -6.222 1.00 . A A .  14 GLU CD   1 1 
       16  9450 1 1 14 GLU CG   C    8.637  -1.481  -5.057 1.00 . A A .  14 GLU CG   1 1 
       16  9451 1 1 14 GLU H    H    5.089  -3.253  -4.947 1.00 . A A .  14 GLU H    1 1 
       16  9452 1 1 14 GLU HA   H    6.730  -1.426  -3.337 1.00 . A A .  14 GLU HA   1 1 
       16  9453 1 1 14 GLU HB2  H    6.947  -1.996  -6.236 1.00 . A A .  14 GLU HB2  1 1 
       16  9454 1 1 14 GLU HB3  H    7.022  -0.302  -5.770 1.00 . A A .  14 GLU HB3  1 1 
       16  9455 1 1 14 GLU HG2  H    9.019  -0.530  -4.718 1.00 . A A .  14 GLU HG2  1 1 
       16  9456 1 1 14 GLU HG3  H    8.713  -2.204  -4.258 1.00 . A A .  14 GLU HG3  1 1 
       16  9457 1 1 14 GLU N    N    5.769  -2.980  -4.297 1.00 . A A .  14 GLU N    1 1 
       16  9458 1 1 14 GLU O    O    4.024  -0.925  -5.008 1.00 . A A .  14 GLU O    1 1 
       16  9459 1 1 14 GLU OE1  O    9.268  -1.464  -7.350 1.00 . A A .  14 GLU OE1  1 1 
       16  9460 1 1 14 GLU OE2  O   10.361  -2.817  -6.006 1.00 . A A .  14 GLU OE2  1 1 
       16  9461 1 1 15 CYS C    C    4.005   2.237  -4.974 1.00 . A A .  15 CYS C    1 1 
       16  9462 1 1 15 CYS CA   C    4.067   1.488  -3.646 1.00 . A A .  15 CYS CA   1 1 
       16  9463 1 1 15 CYS CB   C    4.279   2.479  -2.499 1.00 . A A .  15 CYS CB   1 1 
       16  9464 1 1 15 CYS H    H    5.953   0.666  -3.149 1.00 . A A .  15 CYS H    1 1 
       16  9465 1 1 15 CYS HA   H    3.132   0.971  -3.494 1.00 . A A .  15 CYS HA   1 1 
       16  9466 1 1 15 CYS HB2  H    4.483   1.929  -1.592 1.00 . A A .  15 CYS HB2  1 1 
       16  9467 1 1 15 CYS HB3  H    5.125   3.109  -2.730 1.00 . A A .  15 CYS HB3  1 1 
       16  9468 1 1 15 CYS N    N    5.133   0.494  -3.659 1.00 . A A .  15 CYS N    1 1 
       16  9469 1 1 15 CYS O    O    5.013   2.754  -5.455 1.00 . A A .  15 CYS O    1 1 
       16  9470 1 1 15 CYS SG   S    2.851   3.563  -2.179 1.00 . A A .  15 CYS SG   1 1 
       16  9471 1 1 16 SER C    C    2.406   4.467  -6.626 1.00 . A A .  16 SER C    1 1 
       16  9472 1 1 16 SER CA   C    2.620   2.971  -6.837 1.00 . A A .  16 SER CA   1 1 
       16  9473 1 1 16 SER CB   C    1.425   2.374  -7.582 1.00 . A A .  16 SER CB   1 1 
       16  9474 1 1 16 SER H    H    2.048   1.857  -5.129 1.00 . A A .  16 SER H    1 1 
       16  9475 1 1 16 SER HA   H    3.512   2.827  -7.428 1.00 . A A .  16 SER HA   1 1 
       16  9476 1 1 16 SER HB2  H    1.599   1.322  -7.750 1.00 . A A .  16 SER HB2  1 1 
       16  9477 1 1 16 SER HB3  H    0.533   2.501  -6.987 1.00 . A A .  16 SER HB3  1 1 
       16  9478 1 1 16 SER HG   H    2.032   2.924  -9.362 1.00 . A A .  16 SER HG   1 1 
       16  9479 1 1 16 SER N    N    2.814   2.289  -5.562 1.00 . A A .  16 SER N    1 1 
       16  9480 1 1 16 SER O    O    2.022   5.185  -7.548 1.00 . A A .  16 SER O    1 1 
       16  9481 1 1 16 SER OG   O    1.235   3.010  -8.834 1.00 . A A .  16 SER OG   1 1 
       16  9482 1 1 17 GLU C    C    3.844   7.006  -4.844 1.00 . A A .  17 GLU C    1 1 
       16  9483 1 1 17 GLU CA   C    2.491   6.338  -5.071 1.00 . A A .  17 GLU CA   1 1 
       16  9484 1 1 17 GLU CB   C    1.618   6.491  -3.824 1.00 . A A .  17 GLU CB   1 1 
       16  9485 1 1 17 GLU CD   C   -0.807   6.409  -4.528 1.00 . A A .  17 GLU CD   1 1 
       16  9486 1 1 17 GLU CG   C    0.341   5.668  -3.870 1.00 . A A .  17 GLU CG   1 1 
       16  9487 1 1 17 GLU H    H    2.961   4.305  -4.711 1.00 . A A .  17 GLU H    1 1 
       16  9488 1 1 17 GLU HA   H    2.001   6.819  -5.904 1.00 . A A .  17 GLU HA   1 1 
       16  9489 1 1 17 GLU HB2  H    2.188   6.184  -2.960 1.00 . A A .  17 GLU HB2  1 1 
       16  9490 1 1 17 GLU HB3  H    1.347   7.530  -3.715 1.00 . A A .  17 GLU HB3  1 1 
       16  9491 1 1 17 GLU HG2  H    0.531   4.763  -4.427 1.00 . A A .  17 GLU HG2  1 1 
       16  9492 1 1 17 GLU HG3  H    0.055   5.414  -2.860 1.00 . A A .  17 GLU HG3  1 1 
       16  9493 1 1 17 GLU N    N    2.657   4.928  -5.404 1.00 . A A .  17 GLU N    1 1 
       16  9494 1 1 17 GLU O    O    4.097   8.106  -5.337 1.00 . A A .  17 GLU O    1 1 
       16  9495 1 1 17 GLU OE1  O   -0.539   7.365  -5.285 1.00 . A A .  17 GLU OE1  1 1 
       16  9496 1 1 17 GLU OE2  O   -1.973   6.033  -4.286 1.00 . A A .  17 GLU OE2  1 1 
       16  9497 1 1 18 CYS C    C    7.122   5.934  -4.335 1.00 . A A .  18 CYS C    1 1 
       16  9498 1 1 18 CYS CA   C    6.036   6.862  -3.797 1.00 . A A .  18 CYS CA   1 1 
       16  9499 1 1 18 CYS CB   C    6.210   7.047  -2.288 1.00 . A A .  18 CYS CB   1 1 
       16  9500 1 1 18 CYS H    H    4.450   5.462  -3.727 1.00 . A A .  18 CYS H    1 1 
       16  9501 1 1 18 CYS HA   H    6.127   7.822  -4.282 1.00 . A A .  18 CYS HA   1 1 
       16  9502 1 1 18 CYS HB2  H    7.194   7.448  -2.094 1.00 . A A .  18 CYS HB2  1 1 
       16  9503 1 1 18 CYS HB3  H    5.467   7.744  -1.931 1.00 . A A .  18 CYS HB3  1 1 
       16  9504 1 1 18 CYS N    N    4.710   6.334  -4.092 1.00 . A A .  18 CYS N    1 1 
       16  9505 1 1 18 CYS O    O    8.166   6.389  -4.801 1.00 . A A .  18 CYS O    1 1 
       16  9506 1 1 18 CYS SG   S    6.039   5.510  -1.325 1.00 . A A .  18 CYS SG   1 1 
       16  9507 1 1 19 GLY C    C    8.395   2.799  -3.638 1.00 . A A .  19 GLY C    1 1 
       16  9508 1 1 19 GLY CA   C    7.832   3.660  -4.750 1.00 . A A .  19 GLY CA   1 1 
       16  9509 1 1 19 GLY H    H    6.017   4.327  -3.885 1.00 . A A .  19 GLY H    1 1 
       16  9510 1 1 19 GLY HA2  H    7.351   3.023  -5.477 1.00 . A A .  19 GLY HA2  1 1 
       16  9511 1 1 19 GLY HA3  H    8.645   4.186  -5.229 1.00 . A A .  19 GLY HA3  1 1 
       16  9512 1 1 19 GLY N    N    6.867   4.631  -4.267 1.00 . A A .  19 GLY N    1 1 
       16  9513 1 1 19 GLY O    O    9.380   2.087  -3.831 1.00 . A A .  19 GLY O    1 1 
       16  9514 1 1 20 LYS C    C    8.298   0.602  -1.665 1.00 . A A .  20 LYS C    1 1 
       16  9515 1 1 20 LYS CA   C    8.213   2.084  -1.318 1.00 . A A .  20 LYS CA   1 1 
       16  9516 1 1 20 LYS CB   C    7.260   2.289  -0.138 1.00 . A A .  20 LYS CB   1 1 
       16  9517 1 1 20 LYS CD   C    7.090   1.766   2.313 1.00 . A A .  20 LYS CD   1 1 
       16  9518 1 1 20 LYS CE   C    7.714   1.980   3.683 1.00 . A A .  20 LYS CE   1 1 
       16  9519 1 1 20 LYS CG   C    7.961   2.341   1.209 1.00 . A A .  20 LYS CG   1 1 
       16  9520 1 1 20 LYS H    H    6.989   3.450  -2.374 1.00 . A A .  20 LYS H    1 1 
       16  9521 1 1 20 LYS HA   H    9.196   2.433  -1.040 1.00 . A A .  20 LYS HA   1 1 
       16  9522 1 1 20 LYS HB2  H    6.726   3.217  -0.279 1.00 . A A .  20 LYS HB2  1 1 
       16  9523 1 1 20 LYS HB3  H    6.550   1.474  -0.119 1.00 . A A .  20 LYS HB3  1 1 
       16  9524 1 1 20 LYS HD2  H    6.126   2.252   2.290 1.00 . A A .  20 LYS HD2  1 1 
       16  9525 1 1 20 LYS HD3  H    6.965   0.705   2.146 1.00 . A A .  20 LYS HD3  1 1 
       16  9526 1 1 20 LYS HE2  H    7.363   2.920   4.082 1.00 . A A .  20 LYS HE2  1 1 
       16  9527 1 1 20 LYS HE3  H    7.406   1.175   4.335 1.00 . A A .  20 LYS HE3  1 1 
       16  9528 1 1 20 LYS HG2  H    8.875   1.769   1.151 1.00 . A A .  20 LYS HG2  1 1 
       16  9529 1 1 20 LYS HG3  H    8.192   3.370   1.444 1.00 . A A .  20 LYS HG3  1 1 
       16  9530 1 1 20 LYS HZ1  H    9.531   2.960   3.363 1.00 . A A .  20 LYS HZ1  1 1 
       16  9531 1 1 20 LYS HZ2  H    9.540   1.332   2.901 1.00 . A A .  20 LYS HZ2  1 1 
       16  9532 1 1 20 LYS HZ3  H    9.605   1.747   4.540 1.00 . A A .  20 LYS HZ3  1 1 
       16  9533 1 1 20 LYS N    N    7.769   2.864  -2.467 1.00 . A A .  20 LYS N    1 1 
