NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
451988 2rq1 11065 cing 4-filtered-FRED STAR entry full 1858


data_FRED_restraints_with_modified_coordinates_PDB_code_2rq1

# This FRED archive file contains, for PDB entry <2rq1>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, W Vranken, C Penkett, J Lin, CF Schulte, G Vuister, G Vriend,
# JL Markley, EL Ulrich. BioMagResBank database `NMR Restraints Grid` with
# curated sets of experimental NMR restraints for over 4,000 protein and nucleic
# acid PDB entries. (in preparation)




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.Sf_category          entry_information
    _Entry.ID                   1
    _Entry.Title                "Data for entry 1"
    _Entry.NMR_STAR_version     3.1.0.8
    _Entry.Experimental_method  NMR
    _Entry.Details              .

save_


save_assembly_2rq1
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2rq1
    _Assembly.Number_of_components  1
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "all free"
    _Assembly.Molecular_mass        12402.91

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $Protein_4_1 A . 1 1 
    stop_

save_


save_Protein_4_1
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "Protein 4 1"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  GSHMDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYVSDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMY
    _Entity.Number_of_monomers           109

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

         1 GLY . 1 1 
         2 SER . 1 1 
         3 HIS . 1 1 
         4 MET . 1 1 
         5 ASP . 1 1 
         6 PRO . 1 1 
         7 ALA . 1 1 
         8 GLN . 1 1 
         9 LEU . 1 1 
        10 THR . 1 1 
        11 GLU . 1 1 
        12 ASP . 1 1 
        13 ILE . 1 1 
        14 THR . 1 1 
        15 ARG . 1 1 
        16 TYR . 1 1 
        17 TYR . 1 1 
        18 LEU . 1 1 
        19 CYS . 1 1 
        20 LEU . 1 1 
        21 GLN . 1 1 
        22 LEU . 1 1 
        23 ARG . 1 1 
        24 GLN . 1 1 
        25 ASP . 1 1 
        26 ILE . 1 1 
        27 VAL . 1 1 
        28 ALA . 1 1 
        29 GLY . 1 1 
        30 ARG . 1 1 
        31 LEU . 1 1 
        32 PRO . 1 1 
        33 CYS . 1 1 
        34 SER . 1 1 
        35 PHE . 1 1 
        36 ALA . 1 1 
        37 THR . 1 1 
        38 LEU . 1 1 
        39 ALA . 1 1 
        40 LEU . 1 1 
        41 LEU . 1 1 
        42 GLY . 1 1 
        43 SER . 1 1 
        44 TYR . 1 1 
        45 THR . 1 1 
        46 ILE . 1 1 
        47 GLN . 1 1 
        48 SER . 1 1 
        49 GLU . 1 1 
        50 LEU . 1 1 
        51 GLY . 1 1 
        52 ASP . 1 1 
        53 TYR . 1 1 
        54 ASP . 1 1 
        55 PRO . 1 1 
        56 GLU . 1 1 
        57 LEU . 1 1 
        58 HIS . 1 1 
        59 GLY . 1 1 
        60 VAL . 1 1 
        61 ASP . 1 1 
        62 TYR . 1 1 
        63 VAL . 1 1 
        64 SER . 1 1 
        65 ASP . 1 1 
        66 PHE . 1 1 
        67 LYS . 1 1 
        68 LEU . 1 1 
        69 ALA . 1 1 
        70 PRO . 1 1 
        71 ASN . 1 1 
        72 GLN . 1 1 
        73 THR . 1 1 
        74 LYS . 1 1 
        75 GLU . 1 1 
        76 LEU . 1 1 
        77 GLU . 1 1 
        78 GLU . 1 1 
        79 LYS . 1 1 
        80 VAL . 1 1 
        81 MET . 1 1 
        82 GLU . 1 1 
        83 LEU . 1 1 
        84 HIS . 1 1 
        85 LYS . 1 1 
        86 SER . 1 1 
        87 TYR . 1 1 
        88 ARG . 1 1 
        89 SER . 1 1 
        90 MET . 1 1 
        91 THR . 1 1 
        92 PRO . 1 1 
        93 ALA . 1 1 
        94 GLN . 1 1 
        95 ALA . 1 1 
        96 ASP . 1 1 
        97 LEU . 1 1 
        98 GLU . 1 1 
        99 PHE . 1 1 
       100 LEU . 1 1 
       101 GLU . 1 1 
       102 ASN . 1 1 
       103 ALA . 1 1 
       104 LYS . 1 1 
       105 LYS . 1 1 
       106 LEU . 1 1 
       107 SER . 1 1 
       108 MET . 1 1 
       109 TYR . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       GLY   1   1 1 1 
       SER   2   2 1 1 
       HIS   3   3 1 1 
       MET   4   4 1 1 
       ASP   5   5 1 1 
       PRO   6   6 1 1 
       ALA   7   7 1 1 
       GLN   8   8 1 1 
       LEU   9   9 1 1 
       THR  10  10 1 1 
       GLU  11  11 1 1 
       ASP  12  12 1 1 
       ILE  13  13 1 1 
       THR  14  14 1 1 
       ARG  15  15 1 1 
       TYR  16  16 1 1 
       TYR  17  17 1 1 
       LEU  18  18 1 1 
       CYS  19  19 1 1 
       LEU  20  20 1 1 
       GLN  21  21 1 1 
       LEU  22  22 1 1 
       ARG  23  23 1 1 
       GLN  24  24 1 1 
       ASP  25  25 1 1 
       ILE  26  26 1 1 
       VAL  27  27 1 1 
       ALA  28  28 1 1 
       GLY  29  29 1 1 
       ARG  30  30 1 1 
       LEU  31  31 1 1 
       PRO  32  32 1 1 
       CYS  33  33 1 1 
       SER  34  34 1 1 
       PHE  35  35 1 1 
       ALA  36  36 1 1 
       THR  37  37 1 1 
       LEU  38  38 1 1 
       ALA  39  39 1 1 
       LEU  40  40 1 1 
       LEU  41  41 1 1 
       GLY  42  42 1 1 
       SER  43  43 1 1 
       TYR  44  44 1 1 
       THR  45  45 1 1 
       ILE  46  46 1 1 
       GLN  47  47 1 1 
       SER  48  48 1 1 
       GLU  49  49 1 1 
       LEU  50  50 1 1 
       GLY  51  51 1 1 
       ASP  52  52 1 1 
       TYR  53  53 1 1 
       ASP  54  54 1 1 
       PRO  55  55 1 1 
       GLU  56  56 1 1 
       LEU  57  57 1 1 
       HIS  58  58 1 1 
       GLY  59  59 1 1 
       VAL  60  60 1 1 
       ASP  61  61 1 1 
       TYR  62  62 1 1 
       VAL  63  63 1 1 
       SER  64  64 1 1 
       ASP  65  65 1 1 
       PHE  66  66 1 1 
       LYS  67  67 1 1 
       LEU  68  68 1 1 
       ALA  69  69 1 1 
       PRO  70  70 1 1 
       ASN  71  71 1 1 
       GLN  72  72 1 1 
       THR  73  73 1 1 
       LYS  74  74 1 1 
       GLU  75  75 1 1 
       LEU  76  76 1 1 
       GLU  77  77 1 1 
       GLU  78  78 1 1 
       LYS  79  79 1 1 
       VAL  80  80 1 1 
       MET  81  81 1 1 
       GLU  82  82 1 1 
       LEU  83  83 1 1 
       HIS  84  84 1 1 
       LYS  85  85 1 1 
       SER  86  86 1 1 
       TYR  87  87 1 1 
       ARG  88  88 1 1 
       SER  89  89 1 1 
       MET  90  90 1 1 
       THR  91  91 1 1 
       PRO  92  92 1 1 
       ALA  93  93 1 1 
       GLN  94  94 1 1 
       ALA  95  95 1 1 
       ASP  96  96 1 1 
       LEU  97  97 1 1 
       GLU  98  98 1 1 
       PHE  99  99 1 1 
       LEU 100 100 1 1 
       GLU 101 101 1 1 
       ASN 102 102 1 1 
       ALA 103 103 1 1 
       LYS 104 104 1 1 
       LYS 105 105 1 1 
       LEU 106 106 1 1 
       SER 107 107 1 1 
       MET 108 108 1 1 
       TYR 109 109 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_2_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

          1 1 . . . 1 1 
          2 1 . . . 1 1 
          3 1 . . . 1 1 
          4 1 . . . 1 1 
          5 1 . . . 1 1 
          6 1 . . . 1 1 
          7 1 . . . 1 1 
          8 1 . . . 1 1 
          9 1 . . . 1 1 
         10 1 . . . 1 1 
         11 1 . . . 1 1 
         12 1 . . . 1 1 
         13 1 . . . 1 1 
         14 1 . . . 1 1 
         15 1 . . . 1 1 
         16 1 . . . 1 1 
         17 1 . . . 1 1 
         18 1 . . . 1 1 
         19 1 . . . 1 1 
         20 1 . . . 1 1 
         21 1 . . . 1 1 
         22 1 . . . 1 1 
         23 1 . . . 1 1 
         24 1 . . . 1 1 
         25 1 . . . 1 1 
         26 1 . . . 1 1 
         27 1 . . . 1 1 
         28 1 . . . 1 1 
         29 1 . . . 1 1 
         30 1 . . . 1 1 
         31 1 . . . 1 1 
         32 1 . . . 1 1 
         33 1 . . . 1 1 
         34 1 . . . 1 1 
         35 1 . . . 1 1 
         36 1 . . . 1 1 
         37 1 . . . 1 1 
         38 1 . . . 1 1 
         39 1 . . . 1 1 
         40 1 . . . 1 1 
         41 1 . . . 1 1 
         42 1 . . . 1 1 
         43 1 . . . 1 1 
         44 1 . . . 1 1 
         45 1 . . . 1 1 
         46 1 . . . 1 1 
         47 1 . . . 1 1 
         48 1 . . . 1 1 
         49 1 . . . 1 1 
         50 1 . . . 1 1 
         51 1 . . . 1 1 
         52 1 . . . 1 1 
         53 1 . . . 1 1 
         54 1 . . . 1 1 
         55 1 . . . 1 1 
         56 1 . . . 1 1 
         57 1 . . . 1 1 
         58 1 . . . 1 1 
         59 1 . . . 1 1 
         60 1 . . . 1 1 
         61 1 . . . 1 1 
         62 1 . . . 1 1 
         63 1 . . . 1 1 
         64 1 . . . 1 1 
         65 1 . . . 1 1 
         66 1 . . . 1 1 
         67 1 . . . 1 1 
         68 1 . . . 1 1 
         69 1 . . . 1 1 
         70 1 . . . 1 1 
         71 1 . . . 1 1 
         72 1 . . . 1 1 
         73 1 . . . 1 1 
         74 1 . . . 1 1 
         75 1 . . . 1 1 
         76 1 . . . 1 1 
         77 1 . . . 1 1 
         78 1 . . . 1 1 
         79 1 . . . 1 1 
         80 1 . . . 1 1 
         81 1 . . . 1 1 
         82 1 . . . 1 1 
         83 1 . . . 1 1 
         84 1 . . . 1 1 
         85 1 . . . 1 1 
         86 1 . . . 1 1 
         87 1 . . . 1 1 
         88 1 . . . 1 1 
         89 1 . . . 1 1 
         90 1 . . . 1 1 
         91 1 . . . 1 1 
         92 1 . . . 1 1 
         93 1 . . . 1 1 
         94 1 . . . 1 1 
         95 1 . . . 1 1 
         96 1 . . . 1 1 
         97 1 . . . 1 1 
         98 1 . . . 1 1 
         99 1 . . . 1 1 
        100 1 . . . 1 1 
        101 1 . . . 1 1 
        102 1 . . . 1 1 
        103 1 . . . 1 1 
        104 1 . . . 1 1 
        105 1 . . . 1 1 
        106 1 . . . 1 1 
        107 1 . . . 1 1 
        108 1 . . . 1 1 
        109 1 . . . 1 1 
        110 1 . . . 1 1 
        111 1 . . . 1 1 
        112 1 . . . 1 1 
        113 1 . . . 1 1 
        114 1 . . . 1 1 
        115 1 . . . 1 1 
        116 1 . . . 1 1 
        117 1 . . . 1 1 
        118 1 . . . 1 1 
        119 1 . . . 1 1 
        120 1 . . . 1 1 
        121 1 . . . 1 1 
        122 1 . . . 1 1 
        123 1 . . . 1 1 
        124 1 . . . 1 1 
        125 1 . . . 1 1 
        126 1 . . . 1 1 
        127 1 . . . 1 1 
        128 1 . . . 1 1 
        129 1 . . . 1 1 
        130 1 . . . 1 1 
        131 1 . . . 1 1 
        132 1 . . . 1 1 
        133 1 . . . 1 1 
        134 1 . . . 1 1 
        135 1 . . . 1 1 
        136 1 . . . 1 1 
        137 1 . . . 1 1 
        138 1 . . . 1 1 
        139 1 . . . 1 1 
        140 1 . . . 1 1 
        141 1 . . . 1 1 
        142 1 . . . 1 1 
        143 1 . . . 1 1 
        144 1 . . . 1 1 
        145 1 . . . 1 1 
        146 1 . . . 1 1 
        147 1 . . . 1 1 
        148 1 . . . 1 1 
        149 1 . . . 1 1 
        150 1 . . . 1 1 
        151 1 . . . 1 1 
        152 1 . . . 1 1 
        153 1 . . . 1 1 
        154 1 . . . 1 1 
        155 1 . . . 1 1 
        156 1 . . . 1 1 
        157 1 . . . 1 1 
        158 1 . . . 1 1 
        159 1 . . . 1 1 
        160 1 . . . 1 1 
        161 1 . . . 1 1 
        162 1 . . . 1 1 
        163 1 . . . 1 1 
        164 1 . . . 1 1 
        165 1 . . . 1 1 
        166 1 . . . 1 1 
        167 1 . . . 1 1 
        168 1 . . . 1 1 
        169 1 . . . 1 1 
        170 1 . . . 1 1 
        171 1 . . . 1 1 
        172 1 . . . 1 1 
        173 1 . . . 1 1 
        174 1 . . . 1 1 
        175 1 . . . 1 1 
        176 1 . . . 1 1 
        177 1 . . . 1 1 
        178 1 . . . 1 1 
        179 1 . . . 1 1 
        180 1 . . . 1 1 
        181 1 . . . 1 1 
        182 1 . . . 1 1 
        183 1 . . . 1 1 
        184 1 . . . 1 1 
        185 1 . . . 1 1 
        186 1 . . . 1 1 
        187 1 . . . 1 1 
        188 1 . . . 1 1 
        189 1 . . . 1 1 
        190 1 . . . 1 1 
        191 1 . . . 1 1 
        192 1 . . . 1 1 
        193 1 . . . 1 1 
        194 1 . . . 1 1 
        195 1 . . . 1 1 
        196 1 . . . 1 1 
        197 1 . . . 1 1 
        198 1 . . . 1 1 
        199 1 . . . 1 1 
        200 1 . . . 1 1 
        201 1 . . . 1 1 
        202 1 . . . 1 1 
        203 1 . . . 1 1 
        204 1 . . . 1 1 
        205 1 . . . 1 1 
        206 1 . . . 1 1 
        207 1 . . . 1 1 
        208 1 . . . 1 1 
        209 1 . . . 1 1 
        210 1 . . . 1 1 
        211 1 . . . 1 1 
        212 1 . . . 1 1 
        213 1 . . . 1 1 
        214 1 . . . 1 1 
        215 1 . . . 1 1 
        216 1 . . . 1 1 
        217 1 . . . 1 1 
        218 1 . . . 1 1 
        219 1 . . . 1 1 
        220 1 . . . 1 1 
        221 1 . . . 1 1 
        222 1 . . . 1 1 
        223 1 . . . 1 1 
        224 1 . . . 1 1 
        225 1 . . . 1 1 
        226 1 . . . 1 1 
        227 1 . . . 1 1 
        228 1 . . . 1 1 
        229 1 . . . 1 1 
        230 1 . . . 1 1 
        231 1 . . . 1 1 
        232 1 . . . 1 1 
        233 1 . . . 1 1 
        234 1 . . . 1 1 
        235 1 . . . 1 1 
        236 1 . . . 1 1 
        237 1 . . . 1 1 
        238 1 . . . 1 1 
        239 1 . . . 1 1 
        240 1 . . . 1 1 
        241 1 . . . 1 1 
        242 1 . . . 1 1 
        243 1 . . . 1 1 
        244 1 . . . 1 1 
        245 1 . . . 1 1 
        246 1 . . . 1 1 
        247 1 . . . 1 1 
        248 1 . . . 1 1 
        249 1 . . . 1 1 
        250 1 . . . 1 1 
        251 1 . . . 1 1 
        252 1 . . . 1 1 
        253 1 . . . 1 1 
        254 1 . . . 1 1 
        255 1 . . . 1 1 
        256 1 . . . 1 1 
        257 1 . . . 1 1 
        258 1 . . . 1 1 
        259 1 . . . 1 1 
        260 1 . . . 1 1 
        261 1 . . . 1 1 
        262 1 . . . 1 1 
        263 1 . . . 1 1 
        264 1 . . . 1 1 
        265 1 . . . 1 1 
        266 1 . . . 1 1 
        267 1 . . . 1 1 
        268 1 . . . 1 1 
        269 1 . . . 1 1 
        270 1 . . . 1 1 
        271 1 . . . 1 1 
        272 1 . . . 1 1 
        273 1 . . . 1 1 
        274 1 . . . 1 1 
        275 1 . . . 1 1 
        276 1 . . . 1 1 
        277 1 . . . 1 1 
        278 1 . . . 1 1 
        279 1 . . . 1 1 
        280 1 . . . 1 1 
        281 1 . . . 1 1 
        282 1 . . . 1 1 
        283 1 . . . 1 1 
        284 1 . . . 1 1 
        285 1 . . . 1 1 
        286 1 . . . 1 1 
        287 1 . . . 1 1 
        288 1 . . . 1 1 
        289 1 . . . 1 1 
        290 1 . . . 1 1 
        291 1 . . . 1 1 
        292 1 . . . 1 1 
        293 1 . . . 1 1 
        294 1 . . . 1 1 
        295 1 . . . 1 1 
        296 1 . . . 1 1 
        297 1 . . . 1 1 
        298 1 . . . 1 1 
        299 1 . . . 1 1 
        300 1 . . . 1 1 
        301 1 . . . 1 1 
        302 1 . . . 1 1 
        303 1 . . . 1 1 
        304 1 . . . 1 1 
        305 1 . . . 1 1 
        306 1 . . . 1 1 
        307 1 . . . 1 1 
        308 1 . . . 1 1 
        309 1 . . . 1 1 
        310 1 . . . 1 1 
        311 1 . . . 1 1 
        312 1 . . . 1 1 
        313 1 . . . 1 1 
        314 1 . . . 1 1 
        315 1 . . . 1 1 
        316 1 . . . 1 1 
        317 1 . . . 1 1 
        318 1 . . . 1 1 
        319 1 . . . 1 1 
        320 1 . . . 1 1 
        321 1 . . . 1 1 
        322 1 . . . 1 1 
        323 1 . . . 1 1 
        324 1 . . . 1 1 
        325 1 . . . 1 1 
        326 1 . . . 1 1 
        327 1 . . . 1 1 
        328 1 . . . 1 1 
        329 1 . . . 1 1 
        330 1 . . . 1 1 
        331 1 . . . 1 1 
        332 1 . . . 1 1 
        333 1 . . . 1 1 
        334 1 . . . 1 1 
        335 1 . . . 1 1 
        336 1 . . . 1 1 
        337 1 . . . 1 1 
        338 1 . . . 1 1 
        339 1 . . . 1 1 
        340 1 . . . 1 1 
        341 1 . . . 1 1 
        342 1 . . . 1 1 
        343 1 . . . 1 1 
        344 1 . . . 1 1 
        345 1 . . . 1 1 
        346 1 . . . 1 1 
        347 1 . . . 1 1 
        348 1 . . . 1 1 
        349 1 . . . 1 1 
        350 1 . . . 1 1 
        351 1 . . . 1 1 
        352 1 . . . 1 1 
        353 1 . . . 1 1 
        354 1 . . . 1 1 
        355 1 . . . 1 1 
        356 1 . . . 1 1 
        357 1 . . . 1 1 
        358 1 . . . 1 1 
        359 1 . . . 1 1 
        360 1 . . . 1 1 
        361 1 . . . 1 1 
        362 1 . . . 1 1 
        363 1 . . . 1 1 
        364 1 . . . 1 1 
        365 1 . . . 1 1 
        366 1 . . . 1 1 
        367 1 . . . 1 1 
        368 1 . . . 1 1 
        369 1 . . . 1 1 
        370 1 . . . 1 1 
        371 1 . . . 1 1 
        372 1 . . . 1 1 
        373 1 . . . 1 1 
        374 1 . . . 1 1 
        375 1 . . . 1 1 
        376 1 . . . 1 1 
        377 1 . . . 1 1 
        378 1 . . . 1 1 
        379 1 . . . 1 1 
        380 1 . . . 1 1 
        381 1 . . . 1 1 
        382 1 . . . 1 1 
        383 1 . . . 1 1 
        384 1 . . . 1 1 
        385 1 . . . 1 1 
        386 1 . . . 1 1 
        387 1 . . . 1 1 
        388 1 . . . 1 1 
        389 1 . . . 1 1 
        390 1 . . . 1 1 
        391 1 . . . 1 1 
        392 1 . . . 1 1 
        393 1 . . . 1 1 
        394 1 . . . 1 1 
        395 1 . . . 1 1 
        396 1 . . . 1 1 
        397 1 . . . 1 1 
        398 1 . . . 1 1 
        399 1 . . . 1 1 
        400 1 . . . 1 1 
        401 1 . . . 1 1 
        402 1 . . . 1 1 
        403 1 . . . 1 1 
        404 1 . . . 1 1 
        405 1 . . . 1 1 
        406 1 . . . 1 1 
        407 1 . . . 1 1 
        408 1 . . . 1 1 
        409 1 . . . 1 1 
        410 1 . . . 1 1 
        411 1 . . . 1 1 
        412 1 . . . 1 1 
        413 1 . . . 1 1 
        414 1 . . . 1 1 
        415 1 . . . 1 1 
        416 1 . . . 1 1 
        417 1 . . . 1 1 
        418 1 . . . 1 1 
        419 1 . . . 1 1 
        420 1 . . . 1 1 
        421 1 . . . 1 1 
        422 1 . . . 1 1 
        423 1 . . . 1 1 
        424 1 . . . 1 1 
        425 1 . . . 1 1 
        426 1 . . . 1 1 
        427 1 . . . 1 1 
        428 1 . . . 1 1 
        429 1 . . . 1 1 
        430 1 . . . 1 1 
        431 1 . . . 1 1 
        432 1 . . . 1 1 
        433 1 . . . 1 1 
        434 1 . . . 1 1 
        435 1 . . . 1 1 
        436 1 . . . 1 1 
        437 1 . . . 1 1 
        438 1 . . . 1 1 
        439 1 . . . 1 1 
        440 1 . . . 1 1 
        441 1 . . . 1 1 
        442 1 . . . 1 1 
        443 1 . . . 1 1 
        444 1 . . . 1 1 
        445 1 . . . 1 1 
        446 1 . . . 1 1 
        447 1 . . . 1 1 
        448 1 . . . 1 1 
        449 1 . . . 1 1 
        450 1 . . . 1 1 
        451 1 . . . 1 1 
        452 1 . . . 1 1 
        453 1 . . . 1 1 
        454 1 . . . 1 1 
        455 1 . . . 1 1 
        456 1 . . . 1 1 
        457 1 . . . 1 1 
        458 1 . . . 1 1 
        459 1 . . . 1 1 
        460 1 . . . 1 1 
        461 1 . . . 1 1 
        462 1 . . . 1 1 
        463 1 . . . 1 1 
        464 1 . . . 1 1 
        465 1 . . . 1 1 
        466 1 . . . 1 1 
        467 1 . . . 1 1 
        468 1 . . . 1 1 
        469 1 . . . 1 1 
        470 1 . . . 1 1 
        471 1 . . . 1 1 
        472 1 . . . 1 1 
        473 1 . . . 1 1 
        474 1 . . . 1 1 
        475 1 . . . 1 1 
        476 1 . . . 1 1 
        477 1 . . . 1 1 
        478 1 . . . 1 1 
        479 1 . . . 1 1 
        480 1 . . . 1 1 
        481 1 . . . 1 1 
        482 1 . . . 1 1 
        483 1 . . . 1 1 
        484 1 . . . 1 1 
        485 1 . . . 1 1 
        486 1 . . . 1 1 
        487 1 . . . 1 1 
        488 1 . . . 1 1 
        489 1 . . . 1 1 
        490 1 . . . 1 1 
        491 1 . . . 1 1 
        492 1 . . . 1 1 
        493 1 . . . 1 1 
        494 1 . . . 1 1 
        495 1 . . . 1 1 
        496 1 . . . 1 1 
        497 1 . . . 1 1 
        498 1 . . . 1 1 
        499 1 . . . 1 1 
        500 1 . . . 1 1 
        501 1 . . . 1 1 
        502 1 . . . 1 1 
        503 1 . . . 1 1 
        504 1 . . . 1 1 
        505 1 . . . 1 1 
        506 1 . . . 1 1 
        507 1 . . . 1 1 
        508 1 . . . 1 1 
        509 1 . . . 1 1 
        510 1 . . . 1 1 
        511 1 . . . 1 1 
        512 1 . . . 1 1 
        513 1 . . . 1 1 
        514 1 . . . 1 1 
        515 1 . . . 1 1 
        516 1 . . . 1 1 
        517 1 . . . 1 1 
        518 1 . . . 1 1 
        519 1 . . . 1 1 
        520 1 . . . 1 1 
        521 1 . . . 1 1 
        522 1 . . . 1 1 
        523 1 . . . 1 1 
        524 1 . . . 1 1 
        525 1 . . . 1 1 
        526 1 . . . 1 1 
        527 1 . . . 1 1 
        528 1 . . . 1 1 
        529 1 . . . 1 1 
        530 1 . . . 1 1 
        531 1 . . . 1 1 
        532 1 . . . 1 1 
        533 1 . . . 1 1 
        534 1 . . . 1 1 
        535 1 . . . 1 1 
        536 1 . . . 1 1 
        537 1 . . . 1 1 
        538 1 . . . 1 1 
        539 1 . . . 1 1 
        540 1 . . . 1 1 
        541 1 . . . 1 1 
        542 1 . . . 1 1 
        543 1 . . . 1 1 
        544 1 . . . 1 1 
        545 1 . . . 1 1 
        546 1 . . . 1 1 
        547 1 . . . 1 1 
        548 1 . . . 1 1 
        549 1 . . . 1 1 
        550 1 . . . 1 1 
        551 1 . . . 1 1 
        552 1 . . . 1 1 
        553 1 . . . 1 1 
        554 1 . . . 1 1 
        555 1 . . . 1 1 
        556 1 . . . 1 1 
        557 1 . . . 1 1 
        558 1 . . . 1 1 
        559 1 . . . 1 1 
        560 1 . . . 1 1 
        561 1 . . . 1 1 
        562 1 . . . 1 1 
        563 1 . . . 1 1 
        564 1 . . . 1 1 
        565 1 . . . 1 1 
        566 1 . . . 1 1 
        567 1 . . . 1 1 
        568 1 . . . 1 1 
        569 1 . . . 1 1 
        570 1 . . . 1 1 
        571 1 . . . 1 1 
        572 1 . . . 1 1 
        573 1 . . . 1 1 
        574 1 . . . 1 1 
        575 1 . . . 1 1 
        576 1 . . . 1 1 
        577 1 . . . 1 1 
        578 1 . . . 1 1 
        579 1 . . . 1 1 
        580 1 . . . 1 1 
        581 1 . . . 1 1 
        582 1 . . . 1 1 
        583 1 . . . 1 1 
        584 1 . . . 1 1 
        585 1 . . . 1 1 
        586 1 . . . 1 1 
        587 1 . . . 1 1 
        588 1 . . . 1 1 
        589 1 . . . 1 1 
        590 1 . . . 1 1 
        591 1 . . . 1 1 
        592 1 . . . 1 1 
        593 1 . . . 1 1 
        594 1 . . . 1 1 
        595 1 . . . 1 1 
        596 1 . . . 1 1 
        597 1 . . . 1 1 
        598 1 . . . 1 1 
        599 1 . . . 1 1 
        600 1 . . . 1 1 
        601 1 . . . 1 1 
        602 1 . . . 1 1 
        603 1 . . . 1 1 
        604 1 . . . 1 1 
        605 1 . . . 1 1 
        606 1 . . . 1 1 
        607 1 . . . 1 1 
        608 1 . . . 1 1 
        609 1 . . . 1 1 
        610 1 . . . 1 1 
        611 1 . . . 1 1 
        612 1 . . . 1 1 
        613 1 . . . 1 1 
        614 1 . . . 1 1 
        615 1 . . . 1 1 
        616 1 . . . 1 1 
        617 1 . . . 1 1 
        618 1 . . . 1 1 
        619 1 . . . 1 1 
        620 1 . . . 1 1 
        621 1 . . . 1 1 
        622 1 . . . 1 1 
        623 1 . . . 1 1 
        624 1 . . . 1 1 
        625 1 . . . 1 1 
        626 1 . . . 1 1 
        627 1 . . . 1 1 
        628 1 . . . 1 1 
        629 1 . . . 1 1 
        630 1 . . . 1 1 
        631 1 . . . 1 1 
        632 1 . . . 1 1 
        633 1 . . . 1 1 
        634 1 . . . 1 1 
        635 1 . . . 1 1 
        636 1 . . . 1 1 
        637 1 . . . 1 1 
        638 1 . . . 1 1 
        639 1 . . . 1 1 
        640 1 . . . 1 1 
        641 1 . . . 1 1 
        642 1 . . . 1 1 
        643 1 . . . 1 1 
        644 1 . . . 1 1 
        645 1 . . . 1 1 
        646 1 . . . 1 1 
        647 1 . . . 1 1 
        648 1 . . . 1 1 
        649 1 . . . 1 1 
        650 1 . . . 1 1 
        651 1 . . . 1 1 
        652 1 . . . 1 1 
        653 1 . . . 1 1 
        654 1 . . . 1 1 
        655 1 . . . 1 1 
        656 1 . . . 1 1 
        657 1 . . . 1 1 
        658 1 . . . 1 1 
        659 1 . . . 1 1 
        660 1 . . . 1 1 
        661 1 . . . 1 1 
        662 1 . . . 1 1 
        663 1 . . . 1 1 
        664 1 . . . 1 1 
        665 1 . . . 1 1 
        666 1 . . . 1 1 
        667 1 . . . 1 1 
        668 1 . . . 1 1 
        669 1 . . . 1 1 
        670 1 . . . 1 1 
        671 1 . . . 1 1 
        672 1 . . . 1 1 
        673 1 . . . 1 1 
        674 1 . . . 1 1 
        675 1 . . . 1 1 
        676 1 . . . 1 1 
        677 1 . . . 1 1 
        678 1 . . . 1 1 
        679 1 . . . 1 1 
        680 1 . . . 1 1 
        681 1 . . . 1 1 
        682 1 . . . 1 1 
        683 1 . . . 1 1 
        684 1 . . . 1 1 
        685 1 . . . 1 1 
        686 1 . . . 1 1 
        687 1 . . . 1 1 
        688 1 . . . 1 1 
        689 1 . . . 1 1 
        690 1 . . . 1 1 
        691 1 . . . 1 1 
        692 1 . . . 1 1 
        693 1 . . . 1 1 
        694 1 . . . 1 1 
        695 1 . . . 1 1 
        696 1 . . . 1 1 
        697 1 . . . 1 1 
        698 1 . . . 1 1 
        699 1 . . . 1 1 
        700 1 . . . 1 1 
        701 1 . . . 1 1 
        702 1 . . . 1 1 
        703 1 . . . 1 1 
        704 1 . . . 1 1 
        705 1 . . . 1 1 
        706 1 . . . 1 1 
        707 1 . . . 1 1 
        708 1 . . . 1 1 
        709 1 . . . 1 1 
        710 1 . . . 1 1 
        711 1 . . . 1 1 
        712 1 . . . 1 1 
        713 1 . . . 1 1 
        714 1 . . . 1 1 
        715 1 . . . 1 1 
        716 1 . . . 1 1 
        717 1 . . . 1 1 
        718 1 . . . 1 1 
        719 1 . . . 1 1 
        720 1 . . . 1 1 
        721 1 . . . 1 1 
        722 1 . . . 1 1 
        723 1 . . . 1 1 
        724 1 . . . 1 1 
        725 1 . . . 1 1 
        726 1 . . . 1 1 
        727 1 . . . 1 1 
        728 1 . . . 1 1 
        729 1 . . . 1 1 
        730 1 . . . 1 1 
        731 1 . . . 1 1 
        732 1 . . . 1 1 
        733 1 . . . 1 1 
        734 1 . . . 1 1 
        735 1 . . . 1 1 
        736 1 . . . 1 1 
        737 1 . . . 1 1 
        738 1 . . . 1 1 
        739 1 . . . 1 1 
        740 1 . . . 1 1 
        741 1 . . . 1 1 
        742 1 . . . 1 1 
        743 1 . . . 1 1 
        744 1 . . . 1 1 
        745 1 . . . 1 1 
        746 1 . . . 1 1 
        747 1 . . . 1 1 
        748 1 . . . 1 1 
        749 1 . . . 1 1 
        750 1 . . . 1 1 
        751 1 . . . 1 1 
        752 1 . . . 1 1 
        753 1 . . . 1 1 
        754 1 . . . 1 1 
        755 1 . . . 1 1 
        756 1 . . . 1 1 
        757 1 . . . 1 1 
        758 1 . . . 1 1 
        759 1 . . . 1 1 
        760 1 . . . 1 1 
        761 1 . . . 1 1 
        762 1 . . . 1 1 
        763 1 . . . 1 1 
        764 1 . . . 1 1 
        765 1 . . . 1 1 
        766 1 . . . 1 1 
        767 1 . . . 1 1 
        768 1 . . . 1 1 
        769 1 . . . 1 1 
        770 1 . . . 1 1 
        771 1 . . . 1 1 
        772 1 . . . 1 1 
        773 1 . . . 1 1 
        774 1 . . . 1 1 
        775 1 . . . 1 1 
        776 1 . . . 1 1 
        777 1 . . . 1 1 
        778 1 . . . 1 1 
        779 1 . . . 1 1 
        780 1 . . . 1 1 
        781 1 . . . 1 1 
        782 1 . . . 1 1 
        783 1 . . . 1 1 
        784 1 . . . 1 1 
        785 1 . . . 1 1 
        786 1 . . . 1 1 
        787 1 . . . 1 1 
        788 1 . . . 1 1 
        789 1 . . . 1 1 
        790 1 . . . 1 1 
        791 1 . . . 1 1 
        792 1 . . . 1 1 
        793 1 . . . 1 1 
        794 1 . . . 1 1 
        795 1 . . . 1 1 
        796 1 . . . 1 1 
        797 1 . . . 1 1 
        798 1 . . . 1 1 
        799 1 . . . 1 1 
        800 1 . . . 1 1 
        801 1 . . . 1 1 
        802 1 . . . 1 1 
        803 1 . . . 1 1 
        804 1 . . . 1 1 
        805 1 . . . 1 1 
        806 1 . . . 1 1 
        807 1 . . . 1 1 
        808 1 . . . 1 1 
        809 1 . . . 1 1 
        810 1 . . . 1 1 
        811 1 . . . 1 1 
        812 1 . . . 1 1 
        813 1 . . . 1 1 
        814 1 . . . 1 1 
        815 1 . . . 1 1 
        816 1 . . . 1 1 
        817 1 . . . 1 1 
        818 1 . . . 1 1 
        819 1 . . . 1 1 
        820 1 . . . 1 1 
        821 1 . . . 1 1 
        822 1 . . . 1 1 
        823 1 . . . 1 1 
        824 1 . . . 1 1 
        825 1 . . . 1 1 
        826 1 . . . 1 1 
        827 1 . . . 1 1 
        828 1 . . . 1 1 
        829 1 . . . 1 1 
        830 1 . . . 1 1 
        831 1 . . . 1 1 
        832 1 . . . 1 1 
        833 1 . . . 1 1 
        834 1 . . . 1 1 
        835 1 . . . 1 1 
        836 1 . . . 1 1 
        837 1 . . . 1 1 
        838 1 . . . 1 1 
        839 1 . . . 1 1 
        840 1 . . . 1 1 
        841 1 . . . 1 1 
        842 1 . . . 1 1 
        843 1 . . . 1 1 
        844 1 . . . 1 1 
        845 1 . . . 1 1 
        846 1 . . . 1 1 
        847 1 . . . 1 1 
        848 1 . . . 1 1 
        849 1 . . . 1 1 
        850 1 . . . 1 1 
        851 1 . . . 1 1 
        852 1 . . . 1 1 
        853 1 . . . 1 1 
        854 1 . . . 1 1 
        855 1 . . . 1 1 
        856 1 . . . 1 1 
        857 1 . . . 1 1 
        858 1 . . . 1 1 
        859 1 . . . 1 1 
        860 1 . . . 1 1 
        861 1 . . . 1 1 
        862 1 . . . 1 1 
        863 1 . . . 1 1 
        864 1 . . . 1 1 
        865 1 . . . 1 1 
        866 1 . . . 1 1 
        867 1 . . . 1 1 
        868 1 . . . 1 1 
        869 1 . . . 1 1 
        870 1 . . . 1 1 
        871 1 . . . 1 1 
        872 1 . . . 1 1 
        873 1 . . . 1 1 
        874 1 . . . 1 1 
        875 1 . . . 1 1 
        876 1 . . . 1 1 
        877 1 . . . 1 1 
        878 1 . . . 1 1 
        879 1 . . . 1 1 
        880 1 . . . 1 1 
        881 1 . . . 1 1 
        882 1 . . . 1 1 
        883 1 . . . 1 1 
        884 1 . . . 1 1 
        885 1 . . . 1 1 
        886 1 . . . 1 1 
        887 1 . . . 1 1 
        888 1 . . . 1 1 
        889 1 . . . 1 1 
        890 1 . . . 1 1 
        891 1 . . . 1 1 
        892 1 . . . 1 1 
        893 1 . . . 1 1 
        894 1 . . . 1 1 
        895 1 . . . 1 1 
        896 1 . . . 1 1 
        897 1 . . . 1 1 
        898 1 . . . 1 1 
        899 1 . . . 1 1 
        900 1 . . . 1 1 
        901 1 . . . 1 1 
        902 1 . . . 1 1 
        903 1 . . . 1 1 
        904 1 . . . 1 1 
        905 1 . . . 1 1 
        906 1 . . . 1 1 
        907 1 . . . 1 1 
        908 1 . . . 1 1 
        909 1 . . . 1 1 
        910 1 . . . 1 1 
        911 1 . . . 1 1 
        912 1 . . . 1 1 
        913 1 . . . 1 1 
        914 1 . . . 1 1 
        915 1 . . . 1 1 
        916 1 . . . 1 1 
        917 1 . . . 1 1 
        918 1 . . . 1 1 
        919 1 . . . 1 1 
        920 1 . . . 1 1 
        921 1 . . . 1 1 
        922 1 . . . 1 1 
        923 1 . . . 1 1 
        924 1 . . . 1 1 
        925 1 . . . 1 1 
        926 1 . . . 1 1 
        927 1 . . . 1 1 
        928 1 . . . 1 1 
        929 1 . . . 1 1 
        930 1 . . . 1 1 
        931 1 . . . 1 1 
        932 1 . . . 1 1 
        933 1 . . . 1 1 
        934 1 . . . 1 1 
        935 1 . . . 1 1 
        936 1 . . . 1 1 
        937 1 . . . 1 1 
        938 1 . . . 1 1 
        939 1 . . . 1 1 
        940 1 . . . 1 1 
        941 1 . . . 1 1 
        942 1 . . . 1 1 
        943 1 . . . 1 1 
        944 1 . . . 1 1 
        945 1 . . . 1 1 
        946 1 . . . 1 1 
        947 1 . . . 1 1 
        948 1 . . . 1 1 
        949 1 . . . 1 1 
        950 1 . . . 1 1 
        951 1 . . . 1 1 
        952 1 . . . 1 1 
        953 1 . . . 1 1 
        954 1 . . . 1 1 
        955 1 . . . 1 1 
        956 1 . . . 1 1 
        957 1 . . . 1 1 
        958 1 . . . 1 1 
        959 1 . . . 1 1 
        960 1 . . . 1 1 
        961 1 . . . 1 1 
        962 1 . . . 1 1 
        963 1 . . . 1 1 
        964 1 . . . 1 1 
        965 1 . . . 1 1 
        966 1 . . . 1 1 
        967 1 . . . 1 1 
        968 1 . . . 1 1 
        969 1 . . . 1 1 
        970 1 . . . 1 1 
        971 1 . . . 1 1 
        972 1 . . . 1 1 
        973 1 . . . 1 1 
        974 1 . . . 1 1 
        975 1 . . . 1 1 
        976 1 . . . 1 1 
        977 1 . . . 1 1 
        978 1 . . . 1 1 
        979 1 . . . 1 1 
        980 1 . . . 1 1 
        981 1 . . . 1 1 
        982 1 . . . 1 1 
        983 1 . . . 1 1 
        984 1 . . . 1 1 
        985 1 . . . 1 1 
        986 1 . . . 1 1 
        987 1 . . . 1 1 
        988 1 . . . 1 1 
        989 1 . . . 1 1 
        990 1 . . . 1 1 
        991 1 . . . 1 1 
        992 1 . . . 1 1 
        993 1 . . . 1 1 
        994 1 . . . 1 1 
        995 1 . . . 1 1 
        996 1 . . . 1 1 
        997 1 . . . 1 1 
        998 1 . . . 1 1 
        999 1 . . . 1 1 
       1000 1 . . . 1 1 
       1001 1 . . . 1 1 
       1002 1 . . . 1 1 
       1003 1 . . . 1 1 
       1004 1 . . . 1 1 
       1005 1 . . . 1 1 
       1006 1 . . . 1 1 
       1007 1 . . . 1 1 
       1008 1 . . . 1 1 
       1009 1 . . . 1 1 
       1010 1 . . . 1 1 
       1011 1 . . . 1 1 
       1012 1 . . . 1 1 
       1013 1 . . . 1 1 
       1014 1 . . . 1 1 
       1015 1 . . . 1 1 
       1016 1 . . . 1 1 
       1017 1 . . . 1 1 
       1018 1 . . . 1 1 
       1019 1 . . . 1 1 
       1020 1 . . . 1 1 
       1021 1 . . . 1 1 
       1022 1 . . . 1 1 
       1023 1 . . . 1 1 
       1024 1 . . . 1 1 
       1025 1 . . . 1 1 
       1026 1 . . . 1 1 
       1027 1 . . . 1 1 
       1028 1 . . . 1 1 
       1029 1 . . . 1 1 
       1030 1 . . . 1 1 
       1031 1 . . . 1 1 
       1032 1 . . . 1 1 
       1033 1 . . . 1 1 
       1034 1 . . . 1 1 
       1035 1 . . . 1 1 
       1036 1 . . . 1 1 
       1037 1 . . . 1 1 
       1038 1 . . . 1 1 
       1039 1 . . . 1 1 
       1040 1 . . . 1 1 
       1041 1 . . . 1 1 
       1042 1 . . . 1 1 
       1043 1 . . . 1 1 
       1044 1 . . . 1 1 
       1045 1 . . . 1 1 
       1046 1 . . . 1 1 
       1047 1 . . . 1 1 
       1048 1 . . . 1 1 
       1049 1 . . . 1 1 
       1050 1 . . . 1 1 
       1051 1 . . . 1 1 
       1052 1 . . . 1 1 
       1053 1 . . . 1 1 
       1054 1 . . . 1 1 
       1055 1 . . . 1 1 
       1056 1 . . . 1 1 
       1057 1 . . . 1 1 
       1058 1 . . . 1 1 
       1059 1 . . . 1 1 
       1060 1 . . . 1 1 
       1061 1 . . . 1 1 
       1062 1 . . . 1 1 
       1063 1 . . . 1 1 
       1064 1 . . . 1 1 
       1065 1 . . . 1 1 
       1066 1 . . . 1 1 
       1067 1 . . . 1 1 
       1068 1 . . . 1 1 
       1069 1 . . . 1 1 
       1070 1 . . . 1 1 
       1071 1 . . . 1 1 
       1072 1 . . . 1 1 
       1073 1 . . . 1 1 
       1074 1 . . . 1 1 
       1075 1 . . . 1 1 
       1076 1 . . . 1 1 
       1077 1 . . . 1 1 
       1078 1 . . . 1 1 
       1079 1 . . . 1 1 
       1080 1 . . . 1 1 
       1081 1 . . . 1 1 
       1082 1 . . . 1 1 
       1083 1 . . . 1 1 
       1084 1 . . . 1 1 
       1085 1 . . . 1 1 
       1086 1 . . . 1 1 
       1087 1 . . . 1 1 
       1088 1 . . . 1 1 
       1089 1 . . . 1 1 
       1090 1 . . . 1 1 
       1091 1 . . . 1 1 
       1092 1 . . . 1 1 
       1093 1 . . . 1 1 
       1094 1 . . . 1 1 
       1095 1 . . . 1 1 
       1096 1 . . . 1 1 
       1097 1 . . . 1 1 
       1098 1 . . . 1 1 
       1099 1 . . . 1 1 
       1100 1 . . . 1 1 
       1101 1 . . . 1 1 
       1102 1 . . . 1 1 
       1103 1 . . . 1 1 
       1104 1 . . . 1 1 
       1105 1 . . . 1 1 
       1106 1 . . . 1 1 
       1107 1 . . . 1 1 
       1108 1 . . . 1 1 
       1109 1 . . . 1 1 
       1110 1 . . . 1 1 
       1111 1 . . . 1 1 
       1112 1 . . . 1 1 
       1113 1 . . . 1 1 
       1114 1 . . . 1 1 
       1115 1 . . . 1 1 
       1116 1 . . . 1 1 
       1117 1 . . . 1 1 
       1118 1 . . . 1 1 
       1119 1 . . . 1 1 
       1120 1 . . . 1 1 
       1121 1 . . . 1 1 
       1122 1 . . . 1 1 
       1123 1 . . . 1 1 
       1124 1 . . . 1 1 
       1125 1 . . . 1 1 
       1126 1 . . . 1 1 
       1127 1 . . . 1 1 
       1128 1 . . . 1 1 
       1129 1 . . . 1 1 
       1130 1 . . . 1 1 
       1131 1 . . . 1 1 
       1132 1 . . . 1 1 
       1133 1 . . . 1 1 
       1134 1 . . . 1 1 
       1135 1 . . . 1 1 
       1136 1 . . . 1 1 
       1137 1 . . . 1 1 
       1138 1 . . . 1 1 
       1139 1 . . . 1 1 
       1140 1 . . . 1 1 
       1141 1 . . . 1 1 
       1142 1 . . . 1 1 
       1143 1 . . . 1 1 
       1144 1 . . . 1 1 
       1145 1 . . . 1 1 
       1146 1 . . . 1 1 
       1147 1 . . . 1 1 
       1148 1 . . . 1 1 
       1149 1 . . . 1 1 
       1150 1 . . . 1 1 
       1151 1 . . . 1 1 
       1152 1 . . . 1 1 
       1153 1 . . . 1 1 
       1154 1 . . . 1 1 
       1155 1 . . . 1 1 
       1156 1 . . . 1 1 
       1157 1 . . . 1 1 
       1158 1 . . . 1 1 
       1159 1 . . . 1 1 
       1160 1 . . . 1 1 
       1161 1 . . . 1 1 
       1162 1 . . . 1 1 
       1163 1 . . . 1 1 
       1164 1 . . . 1 1 
       1165 1 . . . 1 1 
       1166 1 . . . 1 1 
       1167 1 . . . 1 1 
       1168 1 . . . 1 1 
       1169 1 . . . 1 1 
       1170 1 . . . 1 1 
       1171 1 . . . 1 1 
       1172 1 . . . 1 1 
       1173 1 . . . 1 1 
       1174 1 . . . 1 1 
       1175 1 . . . 1 1 
       1176 1 . . . 1 1 
       1177 1 . . . 1 1 
       1178 1 . . . 1 1 
       1179 1 . . . 1 1 
       1180 1 . . . 1 1 
       1181 1 . . . 1 1 
       1182 1 . . . 1 1 
       1183 1 . . . 1 1 
       1184 1 . . . 1 1 
       1185 1 . . . 1 1 
       1186 1 . . . 1 1 
       1187 1 . . . 1 1 
       1188 1 . . . 1 1 
       1189 1 . . . 1 1 
       1190 1 . . . 1 1 
       1191 1 . . . 1 1 
       1192 1 . . . 1 1 
       1193 1 . . . 1 1 
       1194 1 . . . 1 1 
       1195 1 . . . 1 1 
       1196 1 . . . 1 1 
       1197 1 . . . 1 1 
       1198 1 . . . 1 1 
       1199 1 . . . 1 1 
       1200 1 . . . 1 1 
       1201 1 . . . 1 1 
       1202 1 . . . 1 1 
       1203 1 . . . 1 1 
       1204 1 . . . 1 1 
       1205 1 . . . 1 1 
       1206 1 . . . 1 1 
       1207 1 . . . 1 1 
       1208 1 . . . 1 1 
       1209 1 . . . 1 1 
       1210 1 . . . 1 1 
       1211 1 . . . 1 1 
       1212 1 . . . 1 1 
       1213 1 . . . 1 1 
       1214 1 . . . 1 1 
       1215 1 . . . 1 1 
       1216 1 . . . 1 1 
       1217 1 . . . 1 1 
       1218 1 . . . 1 1 
       1219 1 . . . 1 1 
       1220 1 . . . 1 1 
       1221 1 . . . 1 1 
       1222 1 . . . 1 1 
       1223 1 . . . 1 1 
       1224 1 . . . 1 1 
       1225 1 . . . 1 1 
       1226 1 . . . 1 1 
       1227 1 . . . 1 1 
       1228 1 . . . 1 1 
       1229 1 . . . 1 1 
       1230 1 . . . 1 1 
       1231 1 . . . 1 1 
       1232 1 . . . 1 1 
       1233 1 . . . 1 1 
       1234 1 . . . 1 1 
       1235 1 . . . 1 1 
       1236 1 . . . 1 1 
       1237 1 . . . 1 1 
       1238 1 . . . 1 1 
       1239 1 . . . 1 1 
       1240 1 . . . 1 1 
       1241 1 . . . 1 1 
       1242 1 . . . 1 1 
       1243 1 . . . 1 1 
       1244 1 . . . 1 1 
       1245 1 . . . 1 1 
       1246 1 . . . 1 1 
       1247 1 . . . 1 1 
       1248 1 . . . 1 1 
       1249 1 . . . 1 1 
       1250 1 . . . 1 1 
       1251 1 . . . 1 1 
       1252 1 . . . 1 1 
       1253 1 . . . 1 1 
       1254 1 . . . 1 1 
       1255 1 . . . 1 1 
       1256 1 . . . 1 1 
       1257 1 . . . 1 1 
       1258 1 . . . 1 1 
       1259 1 . . . 1 1 
       1260 1 . . . 1 1 
       1261 1 . . . 1 1 
       1262 1 . . . 1 1 
       1263 1 . . . 1 1 
       1264 1 . . . 1 1 
       1265 1 . . . 1 1 
       1266 1 . . . 1 1 
       1267 1 . . . 1 1 
       1268 1 . . . 1 1 
       1269 1 . . . 1 1 
       1270 1 . . . 1 1 
       1271 1 . . . 1 1 
       1272 1 . . . 1 1 
       1273 1 . . . 1 1 
       1274 1 . . . 1 1 
       1275 1 . . . 1 1 
       1276 1 . . . 1 1 
       1277 1 . . . 1 1 
       1278 1 . . . 1 1 
       1279 1 . . . 1 1 
       1280 1 . . . 1 1 
       1281 1 . . . 1 1 
       1282 1 . . . 1 1 
       1283 1 . . . 1 1 
       1284 1 . . . 1 1 
       1285 1 . . . 1 1 
       1286 1 . . . 1 1 
       1287 1 . . . 1 1 
       1288 1 . . . 1 1 
       1289 1 . . . 1 1 
       1290 1 . . . 1 1 
       1291 1 . . . 1 1 
       1292 1 . . . 1 1 
       1293 1 . . . 1 1 
       1294 1 . . . 1 1 
       1295 1 . . . 1 1 
       1296 1 . . . 1 1 
       1297 1 . . . 1 1 
       1298 1 . . . 1 1 
       1299 1 . . . 1 1 
       1300 1 . . . 1 1 
       1301 1 . . . 1 1 
       1302 1 . . . 1 1 
       1303 1 . . . 1 1 
       1304 1 . . . 1 1 
       1305 1 . . . 1 1 
       1306 1 . . . 1 1 
       1307 1 . . . 1 1 
       1308 1 . . . 1 1 
       1309 1 . . . 1 1 
       1310 1 . . . 1 1 
       1311 1 . . . 1 1 
       1312 1 . . . 1 1 
       1313 1 . . . 1 1 
       1314 1 . . . 1 1 
       1315 1 . . . 1 1 
       1316 1 . . . 1 1 
       1317 1 . . . 1 1 
       1318 1 . . . 1 1 
       1319 1 . . . 1 1 
       1320 1 . . . 1 1 
       1321 1 . . . 1 1 
       1322 1 . . . 1 1 
       1323 1 . . . 1 1 
       1324 1 . . . 1 1 
       1325 1 . . . 1 1 
       1326 1 . . . 1 1 
       1327 1 . . . 1 1 
       1328 1 . . . 1 1 
       1329 1 . . . 1 1 
       1330 1 . . . 1 1 
       1331 1 . . . 1 1 
       1332 1 . . . 1 1 
       1333 1 . . . 1 1 
       1334 1 . . . 1 1 
       1335 1 . . . 1 1 
       1336 1 . . . 1 1 
       1337 1 . . . 1 1 
       1338 1 . . . 1 1 
       1339 1 . . . 1 1 
       1340 1 . . . 1 1 
       1341 1 . . . 1 1 
       1342 1 . . . 1 1 
       1343 1 . . . 1 1 
       1344 1 . . . 1 1 
       1345 1 . . . 1 1 
       1346 1 . . . 1 1 
       1347 1 . . . 1 1 
       1348 1 . . . 1 1 
       1349 1 . . . 1 1 
       1350 1 . . . 1 1 
       1351 1 . . . 1 1 
       1352 1 . . . 1 1 
       1353 1 . . . 1 1 
       1354 1 . . . 1 1 
       1355 1 . . . 1 1 
       1356 1 . . . 1 1 
       1357 1 . . . 1 1 
       1358 1 . . . 1 1 
       1359 1 . . . 1 1 
       1360 1 . . . 1 1 
       1361 1 . . . 1 1 
       1362 1 . . . 1 1 
       1363 1 . . . 1 1 
       1364 1 . . . 1 1 
       1365 1 . . . 1 1 
       1366 1 . . . 1 1 
       1367 1 . . . 1 1 
       1368 1 . . . 1 1 
       1369 1 . . . 1 1 
       1370 1 . . . 1 1 
       1371 1 . . . 1 1 
       1372 1 . . . 1 1 
       1373 1 . . . 1 1 
       1374 1 . . . 1 1 
       1375 1 . . . 1 1 
       1376 1 . . . 1 1 
       1377 1 . . . 1 1 
       1378 1 . . . 1 1 
       1379 1 . . . 1 1 
       1380 1 . . . 1 1 
       1381 1 . . . 1 1 
       1382 1 . . . 1 1 
       1383 1 . . . 1 1 
       1384 1 . . . 1 1 
       1385 1 . . . 1 1 
       1386 1 . . . 1 1 
       1387 1 . . . 1 1 
       1388 1 . . . 1 1 
       1389 1 . . . 1 1 
       1390 1 . . . 1 1 
       1391 1 . . . 1 1 
       1392 1 . . . 1 1 
       1393 1 . . . 1 1 
       1394 1 . . . 1 1 
       1395 1 . . . 1 1 
       1396 1 . . . 1 1 
       1397 1 . . . 1 1 
       1398 1 . . . 1 1 
       1399 1 . . . 1 1 
       1400 1 . . . 1 1 
       1401 1 . . . 1 1 
       1402 1 . . . 1 1 
       1403 1 . . . 1 1 
       1404 1 . . . 1 1 
       1405 1 . . . 1 1 
       1406 1 . . . 1 1 
       1407 1 . . . 1 1 
       1408 1 . . . 1 1 
       1409 1 . . . 1 1 
       1410 1 . . . 1 1 
       1411 1 . . . 1 1 
       1412 1 . . . 1 1 
       1413 1 . . . 1 1 
       1414 1 . . . 1 1 
       1415 1 . . . 1 1 
       1416 1 . . . 1 1 
       1417 1 . . . 1 1 
       1418 1 . . . 1 1 
       1419 1 . . . 1 1 
       1420 1 . . . 1 1 
       1421 1 . . . 1 1 
       1422 1 . . . 1 1 
       1423 1 . . . 1 1 
       1424 1 . . . 1 1 
       1425 1 . . . 1 1 
       1426 1 . . . 1 1 
       1427 1 . . . 1 1 
       1428 1 . . . 1 1 
       1429 1 . . . 1 1 
       1430 1 . . . 1 1 
       1431 1 . . . 1 1 
       1432 1 . . . 1 1 
       1433 1 . . . 1 1 
       1434 1 . . . 1 1 
       1435 1 . . . 1 1 
       1436 1 . . . 1 1 
       1437 1 . . . 1 1 
       1438 1 . . . 1 1 
       1439 1 . . . 1 1 
       1440 1 . . . 1 1 
       1441 1 . . . 1 1 
       1442 1 . . . 1 1 
       1443 1 . . . 1 1 
       1444 1 . . . 1 1 
       1445 1 . . . 1 1 
       1446 1 . . . 1 1 
       1447 1 . . . 1 1 
       1448 1 . . . 1 1 
       1449 1 . . . 1 1 
       1450 1 . . . 1 1 
       1451 1 . . . 1 1 
       1452 1 . . . 1 1 
       1453 1 . . . 1 1 
       1454 1 . . . 1 1 
       1455 1 . . . 1 1 
       1456 1 . . . 1 1 
       1457 1 . . . 1 1 
       1458 1 . . . 1 1 
       1459 1 . . . 1 1 
       1460 1 . . . 1 1 
       1461 1 . . . 1 1 
       1462 1 . . . 1 1 
       1463 1 . . . 1 1 
       1464 1 . . . 1 1 
       1465 1 . . . 1 1 
       1466 1 . . . 1 1 
       1467 1 . . . 1 1 
       1468 1 . . . 1 1 
       1469 1 . . . 1 1 
       1470 1 . . . 1 1 
       1471 1 . . . 1 1 
       1472 1 . . . 1 1 
       1473 1 . . . 1 1 
       1474 1 . . . 1 1 
       1475 1 . . . 1 1 
       1476 1 . . . 1 1 
       1477 1 . . . 1 1 
       1478 1 . . . 1 1 
       1479 1 . . . 1 1 
       1480 1 . . . 1 1 
       1481 1 . . . 1 1 
       1482 1 . . . 1 1 
       1483 1 . . . 1 1 
       1484 1 . . . 1 1 
       1485 1 . . . 1 1 
       1486 1 . . . 1 1 
       1487 1 . . . 1 1 
       1488 1 . . . 1 1 
       1489 1 . . . 1 1 
       1490 1 . . . 1 1 
       1491 1 . . . 1 1 
       1492 1 . . . 1 1 
       1493 1 . . . 1 1 
       1494 1 . . . 1 1 
       1495 1 . . . 1 1 
       1496 1 . . . 1 1 
       1497 1 . . . 1 1 
       1498 1 . . . 1 1 
       1499 1 . . . 1 1 
       1500 1 . . . 1 1 
       1501 1 . . . 1 1 
       1502 1 . . . 1 1 
       1503 1 . . . 1 1 
       1504 1 . . . 1 1 
       1505 1 . . . 1 1 
       1506 1 . . . 1 1 
       1507 1 . . . 1 1 
       1508 1 . . . 1 1 
       1509 1 . . . 1 1 
       1510 1 . . . 1 1 
       1511 1 . . . 1 1 
       1512 1 . . . 1 1 
       1513 1 . . . 1 1 
       1514 1 . . . 1 1 
       1515 1 . . . 1 1 
       1516 1 . . . 1 1 
       1517 1 . . . 1 1 
       1518 1 . . . 1 1 
       1519 1 . . . 1 1 
       1520 1 . . . 1 1 
       1521 1 . . . 1 1 
       1522 1 . . . 1 1 
       1523 1 . . . 1 1 
       1524 1 . . . 1 1 
       1525 1 . . . 1 1 
       1526 1 . . . 1 1 
       1527 1 . . . 1 1 
       1528 1 . . . 1 1 
       1529 1 . . . 1 1 
       1530 1 . . . 1 1 
       1531 1 . . . 1 1 
       1532 1 . . . 1 1 
       1533 1 . . . 1 1 
       1534 1 . . . 1 1 
       1535 1 . . . 1 1 
       1536 1 . . . 1 1 
       1537 1 . . . 1 1 
       1538 1 . . . 1 1 
       1539 1 . . . 1 1 
       1540 1 . . . 1 1 
       1541 1 . . . 1 1 
       1542 1 . . . 1 1 
       1543 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