       16  9534 1 1 20 LYS NZ   N    9.202   2.007   3.617 1.00 . A A .  20 LYS NZ   1 1 
       16  9535 1 1 20 LYS O    O    8.102   0.212  -2.816 1.00 . A A .  20 LYS O    1 1 
       16  9536 1 1 21 ALA C    C    8.049  -2.424   0.288 1.00 . A A .  21 ALA C    1 1 
       16  9537 1 1 21 ALA CA   C    8.695  -1.661  -0.863 1.00 . A A .  21 ALA CA   1 1 
       16  9538 1 1 21 ALA CB   C   10.154  -2.066  -1.015 1.00 . A A .  21 ALA CB   1 1 
       16  9539 1 1 21 ALA H    H    8.734   0.149   0.232 1.00 . A A .  21 ALA H    1 1 
       16  9540 1 1 21 ALA HA   H    8.181  -1.910  -1.780 1.00 . A A .  21 ALA HA   1 1 
       16  9541 1 1 21 ALA HB1  H   10.256  -2.734  -1.857 1.00 . A A .  21 ALA HB1  1 1 
       16  9542 1 1 21 ALA HB2  H   10.756  -1.185  -1.179 1.00 . A A .  21 ALA HB2  1 1 
       16  9543 1 1 21 ALA HB3  H   10.484  -2.566  -0.116 1.00 . A A .  21 ALA HB3  1 1 
       16  9544 1 1 21 ALA N    N    8.589  -0.221  -0.663 1.00 . A A .  21 ALA N    1 1 
       16  9545 1 1 21 ALA O    O    7.981  -1.930   1.414 1.00 . A A .  21 ALA O    1 1 
       16  9546 1 1 22 PHE C    C    7.149  -5.944   0.715 1.00 . A A .  22 PHE C    1 1 
       16  9547 1 1 22 PHE CA   C    6.932  -4.463   1.010 1.00 . A A .  22 PHE CA   1 1 
       16  9548 1 1 22 PHE CB   C    5.434  -4.159   1.074 1.00 . A A .  22 PHE CB   1 1 
       16  9549 1 1 22 PHE CD1  C    5.260  -1.829   0.158 1.00 . A A .  22 PHE CD1  1 1 
       16  9550 1 1 22 PHE CD2  C    4.701  -2.190   2.447 1.00 . A A .  22 PHE CD2  1 1 
       16  9551 1 1 22 PHE CE1  C    4.977  -0.483   0.297 1.00 . A A .  22 PHE CE1  1 1 
       16  9552 1 1 22 PHE CE2  C    4.416  -0.846   2.593 1.00 . A A .  22 PHE CE2  1 1 
       16  9553 1 1 22 PHE CG   C    5.125  -2.697   1.229 1.00 . A A .  22 PHE CG   1 1 
       16  9554 1 1 22 PHE CZ   C    4.555   0.009   1.517 1.00 . A A .  22 PHE CZ   1 1 
       16  9555 1 1 22 PHE H    H    7.659  -3.972  -0.917 1.00 . A A .  22 PHE H    1 1 
       16  9556 1 1 22 PHE HA   H    7.379  -4.229   1.964 1.00 . A A .  22 PHE HA   1 1 
       16  9557 1 1 22 PHE HB2  H    4.965  -4.501   0.164 1.00 . A A .  22 PHE HB2  1 1 
       16  9558 1 1 22 PHE HB3  H    5.004  -4.681   1.915 1.00 . A A .  22 PHE HB3  1 1 
       16  9559 1 1 22 PHE HD1  H    5.591  -2.213  -0.797 1.00 . A A .  22 PHE HD1  1 1 
       16  9560 1 1 22 PHE HD2  H    4.593  -2.857   3.290 1.00 . A A .  22 PHE HD2  1 1 
       16  9561 1 1 22 PHE HE1  H    5.087   0.182  -0.546 1.00 . A A .  22 PHE HE1  1 1 
       16  9562 1 1 22 PHE HE2  H    4.086  -0.464   3.547 1.00 . A A .  22 PHE HE2  1 1 
       16  9563 1 1 22 PHE HZ   H    4.332   1.059   1.628 1.00 . A A .  22 PHE HZ   1 1 
       16  9564 1 1 22 PHE N    N    7.575  -3.632  -0.001 1.00 . A A .  22 PHE N    1 1 
       16  9565 1 1 22 PHE O    O    7.355  -6.335  -0.434 1.00 . A A .  22 PHE O    1 1 
       16  9566 1 1 23 ILE C    C    6.028  -8.873   1.095 1.00 . A A .  23 ILE C    1 1 
       16  9567 1 1 23 ILE CA   C    7.294  -8.200   1.614 1.00 . A A .  23 ILE CA   1 1 
       16  9568 1 1 23 ILE CB   C    7.698  -8.853   2.949 1.00 . A A .  23 ILE CB   1 1 
       16  9569 1 1 23 ILE CD1  C    9.279  -8.497   4.911 1.00 . A A .  23 ILE CD1  1 1 
       16  9570 1 1 23 ILE CG1  C    9.036  -8.290   3.433 1.00 . A A .  23 ILE CG1  1 1 
       16  9571 1 1 23 ILE CG2  C    7.779 -10.365   2.796 1.00 . A A .  23 ILE CG2  1 1 
       16  9572 1 1 23 ILE H    H    6.935  -6.391   2.652 1.00 . A A .  23 ILE H    1 1 
       16  9573 1 1 23 ILE HA   H    8.091  -8.359   0.902 1.00 . A A .  23 ILE HA   1 1 
       16  9574 1 1 23 ILE HB   H    6.936  -8.630   3.679 1.00 . A A .  23 ILE HB   1 1 
       16  9575 1 1 23 ILE HD11 H    9.340  -9.555   5.121 1.00 . A A .  23 ILE HD11 1 1 
       16  9576 1 1 23 ILE HD12 H   10.207  -8.022   5.194 1.00 . A A .  23 ILE HD12 1 1 
       16  9577 1 1 23 ILE HD13 H    8.467  -8.065   5.475 1.00 . A A .  23 ILE HD13 1 1 
       16  9578 1 1 23 ILE HG12 H    9.838  -8.770   2.895 1.00 . A A .  23 ILE HG12 1 1 
       16  9579 1 1 23 ILE HG13 H    9.062  -7.227   3.237 1.00 . A A .  23 ILE HG13 1 1 
       16  9580 1 1 23 ILE HG21 H    8.751 -10.708   3.117 1.00 . A A .  23 ILE HG21 1 1 
       16  9581 1 1 23 ILE HG22 H    7.016 -10.829   3.403 1.00 . A A .  23 ILE HG22 1 1 
       16  9582 1 1 23 ILE HG23 H    7.626 -10.631   1.761 1.00 . A A .  23 ILE HG23 1 1 
       16  9583 1 1 23 ILE N    N    7.103  -6.763   1.761 1.00 . A A .  23 ILE N    1 1 
       16  9584 1 1 23 ILE O    O    6.088  -9.755   0.238 1.00 . A A .  23 ILE O    1 1 
       16  9585 1 1 24 ARG C    C    2.625  -7.906   0.812 1.00 . A A .  24 ARG C    1 1 
       16  9586 1 1 24 ARG CA   C    3.600  -9.010   1.208 1.00 . A A .  24 ARG CA   1 1 
       16  9587 1 1 24 ARG CB   C    3.003  -9.853   2.336 1.00 . A A .  24 ARG CB   1 1 
       16  9588 1 1 24 ARG CD   C    3.917 -12.132   1.800 1.00 . A A .  24 ARG CD   1 1 
       16  9589 1 1 24 ARG CG   C    3.908 -10.984   2.797 1.00 . A A .  24 ARG CG   1 1 
       16  9590 1 1 24 ARG CZ   C    5.437 -13.949   1.143 1.00 . A A .  24 ARG CZ   1 1 
       16  9591 1 1 24 ARG H    H    4.898  -7.743   2.298 1.00 . A A .  24 ARG H    1 1 
       16  9592 1 1 24 ARG HA   H    3.775  -9.644   0.351 1.00 . A A .  24 ARG HA   1 1 
       16  9593 1 1 24 ARG HB2  H    2.805  -9.212   3.183 1.00 . A A .  24 ARG HB2  1 1 
       16  9594 1 1 24 ARG HB3  H    2.073 -10.281   1.995 1.00 . A A .  24 ARG HB3  1 1 
       16  9595 1 1 24 ARG HD2  H    2.989 -12.676   1.890 1.00 . A A .  24 ARG HD2  1 1 
       16  9596 1 1 24 ARG HD3  H    3.999 -11.724   0.803 1.00 . A A .  24 ARG HD3  1 1 
       16  9597 1 1 24 ARG HE   H    5.494 -12.990   2.891 1.00 . A A .  24 ARG HE   1 1 
       16  9598 1 1 24 ARG HG2  H    4.914 -10.606   2.904 1.00 . A A .  24 ARG HG2  1 1 
       16  9599 1 1 24 ARG HG3  H    3.555 -11.348   3.750 1.00 . A A .  24 ARG HG3  1 1 
       16  9600 1 1 24 ARG HH11 H    4.058 -13.449  -0.246 1.00 . A A .  24 ARG HH11 1 1 
       16  9601 1 1 24 ARG HH12 H    5.136 -14.729  -0.697 1.00 . A A .  24 ARG HH12 1 1 
       16  9602 1 1 24 ARG HH21 H    6.920 -14.674   2.310 1.00 . A A .  24 ARG HH21 1 1 
       16  9603 1 1 24 ARG HH22 H    6.763 -15.425   0.758 1.00 . A A .  24 ARG HH22 1 1 
       16  9604 1 1 24 ARG N    N    4.882  -8.449   1.619 1.00 . A A .  24 ARG N    1 1 
       16  9605 1 1 24 ARG NE   N    5.029 -13.049   2.031 1.00 . A A .  24 ARG NE   1 1 
       16  9606 1 1 24 ARG NH1  N    4.826 -14.051  -0.029 1.00 . A A .  24 ARG NH1  1 1 
       16  9607 1 1 24 ARG NH2  N    6.457 -14.748   1.427 1.00 . A A .  24 ARG NH2  1 1 
       16  9608 1 1 24 ARG O    O    2.655  -6.809   1.369 1.00 . A A .  24 ARG O    1 1 
       16  9609 1 1 25 ASN C    C    0.033  -6.603   0.545 1.00 . A A .  25 ASN C    1 1 
       16  9610 1 1 25 ASN CA   C    0.779  -7.235  -0.626 1.00 . A A .  25 ASN CA   1 1 
       16  9611 1 1 25 ASN CB   C   -0.215  -7.907  -1.575 1.00 . A A .  25 ASN CB   1 1 
       16  9612 1 1 25 ASN CG   C   -0.751  -6.951  -2.623 1.00 . A A .  25 ASN CG   1 1 
       16  9613 1 1 25 ASN H    H    1.788  -9.095  -0.561 1.00 . A A .  25 ASN H    1 1 
       16  9614 1 1 25 ASN HA   H    1.307  -6.460  -1.162 1.00 . A A .  25 ASN HA   1 1 
       16  9615 1 1 25 ASN HB2  H    0.276  -8.726  -2.080 1.00 . A A .  25 ASN HB2  1 1 
       16  9616 1 1 25 ASN HB3  H   -1.047  -8.290  -1.003 1.00 . A A .  25 ASN HB3  1 1 
       16  9617 1 1 25 ASN HD21 H   -0.596  -5.431  -1.351 1.00 . A A .  25 ASN HD21 1 1 
       16  9618 1 1 25 ASN HD22 H   -1.206  -5.039  -2.919 1.00 . A A .  25 ASN HD22 1 1 
       16  9619 1 1 25 ASN N    N    1.763  -8.203  -0.155 1.00 . A A .  25 ASN N    1 1 
       16  9620 1 1 25 ASN ND2  N   -0.862  -5.678  -2.261 1.00 . A A .  25 ASN ND2  1 1 
       16  9621 1 1 25 ASN O    O    0.003  -5.381   0.688 1.00 . A A .  25 ASN O    1 1 
       16  9622 1 1 25 ASN OD1  O   -1.061  -7.353  -3.745 1.00 . A A .  25 ASN OD1  1 1 
       16  9623 1 1 26 SER C    C   -0.604  -5.791   3.199 1.00 . A A .  26 SER C    1 1 
       16  9624 1 1 26 SER CA   C   -1.315  -6.969   2.539 1.00 . A A .  26 SER CA   1 1 
       16  9625 1 1 26 SER CB   C   -1.502  -8.099   3.552 1.00 . A A .  26 SER CB   1 1 
       16  9626 1 1 26 SER H    H   -0.506  -8.408   1.214 1.00 . A A .  26 SER H    1 1 
       16  9627 1 1 26 SER HA   H   -2.285  -6.641   2.195 1.00 . A A .  26 SER HA   1 1 
       16  9628 1 1 26 SER HB2  H   -2.063  -8.900   3.095 1.00 . A A .  26 SER HB2  1 1 
       16  9629 1 1 26 SER HB3  H   -0.533  -8.468   3.859 1.00 . A A .  26 SER HB3  1 1 
       16  9630 1 1 26 SER HG   H   -1.914  -8.144   5.467 1.00 . A A .  26 SER HG   1 1 
       16  9631 1 1 26 SER N    N   -0.567  -7.444   1.381 1.00 . A A .  26 SER N    1 1 
       16  9632 1 1 26 SER O    O   -1.244  -4.850   3.666 1.00 . A A .  26 SER O    1 1 
       16  9633 1 1 26 SER OG   O   -2.202  -7.647   4.698 1.00 . A A .  26 SER OG   1 1 
       16  9634 1 1 27 GLN C    C    1.433  -3.510   3.014 1.00 . A A .  27 GLN C    1 1 
       16  9635 1 1 27 GLN CA   C    1.521  -4.792   3.836 1.00 . A A .  27 GLN CA   1 1 
       16  9636 1 1 27 GLN CB   C    2.981  -5.232   3.961 1.00 . A A .  27 GLN CB   1 1 
       16  9637 1 1 27 GLN CD   C    4.449  -6.728   5.372 1.00 . A A .  27 GLN CD   1 1 
       16  9638 1 1 27 GLN CG   C    3.151  -6.602   4.600 1.00 . A A .  27 GLN CG   1 1 
       16  9639 1 1 27 GLN H    H    1.175  -6.629   2.843 1.00 . A A .  27 GLN H    1 1 
       16  9640 1 1 27 GLN HA   H    1.127  -4.601   4.822 1.00 . A A .  27 GLN HA   1 1 
       16  9641 1 1 27 GLN HB2  H    3.422  -5.261   2.976 1.00 . A A .  27 GLN HB2  1 1 
       16  9642 1 1 27 GLN HB3  H    3.512  -4.510   4.564 1.00 . A A .  27 GLN HB3  1 1 
       16  9643 1 1 27 GLN HE21 H    3.497  -7.615   6.875 1.00 . A A .  27 GLN HE21 1 1 
       16  9644 1 1 27 GLN HE22 H    5.198  -7.401   7.086 1.00 . A A .  27 GLN HE22 1 1 
       16  9645 1 1 27 GLN HG2  H    2.328  -6.773   5.278 1.00 . A A .  27 GLN HG2  1 1 
       16  9646 1 1 27 GLN HG3  H    3.137  -7.351   3.822 1.00 . A A .  27 GLN HG3  1 1 
       16  9647 1 1 27 GLN N    N    0.723  -5.853   3.232 1.00 . A A .  27 GLN N    1 1 
       16  9648 1 1 27 GLN NE2  N    4.374  -7.306   6.566 1.00 . A A .  27 GLN NE2  1 1 
       16  9649 1 1 27 GLN O    O    1.093  -2.448   3.537 1.00 . A A .  27 GLN O    1 1 
       16  9650 1 1 27 GLN OE1  O    5.508  -6.311   4.902 1.00 . A A .  27 GLN OE1  1 1 
       16  9651 1 1 28 LEU C    C    0.330  -1.791   0.878 1.00 . A A .  28 LEU C    1 1 
       16  9652 1 1 28 LEU CA   C    1.698  -2.465   0.832 1.00 . A A .  28 LEU CA   1 1 
       16  9653 1 1 28 LEU CB   C    2.020  -2.894  -0.600 1.00 . A A .  28 LEU CB   1 1 
       16  9654 1 1 28 LEU CD1  C    2.217  -0.540  -1.439 1.00 . A A .  28 LEU CD1  1 1 
       16  9655 1 1 28 LEU CD2  C    2.050  -2.434  -3.064 1.00 . A A .  28 LEU CD2  1 1 
       16  9656 1 1 28 LEU CG   C    1.617  -1.913  -1.702 1.00 . A A .  28 LEU CG   1 1 
       16  9657 1 1 28 LEU H    H    2.006  -4.489   1.368 1.00 . A A .  28 LEU H    1 1 
       16  9658 1 1 28 LEU HA   H    2.445  -1.759   1.164 1.00 . A A .  28 LEU HA   1 1 
       16  9659 1 1 28 LEU HB2  H    3.086  -3.047  -0.668 1.00 . A A .  28 LEU HB2  1 1 
       16  9660 1 1 28 LEU HB3  H    1.511  -3.829  -0.786 1.00 . A A .  28 LEU HB3  1 1 
       16  9661 1 1 28 LEU HD11 H    1.862   0.156  -2.184 1.00 . A A .  28 LEU HD11 1 1 
       16  9662 1 1 28 LEU HD12 H    3.294  -0.603  -1.488 1.00 . A A .  28 LEU HD12 1 1 
       16  9663 1 1 28 LEU HD13 H    1.921  -0.200  -0.457 1.00 . A A .  28 LEU HD13 1 1 
       16  9664 1 1 28 LEU HD21 H    3.104  -2.669  -3.042 1.00 . A A .  28 LEU HD21 1 1 
       16  9665 1 1 28 LEU HD22 H    1.865  -1.678  -3.814 1.00 . A A .  28 LEU HD22 1 1 
       16  9666 1 1 28 LEU HD23 H    1.487  -3.324  -3.305 1.00 . A A .  28 LEU HD23 1 1 
       16  9667 1 1 28 LEU HG   H    0.541  -1.811  -1.708 1.00 . A A .  28 LEU HG   1 1 
       16  9668 1 1 28 LEU N    N    1.742  -3.616   1.727 1.00 . A A .  28 LEU N    1 1 
       16  9669 1 1 28 LEU O    O    0.225  -0.597   1.159 1.00 . A A .  28 LEU O    1 1 
       16  9670 1 1 29 ILE C    C   -2.295  -1.110   1.801 1.00 . A A .  29 ILE C    1 1 
       16  9671 1 1 29 ILE CA   C   -2.075  -2.044   0.615 1.00 . A A .  29 ILE CA   1 1 
       16  9672 1 1 29 ILE CB   C   -3.113  -3.181   0.673 1.00 . A A .  29 ILE CB   1 1 
       16  9673 1 1 29 ILE CD1  C   -3.656  -5.420  -0.408 1.00 . A A .  29 ILE CD1  1 1 
       16  9674 1 1 29 ILE CG1  C   -3.000  -4.067  -0.569 1.00 . A A .  29 ILE CG1  1 1 
       16  9675 1 1 29 ILE CG2  C   -4.517  -2.610   0.797 1.00 . A A .  29 ILE CG2  1 1 
       16  9676 1 1 29 ILE H    H   -0.565  -3.509   0.386 1.00 . A A .  29 ILE H    1 1 
       16  9677 1 1 29 ILE HA   H   -2.228  -1.490  -0.299 1.00 . A A .  29 ILE HA   1 1 
       16  9678 1 1 29 ILE HB   H   -2.913  -3.777   1.551 1.00 . A A .  29 ILE HB   1 1 
       16  9679 1 1 29 ILE HD11 H   -3.101  -6.159  -0.968 1.00 . A A .  29 ILE HD11 1 1 
       16  9680 1 1 29 ILE HD12 H   -3.665  -5.695   0.637 1.00 . A A .  29 ILE HD12 1 1 
       16  9681 1 1 29 ILE HD13 H   -4.669  -5.376  -0.778 1.00 . A A .  29 ILE HD13 1 1 
       16  9682 1 1 29 ILE HG12 H   -3.469  -3.569  -1.403 1.00 . A A .  29 ILE HG12 1 1 
       16  9683 1 1 29 ILE HG13 H   -1.955  -4.229  -0.793 1.00 . A A .  29 ILE HG13 1 1 
       16  9684 1 1 29 ILE HG21 H   -4.828  -2.641   1.831 1.00 . A A .  29 ILE HG21 1 1 
       16  9685 1 1 29 ILE HG22 H   -4.522  -1.588   0.452 1.00 . A A .  29 ILE HG22 1 1 
       16  9686 1 1 29 ILE HG23 H   -5.199  -3.196   0.199 1.00 . A A .  29 ILE HG23 1 1 
       16  9687 1 1 29 ILE N    N   -0.714  -2.565   0.602 1.00 . A A .  29 ILE N    1 1 
       16  9688 1 1 29 ILE O    O   -2.725   0.031   1.634 1.00 . A A .  29 ILE O    1 1 
       16  9689 1 1 30 VAL C    C   -1.451   0.535   4.089 1.00 . A A .  30 VAL C    1 1 
       16  9690 1 1 30 VAL CA   C   -2.157  -0.811   4.212 1.00 . A A .  30 VAL CA   1 1 
       16  9691 1 1 30 VAL CB   C   -1.607  -1.555   5.444 1.00 . A A .  30 VAL CB   1 1 
       16  9692 1 1 30 VAL CG1  C   -1.802  -0.722   6.702 1.00 . A A .  30 VAL CG1  1 1 
       16  9693 1 1 30 VAL CG2  C   -2.275  -2.914   5.587 1.00 . A A .  30 VAL CG2  1 1 
       16  9694 1 1 30 VAL H    H   -1.656  -2.519   3.067 1.00 . A A .  30 VAL H    1 1 
       16  9695 1 1 30 VAL HA   H   -3.213  -0.641   4.362 1.00 . A A .  30 VAL HA   1 1 
       16  9696 1 1 30 VAL HB   H   -0.548  -1.711   5.303 1.00 . A A .  30 VAL HB   1 1 
       16  9697 1 1 30 VAL HG11 H   -1.020  -0.952   7.411 1.00 . A A .  30 VAL HG11 1 1 
       16  9698 1 1 30 VAL HG12 H   -1.762   0.328   6.449 1.00 . A A .  30 VAL HG12 1 1 
       16  9699 1 1 30 VAL HG13 H   -2.762  -0.951   7.140 1.00 . A A .  30 VAL HG13 1 1 
       16  9700 1 1 30 VAL HG21 H   -2.794  -2.964   6.533 1.00 . A A .  30 VAL HG21 1 1 
       16  9701 1 1 30 VAL HG22 H   -2.980  -3.054   4.781 1.00 . A A .  30 VAL HG22 1 1 
       16  9702 1 1 30 VAL HG23 H   -1.525  -3.691   5.547 1.00 . A A .  30 VAL HG23 1 1 
       16  9703 1 1 30 VAL N    N   -1.995  -1.603   2.999 1.00 . A A .  30 VAL N    1 1 