          1 1 1 1 1  89 SER H    . 167 . HN   1 1 
          1 1 2 1 1  90 MET H    . 168 . HN   1 1 
          2 1 1 1 1  89 SER HA   . 167 . HA   1 1 
          2 1 2 1 1  90 MET H    . 168 . HN   1 1 
          3 1 1 1 1  90 MET H    . 168 . HN   1 1 
          3 1 2 1 1  90 MET HB2  . 168 . HB2  1 1 
          4 1 1 1 1  90 MET H    . 168 . HN   1 1 
          4 1 2 1 1  90 MET HB3  . 168 . HB1  1 1 
          5 1 1 1 1   4 MET HA   .  82 . HA   1 1 
          5 1 2 1 1   5 ASP H    .  83 . HN   1 1 
          6 1 1 1 1   5 ASP H    .  83 . HN   1 1 
          6 1 2 1 1   5 ASP HB2  .  83 . HB2  1 1 
          7 1 1 1 1   5 ASP H    .  83 . HN   1 1 
          7 1 2 1 1   5 ASP HB3  .  83 . HB1  1 1 
          8 1 1 1 1  44 TYR H    . 122 . HN   1 1 
          8 1 2 1 1  45 THR H    . 123 . HN   1 1 
          9 1 1 1 1  44 TYR H    . 122 . HN   1 1 
          9 1 2 1 1  44 TYR QD   . 122 . HD#  1 1 
         10 1 1 1 1  98 GLU H    . 176 . HN   1 1 
         10 1 2 1 1  99 PHE H    . 177 . HN   1 1 
         11 1 1 1 1  99 PHE H    . 177 . HN   1 1 
         11 1 2 1 1  99 PHE HB3  . 177 . HB1  1 1 
         12 1 1 1 1  99 PHE H    . 177 . HN   1 1 
         12 1 2 1 1  99 PHE HB2  . 177 . HB2  1 1 
         13 1 1 1 1  98 GLU QB   . 176 . HB#  1 1 
         13 1 2 1 1  99 PHE H    . 177 . HN   1 1 
         14 1 1 1 1  94 GLN H    . 172 . HN   1 1 
         14 1 2 1 1  95 ALA H    . 173 . HN   1 1 
         15 1 1 1 1  71 ASN HA   . 149 . HA   1 1 
         15 1 2 1 1  72 GLN H    . 150 . HN   1 1 
         16 1 1 1 1  90 MET HG2  . 168 . HG2  1 1 
         16 1 2 1 1  95 ALA H    . 173 . HN   1 1 
         17 1 1 1 1  94 GLN QG   . 172 . HG#  1 1 
         17 1 2 1 1  95 ALA H    . 173 . HN   1 1 
         18 1 1 1 1  72 GLN H    . 150 . HN   1 1 
         18 1 2 1 1  72 GLN HB3  . 150 . HB1  1 1 
         19 1 1 1 1  72 GLN H    . 150 . HN   1 1 
         19 1 2 1 1  72 GLN HB2  . 150 . HB2  1 1 
         20 1 1 1 1  95 ALA H    . 173 . HN   1 1 
         20 1 2 1 1  95 ALA MB   . 173 . HB#  1 1 
         21 1 1 1 1  67 LYS HA   . 145 . HA   1 1 
         21 1 2 1 1  68 LEU H    . 146 . HN   1 1 
         22 1 1 1 1  68 LEU H    . 146 . HN   1 1 
         22 1 2 1 1  68 LEU HG   . 146 . HG   1 1 
         23 1 1 1 1  87 TYR H    . 165 . HN   1 1 
         23 1 2 1 1  87 TYR QD   . 165 . HD#  1 1 
         24 1 1 1 1  17 TYR H    .  95 . HN   1 1 
         24 1 2 1 1  18 LEU H    .  96 . HN   1 1 
         25 1 1 1 1  18 LEU H    .  96 . HN   1 1 
         25 1 2 1 1  19 CYS H    .  97 . HN   1 1 
         26 1 1 1 1  18 LEU H    .  96 . HN   1 1 
         26 1 2 1 1  18 LEU HB2  .  96 . HB2  1 1 
         27 1 1 1 1  18 LEU H    .  96 . HN   1 1 
         27 1 2 1 1  18 LEU HB3  .  96 . HB1  1 1 
         28 1 1 1 1  38 LEU H    . 116 . HN   1 1 
         28 1 2 1 1  39 ALA H    . 117 . HN   1 1 
         29 1 1 1 1  26 ILE H    . 104 . HN   1 1 
         29 1 2 1 1  27 VAL H    . 105 . HN   1 1 
         30 1 1 1 1  37 THR HB   . 115 . HB   1 1 
         30 1 2 1 1  38 LEU H    . 116 . HN   1 1 
         31 1 1 1 1  35 PHE HA   . 113 . HA   1 1 
         31 1 2 1 1  38 LEU H    . 116 . HN   1 1 
         32 1 1 1 1 100 LEU HA   . 178 . HA   1 1 
         32 1 2 1 1 103 ALA H    . 181 . HN   1 1 
         33 1 1 1 1  26 ILE H    . 104 . HN   1 1 
         33 1 2 1 1  26 ILE HB   . 104 . HB   1 1 
         34 1 1 1 1  38 LEU H    . 116 . HN   1 1 
         34 1 2 1 1  38 LEU HB2  . 116 . HB2  1 1 
         35 1 1 1 1  26 ILE H    . 104 . HN   1 1 
         35 1 2 1 1  26 ILE MD   . 104 . HD1# 1 1 
         36 1 1 1 1  38 LEU H    . 116 . HN   1 1 
         36 1 2 1 1  38 LEU MD2  . 116 . HD2# 1 1 
         37 1 1 1 1  66 PHE HA   . 144 . HA   1 1 
         37 1 2 1 1  67 LYS H    . 145 . HN   1 1 
         38 1 1 1 1  66 PHE HB3  . 144 . HB1  1 1 
         38 1 2 1 1  67 LYS H    . 145 . HN   1 1 
         39 1 1 1 1  90 MET HA   . 168 . HA   1 1 
         39 1 2 1 1  91 THR H    . 169 . HN   1 1 
         40 1 1 1 1  90 MET HG2  . 168 . HG2  1 1 
         40 1 2 1 1  91 THR H    . 169 . HN   1 1 
         41 1 1 1 1  91 THR H    . 169 . HN   1 1 
         41 1 2 1 1  94 GLN QG   . 172 . HG#  1 1 
         42 1 1 1 1  91 THR H    . 169 . HN   1 1 
         42 1 2 1 1  91 THR MG   . 169 . HG2# 1 1 
         43 1 1 1 1  13 ILE H    .  91 . HN   1 1 
         43 1 2 1 1  13 ILE HB   .  91 . HB   1 1 
         44 1 1 1 1 103 ALA H    . 181 . HN   1 1 
         44 1 2 1 1 104 LYS H    . 182 . HN   1 1 
         45 1 1 1 1 103 ALA H    . 181 . HN   1 1 
         45 1 2 1 1 103 ALA MB   . 181 . HB#  1 1 
         46 1 1 1 1  35 PHE H    . 113 . HN   1 1 
         46 1 2 1 1  35 PHE HB2  . 113 . HB2  1 1 
         47 1 1 1 1  25 ASP H    . 103 . HN   1 1 
         47 1 2 1 1  26 ILE H    . 104 . HN   1 1 
         48 1 1 1 1   7 ALA H    .  85 . HN   1 1 
         48 1 2 1 1   8 GLN H    .  86 . HN   1 1 
         49 1 1 1 1  24 GLN H    . 102 . HN   1 1 
         49 1 2 1 1  25 ASP H    . 103 . HN   1 1 
         50 1 1 1 1   5 ASP HA   .  83 . HA   1 1 
         50 1 2 1 1   7 ALA H    .  85 . HN   1 1 
         51 1 1 1 1   6 PRO HA   .  84 . HA   1 1 
         51 1 2 1 1   7 ALA H    .  85 . HN   1 1 
         52 1 1 1 1  22 LEU HA   . 100 . HA   1 1 
         52 1 2 1 1  25 ASP H    . 103 . HN   1 1 
         53 1 1 1 1   6 PRO QG   .  84 . HG#  1 1 
         53 1 2 1 1   7 ALA H    .  85 . HN   1 1 
         54 1 1 1 1   7 ALA H    .  85 . HN   1 1 
         54 1 2 1 1   7 ALA MB   .  85 . HB#  1 1 
         55 1 1 1 1  73 THR HB   . 151 . HB   1 1 
         55 1 2 1 1  74 LYS H    . 152 . HN   1 1 
         56 1 1 1 1  73 THR HA   . 151 . HA   1 1 
         56 1 2 1 1  74 LYS H    . 152 . HN   1 1 
         57 1 1 1 1  74 LYS H    . 152 . HN   1 1 
         57 1 2 1 1  74 LYS QG   . 152 . HG#  1 1 
         58 1 1 1 1   8 GLN HA   .  86 . HA   1 1 
         58 1 2 1 1   9 LEU H    .  87 . HN   1 1 
         59 1 1 1 1   9 LEU H    .  87 . HN   1 1 
         59 1 2 1 1   9 LEU HG   .  87 . HG   1 1 
         60 1 1 1 1  52 ASP HA   . 130 . HA   1 1 
         60 1 2 1 1  53 TYR H    . 131 . HN   1 1 
         61 1 1 1 1  45 THR H    . 123 . HN   1 1 
         61 1 2 1 1  45 THR HB   . 123 . HB   1 1 
         62 1 1 1 1  14 THR HB   .  92 . HB   1 1 
         62 1 2 1 1  15 ARG H    .  93 . HN   1 1 
         63 1 1 1 1  15 ARG H    .  93 . HN   1 1 
         63 1 2 1 1  15 ARG HB2  .  93 . HB2  1 1 
         64 1 1 1 1  15 ARG H    .  93 . HN   1 1 
         64 1 2 1 1  15 ARG HB3  .  93 . HB1  1 1 
         65 1 1 1 1  88 ARG HA   . 166 . HA   1 1 
         65 1 2 1 1  89 SER H    . 167 . HN   1 1 
         66 1 1 1 1  76 LEU H    . 154 . HN   1 1 
         66 1 2 1 1  77 GLU H    . 155 . HN   1 1 
         67 1 1 1 1  76 LEU H    . 154 . HN   1 1 
         67 1 2 1 1  76 LEU HB3  . 154 . HB1  1 1 
         68 1 1 1 1  76 LEU H    . 154 . HN   1 1 
         68 1 2 1 1  76 LEU HB2  . 154 . HB2  1 1 
         69 1 1 1 1  26 ILE HB   . 104 . HB   1 1 
         69 1 2 1 1  27 VAL H    . 105 . HN   1 1 
         70 1 1 1 1  26 ILE MG   . 104 . HG2# 1 1 
         70 1 2 1 1  27 VAL H    . 105 . HN   1 1 
         71 1 1 1 1  27 VAL H    . 105 . HN   1 1 
         71 1 2 1 1  27 VAL MG1  . 105 . HG1# 1 1 
         72 1 1 1 1  47 GLN H    . 125 . HN   1 1 
         72 1 2 1 1  48 SER H    . 126 . HN   1 1 
         73 1 1 1 1  47 GLN H    . 125 . HN   1 1 
         73 1 2 1 1  47 GLN QG   . 125 . HG#  1 1 
         74 1 1 1 1  47 GLN H    . 125 . HN   1 1 
         74 1 2 1 1  47 GLN QB   . 125 . HB#  1 1 
         75 1 1 1 1  46 ILE HB   . 124 . HB   1 1 
         75 1 2 1 1  47 GLN H    . 125 . HN   1 1 
         76 1 1 1 1  78 GLU H    . 156 . HN   1 1 
         76 1 2 1 1  79 LYS H    . 157 . HN   1 1 
         77 1 1 1 1  79 LYS H    . 157 . HN   1 1 
         77 1 2 1 1  80 VAL H    . 158 . HN   1 1 
         78 1 1 1 1  78 GLU HB2  . 156 . HB2  1 1 
         78 1 2 1 1  79 LYS H    . 157 . HN   1 1 
         79 1 1 1 1  79 LYS H    . 157 . HN   1 1 
         79 1 2 1 1  79 LYS QB   . 157 . HB#  1 1 
         80 1 1 1 1 108 MET H    . 186 . HN   1 1 
         80 1 2 1 1 109 TYR H    . 187 . HN   1 1 
         81 1 1 1 1 109 TYR H    . 187 . HN   1 1 
         81 1 2 1 1 109 TYR QD   . 187 . HD#  1 1 
         82 1 1 1 1 107 SER HA   . 185 . HA   1 1 
         82 1 2 1 1 109 TYR H    . 187 . HN   1 1 
         83 1 1 1 1 109 TYR H    . 187 . HN   1 1 
         83 1 2 1 1 109 TYR QB   . 187 . HB#  1 1 
         84 1 1 1 1 101 GLU H    . 179 . HN   1 1 
         84 1 2 1 1 101 GLU HB3  . 179 . HB1  1 1 
         85 1 1 1 1 101 GLU H    . 179 . HN   1 1 
         85 1 2 1 1 101 GLU HB2  . 179 . HB2  1 1 
         86 1 1 1 1  36 ALA HA   . 114 . HA   1 1 
         86 1 2 1 1  39 ALA H    . 117 . HN   1 1 
         87 1 1 1 1  39 ALA H    . 117 . HN   1 1 
         87 1 2 1 1  39 ALA MB   . 117 . HB#  1 1 
         88 1 1 1 1  39 ALA H    . 117 . HN   1 1 
         88 1 2 1 1  76 LEU MD1  . 154 . HD1# 1 1 
         89 1 1 1 1  96 ASP H    . 174 . HN   1 1 
         89 1 2 1 1  97 LEU H    . 175 . HN   1 1 
         90 1 1 1 1  97 LEU H    . 175 . HN   1 1 
         90 1 2 1 1  98 GLU H    . 176 . HN   1 1 
         91 1 1 1 1  97 LEU H    . 175 . HN   1 1 
         91 1 2 1 1  97 LEU HB2  . 175 . HB2  1 1 
         92 1 1 1 1  97 LEU H    . 175 . HN   1 1 
         92 1 2 1 1  97 LEU HB3  . 175 . HB1  1 1 
         93 1 1 1 1  97 LEU H    . 175 . HN   1 1 
         93 1 2 1 1  97 LEU MD1  . 175 . HD1# 1 1 
         94 1 1 1 1  97 LEU H    . 175 . HN   1 1 
         94 1 2 1 1  97 LEU MD2  . 175 . HD2# 1 1 
         95 1 1 1 1  60 VAL MG1  . 138 . HG1# 1 1 
         95 1 2 1 1  61 ASP H    . 139 . HN   1 1 
         96 1 1 1 1  60 VAL MG2  . 138 . HG2# 1 1 
         96 1 2 1 1  61 ASP H    . 139 . HN   1 1 
         97 1 1 1 1  83 LEU H    . 161 . HN   1 1 
         97 1 2 1 1  84 HIS H    . 162 . HN   1 1 
         98 1 1 1 1  84 HIS H    . 162 . HN   1 1 
         98 1 2 1 1  84 HIS HB3  . 162 . HB1  1 1 
         99 1 1 1 1  84 HIS H    . 162 . HN   1 1 
         99 1 2 1 1  84 HIS HB2  . 162 . HB2  1 1 
        100 1 1 1 1 105 LYS H    . 183 . HN   1 1 
        100 1 2 1 1 105 LYS QB   . 183 . HB#  1 1 
        101 1 1 1 1  66 PHE H    . 144 . HN   1 1 
        101 1 2 1 1  66 PHE QD   . 144 . HD#  1 1 
        102 1 1 1 1  66 PHE H    . 144 . HN   1 1 
        102 1 2 1 1  66 PHE HB2  . 144 . HB2  1 1 
        103 1 1 1 1  66 PHE H    . 144 . HN   1 1 
        103 1 2 1 1  66 PHE HB3  . 144 . HB1  1 1 
        104 1 1 1 1  58 HIS H    . 136 . HN   1 1 
        104 1 2 1 1  58 HIS HB2  . 136 . HB2  1 1 
        105 1 1 1 1  12 ASP H    .  90 . HN   1 1 
        105 1 2 1 1  13 ILE H    .  91 . HN   1 1 
        106 1 1 1 1  12 ASP H    .  90 . HN   1 1 
        106 1 2 1 1  12 ASP QB   .  90 . HB#  1 1 
        107 1 1 1 1  11 GLU QB   .  89 . HB#  1 1 
        107 1 2 1 1  12 ASP H    .  90 . HN   1 1 
        108 1 1 1 1  22 LEU H    . 100 . HN   1 1 
        108 1 2 1 1  22 LEU HG   . 100 . HG   1 1 
        109 1 1 1 1  98 GLU H    . 176 . HN   1 1 
        109 1 2 1 1  98 GLU HG3  . 176 . HG1  1 1 
        110 1 1 1 1  98 GLU H    . 176 . HN   1 1 
        110 1 2 1 1  98 GLU QB   . 176 . HB#  1 1 
        111 1 1 1 1  39 ALA H    . 117 . HN   1 1 
        111 1 2 1 1  40 LEU H    . 118 . HN   1 1 
        112 1 1 1 1  82 GLU H    . 160 . HN   1 1 
        112 1 2 1 1  82 GLU QB   . 160 . HB#  1 1 
        113 1 1 1 1  40 LEU H    . 118 . HN   1 1 
        113 1 2 1 1  40 LEU HB3  . 118 . HB1  1 1 
        114 1 1 1 1  40 LEU H    . 118 . HN   1 1 
        114 1 2 1 1  40 LEU HB2  . 118 . HB2  1 1 
        115 1 1 1 1  39 ALA MB   . 117 . HB#  1 1 
        115 1 2 1 1  40 LEU H    . 118 . HN   1 1 
        116 1 1 1 1  46 ILE H    . 124 . HN   1 1 
        116 1 2 1 1  46 ILE HB   . 124 . HB   1 1 
        117 1 1 1 1 100 LEU H    . 178 . HN   1 1 
        117 1 2 1 1 101 GLU H    . 179 . HN   1 1 
        118 1 1 1 1  99 PHE HB3  . 177 . HB1  1 1 
        118 1 2 1 1 100 LEU H    . 178 . HN   1 1 
        119 1 1 1 1  96 ASP H    . 174 . HN   1 1 
        119 1 2 1 1  96 ASP HB3  . 174 . HB1  1 1 
        120 1 1 1 1  96 ASP H    . 174 . HN   1 1 
        120 1 2 1 1  96 ASP HB2  . 174 . HB2  1 1 
        121 1 1 1 1 100 LEU H    . 178 . HN   1 1 
        121 1 2 1 1 100 LEU HG   . 178 . HG   1 1 
        122 1 1 1 1 100 LEU H    . 178 . HN   1 1 
        122 1 2 1 1 100 LEU HB2  . 178 . HB2  1 1 
        123 1 1 1 1 100 LEU H    . 178 . HN   1 1 
        123 1 2 1 1 100 LEU HB3  . 178 . HB1  1 1 
        124 1 1 1 1  95 ALA MB   . 173 . HB#  1 1 
        124 1 2 1 1  96 ASP H    . 174 . HN   1 1 
        125 1 1 1 1 100 LEU H    . 178 . HN   1 1 
        125 1 2 1 1 100 LEU MD1  . 178 . HD1# 1 1 
        126 1 1 1 1  88 ARG H    . 166 . HN   1 1 
        126 1 2 1 1  88 ARG QB   . 166 . HB#  1 1 
        127 1 1 1 1  80 VAL H    . 158 . HN   1 1 
        127 1 2 1 1  80 VAL HB   . 158 . HB   1 1 
        128 1 1 1 1  80 VAL H    . 158 . HN   1 1 
        128 1 2 1 1  80 VAL MG2  . 158 . HG2# 1 1 
        129 1 1 1 1 104 LYS H    . 182 . HN   1 1 
        129 1 2 1 1 104 LYS HB3  . 182 . HB1  1 1 
        130 1 1 1 1 103 ALA MB   . 181 . HB#  1 1 
        130 1 2 1 1 104 LYS H    . 182 . HN   1 1 
        131 1 1 1 1  35 PHE HB2  . 113 . HB2  1 1 
        131 1 2 1 1  36 ALA H    . 114 . HN   1 1 
        132 1 1 1 1  35 PHE HB3  . 113 . HB1  1 1 
        132 1 2 1 1  36 ALA H    . 114 . HN   1 1 
        133 1 1 1 1  36 ALA H    . 114 . HN   1 1 
        133 1 2 1 1  36 ALA MB   . 114 . HB#  1 1 
        134 1 1 1 1  21 GLN H    .  99 . HN   1 1 
        134 1 2 1 1  22 LEU H    . 100 . HN   1 1 
        135 1 1 1 1  63 VAL H    . 141 . HN   1 1 
        135 1 2 1 1  63 VAL HB   . 141 . HB   1 1 
        136 1 1 1 1  20 LEU QB   .  98 . HB#  1 1 
        136 1 2 1 1  21 GLN H    .  99 . HN   1 1 
        137 1 1 1 1  19 CYS H    .  97 . HN   1 1 
        137 1 2 1 1  20 LEU H    .  98 . HN   1 1 
        138 1 1 1 1  20 LEU H    .  98 . HN   1 1 
        138 1 2 1 1  21 GLN H    .  99 . HN   1 1 
        139 1 1 1 1  17 TYR HA   .  95 . HA   1 1 
        139 1 2 1 1  20 LEU H    .  98 . HN   1 1 
        140 1 1 1 1  94 GLN H    . 172 . HN   1 1 
        140 1 2 1 1  94 GLN QG   . 172 . HG#  1 1 
        141 1 1 1 1  94 GLN H    . 172 . HN   1 1 
        141 1 2 1 1  94 GLN HB3  . 172 . HB1  1 1 
        142 1 1 1 1  20 LEU H    .  98 . HN   1 1 
        142 1 2 1 1  20 LEU QB   .  98 . HB#  1 1 
        143 1 1 1 1  20 LEU H    .  98 . HN   1 1 
        143 1 2 1 1  20 LEU HG   .  98 . HG   1 1 
        144 1 1 1 1  52 ASP H    . 130 . HN   1 1 
        144 1 2 1 1  52 ASP QB   . 130 . HB#  1 1 
        145 1 1 1 1  30 ARG H    . 108 . HN   1 1 
        145 1 2 1 1  31 LEU H    . 109 . HN   1 1 
        146 1 1 1 1  31 LEU H    . 109 . HN   1 1 
        146 1 2 1 1  31 LEU HB2  . 109 . HB2  1 1 
        147 1 1 1 1  41 LEU H    . 119 . HN   1 1 
        147 1 2 1 1  41 LEU HG   . 119 . HG   1 1 
        148 1 1 1 1 106 LEU H    . 184 . HN   1 1 
        148 1 2 1 1 107 SER H    . 185 . HN   1 1 
        149 1 1 1 1 105 LYS H    . 183 . HN   1 1 
        149 1 2 1 1 106 LEU H    . 184 . HN   1 1 
        150 1 1 1 1 103 ALA HA   . 181 . HA   1 1 
        150 1 2 1 1 106 LEU H    . 184 . HN   1 1 
        151 1 1 1 1 105 LYS QB   . 183 . HB#  1 1 
        151 1 2 1 1 106 LEU H    . 184 . HN   1 1 
        152 1 1 1 1 106 LEU H    . 184 . HN   1 1 
        152 1 2 1 1 106 LEU QB   . 184 . HB#  1 1 
        153 1 1 1 1 106 LEU H    . 184 . HN   1 1 
        153 1 2 1 1 106 LEU MD1  . 184 . HD1# 1 1 
        154 1 1 1 1 106 LEU H    . 184 . HN   1 1 
        154 1 2 1 1 106 LEU MD2  . 184 . HD2# 1 1 
        155 1 1 1 1  82 GLU QB   . 160 . HB#  1 1 
        155 1 2 1 1  83 LEU H    . 161 . HN   1 1 
        156 1 1 1 1  83 LEU H    . 161 . HN   1 1 
        156 1 2 1 1  83 LEU HG   . 161 . HG   1 1 
        157 1 1 1 1  83 LEU H    . 161 . HN   1 1 
        157 1 2 1 1  83 LEU MD2  . 161 . HD2# 1 1 
        158 1 1 1 1  74 LYS H    . 152 . HN   1 1 
        158 1 2 1 1  75 GLU H    . 153 . HN   1 1 
        159 1 1 1 1  75 GLU H    . 153 . HN   1 1 
        159 1 2 1 1  76 LEU H    . 154 . HN   1 1 
        160 1 1 1 1  33 CYS HA   . 111 . HA   1 1 
        160 1 2 1 1  34 SER H    . 112 . HN   1 1 
        161 1 1 1 1  75 GLU H    . 153 . HN   1 1 
        161 1 2 1 1  75 GLU HB2  . 153 . HB2  1 1 
        162 1 1 1 1  75 GLU H    . 153 . HN   1 1 
        162 1 2 1 1  75 GLU HB3  . 153 . HB1  1 1 
        163 1 1 1 1  74 LYS HB2  . 152 . HB2  1 1 
        163 1 2 1 1  75 GLU H    . 153 . HN   1 1 
        164 1 1 1 1  30 ARG H    . 108 . HN   1 1 
        164 1 2 1 1  30 ARG HB2  . 108 . HB2  1 1 
        165 1 1 1 1  30 ARG H    . 108 . HN   1 1 
        165 1 2 1 1  30 ARG HB3  . 108 . HB1  1 1 
        166 1 1 1 1  28 ALA MB   . 106 . HB#  1 1 
        166 1 2 1 1  30 ARG H    . 108 . HN   1 1 
        167 1 1 1 1  65 ASP H    . 143 . HN   1 1 
        167 1 2 1 1  66 PHE H    . 144 . HN   1 1 
        168 1 1 1 1  64 SER H    . 142 . HN   1 1 
        168 1 2 1 1  65 ASP H    . 143 . HN   1 1 
        169 1 1 1 1  65 ASP H    . 143 . HN   1 1 
        169 1 2 1 1  65 ASP HB2  . 143 . HB2  1 1 
        170 1 1 1 1  65 ASP H    . 143 . HN   1 1 
        170 1 2 1 1  65 ASP HB3  . 143 . HB1  1 1 
        171 1 1 1 1  56 GLU HB2  . 134 . HB2  1 1 
        171 1 2 1 1  57 LEU H    . 135 . HN   1 1 
        172 1 1 1 1  56 GLU HB3  . 134 . HB1  1 1 
        172 1 2 1 1  57 LEU H    . 135 . HN   1 1 
        173 1 1 1 1  57 LEU H    . 135 . HN   1 1 
        173 1 2 1 1  57 LEU HG   . 135 . HG   1 1 
        174 1 1 1 1  57 LEU H    . 135 . HN   1 1 
        174 1 2 1 1  57 LEU HB2  . 135 . HB2  1 1 
        175 1 1 1 1  57 LEU H    . 135 . HN   1 1 
        175 1 2 1 1  57 LEU HB3  . 135 . HB1  1 1 
        176 1 1 1 1  57 LEU H    . 135 . HN   1 1 
        176 1 2 1 1  57 LEU MD1  . 135 . HD1# 1 1 
        177 1 1 1 1  61 ASP H    . 139 . HN   1 1 
        177 1 2 1 1  62 TYR H    . 140 . HN   1 1 
        178 1 1 1 1  62 TYR H    . 140 . HN   1 1 
        178 1 2 1 1  62 TYR QD   . 140 . HD#  1 1 
        179 1 1 1 1  62 TYR H    . 140 . HN   1 1 
        179 1 2 1 1  62 TYR HB3  . 140 . HB1  1 1 
        180 1 1 1 1  77 GLU H    . 155 . HN   1 1 
        180 1 2 1 1  78 GLU H    . 156 . HN   1 1 
        181 1 1 1 1  72 GLN HG2  . 150 . HG2  1 1 
        181 1 2 1 1  77 GLU H    . 155 . HN   1 1 
        182 1 1 1 1  77 GLU H    . 155 . HN   1 1 
        182 1 2 1 1  77 GLU HB2  . 155 . HB2  1 1 
        183 1 1 1 1  77 GLU H    . 155 . HN   1 1 
        183 1 2 1 1  77 GLU HG3  . 155 . HG1  1 1 
        184 1 1 1 1  77 GLU H    . 155 . HN   1 1 
        184 1 2 1 1  77 GLU HB3  . 155 . HB1  1 1 
        185 1 1 1 1  75 GLU HA   . 153 . HA   1 1 
        185 1 2 1 1  78 GLU H    . 156 . HN   1 1 
        186 1 1 1 1  78 GLU H    . 156 . HN   1 1 
        186 1 2 1 1  78 GLU HG2  . 156 . HG2  1 1 
        187 1 1 1 1  78 GLU H    . 156 . HN   1 1 
        187 1 2 1 1  78 GLU HG3  . 156 . HG1  1 1 
        188 1 1 1 1  78 GLU H    . 156 . HN   1 1 
        188 1 2 1 1  81 MET ME   . 159 . HE#  1 1 
        189 1 1 1 1  80 VAL H    . 158 . HN   1 1 
        189 1 2 1 1  81 MET H    . 159 . HN   1 1 
        190 1 1 1 1  81 MET H    . 159 . HN   1 1 
        190 1 2 1 1  82 GLU H    . 160 . HN   1 1 
        191 1 1 1 1  80 VAL HB   . 158 . HB   1 1 
        191 1 2 1 1  81 MET H    . 159 . HN   1 1 
        192 1 1 1 1  43 SER H    . 121 . HN   1 1 
        192 1 2 1 1  43 SER HB3  . 121 . HB1  1 1 
        193 1 1 1 1   8 GLN H    .  86 . HN   1 1 
        193 1 2 1 1   8 GLN QG   .  86 . HG#  1 1 
        194 1 1 1 1   8 GLN H    .  86 . HN   1 1 
        194 1 2 1 1   8 GLN HB2  .  86 . HB2  1 1 
        195 1 1 1 1   8 GLN H    .  86 . HN   1 1 
        195 1 2 1 1   8 GLN HB3  .  86 . HB1  1 1 
        196 1 1 1 1   7 ALA MB   .  85 . HB#  1 1 
        196 1 2 1 1   8 GLN H    .  86 . HN   1 1 
        197 1 1 1 1  23 ARG H    . 101 . HN   1 1 
        197 1 2 1 1  24 GLN H    . 102 . HN   1 1 
        198 1 1 1 1  24 GLN H    . 102 . HN   1 1 
        198 1 2 1 1  24 GLN HG3  . 102 . HG1  1 1 
        199 1 1 1 1  24 GLN H    . 102 . HN   1 1 
        199 1 2 1 1  24 GLN HB2  . 102 . HB2  1 1 
        200 1 1 1 1  24 GLN H    . 102 . HN   1 1 
        200 1 2 1 1  24 GLN HB3  . 102 . HB1  1 1 
        201 1 1 1 1  37 THR H    . 115 . HN   1 1 
        201 1 2 1 1  38 LEU H    . 116 . HN   1 1 
        202 1 1 1 1  36 ALA H    . 114 . HN   1 1 
        202 1 2 1 1  37 THR H    . 115 . HN   1 1 
        203 1 1 1 1  37 THR H    . 115 . HN   1 1 
        203 1 2 1 1  37 THR HB   . 115 . HB   1 1 
        204 1 1 1 1  68 LEU H    . 146 . HN   1 1 
        204 1 2 1 1  69 ALA H    . 147 . HN   1 1 
        205 1 1 1 1  67 LYS HA   . 145 . HA   1 1 
        205 1 2 1 1  69 ALA H    . 147 . HN   1 1 
        206 1 1 1 1  69 ALA H    . 147 . HN   1 1 
        206 1 2 1 1  69 ALA MB   . 147 . HB#  1 1 
        207 1 1 1 1  27 VAL MG1  . 105 . HG1# 1 1 
        207 1 2 1 1  69 ALA H    . 147 . HN   1 1 
        208 1 1 1 1 107 SER HA   . 185 . HA   1 1 
        208 1 2 1 1 108 MET H    . 186 . HN   1 1 
        209 1 1 1 1 108 MET H    . 186 . HN   1 1 
        209 1 2 1 1 108 MET HG2  . 186 . HG2  1 1 
        210 1 1 1 1  16 TYR H    .  94 . HN   1 1 
        210 1 2 1 1  17 TYR H    .  95 . HN   1 1 
        211 1 1 1 1  19 CYS H    .  97 . HN   1 1 
        211 1 2 1 1  19 CYS HB2  .  97 . HB2  1 1 
        212 1 1 1 1  18 LEU HB3  .  96 . HB1  1 1 
        212 1 2 1 1  19 CYS H    .  97 . HN   1 1 
        213 1 1 1 1  50 LEU H    . 128 . HN   1 1 
        213 1 2 1 1  50 LEU HB2  . 128 . HB2  1 1 
        214 1 1 1 1  27 VAL HB   . 105 . HB   1 1 
        214 1 2 1 1  28 ALA H    . 106 . HN   1 1 
        215 1 1 1 1  36 ALA MB   . 114 . HB#  1 1 
        215 1 2 1 1  37 THR H    . 115 . HN   1 1 
        216 1 1 1 1  27 VAL MG2  . 105 . HG2# 1 1 
        216 1 2 1 1  28 ALA H    . 106 . HN   1 1 
        217 1 1 1 1  59 GLY HA2  . 137 . HA2  1 1 
        217 1 2 1 1  60 VAL H    . 138 . HN   1 1 
        218 1 1 1 1  59 GLY HA3  . 137 . HA1  1 1 
        218 1 2 1 1  60 VAL H    . 138 . HN   1 1 
        219 1 1 1 1  60 VAL H    . 138 . HN   1 1 
        219 1 2 1 1  60 VAL HB   . 138 . HB   1 1 
        220 1 1 1 1 101 GLU H    . 179 . HN   1 1 
        220 1 2 1 1 102 ASN H    . 180 . HN   1 1 
        221 1 1 1 1 102 ASN H    . 180 . HN   1 1 
        221 1 2 1 1 103 ALA H    . 181 . HN   1 1 
        222 1 1 1 1 102 ASN H    . 180 . HN   1 1 
        222 1 2 1 1 102 ASN HB2  . 180 . HB2  1 1 
        223 1 1 1 1 101 GLU QG   . 179 . HG#  1 1 
        223 1 2 1 1 102 ASN H    . 180 . HN   1 1 
        224 1 1 1 1  14 THR H    .  92 . HN   1 1 
        224 1 2 1 1  14 THR HB   .  92 . HB   1 1 
        225 1 1 1 1  85 LYS H    . 163 . HN   1 1 
        225 1 2 1 1  86 SER H    . 164 . HN   1 1 
        226 1 1 1 1  56 GLU H    . 134 . HN   1 1 
        226 1 2 1 1  57 LEU H    . 135 . HN   1 1 
        227 1 1 1 1  82 GLU HA   . 160 . HA   1 1 
        227 1 2 1 1  85 LYS H    . 163 . HN   1 1 
        228 1 1 1 1  84 HIS HB3  . 162 . HB1  1 1 
        228 1 2 1 1  85 LYS H    . 163 . HN   1 1 
        229 1 1 1 1  56 GLU H    . 134 . HN   1 1 
        229 1 2 1 1  56 GLU HG3  . 134 . HG1  1 1 
        230 1 1 1 1  56 GLU H    . 134 . HN   1 1 
        230 1 2 1 1  56 GLU HG2  . 134 . HG2  1 1 
        231 1 1 1 1  85 LYS H    . 163 . HN   1 1 
        231 1 2 1 1  85 LYS HB2  . 163 . HB2  1 1 
        232 1 1 1 1  85 LYS H    . 163 . HN   1 1 
        232 1 2 1 1  85 LYS HB3  . 163 . HB1  1 1 
        233 1 1 1 1  85 LYS H    . 163 . HN   1 1 
        233 1 2 1 1  85 LYS HG2  . 163 . HG2  1 1 
        234 1 1 1 1  85 LYS H    . 163 . HN   1 1 
        234 1 2 1 1  85 LYS QD   . 163 . HD#  1 1 
        235 1 1 1 1  49 GLU H    . 127 . HN   1 1 
        235 1 2 1 1  50 LEU H    . 128 . HN   1 1 
        236 1 1 1 1  49 GLU H    . 127 . HN   1 1 
        236 1 2 1 1  49 GLU HB3  . 127 . HB1  1 1 
        237 1 1 1 1  49 GLU H    . 127 . HN   1 1 
        237 1 2 1 1  49 GLU HB2  . 127 . HB2  1 1 
        238 1 1 1 1  92 PRO HG3  . 170 . HG1  1 1 
        238 1 2 1 1  93 ALA H    . 171 . HN   1 1 
        239 1 1 1 1  93 ALA H    . 171 . HN   1 1 
        239 1 2 1 1  93 ALA MB   . 171 . HB#  1 1 
        240 1 1 1 1  72 GLN HA   . 150 . HA   1 1 
        240 1 2 1 1  73 THR H    . 151 . HN   1 1 
        241 1 1 1 1  73 THR H    . 151 . HN   1 1 
        241 1 2 1 1  73 THR MG   . 151 . HG2# 1 1 
        242 1 1 1 1  73 THR H    . 151 . HN   1 1 
        242 1 2 1 1  76 LEU MD2  . 154 . HD2# 1 1 
        243 1 1 1 1  86 SER H    . 164 . HN   1 1 
        243 1 2 1 1  86 SER HB2  . 164 . HB2  1 1 
        244 1 1 1 1  10 THR H    .  88 . HN   1 1 
        244 1 2 1 1  10 THR HB   .  88 . HB   1 1 
        245 1 1 1 1   8 GLN HA   .  86 . HA   1 1 
        245 1 2 1 1  10 THR H    .  88 . HN   1 1 
        246 1 1 1 1  10 THR H    .  88 . HN   1 1 
        246 1 2 1 1  10 THR MG   .  88 . HG2# 1 1 
        247 1 1 1 1  64 SER H    . 142 . HN   1 1 
        247 1 2 1 1  64 SER HB3  . 142 . HB1  1 1 
        248 1 1 1 1  64 SER H    . 142 . HN   1 1 
        248 1 2 1 1  64 SER HB2  . 142 . HB2  1 1 
        249 1 1 1 1   8 GLN HE22 .  86 . HE22 1 1 
        249 1 2 1 1   8 GLN QG   .  86 . HG#  1 1 
        250 1 1 1 1  94 GLN HE22 . 172 . HE22 1 1 
        250 1 2 1 1  94 GLN QG   . 172 . HG#  1 1 
        251 1 1 1 1  48 SER H    . 126 . HN   1 1 
        251 1 2 1 1  49 GLU H    . 127 . HN   1 1 
        252 1 1 1 1  50 LEU H    . 128 . HN   1 1 
        252 1 2 1 1  51 GLY H    . 129 . HN   1 1 
        253 1 1 1 1  58 HIS HA   . 136 . HA   1 1 
        253 1 2 1 1  59 GLY H    . 137 . HN   1 1 
        254 1 1 1 1  42 GLY H    . 120 . HN   1 1 
        254 1 2 1 1  43 SER H    . 121 . HN   1 1 
        255 1 1 1 1  29 GLY H    . 107 . HN   1 1 
        255 1 2 1 1  30 ARG H    . 108 . HN   1 1 
        256 1 1 1 1  28 ALA MB   . 106 . HB#  1 1 
        256 1 2 1 1  29 GLY H    . 107 . HN   1 1 
        257 1 1 1 1  32 PRO HA   . 110 . HA   1 1 
        257 1 2 1 1  33 CYS H    . 111 . HN   1 1 
        258 1 1 1 1  32 PRO HB3  . 110 . HB1  1 1 
        258 1 2 1 1  33 CYS H    . 111 . HN   1 1 
        259 1 1 1 1  32 PRO HB2  . 110 . HB2  1 1 
        259 1 2 1 1  33 CYS H    . 111 . HN   1 1 
        260 1 1 1 1  43 SER H    . 121 . HN   1 1 
        260 1 2 1 1  44 TYR H    . 122 . HN   1 1 
        261 1 1 1 1  44 TYR H    . 122 . HN   1 1 
        261 1 2 1 1  44 TYR HB3  . 122 . HB1  1 1 
        262 1 1 1 1  44 TYR H    . 122 . HN   1 1 
        262 1 2 1 1  44 TYR HB2  . 122 . HB2  1 1 
        263 1 1 1 1  72 GLN H    . 150 . HN   1 1 
        263 1 2 1 1  72 GLN HG2  . 150 . HG2  1 1 
        264 1 1 1 1  90 MET HG3  . 168 . HG1  1 1 
        264 1 2 1 1  95 ALA H    . 173 . HN   1 1 
        265 1 1 1 1  68 LEU H    . 146 . HN   1 1 
        265 1 2 1 1  68 LEU HB3  . 146 . HB1  1 1 
        266 1 1 1 1  15 ARG HA   .  93 . HA   1 1 
        266 1 2 1 1  18 LEU H    .  96 . HN   1 1 
        267 1 1 1 1  18 LEU H    .  96 . HN   1 1 
        267 1 2 1 1  18 LEU HG   .  96 . HG   1 1 
        268 1 1 1 1  67 LYS H    . 145 . HN   1 1 
        268 1 2 1 1  67 LYS HG2  . 145 . HG2  1 1 
        269 1 1 1 1  12 ASP QB   .  90 . HB#  1 1 
        269 1 2 1 1  13 ILE H    .  91 . HN   1 1 
        270 1 1 1 1  13 ILE H    .  91 . HN   1 1 
        270 1 2 1 1  13 ILE HG13 .  91 . HG11 1 1 
        271 1 1 1 1  13 ILE H    .  91 . HN   1 1 
        271 1 2 1 1  13 ILE MG   .  91 . HG2# 1 1 
        272 1 1 1 1 102 ASN HB2  . 180 . HB2  1 1 
        272 1 2 1 1 103 ALA H    . 181 . HN   1 1 
        273 1 1 1 1 102 ASN HB3  . 180 . HB1  1 1 
        273 1 2 1 1 103 ALA H    . 181 . HN   1 1 
        274 1 1 1 1  41 LEU MD2  . 119 . HD2# 1 1 
        274 1 2 1 1 103 ALA H    . 181 . HN   1 1 
        275 1 1 1 1  35 PHE H    . 113 . HN   1 1 
        275 1 2 1 1  35 PHE HB3  . 113 . HB1  1 1 
        276 1 1 1 1   7 ALA H    .  85 . HN   1 1 
        276 1 2 1 1   9 LEU H    .  87 . HN   1 1 
        277 1 1 1 1   6 PRO HD3  .  84 . HD1  1 1 
        277 1 2 1 1   7 ALA H    .  85 . HN   1 1 
        278 1 1 1 1  73 THR MG   . 151 . HG2# 1 1 
        278 1 2 1 1  74 LYS H    . 152 . HN   1 1 
        279 1 1 1 1   8 GLN HB2  .  86 . HB2  1 1 
        279 1 2 1 1   9 LEU H    .  87 . HN   1 1 
        280 1 1 1 1   8 GLN HB3  .  86 . HB1  1 1 
        280 1 2 1 1   9 LEU H    .  87 . HN   1 1 
        281 1 1 1 1   9 LEU H    .  87 . HN   1 1 
        281 1 2 1 1   9 LEU MD2  .  87 . HD2# 1 1 
        282 1 1 1 1  45 THR H    . 123 . HN   1 1 
        282 1 2 1 1  46 ILE H    . 124 . HN   1 1 
        283 1 1 1 1  53 TYR H    . 131 . HN   1 1 
        283 1 2 1 1  53 TYR HB2  . 131 . HB2  1 1 
        284 1 1 1 1  53 TYR H    . 131 . HN   1 1 
        284 1 2 1 1  53 TYR HB3  . 131 . HB1  1 1 
        285 1 1 1 1  88 ARG QB   . 166 . HB#  1 1 
        285 1 2 1 1  89 SER H    . 167 . HN   1 1 
        286 1 1 1 1  79 LYS H    . 157 . HN   1 1 
        286 1 2 1 1  80 VAL MG2  . 158 . HG2# 1 1 
        287 1 1 1 1 108 MET HB3  . 186 . HB1  1 1 
        287 1 2 1 1 109 TYR H    . 187 . HN   1 1 
        288 1 1 1 1  98 GLU HA   . 176 . HA   1 1 
        288 1 2 1 1 101 GLU H    . 179 . HN   1 1 
        289 1 1 1 1  38 LEU HB2  . 116 . HB2  1 1 
        289 1 2 1 1  39 ALA H    . 117 . HN   1 1 
        290 1 1 1 1  61 ASP H    . 139 . HN   1 1 
        290 1 2 1 1  61 ASP HB3  . 139 . HB1  1 1 
        291 1 1 1 1 105 LYS H    . 183 . HN   1 1 
        291 1 2 1 1 105 LYS HG2  . 183 . HG2  1 1 
        292 1 1 1 1 105 LYS H    . 183 . HN   1 1 
        292 1 2 1 1 105 LYS QD   . 183 . HD#  1 1 
        293 1 1 1 1  57 LEU HB3  . 135 . HB1  1 1 
        293 1 2 1 1  58 HIS H    . 136 . HN   1 1 
        294 1 1 1 1  98 GLU H    . 176 . HN   1 1 
        294 1 2 1 1  98 GLU HG2  . 176 . HG2  1 1 
        295 1 1 1 1  97 LEU HB2  . 175 . HB2  1 1 
        295 1 2 1 1  98 GLU H    . 176 . HN   1 1 
        296 1 1 1 1  97 LEU HB3  . 175 . HB1  1 1 
        296 1 2 1 1  98 GLU H    . 176 . HN   1 1 
        297 1 1 1 1  79 LYS HA   . 157 . HA   1 1 
        297 1 2 1 1  82 GLU H    . 160 . HN   1 1 
        298 1 1 1 1  82 GLU H    . 160 . HN   1 1 
        298 1 2 1 1  82 GLU HG2  . 160 . HG2  1 1 
        299 1 1 1 1  36 ALA MB   . 114 . HB#  1 1 
        299 1 2 1 1  40 LEU H    . 118 . HN   1 1 
        300 1 1 1 1  46 ILE H    . 124 . HN   1 1 
        300 1 2 1 1  46 ILE HG12 . 124 . HG12 1 1 
        301 1 1 1 1  92 PRO HA   . 170 . HA   1 1 
        301 1 2 1 1  96 ASP H    . 174 . HN   1 1 
        302 1 1 1 1  87 TYR QD   . 165 . HD#  1 1 
        302 1 2 1 1  88 ARG H    . 166 . HN   1 1 
        303 1 1 1 1 104 LYS H    . 182 . HN   1 1 
        303 1 2 1 1 105 LYS H    . 183 . HN   1 1 
        304 1 1 1 1  35 PHE QD   . 113 . HD#  1 1 
        304 1 2 1 1  36 ALA H    . 114 . HN   1 1 
        305 1 1 1 1  63 VAL H    . 141 . HN   1 1 
        305 1 2 1 1  63 VAL MG1  . 141 . HG1# 1 1 
        306 1 1 1 1  94 GLN H    . 172 . HN   1 1 
        306 1 2 1 1  94 GLN HB2  . 172 . HB2  1 1 
        307 1 1 1 1  29 GLY HA2  . 107 . HA2  1 1 
        307 1 2 1 1  31 LEU H    . 109 . HN   1 1 
        308 1 1 1 1  31 LEU H    . 109 . HN   1 1 
        308 1 2 1 1  32 PRO QD   . 110 . HD#  1 1 
        309 1 1 1 1  31 LEU H    . 109 . HN   1 1 
        309 1 2 1 1  31 LEU HB3  . 109 . HB1  1 1 
        310 1 1 1 1  40 LEU H    . 118 . HN   1 1 
        310 1 2 1 1  41 LEU H    . 119 . HN   1 1 
        311 1 1 1 1  37 THR HA   . 115 . HA   1 1 
        311 1 2 1 1  41 LEU H    . 119 . HN   1 1 
        312 1 1 1 1  38 LEU HA   . 116 . HA   1 1 
        312 1 2 1 1  41 LEU H    . 119 . HN   1 1 
        313 1 1 1 1  40 LEU MD2  . 118 . HD2# 1 1 
        313 1 2 1 1  41 LEU H    . 119 . HN   1 1 
        314 1 1 1 1  41 LEU H    . 119 . HN   1 1 
        314 1 2 1 1  41 LEU MD1  . 119 . HD1# 1 1 
        315 1 1 1 1  41 LEU H    . 119 . HN   1 1 
        315 1 2 1 1  41 LEU MD2  . 119 . HD2# 1 1 
        316 1 1 1 1  34 SER H    . 112 . HN   1 1 
        316 1 2 1 1  37 THR HB   . 115 . HB   1 1 
        317 1 1 1 1  62 TYR H    . 140 . HN   1 1 
        317 1 2 1 1  62 TYR HB2  . 140 . HB2  1 1 
        318 1 1 1 1  74 LYS HA   . 152 . HA   1 1 
        318 1 2 1 1  77 GLU H    . 155 . HN   1 1 
        319 1 1 1 1  43 SER H    . 121 . HN   1 1 
        319 1 2 1 1  80 VAL MG2  . 158 . HG2# 1 1 
        320 1 1 1 1  22 LEU H    . 100 . HN   1 1 
        320 1 2 1 1  23 ARG H    . 101 . HN   1 1 
        321 1 1 1 1  23 ARG H    . 101 . HN   1 1 
        321 1 2 1 1  23 ARG HG3  . 101 . HG1  1 1 
        322 1 1 1 1  24 GLN H    . 102 . HN   1 1 
        322 1 2 1 1  24 GLN HG2  . 102 . HG2  1 1 
        323 1 1 1 1  23 ARG HB2  . 101 . HB2  1 1 
        323 1 2 1 1  24 GLN H    . 102 . HN   1 1 
        324 1 1 1 1  23 ARG HB3  . 101 . HB1  1 1 
        324 1 2 1 1  24 GLN H    . 102 . HN   1 1 
        325 1 1 1 1  37 THR H    . 115 . HN   1 1 
        325 1 2 1 1  37 THR MG   . 115 . HG2# 1 1 
        326 1 1 1 1  68 LEU HB3  . 146 . HB1  1 1 
        326 1 2 1 1  69 ALA H    . 147 . HN   1 1 
        327 1 1 1 1  71 ASN H    . 149 . HN   1 1 
        327 1 2 1 1  71 ASN HB3  . 149 . HB1  1 1 
        328 1 1 1 1 108 MET H    . 186 . HN   1 1 
        328 1 2 1 1 108 MET HG3  . 186 . HG1  1 1 
        329 1 1 1 1  70 PRO HG2  . 148 . HG2  1 1 
        329 1 2 1 1  71 ASN H    . 149 . HN   1 1 
        330 1 1 1 1  69 ALA MB   . 147 . HB#  1 1 
        330 1 2 1 1  71 ASN H    . 149 . HN   1 1 
        331 1 1 1 1 102 ASN H    . 180 . HN   1 1 
        331 1 2 1 1 102 ASN HD22 . 180 . HD22 1 1 
        332 1 1 1 1 102 ASN H    . 180 . HN   1 1 
        332 1 2 1 1 102 ASN HD21 . 180 . HD21 1 1 
        333 1 1 1 1  19 CYS H    .  97 . HN   1 1 
        333 1 2 1 1  19 CYS HB3  .  97 . HB1  1 1 
        334 1 1 1 1  14 THR H    .  92 . HN   1 1 
        334 1 2 1 1  14 THR MG   .  92 . HG2# 1 1 
        335 1 1 1 1  84 HIS H    . 162 . HN   1 1 
        335 1 2 1 1  85 LYS H    . 163 . HN   1 1 
        336 1 1 1 1  49 GLU H    . 127 . HN   1 1 
        336 1 2 1 1  49 GLU HG2  . 127 . HG2  1 1 
        337 1 1 1 1  91 THR HB   . 169 . HB   1 1 
        337 1 2 1 1  93 ALA H    . 171 . HN   1 1 
        338 1 1 1 1  73 THR H    . 151 . HN   1 1 
        338 1 2 1 1  76 LEU HB3  . 154 . HB1  1 1 
        339 1 1 1 1  73 THR H    . 151 . HN   1 1 
        339 1 2 1 1  76 LEU HG   . 154 . HG   1 1 
        340 1 1 1 1   9 LEU H    .  87 . HN   1 1 
        340 1 2 1 1  10 THR H    .  88 . HN   1 1 
        341 1 1 1 1   9 LEU HB3  .  87 . HB1  1 1 
        341 1 2 1 1  10 THR H    .  88 . HN   1 1 
        342 1 1 1 1   9 LEU HG   .  87 . HG   1 1 
        342 1 2 1 1  10 THR H    .  88 . HN   1 1 
        343 1 1 1 1  48 SER H    . 126 . HN   1 1 
        343 1 2 1 1  95 ALA MB   . 173 . HB#  1 1 
        344 1 1 1 1  58 HIS H    . 136 . HN   1 1 
        344 1 2 1 1  59 GLY H    . 137 . HN   1 1 
        345 1 1 1 1  41 LEU H    . 119 . HN   1 1 
        345 1 2 1 1  42 GLY H    . 120 . HN   1 1 
        346 1 1 1 1  41 LEU HG   . 119 . HG   1 1 
        346 1 2 1 1  42 GLY H    . 120 . HN   1 1 
        347 1 1 1 1  29 GLY H    . 107 . HN   1 1 
        347 1 2 1 1  70 PRO HG3  . 148 . HG1  1 1 
        348 1 1 1 1  68 LEU H    . 146 . HN   1 1 
        348 1 2 1 1  68 LEU HB2  . 146 . HB2  1 1 
        349 1 1 1 1  27 VAL MG1  . 105 . HG1# 1 1 
        349 1 2 1 1  68 LEU H    . 146 . HN   1 1 
        350 1 1 1 1  68 LEU H    . 146 . HN   1 1 
        350 1 2 1 1  68 LEU MD2  . 146 . HD2# 1 1 
        351 1 1 1 1  17 TYR HB2  .  95 . HB2  1 1 
        351 1 2 1 1  18 LEU H    .  96 . HN   1 1 
        352 1 1 1 1  17 TYR HB3  .  95 . HB1  1 1 
        352 1 2 1 1  18 LEU H    .  96 . HN   1 1 
        353 1 1 1 1  18 LEU H    .  96 . HN   1 1 
        353 1 2 1 1  18 LEU MD1  .  96 . HD1# 1 1 
        354 1 1 1 1  37 THR MG   . 115 . HG2# 1 1 
        354 1 2 1 1  38 LEU H    . 116 . HN   1 1 
        355 1 1 1 1  66 PHE HB2  . 144 . HB2  1 1 
        355 1 2 1 1  67 LYS H    . 145 . HN   1 1 
        356 1 1 1 1  67 LYS H    . 145 . HN   1 1 
        356 1 2 1 1  67 LYS QE   . 145 . HE#  1 1 
        357 1 1 1 1  67 LYS H    . 145 . HN   1 1 
        357 1 2 1 1  67 LYS HG3  . 145 . HG1  1 1 
        358 1 1 1 1  90 MET HG3  . 168 . HG1  1 1 
        358 1 2 1 1  91 THR H    . 169 . HN   1 1 
        359 1 1 1 1  34 SER HB2  . 112 . HB2  1 1 
        359 1 2 1 1  35 PHE H    . 113 . HN   1 1 
        360 1 1 1 1   6 PRO HD2  .  84 . HD2  1 1 
        360 1 2 1 1   7 ALA H    .  85 . HN   1 1 
        361 1 1 1 1  44 TYR HB3  . 122 . HB1  1 1 
        361 1 2 1 1  45 THR H    . 123 . HN   1 1 
        362 1 1 1 1  52 ASP QB   . 130 . HB#  1 1 
        362 1 2 1 1  53 TYR H    . 131 . HN   1 1 
        363 1 1 1 1  45 THR H    . 123 . HN   1 1 
        363 1 2 1 1  45 THR MG   . 123 . HG2# 1 1 
        364 1 1 1 1  14 THR MG   .  92 . HG2# 1 1 
        364 1 2 1 1  15 ARG H    .  93 . HN   1 1 
        365 1 1 1 1  88 ARG QG   . 166 . HG#  1 1 
        365 1 2 1 1  89 SER H    . 167 . HN   1 1 
        366 1 1 1 1  35 PHE HZ   . 113 . HZ   1 1 
        366 1 2 1 1  76 LEU H    . 154 . HN   1 1 
        367 1 1 1 1  76 LEU H    . 154 . HN   1 1 
        367 1 2 1 1  76 LEU MD2  . 154 . HD2# 1 1 
        368 1 1 1 1  46 ILE MG   . 124 . HG2# 1 1 
        368 1 2 1 1  47 GLN H    . 125 . HN   1 1 
        369 1 1 1 1  79 LYS H    . 157 . HN   1 1 
        369 1 2 1 1  79 LYS HD2  . 157 . HD2  1 1 
        370 1 1 1 1 104 LYS HA   . 182 . HA   1 1 
        370 1 2 1 1 109 TYR H    . 187 . HN   1 1 
        371 1 1 1 1  16 TYR H    .  94 . HN   1 1 
        371 1 2 1 1  16 TYR QD   .  94 . HD#  1 1 
        372 1 1 1 1  61 ASP H    . 139 . HN   1 1 
        372 1 2 1 1  61 ASP HB2  . 139 . HB2  1 1 
        373 1 1 1 1  83 LEU HB3  . 161 . HB1  1 1 
        373 1 2 1 1  84 HIS H    . 162 . HN   1 1 
        374 1 1 1 1 105 LYS H    . 183 . HN   1 1 
        374 1 2 1 1 106 LEU QB   . 184 . HB#  1 1 
        375 1 1 1 1  66 PHE H    . 144 . HN   1 1 
        375 1 2 1 1  66 PHE QE   . 144 . HE#  1 1 
        376 1 1 1 1  64 SER HA   . 142 . HA   1 1 
        376 1 2 1 1  66 PHE H    . 144 . HN   1 1 
        377 1 1 1 1  58 HIS H    . 136 . HN   1 1 
        377 1 2 1 1  58 HIS HB3  . 136 . HB1  1 1 
        378 1 1 1 1  22 LEU H    . 100 . HN   1 1 
        378 1 2 1 1  22 LEU MD2  . 100 . HD2# 1 1 
        379 1 1 1 1  22 LEU H    . 100 . HN   1 1 
        379 1 2 1 1  22 LEU MD1  . 100 . HD1# 1 1 
        380 1 1 1 1  97 LEU MD1  . 175 . HD1# 1 1 
        380 1 2 1 1  98 GLU H    . 176 . HN   1 1 
        381 1 1 1 1  97 LEU MD2  . 175 . HD2# 1 1 
        381 1 2 1 1  98 GLU H    . 176 . HN   1 1 
        382 1 1 1 1  46 ILE H    . 124 . HN   1 1 
        382 1 2 1 1  46 ILE HG13 . 124 . HG11 1 1 
        383 1 1 1 1  46 ILE H    . 124 . HN   1 1 
        383 1 2 1 1  46 ILE MG   . 124 . HG2# 1 1 
        384 1 1 1 1  99 PHE QD   . 177 . HD#  1 1 
        384 1 2 1 1 100 LEU H    . 178 . HN   1 1 
        385 1 1 1 1  79 LYS QB   . 157 . HB#  1 1 
        385 1 2 1 1  80 VAL H    . 158 . HN   1 1 
        386 1 1 1 1  80 VAL H    . 158 . HN   1 1 
        386 1 2 1 1  80 VAL MG1  . 158 . HG1# 1 1 
        387 1 1 1 1  35 PHE H    . 113 . HN   1 1 
        387 1 2 1 1  36 ALA H    . 114 . HN   1 1 
        388 1 1 1 1  18 LEU HA   .  96 . HA   1 1 
        388 1 2 1 1  21 GLN H    .  99 . HN   1 1 
        389 1 1 1 1  20 LEU MD2  .  98 . HD2# 1 1 
        389 1 2 1 1  21 GLN H    .  99 . HN   1 1 
        390 1 1 1 1  30 ARG HB2  . 108 . HB2  1 1 
        390 1 2 1 1  31 LEU H    . 109 . HN   1 1 
        391 1 1 1 1  31 LEU H    . 109 . HN   1 1 
        391 1 2 1 1  31 LEU MD2  . 109 . HD2# 1 1 
        392 1 1 1 1  73 THR HA   . 151 . HA   1 1 
        392 1 2 1 1  75 GLU H    . 153 . HN   1 1 
        393 1 1 1 1  33 CYS HB2  . 111 . HB2  1 1 
        393 1 2 1 1  34 SER H    . 112 . HN   1 1 
        394 1 1 1 1  33 CYS HB3  . 111 . HB1  1 1 
        394 1 2 1 1  34 SER H    . 112 . HN   1 1 
        395 1 1 1 1  75 GLU H    . 153 . HN   1 1 
        395 1 2 1 1  75 GLU HG3  . 153 . HG1  1 1 
        396 1 1 1 1  75 GLU H    . 153 . HN   1 1 
        396 1 2 1 1  75 GLU HG2  . 153 . HG2  1 1 
        397 1 1 1 1  73 THR MG   . 151 . HG2# 1 1 
        397 1 2 1 1  75 GLU H    . 153 . HN   1 1 
        398 1 1 1 1  54 ASP QB   . 132 . HB#  1 1 
        398 1 2 1 1  57 LEU H    . 135 . HN   1 1 
        399 1 1 1 1  77 GLU H    . 155 . HN   1 1 
        399 1 2 1 1  78 GLU HB2  . 156 . HB2  1 1 
        400 1 1 1 1  77 GLU H    . 155 . HN   1 1 
        400 1 2 1 1  81 MET ME   . 159 . HE#  1 1 
        401 1 1 1 1  80 VAL MG1  . 158 . HG1# 1 1 
        401 1 2 1 1  81 MET H    . 159 . HN   1 1 
        402 1 1 1 1  22 LEU HB2  . 100 . HB2  1 1 
        402 1 2 1 1  23 ARG H    . 101 . HN   1 1 
        403 1 1 1 1  25 ASP HA   . 103 . HA   1 1 
        403 1 2 1 1  28 ALA H    . 106 . HN   1 1 
        404 1 1 1 1  71 ASN H    . 149 . HN   1 1 
        404 1 2 1 1  71 ASN HB2  . 149 . HB2  1 1 
        405 1 1 1 1  17 TYR H    .  95 . HN   1 1 
        405 1 2 1 1  17 TYR QD   .  95 . HD#  1 1 
        406 1 1 1 1  16 TYR QD   .  94 . HD#  1 1 
        406 1 2 1 1  17 TYR H    .  95 . HN   1 1 
        407 1 1 1 1  18 LEU MD2  .  96 . HD2# 1 1 
        407 1 2 1 1  19 CYS H    .  97 . HN   1 1 
        408 1 1 1 1  17 TYR H    .  95 . HN   1 1 
        408 1 2 1 1  20 LEU MD1  .  98 . HD1# 1 1 
        409 1 1 1 1  49 GLU HB2  . 127 . HB2  1 1 
        409 1 2 1 1  50 LEU H    . 128 . HN   1 1 
        410 1 1 1 1  50 LEU H    . 128 . HN   1 1 
        410 1 2 1 1  50 LEU MD2  . 128 . HD2# 1 1 
        411 1 1 1 1  70 PRO HG3  . 148 . HG1  1 1 
        411 1 2 1 1  71 ASN H    . 149 . HN   1 1 
        412 1 1 1 1  24 GLN HA   . 102 . HA   1 1 
        412 1 2 1 1  28 ALA H    . 106 . HN   1 1 
        413 1 1 1 1  13 ILE HB   .  91 . HB   1 1 
        413 1 2 1 1  14 THR H    .  92 . HN   1 1 
        414 1 1 1 1  13 ILE MG   .  91 . HG2# 1 1 
        414 1 2 1 1  14 THR H    .  92 . HN   1 1 
        415 1 1 1 1  83 LEU H    . 161 . HN   1 1 
        415 1 2 1 1  85 LYS H    . 163 . HN   1 1 
        416 1 1 1 1  84 HIS HD2  . 162 . HD2  1 1 
        416 1 2 1 1  85 LYS H    . 163 . HN   1 1 
        417 1 1 1 1  84 HIS HB2  . 162 . HB2  1 1 
        417 1 2 1 1  85 LYS H    . 163 . HN   1 1 
        418 1 1 1 1  85 LYS H    . 163 . HN   1 1 
        418 1 2 1 1  85 LYS HG3  . 163 . HG1  1 1 
        419 1 1 1 1  47 GLN H    . 125 . HN   1 1 
        419 1 2 1 1  49 GLU H    . 127 . HN   1 1 
        420 1 1 1 1  46 ILE HA   . 124 . HA   1 1 
        420 1 2 1 1  49 GLU H    . 127 . HN   1 1 
        421 1 1 1 1  92 PRO QB   . 170 . HB#  1 1 
        421 1 2 1 1  93 ALA H    . 171 . HN   1 1 
        422 1 1 1 1  72 GLN HG2  . 150 . HG2  1 1 
        422 1 2 1 1  73 THR H    . 151 . HN   1 1 
        423 1 1 1 1  72 GLN HG3  . 150 . HG1  1 1 
        423 1 2 1 1  73 THR H    . 151 . HN   1 1 
        424 1 1 1 1  73 THR H    . 151 . HN   1 1 
        424 1 2 1 1  76 LEU HB2  . 154 . HB2  1 1 
        425 1 1 1 1  86 SER H    . 164 . HN   1 1 
        425 1 2 1 1  86 SER HB3  . 164 . HB1  1 1 
        426 1 1 1 1  85 LYS HB2  . 163 . HB2  1 1 
        426 1 2 1 1  86 SER H    . 164 . HN   1 1 
        427 1 1 1 1  85 LYS HB3  . 163 . HB1  1 1 
        427 1 2 1 1  86 SER H    . 164 . HN   1 1 
        428 1 1 1 1   9 LEU HB2  .  87 . HB2  1 1 
        428 1 2 1 1  10 THR H    .  88 . HN   1 1 
        429 1 1 1 1   9 LEU MD2  .  87 . HD2# 1 1 
        429 1 2 1 1  10 THR H    .  88 . HN   1 1 
        430 1 1 1 1  63 VAL HB   . 141 . HB   1 1 
        430 1 2 1 1  64 SER H    . 142 . HN   1 1 
        431 1 1 1 1  63 VAL MG2  . 141 . HG2# 1 1 
        431 1 2 1 1  64 SER H    . 142 . HN   1 1 
        432 1 1 1 1 106 LEU QB   . 184 . HB#  1 1 
        432 1 2 1 1 107 SER H    . 185 . HN   1 1 
        433 1 1 1 1  51 GLY H    . 129 . HN   1 1 
        433 1 2 1 1  52 ASP H    . 130 . HN   1 1 
        434 1 1 1 1  49 GLU H    . 127 . HN   1 1 
        434 1 2 1 1  51 GLY H    . 129 . HN   1 1 
        435 1 1 1 1  50 LEU HB2  . 128 . HB2  1 1 
        435 1 2 1 1  51 GLY H    . 129 . HN   1 1 
        436 1 1 1 1  50 LEU HB3  . 128 . HB1  1 1 
        436 1 2 1 1  51 GLY H    . 129 . HN   1 1 
        437 1 1 1 1  59 GLY H    . 137 . HN   1 1 
        437 1 2 1 1  60 VAL H    . 138 . HN   1 1 
        438 1 1 1 1  40 LEU MD2  . 118 . HD2# 1 1 
        438 1 2 1 1  42 GLY H    . 120 . HN   1 1 
        439 1 1 1 1  42 GLY H    . 120 . HN   1 1 
        439 1 2 1 1  80 VAL MG2  . 158 . HG2# 1 1 
        440 1 1 1 1  33 CYS H    . 111 . HN   1 1 
        440 1 2 1 1  38 LEU MD2  . 116 . HD2# 1 1 
        441 1 1 1 1  28 ALA H    . 106 . HN   1 1 
        441 1 2 1 1  29 GLY H    . 107 . HN   1 1 
        442 1 1 1 1  90 MET H    . 168 . HN   1 1 
        442 1 2 1 1  90 MET HG2  . 168 . HG2  1 1 
        443 1 1 1 1  41 LEU HA   . 119 . HA   1 1 
        443 1 2 1 1  44 TYR H    . 122 . HN   1 1 
        444 1 1 1 1  99 PHE H    . 177 . HN   1 1 
        444 1 2 1 1 101 GLU H    . 179 . HN   1 1 
        445 1 1 1 1  99 PHE H    . 177 . HN   1 1 
        445 1 2 1 1  99 PHE QD   . 177 . HD#  1 1 
        446 1 1 1 1  96 ASP HA   . 174 . HA   1 1 
        446 1 2 1 1  99 PHE H    . 177 . HN   1 1 
        447 1 1 1 1  71 ASN H    . 149 . HN   1 1 
        447 1 2 1 1  72 GLN H    . 150 . HN   1 1 
        448 1 1 1 1  72 GLN H    . 150 . HN   1 1 
        448 1 2 1 1  72 GLN HG3  . 150 . HG1  1 1 
        449 1 1 1 1  90 MET ME   . 168 . HE#  1 1 
        449 1 2 1 1  95 ALA H    . 173 . HN   1 1 
        450 1 1 1 1  93 ALA MB   . 171 . HB#  1 1 
        450 1 2 1 1  95 ALA H    . 173 . HN   1 1 
        451 1 1 1 1  18 LEU H    .  96 . HN   1 1 
        451 1 2 1 1  18 LEU MD2  .  96 . HD2# 1 1 
        452 1 1 1 1  38 LEU H    . 116 . HN   1 1 
        452 1 2 1 1  38 LEU HG   . 116 . HG   1 1 
        453 1 1 1 1  67 LYS H    . 145 . HN   1 1 
        453 1 2 1 1  68 LEU H    . 146 . HN   1 1 
        454 1 1 1 1  66 PHE QD   . 144 . HD#  1 1 
        454 1 2 1 1  67 LYS H    . 145 . HN   1 1 
        455 1 1 1 1  67 LYS H    . 145 . HN   1 1 
        455 1 2 1 1  68 LEU HG   . 146 . HG   1 1 
        456 1 1 1 1  90 MET H    . 168 . HN   1 1 
        456 1 2 1 1  91 THR H    . 169 . HN   1 1 
        457 1 1 1 1  10 THR HB   .  88 . HB   1 1 
        457 1 2 1 1  11 GLU H    .  89 . HN   1 1 
        458 1 1 1 1   7 ALA H    .  85 . HN   1 1 
        458 1 2 1 1   8 GLN QG   .  86 . HG#  1 1 
        459 1 1 1 1   7 ALA H    .  85 . HN   1 1 
        459 1 2 1 1   9 LEU MD2  .  87 . HD2# 1 1 
        460 1 1 1 1  25 ASP H    . 103 . HN   1 1 
        460 1 2 1 1  27 VAL MG2  . 105 . HG2# 1 1 
        461 1 1 1 1  74 LYS H    . 152 . HN   1 1 
        461 1 2 1 1  74 LYS QD   . 152 . HD#  1 1 
        462 1 1 1 1   7 ALA MB   .  85 . HB#  1 1 
        462 1 2 1 1   9 LEU H    .  87 . HN   1 1 
        463 1 1 1 1  53 TYR H    . 131 . HN   1 1 
        463 1 2 1 1  53 TYR QD   . 131 . HD#  1 1 
        464 1 1 1 1  44 TYR HB2  . 122 . HB2  1 1 
        464 1 2 1 1  45 THR H    . 123 . HN   1 1 
        465 1 1 1 1  15 ARG H    .  93 . HN   1 1 
        465 1 2 1 1  15 ARG QG   .  93 . HG#  1 1 
        466 1 1 1 1  73 THR MG   . 151 . HG2# 1 1 
        466 1 2 1 1  76 LEU H    . 154 . HN   1 1 
        467 1 1 1 1  76 LEU H    . 154 . HN   1 1 
        467 1 2 1 1  76 LEU HG   . 154 . HG   1 1 
        468 1 1 1 1  76 LEU H    . 154 . HN   1 1 
        468 1 2 1 1  76 LEU MD1  . 154 . HD1# 1 1 
        469 1 1 1 1  79 LYS H    . 157 . HN   1 1 
        469 1 2 1 1  79 LYS HD3  . 157 . HD1  1 1 
        470 1 1 1 1  79 LYS H    . 157 . HN   1 1 
        470 1 2 1 1  79 LYS HG3  . 157 . HG1  1 1 
        471 1 1 1 1  15 ARG HB3  .  93 . HB1  1 1 
        471 1 2 1 1  16 TYR H    .  94 . HN   1 1 
        472 1 1 1 1  39 ALA H    . 117 . HN   1 1 
        472 1 2 1 1  76 LEU MD2  . 154 . HD2# 1 1 
        473 1 1 1 1  60 VAL HB   . 138 . HB   1 1 
        473 1 2 1 1  61 ASP H    . 139 . HN   1 1 
        474 1 1 1 1  83 LEU HB2  . 161 . HB2  1 1 
        474 1 2 1 1  84 HIS H    . 162 . HN   1 1 
        475 1 1 1 1  54 ASP QB   . 132 . HB#  1 1 
        475 1 2 1 1  58 HIS H    . 136 . HN   1 1 
        476 1 1 1 1  11 GLU H    .  89 . HN   1 1 
        476 1 2 1 1  12 ASP H    .  90 . HN   1 1 
        477 1 1 1 1  96 ASP H    . 174 . HN   1 1 
        477 1 2 1 1  98 GLU H    . 176 . HN   1 1 
        478 1 1 1 1  98 GLU H    . 176 . HN   1 1 
        478 1 2 1 1 100 LEU H    . 178 . HN   1 1 
        479 1 1 1 1  99 PHE HB2  . 177 . HB2  1 1 
        479 1 2 1 1 100 LEU H    . 178 . HN   1 1 
        480 1 1 1 1 100 LEU HA   . 178 . HA   1 1 
        480 1 2 1 1 104 LYS H    . 182 . HN   1 1 
        481 1 1 1 1  91 THR H    . 169 . HN   1 1 
        481 1 2 1 1  94 GLN H    . 172 . HN   1 1 
        482 1 1 1 1  94 GLN H    . 172 . HN   1 1 
        482 1 2 1 1  95 ALA MB   . 173 . HB#  1 1 
        483 1 1 1 1  74 LYS QG   . 152 . HG#  1 1 
        483 1 2 1 1  75 GLU H    . 153 . HN   1 1 
        484 1 1 1 1  78 GLU H    . 156 . HN   1 1 
        484 1 2 1 1  79 LYS QB   . 157 . HB#  1 1 
        485 1 1 1 1  78 GLU HA   . 156 . HA   1 1 
        485 1 2 1 1  81 MET H    . 159 . HN   1 1 
        486 1 1 1 1  80 VAL MG2  . 158 . HG2# 1 1 
        486 1 2 1 1  81 MET H    . 159 . HN   1 1 
        487 1 1 1 1  63 VAL MG2  . 141 . HG2# 1 1 
        487 1 2 1 1  81 MET H    . 159 . HN   1 1 
        488 1 1 1 1  43 SER H    . 121 . HN   1 1 
        488 1 2 1 1  83 LEU MD1  . 161 . HD1# 1 1 
        489 1 1 1 1  23 ARG H    . 101 . HN   1 1 
        489 1 2 1 1  23 ARG HG2  . 101 . HG2  1 1 
        490 1 1 1 1  22 LEU HB3  . 100 . HB1  1 1 
        490 1 2 1 1  23 ARG H    . 101 . HN   1 1 
        491 1 1 1 1 104 LYS HA   . 182 . HA   1 1 
        491 1 2 1 1 108 MET H    . 186 . HN   1 1 
        492 1 1 1 1  18 LEU HG   .  96 . HG   1 1 
        492 1 2 1 1  19 CYS H    .  97 . HN   1 1 
        493 1 1 1 1  50 LEU H    . 128 . HN   1 1 
        493 1 2 1 1  50 LEU MD1  . 128 . HD1# 1 1 
        494 1 1 1 1  70 PRO HD3  . 148 . HD1  1 1 
        494 1 2 1 1  71 ASN H    . 149 . HN   1 1 
        495 1 1 1 1  92 PRO HG2  . 170 . HG2  1 1 
        495 1 2 1 1  93 ALA H    . 171 . HN   1 1 
        496 1 1 1 1  72 GLN HB2  . 150 . HB2  1 1 
        496 1 2 1 1  73 THR H    . 151 . HN   1 1 
        497 1 1 1 1 105 LYS HA   . 183 . HA   1 1 
        497 1 2 1 1 107 SER H    . 185 . HN   1 1 
        498 1 1 1 1 106 LEU MD1  . 184 . HD1# 1 1 
        498 1 2 1 1 107 SER H    . 185 . HN   1 1 
        499 1 1 1 1 106 LEU MD2  . 184 . HD2# 1 1 
        499 1 2 1 1 107 SER H    . 185 . HN   1 1 
        500 1 1 1 1  47 GLN QB   . 125 . HB#  1 1 
        500 1 2 1 1  48 SER H    . 126 . HN   1 1 
        501 1 1 1 1  39 ALA HA   . 117 . HA   1 1 
        501 1 2 1 1  42 GLY H    . 120 . HN   1 1 
        502 1 1 1 1  26 ILE HA   . 104 . HA   1 1 
        502 1 2 1 1  29 GLY H    . 107 . HN   1 1 
        503 1 1 1 1  47 GLN QB   . 125 . HB#  1 1 
        503 1 2 1 1  47 GLN HE22 . 125 . HE22 1 1 
        504 1 1 1 1 104 LYS H    . 182 . HN   1 1 
        504 1 2 1 1 104 LYS HB2  . 182 . HB2  1 1 
        505 1 1 1 1  78 GLU H    . 156 . HN   1 1 
        505 1 2 1 1  78 GLU HB2  . 156 . HB2  1 1 
        506 1 1 1 1 101 GLU HB2  . 179 . HB2  1 1 
        506 1 2 1 1 102 ASN H    . 180 . HN   1 1 
        507 1 1 1 1   8 GLN H    .  86 . HN   1 1 
        507 1 2 1 1   9 LEU MD2  .  87 . HD2# 1 1 
        508 1 1 1 1  88 ARG H    . 166 . HN   1 1 
        508 1 2 1 1  90 MET H    . 168 . HN   1 1 
        509 1 1 1 1  88 ARG QB   . 166 . HB#  1 1 
        509 1 2 1 1  90 MET H    . 168 . HN   1 1 
        510 1 1 1 1  90 MET H    . 168 . HN   1 1 
        510 1 2 1 1  90 MET ME   . 168 . HE#  1 1 
        511 1 1 1 1   4 MET HG2  .  82 . HG2  1 1 
        511 1 2 1 1   5 ASP H    .  83 . HN   1 1 
        512 1 1 1 1   4 MET HG3  .  82 . HG1  1 1 
        512 1 2 1 1   5 ASP H    .  83 . HN   1 1 
        513 1 1 1 1  40 LEU MD2  . 118 . HD2# 1 1 
        513 1 2 1 1  44 TYR H    . 122 . HN   1 1 
        514 1 1 1 1  70 PRO HA   . 148 . HA   1 1 
        514 1 2 1 1  72 GLN H    . 150 . HN   1 1 
        515 1 1 1 1  71 ASN HB3  . 149 . HB1  1 1 
        515 1 2 1 1  72 GLN H    . 150 . HN   1 1 
        516 1 1 1 1  68 LEU H    . 146 . HN   1 1 
        516 1 2 1 1  68 LEU MD1  . 146 . HD1# 1 1 
        517 1 1 1 1  11 GLU QB   .  89 . HB#  1 1 
        517 1 2 1 1  13 ILE H    .  91 . HN   1 1 
        518 1 1 1 1  99 PHE QD   . 177 . HD#  1 1 
        518 1 2 1 1 103 ALA H    . 181 . HN   1 1 
        519 1 1 1 1 103 ALA H    . 181 . HN   1 1 
        519 1 2 1 1 106 LEU H    . 184 . HN   1 1 
        520 1 1 1 1  25 ASP H    . 103 . HN   1 1 
        520 1 2 1 1  26 ILE MD   . 104 . HD1# 1 1 
        521 1 1 1 1   8 GLN QG   .  86 . HG#  1 1 
        521 1 2 1 1   9 LEU H    .  87 . HN   1 1 
        522 1 1 1 1  12 ASP HA   .  90 . HA   1 1 
        522 1 2 1 1  15 ARG H    .  93 . HN   1 1 
        523 1 1 1 1  72 GLN HG3  . 150 . HG1  1 1 
        523 1 2 1 1  76 LEU H    . 154 . HN   1 1 
        524 1 1 1 1  79 LYS H    . 157 . HN   1 1 
        524 1 2 1 1  79 LYS HG2  . 157 . HG2  1 1 
        525 1 1 1 1 108 MET HB2  . 186 . HB2  1 1 
        525 1 2 1 1 109 TYR H    . 187 . HN   1 1 
        526 1 1 1 1  97 LEU MD1  . 175 . HD1# 1 1 
        526 1 2 1 1 101 GLU H    . 179 . HN   1 1 
        527 1 1 1 1 100 LEU MD1  . 178 . HD1# 1 1 
        527 1 2 1 1 101 GLU H    . 179 . HN   1 1 
        528 1 1 1 1  35 PHE HA   . 113 . HA   1 1 
        528 1 2 1 1  39 ALA H    . 117 . HN   1 1 
        529 1 1 1 1  36 ALA MB   . 114 . HB#  1 1 
        529 1 2 1 1  39 ALA H    . 117 . HN   1 1 
        530 1 1 1 1  83 LEU MD1  . 161 . HD1# 1 1 
        530 1 2 1 1  84 HIS H    . 162 . HN   1 1 
        531 1 1 1 1 102 ASN HA   . 180 . HA   1 1 
        531 1 2 1 1 105 LYS H    . 183 . HN   1 1 
        532 1 1 1 1 105 LYS H    . 183 . HN   1 1 
        532 1 2 1 1 105 LYS HG3  . 183 . HG1  1 1 
        533 1 1 1 1  20 LEU H    .  98 . HN   1 1 
        533 1 2 1 1  22 LEU H    . 100 . HN   1 1 
        534 1 1 1 1  11 GLU QG   .  89 . HG#  1 1 
        534 1 2 1 1  12 ASP H    .  90 . HN   1 1 
        535 1 1 1 1  10 THR MG   .  88 . HG2# 1 1 
        535 1 2 1 1  12 ASP H    .  90 . HN   1 1 
        536 1 1 1 1  95 ALA HA   . 173 . HA   1 1 
        536 1 2 1 1  98 GLU H    . 176 . HN   1 1 
        537 1 1 1 1  40 LEU H    . 118 . HN   1 1 
        537 1 2 1 1  83 LEU MD1  . 161 . HD1# 1 1 
        538 1 1 1 1 100 LEU H    . 178 . HN   1 1 
        538 1 2 1 1 103 ALA MB   . 181 . HB#  1 1 
        539 1 1 1 1  96 ASP H    . 174 . HN   1 1 
        539 1 2 1 1  98 GLU QB   . 176 . HB#  1 1 
        540 1 1 1 1  98 GLU QB   . 176 . HB#  1 1 
        540 1 2 1 1 100 LEU H    . 178 . HN   1 1 
        541 1 1 1 1  88 ARG H    . 166 . HN   1 1 
        541 1 2 1 1  89 SER H    . 167 . HN   1 1 
        542 1 1 1 1  88 ARG H    . 166 . HN   1 1 
        542 1 2 1 1  88 ARG QD   . 166 . HD#  1 1 
        543 1 1 1 1  17 TYR HA   .  95 . HA   1 1 
        543 1 2 1 1  21 GLN H    .  99 . HN   1 1 
        544 1 1 1 1  29 GLY H    . 107 . HN   1 1 
        544 1 2 1 1  31 LEU H    . 109 . HN   1 1 
        545 1 1 1 1  30 ARG HB3  . 108 . HB1  1 1 
        545 1 2 1 1  31 LEU H    . 109 . HN   1 1 
        546 1 1 1 1  37 THR MG   . 115 . HG2# 1 1 
        546 1 2 1 1  41 LEU H    . 119 . HN   1 1 
        547 1 1 1 1  75 GLU H    . 153 . HN   1 1 
        547 1 2 1 1  77 GLU H    . 155 . HN   1 1 
        548 1 1 1 1  74 LYS QD   . 152 . HD#  1 1 
        548 1 2 1 1  75 GLU H    . 153 . HN   1 1 
        549 1 1 1 1  62 TYR H    . 140 . HN   1 1 
        549 1 2 1 1  62 TYR QE   . 140 . HE#  1 1 
        550 1 1 1 1  76 LEU MD2  . 154 . HD2# 1 1 
        550 1 2 1 1  77 GLU H    . 155 . HN   1 1 
        551 1 1 1 1  78 GLU H    . 156 . HN   1 1 
        551 1 2 1 1  81 MET H    . 159 . HN   1 1 
        552 1 1 1 1  77 GLU HA   . 155 . HA   1 1 
        552 1 2 1 1  81 MET H    . 159 . HN   1 1 
        553 1 1 1 1  39 ALA HA   . 117 . HA   1 1 
        553 1 2 1 1  43 SER H    . 121 . HN   1 1 
        554 1 1 1 1  69 ALA H    . 147 . HN   1 1 
        554 1 2 1 1  72 GLN HG3  . 150 . HG1  1 1 
        555 1 1 1 1  68 LEU HG   . 146 . HG   1 1 
        555 1 2 1 1  69 ALA H    . 147 . HN   1 1 
        556 1 1 1 1  68 LEU HB2  . 146 . HB2  1 1 
        556 1 2 1 1  69 ALA H    . 147 . HN   1 1 
        557 1 1 1 1  68 LEU MD1  . 146 . HD1# 1 1 
        557 1 2 1 1  69 ALA H    . 147 . HN   1 1 
        558 1 1 1 1  70 PRO HD2  . 148 . HD2  1 1 
        558 1 2 1 1  71 ASN H    . 149 . HN   1 1 
        559 1 1 1 1  49 GLU HB3  . 127 . HB1  1 1 
        559 1 2 1 1  50 LEU H    . 128 . HN   1 1 
        560 1 1 1 1  46 ILE MG   . 124 . HG2# 1 1 
        560 1 2 1 1  50 LEU H    . 128 . HN   1 1 
        561 1 1 1 1  56 GLU H    . 134 . HN   1 1 
        561 1 2 1 1  57 LEU HA   . 135 . HA   1 1 
        562 1 1 1 1  56 GLU H    . 134 . HN   1 1 
        562 1 2 1 1  57 LEU HB2  . 135 . HB2  1 1 
        563 1 1 1 1  56 GLU H    . 134 . HN   1 1 
        563 1 2 1 1  57 LEU MD1  . 135 . HD1# 1 1 
        564 1 1 1 1  49 GLU H    . 127 . HN   1 1 
        564 1 2 1 1  50 LEU HB2  . 128 . HB2  1 1 
        565 1 1 1 1  73 THR H    . 151 . HN   1 1 
        565 1 2 1 1  74 LYS H    . 152 . HN   1 1 
        566 1 1 1 1  73 THR H    . 151 . HN   1 1 
        566 1 2 1 1  76 LEU H    . 154 . HN   1 1 
        567 1 1 1 1  83 LEU H    . 161 . HN   1 1 
        567 1 2 1 1  86 SER H    . 164 . HN   1 1 
        568 1 1 1 1  63 VAL MG1  . 141 . HG1# 1 1 
        568 1 2 1 1  64 SER H    . 142 . HN   1 1 
        569 1 1 1 1  45 THR HA   . 123 . HA   1 1 
        569 1 2 1 1  48 SER H    . 126 . HN   1 1 
        570 1 1 1 1  47 GLN H    . 125 . HN   1 1 
        570 1 2 1 1  51 GLY H    . 129 . HN   1 1 
        571 1 1 1 1  58 HIS HD2  . 136 . HD2  1 1 
        571 1 2 1 1  59 GLY H    . 137 . HN   1 1 
        572 1 1 1 1  58 HIS HB3  . 136 . HB1  1 1 
        572 1 2 1 1  59 GLY H    . 137 . HN   1 1 
        573 1 1 1 1  38 LEU HA   . 116 . HA   1 1 
        573 1 2 1 1  42 GLY H    . 120 . HN   1 1 
        574 1 1 1 1  41 LEU HB2  . 119 . HB2  1 1 
        574 1 2 1 1  42 GLY H    . 120 . HN   1 1 
        575 1 1 1 1  41 LEU MD1  . 119 . HD1# 1 1 
        575 1 2 1 1  42 GLY H    . 120 . HN   1 1 
        576 1 1 1 1  33 CYS H    . 111 . HN   1 1 
        576 1 2 1 1  34 SER H    . 112 . HN   1 1 
        577 1 1 1 1  33 CYS H    . 111 . HN   1 1 
        577 1 2 1 1  34 SER HA   . 112 . HA   1 1 
        578 1 1 1 1  47 GLN HE21 . 125 . HE21 1 1 
        578 1 2 1 1  52 ASP HA   . 130 . HA   1 1 
        579 1 1 1 1  47 GLN HA   . 125 . HA   1 1 
        579 1 2 1 1  51 GLY H    . 129 . HN   1 1 
        580 1 1 1 1  34 SER HB3  . 112 . HB1  1 1 
        580 1 2 1 1  35 PHE H    . 113 . HN   1 1 
        581 1 1 1 1  16 TYR H    .  94 . HN   1 1 
        581 1 2 1 1  16 TYR HB3  .  94 . HB1  1 1 
        582 1 1 1 1  16 TYR H    .  94 . HN   1 1 
        582 1 2 1 1  16 TYR HB2  .  94 . HB2  1 1 
        583 1 1 1 1  81 MET H    . 159 . HN   1 1 
        583 1 2 1 1  81 MET HB2  . 159 . HB2  1 1 
        584 1 1 1 1  57 LEU H    . 135 . HN   1 1 
        584 1 2 1 1  57 LEU MD2  . 135 . HD2# 1 1 
        585 1 1 1 1  38 LEU H    . 116 . HN   1 1 
        585 1 2 1 1  38 LEU HB3  . 116 . HB1  1 1 
        586 1 1 1 1 100 LEU H    . 178 . HN   1 1 
        586 1 2 1 1 100 LEU MD2  . 178 . HD2# 1 1 
        587 1 1 1 1  44 TYR H    . 122 . HN   1 1 
        587 1 2 1 1  44 TYR QE   . 122 . HE#  1 1 
        588 1 1 1 1  44 TYR H    . 122 . HN   1 1 
        588 1 2 1 1  87 TYR QE   . 165 . HE#  1 1 
        589 1 1 1 1  47 GLN HE22 . 125 . HE22 1 1 
        589 1 2 1 1  52 ASP HA   . 130 . HA   1 1 
        590 1 1 1 1   5 ASP H    .  83 . HN   1 1 
        590 1 2 1 1   6 PRO HD3  .  84 . HD1  1 1 
        591 1 1 1 1  10 THR H    .  88 . HN   1 1 
        591 1 2 1 1  11 GLU H    .  89 . HN   1 1 
        592 1 1 1 1  10 THR H    .  88 . HN   1 1 
        592 1 2 1 1  13 ILE HB   .  91 . HB   1 1 
        593 1 1 1 1  11 GLU H    .  89 . HN   1 1 
        593 1 2 1 1  11 GLU QG   .  89 . HG#  1 1 
        594 1 1 1 1  18 LEU HG   .  96 . HG   1 1 
        594 1 2 1 1  22 LEU H    . 100 . HN   1 1 
        595 1 1 1 1  10 THR HA   .  88 . HA   1 1 
        595 1 2 1 1  13 ILE H    .  91 . HN   1 1 
        596 1 1 1 1  27 VAL H    . 105 . HN   1 1 
        596 1 2 1 1  28 ALA MB   . 106 . HB#  1 1 
        597 1 1 1 1  19 CYS H    .  97 . HN   1 1 
        597 1 2 1 1  21 GLN H    .  99 . HN   1 1 
        598 1 1 1 1  71 ASN H    . 149 . HN   1 1 
        598 1 2 1 1  72 GLN HA   . 150 . HA   1 1 
        599 1 1 1 1 103 ALA MB   . 181 . HB#  1 1 
        599 1 2 1 1 108 MET H    . 186 . HN   1 1 
        600 1 1 1 1  38 LEU MD1  . 116 . HD1# 1 1 
        600 1 2 1 1  71 ASN H    . 149 . HN   1 1 
        601 1 1 1 1  61 ASP HA   . 139 . HA   1 1 
        601 1 2 1 1  63 VAL H    . 141 . HN   1 1 
        602 1 1 1 1  23 ARG H    . 101 . HN   1 1 
        602 1 2 1 1  25 ASP H    . 103 . HN   1 1 
        603 1 1 1 1  37 THR H    . 115 . HN   1 1 
        603 1 2 1 1  39 ALA MB   . 117 . HB#  1 1 
        604 1 1 1 1  29 GLY H    . 107 . HN   1 1 
        604 1 2 1 1  70 PRO HG2  . 148 . HG2  1 1 
        605 1 1 1 1  26 ILE MG   . 104 . HG2# 1 1 
        605 1 2 1 1  29 GLY H    . 107 . HN   1 1 
        606 1 1 1 1  27 VAL MG2  . 105 . HG2# 1 1 
        606 1 2 1 1  29 GLY H    . 107 . HN   1 1 
        607 1 1 1 1  25 ASP HA   . 103 . HA   1 1 
        607 1 2 1 1  30 ARG H    . 108 . HN   1 1 
        608 1 1 1 1  76 LEU MD1  . 154 . HD1# 1 1 
        608 1 2 1 1  80 VAL H    . 158 . HN   1 1 
        609 1 1 1 1  34 SER H    . 112 . HN   1 1 
        609 1 2 1 1  37 THR MG   . 115 . HG2# 1 1 
        610 1 1 1 1  76 LEU MD1  . 154 . HD1# 1 1 
        610 1 2 1 1  77 GLU H    . 155 . HN   1 1 
        611 1 1 1 1  74 LYS QG   . 152 . HG#  1 1 
        611 1 2 1 1  77 GLU H    . 155 . HN   1 1 
        612 1 1 1 1  79 LYS H    . 157 . HN   1 1 
        612 1 2 1 1  81 MET H    . 159 . HN   1 1 
        613 1 1 1 1  34 SER HA   . 112 . HA   1 1 
        613 1 2 1 1  36 ALA H    . 114 . HN   1 1 
        614 1 1 1 1  37 THR MG   . 115 . HG2# 1 1 
        614 1 2 1 1  39 ALA H    . 117 . HN   1 1 
        615 1 1 1 1  57 LEU HG   . 135 . HG   1 1 
        615 1 2 1 1  58 HIS H    . 136 . HN   1 1 
        616 1 1 1 1  36 ALA H    . 114 . HN   1 1 
        616 1 2 1 1  39 ALA H    . 117 . HN   1 1 
        617 1 1 1 1  93 ALA H    . 171 . HN   1 1 
        617 1 2 1 1  95 ALA MB   . 173 . HB#  1 1 
        618 1 1 1 1  48 SER HA   . 126 . HA   1 1 
        618 1 2 1 1  50 LEU H    . 128 . HN   1 1 
        619 1 1 1 1  46 ILE HA   . 124 . HA   1 1 
        619 1 2 1 1  50 LEU H    . 128 . HN   1 1 
        620 1 1 1 1  50 LEU MD1  . 128 . HD1# 1 1 
        620 1 2 1 1  51 GLY H    . 129 . HN   1 1 
        621 1 1 1 1  66 PHE H    . 144 . HN   1 1 
        621 1 2 1 1  67 LYS H    . 145 . HN   1 1 
        622 1 1 1 1  58 HIS HB2  . 136 . HB2  1 1 
        622 1 2 1 1  59 GLY H    . 137 . HN   1 1 
        623 1 1 1 1  61 ASP H    . 139 . HN   1 1 
        623 1 2 1 1  62 TYR HA   . 140 . HA   1 1 
        624 1 1 1 1  62 TYR H    . 140 . HN   1 1 
        624 1 2 1 1  63 VAL MG2  . 141 . HG2# 1 1 
        625 1 1 1 1  60 VAL HA   . 138 . HA   1 1 
        625 1 2 1 1  62 TYR H    . 140 . HN   1 1 
        626 1 1 1 1  61 ASP HA   . 139 . HA   1 1 
        626 1 2 1 1  64 SER H    . 142 . HN   1 1 
        627 1 1 1 1  72 GLN HB3  . 150 . HB1  1 1 
        627 1 2 1 1  73 THR H    . 151 . HN   1 1 
        628 1 1 1 1  34 SER H    . 112 . HN   1 1 
        628 1 2 1 1  38 LEU MD2  . 116 . HD2# 1 1 
        629 1 1 1 1  73 THR HB   . 151 . HB   1 1 
        629 1 2 1 1  76 LEU H    . 154 . HN   1 1 
        630 1 1 1 1  72 GLN HG2  . 150 . HG2  1 1 
        630 1 2 1 1  76 LEU H    . 154 . HN   1 1 
        631 1 1 1 1  71 ASN HB2  . 149 . HB2  1 1 
        631 1 2 1 1  72 GLN H    . 150 . HN   1 1 
        632 1 1 1 1  69 ALA MB   . 147 . HB#  1 1 
        632 1 2 1 1  72 GLN H    . 150 . HN   1 1 
        633 1 1 1 1  93 ALA MB   . 171 . HB#  1 1 
        633 1 2 1 1  97 LEU H    . 175 . HN   1 1 
        634 1 1 1 1  83 LEU H    . 161 . HN   1 1 
        634 1 2 1 1  83 LEU MD1  . 161 . HD1# 1 1 
        635 1 1 1 1  57 LEU H    . 135 . HN   1 1 
        635 1 2 1 1  58 HIS H    . 136 . HN   1 1 
        636 1 1 1 1  74 LYS HB3  . 152 . HB1  1 1 
        636 1 2 1 1  75 GLU H    . 153 . HN   1 1 
        637 1 1 1 1  43 SER H    . 121 . HN   1 1 
        637 1 2 1 1  43 SER HB2  . 121 . HB2  1 1 
        638 1 1 1 1  50 LEU H    . 128 . HN   1 1 
        638 1 2 1 1  50 LEU HG   . 128 . HG   1 1 
        639 1 1 1 1  50 LEU H    . 128 . HN   1 1 
        639 1 2 1 1  50 LEU HB3  . 128 . HB1  1 1 
        640 1 1 1 1  20 LEU H    .  98 . HN   1 1 
        640 1 2 1 1  20 LEU MD1  .  98 . HD1# 1 1 
        641 1 1 1 1  20 LEU H    .  98 . HN   1 1 
        641 1 2 1 1  20 LEU MD2  .  98 . HD2# 1 1 
        642 1 1 1 1  49 GLU H    . 127 . HN   1 1 
        642 1 2 1 1  49 GLU HG3  . 127 . HG1  1 1 
        643 1 1 1 1  91 THR HA   . 169 . HA   1 1 
        643 1 2 1 1  93 ALA H    . 171 . HN   1 1 
        644 1 1 1 1   4 MET ME   .  82 . HE#  1 1 
        644 1 2 1 1   5 ASP H    .  83 . HN   1 1 
        645 1 1 1 1  13 ILE H    .  91 . HN   1 1 
        645 1 2 1 1  13 ILE HG12 .  91 . HG12 1 1 
        646 1 1 1 1  19 CYS H    .  97 . HN   1 1 
        646 1 2 1 1 100 LEU MD1  . 178 . HD1# 1 1 
        647 1 1 1 1  19 CYS H    .  97 . HN   1 1 
        647 1 2 1 1 100 LEU MD2  . 178 . HD2# 1 1 
        648 1 1 1 1  17 TYR H    .  95 . HN   1 1 
        648 1 2 1 1  20 LEU HG   .  98 . HG   1 1 
        649 1 1 1 1  19 CYS H    .  97 . HN   1 1 
        649 1 2 1 1  20 LEU HG   .  98 . HG   1 1 
        650 1 1 1 1 101 GLU HB3  . 179 . HB1  1 1 
        650 1 2 1 1 102 ASN H    . 180 . HN   1 1 
        651 1 1 1 1  50 LEU HG   . 128 . HG   1 1 
        651 1 2 1 1  51 GLY H    . 129 . HN   1 1 
        652 1 1 1 1  64 SER HB2  . 142 . HB2  1 1 
        652 1 2 1 1  65 ASP H    . 143 . HN   1 1 
        653 1 1 1 1  40 LEU HA   . 118 . HA   1 1 
        653 1 2 1 1  44 TYR H    . 122 . HN   1 1 
        654 1 1 1 1  88 ARG H    . 166 . HN   1 1 
        654 1 2 1 1  88 ARG QG   . 166 . HG#  1 1 
        655 1 1 1 1  90 MET H    . 168 . HN   1 1 
        655 1 2 1 1  90 MET HG3  . 168 . HG1  1 1 
        656 1 1 1 1  14 THR HA   .  92 . HA   1 1 
        656 1 2 1 1  18 LEU H    .  96 . HN   1 1 
        657 1 1 1 1  81 MET H    . 159 . HN   1 1 
        657 1 2 1 1  81 MET HB3  . 159 . HB1  1 1 
        658 1 1 1 1  23 ARG H    . 101 . HN   1 1 
        658 1 2 1 1  23 ARG HB3  . 101 . HB1  1 1 
        659 1 1 1 1  23 ARG H    . 101 . HN   1 1 
        659 1 2 1 1  23 ARG HB2  . 101 . HB2  1 1 
        660 1 1 1 1  41 LEU HB3  . 119 . HB1  1 1 
        660 1 2 1 1  42 GLY H    . 120 . HN   1 1 
        661 1 1 1 1  75 GLU HA   . 153 . HA   1 1 
        661 1 2 1 1  79 LYS H    . 157 . HN   1 1 
        662 1 1 1 1  76 LEU HA   . 154 . HA   1 1 
        662 1 2 1 1  79 LYS H    . 157 . HN   1 1 
        663 1 1 1 1  90 MET ME   . 168 . HE#  1 1 
        663 1 2 1 1  90 MET HG3  . 168 . HG1  1 1 
        664 1 1 1 1  90 MET ME   . 168 . HE#  1 1 
        664 1 2 1 1  90 MET HG2  . 168 . HG2  1 1 
        665 1 1 1 1  90 MET HB2  . 168 . HB2  1 1 
        665 1 2 1 1  90 MET ME   . 168 . HE#  1 1 
        666 1 1 1 1  47 GLN QB   . 125 . HB#  1 1 
        666 1 2 1 1  90 MET ME   . 168 . HE#  1 1 
        667 1 1 1 1  60 VAL MG1  . 138 . HG1# 1 1 
        667 1 2 1 1  81 MET ME   . 159 . HE#  1 1 
        668 1 1 1 1  60 VAL MG2  . 138 . HG2# 1 1 
        668 1 2 1 1  81 MET ME   . 159 . HE#  1 1 
        669 1 1 1 1  81 MET H    . 159 . HN   1 1 
        669 1 2 1 1  81 MET ME   . 159 . HE#  1 1 
        670 1 1 1 1  26 ILE MD   . 104 . HD1# 1 1 
        670 1 2 1 1 108 MET ME   . 186 . HE#  1 1 
        671 1 1 1 1 103 ALA MB   . 181 . HB#  1 1 
        671 1 2 1 1 108 MET ME   . 186 . HE#  1 1 
        672 1 1 1 1 103 ALA HA   . 181 . HA   1 1 
        672 1 2 1 1 108 MET ME   . 186 . HE#  1 1 
        673 1 1 1 1  44 TYR QE   . 122 . HE#  1 1 
        673 1 2 1 1 102 ASN HD22 . 180 . HD22 1 1 
        674 1 1 1 1  44 TYR QE   . 122 . HE#  1 1 
        674 1 2 1 1 102 ASN HD21 . 180 . HD21 1 1 
        675 1 1 1 1 104 LYS H    . 182 . HN   1 1 
        675 1 2 1 1 109 TYR QE   . 187 . HE#  1 1 
        676 1 1 1 1 100 LEU HA   . 178 . HA   1 1 
        676 1 2 1 1 109 TYR QE   . 187 . HE#  1 1 
        677 1 1 1 1  53 TYR QE   . 131 . HE#  1 1 
        677 1 2 1 1  55 PRO HB2  . 133 . HB2  1 1 
        678 1 1 1 1  17 TYR QE   .  95 . HE#  1 1 
        678 1 2 1 1  20 LEU MD1  .  98 . HD1# 1 1 
        679 1 1 1 1  83 LEU MD1  . 161 . HD1# 1 1 
        679 1 2 1 1  87 TYR QE   . 165 . HE#  1 1 
        680 1 1 1 1  44 TYR QD   . 122 . HD#  1 1 
        680 1 2 1 1  90 MET ME   . 168 . HE#  1 1 
        681 1 1 1 1  22 LEU MD2  . 100 . HD2# 1 1 
        681 1 2 1 1 109 TYR QD   . 187 . HD#  1 1 
        682 1 1 1 1  18 LEU MD1  .  96 . HD1# 1 1 
        682 1 2 1 1 109 TYR QD   . 187 . HD#  1 1 
        683 1 1 1 1  22 LEU MD1  . 100 . HD1# 1 1 
        683 1 2 1 1 109 TYR QD   . 187 . HD#  1 1 
        684 1 1 1 1  18 LEU MD2  .  96 . HD2# 1 1 
        684 1 2 1 1 109 TYR QD   . 187 . HD#  1 1 
        685 1 1 1 1 103 ALA MB   . 181 . HB#  1 1 
        685 1 2 1 1 109 TYR QD   . 187 . HD#  1 1 
        686 1 1 1 1  16 TYR QD   .  94 . HD#  1 1 
        686 1 2 1 1  17 TYR QE   .  95 . HE#  1 1 
        687 1 1 1 1  35 PHE H    . 113 . HN   1 1 
        687 1 2 1 1  35 PHE QD   . 113 . HD#  1 1 
        688 1 1 1 1  17 TYR QD   .  95 . HD#  1 1 
        688 1 2 1 1  18 LEU H    .  96 . HN   1 1 
        689 1 1 1 1  35 PHE QD   . 113 . HD#  1 1 
        689 1 2 1 1  76 LEU H    . 154 . HN   1 1 
        690 1 1 1 1  17 TYR QD   .  95 . HD#  1 1 
        690 1 2 1 1  20 LEU MD1  .  98 . HD1# 1 1 
        691 1 1 1 1  44 TYR QD   . 122 . HD#  1 1 
        691 1 2 1 1  99 PHE HA   . 177 . HA   1 1 
        692 1 1 1 1  65 ASP H    . 143 . HN   1 1 
        692 1 2 1 1  66 PHE QD   . 144 . HD#  1 1 
        693 1 1 1 1  46 ILE MD   . 124 . HD1# 1 1 
        693 1 2 1 1  49 GLU HB2  . 127 . HB2  1 1 
        694 1 1 1 1  46 ILE MD   . 124 . HD1# 1 1 
        694 1 2 1 1  66 PHE HB2  . 144 . HB2  1 1 
        695 1 1 1 1  46 ILE H    . 124 . HN   1 1 
        695 1 2 1 1  46 ILE MD   . 124 . HD1# 1 1 
        696 1 1 1 1  13 ILE H    .  91 . HN   1 1 
        696 1 2 1 1  13 ILE MD   .  91 . HD1# 1 1 
        697 1 1 1 1  23 ARG H    . 101 . HN   1 1 
        697 1 2 1 1  26 ILE MD   . 104 . HD1# 1 1 
        698 1 1 1 1  46 ILE MG   . 124 . HG2# 1 1 
        698 1 2 1 1  50 LEU MD2  . 128 . HD2# 1 1 
        699 1 1 1 1  46 ILE MG   . 124 . HG2# 1 1 
        699 1 2 1 1  68 LEU MD2  . 146 . HD2# 1 1 
        700 1 1 1 1  46 ILE MG   . 124 . HG2# 1 1 
        700 1 2 1 1  80 VAL MG1  . 158 . HG1# 1 1 
        701 1 1 1 1  93 ALA MB   . 171 . HB#  1 1 
        701 1 2 1 1  94 GLN H    . 172 . HN   1 1 
        702 1 1 1 1  99 PHE QE   . 177 . HE#  1 1 
        702 1 2 1 1 103 ALA MB   . 181 . HB#  1 1 
        703 1 1 1 1  35 PHE HA   . 113 . HA   1 1 
        703 1 2 1 1  36 ALA MB   . 114 . HB#  1 1 
        704 1 1 1 1  22 LEU MD2  . 100 . HD2# 1 1 
        704 1 2 1 1 103 ALA MB   . 181 . HB#  1 1 
        705 1 1 1 1  39 ALA MB   . 117 . HB#  1 1 
        705 1 2 1 1  79 LYS HG2  . 157 . HG2  1 1 
        706 1 1 1 1  13 ILE HG12 .  91 . HG12 1 1 
        706 1 2 1 1  13 ILE MG   .  91 . HG2# 1 1 
        707 1 1 1 1  39 ALA MB   . 117 . HB#  1 1 
        707 1 2 1 1  79 LYS HG3  . 157 . HG1  1 1 
        708 1 1 1 1  47 GLN QB   . 125 . HB#  1 1 
        708 1 2 1 1  95 ALA MB   . 173 . HB#  1 1 
        709 1 1 1 1  22 LEU HG   . 100 . HG   1 1 
        709 1 2 1 1 103 ALA MB   . 181 . HB#  1 1 
        710 1 1 1 1 103 ALA MB   . 181 . HB#  1 1 
        710 1 2 1 1 106 LEU QB   . 184 . HB#  1 1 
        711 1 1 1 1  28 ALA H    . 106 . HN   1 1 
        711 1 2 1 1  28 ALA MB   . 106 . HB#  1 1 
        712 1 1 1 1  60 VAL H    . 138 . HN   1 1 
        712 1 2 1 1  60 VAL MG1  . 138 . HG1# 1 1 
        713 1 1 1 1  60 VAL H    . 138 . HN   1 1 
        713 1 2 1 1  60 VAL MG2  . 138 . HG2# 1 1 
        714 1 1 1 1  27 VAL MG2  . 105 . HG2# 1 1 
        714 1 2 1 1  28 ALA MB   . 106 . HB#  1 1 
        715 1 1 1 1  63 VAL MG2  . 141 . HG2# 1 1 
        715 1 2 1 1  80 VAL HB   . 158 . HB   1 1 
        716 1 1 1 1  63 VAL H    . 141 . HN   1 1 
        716 1 2 1 1  63 VAL MG2  . 141 . HG2# 1 1 
        717 1 1 1 1  43 SER H    . 121 . HN   1 1 
        717 1 2 1 1  80 VAL MG1  . 158 . HG1# 1 1 
        718 1 1 1 1  80 VAL MG1  . 158 . HG1# 1 1 
        718 1 2 1 1  81 MET HA   . 159 . HA   1 1 
        719 1 1 1 1  41 LEU MD2  . 119 . HD2# 1 1 
        719 1 2 1 1 102 ASN HB2  . 180 . HB2  1 1 
        720 1 1 1 1 106 LEU QB   . 184 . HB#  1 1 
        720 1 2 1 1 106 LEU MD2  . 184 . HD2# 1 1 
        721 1 1 1 1  46 ILE HG12 . 124 . HG12 1 1 
        721 1 2 1 1  80 VAL MG1  . 158 . HG1# 1 1 
        722 1 1 1 1  38 LEU MD1  . 116 . HD1# 1 1 
        722 1 2 1 1  76 LEU MD1  . 154 . HD1# 1 1 
        723 1 1 1 1  63 VAL MG2  . 141 . HG2# 1 1 
        723 1 2 1 1  68 LEU MD2  . 146 . HD2# 1 1 
        724 1 1 1 1  46 ILE HG13 . 124 . HG11 1 1 
        724 1 2 1 1  80 VAL MG1  . 158 . HG1# 1 1 
        725 1 1 1 1  68 LEU MD1  . 146 . HD1# 1 1 
        725 1 2 1 1  80 VAL MG1  . 158 . HG1# 1 1 
        726 1 1 1 1  69 ALA MB   . 147 . HB#  1 1 
        726 1 2 1 1  76 LEU MD1  . 154 . HD1# 1 1 
        727 1 1 1 1  63 VAL MG1  . 141 . HG1# 1 1 
        727 1 2 1 1  80 VAL MG2  . 158 . HG2# 1 1 
        728 1 1 1 1  41 LEU MD2  . 119 . HD2# 1 1 
        728 1 2 1 1 102 ASN HB3  . 180 . HB1  1 1 
        729 1 1 1 1  97 LEU HB2  . 175 . HB2  1 1 
        729 1 2 1 1  97 LEU MD2  . 175 . HD2# 1 1 
        730 1 1 1 1  97 LEU HB3  . 175 . HB1  1 1 
        730 1 2 1 1  97 LEU MD2  . 175 . HD2# 1 1 
        731 1 1 1 1  69 ALA MB   . 147 . HB#  1 1 
        731 1 2 1 1  70 PRO HG3  . 148 . HG1  1 1 
        732 1 1 1 1 100 LEU HA   . 178 . HA   1 1 
        732 1 2 1 1 100 LEU MD2  . 178 . HD2# 1 1 
        733 1 1 1 1  24 GLN HA   . 102 . HA   1 1 
        733 1 2 1 1  27 VAL MG2  . 105 . HG2# 1 1 
        734 1 1 1 1  27 VAL H    . 105 . HN   1 1 
        734 1 2 1 1  27 VAL MG2  . 105 . HG2# 1 1 
        735 1 1 1 1  38 LEU H    . 116 . HN   1 1 
        735 1 2 1 1  76 LEU MD1  . 154 . HD1# 1 1 
        736 1 1 1 1  38 LEU H    . 116 . HN   1 1 
        736 1 2 1 1  38 LEU MD1  . 116 . HD1# 1 1 
        737 1 1 1 1  26 ILE H    . 104 . HN   1 1 
        737 1 2 1 1  27 VAL MG2  . 105 . HG2# 1 1 
        738 1 1 1 1  18 LEU HA   .  96 . HA   1 1 
        738 1 2 1 1  18 LEU MD2  .  96 . HD2# 1 1 
        739 1 1 1 1 105 LYS HA   . 183 . HA   1 1 
        739 1 2 1 1 105 LYS HG3  . 183 . HG1  1 1 
        740 1 1 1 1  37 THR MG   . 115 . HG2# 1 1 
        740 1 2 1 1 108 MET ME   . 186 . HE#  1 1 
        741 1 1 1 1  37 THR MG   . 115 . HG2# 1 1 
        741 1 2 1 1  41 LEU HG   . 119 . HG   1 1 
        742 1 1 1 1  26 ILE MD   . 104 . HD1# 1 1 
        742 1 2 1 1  41 LEU MD1  . 119 . HD1# 1 1 
        743 1 1 1 1  68 LEU MD1  . 146 . HD1# 1 1 
        743 1 2 1 1  80 VAL MG2  . 158 . HG2# 1 1 
        744 1 1 1 1  38 LEU MD2  . 116 . HD2# 1 1 
        744 1 2 1 1  76 LEU MD2  . 154 . HD2# 1 1 
        745 1 1 1 1  14 THR MG   .  92 . HG2# 1 1 
        745 1 2 1 1  18 LEU MD2  .  96 . HD2# 1 1 
        746 1 1 1 1  40 LEU HA   . 118 . HA   1 1 
        746 1 2 1 1  83 LEU MD1  . 161 . HD1# 1 1 
        747 1 1 1 1 106 LEU QB   . 184 . HB#  1 1 
        747 1 2 1 1 106 LEU MD1  . 184 . HD1# 1 1 
        748 1 1 1 1 100 LEU HB3  . 178 . HB1  1 1 
        748 1 2 1 1 100 LEU MD1  . 178 . HD1# 1 1 
        749 1 1 1 1  25 ASP HB3  . 103 . HB1  1 1 
        749 1 2 1 1  31 LEU MD1  . 109 . HD1# 1 1 
        750 1 1 1 1  31 LEU MD1  . 109 . HD1# 1 1 
        750 1 2 1 1 108 MET ME   . 186 . HE#  1 1 
        751 1 1 1 1  31 LEU MD1  . 109 . HD1# 1 1 
        751 1 2 1 1  32 PRO QD   . 110 . HD#  1 1 
        752 1 1 1 1  40 LEU H    . 118 . HN   1 1 
        752 1 2 1 1  40 LEU MD2  . 118 . HD2# 1 1 
        753 1 1 1 1  46 ILE MD   . 124 . HD1# 1 1 
        753 1 2 1 1  68 LEU MD1  . 146 . HD1# 1 1 
        754 1 1 1 1  97 LEU H    . 175 . HN   1 1 
        754 1 2 1 1  97 LEU HG   . 175 . HG   1 1 
        755 1 1 1 1  74 LYS HA   . 152 . HA   1 1 
        755 1 2 1 1  74 LYS QD   . 152 . HD#  1 1 
        756 1 1 1 1  79 LYS H    . 157 . HN   1 1 
        756 1 2 1 1  82 GLU QB   . 160 . HB#  1 1 
        757 1 1 1 1  15 ARG HB2  .  93 . HB2  1 1 
        757 1 2 1 1  16 TYR H    .  94 . HN   1 1 
        758 1 1 1 1  88 ARG QB   . 166 . HB#  1 1 
        758 1 2 1 1  88 ARG HE   . 166 . HE   1 1 
        759 1 1 1 1  27 VAL H    . 105 . HN   1 1 
        759 1 2 1 1  27 VAL HB   . 105 . HB   1 1 
        760 1 1 1 1 102 ASN HA   . 180 . HA   1 1 
        760 1 2 1 1 105 LYS QB   . 183 . HB#  1 1 
        761 1 1 1 1  21 GLN HA   .  99 . HA   1 1 
        761 1 2 1 1  21 GLN HG3  .  99 . HG1  1 1 
        762 1 1 1 1  21 GLN HA   .  99 . HA   1 1 
        762 1 2 1 1  21 GLN HG2  .  99 . HG2  1 1 
        763 1 1 1 1  21 GLN H    .  99 . HN   1 1 
        763 1 2 1 1  21 GLN HG3  .  99 . HG1  1 1 
        764 1 1 1 1  21 GLN H    .  99 . HN   1 1 
        764 1 2 1 1  21 GLN HG2  .  99 . HG2  1 1 
        765 1 1 1 1   7 ALA MB   .  85 . HB#  1 1 
        765 1 2 1 1   8 GLN QG   .  86 . HG#  1 1 
        766 1 1 1 1  94 GLN QG   . 172 . HG#  1 1 
        766 1 2 1 1  97 LEU MD2  . 175 . HD2# 1 1 
        767 1 1 1 1 101 GLU H    . 179 . HN   1 1 
        767 1 2 1 1 101 GLU QG   . 179 . HG#  1 1 
        768 1 1 1 1  77 GLU H    . 155 . HN   1 1 
        768 1 2 1 1  77 GLU HG2  . 155 . HG2  1 1 
        769 1 1 1 1  82 GLU H    . 160 . HN   1 1 
        769 1 2 1 1  82 GLU HG3  . 160 . HG1  1 1 
        770 1 1 1 1  66 PHE HB3  . 144 . HB1  1 1 
        770 1 2 1 1  68 LEU MD2  . 146 . HD2# 1 1 
        771 1 1 1 1  18 LEU HB2  .  96 . HB2  1 1 
        771 1 2 1 1  19 CYS H    .  97 . HN   1 1 
        772 1 1 1 1  38 LEU HB3  . 116 . HB1  1 1 
        772 1 2 1 1  39 ALA H    . 117 . HN   1 1 
        773 1 1 1 1 102 ASN HA   . 180 . HA   1 1 
        773 1 2 1 1 105 LYS QE   . 183 . HE#  1 1 
        774 1 1 1 1  15 ARG HD2  .  93 . HD2  1 1 
        774 1 2 1 1 100 LEU MD1  . 178 . HD1# 1 1 
        775 1 1 1 1  57 LEU HB2  . 135 . HB2  1 1 
        775 1 2 1 1  58 HIS H    . 136 . HN   1 1 
        776 1 1 1 1  54 ASP HA   . 132 . HA   1 1 
        776 1 2 1 1  55 PRO HD3  . 133 . HD1  1 1 
        777 1 1 1 1   6 PRO HD2  .  84 . HD2  1 1 
        777 1 2 1 1   7 ALA MB   .  85 . HB#  1 1 
        778 1 1 1 1  54 ASP HA   . 132 . HA   1 1 
        778 1 2 1 1  55 PRO HD2  . 133 . HD2  1 1 
        779 1 1 1 1   5 ASP HA   .  83 . HA   1 1 
        779 1 2 1 1   6 PRO HD2  .  84 . HD2  1 1 
        780 1 1 1 1 105 LYS QB   . 183 . HB#  1 1 
        780 1 2 1 1 106 LEU HA   . 184 . HA   1 1 
        781 1 1 1 1  93 ALA HA   . 171 . HA   1 1 
        781 1 2 1 1  96 ASP H    . 174 . HN   1 1 
        782 1 1 1 1 103 ALA HA   . 181 . HA   1 1 
        782 1 2 1 1 106 LEU MD2  . 184 . HD2# 1 1 
        783 1 1 1 1   4 MET HA   .  82 . HA   1 1 
        783 1 2 1 1   4 MET ME   .  82 . HE#  1 1 
        784 1 1 1 1  41 LEU MD2  . 119 . HD2# 1 1 
        784 1 2 1 1 103 ALA HA   . 181 . HA   1 1 
        785 1 1 1 1  12 ASP HA   .  90 . HA   1 1 
        785 1 2 1 1  16 TYR H    .  94 . HN   1 1 
        786 1 1 1 1  18 LEU HA   .  96 . HA   1 1 
        786 1 2 1 1  22 LEU H    . 100 . HN   1 1 
        787 1 1 1 1 108 MET HA   . 186 . HA   1 1 
        787 1 2 1 1 108 MET HG2  . 186 . HG2  1 1 
        788 1 1 1 1 108 MET HA   . 186 . HA   1 1 
        788 1 2 1 1 108 MET HG3  . 186 . HG1  1 1 
        789 1 1 1 1  79 LYS HA   . 157 . HA   1 1 
        789 1 2 1 1  82 GLU QB   . 160 . HB#  1 1 
        790 1 1 1 1  38 LEU HA   . 116 . HA   1 1 
        790 1 2 1 1  38 LEU MD2  . 116 . HD2# 1 1 
        791 1 1 1 1  94 GLN HA   . 172 . HA   1 1 
        791 1 2 1 1  97 LEU MD2  . 175 . HD2# 1 1 
        792 1 1 1 1  74 LYS HA   . 152 . HA   1 1 
        792 1 2 1 1  74 LYS QG   . 152 . HG#  1 1 
        793 1 1 1 1  20 LEU QB   .  98 . HB#  1 1 
        793 1 2 1 1  21 GLN HA   .  99 . HA   1 1 
        794 1 1 1 1  24 GLN HA   . 102 . HA   1 1 
        794 1 2 1 1  24 GLN HG2  . 102 . HG2  1 1 
        795 1 1 1 1  49 GLU HA   . 127 . HA   1 1 
        795 1 2 1 1  49 GLU HG3  . 127 . HG1  1 1 
        796 1 1 1 1  94 GLN HA   . 172 . HA   1 1 
        796 1 2 1 1  97 LEU HB3  . 175 . HB1  1 1 
        797 1 1 1 1  24 GLN HA   . 102 . HA   1 1 
        797 1 2 1 1  26 ILE H    . 104 . HN   1 1 
        798 1 1 1 1  97 LEU HA   . 175 . HA   1 1 
        798 1 2 1 1  99 PHE H    . 177 . HN   1 1 
        799 1 1 1 1  97 LEU HA   . 175 . HA   1 1 
        799 1 2 1 1 100 LEU H    . 178 . HN   1 1 
        800 1 1 1 1  47 GLN HA   . 125 . HA   1 1 
        800 1 2 1 1  49 GLU H    . 127 . HN   1 1 
        801 1 1 1 1  24 GLN HA   . 102 . HA   1 1 
        801 1 2 1 1  27 VAL H    . 105 . HN   1 1 
        802 1 1 1 1  21 GLN HA   .  99 . HA   1 1 
        802 1 2 1 1  24 GLN H    . 102 . HN   1 1 
        803 1 1 1 1  94 GLN HA   . 172 . HA   1 1 
        803 1 2 1 1  97 LEU H    . 175 . HN   1 1 
        804 1 1 1 1  84 HIS HA   . 162 . HA   1 1 
        804 1 2 1 1  84 HIS HD2  . 162 . HD2  1 1 
        805 1 1 1 1  17 TYR HA   .  95 . HA   1 1 
        805 1 2 1 1  20 LEU QB   .  98 . HB#  1 1 
        806 1 1 1 1  17 TYR HA   .  95 . HA   1 1 
        806 1 2 1 1  20 LEU MD1  .  98 . HD1# 1 1 
        807 1 1 1 1  63 VAL HA   . 141 . HA   1 1 
        807 1 2 1 1  66 PHE QE   . 144 . HE#  1 1 
        808 1 1 1 1  10 THR HA   .  88 . HA   1 1 
        808 1 2 1 1  13 ILE HB   .  91 . HB   1 1 
        809 1 1 1 1  35 PHE HA   . 113 . HA   1 1 
        809 1 2 1 1  76 LEU MD1  . 154 . HD1# 1 1 
        810 1 1 1 1  27 VAL HA   . 105 . HA   1 1 
        810 1 2 1 1  70 PRO HD2  . 148 . HD2  1 1 
        811 1 1 1 1  26 ILE HA   . 104 . HA   1 1 
        811 1 2 1 1  31 LEU H    . 109 . HN   1 1 
        812 1 1 1 1  45 THR HB   . 123 . HB   1 1 
        812 1 2 1 1  46 ILE H    . 124 . HN   1 1 
        813 1 1 1 1  10 THR HB   .  88 . HB   1 1 
        813 1 2 1 1  12 ASP H    .  90 . HN   1 1 
        814 1 1 1 1  13 ILE MD   .  91 . HD1# 1 1 
        814 1 2 1 1  17 TYR QD   .  95 . HD#  1 1 
        815 1 1 1 1  13 ILE MD   .  91 . HD1# 1 1 
        815 1 2 1 1  17 TYR QE   .  95 . HE#  1 1 
        816 1 1 1 1  46 ILE MD   . 124 . HD1# 1 1 
        816 1 2 1 1  63 VAL HB   . 141 . HB   1 1 
        817 1 1 1 1  63 VAL MG1  . 141 . HG1# 1 1 
        817 1 2 1 1  68 LEU MD2  . 146 . HD2# 1 1 
        818 1 1 1 1  95 ALA HA   . 173 . HA   1 1 
        818 1 2 1 1  99 PHE H    . 177 . HN   1 1 
        819 1 1 1 1  47 GLN H    . 125 . HN   1 1 
        819 1 2 1 1  48 SER HA   . 126 . HA   1 1 
        820 1 1 1 1 101 GLU HA   . 179 . HA   1 1 
        820 1 2 1 1 102 ASN HB2  . 180 . HB2  1 1 
        821 1 1 1 1 108 MET HA   . 186 . HA   1 1 
        821 1 2 1 1 108 MET ME   . 186 . HE#  1 1 
        822 1 1 1 1  31 LEU HA   . 109 . HA   1 1 
        822 1 2 1 1  32 PRO QD   . 110 . HD#  1 1 
        823 1 1 1 1  31 LEU HA   . 109 . HA   1 1 
        823 1 2 1 1  31 LEU MD2  . 109 . HD2# 1 1 
        824 1 1 1 1  35 PHE QD   . 113 . HD#  1 1 
        824 1 2 1 1  76 LEU MD2  . 154 . HD2# 1 1 
        825 1 1 1 1  99 PHE QD   . 177 . HD#  1 1 
        825 1 2 1 1 103 ALA MB   . 181 . HB#  1 1 
        826 1 1 1 1 103 ALA MB   . 181 . HB#  1 1 
        826 1 2 1 1 106 LEU H    . 184 . HN   1 1 
        827 1 1 1 1  39 ALA MB   . 117 . HB#  1 1 
        827 1 2 1 1  83 LEU MD1  . 161 . HD1# 1 1 
        828 1 1 1 1 108 MET H    . 186 . HN   1 1 
        828 1 2 1 1 109 TYR QD   . 187 . HD#  1 1 
        829 1 1 1 1  46 ILE MD   . 124 . HD1# 1 1 
        829 1 2 1 1  80 VAL MG1  . 158 . HG1# 1 1 
        830 1 1 1 1  45 THR MG   . 123 . HG2# 1 1 
        830 1 2 1 1  46 ILE MD   . 124 . HD1# 1 1 
        831 1 1 1 1  46 ILE MD   . 124 . HD1# 1 1 
        831 1 2 1 1  68 LEU MD2  . 146 . HD2# 1 1 
        832 1 1 1 1  46 ILE MD   . 124 . HD1# 1 1 
        832 1 2 1 1  63 VAL MG1  . 141 . HG1# 1 1 
        833 1 1 1 1  46 ILE MD   . 124 . HD1# 1 1 
        833 1 2 1 1  63 VAL HA   . 141 . HA   1 1 
        834 1 1 1 1  46 ILE HA   . 124 . HA   1 1 
        834 1 2 1 1  46 ILE MD   . 124 . HD1# 1 1 
        835 1 1 1 1  46 ILE MD   . 124 . HD1# 1 1 
        835 1 2 1 1  66 PHE HB3  . 144 . HB1  1 1 
        836 1 1 1 1  13 ILE HA   .  91 . HA   1 1 
        836 1 2 1 1  13 ILE MD   .  91 . HD1# 1 1 
        837 1 1 1 1  26 ILE MD   . 104 . HD1# 1 1 
        837 1 2 1 1  41 LEU MD2  . 119 . HD2# 1 1 
        838 1 1 1 1  26 ILE HB   . 104 . HB   1 1 
        838 1 2 1 1  26 ILE MD   . 104 . HD1# 1 1 
        839 1 1 1 1  23 ARG HA   . 101 . HA   1 1 
        839 1 2 1 1  26 ILE MD   . 104 . HD1# 1 1 
        840 1 1 1 1  26 ILE HA   . 104 . HA   1 1 
        840 1 2 1 1  26 ILE MD   . 104 . HD1# 1 1 
        841 1 1 1 1  46 ILE MG   . 124 . HG2# 1 1 
        841 1 2 1 1  50 LEU HG   . 128 . HG   1 1 
        842 1 1 1 1  45 THR MG   . 123 . HG2# 1 1 
        842 1 2 1 1  46 ILE MG   . 124 . HG2# 1 1 
        843 1 1 1 1  46 ILE MG   . 124 . HG2# 1 1 
        843 1 2 1 1  80 VAL MG2  . 158 . HG2# 1 1 
        844 1 1 1 1  46 ILE HA   . 124 . HA   1 1 
        844 1 2 1 1  46 ILE MG   . 124 . HG2# 1 1 
        845 1 1 1 1  39 ALA MB   . 117 . HB#  1 1 
        845 1 2 1 1  76 LEU MD1  . 154 . HD1# 1 1 
        846 1 1 1 1  39 ALA MB   . 117 . HB#  1 1 
        846 1 2 1 1  83 LEU HG   . 161 . HG   1 1 
        847 1 1 1 1  13 ILE HA   .  91 . HA   1 1 
        847 1 2 1 1  13 ILE MG   .  91 . HG2# 1 1 
        848 1 1 1 1  36 ALA HA   . 114 . HA   1 1 
        848 1 2 1 1  39 ALA MB   . 117 . HB#  1 1 
        849 1 1 1 1  35 PHE QD   . 113 . HD#  1 1 
        849 1 2 1 1  39 ALA MB   . 117 . HB#  1 1 
        850 1 1 1 1  35 PHE HZ   . 113 . HZ   1 1 
        850 1 2 1 1  39 ALA MB   . 117 . HB#  1 1 
        851 1 1 1 1  39 ALA MB   . 117 . HB#  1 1 
        851 1 2 1 1  43 SER H    . 121 . HN   1 1 
        852 1 1 1 1  22 LEU MD1  . 100 . HD1# 1 1 
        852 1 2 1 1 103 ALA MB   . 181 . HB#  1 1 
        853 1 1 1 1  41 LEU MD1  . 119 . HD1# 1 1 
        853 1 2 1 1 103 ALA MB   . 181 . HB#  1 1 
        854 1 1 1 1  31 LEU HB2  . 109 . HB2  1 1 
        854 1 2 1 1 108 MET ME   . 186 . HE#  1 1 
        855 1 1 1 1  31 LEU HB3  . 109 . HB1  1 1 
        855 1 2 1 1 108 MET ME   . 186 . HE#  1 1 
        856 1 1 1 1  41 LEU MD1  . 119 . HD1# 1 1 
        856 1 2 1 1 108 MET ME   . 186 . HE#  1 1 
        857 1 1 1 1  41 LEU MD2  . 119 . HD2# 1 1 
        857 1 2 1 1 108 MET ME   . 186 . HE#  1 1 
        858 1 1 1 1  47 GLN QG   . 125 . HG#  1 1 
        858 1 2 1 1  95 ALA MB   . 173 . HB#  1 1 
        859 1 1 1 1  92 PRO QB   . 170 . HB#  1 1 
        859 1 2 1 1  95 ALA MB   . 173 . HB#  1 1 
        860 1 1 1 1 100 LEU HA   . 178 . HA   1 1 
        860 1 2 1 1 103 ALA MB   . 181 . HB#  1 1 
        861 1 1 1 1  48 SER QB   . 126 . HB#  1 1 
        861 1 2 1 1  95 ALA MB   . 173 . HB#  1 1 
        862 1 1 1 1  22 LEU HA   . 100 . HA   1 1 
        862 1 2 1 1 108 MET ME   . 186 . HE#  1 1 
        863 1 1 1 1  26 ILE HA   . 104 . HA   1 1 
        863 1 2 1 1 108 MET ME   . 186 . HE#  1 1 
        864 1 1 1 1  93 ALA MB   . 171 . HB#  1 1 
        864 1 2 1 1  97 LEU MD2  . 175 . HD2# 1 1 
        865 1 1 1 1 102 ASN HB3  . 180 . HB1  1 1 
        865 1 2 1 1 103 ALA MB   . 181 . HB#  1 1 
        866 1 1 1 1  13 ILE MD   .  91 . HD1# 1 1 
        866 1 2 1 1  13 ILE MG   .  91 . HG2# 1 1 
        867 1 1 1 1  25 ASP HA   . 103 . HA   1 1 
        867 1 2 1 1  28 ALA MB   . 106 . HB#  1 1 
        868 1 1 1 1  46 ILE MD   . 124 . HD1# 1 1 
        868 1 2 1 1  63 VAL MG2  . 141 . HG2# 1 1 
        869 1 1 1 1  80 VAL HA   . 158 . HA   1 1 
        869 1 2 1 1  80 VAL MG1  . 158 . HG1# 1 1 
        870 1 1 1 1  40 LEU HA   . 118 . HA   1 1 
        870 1 2 1 1  83 LEU MD2  . 161 . HD2# 1 1 
        871 1 1 1 1  83 LEU HA   . 161 . HA   1 1 
        871 1 2 1 1  83 LEU MD2  . 161 . HD2# 1 1 
        872 1 1 1 1  63 VAL MG2  . 141 . HG2# 1 1 
        872 1 2 1 1  81 MET HA   . 159 . HA   1 1 
        873 1 1 1 1  91 THR HA   . 169 . HA   1 1 
        873 1 2 1 1  91 THR MG   . 169 . HG2# 1 1 
        874 1 1 1 1  10 THR HA   .  88 . HA   1 1 
        874 1 2 1 1  10 THR MG   .  88 . HG2# 1 1 
        875 1 1 1 1  14 THR HA   .  92 . HA   1 1 
        875 1 2 1 1  14 THR MG   .  92 . HG2# 1 1 
        876 1 1 1 1  63 VAL MG2  . 141 . HG2# 1 1 
        876 1 2 1 1  80 VAL MG1  . 158 . HG1# 1 1 
        877 1 1 1 1  14 THR MG   .  92 . HG2# 1 1 
        877 1 2 1 1  18 LEU MD1  .  96 . HD1# 1 1 
        878 1 1 1 1  73 THR MG   . 151 . HG2# 1 1 
        878 1 2 1 1  76 LEU MD2  . 154 . HD2# 1 1 
        879 1 1 1 1  41 LEU HA   . 119 . HA   1 1 
        879 1 2 1 1  41 LEU MD2  . 119 . HD2# 1 1 
        880 1 1 1 1  41 LEU MD2  . 119 . HD2# 1 1 
        880 1 2 1 1  99 PHE HA   . 177 . HA   1 1 
        881 1 1 1 1  69 ALA MB   . 147 . HB#  1 1 
        881 1 2 1 1  72 GLN HA   . 150 . HA   1 1 
        882 1 1 1 1  69 ALA MB   . 147 . HB#  1 1 
        882 1 2 1 1  70 PRO HD2  . 148 . HD2  1 1 
        883 1 1 1 1  69 ALA MB   . 147 . HB#  1 1 
        883 1 2 1 1  70 PRO HD3  . 148 . HD1  1 1 
        884 1 1 1 1 106 LEU HA   . 184 . HA   1 1 
        884 1 2 1 1 106 LEU MD2  . 184 . HD2# 1 1 
        885 1 1 1 1  69 ALA MB   . 147 . HB#  1 1 
        885 1 2 1 1  76 LEU MD2  . 154 . HD2# 1 1 
        886 1 1 1 1 100 LEU MD2  . 178 . HD2# 1 1 
        886 1 2 1 1 103 ALA MB   . 181 . HB#  1 1 
        887 1 1 1 1  13 ILE MG   .  91 . HG2# 1 1 
        887 1 2 1 1  14 THR MG   .  92 . HG2# 1 1 
        888 1 1 1 1  38 LEU MD2  . 116 . HD2# 1 1 
        888 1 2 1 1  69 ALA MB   . 147 . HB#  1 1 
        889 1 1 1 1  38 LEU MD1  . 116 . HD1# 1 1 
        889 1 2 1 1  69 ALA MB   . 147 . HB#  1 1 
        890 1 1 1 1  18 LEU MD2  .  96 . HD2# 1 1 
        890 1 2 1 1 100 LEU MD2  . 178 . HD2# 1 1 
        891 1 1 1 1 105 LYS QB   . 183 . HB#  1 1 
        891 1 2 1 1 106 LEU MD2  . 184 . HD2# 1 1 
        892 1 1 1 1  50 LEU HA   . 128 . HA   1 1 
        892 1 2 1 1  50 LEU MD2  . 128 . HD2# 1 1 
        893 1 1 1 1  68 LEU HA   . 146 . HA   1 1 
        893 1 2 1 1  68 LEU MD2  . 146 . HD2# 1 1 
        894 1 1 1 1   9 LEU HA   .  87 . HA   1 1 
        894 1 2 1 1   9 LEU MD2  .  87 . HD2# 1 1 
        895 1 1 1 1  56 GLU HA   . 134 . HA   1 1 
        895 1 2 1 1  57 LEU MD2  . 135 . HD2# 1 1 
        896 1 1 1 1  76 LEU MD1  . 154 . HD1# 1 1 
        896 1 2 1 1  80 VAL MG2  . 158 . HG2# 1 1 
        897 1 1 1 1  18 LEU MD1  .  96 . HD1# 1 1 
        897 1 2 1 1  22 LEU HG   . 100 . HG   1 1 
        898 1 1 1 1  22 LEU HG   . 100 . HG   1 1 
        898 1 2 1 1 100 LEU MD2  . 178 . HD2# 1 1 
        899 1 1 1 1  69 ALA MB   . 147 . HB#  1 1 
        899 1 2 1 1  72 GLN HG3  . 150 . HG1  1 1 
        900 1 1 1 1  76 LEU HA   . 154 . HA   1 1 
        900 1 2 1 1  76 LEU MD1  . 154 . HD1# 1 1 
        901 1 1 1 1  72 GLN HA   . 150 . HA   1 1 
        901 1 2 1 1  76 LEU MD1  . 154 . HD1# 1 1 
        902 1 1 1 1  42 GLY HA3  . 120 . HA1  1 1 
        902 1 2 1 1  68 LEU MD2  . 146 . HD2# 1 1 
        903 1 1 1 1  37 THR MG   . 115 . HG2# 1 1 
        903 1 2 1 1  41 LEU MD1  . 119 . HD1# 1 1 
        904 1 1 1 1  37 THR MG   . 115 . HG2# 1 1 
        904 1 2 1 1  41 LEU MD2  . 119 . HD2# 1 1 
        905 1 1 1 1  37 THR HA   . 115 . HA   1 1 
        905 1 2 1 1  37 THR MG   . 115 . HG2# 1 1 
        906 1 1 1 1  27 VAL HA   . 105 . HA   1 1 
        906 1 2 1 1  27 VAL MG2  . 105 . HG2# 1 1 
        907 1 1 1 1  43 SER H    . 121 . HN   1 1 
        907 1 2 1 1  68 LEU MD2  . 146 . HD2# 1 1 
        908 1 1 1 1  31 LEU MD2  . 109 . HD2# 1 1 
        908 1 2 1 1 108 MET ME   . 186 . HE#  1 1 
        909 1 1 1 1  50 LEU HB3  . 128 . HB1  1 1 
        909 1 2 1 1  50 LEU MD1  . 128 . HD1# 1 1 
        910 1 1 1 1  50 LEU HB2  . 128 . HB2  1 1 
        910 1 2 1 1  50 LEU MD1  . 128 . HD1# 1 1 
        911 1 1 1 1 100 LEU HB2  . 178 . HB2  1 1 
        911 1 2 1 1 100 LEU MD1  . 178 . HD1# 1 1 
        912 1 1 1 1  25 ASP HB2  . 103 . HB2  1 1 
        912 1 2 1 1  31 LEU MD1  . 109 . HD1# 1 1 
        913 1 1 1 1  63 VAL HB   . 141 . HB   1 1 
        913 1 2 1 1  68 LEU MD1  . 146 . HD1# 1 1 
        914 1 1 1 1  68 LEU MD1  . 146 . HD1# 1 1 
        914 1 2 1 1  72 GLN HG3  . 150 . HG1  1 1 
        915 1 1 1 1  37 THR MG   . 115 . HG2# 1 1 
        915 1 2 1 1 106 LEU MD1  . 184 . HD1# 1 1 
        916 1 1 1 1  38 LEU HB3  . 116 . HB1  1 1 
        916 1 2 1 1  76 LEU MD2  . 154 . HD2# 1 1 
        917 1 1 1 1  76 LEU HG   . 154 . HG   1 1 
        917 1 2 1 1  80 VAL MG2  . 158 . HG2# 1 1 
        918 1 1 1 1  68 LEU MD1  . 146 . HD1# 1 1 
        918 1 2 1 1  76 LEU MD1  . 154 . HD1# 1 1 
        919 1 1 1 1  37 THR HB   . 115 . HB   1 1 
        919 1 2 1 1  38 LEU HG   . 116 . HG   1 1 
        920 1 1 1 1  22 LEU HA   . 100 . HA   1 1 
        920 1 2 1 1  22 LEU MD1  . 100 . HD1# 1 1 
        921 1 1 1 1  38 LEU HB2  . 116 . HB2  1 1 
        921 1 2 1 1  76 LEU MD2  . 154 . HD2# 1 1 
        922 1 1 1 1  72 GLN HG3  . 150 . HG1  1 1 
        922 1 2 1 1  76 LEU MD2  . 154 . HD2# 1 1 
        923 1 1 1 1  76 LEU MD2  . 154 . HD2# 1 1 
        923 1 2 1 1  80 VAL MG2  . 158 . HG2# 1 1 
        924 1 1 1 1  40 LEU MD2  . 118 . HD2# 1 1 
        924 1 2 1 1  41 LEU HG   . 119 . HG   1 1 
        925 1 1 1 1  68 LEU MD1  . 146 . HD1# 1 1 
        925 1 2 1 1  76 LEU MD2  . 154 . HD2# 1 1 
        926 1 1 1 1 104 LYS HA   . 182 . HA   1 1 
        926 1 2 1 1 104 LYS HD3  . 182 . HD1  1 1 
        927 1 1 1 1 104 LYS HA   . 182 . HA   1 1 
        927 1 2 1 1 104 LYS HD2  . 182 . HD2  1 1 
        928 1 1 1 1  27 VAL MG1  . 105 . HG1# 1 1 
        928 1 2 1 1  67 LYS QD   . 145 . HD#  1 1 
        929 1 1 1 1  48 SER HA   . 126 . HA   1 1 
        929 1 2 1 1  92 PRO QB   . 170 . HB#  1 1 
        930 1 1 1 1  94 GLN HA   . 172 . HA   1 1 
        930 1 2 1 1  94 GLN QG   . 172 . HG#  1 1 
        931 1 1 1 1  24 GLN HA   . 102 . HA   1 1 
        931 1 2 1 1  24 GLN HG3  . 102 . HG1  1 1 
        932 1 1 1 1  46 ILE HB   . 124 . HB   1 1 
        932 1 2 1 1  80 VAL MG1  . 158 . HG1# 1 1 
        933 1 1 1 1  98 GLU HA   . 176 . HA   1 1 
        933 1 2 1 1 101 GLU QG   . 179 . HG#  1 1 
        934 1 1 1 1 101 GLU HA   . 179 . HA   1 1 
        934 1 2 1 1 101 GLU QG   . 179 . HG#  1 1 
        935 1 1 1 1  56 GLU HA   . 134 . HA   1 1 
        935 1 2 1 1  56 GLU HG2  . 134 . HG2  1 1 
        936 1 1 1 1  75 GLU HA   . 153 . HA   1 1 
        936 1 2 1 1  75 GLU HG3  . 153 . HG1  1 1 
        937 1 1 1 1  10 THR MG   .  88 . HG2# 1 1 
        937 1 2 1 1  13 ILE HB   .  91 . HB   1 1 
        938 1 1 1 1  42 GLY HA2  . 120 . HA2  1 1 
        938 1 2 1 1  46 ILE MD   . 124 . HD1# 1 1 
        939 1 1 1 1  46 ILE MD   . 124 . HD1# 1 1 
        939 1 2 1 1  49 GLU HB3  . 127 . HB1  1 1 
        940 1 1 1 1  46 ILE MD   . 124 . HD1# 1 1 
        940 1 2 1 1  46 ILE MG   . 124 . HG2# 1 1 
        941 1 1 1 1  90 MET ME   . 168 . HE#  1 1 
        941 1 2 1 1  95 ALA HA   . 173 . HA   1 1 
        942 1 1 1 1  78 GLU HA   . 156 . HA   1 1 
        942 1 2 1 1  81 MET ME   . 159 . HE#  1 1 
        943 1 1 1 1  90 MET HB3  . 168 . HB1  1 1 
        943 1 2 1 1  90 MET ME   . 168 . HE#  1 1 
        944 1 1 1 1  90 MET ME   . 168 . HE#  1 1 
        944 1 2 1 1  95 ALA MB   . 173 . HB#  1 1 
        945 1 1 1 1  63 VAL MG2  . 141 . HG2# 1 1 
        945 1 2 1 1  81 MET ME   . 159 . HE#  1 1 
        946 1 1 1 1  62 TYR QE   . 140 . HE#  1 1 
        946 1 2 1 1  81 MET ME   . 159 . HE#  1 1 
        947 1 1 1 1  44 TYR QE   . 122 . HE#  1 1 
        947 1 2 1 1  90 MET ME   . 168 . HE#  1 1 
        948 1 1 1 1  87 TYR HA   . 165 . HA   1 1 
        948 1 2 1 1  90 MET ME   . 168 . HE#  1 1 
        949 1 1 1 1  90 MET HA   . 168 . HA   1 1 
        949 1 2 1 1  90 MET ME   . 168 . HE#  1 1 
        950 1 1 1 1  99 PHE HZ   . 177 . HZ   1 1 
        950 1 2 1 1 103 ALA MB   . 181 . HB#  1 1 
        951 1 1 1 1  93 ALA MB   . 171 . HB#  1 1 
        951 1 2 1 1  94 GLN HA   . 172 . HA   1 1 
        952 1 1 1 1  28 ALA MB   . 106 . HB#  1 1 
        952 1 2 1 1  29 GLY HA2  . 107 . HA2  1 1 
        953 1 1 1 1  28 ALA MB   . 106 . HB#  1 1 
        953 1 2 1 1  30 ARG HA   . 108 . HA   1 1 
        954 1 1 1 1  54 ASP QB   . 132 . HB#  1 1 
        954 1 2 1 1  57 LEU MD2  . 135 . HD2# 1 1 
        955 1 1 1 1  76 LEU MD1  . 154 . HD1# 1 1 
        955 1 2 1 1  80 VAL HA   . 158 . HA   1 1 
        956 1 1 1 1  72 GLN HG3  . 150 . HG1  1 1 
        956 1 2 1 1  76 LEU MD1  . 154 . HD1# 1 1 
        957 1 1 1 1  94 GLN HA   . 172 . HA   1 1 
        957 1 2 1 1  97 LEU HG   . 175 . HG   1 1 
        958 1 1 1 1  97 LEU HG   . 175 . HG   1 1 
        958 1 2 1 1  98 GLU HA   . 176 . HA   1 1 
        959 1 1 1 1  47 GLN QG   . 125 . HG#  1 1 
        959 1 2 1 1  90 MET ME   . 168 . HE#  1 1 
        960 1 1 1 1  40 LEU MD2  . 118 . HD2# 1 1 
        960 1 2 1 1 102 ASN HB3  . 180 . HB1  1 1 
        961 1 1 1 1 105 LYS QB   . 183 . HB#  1 1 
        961 1 2 1 1 105 LYS QE   . 183 . HE#  1 1 
        962 1 1 1 1  54 ASP QB   . 132 . HB#  1 1 
        962 1 2 1 1  57 LEU HB2  . 135 . HB2  1 1 
        963 1 1 1 1  54 ASP QB   . 132 . HB#  1 1 
        963 1 2 1 1  57 LEU HB3  . 135 . HB1  1 1 
        964 1 1 1 1  46 ILE MG   . 124 . HG2# 1 1 
        964 1 2 1 1  50 LEU HB2  . 128 . HB2  1 1 
        965 1 1 1 1  46 ILE MG   . 124 . HG2# 1 1 
        965 1 2 1 1  50 LEU HB3  . 128 . HB1  1 1 
        966 1 1 1 1  15 ARG HD3  .  93 . HD1  1 1 
        966 1 2 1 1 100 LEU MD1  . 178 . HD1# 1 1 
        967 1 1 1 1  29 GLY HA2  . 107 . HA2  1 1 
        967 1 2 1 1  70 PRO HG3  . 148 . HG1  1 1 
        968 1 1 1 1  29 GLY HA3  . 107 . HA1  1 1 
        968 1 2 1 1  70 PRO HG3  . 148 . HG1  1 1 
        969 1 1 1 1  59 GLY HA3  . 137 . HA1  1 1 
        969 1 2 1 1  60 VAL MG1  . 138 . HG1# 1 1 
        970 1 1 1 1  59 GLY HA3  . 137 . HA1  1 1 
        970 1 2 1 1  60 VAL MG2  . 138 . HG2# 1 1 
        971 1 1 1 1  59 GLY HA2  . 137 . HA2  1 1 
        971 1 2 1 1  60 VAL MG1  . 138 . HG1# 1 1 
        972 1 1 1 1  59 GLY HA2  . 137 . HA2  1 1 
        972 1 2 1 1  60 VAL MG2  . 138 . HG2# 1 1 
        973 1 1 1 1  42 GLY HA3  . 120 . HA1  1 1 
        973 1 2 1 1  68 LEU HA   . 146 . HA   1 1 
        974 1 1 1 1  42 GLY HA3  . 120 . HA1  1 1 
        974 1 2 1 1  80 VAL MG2  . 158 . HG2# 1 1 
        975 1 1 1 1  42 GLY HA2  . 120 . HA2  1 1 
        975 1 2 1 1  45 THR MG   . 123 . HG2# 1 1 
        976 1 1 1 1  42 GLY HA2  . 120 . HA2  1 1 
        976 1 2 1 1  80 VAL MG2  . 158 . HG2# 1 1 
        977 1 1 1 1  42 GLY HA2  . 120 . HA2  1 1 
        977 1 2 1 1  68 LEU MD2  . 146 . HD2# 1 1 
        978 1 1 1 1  42 GLY HA3  . 120 . HA1  1 1 
        978 1 2 1 1  68 LEU MD1  . 146 . HD1# 1 1 
        979 1 1 1 1  26 ILE MG   . 104 . HG2# 1 1 
        979 1 2 1 1  69 ALA HA   . 147 . HA   1 1 
        980 1 1 1 1  27 VAL MG1  . 105 . HG1# 1 1 
        980 1 2 1 1  69 ALA HA   . 147 . HA   1 1 
        981 1 1 1 1  54 ASP HA   . 132 . HA   1 1 
        981 1 2 1 1  55 PRO HG2  . 133 . HG2  1 1 
        982 1 1 1 1   5 ASP HA   .  83 . HA   1 1 
        982 1 2 1 1   6 PRO HD3  .  84 . HD1  1 1 
        983 1 1 1 1  27 VAL MG2  . 105 . HG2# 1 1 
        983 1 2 1 1  28 ALA HA   . 106 . HA   1 1 
        984 1 1 1 1  39 ALA HA   . 117 . HA   1 1 
        984 1 2 1 1  76 LEU MD2  . 154 . HD2# 1 1 
        985 1 1 1 1  39 ALA HA   . 117 . HA   1 1 
        985 1 2 1 1  83 LEU MD1  . 161 . HD1# 1 1 
        986 1 1 1 1  61 ASP HA   . 139 . HA   1 1 
        986 1 2 1 1  81 MET ME   . 159 . HE#  1 1 
        987 1 1 1 1  87 TYR HA   . 165 . HA   1 1 
        987 1 2 1 1  88 ARG QB   . 166 . HB#  1 1 
        988 1 1 1 1  92 PRO QB   . 170 . HB#  1 1 
        988 1 2 1 1  93 ALA HA   . 171 . HA   1 1 
        989 1 1 1 1 106 LEU HA   . 184 . HA   1 1 
        989 1 2 1 1 106 LEU MD1  . 184 . HD1# 1 1 
        990 1 1 1 1 103 ALA HA   . 181 . HA   1 1 
        990 1 2 1 1 106 LEU QB   . 184 . HB#  1 1 
        991 1 1 1 1  67 LYS HA   . 145 . HA   1 1 
        991 1 2 1 1  67 LYS QD   . 145 . HD#  1 1 
        992 1 1 1 1  57 LEU HA   . 135 . HA   1 1 
        992 1 2 1 1  57 LEU HG   . 135 . HG   1 1 
        993 1 1 1 1  95 ALA HA   . 173 . HA   1 1 
        993 1 2 1 1  98 GLU QB   . 176 . HB#  1 1 
        994 1 1 1 1  27 VAL MG1  . 105 . HG1# 1 1 
        994 1 2 1 1  67 LYS HA   . 145 . HA   1 1 
        995 1 1 1 1  67 LYS HA   . 145 . HA   1 1 
        995 1 2 1 1  68 LEU MD2  . 146 . HD2# 1 1 
        996 1 1 1 1   3 HIS HA   .  81 . HA   1 1 
        996 1 2 1 1   3 HIS HD2  .  81 . HD2  1 1 
        997 1 1 1 1   8 GLN HA   .  86 . HA   1 1 
        997 1 2 1 1   8 GLN QG   .  86 . HG#  1 1 
        998 1 1 1 1 102 ASN HA   . 180 . HA   1 1 
        998 1 2 1 1 105 LYS QD   . 183 . HD#  1 1 
        999 1 1 1 1  31 LEU MD2  . 109 . HD2# 1 1 
        999 1 2 1 1 108 MET HA   . 186 . HA   1 1 
       1000 1 1 1 1  56 GLU HA   . 134 . HA   1 1 
       1000 1 2 1 1  56 GLU HG3  . 134 . HG1  1 1 
       1001 1 1 1 1  72 GLN HA   . 150 . HA   1 1 
       1001 1 2 1 1  72 GLN HG3  . 150 . HG1  1 1 
       1002 1 1 1 1  88 ARG HA   . 166 . HA   1 1 
       1002 1 2 1 1  88 ARG QG   . 166 . HG#  1 1 
       1003 1 1 1 1  72 GLN HA   . 150 . HA   1 1 
       1003 1 2 1 1  76 LEU HG   . 154 . HG   1 1 
       1004 1 1 1 1  72 GLN HA   . 150 . HA   1 1 
       1004 1 2 1 1  76 LEU MD2  . 154 . HD2# 1 1 
       1005 1 1 1 1  49 GLU HA   . 127 . HA   1 1 
       1005 1 2 1 1  49 GLU HG2  . 127 . HG2  1 1 
       1006 1 1 1 1  11 GLU HA   .  89 . HA   1 1 
       1006 1 2 1 1  11 GLU QG   .  89 . HG#  1 1 
       1007 1 1 1 1  94 GLN HA   . 172 . HA   1 1 
       1007 1 2 1 1  97 LEU HB2  . 175 . HB2  1 1 
       1008 1 1 1 1  39 ALA MB   . 117 . HB#  1 1 
       1008 1 2 1 1  76 LEU HA   . 154 . HA   1 1 
       1009 1 1 1 1  76 LEU HA   . 154 . HA   1 1 
       1009 1 2 1 1  80 VAL MG2  . 158 . HG2# 1 1 
       1010 1 1 1 1  38 LEU HA   . 116 . HA   1 1 
       1010 1 2 1 1  38 LEU MD1  . 116 . HD1# 1 1 
       1011 1 1 1 1  46 ILE MG   . 124 . HG2# 1 1 
       1011 1 2 1 1  47 GLN HA   . 125 . HA   1 1 
       1012 1 1 1 1 105 LYS HA   . 183 . HA   1 1 
       1012 1 2 1 1 105 LYS HG2  . 183 . HG2  1 1 
       1013 1 1 1 1  97 LEU HA   . 175 . HA   1 1 
       1013 1 2 1 1  97 LEU MD1  . 175 . HD1# 1 1 
       1014 1 1 1 1  82 GLU HA   . 160 . HA   1 1 
       1014 1 2 1 1  82 GLU HG2  . 160 . HG2  1 1 
       1015 1 1 1 1  82 GLU HA   . 160 . HA   1 1 
       1015 1 2 1 1  82 GLU HG3  . 160 . HG1  1 1 
       1016 1 1 1 1  82 GLU HA   . 160 . HA   1 1 
       1016 1 2 1 1  85 LYS QD   . 163 . HD#  1 1 
       1017 1 1 1 1  73 THR HA   . 151 . HA   1 1 
       1017 1 2 1 1  73 THR MG   . 151 . HG2# 1 1 
       1018 1 1 1 1  75 GLU HA   . 153 . HA   1 1 
       1018 1 2 1 1  75 GLU HG2  . 153 . HG2  1 1 
       1019 1 1 1 1  48 SER HA   . 126 . HA   1 1 
       1019 1 2 1 1  95 ALA MB   . 173 . HB#  1 1 
       1020 1 1 1 1  77 GLU HA   . 155 . HA   1 1 
       1020 1 2 1 1  80 VAL MG2  . 158 . HG2# 1 1 
       1021 1 1 1 1  15 ARG HA   .  93 . HA   1 1 
       1021 1 2 1 1 100 LEU MD2  . 178 . HD2# 1 1 
       1022 1 1 1 1  47 GLN QG   . 125 . HG#  1 1 
       1022 1 2 1 1  48 SER HA   . 126 . HA   1 1 
       1023 1 1 1 1  16 TYR HA   .  94 . HA   1 1 
       1023 1 2 1 1  20 LEU HG   .  98 . HG   1 1 
       1024 1 1 1 1  17 TYR HA   .  95 . HA   1 1 
       1024 1 2 1 1  20 LEU HG   .  98 . HG   1 1 
       1025 1 1 1 1  44 TYR HA   . 122 . HA   1 1 
       1025 1 2 1 1  44 TYR QE   . 122 . HE#  1 1 
       1026 1 1 1 1  44 TYR HA   . 122 . HA   1 1 
       1026 1 2 1 1  95 ALA MB   . 173 . HB#  1 1 
       1027 1 1 1 1  46 ILE HA   . 124 . HA   1 1 
       1027 1 2 1 1  49 GLU HB3  . 127 . HB1  1 1 
       1028 1 1 1 1  45 THR MG   . 123 . HG2# 1 1 
       1028 1 2 1 1  46 ILE HA   . 124 . HA   1 1 
       1029 1 1 1 1  35 PHE HA   . 113 . HA   1 1 
       1029 1 2 1 1  38 LEU MD1  . 116 . HD1# 1 1 
       1030 1 1 1 1  60 VAL HA   . 138 . HA   1 1 
       1030 1 2 1 1  81 MET ME   . 159 . HE#  1 1 
       1031 1 1 1 1  60 VAL HA   . 138 . HA   1 1 
       1031 1 2 1 1  60 VAL MG1  . 138 . HG1# 1 1 
       1032 1 1 1 1  10 THR HA   .  88 . HA   1 1 
       1032 1 2 1 1  13 ILE MG   .  91 . HG2# 1 1 
       1033 1 1 1 1  35 PHE HA   . 113 . HA   1 1 
       1033 1 2 1 1  39 ALA MB   . 117 . HB#  1 1 
       1034 1 1 1 1  10 THR HA   .  88 . HA   1 1 
       1034 1 2 1 1  13 ILE MD   .  91 . HD1# 1 1 
       1035 1 1 1 1  45 THR HA   . 123 . HA   1 1 
       1035 1 2 1 1  48 SER QB   . 126 . HB#  1 1 
       1036 1 1 1 1  13 ILE HA   .  91 . HA   1 1 
       1036 1 2 1 1  16 TYR HB2  .  94 . HB2  1 1 
       1037 1 1 1 1  13 ILE HA   .  91 . HA   1 1 
       1037 1 2 1 1  16 TYR HB3  .  94 . HB1  1 1 
       1038 1 1 1 1  27 VAL HA   . 105 . HA   1 1 
       1038 1 2 1 1  70 PRO HA   . 148 . HA   1 1 
       1039 1 1 1 1  69 ALA MB   . 147 . HB#  1 1 
       1039 1 2 1 1  70 PRO HA   . 148 . HA   1 1 
       1040 1 1 1 1  27 VAL MG1  . 105 . HG1# 1 1 
       1040 1 2 1 1  70 PRO HA   . 148 . HA   1 1 
       1041 1 1 1 1  19 CYS HA   .  97 . HA   1 1 
       1041 1 2 1 1 100 LEU MD2  . 178 . HD2# 1 1 
       1042 1 1 1 1  14 THR HA   .  92 . HA   1 1 
       1042 1 2 1 1  17 TYR QD   .  95 . HD#  1 1 
       1043 1 1 1 1  36 ALA MB   . 114 . HB#  1 1 
       1043 1 2 1 1  37 THR HA   . 115 . HA   1 1 
       1044 1 1 1 1  26 ILE HA   . 104 . HA   1 1 
       1044 1 2 1 1  26 ILE MG   . 104 . HG2# 1 1 
       1045 1 1 1 1  37 THR HA   . 115 . HA   1 1 
       1045 1 2 1 1  40 LEU HB3  . 118 . HB1  1 1 
       1046 1 1 1 1  37 THR HA   . 115 . HA   1 1 
       1046 1 2 1 1  40 LEU HB2  . 118 . HB2  1 1 
       1047 1 1 1 1  92 PRO HA   . 170 . HA   1 1 
       1047 1 2 1 1  95 ALA MB   . 173 . HB#  1 1 
       1048 1 1 1 1  13 ILE MG   .  91 . HG2# 1 1 
       1048 1 2 1 1  14 THR HA   .  92 . HA   1 1 
       1049 1 1 1 1  37 THR HA   . 115 . HA   1 1 
       1049 1 2 1 1  40 LEU MD2  . 118 . HD2# 1 1 
       1050 1 1 1 1  27 VAL HA   . 105 . HA   1 1 
       1050 1 2 1 1  69 ALA HA   . 147 . HA   1 1 
       1051 1 1 1 1  48 SER HA   . 126 . HA   1 1 
       1051 1 2 1 1  92 PRO HA   . 170 . HA   1 1 
       1052 1 1 1 1  42 GLY HA2  . 120 . HA2  1 1 
       1052 1 2 1 1  45 THR HA   . 123 . HA   1 1 
       1053 1 1 1 1  45 THR HA   . 123 . HA   1 1 
       1053 1 2 1 1  48 SER HA   . 126 . HA   1 1 
       1054 1 1 1 1  39 ALA HA   . 117 . HA   1 1 
       1054 1 2 1 1  80 VAL HA   . 158 . HA   1 1 
       1055 1 1 1 1  27 VAL HA   . 105 . HA   1 1 
       1055 1 2 1 1  70 PRO HD3  . 148 . HD1  1 1 
       1056 1 1 1 1  27 VAL HA   . 105 . HA   1 1 
       1056 1 2 1 1  70 PRO HG3  . 148 . HG1  1 1 
       1057 1 1 1 1  80 VAL HA   . 158 . HA   1 1 
       1057 1 2 1 1  83 LEU HG   . 161 . HG   1 1 
       1058 1 1 1 1  27 VAL HA   . 105 . HA   1 1 
       1058 1 2 1 1  69 ALA MB   . 147 . HB#  1 1 
       1059 1 1 1 1  42 GLY HA2  . 120 . HA2  1 1 
       1059 1 2 1 1  45 THR HB   . 123 . HB   1 1 
       1060 1 1 1 1  42 GLY HA3  . 120 . HA1  1 1 
       1060 1 2 1 1  45 THR HB   . 123 . HB   1 1 
       1061 1 1 1 1  45 THR HB   . 123 . HB   1 1 
       1061 1 2 1 1  68 LEU MD2  . 146 . HD2# 1 1 
       1062 1 1 1 1  37 THR HB   . 115 . HB   1 1 
       1062 1 2 1 1  38 LEU MD2  . 116 . HD2# 1 1 
       1063 1 1 1 1  11 GLU QB   .  89 . HB#  1 1 
       1063 1 2 1 1  14 THR HB   .  92 . HB   1 1 
       1064 1 1 1 1  13 ILE HG13 .  91 . HG11 1 1 
       1064 1 2 1 1  13 ILE MG   .  91 . HG2# 1 1 
       1065 1 1 1 1  60 VAL HA   . 138 . HA   1 1 
       1065 1 2 1 1  60 VAL MG2  . 138 . HG2# 1 1 
       1066 1 1 1 1  24 GLN HA   . 102 . HA   1 1 
       1066 1 2 1 1  28 ALA MB   . 106 . HB#  1 1 
       1067 1 1 1 1  68 LEU MD2  . 146 . HD2# 1 1 
       1067 1 2 1 1  80 VAL MG1  . 158 . HG1# 1 1 
       1068 1 1 1 1  68 LEU MD1  . 146 . HD1# 1 1 
       1068 1 2 1 1  80 VAL HA   . 158 . HA   1 1 
       1069 1 1 1 1  57 LEU HA   . 135 . HA   1 1 
       1069 1 2 1 1  57 LEU MD1  . 135 . HD1# 1 1 
       1070 1 1 1 1  44 TYR H    . 122 . HN   1 1 
       1070 1 2 1 1  83 LEU MD1  . 161 . HD1# 1 1 
       1071 1 1 1 1  50 LEU MD1  . 128 . HD1# 1 1 
       1071 1 2 1 1  66 PHE QD   . 144 . HD#  1 1 
       1072 1 1 1 1  46 ILE MG   . 124 . HG2# 1 1 
       1072 1 2 1 1  50 LEU MD1  . 128 . HD1# 1 1 
       1073 1 1 1 1  53 TYR QE   . 131 . HE#  1 1 
       1073 1 2 1 1  62 TYR QE   . 140 . HE#  1 1 
       1074 1 1 1 1  41 LEU HA   . 119 . HA   1 1 
       1074 1 2 1 1  44 TYR QD   . 122 . HD#  1 1 
       1075 1 1 1 1  35 PHE HZ   . 113 . HZ   1 1 
       1075 1 2 1 1  76 LEU HA   . 154 . HA   1 1 
       1076 1 1 1 1  35 PHE QE   . 113 . HE#  1 1 
       1076 1 2 1 1  76 LEU HA   . 154 . HA   1 1 
       1077 1 1 1 1  17 TYR HA   .  95 . HA   1 1 
       1077 1 2 1 1  17 TYR QD   .  95 . HD#  1 1 
       1078 1 1 1 1  35 PHE HA   . 113 . HA   1 1 
       1078 1 2 1 1  35 PHE QD   . 113 . HD#  1 1 
       1079 1 1 1 1  16 TYR HA   .  94 . HA   1 1 
       1079 1 2 1 1  16 TYR QD   .  94 . HD#  1 1 
       1080 1 1 1 1  17 TYR HA   .  95 . HA   1 1 
       1080 1 2 1 1  17 TYR QE   .  95 . HE#  1 1 
       1081 1 1 1 1  84 HIS HA   . 162 . HA   1 1 
       1081 1 2 1 1  87 TYR QD   . 165 . HD#  1 1 
       1082 1 1 1 1  35 PHE QD   . 113 . HD#  1 1 
       1082 1 2 1 1  36 ALA HA   . 114 . HA   1 1 
       1083 1 1 1 1  63 VAL HA   . 141 . HA   1 1 
       1083 1 2 1 1  66 PHE QD   . 144 . HD#  1 1 
       1084 1 1 1 1  19 CYS HA   .  97 . HA   1 1 
       1084 1 2 1 1  99 PHE HZ   . 177 . HZ   1 1 
       1085 1 1 1 1 104 LYS HA   . 182 . HA   1 1 
       1085 1 2 1 1 109 TYR QE   . 187 . HE#  1 1 
       1086 1 1 1 1  53 TYR QE   . 131 . HE#  1 1 
       1086 1 2 1 1  55 PRO HG3  . 133 . HG1  1 1 
       1087 1 1 1 1  53 TYR QE   . 131 . HE#  1 1 
       1087 1 2 1 1  55 PRO HB3  . 133 . HB1  1 1 
       1088 1 1 1 1  35 PHE HZ   . 113 . HZ   1 1 
       1088 1 2 1 1  79 LYS QB   . 157 . HB#  1 1 
       1089 1 1 1 1  22 LEU HG   . 100 . HG   1 1 
       1089 1 2 1 1 109 TYR QE   . 187 . HE#  1 1 
       1090 1 1 1 1  87 TYR QD   . 165 . HD#  1 1 
       1090 1 2 1 1  90 MET ME   . 168 . HE#  1 1 
       1091 1 1 1 1  22 LEU HB3  . 100 . HB1  1 1 
       1091 1 2 1 1  99 PHE HZ   . 177 . HZ   1 1 
       1092 1 1 1 1 103 ALA MB   . 181 . HB#  1 1 
       1092 1 2 1 1 109 TYR QE   . 187 . HE#  1 1 
       1093 1 1 1 1  13 ILE MG   .  91 . HG2# 1 1 
       1093 1 2 1 1  17 TYR QE   .  95 . HE#  1 1 
       1094 1 1 1 1  13 ILE MG   .  91 . HG2# 1 1 
       1094 1 2 1 1  17 TYR QD   .  95 . HD#  1 1 
       1095 1 1 1 1  40 LEU MD2  . 118 . HD2# 1 1 
       1095 1 2 1 1  44 TYR QD   . 122 . HD#  1 1 
       1096 1 1 1 1  40 LEU MD1  . 118 . HD1# 1 1 
       1096 1 2 1 1  44 TYR QE   . 122 . HE#  1 1 
       1097 1 1 1 1  40 LEU MD2  . 118 . HD2# 1 1 
       1097 1 2 1 1  44 TYR QE   . 122 . HE#  1 1 
       1098 1 1 1 1  26 ILE MD   . 104 . HD1# 1 1 
       1098 1 2 1 1  99 PHE QE   . 177 . HE#  1 1 
       1099 1 1 1 1  26 ILE MD   . 104 . HD1# 1 1 
       1099 1 2 1 1  99 PHE HZ   . 177 . HZ   1 1 
       1100 1 1 1 1  22 LEU MD2  . 100 . HD2# 1 1 
       1100 1 2 1 1 109 TYR QE   . 187 . HE#  1 1 
       1101 1 1 1 1  50 LEU MD2  . 128 . HD2# 1 1 
       1101 1 2 1 1  66 PHE QE   . 144 . HE#  1 1 
       1102 1 1 1 1  99 PHE QD   . 177 . HD#  1 1 
       1102 1 2 1 1 100 LEU MD2  . 178 . HD2# 1 1 
       1103 1 1 1 1  99 PHE HZ   . 177 . HZ   1 1 
       1103 1 2 1 1 100 LEU MD2  . 178 . HD2# 1 1 
       1104 1 1 1 1  18 LEU MD1  .  96 . HD1# 1 1 
       1104 1 2 1 1 109 TYR QE   . 187 . HE#  1 1 
       1105 1 1 1 1  50 LEU MD1  . 128 . HD1# 1 1 
       1105 1 2 1 1  66 PHE QE   . 144 . HE#  1 1 
       1106 1 1 1 1  50 LEU MD1  . 128 . HD1# 1 1 
       1106 1 2 1 1  62 TYR QE   . 140 . HE#  1 1 
       1107 1 1 1 1  22 LEU MD1  . 100 . HD1# 1 1 
       1107 1 2 1 1 109 TYR QE   . 187 . HE#  1 1 
       1108 1 1 1 1  16 TYR QE   .  94 . HE#  1 1 
       1108 1 2 1 1  20 LEU MD2  .  98 . HD2# 1 1 
       1109 1 1 1 1  16 TYR QE   .  94 . HE#  1 1 
       1109 1 2 1 1  20 LEU MD1  .  98 . HD1# 1 1 
       1110 1 1 1 1  35 PHE QD   . 113 . HD#  1 1 
       1110 1 2 1 1  76 LEU MD1  . 154 . HD1# 1 1 
       1111 1 1 1 1  35 PHE HZ   . 113 . HZ   1 1 
       1111 1 2 1 1  76 LEU MD1  . 154 . HD1# 1 1 
       1112 1 1 1 1  46 ILE MD   . 124 . HD1# 1 1 
       1112 1 2 1 1  66 PHE QD   . 144 . HD#  1 1 
       1113 1 1 1 1  46 ILE MG   . 124 . HG2# 1 1 
       1113 1 2 1 1  62 TYR QE   . 140 . HE#  1 1 
       1114 1 1 1 1  99 PHE HA   . 177 . HA   1 1 
       1114 1 2 1 1  99 PHE QD   . 177 . HD#  1 1 
       1115 1 1 1 1  66 PHE HA   . 144 . HA   1 1 
       1115 1 2 1 1  66 PHE QD   . 144 . HD#  1 1 
       1116 1 1 1 1  87 TYR HA   . 165 . HA   1 1 
       1116 1 2 1 1  87 TYR QD   . 165 . HD#  1 1 
       1117 1 1 1 1 109 TYR HA   . 187 . HA   1 1 
       1117 1 2 1 1 109 TYR QD   . 187 . HD#  1 1 
       1118 1 1 1 1  58 HIS HA   . 136 . HA   1 1 
       1118 1 2 1 1  58 HIS HD2  . 136 . HD2  1 1 
       1119 1 1 1 1  44 TYR HA   . 122 . HA   1 1 
       1119 1 2 1 1  44 TYR QD   . 122 . HD#  1 1 
       1120 1 1 1 1  44 TYR QD   . 122 . HD#  1 1 
       1120 1 2 1 1  95 ALA HA   . 173 . HA   1 1 
       1121 1 1 1 1  53 TYR QE   . 131 . HE#  1 1 
       1121 1 2 1 1  55 PRO HA   . 133 . HA   1 1 
       1122 1 1 1 1 103 ALA HA   . 181 . HA   1 1 
       1122 1 2 1 1 109 TYR QE   . 187 . HE#  1 1 
       1123 1 1 1 1  35 PHE QD   . 113 . HD#  1 1 
       1123 1 2 1 1  36 ALA MB   . 114 . HB#  1 1 
       1124 1 1 1 1  35 PHE QE   . 113 . HE#  1 1 
       1124 1 2 1 1  75 GLU HB3  . 153 . HB1  1 1 
       1125 1 1 1 1  46 ILE MD   . 124 . HD1# 1 1 
       1125 1 2 1 1  50 LEU MD1  . 128 . HD1# 1 1 
       1126 1 1 1 1  46 ILE MG   . 124 . HG2# 1 1 
       1126 1 2 1 1  63 VAL MG1  . 141 . HG1# 1 1 
       1127 1 1 1 1  38 LEU HA   . 116 . HA   1 1 
       1127 1 2 1 1  76 LEU MD1  . 154 . HD1# 1 1 
       1128 1 1 1 1  41 LEU MD2  . 119 . HD2# 1 1 
       1128 1 2 1 1 103 ALA MB   . 181 . HB#  1 1 
       1129 1 1 1 1  40 LEU MD2  . 118 . HD2# 1 1 
       1129 1 2 1 1  41 LEU MD2  . 119 . HD2# 1 1 
       1130 1 1 1 1  63 VAL MG2  . 141 . HG2# 1 1 
       1130 1 2 1 1  68 LEU MD1  . 146 . HD1# 1 1 
       1131 1 1 1 1  63 VAL MG1  . 141 . HG1# 1 1 
       1131 1 2 1 1  80 VAL HB   . 158 . HB   1 1 
       1132 1 1 1 1  45 THR HA   . 123 . HA   1 1 
       1132 1 2 1 1  45 THR MG   . 123 . HG2# 1 1 
       1133 1 1 1 1  31 LEU MD2  . 109 . HD2# 1 1 
       1133 1 2 1 1  32 PRO QD   . 110 . HD#  1 1 
       1134 1 1 1 1  39 ALA HA   . 117 . HA   1 1 
       1134 1 2 1 1  76 LEU MD1  . 154 . HD1# 1 1 
       1135 1 1 1 1  63 VAL HA   . 141 . HA   1 1 
       1135 1 2 1 1  63 VAL MG2  . 141 . HG2# 1 1 
       1136 1 1 1 1  41 LEU MD2  . 119 . HD2# 1 1 
       1136 1 2 1 1 106 LEU MD1  . 184 . HD1# 1 1 
       1137 1 1 1 1  63 VAL HA   . 141 . HA   1 1 
       1137 1 2 1 1  63 VAL MG1  . 141 . HG1# 1 1 
       1138 1 1 1 1  43 SER HA   . 121 . HA   1 1 
       1138 1 2 1 1  80 VAL MG1  . 158 . HG1# 1 1 
       1139 1 1 1 1  85 LYS HA   . 163 . HA   1 1 
       1139 1 2 1 1  85 LYS HG3  . 163 . HG1  1 1 
       1140 1 1 1 1  26 ILE MG   . 104 . HG2# 1 1 
       1140 1 2 1 1  27 VAL HA   . 105 . HA   1 1 
       1141 1 1 1 1  27 VAL HA   . 105 . HA   1 1 
       1141 1 2 1 1  27 VAL MG1  . 105 . HG1# 1 1 
       1142 1 1 1 1  66 PHE HB2  . 144 . HB2  1 1 
       1142 1 2 1 1  68 LEU MD2  . 146 . HD2# 1 1 
       1143 1 1 1 1  77 GLU HA   . 155 . HA   1 1 
       1143 1 2 1 1  80 VAL HB   . 158 . HB   1 1 
       1144 1 1 1 1  85 LYS HA   . 163 . HA   1 1 
       1144 1 2 1 1  85 LYS HG2  . 163 . HG2  1 1 
       1145 1 1 1 1  80 VAL HA   . 158 . HA   1 1 
       1145 1 2 1 1  80 VAL MG2  . 158 . HG2# 1 1 
       1146 1 1 1 1  16 TYR QD   .  94 . HD#  1 1 
       1146 1 2 1 1  17 TYR QD   .  95 . HD#  1 1 
       1147 1 1 1 1  41 LEU HA   . 119 . HA   1 1 
       1147 1 2 1 1  99 PHE QD   . 177 . HD#  1 1 
       1148 1 1 1 1  22 LEU HA   . 100 . HA   1 1 
       1148 1 2 1 1  99 PHE HZ   . 177 . HZ   1 1 
       1149 1 1 1 1  30 ARG HA   . 108 . HA   1 1 
       1149 1 2 1 1  30 ARG HE   . 108 . HE   1 1 
       1150 1 1 1 1  64 SER HB3  . 142 . HB1  1 1 
       1150 1 2 1 1  65 ASP H    . 143 . HN   1 1 
       1151 1 1 1 1  99 PHE QD   . 177 . HD#  1 1 
       1151 1 2 1 1 100 LEU HA   . 178 . HA   1 1 
       1152 1 1 1 1  47 GLN QG   . 125 . HG#  1 1 
       1152 1 2 1 1  87 TYR QD   . 165 . HD#  1 1 
       1153 1 1 1 1  41 LEU HA   . 119 . HA   1 1 
       1153 1 2 1 1  44 TYR QE   . 122 . HE#  1 1 
       1154 1 1 1 1  43 SER HB3  . 121 . HB1  1 1 
       1154 1 2 1 1  87 TYR QE   . 165 . HE#  1 1 
       1155 1 1 1 1  44 TYR QE   . 122 . HE#  1 1 
       1155 1 2 1 1  95 ALA HA   . 173 . HA   1 1 
       1156 1 1 1 1  84 HIS HA   . 162 . HA   1 1 
       1156 1 2 1 1  87 TYR QE   . 165 . HE#  1 1 
       1157 1 1 1 1  43 SER HA   . 121 . HA   1 1 
       1157 1 2 1 1  87 TYR QE   . 165 . HE#  1 1 
       1158 1 1 1 1  40 LEU HA   . 118 . HA   1 1 
       1158 1 2 1 1  44 TYR QE   . 122 . HE#  1 1 
       1159 1 1 1 1  43 SER HB2  . 121 . HB2  1 1 
       1159 1 2 1 1  87 TYR QE   . 165 . HE#  1 1 
       1160 1 1 1 1  44 TYR QE   . 122 . HE#  1 1 
       1160 1 2 1 1  98 GLU HG2  . 176 . HG2  1 1 
       1161 1 1 1 1  87 TYR QE   . 165 . HE#  1 1 
       1161 1 2 1 1  90 MET ME   . 168 . HE#  1 1 
       1162 1 1 1 1  35 PHE QE   . 113 . HE#  1 1 
       1162 1 2 1 1  75 GLU HB2  . 153 . HB2  1 1 
       1163 1 1 1 1  22 LEU HB2  . 100 . HB2  1 1 
       1163 1 2 1 1  99 PHE HZ   . 177 . HZ   1 1 
       1164 1 1 1 1  99 PHE QD   . 177 . HD#  1 1 
       1164 1 2 1 1 100 LEU HG   . 178 . HG   1 1 
       1165 1 1 1 1  47 GLN QB   . 125 . HB#  1 1 
       1165 1 2 1 1  87 TYR QD   . 165 . HD#  1 1 
       1166 1 1 1 1  16 TYR QD   .  94 . HD#  1 1 
       1166 1 2 1 1  20 LEU MD1  .  98 . HD1# 1 1 
       1167 1 1 1 1  18 LEU MD2  .  96 . HD2# 1 1 
       1167 1 2 1 1 109 TYR QE   . 187 . HE#  1 1 
       1168 1 1 1 1  63 VAL MG1  . 141 . HG1# 1 1 
       1168 1 2 1 1  66 PHE QD   . 144 . HD#  1 1 
       1169 1 1 1 1  41 LEU MD1  . 119 . HD1# 1 1 
       1169 1 2 1 1  99 PHE HZ   . 177 . HZ   1 1 
       1170 1 1 1 1  41 LEU MD2  . 119 . HD2# 1 1 
       1170 1 2 1 1  99 PHE QD   . 177 . HD#  1 1 
       1171 1 1 1 1  41 LEU MD2  . 119 . HD2# 1 1 
       1171 1 2 1 1  99 PHE HZ   . 177 . HZ   1 1 
       1172 1 1 1 1  41 LEU MD2  . 119 . HD2# 1 1 
       1172 1 2 1 1  44 TYR QD   . 122 . HD#  1 1 
       1173 1 1 1 1  41 LEU MD2  . 119 . HD2# 1 1 
       1173 1 2 1 1  99 PHE QE   . 177 . HE#  1 1 
       1174 1 1 1 1  62 TYR QE   . 140 . HE#  1 1 
       1174 1 2 1 1  63 VAL MG2  . 141 . HG2# 1 1 
       1175 1 1 1 1  83 LEU MD2  . 161 . HD2# 1 1 
       1175 1 2 1 1  87 TYR QE   . 165 . HE#  1 1 
       1176 1 1 1 1  44 TYR QD   . 122 . HD#  1 1 
       1176 1 2 1 1  95 ALA MB   . 173 . HB#  1 1 
       1177 1 1 1 1  22 LEU HG   . 100 . HG   1 1 
       1177 1 2 1 1  99 PHE HZ   . 177 . HZ   1 1 
       1178 1 1 1 1  46 ILE MD   . 124 . HD1# 1 1 
       1178 1 2 1 1  66 PHE QE   . 144 . HE#  1 1 
       1179 1 1 1 1  20 LEU HA   .  98 . HA   1 1 
       1179 1 2 1 1  20 LEU MD2  .  98 . HD2# 1 1 
       1180 1 1 1 1  20 LEU HA   .  98 . HA   1 1 
       1180 1 2 1 1  20 LEU MD1  .  98 . HD1# 1 1 
       1181 1 1 1 1  18 LEU HA   .  96 . HA   1 1 
       1181 1 2 1 1  18 LEU MD1  .  96 . HD1# 1 1 
       1182 1 1 1 1  57 LEU HA   . 135 . HA   1 1 
       1182 1 2 1 1  57 LEU MD2  . 135 . HD2# 1 1 
       1183 1 1 1 1  31 LEU MD1  . 109 . HD1# 1 1 
       1183 1 2 1 1 108 MET HA   . 186 . HA   1 1 
       1184 1 1 1 1  22 LEU HA   . 100 . HA   1 1 
       1184 1 2 1 1  26 ILE MD   . 104 . HD1# 1 1 
       1185 1 1 1 1 103 ALA HA   . 181 . HA   1 1 
       1185 1 2 1 1 106 LEU MD1  . 184 . HD1# 1 1 
       1186 1 1 1 1  22 LEU HA   . 100 . HA   1 1 
       1186 1 2 1 1  22 LEU MD2  . 100 . HD2# 1 1 
       1187 1 1 1 1  46 ILE MG   . 124 . HG2# 1 1 
       1187 1 2 1 1  63 VAL MG2  . 141 . HG2# 1 1 
       1188 1 1 1 1  63 VAL MG2  . 141 . HG2# 1 1 
       1188 1 2 1 1  77 GLU HA   . 155 . HA   1 1 
       1189 1 1 1 1  72 GLN HG2  . 150 . HG2  1 1 
       1189 1 2 1 1  76 LEU MD2  . 154 . HD2# 1 1 
       1190 1 1 1 1  80 VAL HA   . 158 . HA   1 1 
       1190 1 2 1 1  83 LEU MD1  . 161 . HD1# 1 1 
       1191 1 1 1 1  50 LEU HA   . 128 . HA   1 1 
       1191 1 2 1 1  50 LEU MD1  . 128 . HD1# 1 1 
       1192 1 1 1 1  68 LEU HA   . 146 . HA   1 1 
       1192 1 2 1 1  68 LEU MD1  . 146 . HD1# 1 1 
       1193 1 1 1 1  50 LEU MD1  . 128 . HD1# 1 1 
       1193 1 2 1 1  62 TYR QD   . 140 . HD#  1 1 
       1194 1 1 1 1  16 TYR HA   .  94 . HA   1 1 
       1194 1 2 1 1  16 TYR QE   .  94 . HE#  1 1 
       1195 1 1 1 1  46 ILE HA   . 124 . HA   1 1 
       1195 1 2 1 1  49 GLU HB2  . 127 . HB2  1 1 
       1196 1 1 1 1  33 CYS HB2  . 111 . HB2  1 1 
       1196 1 2 1 1  37 THR MG   . 115 . HG2# 1 1 
       1197 1 1 1 1  33 CYS HB3  . 111 . HB1  1 1 
       1197 1 2 1 1  37 THR MG   . 115 . HG2# 1 1 
       1198 1 1 1 1  16 TYR QE   .  94 . HE#  1 1 
       1198 1 2 1 1  17 TYR QE   .  95 . HE#  1 1 
       1199 1 1 1 1  53 TYR QD   . 131 . HD#  1 1 
       1199 1 2 1 1  62 TYR QE   . 140 . HE#  1 1 
       1200 1 1 1 1  53 TYR HA   . 131 . HA   1 1 
       1200 1 2 1 1  53 TYR QD   . 131 . HD#  1 1 
       1201 1 1 1 1  41 LEU HA   . 119 . HA   1 1 
       1201 1 2 1 1  41 LEU MD1  . 119 . HD1# 1 1 
       1202 1 1 1 1  53 TYR QD   . 131 . HD#  1 1 
       1202 1 2 1 1  84 HIS HD2  . 162 . HD2  1 1 
       1203 1 1 1 1  16 TYR QE   .  94 . HE#  1 1 
       1203 1 2 1 1  17 TYR QD   .  95 . HD#  1 1 
       1204 1 1 1 1  46 ILE MD   . 124 . HD1# 1 1 
       1204 1 2 1 1  62 TYR QE   . 140 . HE#  1 1 
       1205 1 1 1 1  76 LEU MD1  . 154 . HD1# 1 1 
       1205 1 2 1 1  77 GLU HA   . 155 . HA   1 1 
       1206 1 1 1 1  62 TYR QE   . 140 . HE#  1 1 
       1206 1 2 1 1  63 VAL MG1  . 141 . HG1# 1 1 
       1207 1 1 1 1  13 ILE MG   .  91 . HG2# 1 1 
       1207 1 2 1 1  16 TYR QD   .  94 . HD#  1 1 
       1208 1 1 1 1  31 LEU H    . 109 . HN   1 1 
       1208 1 2 1 1  31 LEU MD1  . 109 . HD1# 1 1 
       1209 1 1 1 1  13 ILE MD   .  91 . HD1# 1 1 
       1209 1 2 1 1  16 TYR QD   .  94 . HD#  1 1 
       1210 1 1 1 1  50 LEU MD2  . 128 . HD2# 1 1 
       1210 1 2 1 1  62 TYR QE   . 140 . HE#  1 1 
       1211 1 1 1 1  53 TYR HA   . 131 . HA   1 1 
       1211 1 2 1 1  53 TYR QE   . 131 . HE#  1 1 
       1212 1 1 1 1  44 TYR QD   . 122 . HD#  1 1 
       1212 1 2 1 1  99 PHE QD   . 177 . HD#  1 1 
       1213 1 1 1 1  84 HIS HD2  . 162 . HD2  1 1 
       1213 1 2 1 1  87 TYR QD   . 165 . HD#  1 1 
       1214 1 1 1 1  88 ARG HA   . 166 . HA   1 1 
       1214 1 2 1 1  88 ARG QD   . 166 . HD#  1 1 
       1215 1 1 1 1  43 SER HA   . 121 . HA   1 1 
       1215 1 2 1 1  80 VAL HA   . 158 . HA   1 1 
       1216 1 1 1 1  63 VAL HB   . 141 . HB   1 1 
       1216 1 2 1 1  80 VAL MG1  . 158 . HG1# 1 1 
       1217 1 1 1 1  12 ASP QB   .  90 . HB#  1 1 
       1217 1 2 1 1  13 ILE MD   .  91 . HD1# 1 1 
       1218 1 1 1 1  93 ALA MB   . 171 . HB#  1 1 
       1218 1 2 1 1  94 GLN QG   . 172 . HG#  1 1 
       1219 1 1 1 1  90 MET HG2  . 168 . HG2  1 1 
       1219 1 2 1 1  95 ALA MB   . 173 . HB#  1 1 
       1220 1 1 1 1  63 VAL MG1  . 141 . HG1# 1 1 
       1220 1 2 1 1  77 GLU HA   . 155 . HA   1 1 
       1221 1 1 1 1  20 LEU HA   .  98 . HA   1 1 
       1221 1 2 1 1  20 LEU HG   .  98 . HG   1 1 
       1222 1 1 1 1  90 MET HG3  . 168 . HG1  1 1 
       1222 1 2 1 1  95 ALA MB   . 173 . HB#  1 1 
       1223 1 1 1 1  41 LEU MD1  . 119 . HD1# 1 1 
       1223 1 2 1 1 102 ASN HB3  . 180 . HB1  1 1 
       1224 1 1 1 1  69 ALA HA   . 147 . HA   1 1 
       1224 1 2 1 1  70 PRO HG3  . 148 . HG1  1 1 
       1225 1 1 1 1  87 TYR HA   . 165 . HA   1 1 
       1225 1 2 1 1  87 TYR QE   . 165 . HE#  1 1 
       1226 1 1 1 1  13 ILE HA   .  91 . HA   1 1 
       1226 1 2 1 1  16 TYR QD   .  94 . HD#  1 1 
       1227 1 1 1 1  53 TYR QD   . 131 . HD#  1 1 
       1227 1 2 1 1  85 LYS HA   . 163 . HA   1 1 
       1228 1 1 1 1 104 LYS HA   . 182 . HA   1 1 
       1228 1 2 1 1 109 TYR QD   . 187 . HD#  1 1 
       1229 1 1 1 1  49 GLU HG2  . 127 . HG2  1 1 
       1229 1 2 1 1  66 PHE QE   . 144 . HE#  1 1 
       1230 1 1 1 1  49 GLU HG3  . 127 . HG1  1 1 
       1230 1 2 1 1  66 PHE QE   . 144 . HE#  1 1 
       1231 1 1 1 1  41 LEU MD1  . 119 . HD1# 1 1 
       1231 1 2 1 1  99 PHE QE   . 177 . HE#  1 1 
       1232 1 1 1 1  41 LEU MD1  . 119 . HD1# 1 1 
       1232 1 2 1 1  99 PHE QD   . 177 . HD#  1 1 
       1233 1 1 1 1  35 PHE QE   . 113 . HE#  1 1 
       1233 1 2 1 1  75 GLU HG3  . 153 . HG1  1 1 
       1234 1 1 1 1  35 PHE QE   . 113 . HE#  1 1 
       1234 1 2 1 1  75 GLU HG2  . 153 . HG2  1 1 
       1235 1 1 1 1  44 TYR QE   . 122 . HE#  1 1 
       1235 1 2 1 1  98 GLU HG3  . 176 . HG1  1 1 
       1236 1 1 1 1  44 TYR QE   . 122 . HE#  1 1 
       1236 1 2 1 1  95 ALA MB   . 173 . HB#  1 1 
       1237 1 1 1 1  41 LEU MD2  . 119 . HD2# 1 1 
       1237 1 2 1 1  44 TYR QE   . 122 . HE#  1 1 
       1238 1 1 1 1  53 TYR HA   . 131 . HA   1 1 
       1238 1 2 1 1  84 HIS HD2  . 162 . HD2  1 1 
       1239 1 1 1 1  63 VAL MG2  . 141 . HG2# 1 1 
       1239 1 2 1 1  66 PHE QD   . 144 . HD#  1 1 
       1240 1 1 1 1   4 MET QB   .  82 . HB#  1 1 
       1240 1 2 1 1   5 ASP H    .  83 . HN   1 1 
       1241 1 1 1 1   5 ASP H    .  83 . HN   1 1 
       1241 1 2 1 1   5 ASP QB   .  83 . HB#  1 1 
       1242 1 1 1 1   5 ASP QB   .  83 . HB#  1 1 
       1242 1 2 1 1   7 ALA H    .  85 . HN   1 1 
       1243 1 1 1 1   5 ASP QB   .  83 . HB#  1 1 
       1243 1 2 1 1   8 GLN H    .  86 . HN   1 1 
       1244 1 1 1 1   6 PRO QB   .  84 . HB#  1 1 
       1244 1 2 1 1   7 ALA H    .  85 . HN   1 1 
       1245 1 1 1 1   8 GLN H    .  86 . HN   1 1 
       1245 1 2 1 1   8 GLN QB   .  86 . HB#  1 1 
       1246 1 1 1 1   9 LEU H    .  87 . HN   1 1 
       1246 1 2 1 1   9 LEU QB   .  87 . HB#  1 1 
       1247 1 1 1 1  12 ASP H    .  90 . HN   1 1 
       1247 1 2 1 1  13 ILE QG   .  91 . HG1# 1 1 
       1248 1 1 1 1  12 ASP HA   .  90 . HA   1 1 
       1248 1 2 1 1  15 ARG QB   .  93 . HB#  1 1 
       1249 1 1 1 1  12 ASP HA   .  90 . HA   1 1 
       1249 1 2 1 1  15 ARG QD   .  93 . HD#  1 1 
       1250 1 1 1 1  13 ILE HA   .  91 . HA   1 1 
       1250 1 2 1 1  13 ILE QG   .  91 . HG1# 1 1 
       1251 1 1 1 1  13 ILE HA   .  91 . HA   1 1 
       1251 1 2 1 1  16 TYR QB   .  94 . HB#  1 1 
       1252 1 1 1 1  14 THR HA   .  92 . HA   1 1 
       1252 1 2 1 1  17 TYR QB   .  95 . HB#  1 1 
       1253 1 1 1 1  14 THR HB   .  92 . HB   1 1 
       1253 1 2 1 1  15 ARG QB   .  93 . HB#  1 1 
       1254 1 1 1 1  15 ARG HA   .  93 . HA   1 1 
       1254 1 2 1 1  18 LEU QB   .  96 . HB#  1 1 
       1255 1 1 1 1  15 ARG QB   .  93 . HB#  1 1 
       1255 1 2 1 1  16 TYR H    .  94 . HN   1 1 
       1256 1 1 1 1  15 ARG QD   .  93 . HD#  1 1 
       1256 1 2 1 1 100 LEU MD1  . 178 . HD1# 1 1 
       1257 1 1 1 1  16 TYR QB   .  94 . HB#  1 1 
       1257 1 2 1 1  17 TYR H    .  95 . HN   1 1 
       1258 1 1 1 1  16 TYR QB   .  94 . HB#  1 1 
       1258 1 2 1 1  20 LEU MD1  .  98 . HD1# 1 1 
       1259 1 1 1 1  17 TYR H    .  95 . HN   1 1 
       1259 1 2 1 1  17 TYR QB   .  95 . HB#  1 1 
       1260 1 1 1 1  17 TYR QB   .  95 . HB#  1 1 
       1260 1 2 1 1  18 LEU H    .  96 . HN   1 1 
       1261 1 1 1 1  18 LEU H    .  96 . HN   1 1 
       1261 1 2 1 1  18 LEU QB   .  96 . HB#  1 1 
       1262 1 1 1 1  18 LEU HA   .  96 . HA   1 1 
       1262 1 2 1 1  21 GLN QB   .  99 . HB#  1 1 
       1263 1 1 1 1  18 LEU QB   .  96 . HB#  1 1 
       1263 1 2 1 1  19 CYS H    .  97 . HN   1 1 
       1264 1 1 1 1  18 LEU HG   .  96 . HG   1 1 
       1264 1 2 1 1  22 LEU QD   . 100 . HD## 1 1 
       1265 1 1 1 1  18 LEU MD1  .  96 . HD1# 1 1 
       1265 1 2 1 1  21 GLN QB   .  99 . HB#  1 1 
       1266 1 1 1 1  18 LEU MD2  .  96 . HD2# 1 1 
       1266 1 2 1 1  22 LEU QD   . 100 . HD## 1 1 
       1267 1 1 1 1  19 CYS H    .  97 . HN   1 1 
       1267 1 2 1 1  19 CYS QB   .  97 . HB#  1 1 
       1268 1 1 1 1  19 CYS HA   .  97 . HA   1 1 
       1268 1 2 1 1  22 LEU QB   . 100 . HB#  1 1 
       1269 1 1 1 1  19 CYS HA   .  97 . HA   1 1 
       1269 1 2 1 1  22 LEU QD   . 100 . HD## 1 1 
       1270 1 1 1 1  19 CYS QB   .  97 . HB#  1 1 
       1270 1 2 1 1  20 LEU H    .  98 . HN   1 1 
       1271 1 1 1 1  21 GLN H    .  99 . HN   1 1 
       1271 1 2 1 1  21 GLN QB   .  99 . HB#  1 1 
       1272 1 1 1 1  21 GLN H    .  99 . HN   1 1 
       1272 1 2 1 1  21 GLN QG   .  99 . HG#  1 1 
       1273 1 1 1 1  21 GLN H    .  99 . HN   1 1 
       1273 1 2 1 1  22 LEU QD   . 100 . HD## 1 1 
       1274 1 1 1 1  21 GLN HA   .  99 . HA   1 1 
       1274 1 2 1 1  21 GLN QG   .  99 . HG#  1 1 
       1275 1 1 1 1  21 GLN HA   .  99 . HA   1 1 
       1275 1 2 1 1  24 GLN QB   . 102 . HB#  1 1 
       1276 1 1 1 1  21 GLN HA   .  99 . HA   1 1 
       1276 1 2 1 1  24 GLN QG   . 102 . HG#  1 1 
       1277 1 1 1 1  21 GLN QB   .  99 . HB#  1 1 
       1277 1 2 1 1  22 LEU H    . 100 . HN   1 1 
       1278 1 1 1 1  21 GLN QB   .  99 . HB#  1 1 
       1278 1 2 1 1  22 LEU HA   . 100 . HA   1 1 
       1279 1 1 1 1  22 LEU H    . 100 . HN   1 1 
       1279 1 2 1 1  22 LEU QB   . 100 . HB#  1 1 
       1280 1 1 1 1  22 LEU HA   . 100 . HA   1 1 
       1280 1 2 1 1  22 LEU QD   . 100 . HD## 1 1 
       1281 1 1 1 1  22 LEU HA   . 100 . HA   1 1 
       1281 1 2 1 1  25 ASP QB   . 103 . HB#  1 1 
       1282 1 1 1 1  22 LEU QB   . 100 . HB#  1 1 
       1282 1 2 1 1  22 LEU QD   . 100 . HD## 1 1 
       1283 1 1 1 1  22 LEU QB   . 100 . HB#  1 1 
       1283 1 2 1 1  23 ARG H    . 101 . HN   1 1 
       1284 1 1 1 1  22 LEU QB   . 100 . HB#  1 1 
       1284 1 2 1 1  26 ILE MD   . 104 . HD1# 1 1 
       1285 1 1 1 1  22 LEU QB   . 100 . HB#  1 1 
       1285 1 2 1 1  99 PHE QE   . 177 . HE#  1 1 
       1286 1 1 1 1  22 LEU QB   . 100 . HB#  1 1 
       1286 1 2 1 1  99 PHE HZ   . 177 . HZ   1 1 
       1287 1 1 1 1  22 LEU QB   . 100 . HB#  1 1 
       1287 1 2 1 1 100 LEU MD2  . 178 . HD2# 1 1 
       1288 1 1 1 1  22 LEU QD   . 100 . HD## 1 1 
       1288 1 2 1 1  23 ARG H    . 101 . HN   1 1 
       1289 1 1 1 1  22 LEU QD   . 100 . HD## 1 1 
       1289 1 2 1 1  99 PHE QE   . 177 . HE#  1 1 
       1290 1 1 1 1  22 LEU QD   . 100 . HD## 1 1 
       1290 1 2 1 1  99 PHE HZ   . 177 . HZ   1 1 
       1291 1 1 1 1  22 LEU QD   . 100 . HD## 1 1 
       1291 1 2 1 1 100 LEU HA   . 178 . HA   1 1 
       1292 1 1 1 1  22 LEU QD   . 100 . HD## 1 1 
       1292 1 2 1 1 100 LEU MD2  . 178 . HD2# 1 1 
       1293 1 1 1 1  22 LEU QD   . 100 . HD## 1 1 
       1293 1 2 1 1 104 LYS H    . 182 . HN   1 1 
       1294 1 1 1 1  22 LEU QD   . 100 . HD## 1 1 
       1294 1 2 1 1 108 MET QG   . 186 . HG#  1 1 
       1295 1 1 1 1  22 LEU QD   . 100 . HD## 1 1 
       1295 1 2 1 1 108 MET ME   . 186 . HE#  1 1 
       1296 1 1 1 1  22 LEU QD   . 100 . HD## 1 1 
       1296 1 2 1 1 109 TYR QB   . 187 . HB#  1 1 
       1297 1 1 1 1  22 LEU QD   . 100 . HD## 1 1 
       1297 1 2 1 1 109 TYR QD   . 187 . HD#  1 1 
       1298 1 1 1 1  23 ARG H    . 101 . HN   1 1 
       1298 1 2 1 1  23 ARG QB   . 101 . HB#  1 1 
       1299 1 1 1 1  23 ARG H    . 101 . HN   1 1 
       1299 1 2 1 1  23 ARG QG   . 101 . HG#  1 1 
       1300 1 1 1 1  23 ARG QB   . 101 . HB#  1 1 
       1300 1 2 1 1  23 ARG HE   . 101 . HE   1 1 
       1301 1 1 1 1  23 ARG QD   . 101 . HD#  1 1 
       1301 1 2 1 1  27 VAL MG1  . 105 . HG1# 1 1 
       1302 1 1 1 1  23 ARG QD   . 101 . HD#  1 1 
       1302 1 2 1 1  27 VAL MG2  . 105 . HG2# 1 1 
       1303 1 1 1 1  24 GLN H    . 102 . HN   1 1 
       1303 1 2 1 1  24 GLN QB   . 102 . HB#  1 1 
       1304 1 1 1 1  24 GLN H    . 102 . HN   1 1 
       1304 1 2 1 1  24 GLN QG   . 102 . HG#  1 1 
       1305 1 1 1 1  24 GLN QB   . 102 . HB#  1 1 
       1305 1 2 1 1  25 ASP H    . 103 . HN   1 1 
       1306 1 1 1 1  24 GLN QG   . 102 . HG#  1 1 
       1306 1 2 1 1  25 ASP H    . 103 . HN   1 1 
       1307 1 1 1 1  24 GLN QG   . 102 . HG#  1 1 
       1307 1 2 1 1  27 VAL MG2  . 105 . HG2# 1 1 
       1308 1 1 1 1  25 ASP H    . 103 . HN   1 1 
       1308 1 2 1 1  25 ASP QB   . 103 . HB#  1 1 
       1309 1 1 1 1  25 ASP HA   . 103 . HA   1 1 
       1309 1 2 1 1  30 ARG QB   . 108 . HB#  1 1 
       1310 1 1 1 1  25 ASP QB   . 103 . HB#  1 1 
       1310 1 2 1 1  26 ILE H    . 104 . HN   1 1 
       1311 1 1 1 1  25 ASP QB   . 103 . HB#  1 1 
       1311 1 2 1 1  31 LEU H    . 109 . HN   1 1 
       1312 1 1 1 1  25 ASP QB   . 103 . HB#  1 1 
       1312 1 2 1 1  31 LEU QB   . 109 . HB#  1 1 
       1313 1 1 1 1  25 ASP QB   . 103 . HB#  1 1 
       1313 1 2 1 1  31 LEU MD1  . 109 . HD1# 1 1 
       1314 1 1 1 1  26 ILE HA   . 104 . HA   1 1 
       1314 1 2 1 1  31 LEU QB   . 109 . HB#  1 1 
       1315 1 1 1 1  26 ILE MG   . 104 . HG2# 1 1 
       1315 1 2 1 1  70 PRO QD   . 148 . HD#  1 1 
       1316 1 1 1 1  27 VAL HA   . 105 . HA   1 1 
       1316 1 2 1 1  70 PRO QD   . 148 . HD#  1 1 
       1317 1 1 1 1  27 VAL MG1  . 105 . HG1# 1 1 
       1317 1 2 1 1  67 LYS QB   . 145 . HB#  1 1 
       1318 1 1 1 1  28 ALA MB   . 106 . HB#  1 1 
       1318 1 2 1 1  30 ARG QD   . 108 . HD#  1 1 
       1319 1 1 1 1  29 GLY H    . 107 . HN   1 1 
       1319 1 2 1 1  70 PRO QB   . 148 . HB#  1 1 
       1320 1 1 1 1  30 ARG H    . 108 . HN   1 1 
       1320 1 2 1 1  30 ARG QB   . 108 . HB#  1 1 
       1321 1 1 1 1  30 ARG HA   . 108 . HA   1 1 
       1321 1 2 1 1  30 ARG QG   . 108 . HG#  1 1 
       1322 1 1 1 1  30 ARG HA   . 108 . HA   1 1 
       1322 1 2 1 1  30 ARG QD   . 108 . HD#  1 1 
       1323 1 1 1 1  30 ARG QB   . 108 . HB#  1 1 
       1323 1 2 1 1  31 LEU H    . 109 . HN   1 1 
       1324 1 1 1 1  31 LEU H    . 109 . HN   1 1 
       1324 1 2 1 1  31 LEU QB   . 109 . HB#  1 1 
       1325 1 1 1 1  31 LEU HA   . 109 . HA   1 1 
       1325 1 2 1 1  32 PRO QG   . 110 . HG#  1 1 
       1326 1 1 1 1  31 LEU QB   . 109 . HB#  1 1 
       1326 1 2 1 1  31 LEU MD1  . 109 . HD1# 1 1 
       1327 1 1 1 1  31 LEU QB   . 109 . HB#  1 1 
       1327 1 2 1 1  32 PRO QD   . 110 . HD#  1 1 
       1328 1 1 1 1  31 LEU QB   . 109 . HB#  1 1 
       1328 1 2 1 1 108 MET ME   . 186 . HE#  1 1 
       1329 1 1 1 1  31 LEU MD1  . 109 . HD1# 1 1 
       1329 1 2 1 1 108 MET QB   . 186 . HB#  1 1 
       1330 1 1 1 1  31 LEU MD1  . 109 . HD1# 1 1 
       1330 1 2 1 1 108 MET QG   . 186 . HG#  1 1 
       1331 1 1 1 1  31 LEU MD2  . 109 . HD2# 1 1 
       1331 1 2 1 1 108 MET QG   . 186 . HG#  1 1 
       1332 1 1 1 1  32 PRO QB   . 110 . HB#  1 1 
       1332 1 2 1 1  33 CYS H    . 111 . HN   1 1 
       1333 1 1 1 1  33 CYS QB   . 111 . HB#  1 1 
       1333 1 2 1 1  34 SER H    . 112 . HN   1 1 
       1334 1 1 1 1  33 CYS QB   . 111 . HB#  1 1 
       1334 1 2 1 1  37 THR HB   . 115 . HB   1 1 
       1335 1 1 1 1  33 CYS QB   . 111 . HB#  1 1 
       1335 1 2 1 1  37 THR MG   . 115 . HG2# 1 1 
       1336 1 1 1 1  33 CYS QB   . 111 . HB#  1 1 
       1336 1 2 1 1  38 LEU H    . 116 . HN   1 1 
       1337 1 1 1 1  33 CYS QB   . 111 . HB#  1 1 
       1337 1 2 1 1  38 LEU MD2  . 116 . HD2# 1 1 
       1338 1 1 1 1  34 SER QB   . 112 . HB#  1 1 
       1338 1 2 1 1  35 PHE H    . 113 . HN   1 1 
       1339 1 1 1 1  34 SER QB   . 112 . HB#  1 1 
       1339 1 2 1 1  36 ALA H    . 114 . HN   1 1 
       1340 1 1 1 1  34 SER QB   . 112 . HB#  1 1 
       1340 1 2 1 1  37 THR H    . 115 . HN   1 1 
       1341 1 1 1 1  35 PHE H    . 113 . HN   1 1 
       1341 1 2 1 1  35 PHE QB   . 113 . HB#  1 1 
       1342 1 1 1 1  35 PHE HA   . 113 . HA   1 1 
       1342 1 2 1 1  38 LEU QB   . 116 . HB#  1 1 
       1343 1 1 1 1  35 PHE QB   . 113 . HB#  1 1 
       1343 1 2 1 1  36 ALA H    . 114 . HN   1 1 
       1344 1 1 1 1  35 PHE QD   . 113 . HD#  1 1 
       1344 1 2 1 1  38 LEU QB   . 116 . HB#  1 1 
       1345 1 1 1 1  35 PHE QD   . 113 . HD#  1 1 
       1345 1 2 1 1  75 GLU QB   . 153 . HB#  1 1 
       1346 1 1 1 1  35 PHE QD   . 113 . HD#  1 1 
       1346 1 2 1 1  76 LEU QB   . 154 . HB#  1 1 
       1347 1 1 1 1  35 PHE QE   . 113 . HE#  1 1 
       1347 1 2 1 1  75 GLU QB   . 153 . HB#  1 1 
       1348 1 1 1 1  35 PHE QE   . 113 . HE#  1 1 
       1348 1 2 1 1  75 GLU QG   . 153 . HG#  1 1 
       1349 1 1 1 1  35 PHE QE   . 113 . HE#  1 1 
       1349 1 2 1 1  76 LEU QB   . 154 . HB#  1 1 
       1350 1 1 1 1  35 PHE QE   . 113 . HE#  1 1 
       1350 1 2 1 1  79 LYS QD   . 157 . HD#  1 1 
       1351 1 1 1 1  35 PHE HZ   . 113 . HZ   1 1 
       1351 1 2 1 1  75 GLU QB   . 153 . HB#  1 1 
       1352 1 1 1 1  35 PHE HZ   . 113 . HZ   1 1 
       1352 1 2 1 1  75 GLU QG   . 153 . HG#  1 1 
       1353 1 1 1 1  35 PHE HZ   . 113 . HZ   1 1 
       1353 1 2 1 1  79 LYS QG   . 157 . HG#  1 1 
       1354 1 1 1 1  35 PHE HZ   . 113 . HZ   1 1 
       1354 1 2 1 1  79 LYS QD   . 157 . HD#  1 1 
       1355 1 1 1 1  37 THR HA   . 115 . HA   1 1 
       1355 1 2 1 1  40 LEU QB   . 118 . HB#  1 1 
       1356 1 1 1 1  38 LEU HA   . 116 . HA   1 1 
       1356 1 2 1 1  41 LEU QB   . 119 . HB#  1 1 
       1357 1 1 1 1  38 LEU QB   . 116 . HB#  1 1 
       1357 1 2 1 1  39 ALA H    . 117 . HN   1 1 
       1358 1 1 1 1  38 LEU QB   . 116 . HB#  1 1 
       1358 1 2 1 1  76 LEU MD1  . 154 . HD1# 1 1 
       1359 1 1 1 1  38 LEU QB   . 116 . HB#  1 1 
       1359 1 2 1 1  76 LEU MD2  . 154 . HD2# 1 1 
       1360 1 1 1 1  38 LEU MD2  . 116 . HD2# 1 1 
       1360 1 2 1 1  70 PRO QD   . 148 . HD#  1 1 
       1361 1 1 1 1  39 ALA MB   . 117 . HB#  1 1 
       1361 1 2 1 1  79 LYS QG   . 157 . HG#  1 1 
       1362 1 1 1 1  39 ALA MB   . 117 . HB#  1 1 
       1362 1 2 1 1  79 LYS QD   . 157 . HD#  1 1 
       1363 1 1 1 1  40 LEU H    . 118 . HN   1 1 
       1363 1 2 1 1  40 LEU QB   . 118 . HB#  1 1 
       1364 1 1 1 1  40 LEU HA   . 118 . HA   1 1 
       1364 1 2 1 1  43 SER QB   . 121 . HB#  1 1 
       1365 1 1 1 1  40 LEU QB   . 118 . HB#  1 1 
       1365 1 2 1 1  41 LEU H    . 119 . HN   1 1 
       1366 1 1 1 1  40 LEU MD1  . 118 . HD1# 1 1 
       1366 1 2 1 1 102 ASN QD   . 180 . HD2# 1 1 
       1367 1 1 1 1  40 LEU MD2  . 118 . HD2# 1 1 
       1367 1 2 1 1 102 ASN QD   . 180 . HD2# 1 1 
       1368 1 1 1 1  41 LEU H    . 119 . HN   1 1 
       1368 1 2 1 1  41 LEU QB   . 119 . HB#  1 1 
       1369 1 1 1 1  41 LEU HA   . 119 . HA   1 1 
       1369 1 2 1 1  44 TYR QB   . 122 . HB#  1 1 
       1370 1 1 1 1  41 LEU QB   . 119 . HB#  1 1 
       1370 1 2 1 1  42 GLY H    . 120 . HN   1 1 
       1371 1 1 1 1  41 LEU QB   . 119 . HB#  1 1 
       1371 1 2 1 1  99 PHE QE   . 177 . HE#  1 1 
       1372 1 1 1 1  41 LEU QB   . 119 . HB#  1 1 
       1372 1 2 1 1  99 PHE HZ   . 177 . HZ   1 1 
       1373 1 1 1 1  43 SER H    . 121 . HN   1 1 
       1373 1 2 1 1  43 SER QB   . 121 . HB#  1 1 
       1374 1 1 1 1  43 SER QB   . 121 . HB#  1 1 
       1374 1 2 1 1  80 VAL HA   . 158 . HA   1 1 
       1375 1 1 1 1  43 SER QB   . 121 . HB#  1 1 
       1375 1 2 1 1  80 VAL MG1  . 158 . HG1# 1 1 
       1376 1 1 1 1  43 SER QB   . 121 . HB#  1 1 
       1376 1 2 1 1  83 LEU QB   . 161 . HB#  1 1 
       1377 1 1 1 1  43 SER QB   . 121 . HB#  1 1 
       1377 1 2 1 1  83 LEU MD1  . 161 . HD1# 1 1 
       1378 1 1 1 1  43 SER QB   . 121 . HB#  1 1 
       1378 1 2 1 1  87 TYR QE   . 165 . HE#  1 1 
       1379 1 1 1 1  44 TYR QE   . 122 . HE#  1 1 
       1379 1 2 1 1  98 GLU QG   . 176 . HG#  1 1 
       1380 1 1 1 1  46 ILE H    . 124 . HN   1 1 
       1380 1 2 1 1  46 ILE QG   . 124 . HG1# 1 1 
       1381 1 1 1 1  46 ILE HA   . 124 . HA   1 1 
       1381 1 2 1 1  49 GLU QB   . 127 . HB#  1 1 
       1382 1 1 1 1  46 ILE MG   . 124 . HG2# 1 1 
       1382 1 2 1 1  84 HIS QB   . 162 . HB#  1 1 
       1383 1 1 1 1  46 ILE QG   . 124 . HG1# 1 1 
       1383 1 2 1 1  63 VAL MG2  . 141 . HG2# 1 1 
       1384 1 1 1 1  46 ILE QG   . 124 . HG1# 1 1 
       1384 1 2 1 1  80 VAL MG1  . 158 . HG1# 1 1 
       1385 1 1 1 1  46 ILE QG   . 124 . HG1# 1 1 
       1385 1 2 1 1  80 VAL MG2  . 158 . HG2# 1 1 
       1386 1 1 1 1  47 GLN QE   . 125 . HE2# 1 1 
       1386 1 2 1 1  51 GLY QA   . 129 . HA#  1 1 
       1387 1 1 1 1  47 GLN QE   . 125 . HE2# 1 1 
       1387 1 2 1 1  52 ASP H    . 130 . HN   1 1 
       1388 1 1 1 1  47 GLN QE   . 125 . HE2# 1 1 
       1388 1 2 1 1  52 ASP HA   . 130 . HA   1 1 
       1389 1 1 1 1  47 GLN QE   . 125 . HE2# 1 1 
       1389 1 2 1 1  90 MET H    . 168 . HN   1 1 
       1390 1 1 1 1  47 GLN QE   . 125 . HE2# 1 1 
       1390 1 2 1 1  90 MET QB   . 168 . HB#  1 1 
       1391 1 1 1 1  49 GLU H    . 127 . HN   1 1 
       1391 1 2 1 1  49 GLU QB   . 127 . HB#  1 1 
       1392 1 1 1 1  49 GLU H    . 127 . HN   1 1 
       1392 1 2 1 1  49 GLU QG   . 127 . HG#  1 1 
       1393 1 1 1 1  49 GLU QB   . 127 . HB#  1 1 
       1393 1 2 1 1  50 LEU H    . 128 . HN   1 1 
       1394 1 1 1 1  49 GLU QB   . 127 . HB#  1 1 
       1394 1 2 1 1  50 LEU MD2  . 128 . HD2# 1 1 
       1395 1 1 1 1  49 GLU QB   . 127 . HB#  1 1 
       1395 1 2 1 1  51 GLY H    . 129 . HN   1 1 
       1396 1 1 1 1  49 GLU QB   . 127 . HB#  1 1 
       1396 1 2 1 1  66 PHE QE   . 144 . HE#  1 1 
       1397 1 1 1 1  49 GLU QG   . 127 . HG#  1 1 
       1397 1 2 1 1  66 PHE QE   . 144 . HE#  1 1 
       1398 1 1 1 1  51 GLY QA   . 129 . HA#  1 1 
       1398 1 2 1 1  52 ASP H    . 130 . HN   1 1 
       1399 1 1 1 1  51 GLY QA   . 129 . HA#  1 1 
       1399 1 2 1 1  52 ASP HA   . 130 . HA   1 1 
       1400 1 1 1 1  53 TYR H    . 131 . HN   1 1 
       1400 1 2 1 1  53 TYR QB   . 131 . HB#  1 1 
       1401 1 1 1 1  53 TYR QB   . 131 . HB#  1 1 
       1401 1 2 1 1  85 LYS HA   . 163 . HA   1 1 
       1402 1 1 1 1  53 TYR QD   . 131 . HD#  1 1 
       1402 1 2 1 1  85 LYS QG   . 163 . HG#  1 1 
       1403 1 1 1 1  53 TYR QE   . 131 . HE#  1 1 
       1403 1 2 1 1  55 PRO QD   . 133 . HD#  1 1 
       1404 1 1 1 1  54 ASP HA   . 132 . HA   1 1 
       1404 1 2 1 1  55 PRO QD   . 133 . HD#  1 1 
       1405 1 1 1 1  55 PRO QB   . 133 . HB#  1 1 
       1405 1 2 1 1  57 LEU H    . 135 . HN   1 1 
       1406 1 1 1 1  56 GLU H    . 134 . HN   1 1 
       1406 1 2 1 1  56 GLU QB   . 134 . HB#  1 1 
       1407 1 1 1 1  56 GLU H    . 134 . HN   1 1 
       1407 1 2 1 1  56 GLU QG   . 134 . HG#  1 1 
       1408 1 1 1 1  56 GLU HA   . 134 . HA   1 1 
       1408 1 2 1 1  56 GLU QG   . 134 . HG#  1 1 
       1409 1 1 1 1  56 GLU QB   . 134 . HB#  1 1 
       1409 1 2 1 1  57 LEU H    . 135 . HN   1 1 
       1410 1 1 1 1  56 GLU QG   . 134 . HG#  1 1 
       1410 1 2 1 1  57 LEU H    . 135 . HN   1 1 
       1411 1 1 1 1  56 GLU QG   . 134 . HG#  1 1 
       1411 1 2 1 1  57 LEU HB3  . 135 . HB1  1 1 
       1412 1 1 1 1  56 GLU QG   . 134 . HG#  1 1 
       1412 1 2 1 1  57 LEU MD2  . 135 . HD2# 1 1 
       1413 1 1 1 1  58 HIS H    . 136 . HN   1 1 
       1413 1 2 1 1  58 HIS QB   . 136 . HB#  1 1 
       1414 1 1 1 1  58 HIS H    . 136 . HN   1 1 
       1414 1 2 1 1  59 GLY QA   . 137 . HA#  1 1 
       1415 1 1 1 1  58 HIS QB   . 136 . HB#  1 1 
       1415 1 2 1 1  59 GLY H    . 137 . HN   1 1 
       1416 1 1 1 1  59 GLY QA   . 137 . HA#  1 1 
       1416 1 2 1 1  60 VAL H    . 138 . HN   1 1 
       1417 1 1 1 1  61 ASP H    . 139 . HN   1 1 
       1417 1 2 1 1  61 ASP QB   . 139 . HB#  1 1 
       1418 1 1 1 1  62 TYR QE   . 140 . HE#  1 1 
       1418 1 2 1 1  81 MET QG   . 159 . HG#  1 1 
       1419 1 1 1 1  63 VAL MG1  . 141 . HG1# 1 1 
       1419 1 2 1 1  66 PHE QB   . 144 . HB#  1 1 
       1420 1 1 1 1  63 VAL MG1  . 141 . HG1# 1 1 
       1420 1 2 1 1  77 GLU QG   . 155 . HG#  1 1 
       1421 1 1 1 1  63 VAL MG1  . 141 . HG1# 1 1 
       1421 1 2 1 1  81 MET QG   . 159 . HG#  1 1 
       1422 1 1 1 1  63 VAL MG2  . 141 . HG2# 1 1 
       1422 1 2 1 1  81 MET QB   . 159 . HB#  1 1 
       1423 1 1 1 1  63 VAL MG2  . 141 . HG2# 1 1 
       1423 1 2 1 1  81 MET QG   . 159 . HG#  1 1 
       1424 1 1 1 1  64 SER QB   . 142 . HB#  1 1 
       1424 1 2 1 1  65 ASP H    . 143 . HN   1 1 
       1425 1 1 1 1  64 SER QB   . 142 . HB#  1 1 
       1425 1 2 1 1  66 PHE H    . 144 . HN   1 1 
       1426 1 1 1 1  65 ASP H    . 143 . HN   1 1 
       1426 1 2 1 1  65 ASP QB   . 143 . HB#  1 1 
       1427 1 1 1 1  65 ASP QB   . 143 . HB#  1 1 
       1427 1 2 1 1  66 PHE H    . 144 . HN   1 1 
       1428 1 1 1 1  65 ASP QB   . 143 . HB#  1 1 
       1428 1 2 1 1  66 PHE QD   . 144 . HD#  1 1 
       1429 1 1 1 1  65 ASP QB   . 143 . HB#  1 1 
       1429 1 2 1 1  66 PHE QE   . 144 . HE#  1 1 
       1430 1 1 1 1  66 PHE H    . 144 . HN   1 1 
       1430 1 2 1 1  66 PHE QB   . 144 . HB#  1 1 
       1431 1 1 1 1  66 PHE QB   . 144 . HB#  1 1 
       1431 1 2 1 1  67 LYS H    . 145 . HN   1 1 
       1432 1 1 1 1  66 PHE QB   . 144 . HB#  1 1 
       1432 1 2 1 1  68 LEU MD1  . 146 . HD1# 1 1 
       1433 1 1 1 1  66 PHE QB   . 144 . HB#  1 1 
       1433 1 2 1 1  68 LEU MD2  . 146 . HD2# 1 1 
       1434 1 1 1 1  67 LYS H    . 145 . HN   1 1 
       1434 1 2 1 1  67 LYS QB   . 145 . HB#  1 1 
       1435 1 1 1 1  67 LYS H    . 145 . HN   1 1 
       1435 1 2 1 1  67 LYS QG   . 145 . HG#  1 1 
       1436 1 1 1 1  67 LYS QB   . 145 . HB#  1 1 
       1436 1 2 1 1  68 LEU H    . 146 . HN   1 1 
       1437 1 1 1 1  67 LYS QE   . 145 . HE#  1 1 
       1437 1 2 1 1  67 LYS QG   . 145 . HG#  1 1 
       1438 1 1 1 1  68 LEU H    . 146 . HN   1 1 
       1438 1 2 1 1  68 LEU QB   . 146 . HB#  1 1 
       1439 1 1 1 1  68 LEU QB   . 146 . HB#  1 1 
       1439 1 2 1 1  69 ALA H    . 147 . HN   1 1 
       1440 1 1 1 1  68 LEU QB   . 146 . HB#  1 1 
       1440 1 2 1 1  76 LEU MD1  . 154 . HD1# 1 1 
       1441 1 1 1 1  68 LEU MD1  . 146 . HD1# 1 1 
       1441 1 2 1 1  72 GLN QE   . 150 . HE2# 1 1 
       1442 1 1 1 1  69 ALA H    . 147 . HN   1 1 
       1442 1 2 1 1  72 GLN QB   . 150 . HB#  1 1 
       1443 1 1 1 1  69 ALA MB   . 147 . HB#  1 1 
       1443 1 2 1 1  70 PRO QD   . 148 . HD#  1 1 
       1444 1 1 1 1  69 ALA MB   . 147 . HB#  1 1 
       1444 1 2 1 1  72 GLN QB   . 150 . HB#  1 1 
       1445 1 1 1 1  70 PRO QB   . 148 . HB#  1 1 
       1445 1 2 1 1  71 ASN H    . 149 . HN   1 1 
       1446 1 1 1 1  70 PRO QD   . 148 . HD#  1 1 
       1446 1 2 1 1  71 ASN H    . 149 . HN   1 1 
       1447 1 1 1 1  71 ASN HA   . 149 . HA   1 1 
       1447 1 2 1 1  71 ASN QD   . 149 . HD2# 1 1 
       1448 1 1 1 1  71 ASN QB   . 149 . HB#  1 1 
       1448 1 2 1 1  72 GLN H    . 150 . HN   1 1 
       1449 1 1 1 1  72 GLN QB   . 150 . HB#  1 1 
       1449 1 2 1 1  73 THR H    . 151 . HN   1 1 
       1450 1 1 1 1  72 GLN QB   . 150 . HB#  1 1 
       1450 1 2 1 1  76 LEU MD2  . 154 . HD2# 1 1 
       1451 1 1 1 1  72 GLN QE   . 150 . HE2# 1 1 
       1451 1 2 1 1  73 THR H    . 151 . HN   1 1 
       1452 1 1 1 1  72 GLN QE   . 150 . HE2# 1 1 
       1452 1 2 1 1  76 LEU HG   . 154 . HG   1 1 
       1453 1 1 1 1  72 GLN QE   . 150 . HE2# 1 1 
       1453 1 2 1 1  76 LEU MD2  . 154 . HD2# 1 1 
       1454 1 1 1 1  73 THR H    . 151 . HN   1 1 
       1454 1 2 1 1  76 LEU QB   . 154 . HB#  1 1 
       1455 1 1 1 1  74 LYS H    . 152 . HN   1 1 
       1455 1 2 1 1  74 LYS QB   . 152 . HB#  1 1 
       1456 1 1 1 1  74 LYS HA   . 152 . HA   1 1 
       1456 1 2 1 1  77 GLU QB   . 155 . HB#  1 1 
       1457 1 1 1 1  75 GLU H    . 153 . HN   1 1 
       1457 1 2 1 1  75 GLU QB   . 153 . HB#  1 1 
       1458 1 1 1 1  75 GLU H    . 153 . HN   1 1 
       1458 1 2 1 1  75 GLU QG   . 153 . HG#  1 1 
       1459 1 1 1 1  75 GLU HA   . 153 . HA   1 1 
       1459 1 2 1 1  75 GLU QG   . 153 . HG#  1 1 
       1460 1 1 1 1  75 GLU QB   . 153 . HB#  1 1 
       1460 1 2 1 1  76 LEU H    . 154 . HN   1 1 
       1461 1 1 1 1  75 GLU QB   . 153 . HB#  1 1 
       1461 1 2 1 1  77 GLU H    . 155 . HN   1 1 
       1462 1 1 1 1  76 LEU H    . 154 . HN   1 1 
       1462 1 2 1 1  76 LEU QB   . 154 . HB#  1 1 
       1463 1 1 1 1  76 LEU QB   . 154 . HB#  1 1 
       1463 1 2 1 1  77 GLU H    . 155 . HN   1 1 
       1464 1 1 1 1  76 LEU MD1  . 154 . HD1# 1 1 
       1464 1 2 1 1  79 LYS QG   . 157 . HG#  1 1 
       1465 1 1 1 1  77 GLU H    . 155 . HN   1 1 
       1465 1 2 1 1  77 GLU QB   . 155 . HB#  1 1 
       1466 1 1 1 1  77 GLU H    . 155 . HN   1 1 
       1466 1 2 1 1  77 GLU QG   . 155 . HG#  1 1 
       1467 1 1 1 1  77 GLU QB   . 155 . HB#  1 1 
       1467 1 2 1 1  78 GLU H    . 156 . HN   1 1 
       1468 1 1 1 1  77 GLU QB   . 155 . HB#  1 1 
       1468 1 2 1 1  78 GLU QG   . 156 . HG#  1 1 
       1469 1 1 1 1  77 GLU QB   . 155 . HB#  1 1 
       1469 1 2 1 1  81 MET ME   . 159 . HE#  1 1 
       1470 1 1 1 1  77 GLU QG   . 155 . HG#  1 1 
       1470 1 2 1 1  78 GLU H    . 156 . HN   1 1 
       1471 1 1 1 1  78 GLU H    . 156 . HN   1 1 
       1471 1 2 1 1  78 GLU QG   . 156 . HG#  1 1 
       1472 1 1 1 1  78 GLU QG   . 156 . HG#  1 1 
       1472 1 2 1 1  81 MET ME   . 159 . HE#  1 1 
       1473 1 1 1 1  79 LYS H    . 157 . HN   1 1 
       1473 1 2 1 1  79 LYS QD   . 157 . HD#  1 1 
       1474 1 1 1 1  79 LYS HA   . 157 . HA   1 1 
       1474 1 2 1 1  79 LYS QD   . 157 . HD#  1 1 
       1475 1 1 1 1  79 LYS QE   . 157 . HE#  1 1 
       1475 1 2 1 1  83 LEU HG   . 161 . HG   1 1 
       1476 1 1 1 1  79 LYS QE   . 157 . HE#  1 1 
       1476 1 2 1 1  83 LEU MD1  . 161 . HD1# 1 1 
       1477 1 1 1 1  79 LYS QE   . 157 . HE#  1 1 
       1477 1 2 1 1  83 LEU MD2  . 161 . HD2# 1 1 
       1478 1 1 1 1  80 VAL HA   . 158 . HA   1 1 
       1478 1 2 1 1  83 LEU QB   . 161 . HB#  1 1 
       1479 1 1 1 1  81 MET H    . 159 . HN   1 1 
       1479 1 2 1 1  81 MET QG   . 159 . HG#  1 1 
       1480 1 1 1 1  81 MET ME   . 159 . HE#  1 1 
       1480 1 2 1 1  81 MET QG   . 159 . HG#  1 1 
       1481 1 1 1 1  81 MET QG   . 159 . HG#  1 1 
       1481 1 2 1 1  82 GLU H    . 160 . HN   1 1 
       1482 1 1 1 1  82 GLU H    . 160 . HN   1 1 
       1482 1 2 1 1  82 GLU QG   . 160 . HG#  1 1 
       1483 1 1 1 1  82 GLU HA   . 160 . HA   1 1 
       1483 1 2 1 1  82 GLU QG   . 160 . HG#  1 1 
       1484 1 1 1 1  82 GLU QG   . 160 . HG#  1 1 
       1484 1 2 1 1  83 LEU H    . 161 . HN   1 1 
       1485 1 1 1 1  83 LEU QB   . 161 . HB#  1 1 
       1485 1 2 1 1  84 HIS H    . 162 . HN   1 1 
       1486 1 1 1 1  83 LEU QB   . 161 . HB#  1 1 
       1486 1 2 1 1  87 TYR QE   . 165 . HE#  1 1 
       1487 1 1 1 1  84 HIS HA   . 162 . HA   1 1 
       1487 1 2 1 1  87 TYR QB   . 165 . HB#  1 1 
       1488 1 1 1 1  84 HIS QB   . 162 . HB#  1 1 
       1488 1 2 1 1  85 LYS H    . 163 . HN   1 1 
       1489 1 1 1 1  85 LYS H    . 163 . HN   1 1 
       1489 1 2 1 1  85 LYS QB   . 163 . HB#  1 1 
       1490 1 1 1 1  85 LYS H    . 163 . HN   1 1 
       1490 1 2 1 1  85 LYS QG   . 163 . HG#  1 1 
       1491 1 1 1 1  85 LYS HA   . 163 . HA   1 1 
       1491 1 2 1 1  85 LYS QG   . 163 . HG#  1 1 
       1492 1 1 1 1  85 LYS QB   . 163 . HB#  1 1 
       1492 1 2 1 1  86 SER H    . 164 . HN   1 1 
       1493 1 1 1 1  86 SER H    . 164 . HN   1 1 
       1493 1 2 1 1  86 SER QB   . 164 . HB#  1 1 
       1494 1 1 1 1  87 TYR H    . 165 . HN   1 1 
       1494 1 2 1 1  87 TYR QB   . 165 . HB#  1 1 
       1495 1 1 1 1  87 TYR QB   . 165 . HB#  1 1 
       1495 1 2 1 1  90 MET ME   . 168 . HE#  1 1 
       1496 1 1 1 1  90 MET QB   . 168 . HB#  1 1 
       1496 1 2 1 1  90 MET ME   . 168 . HE#  1 1 
       1497 1 1 1 1  90 MET QB   . 168 . HB#  1 1 
       1497 1 2 1 1  95 ALA MB   . 173 . HB#  1 1 
       1498 1 1 1 1  90 MET ME   . 168 . HE#  1 1 
       1498 1 2 1 1  90 MET QG   . 168 . HG#  1 1 
       1499 1 1 1 1  90 MET QG   . 168 . HG#  1 1 
       1499 1 2 1 1  91 THR H    . 169 . HN   1 1 
       1500 1 1 1 1  90 MET QG   . 168 . HG#  1 1 
       1500 1 2 1 1  94 GLN H    . 172 . HN   1 1 
       1501 1 1 1 1  90 MET QG   . 168 . HG#  1 1 
       1501 1 2 1 1  95 ALA H    . 173 . HN   1 1 
       1502 1 1 1 1  90 MET QG   . 168 . HG#  1 1 
       1502 1 2 1 1  95 ALA MB   . 173 . HB#  1 1 
       1503 1 1 1 1  90 MET ME   . 168 . HE#  1 1 
       1503 1 2 1 1  94 GLN QB   . 172 . HB#  1 1 
       1504 1 1 1 1  91 THR H    . 169 . HN   1 1 
       1504 1 2 1 1  94 GLN QB   . 172 . HB#  1 1 
       1505 1 1 1 1  92 PRO QG   . 170 . HG#  1 1 
       1505 1 2 1 1  93 ALA H    . 171 . HN   1 1 
       1506 1 1 1 1  93 ALA HA   . 171 . HA   1 1 
       1506 1 2 1 1  96 ASP QB   . 174 . HB#  1 1 
       1507 1 1 1 1  94 GLN H    . 172 . HN   1 1 
       1507 1 2 1 1  94 GLN QB   . 172 . HB#  1 1 
       1508 1 1 1 1  94 GLN H    . 172 . HN   1 1 
       1508 1 2 1 1  94 GLN QE   . 172 . HE2# 1 1 
       1509 1 1 1 1  94 GLN H    . 172 . HN   1 1 
       1509 1 2 1 1  97 LEU QB   . 175 . HB#  1 1 
       1510 1 1 1 1  94 GLN QB   . 172 . HB#  1 1 
       1510 1 2 1 1  95 ALA H    . 173 . HN   1 1 
       1511 1 1 1 1  94 GLN QB   . 172 . HB#  1 1 
       1511 1 2 1 1  95 ALA MB   . 173 . HB#  1 1 
       1512 1 1 1 1  96 ASP H    . 174 . HN   1 1 
       1512 1 2 1 1  96 ASP QB   . 174 . HB#  1 1 
       1513 1 1 1 1  96 ASP H    . 174 . HN   1 1 
       1513 1 2 1 1  97 LEU QB   . 175 . HB#  1 1 
       1514 1 1 1 1  96 ASP HA   . 174 . HA   1 1 
       1514 1 2 1 1  99 PHE QB   . 177 . HB#  1 1 
       1515 1 1 1 1  96 ASP QB   . 174 . HB#  1 1 
       1515 1 2 1 1  97 LEU H    . 175 . HN   1 1 
       1516 1 1 1 1  97 LEU QB   . 175 . HB#  1 1 
       1516 1 2 1 1  97 LEU MD2  . 175 . HD2# 1 1 
       1517 1 1 1 1  98 GLU H    . 176 . HN   1 1 
       1517 1 2 1 1  98 GLU QG   . 176 . HG#  1 1 
       1518 1 1 1 1  98 GLU HA   . 176 . HA   1 1 
       1518 1 2 1 1 101 GLU QB   . 179 . HB#  1 1 
       1519 1 1 1 1  99 PHE H    . 177 . HN   1 1 
       1519 1 2 1 1  99 PHE QB   . 177 . HB#  1 1 
       1520 1 1 1 1  99 PHE QB   . 177 . HB#  1 1 
       1520 1 2 1 1 100 LEU H    . 178 . HN   1 1 
       1521 1 1 1 1  99 PHE QB   . 177 . HB#  1 1 
       1521 1 2 1 1 100 LEU MD2  . 178 . HD2# 1 1 
       1522 1 1 1 1 100 LEU H    . 178 . HN   1 1 
       1522 1 2 1 1 100 LEU QB   . 178 . HB#  1 1 
       1523 1 1 1 1 100 LEU QB   . 178 . HB#  1 1 
       1523 1 2 1 1 100 LEU MD1  . 178 . HD1# 1 1 
       1524 1 1 1 1 100 LEU QB   . 178 . HB#  1 1 
       1524 1 2 1 1 101 GLU H    . 179 . HN   1 1 
       1525 1 1 1 1 100 LEU QB   . 178 . HB#  1 1 
       1525 1 2 1 1 103 ALA MB   . 181 . HB#  1 1 
       1526 1 1 1 1 101 GLU H    . 179 . HN   1 1 
       1526 1 2 1 1 101 GLU QB   . 179 . HB#  1 1 
       1527 1 1 1 1 101 GLU QB   . 179 . HB#  1 1 
       1527 1 2 1 1 102 ASN H    . 180 . HN   1 1 
       1528 1 1 1 1 101 GLU QB   . 179 . HB#  1 1 
       1528 1 2 1 1 102 ASN QD   . 180 . HD2# 1 1 
       1529 1 1 1 1 102 ASN H    . 180 . HN   1 1 
       1529 1 2 1 1 102 ASN QD   . 180 . HD2# 1 1 
       1530 1 1 1 1 103 ALA MB   . 181 . HB#  1 1 
       1530 1 2 1 1 108 MET QB   . 186 . HB#  1 1 
       1531 1 1 1 1 103 ALA MB   . 181 . HB#  1 1 
       1531 1 2 1 1 108 MET QG   . 186 . HG#  1 1 
       1532 1 1 1 1 104 LYS QB   . 182 . HB#  1 1 
       1532 1 2 1 1 104 LYS QE   . 182 . HE#  1 1 
       1533 1 1 1 1 104 LYS QB   . 182 . HB#  1 1 
       1533 1 2 1 1 109 TYR QE   . 187 . HE#  1 1 
       1534 1 1 1 1 105 LYS H    . 183 . HN   1 1 
       1534 1 2 1 1 105 LYS QG   . 183 . HG#  1 1 
       1535 1 1 1 1 105 LYS HA   . 183 . HA   1 1 
       1535 1 2 1 1 105 LYS QG   . 183 . HG#  1 1 
       1536 1 1 1 1 105 LYS QE   . 183 . HE#  1 1 
       1536 1 2 1 1 105 LYS QG   . 183 . HG#  1 1 
       1537 1 1 1 1 108 MET H    . 186 . HN   1 1 
       1537 1 2 1 1 108 MET QB   . 186 . HB#  1 1 
       1538 1 1 1 1 108 MET H    . 186 . HN   1 1 
       1538 1 2 1 1 108 MET QG   . 186 . HG#  1 1 
       1539 1 1 1 1 108 MET HA   . 186 . HA   1 1 
       1539 1 2 1 1 108 MET QG   . 186 . HG#  1 1 
       1540 1 1 1 1 108 MET QB   . 186 . HB#  1 1 
       1540 1 2 1 1 108 MET ME   . 186 . HE#  1 1 
       1541 1 1 1 1 108 MET QB   . 186 . HB#  1 1 
       1541 1 2 1 1 109 TYR H    . 187 . HN   1 1 
       1542 1 1 1 1 108 MET QG   . 186 . HG#  1 1 
       1542 1 2 1 1 109 TYR QD   . 187 . HD#  1 1 
       1543 1 1 1 1 108 MET QG   . 186 . HG#  1 1 
       1543 1 2 1 1 109 TYR QE   . 187 . HE#  1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