       16  9704 1 1 30 VAL O    O   -1.929   1.548   4.601 1.00 . A A .  30 VAL O    1 1 
       16  9705 1 1 31 HIS C    C   -0.169   2.637   2.133 1.00 . A A .  31 HIS C    1 1 
       16  9706 1 1 31 HIS CA   C    0.460   1.762   3.213 1.00 . A A .  31 HIS CA   1 1 
       16  9707 1 1 31 HIS CB   C    1.903   1.425   2.836 1.00 . A A .  31 HIS CB   1 1 
       16  9708 1 1 31 HIS CD2  C    3.083   3.149   1.299 1.00 . A A .  31 HIS CD2  1 1 
       16  9709 1 1 31 HIS CE1  C    3.965   4.416   2.855 1.00 . A A .  31 HIS CE1  1 1 
       16  9710 1 1 31 HIS CG   C    2.729   2.628   2.497 1.00 . A A .  31 HIS CG   1 1 
       16  9711 1 1 31 HIS H    H    0.018  -0.300   3.021 1.00 . A A .  31 HIS H    1 1 
       16  9712 1 1 31 HIS HA   H    0.458   2.305   4.146 1.00 . A A .  31 HIS HA   1 1 
       16  9713 1 1 31 HIS HB2  H    2.377   0.922   3.666 1.00 . A A .  31 HIS HB2  1 1 
       16  9714 1 1 31 HIS HB3  H    1.901   0.770   1.977 1.00 . A A .  31 HIS HB3  1 1 
       16  9715 1 1 31 HIS HD1  H    3.224   3.328   4.421 1.00 . A A .  31 HIS HD1  1 1 
       16  9716 1 1 31 HIS HD2  H    2.812   2.764   0.326 1.00 . A A .  31 HIS HD2  1 1 
       16  9717 1 1 31 HIS HE1  H    4.511   5.205   3.351 1.00 . A A .  31 HIS HE1  1 1 
       16  9718 1 1 31 HIS N    N   -0.311   0.539   3.405 1.00 . A A .  31 HIS N    1 1 
       16  9719 1 1 31 HIS ND1  N    3.298   3.444   3.451 1.00 . A A .  31 HIS ND1  1 1 
       16  9720 1 1 31 HIS NE2  N    3.850   4.260   1.549 1.00 . A A .  31 HIS NE2  1 1 
       16  9721 1 1 31 HIS O    O    0.095   3.837   2.063 1.00 . A A .  31 HIS O    1 1 
       16  9722 1 1 32 GLN C    C   -2.932   3.438   0.724 1.00 . A A .  32 GLN C    1 1 
       16  9723 1 1 32 GLN CA   C   -1.667   2.753   0.219 1.00 . A A .  32 GLN CA   1 1 
       16  9724 1 1 32 GLN CB   C   -2.011   1.801  -0.928 1.00 . A A .  32 GLN CB   1 1 
       16  9725 1 1 32 GLN CD   C   -1.152   0.573  -2.963 1.00 . A A .  32 GLN CD   1 1 
       16  9726 1 1 32 GLN CG   C   -0.792   1.271  -1.666 1.00 . A A .  32 GLN CG   1 1 
       16  9727 1 1 32 GLN H    H   -1.172   1.070   1.403 1.00 . A A .  32 GLN H    1 1 
       16  9728 1 1 32 GLN HA   H   -0.985   3.507  -0.144 1.00 . A A .  32 GLN HA   1 1 
       16  9729 1 1 32 GLN HB2  H   -2.558   0.960  -0.530 1.00 . A A .  32 GLN HB2  1 1 
       16  9730 1 1 32 GLN HB3  H   -2.635   2.323  -1.639 1.00 . A A .  32 GLN HB3  1 1 
       16  9731 1 1 32 GLN HE21 H   -0.117   1.917  -4.001 1.00 . A A .  32 GLN HE21 1 1 
       16  9732 1 1 32 GLN HE22 H   -0.887   0.681  -4.930 1.00 . A A .  32 GLN HE22 1 1 
       16  9733 1 1 32 GLN HG2  H   -0.135   2.098  -1.890 1.00 . A A .  32 GLN HG2  1 1 
       16  9734 1 1 32 GLN HG3  H   -0.278   0.568  -1.026 1.00 . A A .  32 GLN HG3  1 1 
       16  9735 1 1 32 GLN N    N   -1.002   2.028   1.295 1.00 . A A .  32 GLN N    1 1 
       16  9736 1 1 32 GLN NE2  N   -0.671   1.111  -4.078 1.00 . A A .  32 GLN NE2  1 1 
       16  9737 1 1 32 GLN O    O   -3.397   4.415   0.137 1.00 . A A .  32 GLN O    1 1 
       16  9738 1 1 32 GLN OE1  O   -1.855  -0.438  -2.963 1.00 . A A .  32 GLN OE1  1 1 
       16  9739 1 1 33 ARG C    C   -4.571   4.990   2.566 1.00 . A A .  33 ARG C    1 1 
       16  9740 1 1 33 ARG CA   C   -4.697   3.479   2.399 1.00 . A A .  33 ARG CA   1 1 
       16  9741 1 1 33 ARG CB   C   -4.986   2.828   3.753 1.00 . A A .  33 ARG CB   1 1 
       16  9742 1 1 33 ARG CD   C   -6.091   0.892   4.913 1.00 . A A .  33 ARG CD   1 1 
       16  9743 1 1 33 ARG CG   C   -5.386   1.365   3.652 1.00 . A A .  33 ARG CG   1 1 
       16  9744 1 1 33 ARG CZ   C   -5.546   0.689   7.302 1.00 . A A .  33 ARG CZ   1 1 
       16  9745 1 1 33 ARG H    H   -3.067   2.139   2.239 1.00 . A A .  33 ARG H    1 1 
       16  9746 1 1 33 ARG HA   H   -5.516   3.270   1.727 1.00 . A A .  33 ARG HA   1 1 
       16  9747 1 1 33 ARG HB2  H   -4.100   2.894   4.367 1.00 . A A .  33 ARG HB2  1 1 
       16  9748 1 1 33 ARG HB3  H   -5.789   3.366   4.233 1.00 . A A .  33 ARG HB3  1 1 
       16  9749 1 1 33 ARG HD2  H   -6.843   1.619   5.184 1.00 . A A .  33 ARG HD2  1 1 
       16  9750 1 1 33 ARG HD3  H   -6.565  -0.057   4.711 1.00 . A A .  33 ARG HD3  1 1 
       16  9751 1 1 33 ARG HE   H   -4.211   0.650   5.821 1.00 . A A .  33 ARG HE   1 1 
       16  9752 1 1 33 ARG HG2  H   -6.054   1.241   2.812 1.00 . A A .  33 ARG HG2  1 1 
       16  9753 1 1 33 ARG HG3  H   -4.499   0.768   3.500 1.00 . A A .  33 ARG HG3  1 1 
       16  9754 1 1 33 ARG HH11 H   -7.512   0.907   6.894 1.00 . A A .  33 ARG HH11 1 1 
       16  9755 1 1 33 ARG HH12 H   -7.115   0.763   8.574 1.00 . A A .  33 ARG HH12 1 1 
       16  9756 1 1 33 ARG HH21 H   -3.674   0.459   8.030 1.00 . A A .  33 ARG HH21 1 1 
       16  9757 1 1 33 ARG HH22 H   -4.931   0.509   9.219 1.00 . A A .  33 ARG HH22 1 1 
       16  9758 1 1 33 ARG N    N   -3.484   2.918   1.816 1.00 . A A .  33 ARG N    1 1 
       16  9759 1 1 33 ARG NE   N   -5.164   0.731   6.030 1.00 . A A .  33 ARG NE   1 1 
       16  9760 1 1 33 ARG NH1  N   -6.830   0.796   7.616 1.00 . A A .  33 ARG NH1  1 1 
       16  9761 1 1 33 ARG NH2  N   -4.643   0.540   8.263 1.00 . A A .  33 ARG NH2  1 1 
       16  9762 1 1 33 ARG O    O   -5.511   5.737   2.291 1.00 . A A .  33 ARG O    1 1 
       16  9763 1 1 34 THR C    C   -2.990   7.584   1.897 1.00 . A A .  34 THR C    1 1 
       16  9764 1 1 34 THR CA   C   -3.155   6.857   3.226 1.00 . A A .  34 THR CA   1 1 
       16  9765 1 1 34 THR CB   C   -1.898   7.089   4.085 1.00 . A A .  34 THR CB   1 1 
       16  9766 1 1 34 THR CG2  C   -0.665   6.510   3.407 1.00 . A A .  34 THR CG2  1 1 
       16  9767 1 1 34 THR H    H   -2.694   4.791   3.222 1.00 . A A .  34 THR H    1 1 
       16  9768 1 1 34 THR HA   H   -4.005   7.272   3.749 1.00 . A A .  34 THR HA   1 1 
       16  9769 1 1 34 THR HB   H   -2.034   6.593   5.036 1.00 . A A .  34 THR HB   1 1 
       16  9770 1 1 34 THR HG1  H   -2.553   8.893   4.536 1.00 . A A .  34 THR HG1  1 1 
       16  9771 1 1 34 THR HG21 H    0.202   6.688   4.025 1.00 . A A .  34 THR HG21 1 1 
       16  9772 1 1 34 THR HG22 H   -0.526   6.986   2.447 1.00 . A A .  34 THR HG22 1 1 
       16  9773 1 1 34 THR HG23 H   -0.796   5.448   3.267 1.00 . A A .  34 THR HG23 1 1 
       16  9774 1 1 34 THR N    N   -3.404   5.435   3.020 1.00 . A A .  34 THR N    1 1 
       16  9775 1 1 34 THR O    O   -3.471   8.705   1.726 1.00 . A A .  34 THR O    1 1 
       16  9776 1 1 34 THR OG1  O   -1.711   8.490   4.312 1.00 . A A .  34 THR OG1  1 1 
       16  9777 1 1 35 HIS C    C   -3.396   7.716  -1.106 1.00 . A A .  35 HIS C    1 1 
       16  9778 1 1 35 HIS CA   C   -2.079   7.526  -0.360 1.00 . A A .  35 HIS CA   1 1 
       16  9779 1 1 35 HIS CB   C   -1.139   6.641  -1.180 1.00 . A A .  35 HIS CB   1 1 
       16  9780 1 1 35 HIS CD2  C    1.307   6.256  -0.408 1.00 . A A .  35 HIS CD2  1 1 
       16  9781 1 1 35 HIS CE1  C    2.165   8.150  -1.103 1.00 . A A .  35 HIS CE1  1 1 
       16  9782 1 1 35 HIS CG   C    0.310   6.966  -0.986 1.00 . A A .  35 HIS CG   1 1 
       16  9783 1 1 35 HIS H    H   -1.948   6.049   1.151 1.00 . A A .  35 HIS H    1 1 
       16  9784 1 1 35 HIS HA   H   -1.617   8.491  -0.218 1.00 . A A .  35 HIS HA   1 1 
       16  9785 1 1 35 HIS HB2  H   -1.288   5.610  -0.897 1.00 . A A .  35 HIS HB2  1 1 
       16  9786 1 1 35 HIS HB3  H   -1.369   6.758  -2.229 1.00 . A A .  35 HIS HB3  1 1 
       16  9787 1 1 35 HIS HD1  H    0.413   8.875  -1.870 1.00 . A A .  35 HIS HD1  1 1 