          1 1 . . . . . 3.85 1.8 3.85 1 1 
          2 1 . . . . . 3.56 1.8 3.56 1 1 
          3 1 . . . . . 3.64 1.8 3.64 1 1 
          4 1 . . . . . 3.64 1.8 3.64 1 1 
          5 1 . . . . . 3.02 1.8 3.02 1 1 
          6 1 . . . . . 3.89 1.8 3.89 1 1 
          7 1 . . . . . 3.89 1.8 3.89 1 1 
          8 1 . . . . . 3.81 1.8 3.81 1 1 
          9 1 . . . . . 3.77 1.8 3.77 1 1 
         10 1 . . . . . 3.71 1.8 3.71 1 1 
         11 1 . . . . . 3.87 1.8 3.87 1 1 
         12 1 . . . . . 3.87 1.8 3.87 1 1 
         13 1 . . . . . 3.83 1.8 3.83 1 1 
         14 1 . . . . . 3.53 1.8 3.53 1 1 
         15 1 . . . . . 3.32 1.8 3.32 1 1 
         16 1 . . . . . 5.24 1.8 5.24 1 1 
         17 1 . . . . . 5.38 1.8 5.38 1 1 
         18 1 . . . . . 3.71 1.8 3.71 1 1 
         19 1 . . . . . 3.71 1.8 3.71 1 1 
         20 1 . . . . . 3.31 1.8 3.31 1 1 
         21 1 . . . . .  3.2 1.8  3.2 1 1 
         22 1 . . . . . 3.93 1.8 3.93 1 1 
         23 1 . . . . . 3.92 1.8 3.92 1 1 
         24 1 . . . . . 3.58 1.8 3.58 1 1 
         25 1 . . . . . 3.88 1.8 3.88 1 1 
         26 1 . . . . . 3.93 1.8 3.93 1 1 
         27 1 . . . . . 3.93 1.8 3.93 1 1 
         28 1 . . . . . 3.77 1.8 3.77 1 1 
         29 1 . . . . . 3.82 1.8 3.82 1 1 
         30 1 . . . . . 3.89 1.8 3.89 1 1 
         31 1 . . . . .  4.1 1.8  4.1 1 1 
         32 1 . . . . . 4.41 1.8 4.41 1 1 
         33 1 . . . . . 3.36 1.8 3.36 1 1 
         34 1 . . . . . 3.66 1.8 3.66 1 1 
         35 1 . . . . .  3.5 1.8  3.5 1 1 
         36 1 . . . . . 3.77 1.8 3.77 1 1 
         37 1 . . . . . 2.97 1.8 2.97 1 1 
         38 1 . . . . . 4.32 1.8 4.32 1 1 
         39 1 . . . . . 3.12 1.8 3.12 1 1 
         40 1 . . . . . 4.72 1.8 4.72 1 1 
         41 1 . . . . . 5.32 1.8 5.32 1 1 
         42 1 . . . . . 3.29 1.8 3.29 1 1 
         43 1 . . . . . 3.52 1.8 3.52 1 1 
         44 1 . . . . . 3.66 1.8 3.66 1 1 
         45 1 . . . . . 3.15 1.8 3.15 1 1 
         46 1 . . . . . 3.97 1.8 3.97 1 1 
         47 1 . . . . . 3.63 1.8 3.63 1 1 
         48 1 . . . . . 3.29 1.8 3.29 1 1 
         49 1 . . . . . 3.54 1.8 3.54 1 1 
         50 1 . . . . . 4.12 1.8 4.12 1 1 
         51 1 . . . . . 3.51 1.8 3.51 1 1 
         52 1 . . . . . 3.88 1.8 3.88 1 1 
         53 1 . . . . . 3.59 1.8 3.59 1 1 
         54 1 . . . . . 2.87 1.8 2.87 1 1 
         55 1 . . . . . 3.78 1.8 3.78 1 1 
         56 1 . . . . . 3.14 1.8 3.14 1 1 
         57 1 . . . . . 3.89 1.8 3.89 1 1 
         58 1 . . . . . 3.46 1.8 3.46 1 1 
         59 1 . . . . . 4.22 1.8 4.22 1 1 
         60 1 . . . . . 3.49 1.8 3.49 1 1 
         61 1 . . . . . 3.56 1.8 3.56 1 1 
         62 1 . . . . .  3.8 3.8  3.8 1 1 
         63 1 . . . . . 3.73 1.8 3.73 1 1 
         64 1 . . . . . 3.73 1.8 3.73 1 1 
         65 1 . . . . .  3.3 1.8  3.3 1 1 
         66 1 . . . . . 3.77 1.8 3.77 1 1 
         67 1 . . . . . 3.62 1.8 3.62 1 1 
         68 1 . . . . . 3.62 1.8 3.62 1 1 
         69 1 . . . . . 3.22 1.8 3.22 1 1 
         70 1 . . . . . 3.92 1.8 3.92 1 1 
         71 1 . . . . . 3.42 1.8 3.42 1 1 
         72 1 . . . . . 3.85 1.8 3.85 1 1 
         73 1 . . . . .  4.1 1.8  4.1 1 1 
         74 1 . . . . . 3.79 1.8 3.79 1 1 
         75 1 . . . . . 3.81 1.8 3.81 1 1 
         76 1 . . . . . 3.72 1.8 3.72 1 1 
         77 1 . . . . . 3.54 1.8 3.54 1 1 
         78 1 . . . . . 3.25 1.8 3.25 1 1 
         79 1 . . . . . 3.48 1.8 3.48 1 1 
         80 1 . . . . . 3.36 1.8 3.36 1 1 
         81 1 . . . . . 3.82 1.8 3.82 1 1 
         82 1 . . . . . 3.78 1.8 3.78 1 1 
         83 1 . . . . . 3.78 1.8 3.78 1 1 
         84 1 . . . . . 3.69 1.8 3.69 1 1 
         85 1 . . . . . 3.69 1.8 3.69 1 1 
         86 1 . . . . . 4.08 1.8 4.08 1 1 
         87 1 . . . . .  3.1 1.8  3.1 1 1 
         88 1 . . . . .  3.9 1.8  3.9 1 1 
         89 1 . . . . . 3.66 1.8 3.66 1 1 
         90 1 . . . . . 3.77 1.8 3.77 1 1 
         91 1 . . . . . 3.49 1.8 3.49 1 1 
         92 1 . . . . . 3.49 1.8 3.49 1 1 
         93 1 . . . . . 4.33 1.8 4.33 1 1 
         94 1 . . . . . 4.82 1.8 4.82 1 1 
         95 1 . . . . . 4.24 1.8 4.24 1 1 
         96 1 . . . . . 4.56 1.8 4.56 1 1 
         97 1 . . . . . 3.78 1.8 3.78 1 1 
         98 1 . . . . . 3.81 1.8 3.81 1 1 
         99 1 . . . . . 3.81 1.8 3.81 1 1 
        100 1 . . . . . 3.47 1.8 3.47 1 1 
        101 1 . . . . . 3.86 1.8 3.86 1 1 
        102 1 . . . . . 3.89 1.8 3.89 1 1 
        103 1 . . . . . 3.89 1.8 3.89 1 1 
        104 1 . . . . . 4.15 1.8 4.15 1 1 
        105 1 . . . . . 3.84 1.8 3.84 1 1 
        106 1 . . . . . 3.55 1.8 3.55 1 1 
        107 1 . . . . . 3.86 1.8 3.86 1 1 
        108 1 . . . . . 4.06 1.8 4.06 1 1 
        109 1 . . . . . 4.06 1.8 4.06 1 1 
        110 1 . . . . . 3.58 1.8 3.58 1 1 
        111 1 . . . . . 3.67 1.8 3.67 1 1 
        112 1 . . . . . 3.05 1.8 3.05 1 1 
        113 1 . . . . . 3.67 1.8 3.67 1 1 
        114 1 . . . . . 3.67 1.8 3.67 1 1 
        115 1 . . . . . 3.54 1.8 3.54 1 1 
        116 1 . . . . . 3.66 1.8 3.66 1 1 
        117 1 . . . . . 3.74 1.8 3.74 1 1 
        118 1 . . . . . 4.32 1.8 4.32 1 1 
        119 1 . . . . . 3.82 1.8 3.82 1 1 
        120 1 . . . . . 3.82 1.8 3.82 1 1 
        121 1 . . . . . 3.62 1.8 3.62 1 1 
        122 1 . . . . . 3.78 1.8 3.78 1 1 
        123 1 . . . . . 3.78 1.8 3.78 1 1 
        124 1 . . . . . 3.62 1.8 3.62 1 1 
        125 1 . . . . . 3.91 1.8 3.91 1 1 
        126 1 . . . . . 3.22 1.8 3.22 1 1 
        127 1 . . . . . 3.49 1.8 3.49 1 1 
        128 1 . . . . . 3.46 1.8 3.46 1 1 
        129 1 . . . . . 3.78 1.8 3.78 1 1 
        130 1 . . . . .  3.9 1.8  3.9 1 1 
        131 1 . . . . . 3.91 1.8 3.91 1 1 
        132 1 . . . . . 3.91 1.8 3.91 1 1 
        133 1 . . . . . 3.08 1.8 3.08 1 1 
        134 1 . . . . . 3.65 1.8 3.65 1 1 
        135 1 . . . . . 3.59 1.8 3.59 1 1 
        136 1 . . . . . 3.55 1.8 3.55 1 1 
        137 1 . . . . . 3.84 1.8 3.84 1 1 
        138 1 . . . . . 3.75 1.8 3.75 1 1 
        139 1 . . . . . 3.86 1.8 3.86 1 1 
        140 1 . . . . . 3.85 1.8 3.85 1 1 
        141 1 . . . . . 3.94 1.8 3.94 1 1 
        142 1 . . . . . 3.32 1.8 3.32 1 1 
        143 1 . . . . . 3.76 1.8 3.76 1 1 
        144 1 . . . . . 3.44 1.8 3.44 1 1 
        145 1 . . . . . 3.57 1.8 3.57 1 1 
        146 1 . . . . . 4.04 1.8 4.04 1 1 
        147 1 . . . . . 3.49 1.8 3.49 1 1 
        148 1 . . . . . 3.75 1.8 3.75 1 1 
        149 1 . . . . . 3.67 1.8 3.67 1 1 
        150 1 . . . . . 4.13 1.8 4.13 1 1 
        151 1 . . . . . 3.84 1.8 3.84 1 1 
        152 1 . . . . . 3.05 1.8 3.05 1 1 
        153 1 . . . . . 4.44 1.8 4.44 1 1 
        154 1 . . . . . 4.66 1.8 4.66 1 1 
        155 1 . . . . .  3.7 1.8  3.7 1 1 
        156 1 . . . . . 3.42 1.8 3.42 1 1 
        157 1 . . . . . 3.98 1.8 3.98 1 1 
        158 1 . . . . .  3.7 1.8  3.7 1 1 
        159 1 . . . . . 3.75 1.8 3.75 1 1 
        160 1 . . . . . 3.28 1.8 3.28 1 1 
        161 1 . . . . . 3.81 1.8 3.81 1 1 
        162 1 . . . . . 3.81 1.8 3.81 1 1 
        163 1 . . . . . 3.99 1.8 3.99 1 1 
        164 1 . . . . . 3.91 1.8 3.91 1 1 
        165 1 . . . . . 3.91 1.8 3.91 1 1 
        166 1 . . . . . 3.59 1.8 3.59 1 1 
        167 1 . . . . . 3.44 1.8 3.44 1 1 
        168 1 . . . . . 3.44 1.8 3.44 1 1 
        169 1 . . . . . 3.63 1.8 3.63 1 1 
        170 1 . . . . . 3.63 1.8 3.63 1 1 
        171 1 . . . . . 4.91 1.8 4.91 1 1 
        172 1 . . . . . 4.91 1.8 4.91 1 1 
        173 1 . . . . . 4.11 1.8 4.11 1 1 
        174 1 . . . . . 3.82 1.8 3.82 1 1 
        175 1 . . . . . 4.02 1.8 4.02 1 1 
        176 1 . . . . . 4.38 1.8 4.38 1 1 
        177 1 . . . . . 3.81 1.8 3.81 1 1 
        178 1 . . . . . 3.74 1.8 3.74 1 1 
        179 1 . . . . . 3.96 1.8 3.96 1 1 
        180 1 . . . . . 3.91 1.8 3.91 1 1 
        181 1 . . . . . 4.79 1.8 4.79 1 1 
        182 1 . . . . . 3.93 1.8 3.93 1 1 
        183 1 . . . . . 4.47 1.8 4.47 1 1 
        184 1 . . . . . 3.93 1.8 3.93 1 1 
        185 1 . . . . . 3.78 1.8 3.78 1 1 
        186 1 . . . . . 3.66 1.8 3.66 1 1 
        187 1 . . . . . 3.66 1.8 3.66 1 1 
        188 1 . . . . .  3.5 1.8  3.5 1 1 
        189 1 . . . . . 3.75 1.8 3.75 1 1 
        190 1 . . . . . 3.77 1.8 3.77 1 1 
        191 1 . . . . . 3.45 1.8 3.45 1 1 
        192 1 . . . . . 3.98 1.8 3.98 1 1 
        193 1 . . . . . 3.66 1.8 3.66 1 1 
        194 1 . . . . . 4.13 1.8 4.13 1 1 
        195 1 . . . . . 4.13 1.8 4.13 1 1 
        196 1 . . . . .  3.7 1.8  3.7 1 1 
        197 1 . . . . . 3.75 1.8 3.75 1 1 
        198 1 . . . . . 4.01 1.8 4.01 1 1 
        199 1 . . . . . 3.72 1.8 3.72 1 1 
        200 1 . . . . . 3.72 1.8 3.72 1 1 
        201 1 . . . . . 3.73 1.8 3.73 1 1 
        202 1 . . . . . 3.75 1.8 3.75 1 1 
        203 1 . . . . . 3.45 1.8 3.45 1 1 
        204 1 . . . . . 3.27 1.8 3.27 1 1 
        205 1 . . . . . 3.86 1.8 3.86 1 1 
        206 1 . . . . . 3.51 1.8 3.51 1 1 
        207 1 . . . . . 4.45 1.8 4.45 1 1 
        208 1 . . . . . 3.55 1.8 3.55 1 1 
        209 1 . . . . . 3.98 1.8 3.98 1 1 
        210 1 . . . . . 3.56 1.8 3.56 1 1 
        211 1 . . . . . 4.03 1.8 4.03 1 1 
        212 1 . . . . . 3.99 1.8 3.99 1 1 
        213 1 . . . . . 3.81 1.8 3.81 1 1 
        214 1 . . . . . 4.07 1.8 4.07 1 1 
        215 1 . . . . .  3.5 1.8  3.5 1 1 
        216 1 . . . . . 3.52 1.8 3.52 1 1 
        217 1 . . . . . 3.55 1.8 3.55 1 1 
        218 1 . . . . . 3.55 1.8 3.55 1 1 
        219 1 . . . . . 4.01 1.8 4.01 1 1 
        220 1 . . . . . 3.69 1.8 3.69 1 1 
        221 1 . . . . . 3.99 1.8 3.99 1 1 
        222 1 . . . . . 3.74 1.8 3.74 1 1 
        223 1 . . . . . 4.21 1.8 4.21 1 1 
        224 1 . . . . . 3.78 1.8 3.78 1 1 
        225 1 . . . . . 3.74 1.8 3.74 1 1 
        226 1 . . . . . 3.25 1.8 3.25 1 1 
        227 1 . . . . . 3.92 1.8 3.92 1 1 
        228 1 . . . . . 4.22 1.8 4.22 1 1 
        229 1 . . . . . 3.86 1.8 3.86 1 1 
        230 1 . . . . . 3.86 1.8 3.86 1 1 
        231 1 . . . . . 4.07 1.8 4.07 1 1 
        232 1 . . . . . 4.07 1.8 4.07 1 1 
        233 1 . . . . . 4.77 1.8 4.77 1 1 
        234 1 . . . . . 5.16 1.8 5.16 1 1 
        235 1 . . . . . 3.73 1.8 3.73 1 1 
        236 1 . . . . .  3.9 1.8  3.9 1 1 
        237 1 . . . . .  3.9 1.8  3.9 1 1 
        238 1 . . . . . 4.38 1.8 4.38 1 1 
        239 1 . . . . . 3.03 1.8 3.03 1 1 
        240 1 . . . . . 3.13 1.8 3.13 1 1 
        241 1 . . . . . 3.42 1.8 3.42 1 1 
        242 1 . . . . . 3.92 1.8 3.92 1 1 
        243 1 . . . . . 4.12 1.8 4.12 1 1 
        244 1 . . . . . 3.83 1.8 3.83 1 1 
        245 1 . . . . . 4.18 1.8 4.18 1 1 
        246 1 . . . . . 3.79 1.8 3.79 1 1 
        247 1 . . . . . 3.56 1.8 3.56 1 1 
        248 1 . . . . . 3.56 1.8 3.56 1 1 
        249 1 . . . . . 3.82 1.8 3.82 1 1 
        250 1 . . . . . 3.66 1.8 3.66 1 1 
        251 1 . . . . . 3.84 1.8 3.84 1 1 
        252 1 . . . . .  3.4 1.8  3.4 1 1 
        253 1 . . . . . 3.51 1.8 3.51 1 1 
        254 1 . . . . . 3.92 1.8 3.92 1 1 
        255 1 . . . . .  3.5 1.8  3.5 1 1 
        256 1 . . . . . 3.82 1.8 3.82 1 1 
        257 1 . . . . . 2.93 1.8 2.93 1 1 
        258 1 . . . . . 4.17 1.8 4.17 1 1 
        259 1 . . . . . 4.17 1.8 4.17 1 1 
        260 1 . . . . . 4.07 1.8 4.07 1 1 
        261 1 . . . . . 4.07 1.8 4.07 1 1 
        262 1 . . . . . 4.07 1.8 4.07 1 1 
        263 1 . . . . .  5.0 1.8  5.0 1 1 
        264 1 . . . . . 5.24 1.8 5.24 1 1 
        265 1 . . . . . 4.14 1.8 4.14 1 1 
        266 1 . . . . . 4.13 1.8 4.13 1 1 
        267 1 . . . . . 4.81 1.8 4.81 1 1 
        268 1 . . . . . 4.24 1.8 4.24 1 1 
        269 1 . . . . . 4.08 1.8 4.08 1 1 
        270 1 . . . . .  4.1 1.8  4.1 1 1 
        271 1 . . . . . 4.08 1.8 4.08 1 1 
        272 1 . . . . . 4.05 1.8 4.05 1 1 
        273 1 . . . . . 3.98 1.8 3.98 1 1 
        274 1 . . . . . 4.07 1.8 4.07 1 1 
        275 1 . . . . . 3.97 1.8 3.97 1 1 
        276 1 . . . . . 4.83 1.8 4.83 1 1 
        277 1 . . . . . 3.97 1.8 3.97 1 1 
        278 1 . . . . . 3.96 1.8 3.96 1 1 
        279 1 . . . . .  4.5 1.8  4.5 1 1 
        280 1 . . . . .  4.5 1.8  4.5 1 1 
        281 1 . . . . . 4.08 1.8 4.08 1 1 
        282 1 . . . . . 3.96 1.8 3.96 1 1 
        283 1 . . . . . 4.07 1.8 4.07 1 1 
        284 1 . . . . . 4.07 1.8 4.07 1 1 
        285 1 . . . . . 4.04 1.8 4.04 1 1 
        286 1 . . . . . 4.25 1.8 4.25 1 1 
        287 1 . . . . . 4.59 1.8 4.59 1 1 
        288 1 . . . . . 4.06 1.8 4.06 1 1 
        289 1 . . . . . 4.67 1.8 4.67 1 1 
        290 1 . . . . . 4.18 1.8 4.18 1 1 
        291 1 . . . . . 4.77 1.8 4.77 1 1 
        292 1 . . . . . 5.21 1.8 5.21 1 1 
        293 1 . . . . . 4.29 1.8 4.29 1 1 
        294 1 . . . . . 4.06 1.8 4.06 1 1 
        295 1 . . . . . 3.95 1.8 3.95 1 1 
        296 1 . . . . . 3.95 1.8 3.95 1 1 
        297 1 . . . . . 3.96 1.8 3.96 1 1 
        298 1 . . . . . 5.06 1.8 5.06 1 1 
        299 1 . . . . . 4.53 1.8 4.53 1 1 
        300 1 . . . . . 4.18 1.8 4.18 1 1 
        301 1 . . . . . 4.36 1.8 4.36 1 1 
        302 1 . . . . . 4.26 1.8 4.26 1 1 
        303 1 . . . . . 4.08 1.8 4.08 1 1 
        304 1 . . . . . 3.96 1.8 3.96 1 1 
        305 1 . . . . . 4.05 1.8 4.05 1 1 
        306 1 . . . . . 3.94 1.8 3.94 1 1 
        307 1 . . . . . 4.48 1.8 4.48 1 1 
        308 1 . . . . . 5.25 1.8 5.25 1 1 
        309 1 . . . . . 4.04 1.8 4.04 1 1 
        310 1 . . . . . 3.98 1.8 3.98 1 1 
        311 1 . . . . . 4.48 1.8 4.48 1 1 
        312 1 . . . . . 5.16 1.8 5.16 1 1 
        313 1 . . . . . 3.99 1.8 3.99 1 1 
        314 1 . . . . . 4.01 1.8 4.01 1 1 
        315 1 . . . . . 4.08 1.8 4.08 1 1 
        316 1 . . . . .  4.0 1.8  4.0 1 1 
        317 1 . . . . . 3.96 1.8 3.96 1 1 
        318 1 . . . . . 4.31 1.8 4.31 1 1 
        319 1 . . . . . 3.96 1.8 3.96 1 1 
        320 1 . . . . . 3.95 1.8 3.95 1 1 
        321 1 . . . . . 4.66 1.8 4.66 1 1 
        322 1 . . . . . 4.01 1.8 4.01 1 1 
        323 1 . . . . . 4.16 1.8 4.16 1 1 
        324 1 . . . . . 4.16 1.8 4.16 1 1 
        325 1 . . . . . 3.98 1.8 3.98 1 1 
        326 1 . . . . . 4.51 1.8 4.51 1 1 
        327 1 . . . . . 4.11 1.8 4.11 1 1 
        328 1 . . . . . 3.98 1.8 3.98 1 1 
        329 1 . . . . . 4.01 1.8 4.01 1 1 
        330 1 . . . . . 3.96 1.8 3.96 1 1 
        331 1 . . . . . 4.54 1.8 4.54 1 1 
        332 1 . . . . . 4.54 1.8 4.54 1 1 
        333 1 . . . . . 4.03 1.8 4.03 1 1 
        334 1 . . . . . 4.07 1.8 4.07 1 1 
        335 1 . . . . . 4.04 1.8 4.04 1 1 
        336 1 . . . . . 4.65 1.8 4.65 1 1 
        337 1 . . . . . 3.94 1.8 3.94 1 1 
        338 1 . . . . . 4.26 1.8 4.26 1 1 
        339 1 . . . . . 4.32 1.8 4.32 1 1 
        340 1 . . . . . 3.98 1.8 3.98 1 1 
        341 1 . . . . . 4.78 1.8 4.78 1 1 
        342 1 . . . . . 5.02 1.8 5.02 1 1 
        343 1 . . . . . 3.95 1.8 3.95 1 1 
        344 1 . . . . . 4.55 1.8 4.55 1 1 
        345 1 . . . . . 3.98 1.8 3.98 1 1 
        346 1 . . . . . 4.42 1.8 4.42 1 1 
        347 1 . . . . . 3.96 1.8 3.96 1 1 
        348 1 . . . . . 4.14 1.8 4.14 1 1 
        349 1 . . . . . 4.65 1.8 4.65 1 1 
        350 1 . . . . . 4.85 1.8 4.85 1 1 
        351 1 . . . . . 4.25 1.8 4.25 1 1 
        352 1 . . . . . 4.25 1.8 4.25 1 1 
        353 1 . . . . .  4.2 1.8  4.2 1 1 
        354 1 . . . . . 4.09 1.8 4.09 1 1 
        355 1 . . . . . 4.32 1.8 4.32 1 1 
        356 1 . . . . . 4.89 1.8 4.89 1 1 
        357 1 . . . . . 4.24 1.8 4.24 1 1 
        358 1 . . . . . 4.72 1.8 4.72 1 1 
        359 1 . . . . . 4.31 1.8 4.31 1 1 
        360 1 . . . . . 4.21 1.8 4.21 1 1 
        361 1 . . . . . 4.34 1.8 4.34 1 1 
        362 1 . . . . . 4.27 1.8 4.27 1 1 
        363 1 . . . . . 4.17 1.8 4.17 1 1 
        364 1 . . . . . 4.21 1.8 4.21 1 1 
        365 1 . . . . . 4.52 1.8 4.52 1 1 
        366 1 . . . . . 4.21 1.8 4.21 1 1 
        367 1 . . . . . 4.26 1.8 4.26 1 1 
        368 1 . . . . . 4.18 1.8 4.18 1 1 
        369 1 . . . . . 4.84 1.8 4.84 1 1 
        370 1 . . . . . 4.65 1.8 4.65 1 1 
        371 1 . . . . . 4.36 1.8 4.36 1 1 
        372 1 . . . . . 4.18 1.8 4.18 1 1 
        373 1 . . . . . 4.31 1.8 4.31 1 1 
        374 1 . . . . . 4.79 1.8 4.79 1 1 
        375 1 . . . . . 4.75 1.8 4.75 1 1 
        376 1 . . . . . 4.17 1.8 4.17 1 1 
        377 1 . . . . . 4.15 1.8 4.15 1 1 
        378 1 . . . . . 4.17 1.8 4.17 1 1 
        379 1 . . . . . 4.17 1.8 4.17 1 1 
        380 1 . . . . .  5.1 1.8  5.1 1 1 
        381 1 . . . . . 5.39 1.8 5.39 1 1 
        382 1 . . . . . 4.18 1.8 4.18 1 1 
        383 1 . . . . . 4.19 1.8 4.19 1 1 
        384 1 . . . . . 4.17 1.8 4.17 1 1 
        385 1 . . . . . 4.16 1.8 4.16 1 1 
        386 1 . . . . . 4.24 1.8 4.24 1 1 
        387 1 . . . . . 4.12 1.8 4.12 1 1 
        388 1 . . . . . 4.21 1.8 4.21 1 1 
        389 1 . . . . . 5.11 1.8 5.11 1 1 
        390 1 . . . . . 4.45 1.8 4.45 1 1 
        391 1 . . . . . 4.59 1.8 4.59 1 1 
        392 1 . . . . . 4.62 1.8 4.62 1 1 
        393 1 . . . . . 5.01 1.8 5.01 1 1 
        394 1 . . . . . 5.01 1.8 5.01 1 1 
        395 1 . . . . . 4.27 1.8 4.27 1 1 
        396 1 . . . . . 4.27 1.8 4.27 1 1 
        397 1 . . . . . 4.18 1.8 4.18 1 1 
        398 1 . . . . . 4.41 1.8 4.41 1 1 
        399 1 . . . . .  5.5 1.8  5.5 1 1 
        400 1 . . . . .  5.5 1.8  5.5 1 1 
        401 1 . . . . . 4.16 1.8 4.16 1 1 
        402 1 . . . . . 4.38 1.8 4.38 1 1 
        403 1 . . . . . 4.82 1.8 4.82 1 1 
        404 1 . . . . . 4.11 1.8 4.11 1 1 
        405 1 . . . . . 4.09 1.8 4.09 1 1 
        406 1 . . . . . 4.12 1.8 4.12 1 1 
        407 1 . . . . . 4.53 1.8 4.53 1 1 
        408 1 . . . . . 4.91 1.8 4.91 1 1 
        409 1 . . . . . 4.51 1.8 4.51 1 1 
        410 1 . . . . . 4.27 1.8 4.27 1 1 
        411 1 . . . . . 4.12 1.8 4.12 1 1 
        412 1 . . . . . 4.63 1.8 4.63 1 1 
        413 1 . . . . . 4.16 1.8 4.16 1 1 
        414 1 . . . . .  4.2 1.8  4.2 1 1 
        415 1 . . . . .  5.1 1.8  5.1 1 1 
        416 1 . . . . . 5.38 1.8 5.38 1 1 
        417 1 . . . . . 4.22 1.8 4.22 1 1 
        418 1 . . . . . 4.77 1.8 4.77 1 1 
        419 1 . . . . . 4.14 1.8 4.14 1 1 
        420 1 . . . . . 4.27 1.8 4.27 1 1 
        421 1 . . . . . 4.12 1.8 4.12 1 1 
        422 1 . . . . .  4.2 1.8  4.2 1 1 
        423 1 . . . . . 4.25 1.8 4.25 1 1 
        424 1 . . . . . 4.26 1.8 4.26 1 1 
        425 1 . . . . . 4.12 1.8 4.12 1 1 
        426 1 . . . . . 4.96 1.8 4.96 1 1 
        427 1 . . . . . 4.96 1.8 4.96 1 1 
        428 1 . . . . . 4.78 1.8 4.78 1 1 
        429 1 . . . . . 4.51 1.8 4.51 1 1 
        430 1 . . . . . 4.12 1.8 4.12 1 1 
        431 1 . . . . . 4.11 1.8 4.11 1 1 
        432 1 . . . . . 4.17 1.8 4.17 1 1 
        433 1 . . . . . 4.55 1.8 4.55 1 1 
        434 1 . . . . . 4.28 1.8 4.28 1 1 
        435 1 . . . . . 4.21 1.8 4.21 1 1 
        436 1 . . . . . 4.35 1.8 4.35 1 1 
        437 1 . . . . . 4.24 1.8 4.24 1 1 
        438 1 . . . . . 5.37 1.8 5.37 1 1 
        439 1 . . . . . 5.04 1.8 5.04 1 1 
        440 1 . . . . . 5.03 1.8 5.03 1 1 
        441 1 . . . . .  3.6 1.8  3.6 1 1 
        442 1 . . . . . 4.63 1.8 4.63 1 1 
        443 1 . . . . . 4.81 1.8 4.81 1 1 
        444 1 . . . . .  4.4 1.8  4.4 1 1 
        445 1 . . . . . 4.32 1.8 4.32 1 1 
        446 1 . . . . . 4.31 1.8 4.31 1 1 
        447 1 . . . . . 4.31 1.8 4.31 1 1 
        448 1 . . . . . 4.98 1.8 4.98 1 1 
        449 1 . . . . . 5.41 1.8 5.41 1 1 
        450 1 . . . . . 4.62 1.8 4.62 1 1 
        451 1 . . . . . 4.34 1.8 4.34 1 1 
        452 1 . . . . . 4.39 1.8 4.39 1 1 
        453 1 . . . . . 4.37 1.8 4.37 1 1 
        454 1 . . . . . 4.32 1.8 4.32 1 1 
        455 1 . . . . . 4.93 1.8 4.93 1 1 
        456 1 . . . . . 4.63 1.8 4.63 1 1 
        457 1 . . . . . 4.33 1.8 4.33 1 1 
        458 1 . . . . . 4.57 1.8 4.57 1 1 
        459 1 . . . . . 4.81 1.8 4.81 1 1 
        460 1 . . . . . 5.06 1.8 5.06 1 1 
        461 1 . . . . . 4.38 1.8 4.38 1 1 
        462 1 . . . . . 4.35 1.8 4.35 1 1 
        463 1 . . . . . 4.34 1.8 4.34 1 1 
        464 1 . . . . . 4.34 1.8 4.34 1 1 
        465 1 . . . . . 4.32 1.8 4.32 1 1 
        466 1 . . . . . 4.33 1.8 4.33 1 1 
        467 1 . . . . . 4.64 1.8 4.64 1 1 
        468 1 . . . . . 4.34 1.8 4.34 1 1 
        469 1 . . . . . 4.84 1.8 4.84 1 1 
        470 1 . . . . .  4.7 1.8  4.7 1 1 
        471 1 . . . . . 4.57 1.8 4.57 1 1 
        472 1 . . . . . 4.91 1.8 4.91 1 1 
        473 1 . . . . . 4.31 1.8 4.31 1 1 
        474 1 . . . . . 4.31 1.8 4.31 1 1 
        475 1 . . . . . 4.41 1.8 4.41 1 1 
        476 1 . . . . . 4.32 1.8 4.32 1 1 
        477 1 . . . . . 4.67 1.8 4.67 1 1 
        478 1 . . . . . 5.09 1.8 5.09 1 1 
        479 1 . . . . . 4.32 1.8 4.32 1 1 
        480 1 . . . . . 4.31 1.8 4.31 1 1 
        481 1 . . . . . 4.64 1.8 4.64 1 1 
        482 1 . . . . . 4.41 1.8 4.41 1 1 
        483 1 . . . . . 4.35 1.8 4.35 1 1 
        484 1 . . . . . 4.56 1.8 4.56 1 1 
        485 1 . . . . . 4.37 1.8 4.37 1 1 
        486 1 . . . . . 4.32 1.8 4.32 1 1 
        487 1 . . . . . 4.41 1.8 4.41 1 1 
        488 1 . . . . .  4.3 1.8  4.3 1 1 
        489 1 . . . . . 4.66 1.8 4.66 1 1 
        490 1 . . . . . 4.38 1.8 4.38 1 1 
        491 1 . . . . . 4.33 1.8 4.33 1 1 
        492 1 . . . . . 4.32 1.8 4.32 1 1 
        493 1 . . . . . 4.38 1.8 4.38 1 1 
        494 1 . . . . . 4.54 1.8 4.54 1 1 
        495 1 . . . . . 4.38 1.8 4.38 1 1 
        496 1 . . . . . 4.69 1.8 4.69 1 1 
        497 1 . . . . . 4.32 1.8 4.32 1 1 
        498 1 . . . . .  5.4 1.8  5.4 1 1 
        499 1 . . . . .  5.5 1.8  5.5 1 1 
        500 1 . . . . .  4.3 1.8  4.3 1 1 
        501 1 . . . . . 4.37 1.8 4.37 1 1 
        502 1 . . . . . 4.35 1.8 4.35 1 1 
        503 1 . . . . .  4.9 1.8  4.9 1 1 
        504 1 . . . . . 3.78 1.8 3.78 1 1 
        505 1 . . . . . 3.44 1.8 3.44 1 1 
        506 1 . . . . . 4.23 1.8 4.23 1 1 
        507 1 . . . . .  4.5 1.8  4.5 1 1 
        508 1 . . . . . 5.43 1.8 5.43 1 1 
        509 1 . . . . .  5.5 1.8  5.5 1 1 
        510 1 . . . . .  5.5 1.8  5.5 1 1 
        511 1 . . . . .  5.5 1.8  5.5 1 1 
        512 1 . . . . .  5.5 1.8  5.5 1 1 
        513 1 . . . . . 4.58 1.8 4.58 1 1 
        514 1 . . . . . 4.53 1.8 4.53 1 1 
        515 1 . . . . . 4.73 1.8 4.73 1 1 
        516 1 . . . . . 4.45 1.8 4.45 1 1 
        517 1 . . . . . 5.08 1.8 5.08 1 1 
        518 1 . . . . .  5.4 1.8  5.4 1 1 
        519 1 . . . . .  5.5 1.8  5.5 1 1 
        520 1 . . . . .  5.5 1.8  5.5 1 1 
        521 1 . . . . . 4.55 1.8 4.55 1 1 
        522 1 . . . . . 4.48 1.8 4.48 1 1 
        523 1 . . . . . 5.24 1.8 5.24 1 1 
        524 1 . . . . .  4.7 1.8  4.7 1 1 
        525 1 . . . . . 4.59 1.8 4.59 1 1 
        526 1 . . . . . 5.24 1.8 5.24 1 1 
        527 1 . . . . .  5.5 1.8  5.5 1 1 
        528 1 . . . . . 4.58 1.8 4.58 1 1 
        529 1 . . . . . 4.86 1.8 4.86 1 1 
        530 1 . . . . . 4.49 1.8 4.49 1 1 
        531 1 . . . . . 4.43 1.8 4.43 1 1 
        532 1 . . . . . 4.77 1.8 4.77 1 1 
        533 1 . . . . . 4.56 1.8 4.56 1 1 
        534 1 . . . . . 4.54 1.8 4.54 1 1 
        535 1 . . . . .  5.5 1.8  5.5 1 1 
        536 1 . . . . . 4.45 1.8 4.45 1 1 
        537 1 . . . . . 4.72 1.8 4.72 1 1 
        538 1 . . . . . 5.01 1.8 5.01 1 1 
        539 1 . . . . .  5.5 1.8  5.5 1 1 
        540 1 . . . . .  5.5 1.8  5.5 1 1 
        541 1 . . . . . 4.46 1.8 4.46 1 1 
        542 1 . . . . . 4.43 1.8 4.43 1 1 
        543 1 . . . . . 4.51 1.8 4.51 1 1 
        544 1 . . . . . 4.57 1.8 4.57 1 1 
        545 1 . . . . . 4.45 1.8 4.45 1 1 
        546 1 . . . . . 4.54 1.8 4.54 1 1 
        547 1 . . . . .  4.5 1.8  4.5 1 1 
        548 1 . . . . . 5.14 1.8 5.14 1 1 
        549 1 . . . . . 4.58 1.8 4.58 1 1 
        550 1 . . . . . 4.51 1.8 4.51 1 1 
        551 1 . . . . .  5.1 1.8  5.1 1 1 
        552 1 . . . . . 4.55 1.8 4.55 1 1 
        553 1 . . . . . 4.51 1.8 4.51 1 1 
        554 1 . . . . . 4.71 1.8 4.71 1 1 
        555 1 . . . . . 4.43 1.8 4.43 1 1 
        556 1 . . . . . 4.51 1.8 4.51 1 1 
        557 1 . . . . . 4.49 1.8 4.49 1 1 
        558 1 . . . . . 4.54 1.8 4.54 1 1 
        559 1 . . . . . 4.51 1.8 4.51 1 1 
        560 1 . . . . . 4.58 1.8 4.58 1 1 
        561 1 . . . . . 5.26 1.8 5.26 1 1 
        562 1 . . . . . 5.06 1.8 5.06 1 1 
        563 1 . . . . .  5.5 1.8  5.5 1 1 
        564 1 . . . . . 4.77 1.8 4.77 1 1 
        565 1 . . . . . 4.53 1.8 4.53 1 1 
        566 1 . . . . . 4.44 1.8 4.44 1 1 
        567 1 . . . . . 4.84 1.8 4.84 1 1 
        568 1 . . . . . 4.55 1.8 4.55 1 1 
        569 1 . . . . . 4.55 1.8 4.55 1 1 
        570 1 . . . . .  5.5 1.8  5.5 1 1 
        571 1 . . . . . 4.97 1.8 4.97 1 1 
        572 1 . . . . . 4.63 1.8 4.63 1 1 
        573 1 . . . . . 4.47 1.8 4.47 1 1 
        574 1 . . . . . 4.44 1.8 4.44 1 1 
        575 1 . . . . . 4.57 1.8 4.57 1 1 
        576 1 . . . . . 4.56 1.8 4.56 1 1 
        577 1 . . . . . 4.77 1.8 4.77 1 1 
        578 1 . . . . . 4.63 1.8 4.63 1 1 
        579 1 . . . . . 4.03 1.8 4.03 1 1 
        580 1 . . . . . 4.31 1.8 4.31 1 1 
        581 1 . . . . . 3.61 1.8 3.61 1 1 
        582 1 . . . . . 3.61 1.8 3.61 1 1 
        583 1 . . . . . 3.65 1.8 3.65 1 1 
        584 1 . . . . . 4.33 1.8 4.33 1 1 
        585 1 . . . . . 3.66 1.8 3.66 1 1 
        586 1 . . . . . 4.34 1.8 4.34 1 1 
        587 1 . . . . . 5.38 1.8 5.38 1 1 
        588 1 . . . . .  5.5 1.8  5.5 1 1 
        589 1 . . . . . 4.63 1.8 4.63 1 1 
        590 1 . . . . . 5.22 1.8 5.22 1 1 
        591 1 . . . . . 4.64 1.8 4.64 1 1 
        592 1 . . . . .  5.5 1.8  5.5 1 1 
        593 1 . . . . . 4.62 1.8 4.62 1 1 
        594 1 . . . . . 4.99 1.8 4.99 1 1 
        595 1 . . . . . 4.67 1.8 4.67 1 1 
        596 1 . . . . . 4.64 1.8 4.64 1 1 
        597 1 . . . . . 4.69 1.8 4.69 1 1 
        598 1 . . . . . 5.19 1.8 5.19 1 1 
        599 1 . . . . .  4.9 1.8  4.9 1 1 
        600 1 . . . . .  4.6 1.8  4.6 1 1 
        601 1 . . . . . 4.65 1.8 4.65 1 1 
        602 1 . . . . . 4.75 1.8 4.75 1 1 
        603 1 . . . . . 4.93 1.8 4.93 1 1 
        604 1 . . . . .  5.5 1.8  5.5 1 1 
        605 1 . . . . . 4.63 1.8 4.63 1 1 
        606 1 . . . . . 4.64 1.8 4.64 1 1 
        607 1 . . . . . 4.71 1.8 4.71 1 1 
        608 1 . . . . . 4.62 1.8 4.62 1 1 
        609 1 . . . . . 4.64 1.8 4.64 1 1 
        610 1 . . . . . 4.69 1.8 4.69 1 1 
        611 1 . . . . .  5.5 1.8  5.5 1 1 
        612 1 . . . . . 4.67 1.8 4.67 1 1 
        613 1 . . . . .  5.0 1.8  5.0 1 1 
        614 1 . . . . .  5.5 1.8  5.5 1 1 
        615 1 . . . . .  5.5 1.8  5.5 1 1 
        616 1 . . . . . 5.04 1.8 5.04 1 1 
        617 1 . . . . . 5.02 1.8 5.02 1 1 
        618 1 . . . . . 5.21 1.8 5.21 1 1 
        619 1 . . . . . 4.65 1.8 4.65 1 1 
        620 1 . . . . . 4.72 1.8 4.72 1 1 
        621 1 . . . . .  4.6 1.8  4.6 1 1 
        622 1 . . . . . 4.63 1.8 4.63 1 1 
        623 1 . . . . . 5.47 1.8 5.47 1 1 
        624 1 . . . . . 4.67 1.8 4.67 1 1 
        625 1 . . . . . 4.74 1.8 4.74 1 1 
        626 1 . . . . . 4.64 1.8 4.64 1 1 
        627 1 . . . . . 4.69 1.8 4.69 1 1 
        628 1 . . . . . 4.89 1.8 4.89 1 1 
        629 1 . . . . . 4.94 1.8 4.94 1 1 
        630 1 . . . . . 5.38 1.8 5.38 1 1 
        631 1 . . . . . 4.73 1.8 4.73 1 1 
        632 1 . . . . . 4.65 1.8 4.65 1 1 
        633 1 . . . . . 4.77 1.8 4.77 1 1 
        634 1 . . . . .  3.9 1.8  3.9 1 1 
        635 1 . . . . . 3.31 1.8 3.31 1 1 
        636 1 . . . . . 3.99 1.8 3.99 1 1 
        637 1 . . . . . 3.98 1.8 3.98 1 1 
        638 1 . . . . . 3.82 1.8 3.82 1 1 
        639 1 . . . . . 3.85 1.8 3.85 1 1 
        640 1 . . . . . 4.12 1.8 4.12 1 1 
        641 1 . . . . . 4.05 1.8 4.05 1 1 
        642 1 . . . . . 4.65 1.8 4.65 1 1 
        643 1 . . . . . 4.65 1.8 4.65 1 1 
        644 1 . . . . . 4.17 1.8 4.17 1 1 
        645 1 . . . . .  4.1 1.8  4.1 1 1 
        646 1 . . . . . 5.48 1.8 5.48 1 1 
        647 1 . . . . .  4.2 1.8  4.2 1 1 
        648 1 . . . . .  5.5 1.8  5.5 1 1 
        649 1 . . . . .  5.5 1.8  5.5 1 1 
        650 1 . . . . . 4.23 1.8 4.23 1 1 
        651 1 . . . . . 5.07 1.8 5.07 1 1 
        652 1 . . . . . 4.73 1.8 4.73 1 1 
        653 1 . . . . . 4.73 1.8 4.73 1 1 
        654 1 . . . . . 3.68 1.8 3.68 1 1 
        655 1 . . . . . 4.63 1.8 4.63 1 1 
        656 1 . . . . . 4.58 1.8 4.58 1 1 
        657 1 . . . . . 3.65 1.8 3.65 1 1 
        658 1 . . . . . 4.05 1.8 4.05 1 1 
        659 1 . . . . . 4.05 1.8 4.05 1 1 
        660 1 . . . . . 4.44 1.8 4.44 1 1 
        661 1 . . . . . 4.74 1.8 4.74 1 1 
        662 1 . . . . . 4.91 1.8 4.91 1 1 
        663 1 . . . . . 3.82 1.8 3.82 1 1 
        664 1 . . . . . 3.82 1.8 3.82 1 1 
        665 1 . . . . . 4.05 1.8 4.05 1 1 
        666 1 . . . . . 4.81 1.8 4.81 1 1 
        667 1 . . . . . 5.44 1.8 5.44 1 1 
        668 1 . . . . .  5.5 1.8  5.5 1 1 
        669 1 . . . . . 4.38 1.8 4.38 1 1 
        670 1 . . . . . 3.08 1.8 3.08 1 1 
        671 1 . . . . . 3.91 1.8 3.91 1 1 
        672 1 . . . . .  5.5 1.8  5.5 1 1 
        673 1 . . . . . 4.51 1.8 4.51 1 1 
        674 1 . . . . . 4.51 1.8 4.51 1 1 
        675 1 . . . . . 4.09 1.8 4.09 1 1 
        676 1 . . . . . 4.86 1.8 4.86 1 1 
        677 1 . . . . .  4.5 1.8  4.5 1 1 
        678 1 . . . . .  4.5 1.8  4.5 1 1 
        679 1 . . . . . 5.19 1.8 5.19 1 1 
        680 1 . . . . . 4.22 1.8 4.22 1 1 
        681 1 . . . . . 4.88 1.8 4.88 1 1 
        682 1 . . . . . 4.24 1.8 4.24 1 1 
        683 1 . . . . . 4.88 1.8 4.88 1 1 
        684 1 . . . . .  5.1 1.8  5.1 1 1 
        685 1 . . . . . 3.82 1.8 3.82 1 1 
        686 1 . . . . . 4.06 1.8 4.06 1 1 
        687 1 . . . . . 4.66 1.8 4.66 1 1 
        688 1 . . . . . 4.66 1.8 4.66 1 1 
        689 1 . . . . . 4.64 1.8 4.64 1 1 
        690 1 . . . . . 4.26 1.8 4.26 1 1 
        691 1 . . . . . 4.51 1.8 4.51 1 1 
        692 1 . . . . . 3.91 1.8 3.91 1 1 
        693 1 . . . . . 5.05 1.8 5.05 1 1 
        694 1 . . . . . 4.36 1.8 4.36 1 1 
        695 1 . . . . . 4.15 1.8 4.15 1 1 
        696 1 . . . . . 4.37 1.8 4.37 1 1 
        697 1 . . . . . 4.64 1.8 4.64 1 1 
        698 1 . . . . . 4.05 1.8 4.05 1 1 
        699 1 . . . . . 4.56 1.8 4.56 1 1 
        700 1 . . . . .  4.1 1.8  4.1 1 1 
        701 1 . . . . . 3.59 1.8 3.59 1 1 
        702 1 . . . . .  4.3 1.8  4.3 1 1 
        703 1 . . . . . 5.11 1.8 5.11 1 1 
        704 1 . . . . . 3.74 1.8 3.74 1 1 
        705 1 . . . . . 4.04 1.8 4.04 1 1 
        706 1 . . . . . 3.68 1.8 3.68 1 1 
        707 1 . . . . . 4.04 1.8 4.04 1 1 
        708 1 . . . . . 3.97 1.8 3.97 1 1 
        709 1 . . . . . 4.26 1.8 4.26 1 1 
        710 1 . . . . .  5.0 1.8  5.0 1 1 
        711 1 . . . . . 3.07 1.8 3.07 1 1 
        712 1 . . . . . 4.24 1.8 4.24 1 1 
        713 1 . . . . . 3.06 1.8 3.06 1 1 
        714 1 . . . . . 3.79 1.8 3.79 1 1 
        715 1 . . . . . 3.95 1.8 3.95 1 1 
        716 1 . . . . . 3.49 1.8 3.49 1 1 
        717 1 . . . . .  4.1 1.8  4.1 1 1 
        718 1 . . . . . 4.34 1.8 4.34 1 1 
        719 1 . . . . . 4.01 1.8 4.01 1 1 
        720 1 . . . . . 3.04 1.8 3.04 1 1 
        721 1 . . . . . 4.07 1.8 4.07 1 1 
        722 1 . . . . . 3.62 1.8 3.62 1 1 
        723 1 . . . . . 4.57 1.8 4.57 1 1 
        724 1 . . . . . 4.07 1.8 4.07 1 1 
        725 1 . . . . . 4.03 1.8 4.03 1 1 
        726 1 . . . . . 4.06 1.8 4.06 1 1 
        727 1 . . . . . 4.09 1.8 4.09 1 1 
        728 1 . . . . . 3.93 1.8 3.93 1 1 
        729 1 . . . . . 3.38 1.8 3.38 1 1 
        730 1 . . . . . 3.38 1.8 3.38 1 1 
        731 1 . . . . . 4.43 1.8 4.43 1 1 
        732 1 . . . . . 3.37 1.8 3.37 1 1 
        733 1 . . . . .  3.3 1.8  3.3 1 1 
        734 1 . . . . .  3.5 1.8  3.5 1 1 
        735 1 . . . . .  4.7 1.8  4.7 1 1 
        736 1 . . . . . 4.11 1.8 4.11 1 1 
        737 1 . . . . . 4.02 1.8 4.02 1 1 
        738 1 . . . . . 3.95 1.8 3.95 1 1 
        739 1 . . . . . 4.07 1.8 4.07 1 1 
        740 1 . . . . . 3.94 1.8 3.94 1 1 
        741 1 . . . . . 3.94 1.8 3.94 1 1 
        742 1 . . . . . 3.46 1.8 3.46 1 1 
        743 1 . . . . . 3.57 1.8 3.57 1 1 
        744 1 . . . . . 3.87 1.8 3.87 1 1 
        745 1 . . . . . 3.45 1.8 3.45 1 1 
        746 1 . . . . . 3.64 1.8 3.64 1 1 
        747 1 . . . . . 3.01 1.8 3.01 1 1 
        748 1 . . . . . 3.59 1.8 3.59 1 1 
        749 1 . . . . . 4.63 1.8 4.63 1 1 
        750 1 . . . . . 3.49 1.8 3.49 1 1 
        751 1 . . . . . 4.12 1.8 4.12 1 1 
        752 1 . . . . . 4.58 1.8 4.58 1 1 
        753 1 . . . . . 3.72 1.8 3.72 1 1 
        754 1 . . . . . 4.82 1.8 4.82 1 1 
        755 1 . . . . .  4.4 1.8  4.4 1 1 
        756 1 . . . . . 4.95 1.8 4.95 1 1 
        757 1 . . . . . 4.57 1.8 4.57 1 1 
        758 1 . . . . . 4.41 1.8 4.41 1 1 
        759 1 . . . . . 4.04 1.8 4.04 1 1 
        760 1 . . . . . 3.73 1.8 3.73 1 1 
        761 1 . . . . . 4.14 1.8 4.14 1 1 
        762 1 . . . . . 4.14 1.8 4.14 1 1 
        763 1 . . . . . 4.49 1.8 4.49 1 1 
        764 1 . . . . . 4.49 1.8 4.49 1 1 
        765 1 . . . . .  4.6 1.8  4.6 1 1 
        766 1 . . . . . 4.87 1.8 4.87 1 1 
        767 1 . . . . . 3.96 1.8 3.96 1 1 
        768 1 . . . . . 4.47 1.8 4.47 1 1 
        769 1 . . . . . 5.06 1.8 5.06 1 1 
        770 1 . . . . .  4.7 1.8  4.7 1 1 
        771 1 . . . . . 3.99 1.8 3.99 1 1 
        772 1 . . . . . 4.67 1.8 4.67 1 1 
        773 1 . . . . . 4.31 1.8 4.31 1 1 
        774 1 . . . . .  5.5 1.8  5.5 1 1 
        775 1 . . . . . 4.63 1.8 4.63 1 1 
        776 1 . . . . . 4.09 1.8 4.09 1 1 
        777 1 . . . . . 4.55 1.8 4.55 1 1 
        778 1 . . . . . 4.09 1.8 4.09 1 1 
        779 1 . . . . . 3.56 1.8 3.56 1 1 
        780 1 . . . . . 4.53 1.8 4.53 1 1 
        781 1 . . . . . 4.39 1.8 4.39 1 1 
        782 1 . . . . . 4.69 1.8 4.69 1 1 
        783 1 . . . . . 4.48 1.8 4.48 1 1 
        784 1 . . . . . 4.59 1.8 4.59 1 1 
        785 1 . . . . . 4.98 1.8 4.98 1 1 
        786 1 . . . . . 4.39 1.8 4.39 1 1 
        787 1 . . . . . 4.11 1.8 4.11 1 1 
        788 1 . . . . . 4.11 1.8 4.11 1 1 
        789 1 . . . . . 3.79 1.8 3.79 1 1 
        790 1 . . . . . 3.14 1.8 3.14 1 1 
        791 1 . . . . . 3.75 1.8 3.75 1 1 
        792 1 . . . . . 3.97 1.8 3.97 1 1 
        793 1 . . . . . 4.46 1.8 4.46 1 1 
        794 1 . . . . . 4.13 1.8 4.13 1 1 
        795 1 . . . . . 4.25 1.8 4.25 1 1 
        796 1 . . . . . 3.82 1.8 3.82 1 1 
        797 1 . . . . . 4.77 1.8 4.77 1 1 
        798 1 . . . . . 5.05 1.8 5.05 1 1 
        799 1 . . . . . 5.21 1.8 5.21 1 1 
        800 1 . . . . . 4.84 1.8 4.84 1 1 
        801 1 . . . . . 4.55 1.8 4.55 1 1 
        802 1 . . . . . 4.16 1.8 4.16 1 1 
        803 1 . . . . . 4.57 1.8 4.57 1 1 
        804 1 . . . . . 4.22 1.8 4.22 1 1 
        805 1 . . . . . 3.89 1.8 3.89 1 1 
        806 1 . . . . . 4.04 1.8 4.04 1 1 
        807 1 . . . . .  4.5 1.8  4.5 1 1 
        808 1 . . . . . 4.39 1.8 4.39 1 1 
        809 1 . . . . . 4.56 1.8 4.56 1 1 
        810 1 . . . . . 5.05 1.8 5.05 1 1 
        811 1 . . . . . 4.47 1.8 4.47 1 1 
        812 1 . . . . . 4.43 1.8 4.43 1 1 
        813 1 . . . . . 5.46 1.8 5.46 1 1 
        814 1 . . . . . 5.32 1.8 5.32 1 1 
        815 1 . . . . . 4.48 1.8 4.48 1 1 
        816 1 . . . . . 4.88 1.8 4.88 1 1 
        817 1 . . . . . 3.77 1.8 3.77 1 1 
        818 1 . . . . . 5.45 1.8 5.45 1 1 
        819 1 . . . . . 5.36 1.8 5.36 1 1 
        820 1 . . . . .  5.5 1.8  5.5 1 1 
        821 1 . . . . .  4.6 1.8  4.6 1 1 
        822 1 . . . . . 3.41 1.8 3.41 1 1 
        823 1 . . . . . 3.72 1.8 3.72 1 1 
        824 1 . . . . . 4.92 1.8 4.92 1 1 
        825 1 . . . . . 4.64 1.8 4.64 1 1 
        826 1 . . . . . 5.15 1.8 5.15 1 1 
        827 1 . . . . . 3.41 1.8 3.41 1 1 
        828 1 . . . . . 4.82 1.8 4.82 1 1 
        829 1 . . . . . 3.72 1.8 3.72 1 1 
        830 1 . . . . .  4.0 1.8  4.0 1 1 
        831 1 . . . . . 3.61 1.8 3.61 1 1 
        832 1 . . . . . 3.57 1.8 3.57 1 1 
        833 1 . . . . .  4.0 1.8  4.0 1 1 
        834 1 . . . . . 3.41 1.8 3.41 1 1 
        835 1 . . . . . 4.36 1.8 4.36 1 1 
        836 1 . . . . . 3.96 1.8 3.96 1 1 
        837 1 . . . . . 4.35 1.8 4.35 1 1 
        838 1 . . . . . 3.16 1.8 3.16 1 1 
        839 1 . . . . . 3.88 1.8 3.88 1 1 
        840 1 . . . . . 4.04 1.8 4.04 1 1 
        841 1 . . . . . 4.01 1.8 4.01 1 1 
        842 1 . . . . . 5.46 1.8 5.46 1 1 
        843 1 . . . . .  5.5 1.8  5.5 1 1 
        844 1 . . . . . 3.67 1.8 3.67 1 1 
        845 1 . . . . . 3.37 1.8 3.37 1 1 
        846 1 . . . . . 5.29 1.8 5.29 1 1 
        847 1 . . . . . 3.63 1.8 3.63 1 1 
        848 1 . . . . .  3.7 1.8  3.7 1 1 
        849 1 . . . . . 4.31 1.8 4.31 1 1 
        850 1 . . . . .  4.4 1.8  4.4 1 1 
        851 1 . . . . . 4.92 1.8 4.92 1 1 
        852 1 . . . . . 3.74 1.8 3.74 1 1 
        853 1 . . . . . 4.11 1.8 4.11 1 1 
        854 1 . . . . . 4.32 1.8 4.32 1 1 
        855 1 . . . . . 4.32 1.8 4.32 1 1 
        856 1 . . . . .  3.2 1.8  3.2 1 1 
        857 1 . . . . . 4.65 1.8 4.65 1 1 
        858 1 . . . . .  4.5 1.8  4.5 1 1 
        859 1 . . . . . 5.02 1.8 5.02 1 1 
        860 1 . . . . . 3.59 1.8 3.59 1 1 
        861 1 . . . . . 3.82 1.8 3.82 1 1 
        862 1 . . . . . 4.96 1.8 4.96 1 1 
        863 1 . . . . . 4.35 1.8 4.35 1 1 
        864 1 . . . . . 4.34 1.8 4.34 1 1 
        865 1 . . . . . 4.88 1.8 4.88 1 1 
        866 1 . . . . . 3.17 1.8 3.17 1 1 
        867 1 . . . . .  3.6 1.8  3.6 1 1 
        868 1 . . . . . 3.75 1.8 3.75 1 1 
        869 1 . . . . . 3.73 1.8 3.73 1 1 
        870 1 . . . . . 4.63 1.8 4.63 1 1 
        871 1 . . . . .  3.1 1.8  3.1 1 1 
        872 1 . . . . . 4.62 1.8 4.62 1 1 
        873 1 . . . . . 3.65 1.8 3.65 1 1 
        874 1 . . . . . 3.14 1.8 3.14 1 1 
        875 1 . . . . . 3.27 1.8 3.27 1 1 
        876 1 . . . . . 3.81 1.8 3.81 1 1 
        877 1 . . . . . 4.25 1.8 4.25 1 1 
        878 1 . . . . . 4.37 1.8 4.37 1 1 
        879 1 . . . . . 3.46 1.8 3.46 1 1 
        880 1 . . . . . 3.95 1.8 3.95 1 1 
        881 1 . . . . . 3.79 1.8 3.79 1 1 
        882 1 . . . . . 3.88 1.8 3.88 1 1 
        883 1 . . . . . 3.88 1.8 3.88 1 1 
        884 1 . . . . . 3.06 1.8 3.06 1 1 
        885 1 . . . . . 3.26 1.8 3.26 1 1 
        886 1 . . . . . 4.88 1.8 4.88 1 1 
        887 1 . . . . . 4.76 1.8 4.76 1 1 
        888 1 . . . . . 3.33 1.8 3.33 1 1 
        889 1 . . . . . 3.29 1.8 3.29 1 1 
        890 1 . . . . .  3.3 1.8  3.3 1 1 
        891 1 . . . . . 4.62 1.8 4.62 1 1 
        892 1 . . . . . 3.38 1.8 3.38 1 1 
        893 1 . . . . . 3.31 1.8 3.31 1 1 
        894 1 . . . . . 3.77 1.8 3.77 1 1 
        895 1 . . . . . 4.81 1.8 4.81 1 1 
        896 1 . . . . .  3.1 1.8  3.1 1 1 
        897 1 . . . . .  5.5 1.8  5.5 1 1 
        898 1 . . . . .  5.5 1.8  5.5 1 1 
        899 1 . . . . . 4.55 1.8 4.55 1 1 
        900 1 . . . . . 3.31 1.8 3.31 1 1 
        901 1 . . . . . 4.76 1.8 4.76 1 1 
        902 1 . . . . . 3.94 1.8 3.94 1 1 
        903 1 . . . . . 3.58 1.8 3.58 1 1 
        904 1 . . . . . 4.34 1.8 4.34 1 1 
        905 1 . . . . . 3.57 1.8 3.57 1 1 
        906 1 . . . . . 3.27 1.8 3.27 1 1 
        907 1 . . . . . 5.01 1.8 5.01 1 1 
        908 1 . . . . .  4.3 1.8  4.3 1 1 
        909 1 . . . . . 3.66 1.8 3.66 1 1 
        910 1 . . . . . 3.64 1.8 3.64 1 1 
        911 1 . . . . . 3.59 1.8 3.59 1 1 
        912 1 . . . . . 4.63 1.8 4.63 1 1 
        913 1 . . . . .  5.1 1.8  5.1 1 1 
        914 1 . . . . . 5.27 1.8 5.27 1 1 
        915 1 . . . . . 3.71 1.8 3.71 1 1 
        916 1 . . . . . 4.24 1.8 4.24 1 1 
        917 1 . . . . . 4.56 1.8 4.56 1 1 
        918 1 . . . . . 5.17 1.8 5.17 1 1 
        919 1 . . . . . 5.35 1.8 5.35 1 1 
        920 1 . . . . . 4.78 1.8 4.78 1 1 
        921 1 . . . . . 4.24 1.8 4.24 1 1 
        922 1 . . . . . 3.83 1.8 3.83 1 1 
        923 1 . . . . . 3.92 1.8 3.92 1 1 
        924 1 . . . . . 3.09 1.8 3.09 1 1 
        925 1 . . . . . 3.72 1.8 3.72 1 1 
        926 1 . . . . .  4.6 1.8  4.6 1 1 
        927 1 . . . . .  4.6 1.8  4.6 1 1 
        928 1 . . . . . 4.15 1.8 4.15 1 1 
        929 1 . . . . . 4.28 1.8 4.28 1 1 
        930 1 . . . . . 3.79 1.8 3.79 1 1 
        931 1 . . . . . 4.13 1.8 4.13 1 1 
        932 1 . . . . . 4.56 1.8 4.56 1 1 
        933 1 . . . . . 4.46 1.8 4.46 1 1 
        934 1 . . . . . 3.51 1.8 3.51 1 1 
        935 1 . . . . .  4.2 1.8  4.2 1 1 
        936 1 . . . . . 4.11 1.8 4.11 1 1 
        937 1 . . . . .  4.7 1.8  4.7 1 1 
        938 1 . . . . . 4.97 1.8 4.97 1 1 
        939 1 . . . . . 5.05 1.8 5.05 1 1 
        940 1 . . . . . 3.14 1.8 3.14 1 1 
        941 1 . . . . . 4.27 1.8 4.27 1 1 
        942 1 . . . . . 3.06 1.8 3.06 1 1 
        943 1 . . . . . 4.05 1.8 4.05 1 1 
        944 1 . . . . . 4.24 1.8 4.24 1 1 
        945 1 . . . . . 3.48 1.8 3.48 1 1 
        946 1 . . . . . 4.83 1.8 4.83 1 1 
        947 1 . . . . . 3.25 1.8 3.25 1 1 
        948 1 . . . . . 4.71 1.8 4.71 1 1 
        949 1 . . . . . 4.34 1.8 4.34 1 1 
        950 1 . . . . .  5.5 1.8  5.5 1 1 
        951 1 . . . . . 4.89 1.8 4.89 1 1 
        952 1 . . . . . 5.05 1.8 5.05 1 1 
        953 1 . . . . . 5.45 1.8 5.45 1 1 
        954 1 . . . . . 5.02 1.8 5.02 1 1 
        955 1 . . . . . 4.84 1.8 4.84 1 1 
        956 1 . . . . . 4.71 1.8 4.71 1 1 
        957 1 . . . . .  5.5 1.8  5.5 1 1 
        958 1 . . . . .  5.5 1.8  5.5 1 1 
        959 1 . . . . . 5.16 1.8 5.16 1 1 
        960 1 . . . . .  4.6 1.8  4.6 1 1 
        961 1 . . . . .  3.7 1.8  3.7 1 1 
        962 1 . . . . . 4.91 1.8 4.91 1 1 
        963 1 . . . . .  5.5 1.8  5.5 1 1 
        964 1 . . . . . 4.92 1.8 4.92 1 1 
        965 1 . . . . . 5.02 1.8 5.02 1 1 
        966 1 . . . . .  5.5 1.8  5.5 1 1 
        967 1 . . . . . 4.72 1.8 4.72 1 1 
        968 1 . . . . . 4.66 1.8 4.66 1 1 
        969 1 . . . . .  5.5 1.8  5.5 1 1 
        970 1 . . . . .  5.5 1.8  5.5 1 1 
        971 1 . . . . .  5.5 1.8  5.5 1 1 
        972 1 . . . . .  5.5 1.8  5.5 1 1 
        973 1 . . . . .  5.5 1.8  5.5 1 1 
        974 1 . . . . . 4.94 1.8 4.94 1 1 
        975 1 . . . . . 5.13 1.8 5.13 1 1 
        976 1 . . . . . 5.49 1.8 5.49 1 1 
        977 1 . . . . . 4.59 1.8 4.59 1 1 
        978 1 . . . . . 5.19 1.8 5.19 1 1 
        979 1 . . . . . 3.91 1.8 3.91 1 1 
        980 1 . . . . .  4.4 1.8  4.4 1 1 
        981 1 . . . . . 4.77 1.8 4.77 1 1 
        982 1 . . . . .  3.5 1.8  3.5 1 1 
        983 1 . . . . . 4.34 1.8 4.34 1 1 
        984 1 . . . . . 5.36 1.8 5.36 1 1 
        985 1 . . . . .  5.5 1.8  5.5 1 1 
        986 1 . . . . . 4.13 1.8 4.13 1 1 
        987 1 . . . . . 4.78 1.8 4.78 1 1 
        988 1 . . . . . 4.85 1.8 4.85 1 1 
        989 1 . . . . . 3.42 1.8 3.42 1 1 
        990 1 . . . . . 4.17 1.8 4.17 1 1 
        991 1 . . . . . 4.19 1.8 4.19 1 1 
        992 1 . . . . . 4.22 1.8 4.22 1 1 
        993 1 . . . . . 4.34 1.8 4.34 1 1 
        994 1 . . . . . 4.89 1.8 4.89 1 1 
        995 1 . . . . .  5.5 1.8  5.5 1 1 
        996 1 . . . . . 4.75 1.8 4.75 1 1 
        997 1 . . . . . 3.64 1.8 3.64 1 1 
        998 1 . . . . . 4.17 1.8 4.17 1 1 
        999 1 . . . . . 4.53 1.8 4.53 1 1 
       1000 1 . . . . .  4.2 1.8  4.2 1 1 
       1001 1 . . . . . 3.99 1.8 3.99 1 1 
       1002 1 . . . . . 3.82 1.8 3.82 1 1 
       1003 1 . . . . .  4.7 1.8  4.7 1 1 
       1004 1 . . . . . 3.86 1.8 3.86 1 1 
       1005 1 . . . . . 4.25 1.8 4.25 1 1 
       1006 1 . . . . . 3.75 1.8 3.75 1 1 
       1007 1 . . . . . 3.82 1.8 3.82 1 1 
       1008 1 . . . . . 5.17 1.8 5.17 1 1 
       1009 1 . . . . .  5.5 1.8  5.5 1 1 
       1010 1 . . . . . 4.18 1.8 4.18 1 1 
       1011 1 . . . . . 4.94 1.8 4.94 1 1 
       1012 1 . . . . . 4.07 1.8 4.07 1 1 
       1013 1 . . . . . 3.31 1.8 3.31 1 1 
       1014 1 . . . . . 4.11 1.8 4.11 1 1 
       1015 1 . . . . . 4.11 1.8 4.11 1 1 
       1016 1 . . . . . 4.22 1.8 4.22 1 1 
       1017 1 . . . . .  3.2 1.8  3.2 1 1 
       1018 1 . . . . . 4.11 1.8 4.11 1 1 
       1019 1 . . . . . 4.64 1.8 4.64 1 1 
       1020 1 . . . . . 4.39 1.8 4.39 1 1 
       1021 1 . . . . . 4.45 1.8 4.45 1 1 
       1022 1 . . . . . 5.37 1.8 5.37 1 1 
       1023 1 . . . . . 4.79 1.8 4.79 1 1 
       1024 1 . . . . . 5.14 1.8 5.14 1 1 
       1025 1 . . . . . 4.61 1.8 4.61 1 1 
       1026 1 . . . . . 4.58 1.8 4.58 1 1 
       1027 1 . . . . . 4.86 1.8 4.86 1 1 
       1028 1 . . . . . 4.65 1.8 4.65 1 1 
       1029 1 . . . . .  3.9 1.8  3.9 1 1 
       1030 1 . . . . . 4.89 1.8 4.89 1 1 
       1031 1 . . . . . 3.23 1.8 3.23 1 1 
       1032 1 . . . . . 4.78 1.8 4.78 1 1 
       1033 1 . . . . . 4.57 1.8 4.57 1 1 
       1034 1 . . . . .  4.5 1.8  4.5 1 1 
       1035 1 . . . . . 4.28 1.8 4.28 1 1 
       1036 1 . . . . . 4.49 1.8 4.49 1 1 
       1037 1 . . . . . 4.49 1.8 4.49 1 1 
       1038 1 . . . . . 4.77 1.8 4.77 1 1 
       1039 1 . . . . .  4.8 1.8  4.8 1 1 
       1040 1 . . . . . 5.42 1.8 5.42 1 1 
       1041 1 . . . . . 4.32 1.8 4.32 1 1 
       1042 1 . . . . . 5.15 1.8 5.15 1 1 
       1043 1 . . . . .  4.7 1.8  4.7 1 1 
       1044 1 . . . . .  3.4 1.8  3.4 1 1 
       1045 1 . . . . . 4.39 1.8 4.39 1 1 
       1046 1 . . . . . 4.39 1.8 4.39 1 1 
       1047 1 . . . . . 4.23 1.8 4.23 1 1 
       1048 1 . . . . . 4.81 1.8 4.81 1 1 
       1049 1 . . . . . 4.08 1.8 4.08 1 1 
       1050 1 . . . . . 4.46 1.8 4.46 1 1 
       1051 1 . . . . . 3.88 1.8 3.88 1 1 
       1052 1 . . . . .  5.5 1.8  5.5 1 1 
       1053 1 . . . . .  5.5 1.8  5.5 1 1 
       1054 1 . . . . . 5.15 1.8 5.15 1 1 
       1055 1 . . . . . 5.05 1.8 5.05 1 1 
       1056 1 . . . . . 4.67 1.8 4.67 1 1 
       1057 1 . . . . .  5.5 1.8  5.5 1 1 
       1058 1 . . . . . 5.05 1.8 5.05 1 1 
       1059 1 . . . . . 4.64 1.8 4.64 1 1 
       1060 1 . . . . . 4.73 1.8 4.73 1 1 
       1061 1 . . . . . 4.46 1.8 4.46 1 1 
       1062 1 . . . . . 4.85 1.8 4.85 1 1 
       1063 1 . . . . .  5.5 1.8  5.5 1 1 
       1064 1 . . . . . 3.68 1.8 3.68 1 1 
       1065 1 . . . . . 3.55 1.8 3.55 1 1 
       1066 1 . . . . . 4.47 1.8 4.47 1 1 
       1067 1 . . . . . 3.68 1.8 3.68 1 1 
       1068 1 . . . . . 5.32 1.8 5.32 1 1 
       1069 1 . . . . . 4.04 1.8 4.04 1 1 
       1070 1 . . . . . 5.29 1.8 5.29 1 1 
       1071 1 . . . . . 4.87 1.8 4.87 1 1 
       1072 1 . . . . . 3.42 1.8 3.42 1 1 
       1073 1 . . . . . 3.82 1.8 3.82 1 1 
       1074 1 . . . . . 3.88 1.8 3.88 1 1 
       1075 1 . . . . . 3.86 1.8 3.86 1 1 
       1076 1 . . . . . 3.68 1.8 3.68 1 1 
       1077 1 . . . . . 3.34 1.8 3.34 1 1 
       1078 1 . . . . . 3.74 1.8 3.74 1 1 
       1079 1 . . . . . 3.52 1.8 3.52 1 1 
       1080 1 . . . . . 4.57 1.8 4.57 1 1 
       1081 1 . . . . . 4.02 1.8 4.02 1 1 
       1082 1 . . . . . 3.69 1.8 3.69 1 1 
       1083 1 . . . . .  3.5 1.8  3.5 1 1 
       1084 1 . . . . . 4.56 1.8 4.56 1 1 
       1085 1 . . . . . 4.77 1.8 4.77 1 1 
       1086 1 . . . . . 3.99 1.8 3.99 1 1 
       1087 1 . . . . .  4.5 1.8  4.5 1 1 
       1088 1 . . . . . 4.49 1.8 4.49 1 1 
       1089 1 . . . . . 4.97 1.8 4.97 1 1 
       1090 1 . . . . . 3.72 1.8 3.72 1 1 
       1091 1 . . . . .  4.2 1.8  4.2 1 1 
       1092 1 . . . . . 3.39 1.8 3.39 1 1 
       1093 1 . . . . . 3.53 1.8 3.53 1 1 
       1094 1 . . . . .  3.6 1.8  3.6 1 1 
       1095 1 . . . . . 3.82 1.8 3.82 1 1 
       1096 1 . . . . . 3.37 1.8 3.37 1 1 
       1097 1 . . . . . 3.76 1.8 3.76 1 1 
       1098 1 . . . . . 3.84 1.8 3.84 1 1 
       1099 1 . . . . .  3.9 1.8  3.9 1 1 
       1100 1 . . . . . 4.06 1.8 4.06 1 1 
       1101 1 . . . . . 3.77 1.8 3.77 1 1 
       1102 1 . . . . . 3.75 1.8 3.75 1 1 
       1103 1 . . . . . 5.03 1.8 5.03 1 1 
       1104 1 . . . . . 3.94 1.8 3.94 1 1 
       1105 1 . . . . . 3.86 1.8 3.86 1 1 
       1106 1 . . . . .  3.8 3.8  3.8 1 1 
       1107 1 . . . . . 4.06 1.8 4.06 1 1 
       1108 1 . . . . . 3.81 1.8 3.81 1 1 
       1109 1 . . . . . 3.68 1.8 3.68 1 1 
       1110 1 . . . . . 4.26 1.8 4.26 1 1 
       1111 1 . . . . . 4.19 1.8 4.19 1 1 
       1112 1 . . . . . 3.79 1.8 3.79 1 1 
       1113 1 . . . . . 3.62 1.8 3.62 1 1 
       1114 1 . . . . . 4.02 1.8 4.02 1 1 
       1115 1 . . . . . 3.86 1.8 3.86 1 1 
       1116 1 . . . . . 3.81 1.8 3.81 1 1 
       1117 1 . . . . . 3.82 1.8 3.82 1 1 
       1118 1 . . . . . 3.53 1.8 3.53 1 1 
       1119 1 . . . . . 4.03 1.8 4.03 1 1 
       1120 1 . . . . . 3.86 1.8 3.86 1 1 
       1121 1 . . . . .  4.2 1.8  4.2 1 1 
       1122 1 . . . . . 4.77 1.8 4.77 1 1 
       1123 1 . . . . . 3.93 1.8 3.93 1 1 
       1124 1 . . . . . 4.32 1.8 4.32 1 1 
       1125 1 . . . . .  4.0 1.8  4.0 1 1 
       1126 1 . . . . . 4.04 1.8 4.04 1 1 
       1127 1 . . . . . 4.07 1.8 4.07 1 1 
       1128 1 . . . . . 3.82 1.8 3.82 1 1 
       1129 1 . . . . . 3.33 1.8 3.33 1 1 
       1130 1 . . . . .  4.5 1.8  4.5 1 1 
       1131 1 . . . . . 3.82 1.8 3.82 1 1 
       1132 1 . . . . . 3.58 1.8 3.58 1 1 
       1133 1 . . . . . 3.37 1.8 3.37 1 1 
       1134 1 . . . . . 3.61 1.8 3.61 1 1 
       1135 1 . . . . . 3.72 1.8 3.72 1 1 
       1136 1 . . . . .  4.0 1.8  4.0 1 1 
       1137 1 . . . . . 3.65 1.8 3.65 1 1 
       1138 1 . . . . . 3.62 1.8 3.62 1 1 
       1139 1 . . . . . 4.03 1.8 4.03 1 1 
       1140 1 . . . . . 3.97 1.8 3.97 1 1 
       1141 1 . . . . . 2.99 1.8 2.99 1 1 
       1142 1 . . . . .  4.7 1.8  4.7 1 1 
       1143 1 . . . . . 4.09 1.8 4.09 1 1 
       1144 1 . . . . . 4.03 1.8 4.03 1 1 
       1145 1 . . . . . 3.52 1.8 3.52 1 1 
       1146 1 . . . . . 4.24 1.8 4.24 1 1 
       1147 1 . . . . . 4.23 1.8 4.23 1 1 
       1148 1 . . . . .  5.5 1.8  5.5 1 1 
       1149 1 . . . . .  5.5 1.8  5.5 1 1 
       1150 1 . . . . . 4.73 1.8 4.73 1 1 
       1151 1 . . . . . 4.85 1.8 4.85 1 1 
       1152 1 . . . . . 4.33 1.8 4.33 1 1 
       1153 1 . . . . . 5.33 1.8 5.33 1 1 
       1154 1 . . . . . 4.33 1.8 4.33 1 1 
       1155 1 . . . . . 4.49 1.8 4.49 1 1 
       1156 1 . . . . . 4.25 1.8 4.25 1 1 
       1157 1 . . . . . 5.07 1.8 5.07 1 1 
       1158 1 . . . . . 4.81 1.8 4.81 1 1 
       1159 1 . . . . . 4.33 1.8 4.33 1 1 
       1160 1 . . . . . 4.99 1.8 4.99 1 1 
       1161 1 . . . . . 4.82 1.8 4.82 1 1 
       1162 1 . . . . . 4.32 1.8 4.32 1 1 
       1163 1 . . . . .  4.2 1.8  4.2 1 1 
       1164 1 . . . . . 4.09 1.8 4.09 1 1 
       1165 1 . . . . . 4.21 1.8 4.21 1 1 
       1166 1 . . . . . 4.15 1.8 4.15 1 1 
       1167 1 . . . . . 4.34 1.8 4.34 1 1 
       1168 1 . . . . . 4.32 1.8 4.32 1 1 
       1169 1 . . . . . 4.84 1.8 4.84 1 1 
       1170 1 . . . . . 4.09 1.8 4.09 1 1 
       1171 1 . . . . . 4.32 1.8 4.32 1 1 
       1172 1 . . . . . 4.11 1.8 4.11 1 1 
       1173 1 . . . . . 4.17 1.8 4.17 1 1 
       1174 1 . . . . .  4.2 1.8  4.2 1 1 
       1175 1 . . . . . 4.31 1.8 4.31 1 1 
       1176 1 . . . . . 4.08 1.8 4.08 1 1 
       1177 1 . . . . . 5.41 1.8 5.41 1 1 
       1178 1 . . . . . 4.19 1.8 4.19 1 1 
       1179 1 . . . . . 3.59 1.8 3.59 1 1 
       1180 1 . . . . . 3.89 1.8 3.89 1 1 
       1181 1 . . . . . 3.28 1.8 3.28 1 1 
       1182 1 . . . . . 3.14 1.8 3.14 1 1 
       1183 1 . . . . . 3.65 1.8 3.65 1 1 
       1184 1 . . . . . 3.77 1.8 3.77 1 1 
       1185 1 . . . . . 4.05 1.8 4.05 1 1 
       1186 1 . . . . . 4.78 1.8 4.78 1 1 
       1187 1 . . . . . 4.21 1.8 4.21 1 1 
       1188 1 . . . . . 4.27 1.8 4.27 1 1 
       1189 1 . . . . . 4.11 1.8 4.11 1 1 
       1190 1 . . . . . 4.07 1.8 4.07 1 1 
       1191 1 . . . . . 4.05 1.8 4.05 1 1 
       1192 1 . . . . . 4.24 1.8 4.24 1 1 
       1193 1 . . . . . 4.71 1.8 4.71 1 1 
       1194 1 . . . . . 4.36 1.8 4.36 1 1 
       1195 1 . . . . . 4.86 1.8 4.86 1 1 
       1196 1 . . . . . 4.31 1.8 4.31 1 1 
       1197 1 . . . . . 4.31 1.8 4.31 1 1 
       1198 1 . . . . .  4.3 1.8  4.3 1 1 
       1199 1 . . . . . 4.44 1.8 4.44 1 1 
       1200 1 . . . . . 3.86 1.8 3.86 1 1 
       1201 1 . . . . . 4.01 1.8 4.01 1 1 
       1202 1 . . . . . 4.24 1.8 4.24 1 1 
       1203 1 . . . . .  4.7 1.8  4.7 1 1 
       1204 1 . . . . . 4.39 1.8 4.39 1 1 
       1205 1 . . . . . 5.02 1.8 5.02 1 1 
       1206 1 . . . . . 4.56 1.8 4.56 1 1 
       1207 1 . . . . . 5.27 1.8 5.27 1 1 
       1208 1 . . . . .  5.5 1.8  5.5 1 1 
       1209 1 . . . . . 5.28 1.8 5.28 1 1 
       1210 1 . . . . . 4.69 1.8 4.69 1 1 
       1211 1 . . . . .  4.6 1.8  4.6 1 1 
       1212 1 . . . . . 4.41 1.8 4.41 1 1 
       1213 1 . . . . . 4.51 1.8 4.51 1 1 
       1214 1 . . . . .  4.3 1.8  4.3 1 1 
       1215 1 . . . . . 4.54 1.8 4.54 1 1 
       1216 1 . . . . . 4.17 1.8 4.17 1 1 
       1217 1 . . . . . 4.62 1.8 4.62 1 1 
       1218 1 . . . . . 5.18 1.8 5.18 1 1 
       1219 1 . . . . . 4.76 1.8 4.76 1 1 
       1220 1 . . . . .  4.0 1.8  4.0 1 1 
       1221 1 . . . . . 4.14 1.8 4.14 1 1 
       1222 1 . . . . . 4.76 1.8 4.76 1 1 
       1223 1 . . . . . 4.77 1.8 4.77 1 1 
       1224 1 . . . . . 5.04 1.8 5.04 1 1 
       1225 1 . . . . . 4.45 1.8 4.45 1 1 
       1226 1 . . . . . 4.38 1.8 4.38 1 1 
       1227 1 . . . . . 4.37 1.8 4.37 1 1 
       1228 1 . . . . . 4.44 1.8 4.44 1 1 
       1229 1 . . . . . 5.07 1.8 5.07 1 1 
       1230 1 . . . . . 5.07 1.8 5.07 1 1 
       1231 1 . . . . . 4.71 1.8 4.71 1 1 
       1232 1 . . . . . 5.01 1.8 5.01 1 1 
       1233 1 . . . . . 4.67 1.8 4.67 1 1 
       1234 1 . . . . . 4.67 1.8 4.67 1 1 
       1235 1 . . . . . 4.99 1.8 4.99 1 1 
       1236 1 . . . . . 4.55 1.8 4.55 1 1 
       1237 1 . . . . . 5.09 1.8 5.09 1 1 
       1238 1 . . . . . 4.27 1.8 4.27 1 1 
       1239 1 . . . . . 4.86 1.8 4.86 1 1 
       1240 1 . . . . . 4.14 1.8 4.14 1 1 
       1241 1 . . . . . 3.19 1.8 3.19 1 1 
       1242 1 . . . . . 4.37 1.8 4.37 1 1 
       1243 1 . . . . . 4.33 1.8 4.33 1 1 
       1244 1 . . . . . 3.95 1.8 3.95 1 1 
       1245 1 . . . . .  3.4 1.8  3.4 1 1 
       1246 1 . . . . . 3.62 1.8 3.62 1 1 
       1247 1 . . . . . 5.34 1.8 5.34 1 1 
       1248 1 . . . . . 4.42 1.8 4.42 1 1 
       1249 1 . . . . . 4.78 1.8 4.78 1 1 
       1250 1 . . . . . 3.74 1.8 3.74 1 1 
       1251 1 . . . . .  3.9 1.8  3.9 1 1 
       1252 1 . . . . . 5.05 1.8 5.05 1 1 
       1253 1 . . . . . 5.34 1.8 5.34 1 1 
       1254 1 . . . . . 4.27 1.8 4.27 1 1 
       1255 1 . . . . . 3.98 1.8 3.98 1 1 
       1256 1 . . . . . 4.82 1.8 4.82 1 1 
       1257 1 . . . . . 3.34 1.8 3.34 1 1 
       1258 1 . . . . . 4.64 1.8 4.64 1 1 
       1259 1 . . . . . 3.32 1.8 3.32 1 1 
       1260 1 . . . . . 3.73 1.8 3.73 1 1 
       1261 1 . . . . . 3.24 1.8 3.24 1 1 
       1262 1 . . . . . 4.09 1.8 4.09 1 1 
       1263 1 . . . . .  3.4 1.8  3.4 1 1 
       1264 1 . . . . . 4.41 1.8 4.41 1 1 
       1265 1 . . . . . 4.46 1.8 4.46 1 1 
       1266 1 . . . . . 3.52 1.8 3.52 1 1 
       1267 1 . . . . . 3.45 1.8 3.45 1 1 
       1268 1 . . . . . 4.75 1.8 4.75 1 1 
       1269 1 . . . . . 3.49 1.8 3.49 1 1 
       1270 1 . . . . . 3.99 1.8 3.99 1 1 
       1271 1 . . . . . 3.09 1.8 3.09 1 1 
       1272 1 . . . . . 3.91 1.8 3.91 1 1 
       1273 1 . . . . . 5.44 1.8 5.44 1 1 
       1274 1 . . . . . 3.62 1.8 3.62 1 1 
       1275 1 . . . . . 4.01 1.8 4.01 1 1 
       1276 1 . . . . . 4.58 1.8 4.58 1 1 
       1277 1 . . . . . 3.56 1.8 3.56 1 1 
       1278 1 . . . . . 4.49 1.8 4.49 1 1 
       1279 1 . . . . . 3.65 1.8 3.65 1 1 
       1280 1 . . . . . 3.46 1.8 3.46 1 1 
       1281 1 . . . . . 4.25 1.8 4.25 1 1 
       1282 1 . . . . . 2.84 1.8 2.84 1 1 
       1283 1 . . . . . 3.84 1.8 3.84 1 1 
       1284 1 . . . . . 4.41 1.8 4.41 1 1 
       1285 1 . . . . . 5.02 1.8 5.02 1 1 
       1286 1 . . . . . 3.61 1.8 3.61 1 1 
       1287 1 . . . . . 5.34 1.8 5.34 1 1 
       1288 1 . . . . . 4.85 1.8 4.85 1 1 
       1289 1 . . . . .  4.1 1.8  4.1 1 1 
       1290 1 . . . . . 4.13 1.8 4.13 1 1 
       1291 1 . . . . . 4.73 1.8 4.73 1 1 
       1292 1 . . . . . 3.26 1.8 3.26 1 1 
       1293 1 . . . . . 5.44 1.8 5.44 1 1 
       1294 1 . . . . . 4.94 1.8 4.94 1 1 
       1295 1 . . . . . 3.23 1.8 3.23 1 1 
       1296 1 . . . . . 4.35 1.8 4.35 1 1 
       1297 1 . . . . . 3.92 1.8 3.92 1 1 
       1298 1 . . . . .  3.5 1.8  3.5 1 1 
       1299 1 . . . . .  4.1 1.8  4.1 1 1 
       1300 1 . . . . . 4.47 1.8 4.47 1 1 
       1301 1 . . . . . 3.99 1.8 3.99 1 1 
       1302 1 . . . . . 5.34 1.8 5.34 1 1 
       1303 1 . . . . . 3.25 1.8 3.25 1 1 
       1304 1 . . . . .  3.5 1.8  3.5 1 1 
       1305 1 . . . . .  4.1 1.8  4.1 1 1 
       1306 1 . . . . . 4.83 1.8 4.83 1 1 
       1307 1 . . . . . 4.53 1.8 4.53 1 1 
       1308 1 . . . . . 3.29 1.8 3.29 1 1 
       1309 1 . . . . . 4.31 1.8 4.31 1 1 
       1310 1 . . . . . 3.82 1.8 3.82 1 1 
       1311 1 . . . . . 4.92 1.8 4.92 1 1 
       1312 1 . . . . . 4.96 1.8 4.96 1 1 
       1313 1 . . . . . 3.81 1.8 3.81 1 1 
       1314 1 . . . . . 5.25 1.8 5.25 1 1 
       1315 1 . . . . . 4.04 1.8 4.04 1 1 
       1316 1 . . . . .  4.2 1.8  4.2 1 1 
       1317 1 . . . . . 3.69 1.8 3.69 1 1 
       1318 1 . . . . . 4.24 1.8 4.24 1 1 
       1319 1 . . . . . 5.04 1.8 5.04 1 1 
       1320 1 . . . . . 3.41 1.8 3.41 1 1 
       1321 1 . . . . . 3.68 1.8 3.68 1 1 
       1322 1 . . . . . 4.91 1.8 4.91 1 1 
       1323 1 . . . . . 3.85 1.8 3.85 1 1 
       1324 1 . . . . . 3.49 1.8 3.49 1 1 
       1325 1 . . . . . 4.59 1.8 4.59 1 1 
       1326 1 . . . . . 3.27 1.8 3.27 1 1 
       1327 1 . . . . . 4.38 1.8 4.38 1 1 
       1328 1 . . . . . 3.57 1.8 3.57 1 1 
       1329 1 . . . . .  4.2 1.8  4.2 1 1 
       1330 1 . . . . . 4.45 1.8 4.45 1 1 
       1331 1 . . . . . 4.29 1.8 4.29 1 1 
       1332 1 . . . . . 3.58 1.8 3.58 1 1 
       1333 1 . . . . . 4.13 1.8 4.13 1 1 
       1334 1 . . . . . 4.15 1.8 4.15 1 1 
       1335 1 . . . . . 3.76 1.8 3.76 1 1 
       1336 1 . . . . .  4.2 1.8  4.2 1 1 
       1337 1 . . . . . 3.98 1.8 3.98 1 1 
       1338 1 . . . . . 3.77 1.8 3.77 1 1 
       1339 1 . . . . . 4.44 1.8 4.44 1 1 
       1340 1 . . . . . 4.86 1.8 4.86 1 1 
       1341 1 . . . . . 3.46 1.8 3.46 1 1 
       1342 1 . . . . . 4.74 1.8 4.74 1 1 
       1343 1 . . . . . 3.35 1.8 3.35 1 1 
       1344 1 . . . . . 5.34 1.8 5.34 1 1 
       1345 1 . . . . . 5.31 1.8 5.31 1 1 
       1346 1 . . . . .  4.7 1.8  4.7 1 1 
       1347 1 . . . . . 3.68 1.8 3.68 1 1 
       1348 1 . . . . . 4.05 1.8 4.05 1 1 
       1349 1 . . . . . 4.99 1.8 4.99 1 1 
       1350 1 . . . . . 5.26 1.8 5.26 1 1 
       1351 1 . . . . . 4.02 1.8 4.02 1 1 
       1352 1 . . . . . 5.34 1.8 5.34 1 1 
       1353 1 . . . . . 4.18 1.8 4.18 1 1 
       1354 1 . . . . . 4.02 1.8 4.02 1 1 
       1355 1 . . . . . 3.83 1.8 3.83 1 1 
       1356 1 . . . . . 4.27 1.8 4.27 1 1 
       1357 1 . . . . . 3.79 1.8 3.79 1 1 
       1358 1 . . . . . 3.52 1.8 3.52 1 1 
       1359 1 . . . . . 3.69 1.8 3.69 1 1 
       1360 1 . . . . . 5.16 1.8 5.16 1 1 
       1361 1 . . . . .  3.5 1.8  3.5 1 1 
       1362 1 . . . . . 4.21 1.8 4.21 1 1 
       1363 1 . . . . . 3.22 1.8 3.22 1 1 
       1364 1 . . . . . 5.16 1.8 5.16 1 1 
       1365 1 . . . . . 3.78 1.8 3.78 1 1 
       1366 1 . . . . . 4.92 1.8 4.92 1 1 
       1367 1 . . . . . 4.62 1.8 4.62 1 1 
       1368 1 . . . . . 3.48 1.8 3.48 1 1 
       1369 1 . . . . . 4.51 1.8 4.51 1 1 
       1370 1 . . . . . 3.83 1.8 3.83 1 1 
       1371 1 . . . . . 4.29 1.8 4.29 1 1 
       1372 1 . . . . . 5.34 1.8 5.34 1 1 
       1373 1 . . . . . 3.48 1.8 3.48 1 1 
       1374 1 . . . . . 4.82 1.8 4.82 1 1 
       1375 1 . . . . . 4.53 1.8 4.53 1 1 
       1376 1 . . . . . 3.87 1.8 3.87 1 1 
       1377 1 . . . . . 4.57 1.8 4.57 1 1 
       1378 1 . . . . . 3.76 1.8 3.76 1 1 
       1379 1 . . . . . 4.16 1.8 4.16 1 1 
       1380 1 . . . . . 3.62 1.8 3.62 1 1 
       1381 1 . . . . . 4.07 1.8 4.07 1 1 
       1382 1 . . . . . 4.95 1.8 4.95 1 1 
       1383 1 . . . . .  3.9 1.8  3.9 1 1 
       1384 1 . . . . . 3.42 1.8 3.42 1 1 
       1385 1 . . . . . 4.28 1.8 4.28 1 1 
       1386 1 . . . . . 4.41 1.8 4.41 1 1 
       1387 1 . . . . . 4.73 1.8 4.73 1 1 
       1388 1 . . . . . 4.03 1.8 4.03 1 1 
       1389 1 . . . . . 4.09 1.8 4.09 1 1 
       1390 1 . . . . . 4.79 1.8 4.79 1 1 
       1391 1 . . . . . 3.39 1.8 3.39 1 1 
       1392 1 . . . . . 4.07 1.8 4.07 1 1 
       1393 1 . . . . .  3.9 1.8  3.9 1 1 
       1394 1 . . . . . 3.75 1.8 3.75 1 1 
       1395 1 . . . . . 4.82 1.8 4.82 1 1 
       1396 1 . . . . . 4.63 1.8 4.63 1 1 
       1397 1 . . . . . 4.27 1.8 4.27 1 1 
       1398 1 . . . . . 3.07 1.8 3.07 1 1 
       1399 1 . . . . . 4.41 1.8 4.41 1 1 
       1400 1 . . . . . 3.56 1.8 3.56 1 1 
       1401 1 . . . . . 4.24 1.8 4.24 1 1 
       1402 1 . . . . . 4.74 1.8 4.74 1 1 
       1403 1 . . . . . 4.43 1.8 4.43 1 1 
       1404 1 . . . . . 3.57 1.8 3.57 1 1 
       1405 1 . . . . . 5.34 1.8 5.34 1 1 
       1406 1 . . . . . 3.07 1.8 3.07 1 1 
       1407 1 . . . . . 3.27 1.8 3.27 1 1 
       1408 1 . . . . . 3.63 1.8 3.63 1 1 
       1409 1 . . . . . 4.25 1.8 4.25 1 1 
       1410 1 . . . . .  4.6 1.8  4.6 1 1 
       1411 1 . . . . . 5.34 1.8 5.34 1 1 
       1412 1 . . . . . 5.33 1.8 5.33 1 1 
       1413 1 . . . . . 3.56 1.8 3.56 1 1 
       1414 1 . . . . . 5.34 1.8 5.34 1 1 
       1415 1 . . . . . 4.05 1.8 4.05 1 1 
       1416 1 . . . . .  3.1 1.8  3.1 1 1 
       1417 1 . . . . . 3.65 1.8 3.65 1 1 
       1418 1 . . . . . 4.92 1.8 4.92 1 1 
       1419 1 . . . . . 4.33 1.8 4.33 1 1 
       1420 1 . . . . . 4.27 1.8 4.27 1 1 
       1421 1 . . . . . 4.82 1.8 4.82 1 1 
       1422 1 . . . . . 4.36 1.8 4.36 1 1 
       1423 1 . . . . . 3.55 1.8 3.55 1 1 
       1424 1 . . . . . 4.03 1.8 4.03 1 1 
       1425 1 . . . . . 5.34 1.8 5.34 1 1 
       1426 1 . . . . . 3.11 1.8 3.11 1 1 
       1427 1 . . . . . 4.42 1.8 4.42 1 1 
       1428 1 . . . . . 4.47 1.8 4.47 1 1 
       1429 1 . . . . . 5.13 1.8 5.13 1 1 
       1430 1 . . . . . 3.37 1.8 3.37 1 1 
       1431 1 . . . . . 3.62 1.8 3.62 1 1 
       1432 1 . . . . . 5.07 1.8 5.07 1 1 
       1433 1 . . . . . 3.98 1.8 3.98 1 1 
       1434 1 . . . . . 3.27 1.8 3.27 1 1 
       1435 1 . . . . . 3.65 1.8 3.65 1 1 
       1436 1 . . . . . 4.45 1.8 4.45 1 1 
       1437 1 . . . . . 3.47 1.8 3.47 1 1 
       1438 1 . . . . . 3.63 1.8 3.63 1 1 
       1439 1 . . . . . 3.76 1.8 3.76 1 1 
       1440 1 . . . . . 5.01 1.8 5.01 1 1 
       1441 1 . . . . . 3.86 1.8 3.86 1 1 
       1442 1 . . . . . 4.17 1.8 4.17 1 1 
       1443 1 . . . . .  3.4 1.8  3.4 1 1 
       1444 1 . . . . . 4.06 1.8 4.06 1 1 
       1445 1 . . . . . 4.06 1.8 4.06 1 1 
       1446 1 . . . . . 3.94 1.8 3.94 1 1 
       1447 1 . . . . . 4.15 1.8 4.15 1 1 
       1448 1 . . . . . 4.08 1.8 4.08 1 1 
       1449 1 . . . . . 4.03 1.8 4.03 1 1 
       1450 1 . . . . . 4.77 1.8 4.77 1 1 
       1451 1 . . . . . 5.34 1.8 5.34 1 1 
       1452 1 . . . . . 4.67 1.8 4.67 1 1 
       1453 1 . . . . . 3.93 1.8 3.93 1 1 
       1454 1 . . . . . 3.64 1.8 3.64 1 1 
       1455 1 . . . . . 3.26 1.8 3.26 1 1 
       1456 1 . . . . . 3.83 1.8 3.83 1 1 
       1457 1 . . . . . 3.16 1.8 3.16 1 1 
       1458 1 . . . . . 3.72 1.8 3.72 1 1 
       1459 1 . . . . . 3.58 1.8 3.58 1 1 
       1460 1 . . . . . 3.93 1.8 3.93 1 1 
       1461 1 . . . . . 5.34 1.8 5.34 1 1 
       1462 1 . . . . . 3.16 1.8 3.16 1 1 
       1463 1 . . . . . 4.04 1.8 4.04 1 1 
       1464 1 . . . . . 5.34 1.8 5.34 1 1 
       1465 1 . . . . . 3.38 1.8 3.38 1 1 
       1466 1 . . . . . 3.92 1.8 3.92 1 1 
       1467 1 . . . . . 3.82 1.8 3.82 1 1 
       1468 1 . . . . . 3.57 1.8 3.57 1 1 
       1469 1 . . . . . 3.71 1.8 3.71 1 1 
       1470 1 . . . . . 5.08 1.8 5.08 1 1 
       1471 1 . . . . . 3.14 1.8 3.14 1 1 
       1472 1 . . . . . 4.05 1.8 4.05 1 1 
       1473 1 . . . . . 3.98 1.8 3.98 1 1 
       1474 1 . . . . . 3.51 1.8 3.51 1 1 
       1475 1 . . . . . 4.73 1.8 4.73 1 1 
       1476 1 . . . . .  4.3 1.8  4.3 1 1 
       1477 1 . . . . . 4.03 1.8 4.03 1 1 
       1478 1 . . . . . 5.07 1.8 5.07 1 1 
       1479 1 . . . . . 3.83 1.8 3.83 1 1 
       1480 1 . . . . . 3.53 1.8 3.53 1 1 
       1481 1 . . . . . 4.84 1.8 4.84 1 1 
       1482 1 . . . . . 4.24 1.8 4.24 1 1 
       1483 1 . . . . . 3.56 1.8 3.56 1 1 
       1484 1 . . . . . 5.34 1.8 5.34 1 1 
       1485 1 . . . . . 3.75 1.8 3.75 1 1 
       1486 1 . . . . . 4.34 1.8 4.34 1 1 
       1487 1 . . . . . 5.02 1.8 5.02 1 1 
       1488 1 . . . . . 3.57 1.8 3.57 1 1 
       1489 1 . . . . . 3.52 1.8 3.52 1 1 
       1490 1 . . . . . 4.08 1.8 4.08 1 1 
       1491 1 . . . . . 3.53 1.8 3.53 1 1 
       1492 1 . . . . . 4.35 1.8 4.35 1 1 
       1493 1 . . . . . 3.53 1.8 3.53 1 1 
       1494 1 . . . . . 3.61 1.8 3.61 1 1 
       1495 1 . . . . . 3.91 1.8 3.91 1 1 
       1496 1 . . . . . 3.34 1.8 3.34 1 1 
       1497 1 . . . . . 4.73 1.8 4.73 1 1 
       1498 1 . . . . . 3.22 1.8 3.22 1 1 
       1499 1 . . . . . 3.97 1.8 3.97 1 1 
       1500 1 . . . . . 5.23 1.8 5.23 1 1 
       1501 1 . . . . . 4.58 1.8 4.58 1 1 
       1502 1 . . . . . 4.01 1.8 4.01 1 1 
       1503 1 . . . . . 4.42 1.8 4.42 1 1 
       1504 1 . . . . .  4.0 1.8  4.0 1 1 
       1505 1 . . . . . 3.61 1.8 3.61 1 1 
       1506 1 . . . . . 5.12 1.8 5.12 1 1 
       1507 1 . . . . . 3.39 1.8 3.39 1 1 
       1508 1 . . . . . 4.44 1.8 4.44 1 1 
       1509 1 . . . . . 4.97 1.8 4.97 1 1 
       1510 1 . . . . . 3.81 1.8 3.81 1 1 
       1511 1 . . . . . 4.26 1.8 4.26 1 1 
       1512 1 . . . . . 3.32 1.8 3.32 1 1 
       1513 1 . . . . . 4.82 1.8 4.82 1 1 
       1514 1 . . . . .  3.8 3.8  3.8 1 1 
       1515 1 . . . . . 4.06 1.8 4.06 1 1 
       1516 1 . . . . . 2.81 1.8 2.81 1 1 
       1517 1 . . . . . 3.43 1.8 3.43 1 1 
       1518 1 . . . . . 4.16 1.8 4.16 1 1 
       1519 1 . . . . . 3.38 1.8 3.38 1 1 
       1520 1 . . . . . 3.51 1.8 3.51 1 1 
       1521 1 . . . . . 4.85 1.8 4.85 1 1 
       1522 1 . . . . . 3.32 1.8 3.32 1 1 
       1523 1 . . . . .  3.0 1.8  3.0 1 1 
       1524 1 . . . . .  4.1 1.8  4.1 1 1 
       1525 1 . . . . . 4.89 1.8 4.89 1 1 
       1526 1 . . . . . 3.18 1.8 3.18 1 1 
       1527 1 . . . . . 3.62 1.8 3.62 1 1 
       1528 1 . . . . . 4.42 1.8 4.42 1 1 
       1529 1 . . . . . 3.73 1.8 3.73 1 1 
       1530 1 . . . . . 5.12 1.8 5.12 1 1 
       1531 1 . . . . . 5.06 1.8 5.06 1 1 
       1532 1 . . . . . 4.18 1.8 4.18 1 1 
       1533 1 . . . . . 5.25 1.8 5.25 1 1 
       1534 1 . . . . . 4.08 1.8 4.08 1 1 
       1535 1 . . . . . 3.47 1.8 3.47 1 1 
       1536 1 . . . . . 3.47 1.8 3.47 1 1 
       1537 1 . . . . . 3.53 1.8 3.53 1 1 
       1538 1 . . . . . 3.48 1.8 3.48 1 1 
       1539 1 . . . . . 3.54 1.8 3.54 1 1 
       1540 1 . . . . . 3.37 1.8 3.37 1 1 
       1541 1 . . . . . 4.04 1.8 4.04 1 1 
       1542 1 . . . . . 4.88 1.8 4.88 1 1 
       1543 1 . . . . . 4.37 1.8 4.37 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_3_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  2
    _Distance_constraint_list.Constraint_type     "hydrogen bond"
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

        1 1 . . . 1 2 
        2 1 . . . 1 2 
        3 1 . . . 1 2 
        4 1 . . . 1 2 
        5 1 . . . 1 2 
        6 1 . . . 1 2 
        7 1 . . . 1 2 
        8 1 . . . 1 2 
        9 1 . . . 1 2 
       10 1 . . . 1 2 
       11 1 . . . 1 2 
       12 1 . . . 1 2 
       13 1 . . . 1 2 
       14 1 . . . 1 2 
       15 1 . . . 1 2 
       16 1 . . . 1 2 
       17 1 . . . 1 2 
       18 1 . . . 1 2 
       19 1 . . . 1 2 
       20 1 . . . 1 2 
       21 1 . . . 1 2 
       22 1 . . . 1 2 
       23 1 . . . 1 2 
       24 1 . . . 1 2 
       25 1 . . . 1 2 
       26 1 . . . 1 2 
       27 1 . . . 1 2 
       28 1 . . . 1 2 
       29 1 . . . 1 2 
       30 1 . . . 1 2 
       31 1 . . . 1 2 
       32 1 . . . 1 2 
       33 1 . . . 1 2 
       34 1 . . . 1 2 
       35 1 . . . 1 2 
       36 1 . . . 1 2 
       37 1 . . . 1 2 
       38 1 . . . 1 2 
       39 1 . . . 1 2 
       40 1 . . . 1 2 
       41 1 . . . 1 2 
       42 1 . . . 1 2 
       43 1 . . . 1 2 
       44 1 . . . 1 2 
       45 1 . . . 1 2 
       46 1 . . . 1 2 
       47 1 . . . 1 2 
       48 1 . . . 1 2 
       49 1 . . . 1 2 
       50 1 . . . 1 2 
       51 1 . . . 1 2 
       52 1 . . . 1 2 
       53 1 . . . 1 2 
       54 1 . . . 1 2 
       55 1 . . . 1 2 
       56 1 . . . 1 2 
       57 1 . . . 1 2 
       58 1 . . . 1 2 
       59 1 . . . 1 2 
       60 1 . . . 1 2 
       61 1 . . . 1 2 
       62 1 . . . 1 2 
       63 1 . . . 1 2 
       64 1 . . . 1 2 
       65 1 . . . 1 2 
       66 1 . . . 1 2 
       67 1 . . . 1 2 
       68 1 . . . 1 2 
       69 1 . . . 1 2 
       70 1 . . . 1 2 
       71 1 . . . 1 2 
       72 1 . . . 1 2 
       73 1 . . . 1 2 
       74 1 . . . 1 2 
       75 1 . . . 1 2 
       76 1 . . . 1 2 
       77 1 . . . 1 2 
       78 1 . . . 1 2 
       79 1 . . . 1 2 
       80 1 . . . 1 2 
       81 1 . . . 1 2 
       82 1 . . . 1 2 
       83 1 . . . 1 2 
       84 1 . . . 1 2 
       85 1 . . . 1 2 
       86 1 . . . 1 2 
       87 1 . . . 1 2 
       88 1 . . . 1 2 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