       16  9788 1 1 35 HIS HD2  H    1.221   5.275   0.038 1.00 . A A .  35 HIS HD2  1 1 
       16  9789 1 1 35 HIS HE1  H    2.864   8.945  -1.314 1.00 . A A .  35 HIS HE1  1 1 
       16  9790 1 1 35 HIS N    N   -2.306   6.940   0.956 1.00 . A A .  35 HIS N    1 1 
       16  9791 1 1 35 HIS ND1  N    0.880   8.147  -1.411 1.00 . A A .  35 HIS ND1  1 1 
       16  9792 1 1 35 HIS NE2  N    2.449   7.013  -0.493 1.00 . A A .  35 HIS NE2  1 1 
       16  9793 1 1 35 HIS O    O   -3.560   8.674  -1.861 1.00 . A A .  35 HIS O    1 1 
       16  9794 1 1 36 SER C    C   -6.171   8.290  -1.543 1.00 . A A .  36 SER C    1 1 
       16  9795 1 1 36 SER CA   C   -5.634   6.862  -1.542 1.00 . A A .  36 SER CA   1 1 
       16  9796 1 1 36 SER CB   C   -6.627   5.932  -0.843 1.00 . A A .  36 SER CB   1 1 
       16  9797 1 1 36 SER H    H   -4.141   6.058  -0.274 1.00 . A A .  36 SER H    1 1 
       16  9798 1 1 36 SER HA   H   -5.507   6.537  -2.564 1.00 . A A .  36 SER HA   1 1 
       16  9799 1 1 36 SER HB2  H   -6.122   5.024  -0.552 1.00 . A A .  36 SER HB2  1 1 
       16  9800 1 1 36 SER HB3  H   -7.018   6.424   0.036 1.00 . A A .  36 SER HB3  1 1 
       16  9801 1 1 36 SER HG   H   -8.017   4.716  -1.496 1.00 . A A .  36 SER HG   1 1 
       16  9802 1 1 36 SER N    N   -4.332   6.798  -0.888 1.00 . A A .  36 SER N    1 1 
       16  9803 1 1 36 SER O    O   -6.782   8.735  -2.514 1.00 . A A .  36 SER O    1 1 
       16  9804 1 1 36 SER OG   O   -7.706   5.601  -1.699 1.00 . A A .  36 SER OG   1 1 
       16  9805 1 1 37 GLY C    C   -5.620  11.324  -1.222 1.00 . A A .  37 GLY C    1 1 
       16  9806 1 1 37 GLY CA   C   -6.405  10.374  -0.340 1.00 . A A .  37 GLY CA   1 1 
       16  9807 1 1 37 GLY H    H   -5.446   8.598   0.297 1.00 . A A .  37 GLY H    1 1 
       16  9808 1 1 37 GLY HA2  H   -7.446  10.412  -0.625 1.00 . A A .  37 GLY HA2  1 1 
       16  9809 1 1 37 GLY HA3  H   -6.312  10.696   0.687 1.00 . A A .  37 GLY HA3  1 1 
       16  9810 1 1 37 GLY N    N   -5.938   9.004  -0.446 1.00 . A A .  37 GLY N    1 1 
       16  9811 1 1 37 GLY O    O   -4.468  11.057  -1.562 1.00 . A A .  37 GLY O    1 1 
       16  9812 1 1 38 GLU C    C   -6.070  14.836  -2.098 1.00 . A A .  38 GLU C    1 1 
       16  9813 1 1 38 GLU CA   C   -5.598  13.427  -2.447 1.00 . A A .  38 GLU CA   1 1 
       16  9814 1 1 38 GLU CB   C   -5.886  13.133  -3.921 1.00 . A A .  38 GLU CB   1 1 
       16  9815 1 1 38 GLU CD   C   -7.738  12.476  -5.509 1.00 . A A .  38 GLU CD   1 1 
       16  9816 1 1 38 GLU CG   C   -7.346  13.309  -4.304 1.00 . A A .  38 GLU CG   1 1 
       16  9817 1 1 38 GLU H    H   -7.165  12.593  -1.293 1.00 . A A .  38 GLU H    1 1 
       16  9818 1 1 38 GLU HA   H   -4.534  13.365  -2.278 1.00 . A A .  38 GLU HA   1 1 
       16  9819 1 1 38 GLU HB2  H   -5.292  13.797  -4.531 1.00 . A A .  38 GLU HB2  1 1 
       16  9820 1 1 38 GLU HB3  H   -5.601  12.113  -4.134 1.00 . A A .  38 GLU HB3  1 1 
       16  9821 1 1 38 GLU HG2  H   -7.962  13.015  -3.467 1.00 . A A .  38 GLU HG2  1 1 
       16  9822 1 1 38 GLU HG3  H   -7.522  14.350  -4.531 1.00 . A A .  38 GLU HG3  1 1 
       16  9823 1 1 38 GLU N    N   -6.246  12.436  -1.596 1.00 . A A .  38 GLU N    1 1 
       16  9824 1 1 38 GLU O    O   -7.268  15.087  -1.969 1.00 . A A .  38 GLU O    1 1 
       16  9825 1 1 38 GLU OE1  O   -7.049  12.575  -6.546 1.00 . A A .  38 GLU OE1  1 1 
       16  9826 1 1 38 GLU OE2  O   -8.732  11.727  -5.415 1.00 . A A .  38 GLU OE2  1 1 
       16  9827 1 1 39 SER C    C   -6.106  17.841  -2.780 1.00 . A A .  39 SER C    1 1 
       16  9828 1 1 39 SER CA   C   -5.434  17.134  -1.606 1.00 . A A .  39 SER CA   1 1 
       16  9829 1 1 39 SER CB   C   -4.165  17.885  -1.202 1.00 . A A .  39 SER CB   1 1 
       16  9830 1 1 39 SER H    H   -4.181  15.489  -2.061 1.00 . A A .  39 SER H    1 1 
       16  9831 1 1 39 SER HA   H   -6.117  17.122  -0.770 1.00 . A A .  39 SER HA   1 1 
       16  9832 1 1 39 SER HB2  H   -4.363  18.946  -1.197 1.00 . A A .  39 SER HB2  1 1 
       16  9833 1 1 39 SER HB3  H   -3.863  17.571  -0.213 1.00 . A A .  39 SER HB3  1 1 
       16  9834 1 1 39 SER HG   H   -3.112  18.280  -2.806 1.00 . A A .  39 SER HG   1 1 
       16  9835 1 1 39 SER N    N   -5.118  15.751  -1.945 1.00 . A A .  39 SER N    1 1 
       16  9836 1 1 39 SER O    O   -6.757  18.870  -2.608 1.00 . A A .  39 SER O    1 1 
       16  9837 1 1 39 SER OG   O   -3.107  17.623  -2.107 1.00 . A A .  39 SER OG   1 1 
       16  9838 1 1 40 GLY C    C   -5.514  18.143  -6.245 1.00 . A A .  40 GLY C    1 1 
       16  9839 1 1 40 GLY CA   C   -6.535  17.869  -5.159 1.00 . A A .  40 GLY CA   1 1 
       16  9840 1 1 40 GLY H    H   -5.410  16.459  -4.050 1.00 . A A .  40 GLY H    1 1 
       16  9841 1 1 40 GLY HA2  H   -7.285  17.195  -5.546 1.00 . A A .  40 GLY HA2  1 1 
       16  9842 1 1 40 GLY HA3  H   -7.010  18.800  -4.885 1.00 . A A .  40 GLY HA3  1 1 
       16  9843 1 1 40 GLY N    N   -5.941  17.280  -3.974 1.00 . A A .  40 GLY N    1 1 
       16  9844 1 1 40 GLY O    O   -4.436  17.550  -6.277 1.00 . A A .  40 GLY O    1 1 
       16  9845 1 1 41 PRO C    C   -3.744  20.209  -7.805 1.00 . A A .  41 PRO C    1 1 
       16  9846 1 1 41 PRO CA   C   -4.970  19.433  -8.273 1.00 . A A .  41 PRO CA   1 1 
       16  9847 1 1 41 PRO CB   C   -5.859  20.316  -9.152 1.00 . A A .  41 PRO CB   1 1 
       16  9848 1 1 41 PRO CD   C   -7.121  19.808  -7.186 1.00 . A A .  41 PRO CD   1 1 
       16  9849 1 1 41 PRO CG   C   -6.879  20.873  -8.220 1.00 . A A .  41 PRO CG   1 1 
       16  9850 1 1 41 PRO HA   H   -4.654  18.566  -8.835 1.00 . A A .  41 PRO HA   1 1 
       16  9851 1 1 41 PRO HB2  H   -5.263  21.099  -9.600 1.00 . A A .  41 PRO HB2  1 1 
       16  9852 1 1 41 PRO HB3  H   -6.317  19.717  -9.925 1.00 . A A .  41 PRO HB3  1 1 
       16  9853 1 1 41 PRO HD2  H   -7.323  20.255  -6.224 1.00 . A A .  41 PRO HD2  1 1 
       16  9854 1 1 41 PRO HD3  H   -7.938  19.169  -7.487 1.00 . A A .  41 PRO HD3  1 1 
       16  9855 1 1 41 PRO HG2  H   -6.500  21.769  -7.753 1.00 . A A .  41 PRO HG2  1 1 
       16  9856 1 1 41 PRO HG3  H   -7.791  21.086  -8.758 1.00 . A A .  41 PRO HG3  1 1 
       16  9857 1 1 41 PRO N    N   -5.852  19.061  -7.163 1.00 . A A .  41 PRO N    1 1 
       16  9858 1 1 41 PRO O    O   -2.661  20.078  -8.374 1.00 . A A .  41 PRO O    1 1 
       16  9859 1 1 42 SER C    C   -1.701  20.924  -5.718 1.00 . A A .  42 SER C    1 1 
       16  9860 1 1 42 SER CA   C   -2.831  21.817  -6.222 1.00 . A A .  42 SER CA   1 1 
       16  9861 1 1 42 SER CB   C   -3.338  22.707  -5.086 1.00 . A A .  42 SER CB   1 1 
       16  9862 1 1 42 SER H    H   -4.811  21.078  -6.354 1.00 . A A .  42 SER H    1 1 
       16  9863 1 1 42 SER HA   H   -2.452  22.443  -7.017 1.00 . A A .  42 SER HA   1 1 
       16  9864 1 1 42 SER HB2  H   -4.047  23.420  -5.480 1.00 . A A .  42 SER HB2  1 1 
       16  9865 1 1 42 SER HB3  H   -3.822  22.093  -4.340 1.00 . A A .  42 SER HB3  1 1 
       16  9866 1 1 42 SER HG   H   -2.626  24.093  -3.899 1.00 . A A .  42 SER HG   1 1 
       16  9867 1 1 42 SER N    N   -3.923  21.017  -6.765 1.00 . A A .  42 SER N    1 1 
       16  9868 1 1 42 SER O    O   -1.655  20.568  -4.541 1.00 . A A .  42 SER O    1 1 
       16  9869 1 1 42 SER OG   O   -2.272  23.413  -4.476 1.00 . A A .  42 SER OG   1 1 
       16  9870 1 1 43 SER C    C    1.651  20.480  -6.365 1.00 . A A .  43 SER C    1 1 
       16  9871 1 1 43 SER CA   C    0.336  19.711  -6.268 1.00 . A A .  43 SER CA   1 1 
       16  9872 1 1 43 SER CB   C    0.380  18.486  -7.183 1.00 . A A .  43 SER CB   1 1 