        1 1 1 1 1  11 GLU O .  89 . O  1 2 
        1 1 2 1 1  15 ARG N .  93 . N  1 2 
        2 1 1 1 1  11 GLU O .  89 . O  1 2 
        2 1 2 1 1  15 ARG H .  93 . HN 1 2 
        3 1 1 1 1  12 ASP O .  90 . O  1 2 
        3 1 2 1 1  16 TYR N .  94 . N  1 2 
        4 1 1 1 1  12 ASP O .  90 . O  1 2 
        4 1 2 1 1  16 TYR H .  94 . HN 1 2 
        5 1 1 1 1  13 ILE O .  91 . O  1 2 
        5 1 2 1 1  17 TYR N .  95 . N  1 2 
        6 1 1 1 1  13 ILE O .  91 . O  1 2 
        6 1 2 1 1  17 TYR H .  95 . HN 1 2 
        7 1 1 1 1  14 THR O .  92 . O  1 2 
        7 1 2 1 1  18 LEU N .  96 . N  1 2 
        8 1 1 1 1  14 THR O .  92 . O  1 2 
        8 1 2 1 1  18 LEU H .  96 . HN 1 2 
        9 1 1 1 1  15 ARG O .  93 . O  1 2 
        9 1 2 1 1  19 CYS N .  97 . N  1 2 
       10 1 1 1 1  15 ARG O .  93 . O  1 2 
       10 1 2 1 1  19 CYS H .  97 . HN 1 2 
       11 1 1 1 1  16 TYR O .  94 . O  1 2 
       11 1 2 1 1  20 LEU N .  98 . N  1 2 
       12 1 1 1 1  16 TYR O .  94 . O  1 2 
       12 1 2 1 1  20 LEU H .  98 . HN 1 2 
       13 1 1 1 1  17 TYR O .  95 . O  1 2 
       13 1 2 1 1  21 GLN N .  99 . N  1 2 
       14 1 1 1 1  17 TYR O .  95 . O  1 2 
       14 1 2 1 1  21 GLN H .  99 . HN 1 2 
       15 1 1 1 1  18 LEU O .  96 . O  1 2 
       15 1 2 1 1  22 LEU N . 100 . N  1 2 
       16 1 1 1 1  18 LEU O .  96 . O  1 2 
       16 1 2 1 1  22 LEU H . 100 . HN 1 2 
       17 1 1 1 1  19 CYS O .  97 . O  1 2 
       17 1 2 1 1  23 ARG N . 101 . N  1 2 
       18 1 1 1 1  19 CYS O .  97 . O  1 2 
       18 1 2 1 1  23 ARG H . 101 . HN 1 2 
       19 1 1 1 1  20 LEU O .  98 . O  1 2 
       19 1 2 1 1  24 GLN N . 102 . N  1 2 
       20 1 1 1 1  20 LEU O .  98 . O  1 2 
       20 1 2 1 1  24 GLN H . 102 . HN 1 2 
       21 1 1 1 1  21 GLN O .  99 . O  1 2 
       21 1 2 1 1  25 ASP N . 103 . N  1 2 
       22 1 1 1 1  21 GLN O .  99 . O  1 2 
       22 1 2 1 1  25 ASP H . 103 . HN 1 2 
       23 1 1 1 1  22 LEU O . 100 . O  1 2 
       23 1 2 1 1  26 ILE N . 104 . N  1 2 
       24 1 1 1 1  22 LEU O . 100 . O  1 2 
       24 1 2 1 1  26 ILE H . 104 . HN 1 2 
       25 1 1 1 1  23 ARG O . 101 . O  1 2 
       25 1 2 1 1  27 VAL N . 105 . N  1 2 
       26 1 1 1 1  23 ARG O . 101 . O  1 2 
       26 1 2 1 1  27 VAL H . 105 . HN 1 2 
       27 1 1 1 1  35 PHE O . 113 . O  1 2 
       27 1 2 1 1  39 ALA N . 117 . N  1 2 
       28 1 1 1 1  35 PHE O . 113 . O  1 2 
       28 1 2 1 1  39 ALA H . 117 . HN 1 2 
       29 1 1 1 1  36 ALA O . 114 . O  1 2 
       29 1 2 1 1  40 LEU N . 118 . N  1 2 
       30 1 1 1 1  36 ALA O . 114 . O  1 2 
       30 1 2 1 1  40 LEU H . 118 . HN 1 2 
       31 1 1 1 1  37 THR O . 115 . O  1 2 
       31 1 2 1 1  41 LEU N . 119 . N  1 2 
       32 1 1 1 1  37 THR O . 115 . O  1 2 
       32 1 2 1 1  41 LEU H . 119 . HN 1 2 
       33 1 1 1 1  38 LEU O . 116 . O  1 2 
       33 1 2 1 1  42 GLY N . 120 . N  1 2 
       34 1 1 1 1  38 LEU O . 116 . O  1 2 
       34 1 2 1 1  42 GLY H . 120 . HN 1 2 
       35 1 1 1 1  39 ALA O . 117 . O  1 2 
       35 1 2 1 1  43 SER N . 121 . N  1 2 
       36 1 1 1 1  39 ALA O . 117 . O  1 2 
       36 1 2 1 1  43 SER H . 121 . HN 1 2 
       37 1 1 1 1  40 LEU O . 118 . O  1 2 
       37 1 2 1 1  44 TYR N . 122 . N  1 2 
       38 1 1 1 1  40 LEU O . 118 . O  1 2 
       38 1 2 1 1  44 TYR H . 122 . HN 1 2 
       39 1 1 1 1  41 LEU O . 119 . O  1 2 
       39 1 2 1 1  45 THR N . 123 . N  1 2 
       40 1 1 1 1  41 LEU O . 119 . O  1 2 
       40 1 2 1 1  45 THR H . 123 . HN 1 2 
       41 1 1 1 1  42 GLY O . 120 . O  1 2 
       41 1 2 1 1  46 ILE N . 124 . N  1 2 
       42 1 1 1 1  42 GLY O . 120 . O  1 2 
       42 1 2 1 1  46 ILE H . 124 . HN 1 2 
       43 1 1 1 1  43 SER O . 121 . O  1 2 
       43 1 2 1 1  47 GLN N . 125 . N  1 2 
       44 1 1 1 1  43 SER O . 121 . O  1 2 
       44 1 2 1 1  47 GLN H . 125 . HN 1 2 
       45 1 1 1 1  44 TYR O . 122 . O  1 2 
       45 1 2 1 1  48 SER N . 126 . N  1 2 
       46 1 1 1 1  44 TYR O . 122 . O  1 2 
       46 1 2 1 1  48 SER H . 126 . HN 1 2 
       47 1 1 1 1  45 THR O . 123 . O  1 2 
       47 1 2 1 1  49 GLU N . 127 . N  1 2 
       48 1 1 1 1  45 THR O . 123 . O  1 2 
       48 1 2 1 1  49 GLU H . 127 . HN 1 2 
       49 1 1 1 1  46 ILE O . 124 . O  1 2 
       49 1 2 1 1  50 LEU N . 128 . N  1 2 
       50 1 1 1 1  46 ILE O . 124 . O  1 2 
       50 1 2 1 1  50 LEU H . 128 . HN 1 2 
       51 1 1 1 1  74 LYS O . 152 . O  1 2 
       51 1 2 1 1  78 GLU N . 156 . N  1 2 
       52 1 1 1 1  74 LYS O . 152 . O  1 2 
       52 1 2 1 1  78 GLU H . 156 . HN 1 2 
       53 1 1 1 1  75 GLU O . 153 . O  1 2 
       53 1 2 1 1  79 LYS N . 157 . N  1 2 
       54 1 1 1 1  75 GLU O . 153 . O  1 2 
       54 1 2 1 1  79 LYS H . 157 . HN 1 2 
       55 1 1 1 1  76 LEU O . 154 . O  1 2 
       55 1 2 1 1  80 VAL N . 158 . N  1 2 
       56 1 1 1 1  76 LEU O . 154 . O  1 2 
       56 1 2 1 1  80 VAL H . 158 . HN 1 2 
       57 1 1 1 1  77 GLU O . 155 . O  1 2 
       57 1 2 1 1  81 MET N . 159 . N  1 2 
       58 1 1 1 1  77 GLU O . 155 . O  1 2 
       58 1 2 1 1  81 MET H . 159 . HN 1 2 
       59 1 1 1 1  78 GLU O . 156 . O  1 2 
       59 1 2 1 1  82 GLU N . 160 . N  1 2 
       60 1 1 1 1  78 GLU O . 156 . O  1 2 
       60 1 2 1 1  82 GLU H . 160 . HN 1 2 
       61 1 1 1 1  79 LYS O . 157 . O  1 2 
       61 1 2 1 1  83 LEU N . 161 . N  1 2 
       62 1 1 1 1  79 LYS O . 157 . O  1 2 
       62 1 2 1 1  83 LEU H . 161 . HN 1 2 
       63 1 1 1 1  80 VAL O . 158 . O  1 2 
       63 1 2 1 1  84 HIS N . 162 . N  1 2 
       64 1 1 1 1  80 VAL O . 158 . O  1 2 
       64 1 2 1 1  84 HIS H . 162 . HN 1 2 
       65 1 1 1 1  81 MET O . 159 . O  1 2 
       65 1 2 1 1  85 LYS N . 163 . N  1 2 
       66 1 1 1 1  81 MET O . 159 . O  1 2 
       66 1 2 1 1  85 LYS H . 163 . HN 1 2 
       67 1 1 1 1  82 GLU O . 160 . O  1 2 
       67 1 2 1 1  86 SER N . 164 . N  1 2 
       68 1 1 1 1  82 GLU O . 160 . O  1 2 
       68 1 2 1 1  86 SER H . 164 . HN 1 2 
       69 1 1 1 1  92 PRO O . 170 . O  1 2 
       69 1 2 1 1  96 ASP N . 174 . N  1 2 
       70 1 1 1 1  92 PRO O . 170 . O  1 2 
       70 1 2 1 1  96 ASP H . 174 . HN 1 2 
       71 1 1 1 1  93 ALA O . 171 . O  1 2 
       71 1 2 1 1  97 LEU N . 175 . N  1 2 
       72 1 1 1 1  93 ALA O . 171 . O  1 2 
       72 1 2 1 1  97 LEU H . 175 . HN 1 2 
       73 1 1 1 1  94 GLN O . 172 . O  1 2 
       73 1 2 1 1  98 GLU N . 176 . N  1 2 
       74 1 1 1 1  94 GLN O . 172 . O  1 2 
       74 1 2 1 1  98 GLU H . 176 . HN 1 2 
       75 1 1 1 1  95 ALA O . 173 . O  1 2 
       75 1 2 1 1  99 PHE N . 177 . N  1 2 
       76 1 1 1 1  95 ALA O . 173 . O  1 2 
       76 1 2 1 1  99 PHE H . 177 . HN 1 2 
       77 1 1 1 1  96 ASP O . 174 . O  1 2 
       77 1 2 1 1 100 LEU N . 178 . N  1 2 
       78 1 1 1 1  96 ASP O . 174 . O  1 2 
       78 1 2 1 1 100 LEU H . 178 . HN 1 2 
       79 1 1 1 1  97 LEU O . 175 . O  1 2 
       79 1 2 1 1 101 GLU N . 179 . N  1 2 
       80 1 1 1 1  97 LEU O . 175 . O  1 2 
       80 1 2 1 1 101 GLU H . 179 . HN 1 2 
       81 1 1 1 1  98 GLU O . 176 . O  1 2 
       81 1 2 1 1 102 ASN N . 180 . N  1 2 
       82 1 1 1 1  98 GLU O . 176 . O  1 2 
       82 1 2 1 1 102 ASN H . 180 . HN 1 2 
       83 1 1 1 1  99 PHE O . 177 . O  1 2 
       83 1 2 1 1 103 ALA N . 181 . N  1 2 
       84 1 1 1 1  99 PHE O . 177 . O  1 2 
       84 1 2 1 1 103 ALA H . 181 . HN 1 2 
       85 1 1 1 1 100 LEU O . 178 . O  1 2 
       85 1 2 1 1 104 LYS N . 182 . N  1 2 
       86 1 1 1 1 100 LEU O . 178 . O  1 2 
       86 1 2 1 1 104 LYS H . 182 . HN 1 2 
       87 1 1 1 1 101 GLU O . 179 . O  1 2 
       87 1 2 1 1 105 LYS N . 183 . N  1 2 
       88 1 1 1 1 101 GLU O . 179 . O  1 2 
       88 1 2 1 1 105 LYS H . 183 . HN 1 2 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