       16  9873 1 1 43 SER H    H   -0.884  20.882  -7.542 1.00 . A A .  43 SER H    1 1 
       16  9874 1 1 43 SER HA   H    0.199  19.383  -5.248 1.00 . A A .  43 SER HA   1 1 
       16  9875 1 1 43 SER HB2  H   -0.564  17.965  -7.128 1.00 . A A .  43 SER HB2  1 1 
       16  9876 1 1 43 SER HB3  H    0.556  18.806  -8.200 1.00 . A A .  43 SER HB3  1 1 
       16  9877 1 1 43 SER HG   H    1.188  16.705  -7.070 1.00 . A A .  43 SER HG   1 1 
       16  9878 1 1 43 SER N    N   -0.792  20.566  -6.619 1.00 . A A .  43 SER N    1 1 
       16  9879 1 1 43 SER O    O    1.961  21.073  -7.397 1.00 . A A .  43 SER O    1 1 
       16  9880 1 1 43 SER OG   O    1.415  17.598  -6.798 1.00 . A A .  43 SER OG   1 1 
       16  9881 1 1 44 GLY C    C    4.858  20.251  -5.593 1.00 . A A .  44 GLY C    1 1 
       16  9882 1 1 44 GLY CA   C    3.692  21.162  -5.263 1.00 . A A .  44 GLY CA   1 1 
       16  9883 1 1 44 GLY H    H    2.122  19.973  -4.486 1.00 . A A .  44 GLY H    1 1 
       16  9884 1 1 44 GLY HA2  H    3.660  21.964  -5.985 1.00 . A A .  44 GLY HA2  1 1 
       16  9885 1 1 44 GLY HA3  H    3.846  21.582  -4.280 1.00 . A A .  44 GLY HA3  1 1 
       16  9886 1 1 44 GLY N    N    2.420  20.463  -5.281 1.00 . A A .  44 GLY N    1 1 
       16  9887 1 1 44 GLY O    O    5.932  20.421  -5.018 1.00 . A A .  44 GLY O    1 1 
       16  9888 2 2  1 ZN  ZN   ZN   3.800   5.117  -0.660 1.00 . B A . 201 ZN  ZN   1 1 
       17  9889 1 1  1 GLY C    C   34.652   3.486  -6.870 1.00 . A A .   1 GLY C    1 1 
       17  9890 1 1  1 GLY CA   C   36.156   3.297  -6.847 1.00 . A A .   1 GLY CA   1 1 
       17  9891 1 1  1 GLY H1   H   36.926   4.416  -8.472 1.00 . A A .   1 GLY H1   1 1 
       17  9892 1 1  1 GLY HA2  H   36.377   2.293  -6.516 1.00 . A A .   1 GLY HA2  1 1 
       17  9893 1 1  1 GLY HA3  H   36.585   3.999  -6.148 1.00 . A A .   1 GLY HA3  1 1 
       17  9894 1 1  1 GLY N    N   36.762   3.505  -8.150 1.00 . A A .   1 GLY N    1 1 
       17  9895 1 1  1 GLY O    O   33.926   2.668  -7.434 1.00 . A A .   1 GLY O    1 1 
       17  9896 1 1  2 SER C    C   31.966   3.626  -5.771 1.00 . A A .   2 SER C    1 1 
       17  9897 1 1  2 SER CA   C   32.756   4.858  -6.201 1.00 . A A .   2 SER CA   1 1 
       17  9898 1 1  2 SER CB   C   32.263   5.345  -7.565 1.00 . A A .   2 SER CB   1 1 
       17  9899 1 1  2 SER H    H   34.814   5.181  -5.823 1.00 . A A .   2 SER H    1 1 
       17  9900 1 1  2 SER HA   H   32.605   5.640  -5.473 1.00 . A A .   2 SER HA   1 1 
       17  9901 1 1  2 SER HB2  H   32.677   4.717  -8.339 1.00 . A A .   2 SER HB2  1 1 
       17  9902 1 1  2 SER HB3  H   31.184   5.289  -7.595 1.00 . A A .   2 SER HB3  1 1 
       17  9903 1 1  2 SER HG   H   32.551   7.197  -6.997 1.00 . A A .   2 SER HG   1 1 
       17  9904 1 1  2 SER N    N   34.184   4.567  -6.254 1.00 . A A .   2 SER N    1 1 
       17  9905 1 1  2 SER O    O   30.908   3.329  -6.325 1.00 . A A .   2 SER O    1 1 
       17  9906 1 1  2 SER OG   O   32.658   6.685  -7.802 1.00 . A A .   2 SER OG   1 1 
       17  9907 1 1  3 SER C    C   30.413   2.014  -3.819 1.00 . A A .   3 SER C    1 1 
       17  9908 1 1  3 SER CA   C   31.835   1.708  -4.278 1.00 . A A .   3 SER CA   1 1 
       17  9909 1 1  3 SER CB   C   32.639   1.111  -3.121 1.00 . A A .   3 SER CB   1 1 
       17  9910 1 1  3 SER H    H   33.336   3.199  -4.379 1.00 . A A .   3 SER H    1 1 
       17  9911 1 1  3 SER HA   H   31.795   0.991  -5.084 1.00 . A A .   3 SER HA   1 1 
       17  9912 1 1  3 SER HB2  H   33.662   0.965  -3.434 1.00 . A A .   3 SER HB2  1 1 
       17  9913 1 1  3 SER HB3  H   32.613   1.789  -2.280 1.00 . A A .   3 SER HB3  1 1 
       17  9914 1 1  3 SER HG   H   32.600  -0.848  -3.129 1.00 . A A .   3 SER HG   1 1 
       17  9915 1 1  3 SER N    N   32.489   2.911  -4.780 1.00 . A A .   3 SER N    1 1 
       17  9916 1 1  3 SER O    O   30.044   3.173  -3.635 1.00 . A A .   3 SER O    1 1 
       17  9917 1 1  3 SER OG   O   32.103  -0.137  -2.718 1.00 . A A .   3 SER OG   1 1 
       17  9918 1 1  4 GLY C    C   27.307   0.121  -3.815 1.00 . A A .   4 GLY C    1 1 
       17  9919 1 1  4 GLY CA   C   28.245   1.140  -3.200 1.00 . A A .   4 GLY CA   1 1 
       17  9920 1 1  4 GLY H    H   29.967   0.062  -3.798 1.00 . A A .   4 GLY H    1 1 
       17  9921 1 1  4 GLY HA2  H   28.205   1.048  -2.125 1.00 . A A .   4 GLY HA2  1 1 
       17  9922 1 1  4 GLY HA3  H   27.915   2.130  -3.479 1.00 . A A .   4 GLY HA3  1 1 
       17  9923 1 1  4 GLY N    N   29.618   0.964  -3.636 1.00 . A A .   4 GLY N    1 1 
       17  9924 1 1  4 GLY O    O   26.219   0.467  -4.275 1.00 . A A .   4 GLY O    1 1 
       17  9925 1 1  5 SER C    C   26.026  -2.841  -3.328 1.00 . A A .   5 SER C    1 1 
       17  9926 1 1  5 SER CA   C   26.920  -2.212  -4.392 1.00 . A A .   5 SER CA   1 1 
       17  9927 1 1  5 SER CB   C   27.819  -3.281  -5.016 1.00 . A A .   5 SER CB   1 1 
       17  9928 1 1  5 SER H    H   28.606  -1.353  -3.442 1.00 . A A .   5 SER H    1 1 
       17  9929 1 1  5 SER HA   H   26.296  -1.784  -5.163 1.00 . A A .   5 SER HA   1 1 
       17  9930 1 1  5 SER HB2  H   28.460  -3.699  -4.254 1.00 . A A .   5 SER HB2  1 1 
       17  9931 1 1  5 SER HB3  H   27.204  -4.064  -5.438 1.00 . A A .   5 SER HB3  1 1 
       17  9932 1 1  5 SER HG   H   28.194  -1.960  -6.413 1.00 . A A .   5 SER HG   1 1 
       17  9933 1 1  5 SER N    N   27.728  -1.140  -3.824 1.00 . A A .   5 SER N    1 1 
       17  9934 1 1  5 SER O    O   26.068  -4.050  -3.101 1.00 . A A .   5 SER O    1 1 
       17  9935 1 1  5 SER OG   O   28.627  -2.733  -6.043 1.00 . A A .   5 SER OG   1 1 
       17  9936 1 1  6 SER C    C   22.863  -2.397  -2.092 1.00 . A A .   6 SER C    1 1 
       17  9937 1 1  6 SER CA   C   24.315  -2.483  -1.634 1.00 . A A .   6 SER CA   1 1 
       17  9938 1 1  6 SER CB   C   24.508  -1.665  -0.355 1.00 . A A .   6 SER CB   1 1 
       17  9939 1 1  6 SER H    H   25.230  -1.057  -2.904 1.00 . A A .   6 SER H    1 1 
       17  9940 1 1  6 SER HA   H   24.556  -3.516  -1.430 1.00 . A A .   6 SER HA   1 1 
       17  9941 1 1  6 SER HB2  H   24.468  -0.613  -0.594 1.00 . A A .   6 SER HB2  1 1 
       17  9942 1 1  6 SER HB3  H   23.721  -1.906   0.345 1.00 . A A .   6 SER HB3  1 1 
       17  9943 1 1  6 SER HG   H   25.811  -2.887   0.450 1.00 . A A .   6 SER HG   1 1 
       17  9944 1 1  6 SER N    N   25.217  -2.010  -2.678 1.00 . A A .   6 SER N    1 1 
       17  9945 1 1  6 SER O    O   22.350  -1.314  -2.367 1.00 . A A .   6 SER O    1 1 
       17  9946 1 1  6 SER OG   O   25.758  -1.950   0.249 1.00 . A A .   6 SER OG   1 1 
       17  9947 1 1  7 GLY C    C   19.852  -3.396  -1.441 1.00 . A A .   7 GLY C    1 1 
       17  9948 1 1  7 GLY CA   C   20.817  -3.584  -2.595 1.00 . A A .   7 GLY CA   1 1 
       17  9949 1 1  7 GLY H    H   22.664  -4.383  -1.937 1.00 . A A .   7 GLY H    1 1 
       17  9950 1 1  7 GLY HA2  H   20.654  -2.800  -3.319 1.00 . A A .   7 GLY HA2  1 1 
       17  9951 1 1  7 GLY HA3  H   20.619  -4.538  -3.062 1.00 . A A .   7 GLY HA3  1 1 
       17  9952 1 1  7 GLY N    N   22.204  -3.550  -2.170 1.00 . A A .   7 GLY N    1 1 
       17  9953 1 1  7 GLY O    O   19.722  -4.268  -0.581 1.00 . A A .   7 GLY O    1 1 
       17  9954 1 1  8 THR C    C   16.785  -2.027  -0.876 1.00 . A A .   8 THR C    1 1 
       17  9955 1 1  8 THR CA   C   18.218  -1.951  -0.361 1.00 . A A .   8 THR CA   1 1 
       17  9956 1 1  8 THR CB   C   18.464  -0.552   0.235 1.00 . A A .   8 THR CB   1 1 
       17  9957 1 1  8 THR CG2  C   18.328   0.523  -0.832 1.00 . A A .   8 THR CG2  1 1 