        1 1 . . . . . 3.2 2.7 3.2 1 2 
        2 1 . . . . . 2.2 1.8 2.2 1 2 
        3 1 . . . . . 3.2 2.7 3.2 1 2 
        4 1 . . . . . 2.2 1.8 2.2 1 2 
        5 1 . . . . . 3.2 2.7 3.2 1 2 
        6 1 . . . . . 2.2 1.8 2.2 1 2 
        7 1 . . . . . 3.2 2.7 3.2 1 2 
        8 1 . . . . . 2.2 1.8 2.2 1 2 
        9 1 . . . . . 3.2 2.7 3.2 1 2 
       10 1 . . . . . 2.2 1.8 2.2 1 2 
       11 1 . . . . . 3.2 2.7 3.2 1 2 
       12 1 . . . . . 2.2 1.8 2.2 1 2 
       13 1 . . . . . 3.2 2.7 3.2 1 2 
       14 1 . . . . . 2.2 1.8 2.2 1 2 
       15 1 . . . . . 3.2 2.7 3.2 1 2 
       16 1 . . . . . 2.2 1.8 2.2 1 2 
       17 1 . . . . . 3.2 2.7 3.2 1 2 
       18 1 . . . . . 2.2 1.8 2.2 1 2 
       19 1 . . . . . 3.2 2.7 3.2 1 2 
       20 1 . . . . . 2.2 1.8 2.2 1 2 
       21 1 . . . . . 3.2 2.7 3.2 1 2 
       22 1 . . . . . 2.2 1.8 2.2 1 2 
       23 1 . . . . . 3.2 2.7 3.2 1 2 
       24 1 . . . . . 2.2 1.8 2.2 1 2 
       25 1 . . . . . 3.2 2.7 3.2 1 2 
       26 1 . . . . . 2.2 1.8 2.2 1 2 
       27 1 . . . . . 3.2 2.7 3.2 1 2 
       28 1 . . . . . 2.2 1.8 2.2 1 2 
       29 1 . . . . . 3.2 2.7 3.2 1 2 
       30 1 . . . . . 2.2 1.8 2.2 1 2 
       31 1 . . . . . 3.2 2.7 3.2 1 2 
       32 1 . . . . . 2.2 1.8 2.2 1 2 
       33 1 . . . . . 3.2 2.7 3.2 1 2 
       34 1 . . . . . 2.2 1.8 2.2 1 2 
       35 1 . . . . . 3.2 2.7 3.2 1 2 
       36 1 . . . . . 2.2 1.8 2.2 1 2 
       37 1 . . . . . 3.2 2.7 3.2 1 2 
       38 1 . . . . . 2.2 1.8 2.2 1 2 
       39 1 . . . . . 3.2 2.7 3.2 1 2 
       40 1 . . . . . 2.2 1.8 2.2 1 2 
       41 1 . . . . . 3.2 2.7 3.2 1 2 
       42 1 . . . . . 2.2 1.8 2.2 1 2 
       43 1 . . . . . 3.2 2.7 3.2 1 2 
       44 1 . . . . . 2.2 1.8 2.2 1 2 
       45 1 . . . . . 3.2 2.7 3.2 1 2 
       46 1 . . . . . 2.2 1.8 2.2 1 2 
       47 1 . . . . . 3.2 2.7 3.2 1 2 
       48 1 . . . . . 2.2 1.8 2.2 1 2 
       49 1 . . . . . 3.2 2.7 3.2 1 2 
       50 1 . . . . . 2.2 1.8 2.2 1 2 
       51 1 . . . . . 3.2 2.7 3.2 1 2 
       52 1 . . . . . 2.2 1.8 2.2 1 2 
       53 1 . . . . . 3.2 2.7 3.2 1 2 
       54 1 . . . . . 2.2 1.8 2.2 1 2 
       55 1 . . . . . 3.2 2.7 3.2 1 2 
       56 1 . . . . . 2.2 1.8 2.2 1 2 
       57 1 . . . . . 3.2 2.7 3.2 1 2 
       58 1 . . . . . 2.2 1.8 2.2 1 2 
       59 1 . . . . . 3.2 2.7 3.2 1 2 
       60 1 . . . . . 2.2 1.8 2.2 1 2 
       61 1 . . . . . 3.2 2.7 3.2 1 2 
       62 1 . . . . . 2.2 1.8 2.2 1 2 
       63 1 . . . . . 3.2 2.7 3.2 1 2 
       64 1 . . . . . 2.2 1.8 2.2 1 2 
       65 1 . . . . . 3.2 2.7 3.2 1 2 
       66 1 . . . . . 2.2 1.8 2.2 1 2 
       67 1 . . . . . 3.2 2.7 3.2 1 2 
       68 1 . . . . . 2.2 1.8 2.2 1 2 
       69 1 . . . . . 3.2 2.7 3.2 1 2 
       70 1 . . . . . 2.2 1.8 2.2 1 2 
       71 1 . . . . . 3.2 2.7 3.2 1 2 
       72 1 . . . . . 2.2 1.8 2.2 1 2 
       73 1 . . . . . 3.2 2.7 3.2 1 2 
       74 1 . . . . . 2.2 1.8 2.2 1 2 
       75 1 . . . . . 3.2 2.7 3.2 1 2 
       76 1 . . . . . 2.2 1.8 2.2 1 2 
       77 1 . . . . . 3.2 2.7 3.2 1 2 
       78 1 . . . . . 2.2 1.8 2.2 1 2 
       79 1 . . . . . 3.2 2.7 3.2 1 2 
       80 1 . . . . . 2.2 1.8 2.2 1 2 
       81 1 . . . . . 3.2 2.7 3.2 1 2 
       82 1 . . . . . 2.2 1.8 2.2 1 2 
       83 1 . . . . . 3.2 2.7 3.2 1 2 
       84 1 . . . . . 2.2 1.8 2.2 1 2 
       85 1 . . . . . 3.2 2.7 3.2 1 2 
       86 1 . . . . . 2.2 1.8 2.2 1 2 
       87 1 . . . . . 3.2 2.7 3.2 1 2 
       88 1 . . . . . 2.2 1.8 2.2 1 2 
    stop_