       17  9958 1 1  8 THR H    H   19.321  -1.597  -2.133 1.00 . A A .   8 THR H    1 1 
       17  9959 1 1  8 THR HA   H   18.348  -2.682   0.424 1.00 . A A .   8 THR HA   1 1 
       17  9960 1 1  8 THR HB   H   19.468  -0.518   0.634 1.00 . A A .   8 THR HB   1 1 
       17  9961 1 1  8 THR HG1  H   18.013  -0.079   2.096 1.00 . A A .   8 THR HG1  1 1 
       17  9962 1 1  8 THR HG21 H   17.413   0.368  -1.384 1.00 . A A .   8 THR HG21 1 1 
       17  9963 1 1  8 THR HG22 H   19.169   0.468  -1.508 1.00 . A A .   8 THR HG22 1 1 
       17  9964 1 1  8 THR HG23 H   18.306   1.495  -0.363 1.00 . A A .   8 THR HG23 1 1 
       17  9965 1 1  8 THR N    N   19.174  -2.253  -1.419 1.00 . A A .   8 THR N    1 1 
       17  9966 1 1  8 THR O    O   16.538  -1.886  -2.073 1.00 . A A .   8 THR O    1 1 
       17  9967 1 1  8 THR OG1  O   17.533  -0.301   1.294 1.00 . A A .   8 THR OG1  1 1 
       17  9968 1 1  9 ARG C    C   14.238  -3.311  -1.490 1.00 . A A .   9 ARG C    1 1 
       17  9969 1 1  9 ARG CA   C   14.436  -2.345  -0.326 1.00 . A A .   9 ARG CA   1 1 
       17  9970 1 1  9 ARG CB   C   13.888  -0.965  -0.696 1.00 . A A .   9 ARG CB   1 1 
       17  9971 1 1  9 ARG CD   C   12.890   1.185   0.138 1.00 . A A .   9 ARG CD   1 1 
       17  9972 1 1  9 ARG CG   C   13.721  -0.037   0.496 1.00 . A A .   9 ARG CG   1 1 
       17  9973 1 1  9 ARG CZ   C   12.844   3.577   0.703 1.00 . A A .   9 ARG CZ   1 1 
       17  9974 1 1  9 ARG H    H   16.105  -2.354   0.976 1.00 . A A .   9 ARG H    1 1 
       17  9975 1 1  9 ARG HA   H   13.897  -2.719   0.532 1.00 . A A .   9 ARG HA   1 1 
       17  9976 1 1  9 ARG HB2  H   14.565  -0.498  -1.396 1.00 . A A .   9 ARG HB2  1 1 
       17  9977 1 1  9 ARG HB3  H   12.925  -1.089  -1.166 1.00 . A A .   9 ARG HB3  1 1 
       17  9978 1 1  9 ARG HD2  H   13.082   1.445  -0.892 1.00 . A A .   9 ARG HD2  1 1 
       17  9979 1 1  9 ARG HD3  H   11.845   0.941   0.260 1.00 . A A .   9 ARG HD3  1 1 
       17  9980 1 1  9 ARG HE   H   13.727   2.164   1.799 1.00 . A A .   9 ARG HE   1 1 
       17  9981 1 1  9 ARG HG2  H   13.227  -0.574   1.292 1.00 . A A .   9 ARG HG2  1 1 
       17  9982 1 1  9 ARG HG3  H   14.697   0.286   0.828 1.00 . A A .   9 ARG HG3  1 1 
       17  9983 1 1  9 ARG HH11 H   11.895   3.090  -1.012 1.00 . A A .   9 ARG HH11 1 1 
       17  9984 1 1  9 ARG HH12 H   11.869   4.773  -0.603 1.00 . A A .   9 ARG HH12 1 1 
       17  9985 1 1  9 ARG HH21 H   13.700   4.378   2.350 1.00 . A A .   9 ARG HH21 1 1 
       17  9986 1 1  9 ARG HH22 H   12.897   5.505   1.310 1.00 . A A .   9 ARG HH22 1 1 
       17  9987 1 1  9 ARG N    N   15.845  -2.250   0.037 1.00 . A A .   9 ARG N    1 1 
       17  9988 1 1  9 ARG NE   N   13.212   2.332   0.983 1.00 . A A .   9 ARG NE   1 1 
       17  9989 1 1  9 ARG NH1  N   12.146   3.835  -0.394 1.00 . A A .   9 ARG NH1  1 1 
       17  9990 1 1  9 ARG NH2  N   13.174   4.568   1.521 1.00 . A A .   9 ARG NH2  1 1 
       17  9991 1 1  9 ARG O    O   13.524  -3.009  -2.446 1.00 . A A .   9 ARG O    1 1 
       17  9992 1 1 10 GLU C    C   13.506  -6.318  -2.276 1.00 . A A .  10 GLU C    1 1 
       17  9993 1 1 10 GLU CA   C   14.772  -5.483  -2.450 1.00 . A A .  10 GLU CA   1 1 
       17  9994 1 1 10 GLU CB   C   16.002  -6.394  -2.437 1.00 . A A .  10 GLU CB   1 1 
       17  9995 1 1 10 GLU CD   C   18.214  -6.803  -3.585 1.00 . A A .  10 GLU CD   1 1 
       17  9996 1 1 10 GLU CG   C   17.228  -5.767  -3.079 1.00 . A A .  10 GLU CG   1 1 
       17  9997 1 1 10 GLU H    H   15.431  -4.657  -0.616 1.00 . A A .  10 GLU H    1 1 
       17  9998 1 1 10 GLU HA   H   14.723  -4.972  -3.399 1.00 . A A .  10 GLU HA   1 1 
       17  9999 1 1 10 GLU HB2  H   16.242  -6.640  -1.414 1.00 . A A .  10 GLU HB2  1 1 
       17 10000 1 1 10 GLU HB3  H   15.767  -7.303  -2.971 1.00 . A A .  10 GLU HB3  1 1 
       17 10001 1 1 10 GLU HG2  H   16.912  -5.157  -3.912 1.00 . A A .  10 GLU HG2  1 1 
       17 10002 1 1 10 GLU HG3  H   17.724  -5.147  -2.348 1.00 . A A .  10 GLU HG3  1 1 
       17 10003 1 1 10 GLU N    N   14.877  -4.474  -1.403 1.00 . A A .  10 GLU N    1 1 
       17 10004 1 1 10 GLU O    O   13.540  -7.546  -2.367 1.00 . A A .  10 GLU O    1 1 
       17 10005 1 1 10 GLU OE1  O   18.630  -7.667  -2.786 1.00 . A A .  10 GLU OE1  1 1 
       17 10006 1 1 10 GLU OE2  O   18.569  -6.748  -4.781 1.00 . A A .  10 GLU OE2  1 1 
       17 10007 1 1 11 LYS C    C   10.346  -6.410  -3.154 1.00 . A A .  11 LYS C    1 1 
       17 10008 1 1 11 LYS CA   C   11.111  -6.320  -1.838 1.00 . A A .  11 LYS CA   1 1 
       17 10009 1 1 11 LYS CB   C   10.268  -5.583  -0.795 1.00 . A A .  11 LYS CB   1 1 
       17 10010 1 1 11 LYS CD   C   11.713  -5.004   1.176 1.00 . A A .  11 LYS CD   1 1 
       17 10011 1 1 11 LYS CE   C   12.301  -5.530   2.477 1.00 . A A .  11 LYS CE   1 1 
       17 10012 1 1 11 LYS CG   C   10.635  -5.929   0.638 1.00 . A A .  11 LYS CG   1 1 
       17 10013 1 1 11 LYS H    H   12.425  -4.665  -1.964 1.00 . A A .  11 LYS H    1 1 
       17 10014 1 1 11 LYS HA   H   11.314  -7.320  -1.484 1.00 . A A .  11 LYS HA   1 1 
       17 10015 1 1 11 LYS HB2  H   10.397  -4.520  -0.931 1.00 . A A .  11 LYS HB2  1 1 
       17 10016 1 1 11 LYS HB3  H    9.228  -5.833  -0.949 1.00 . A A .  11 LYS HB3  1 1 
       17 10017 1 1 11 LYS HD2  H   12.503  -4.922   0.445 1.00 . A A .  11 LYS HD2  1 1 
       17 10018 1 1 11 LYS HD3  H   11.283  -4.029   1.355 1.00 . A A .  11 LYS HD3  1 1 
       17 10019 1 1 11 LYS HE2  H   12.880  -4.745   2.938 1.00 . A A .  11 LYS HE2  1 1 
       17 10020 1 1 11 LYS HE3  H   11.492  -5.814   3.133 1.00 . A A .  11 LYS HE3  1 1 
       17 10021 1 1 11 LYS HG2  H    9.755  -5.837   1.257 1.00 . A A .  11 LYS HG2  1 1 
       17 10022 1 1 11 LYS HG3  H   10.996  -6.947   0.672 1.00 . A A .  11 LYS HG3  1 1 
       17 10023 1 1 11 LYS HZ1  H   13.260  -6.907   1.232 1.00 . A A .  11 LYS HZ1  1 1 
       17 10024 1 1 11 LYS HZ2  H   12.780  -7.548   2.722 1.00 . A A .  11 LYS HZ2  1 1 
       17 10025 1 1 11 LYS HZ3  H   14.128  -6.530   2.635 1.00 . A A .  11 LYS HZ3  1 1 
       17 10026 1 1 11 LYS N    N   12.389  -5.643  -2.024 1.00 . A A .  11 LYS N    1 1 
       17 10027 1 1 11 LYS NZ   N   13.179  -6.712   2.250 1.00 . A A .  11 LYS NZ   1 1 
       17 10028 1 1 11 LYS O    O   10.510  -5.585  -4.053 1.00 . A A .  11 LYS O    1 1 
       17 10029 1 1 12 PRO C    C    7.593  -6.600  -4.644 1.00 . A A .  12 PRO C    1 1 
       17 10030 1 1 12 PRO CA   C    8.680  -7.656  -4.475 1.00 . A A .  12 PRO CA   1 1 
       17 10031 1 1 12 PRO CB   C    8.055  -9.032  -4.235 1.00 . A A .  12 PRO CB   1 1 
       17 10032 1 1 12 PRO CD   C    9.244  -8.458  -2.242 1.00 . A A .  12 PRO CD   1 1 
       17 10033 1 1 12 PRO CG   C    8.030  -9.183  -2.753 1.00 . A A .  12 PRO CG   1 1 
       17 10034 1 1 12 PRO HA   H    9.292  -7.687  -5.365 1.00 . A A .  12 PRO HA   1 1 
       17 10035 1 1 12 PRO HB2  H    7.059  -9.056  -4.653 1.00 . A A .  12 PRO HB2  1 1 
       17 10036 1 1 12 PRO HB3  H    8.664  -9.794  -4.699 1.00 . A A .  12 PRO HB3  1 1 
       17 10037 1 1 12 PRO HD2  H    9.035  -7.999  -1.286 1.00 . A A .  12 PRO HD2  1 1 
       17 10038 1 1 12 PRO HD3  H   10.082  -9.134  -2.163 1.00 . A A .  12 PRO HD3  1 1 
       17 10039 1 1 12 PRO HG2  H    7.131  -8.738  -2.354 1.00 . A A .  12 PRO HG2  1 1 
       17 10040 1 1 12 PRO HG3  H    8.081 -10.230  -2.490 1.00 . A A .  12 PRO HG3  1 1 
       17 10041 1 1 12 PRO N    N    9.489  -7.435  -3.273 1.00 . A A .  12 PRO N    1 1 
       17 10042 1 1 12 PRO O    O    7.436  -6.023  -5.721 1.00 . A A .  12 PRO O    1 1 
       17 10043 1 1 13 TYR C    C    6.330  -3.948  -3.517 1.00 . A A .  13 TYR C    1 1 
       17 10044 1 1 13 TYR CA   C    5.772  -5.365  -3.606 1.00 . A A .  13 TYR CA   1 1 
       17 10045 1 1 13 TYR CB   C    4.791  -5.612  -2.459 1.00 . A A .  13 TYR CB   1 1 
       17 10046 1 1 13 TYR CD1  C    2.969  -7.153  -3.286 1.00 . A A .  13 TYR CD1  1 1 
       17 10047 1 1 13 TYR CD2  C    4.618  -8.048  -1.817 1.00 . A A .  13 TYR CD2  1 1 
       17 10048 1 1 13 TYR CE1  C    2.346  -8.384  -3.345 1.00 . A A .  13 TYR CE1  1 1 
       17 10049 1 1 13 TYR CE2  C    4.003  -9.284  -1.871 1.00 . A A .  13 TYR CE2  1 1 
       17 10050 1 1 13 TYR CG   C    4.113  -6.962  -2.521 1.00 . A A .  13 TYR CG   1 1 
       17 10051 1 1 13 TYR CZ   C    2.867  -9.447  -2.636 1.00 . A A .  13 TYR CZ   1 1 
       17 10052 1 1 13 TYR H    H    7.018  -6.843  -2.745 1.00 . A A .  13 TYR H    1 1 
       17 10053 1 1 13 TYR HA   H    5.248  -5.475  -4.544 1.00 . A A .  13 TYR HA   1 1 
       17 10054 1 1 13 TYR HB2  H    5.322  -5.552  -1.521 1.00 . A A .  13 TYR HB2  1 1 
       17 10055 1 1 13 TYR HB3  H    4.022  -4.854  -2.481 1.00 . A A .  13 TYR HB3  1 1 
       17 10056 1 1 13 TYR HD1  H    2.563  -6.318  -3.840 1.00 . A A .  13 TYR HD1  1 1 
       17 10057 1 1 13 TYR HD2  H    5.509  -7.918  -1.218 1.00 . A A .  13 TYR HD2  1 1 
       17 10058 1 1 13 TYR HE1  H    1.457  -8.512  -3.944 1.00 . A A .  13 TYR HE1  1 1 
       17 10059 1 1 13 TYR HE2  H    4.411 -10.116  -1.317 1.00 . A A .  13 TYR HE2  1 1 
       17 10060 1 1 13 TYR HH   H    1.814 -10.854  -1.858 1.00 . A A .  13 TYR HH   1 1 
       17 10061 1 1 13 TYR N    N    6.845  -6.351  -3.575 1.00 . A A .  13 TYR N    1 1 
       17 10062 1 1 13 TYR O    O    7.302  -3.697  -2.806 1.00 . A A .  13 TYR O    1 1 
       17 10063 1 1 13 TYR OH   O    2.251 -10.676  -2.694 1.00 . A A .  13 TYR OH   1 1 
       17 10064 1 1 14 GLU C    C    4.944  -0.691  -4.333 1.00 . A A .  14 GLU C    1 1 
       17 10065 1 1 14 GLU CA   C    6.140  -1.634  -4.246 1.00 . A A .  14 GLU CA   1 1 
       17 10066 1 1 14 GLU CB   C    7.093  -1.377  -5.416 1.00 . A A .  14 GLU CB   1 1 
       17 10067 1 1 14 GLU CD   C    9.403  -2.023  -6.207 1.00 . A A .  14 GLU CD   1 1 
       17 10068 1 1 14 GLU CG   C    8.560  -1.523  -5.050 1.00 . A A .  14 GLU CG   1 1 
       17 10069 1 1 14 GLU H    H    4.936  -3.288  -4.790 1.00 . A A .  14 GLU H    1 1 
       17 10070 1 1 14 GLU HA   H    6.664  -1.448  -3.321 1.00 . A A .  14 GLU HA   1 1 
       17 10071 1 1 14 GLU HB2  H    6.869  -2.076  -6.208 1.00 . A A .  14 GLU HB2  1 1 
       17 10072 1 1 14 GLU HB3  H    6.933  -0.372  -5.780 1.00 . A A .  14 GLU HB3  1 1 
       17 10073 1 1 14 GLU HG2  H    8.938  -0.561  -4.739 1.00 . A A .  14 GLU HG2  1 1 
       17 10074 1 1 14 GLU HG3  H    8.646  -2.223  -4.232 1.00 . A A .  14 GLU HG3  1 1 
       17 10075 1 1 14 GLU N    N    5.706  -3.026  -4.243 1.00 . A A .  14 GLU N    1 1 
       17 10076 1 1 14 GLU O    O    3.939  -1.002  -4.974 1.00 . A A .  14 GLU O    1 1 
       17 10077 1 1 14 GLU OE1  O    9.052  -1.725  -7.368 1.00 . A A .  14 GLU OE1  1 1 
       17 10078 1 1 14 GLU OE2  O   10.412  -2.713  -5.952 1.00 . A A .  14 GLU OE2  1 1 
       17 10079 1 1 15 CYS C    C    3.937   2.196  -5.016 1.00 . A A .  15 CYS C    1 1 
       17 10080 1 1 15 CYS CA   C    3.988   1.452  -3.685 1.00 . A A .  15 CYS CA   1 1 
       17 10081 1 1 15 CYS CB   C    4.182   2.446  -2.539 1.00 . A A .  15 CYS CB   1 1 
       17 10082 1 1 15 CYS H    H    5.885   0.653  -3.190 1.00 . A A .  15 CYS H    1 1 
       17 10083 1 1 15 CYS HA   H    3.054   0.930  -3.543 1.00 . A A .  15 CYS HA   1 1 
       17 10084 1 1 15 CYS HB2  H    4.369   1.899  -1.626 1.00 . A A .  15 CYS HB2  1 1 
       17 10085 1 1 15 CYS HB3  H    5.034   3.073  -2.757 1.00 . A A .  15 CYS HB3  1 1 
       17 10086 1 1 15 CYS N    N    5.059   0.462  -3.684 1.00 . A A .  15 CYS N    1 1 
       17 10087 1 1 15 CYS O    O    4.946   2.725  -5.482 1.00 . A A .  15 CYS O    1 1 
       17 10088 1 1 15 CYS SG   S    2.751   3.535  -2.248 1.00 . A A .  15 CYS SG   1 1 
       17 10089 1 1 16 SER C    C    2.369   4.408  -6.699 1.00 . A A .  16 SER C    1 1 
       17 10090 1 1 16 SER CA   C    2.573   2.909  -6.901 1.00 . A A .  16 SER CA   1 1 
       17 10091 1 1 16 SER CB   C    1.377   2.317  -7.650 1.00 . A A .  16 SER CB   1 1 
       17 10092 1 1 16 SER H    H    1.988   1.792  -5.201 1.00 . A A .  16 SER H    1 1 
       17 10093 1 1 16 SER HA   H    3.466   2.755  -7.488 1.00 . A A .  16 SER HA   1 1 
       17 10094 1 1 16 SER HB2  H    0.600   2.068  -6.943 1.00 . A A .  16 SER HB2  1 1 
       17 10095 1 1 16 SER HB3  H    1.002   3.044  -8.356 1.00 . A A .  16 SER HB3  1 1 
       17 10096 1 1 16 SER HG   H    2.627   0.873  -8.085 1.00 . A A .  16 SER HG   1 1 
       17 10097 1 1 16 SER N    N    2.755   2.233  -5.623 1.00 . A A .  16 SER N    1 1 
       17 10098 1 1 16 SER O    O    1.974   5.120  -7.621 1.00 . A A .  16 SER O    1 1 
       17 10099 1 1 16 SER OG   O    1.746   1.144  -8.354 1.00 . A A .  16 SER OG   1 1 
       17 10100 1 1 17 GLU C    C    3.844   6.943  -4.913 1.00 . A A .  17 GLU C    1 1 
       17 10101 1 1 17 GLU CA   C    2.487   6.291  -5.162 1.00 . A A .  17 GLU CA   1 1 
       17 10102 1 1 17 GLU CB   C    1.594   6.460  -3.931 1.00 . A A .  17 GLU CB   1 1 
       17 10103 1 1 17 GLU CD   C   -0.795   6.229  -4.719 1.00 . A A .  17 GLU CD   1 1 
       17 10104 1 1 17 GLU CG   C    0.349   5.589  -3.957 1.00 . A A .  17 GLU CG   1 1 
       17 10105 1 1 17 GLU H    H    2.953   4.259  -4.792 1.00 . A A .  17 GLU H    1 1 
       17 10106 1 1 17 GLU HA   H    2.018   6.775  -6.005 1.00 . A A .  17 GLU HA   1 1 
       17 10107 1 1 17 GLU HB2  H    2.165   6.210  -3.049 1.00 . A A .  17 GLU HB2  1 1 
       17 10108 1 1 17 GLU HB3  H    1.284   7.492  -3.866 1.00 . A A .  17 GLU HB3  1 1 
       17 10109 1 1 17 GLU HG2  H    0.594   4.649  -4.429 1.00 . A A .  17 GLU HG2  1 1 
       17 10110 1 1 17 GLU HG3  H    0.030   5.409  -2.941 1.00 . A A .  17 GLU HG3  1 1 
       17 10111 1 1 17 GLU N    N    2.641   4.877  -5.486 1.00 . A A .  17 GLU N    1 1 
       17 10112 1 1 17 GLU O    O    4.143   8.007  -5.456 1.00 . A A .  17 GLU O    1 1 
       17 10113 1 1 17 GLU OE1  O   -0.597   6.580  -5.901 1.00 . A A .  17 GLU OE1  1 1 
       17 10114 1 1 17 GLU OE2  O   -1.888   6.379  -4.134 1.00 . A A .  17 GLU OE2  1 1 
       17 10115 1 1 18 CYS C    C    7.076   5.906  -4.328 1.00 . A A .  18 CYS C    1 1 
       17 10116 1 1 18 CYS CA   C    5.986   6.814  -3.765 1.00 . A A .  18 CYS CA   1 1 
       17 10117 1 1 18 CYS CB   C    6.150   6.945  -2.249 1.00 . A A .  18 CYS CB   1 1 
       17 10118 1 1 18 CYS H    H    4.367   5.453  -3.685 1.00 . A A .  18 CYS H    1 1 
       17 10119 1 1 18 CYS HA   H    6.081   7.790  -4.214 1.00 . A A .  18 CYS HA   1 1 
       17 10120 1 1 18 CYS HB2  H    7.147   7.298  -2.032 1.00 . A A .  18 CYS HB2  1 1 
       17 10121 1 1 18 CYS HB3  H    5.431   7.661  -1.878 1.00 . A A .  18 CYS HB3  1 1 
       17 10122 1 1 18 CYS N    N    4.662   6.298  -4.088 1.00 . A A .  18 CYS N    1 1 
       17 10123 1 1 18 CYS O    O    8.104   6.378  -4.811 1.00 . A A .  18 CYS O    1 1 
       17 10124 1 1 18 CYS SG   S    5.904   5.388  -1.337 1.00 . A A .  18 CYS SG   1 1 
       17 10125 1 1 19 GLY C    C    8.406   2.784  -3.673 1.00 . A A .  19 GLY C    1 1 
       17 10126 1 1 19 GLY CA   C    7.811   3.645  -4.770 1.00 . A A .  19