save_


save_CNS/XPLOR_dihedral_4
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

         1 . 1 1   4 MET C 1 1   5 ASP N  1 1   5 ASP CA 1 1   5 ASP C      -147.89     -25.45 .  82 . C .  83 . N  .  83 . CA .  83 . C  1 1 
         2 . 1 1   5 ASP N 1 1   5 ASP CA 1 1   5 ASP C  1 1   6 PRO N       100.76     184.36 .  83 . N .  83 . CA .  83 . C  .  84 . N  1 1 
         3 . 1 1   6 PRO C 1 1   7 ALA N  1 1   7 ALA CA 1 1   7 ALA C       -109.5 -43.139996 .  84 . C .  85 . N  .  85 . CA .  85 . C  1 1 
         4 . 1 1   7 ALA N 1 1   7 ALA CA 1 1   7 ALA C  1 1   8 GLN N       -75.83      34.73 .  85 . N .  85 . CA .  85 . C  .  86 . N  1 1 
         5 . 1 1   8 GLN C 1 1   9 LEU N  1 1   9 LEU CA 1 1   9 LEU C      -104.78     -46.22 .  86 . C .  87 . N  .  87 . CA .  87 . C  1 1 
         6 . 1 1   9 LEU N 1 1   9 LEU CA 1 1   9 LEU C  1 1  10 THR N       -78.39      17.37 .  87 . N .  87 . CA .  87 . C  .  88 . N  1 1 
         7 . 1 1   9 LEU C 1 1  10 THR N  1 1  10 THR CA 1 1  10 THR C       -70.88     -53.04 .  87 . C .  88 . N  .  88 . CA .  88 . C  1 1 
         8 . 1 1  10 THR N 1 1  10 THR CA 1 1  10 THR C  1 1  11 GLU N       -64.63     -24.43 .  88 . N .  88 . CA .  88 . C  .  89 . N  1 1 
         9 . 1 1  10 THR C 1 1  11 GLU N  1 1  11 GLU CA 1 1  11 GLU C        -74.2     -50.64 .  88 . C .  89 . N  .  89 . CA .  89 . C  1 1 
        10 . 1 1  11 GLU N 1 1  11 GLU CA 1 1  11 GLU C  1 1  12 ASP N       -51.78 -30.060001 .  89 . N .  89 . CA .  89 . C  .  90 . N  1 1 
        11 . 1 1  11 GLU C 1 1  12 ASP N  1 1  12 ASP CA 1 1  12 ASP C       -84.17 -50.089996 .  89 . C .  90 . N  .  90 . CA .  90 . C  1 1 
        12 . 1 1  12 ASP N 1 1  12 ASP CA 1 1  12 ASP C  1 1  13 ILE N       -47.19 -24.189999 .  90 . N .  90 . CA .  90 . C  .  91 . N  1 1 
        13 . 1 1  12 ASP C 1 1  13 ILE N  1 1  13 ILE CA 1 1  13 ILE C       -81.32 -49.439995 .  90 . C .  91 . N  .  91 . CA .  91 . C  1 1 
        14 . 1 1  13 ILE N 1 1  13 ILE CA 1 1  13 ILE C  1 1  14 THR N       -49.83     -33.83 .  91 . N .  91 . CA .  91 . C  .  92 . N  1 1 
        15 . 1 1  13 ILE C 1 1  14 THR N  1 1  14 THR CA 1 1  14 THR C       -69.14     -55.94 .  91 . C .  92 . N  .  92 . CA .  92 . C  1 1 
        16 . 1 1  14 THR N 1 1  14 THR CA 1 1  14 THR C  1 1  15 ARG N       -52.58      -25.7 .  92 . N .  92 . CA .  92 . C  .  93 . N  1 1 
        17 . 1 1  14 THR C 1 1  15 ARG N  1 1  15 ARG CA 1 1  15 ARG C       -77.72     -55.28 .  92 . C .  93 . N  .  93 . CA .  93 . C  1 1 
        18 . 1 1  15 ARG N 1 1  15 ARG CA 1 1  15 ARG C  1 1  16 TYR N   -51.039997     -28.88 .  93 . N .  93 . CA .  93 . C  .  94 . N  1 1 
        19 . 1 1  15 ARG C 1 1  16 TYR N  1 1  16 TYR CA 1 1  16 TYR C       -73.77     -50.37 .  93 . C .  94 . N  .  94 . CA .  94 . C  1 1 
        20 . 1 1  16 TYR N 1 1  16 TYR CA 1 1  16 TYR C  1 1  17 TYR N   -62.109997 -28.669998 .  94 . N .  94 . CA .  94 . C  .  95 . N  1 1 
        21 . 1 1  16 TYR C 1 1  17 TYR N  1 1  17 TYR CA 1 1  17 TYR C       -72.46      -53.1 .  94 . C .  95 . N  .  95 . CA .  95 . C  1 1 
        22 . 1 1  17 TYR N 1 1  17 TYR CA 1 1  17 TYR C  1 1  18 LEU N       -48.64     -28.56 .  95 . N .  95 . CA .  95 . C  .  96 . N  1 1 
        23 . 1 1  17 TYR C 1 1  18 LEU N  1 1  18 LEU CA 1 1  18 LEU C       -72.55     -51.79 .  95 . C .  96 . N  .  96 . CA .  96 . C  1 1 
        24 . 1 1  18 LEU N 1 1  18 LEU CA 1 1  18 LEU C  1 1  19 CYS N       -55.19     -36.15 .  96 . N .  96 . CA .  96 . C  .  97 . N  1 1 
        25 . 1 1  18 LEU C 1 1  19 CYS N  1 1  19 CYS CA 1 1  19 CYS C       -69.71     -51.59 .  96 . C .  97 . N  .  97 . CA .  97 . C  1 1 
        26 . 1 1  19 CYS N 1 1  19 CYS CA 1 1  19 CYS C  1 1  20 LEU N       -53.52     -35.52 .  97 . N .  97 . CA .  97 . C  .  98 . N  1 1 
        27 . 1 1  19 CYS C 1 1  20 LEU N  1 1  20 LEU CA 1 1  20 LEU C       -73.13     -52.53 .  97 . C .  98 . N  .  98 . CA .  98 . C  1 1 
        28 . 1 1  20 LEU N 1 1  20 LEU CA 1 1  20 LEU C  1 1  21 GLN N   -51.949997     -29.47 .  98 . N .  98 . CA .  98 . C  .  99 . N  1 1 
        29 . 1 1  20 LEU C 1 1  21 GLN N  1 1  21 GLN CA 1 1  21 GLN C       -72.58 -59.499996 .  98 . C .  99 . N  .  99 . CA .  99 . C  1 1 
        30 . 1 1  21 GLN N 1 1  21 GLN CA 1 1  21 GLN C  1 1  22 LEU N       -48.55     -30.55 .  99 . N .  99 . CA .  99 . C  . 100 . N  1 1 
        31 . 1 1  21 GLN C 1 1  22 LEU N  1 1  22 LEU CA 1 1  22 LEU C       -70.01     -50.21 .  99 . C . 100 . N  . 100 . CA . 100 . C  1 1 
        32 . 1 1  22 LEU N 1 1  22 LEU CA 1 1  22 LEU C  1 1  23 ARG N       -53.42     -30.74 . 100 . N . 100 . CA . 100 . C  . 101 . N  1 1 
        33 . 1 1  22 LEU C 1 1  23 ARG N  1 1  23 ARG CA 1 1  23 ARG C       -78.15     -52.11 . 100 . C . 101 . N  . 101 . CA . 101 . C  1 1 
        34 . 1 1  23 ARG N 1 1  23 ARG CA 1 1  23 ARG C  1 1  24 GLN N       -49.34     -28.94 . 101 . N . 101 . CA . 101 . C  . 102 . N  1 1 
        35 . 1 1  23 ARG C 1 1  24 GLN N  1 1  24 GLN CA 1 1  24 GLN C       -71.08      -57.2 . 101 . C . 102 . N  . 102 . CA . 102 . C  1 1 
        36 . 1 1  24 GLN N 1 1  24 GLN CA 1 1  24 GLN C  1 1  25 ASP N       -52.54 -30.699999 . 102 . N . 102 . CA . 102 . C  . 103 . N  1 1 
        37 . 1 1  24 GLN C 1 1  25 ASP N  1 1  25 ASP CA 1 1  25 ASP C       -70.86     -55.02 . 102 . C . 103 . N  . 103 . CA . 103 . C  1 1 
        38 . 1 1  25 ASP N 1 1  25 ASP CA 1 1  25 ASP C  1 1  26 ILE N       -55.01     -25.17 . 103 . N . 103 . CA . 103 . C  . 104 . N  1 1 
        39 . 1 1  25 ASP C 1 1  26 ILE N  1 1  26 ILE CA 1 1  26 ILE C       -78.72 -52.519997 . 103 . C . 104 . N  . 104 . CA . 104 . C  1 1 
        40 . 1 1  26 ILE N 1 1  26 ILE CA 1 1  26 ILE C  1 1  27 VAL N       -54.35     -24.71 . 104 . N . 104 . CA . 104 . C  . 105 . N  1 1 
        41 . 1 1  26 ILE C 1 1  27 VAL N  1 1  27 VAL CA 1 1  27 VAL C       -74.59     -51.27 . 104 . C . 105 . N  . 105 . CA . 105 . C  1 1 
        42 . 1 1  27 VAL N 1 1  27 VAL CA 1 1  27 VAL C  1 1  28 ALA N       -55.64      -32.6 . 105 . N . 105 . CA . 105 . C  . 106 . N  1 1 
        43 . 1 1  27 VAL C 1 1  28 ALA N  1 1  28 ALA CA 1 1  28 ALA C   -124.51999     -53.32 . 105 . C . 106 . N  . 106 . CA . 106 . C  1 1 
        44 . 1 1  28 ALA N 1 1  28 ALA CA 1 1  28 ALA C  1 1  29 GLY N   -55.289997      40.87 . 106 . N . 106 . CA . 106 . C  . 107 . N  1 1 
        45 . 1 1  32 PRO C 1 1  33 CYS N  1 1  33 CYS CA 1 1  33 CYS C      -145.56      -70.8 . 110 . C . 111 . N  . 111 . CA . 111 . C  1 1 
        46 . 1 1  33 CYS N 1 1  33 CYS CA 1 1  33 CYS C  1 1  34 SER N        113.9     168.22 . 111 . N . 111 . CA . 111 . C  . 112 . N  1 1 
        47 . 1 1  33 CYS C 1 1  34 SER N  1 1  34 SER CA 1 1  34 SER C      -106.76     -52.64 . 111 . C . 112 . N  . 112 . CA . 112 . C  1 1 
        48 . 1 1  34 SER N 1 1  34 SER CA 1 1  34 SER C  1 1  35 PHE N    124.67999      185.6 . 112 . N . 112 . CA . 112 . C  . 113 . N  1 1 
        49 . 1 1  34 SER C 1 1  35 PHE N  1 1  35 PHE CA 1 1  35 PHE C       -70.51     -45.51 . 112 . C . 113 . N  . 113 . CA . 113 . C  1 1 
        50 . 1 1  35 PHE N 1 1  35 PHE CA 1 1  35 PHE C  1 1  36 ALA N       -58.37     -19.85 . 113 . N . 113 . CA . 113 . C  . 114 . N  1 1 
        51 . 1 1  35 PHE C 1 1  36 ALA N  1 1  36 ALA CA 1 1  36 ALA C       -72.01     -57.21 . 113 . C . 114 . N  . 114 . CA . 114 . C  1 1 
        52 . 1 1  36 ALA N 1 1  36 ALA CA 1 1  36 ALA C  1 1  37 THR N       -53.83     -14.31 . 114 . N . 114 . CA . 114 . C  . 115 . N  1 1 
        53 . 1 1  36 ALA C 1 1  37 THR N  1 1  37 THR CA 1 1  37 THR C       -88.96     -56.56 . 114 . C . 115 . N  . 115 . CA . 115 . C  1 1 
        54 . 1 1  37 THR N 1 1  37 THR CA 1 1  37 THR C  1 1  38 LEU N    -54.63999     -23.56 . 115 . N . 115 . CA . 115 . C  . 116 . N  1 1 
        55 . 1 1  37 THR C 1 1  38 LEU N  1 1  38 LEU CA 1 1  38 LEU C       -77.62     -45.74 . 115 . C . 116 . N  . 116 . CA . 116 . C  1 1 
        56 . 1 1  38 LEU N 1 1  38 LEU CA 1 1  38 LEU C  1 1  39 ALA N       -50.26     -28.94 . 116 . N . 116 . CA . 116 . C  . 117 . N  1 1 
        57 . 1 1  38 LEU C 1 1  39 ALA N  1 1  39 ALA CA 1 1  39 ALA C        -73.8     -60.48 . 116 . C . 117 . N  . 117 . CA . 117 . C  1 1 
        58 . 1 1  39 ALA N 1 1  39 ALA CA 1 1  39 ALA C  1 1  40 LEU N       -53.83     -18.79 . 117 . N . 117 . CA . 117 . C  . 118 . N  1 1 
        59 . 1 1  39 ALA C 1 1  40 LEU N  1 1  40 LEU CA 1 1  40 LEU C    -77.88999     -51.33 . 117 . C . 118 . N  . 118 . CA . 118 . C  1 1 
        60 . 1 1  40 LEU N 1 1  40 LEU CA 1 1  40 LEU C  1 1  41 LEU N   -51.569996     -33.37 . 118 . N . 118 . CA . 118 . C  . 119 . N  1 1 
        61 . 1 1  40 LEU C 1 1  41 LEU N  1 1  41 LEU CA 1 1  41 LEU C       -76.27     -51.79 . 118 . C . 119 . N  . 119 . CA . 119 . C  1 1 
        62 . 1 1  41 LEU N 1 1  41 LEU CA 1 1  41 LEU C  1 1  42 GLY N   -61.209995     -18.73 . 119 . N . 119 . CA . 119 . C  . 120 . N  1 1 
        63 . 1 1  41 LEU C 1 1  42 GLY N  1 1  42 GLY CA 1 1  42 GLY C       -70.96     -55.52 . 119 . C . 120 . N  . 120 . CA . 120 . C  1 1 
        64 . 1 1  42 GLY N 1 1  42 GLY CA 1 1  42 GLY C  1 1  43 SER N   -52.329998     -26.21 . 120 . N . 120 . CA . 120 . C  . 121 . N  1 1 
        65 . 1 1  42 GLY C 1 1  43 SER N  1 1  43 SER CA 1 1  43 SER C       -81.52     -53.64 . 120 . C . 121 . N  . 121 . CA . 121 . C  1 1 
        66 . 1 1  43 SER N 1 1  43 SER CA 1 1  43 SER C  1 1  44 TYR N       -64.32     -13.16 . 121 . N . 121 . CA . 121 . C  . 122 . N  1 1 
        67 . 1 1  44 TYR C 1 1  45 THR N  1 1  45 THR CA 1 1  45 THR C       -71.16      -53.8 . 122 . C . 123 . N  . 123 . CA . 123 . C  1 1 
        68 . 1 1  45 THR N 1 1  45 THR CA 1 1  45 THR C  1 1  46 ILE N       -53.62     -31.38 . 123 . N . 123 . CA . 123 . C  . 124 . N  1 1 
        69 . 1 1  45 THR C 1 1  46 ILE N  1 1  46 ILE CA 1 1  46 ILE C       -78.06     -54.78 . 123 . C . 124 . N  . 124 . CA . 124 . C  1 1 
        70 . 1 1  46 ILE N 1 1  46 ILE CA 1 1  46 ILE C  1 1  47 GLN N       -52.14     -25.94 . 124 . N . 124 . CA . 124 . C  . 125 . N  1 1 
        71 . 1 1  46 ILE C 1 1  47 GLN N  1 1  47 GLN CA 1 1  47 GLN C       -82.06     -43.06 . 124 . C . 125 . N  . 125 . CA . 125 . C  1 1 
        72 . 1 1  47 GLN N 1 1  47 GLN CA 1 1  47 GLN C  1 1  48 SER N       -56.91     -12.67 . 125 . N . 125 . CA . 125 . C  . 126 . N  1 1 
        73 . 1 1  47 GLN C 1 1  48 SER N  1 1  48 SER CA 1 1  48 SER C       -78.49     -52.17 . 125 . C . 126 . N  . 126 . CA . 126 . C  1 1 
        74 . 1 1  48 SER N 1 1  48 SER CA 1 1  48 SER C  1 1  49 GLU N        -55.3     -23.62 . 126 . N . 126 . CA . 126 . C  . 127 . N  1 1 
        75 . 1 1  48 SER C 1 1  49 GLU N  1 1  49 GLU CA 1 1  49 GLU C   -96.189995     -54.59 . 126 . C . 127 . N  . 127 . CA . 127 . C  1 1 
        76 . 1 1  49 GLU N 1 1  49 GLU CA 1 1  49 GLU C  1 1  50 LEU N       -55.08      -7.08 . 127 . N . 127 . CA . 127 . C  . 128 . N  1 1 
        77 . 1 1  49 GLU C 1 1  50 LEU N  1 1  50 LEU CA 1 1  50 LEU C       -136.4  -75.87999 . 127 . C . 128 . N  . 128 . CA . 128 . C  1 1 
        78 . 1 1  50 LEU N 1 1  50 LEU CA 1 1  50 LEU C  1 1  51 GLY N       -45.68      24.48 . 128 . N . 128 . CA . 128 . C  . 129 . N  1 1 
        79 . 1 1  53 TYR C 1 1  54 ASP N  1 1  54 ASP CA 1 1  54 ASP C      -146.34      -45.1 . 131 . C . 132 . N  . 132 . CA . 132 . C  1 1 
        80 . 1 1  54 ASP N 1 1  54 ASP CA 1 1  54 ASP C  1 1  55 PRO N        90.66     137.62 . 132 . N . 132 . CA . 132 . C  . 133 . N  1 1 
        81 . 1 1  55 PRO C 1 1  56 GLU N  1 1  56 GLU CA 1 1  56 GLU C       -86.68     -45.84 . 133 . C . 134 . N  . 134 . CA . 134 . C  1 1 
        82 . 1 1  56 GLU N 1 1  56 GLU CA 1 1  56 GLU C  1 1  57 LEU N       -57.04      -8.24 . 134 . N . 134 . CA . 134 . C  . 135 . N  1 1 
        83 . 1 1  56 GLU C 1 1  57 LEU N  1 1  57 LEU CA 1 1  57 LEU C  -110.689995     -57.17 . 134 . C . 135 . N  . 135 . CA . 135 . C  1 1 
        84 . 1 1  57 LEU N 1 1  57 LEU CA 1 1  57 LEU C  1 1  58 HIS N       -45.45       4.11 . 135 . N . 135 . CA . 135 . C  . 136 . N  1 1 
        85 . 1 1  61 ASP C 1 1  62 TYR N  1 1  62 TYR CA 1 1  62 TYR C       -92.45     -37.77 . 139 . C . 140 . N  . 140 . CA . 140 . C  1 1 
        86 . 1 1  62 TYR N 1 1  62 TYR CA 1 1  62 TYR C  1 1  63 VAL N       -88.88      16.96 . 140 . N . 140 . CA . 140 . C  . 141 . N  1 1 
        87 . 1 1  63 VAL C 1 1  64 SER N  1 1  64 SER CA 1 1  64 SER C       -80.43     -49.31 . 141 . C . 142 . N  . 142 . CA . 142 . C  1 1 
        88 . 1 1  64 SER N 1 1  64 SER CA 1 1  64 SER C  1 1  65 ASP N       -53.34 -15.499999 . 142 . N . 142 . CA . 142 . C  . 143 . N  1 1 
        89 . 1 1  64 SER C 1 1  65 ASP N  1 1  65 ASP CA 1 1  65 ASP C   -116.33001     -54.73 . 142 . C . 143 . N  . 143 . CA . 143 . C  1 1 
        90 . 1 1  65 ASP N 1 1  65 ASP CA 1 1  65 ASP C  1 1  66 PHE N       -66.53      19.07 . 143 . N . 143 . CA . 143 . C  . 144 . N  1 1 
        91 . 1 1  66 PHE C 1 1  67 LYS N  1 1  67 LYS CA 1 1  67 LYS C      -130.08     -50.64 . 144 . C . 145 . N  . 145 . CA . 145 . C  1 1 
        92 . 1 1  67 LYS N 1 1  67 LYS CA 1 1  67 LYS C  1 1  68 LEU N        80.65     163.13 . 145 . N . 145 . CA . 145 . C  . 146 . N  1 1 
        93 . 1 1  71 ASN C 1 1  72 GLN N  1 1  72 GLN CA 1 1  72 GLN C        -89.5     -51.58 . 149 . C . 150 . N  . 150 . CA . 150 . C  1 1 
        94 . 1 1  72 GLN N 1 1  72 GLN CA 1 1  72 GLN C  1 1  73 THR N        89.73     170.61 . 150 . N . 150 . CA . 150 . C  . 151 . N  1 1 
        95 . 1 1  72 GLN C 1 1  73 THR N  1 1  73 THR CA 1 1  73 THR C      -161.55     -53.55 . 150 . C . 151 . N  . 151 . CA . 151 . C  1 1 
        96 . 1 1  73 THR N 1 1  73 THR CA 1 1  73 THR C  1 1  74 LYS N       134.83     185.59 . 151 . N . 151 . CA . 151 . C  . 152 . N  1 1 
        97 . 1 1  73 THR C 1 1  74 LYS N  1 1  74 LYS CA 1 1  74 LYS C       -78.63     -44.83 . 151 . C . 152 . N  . 152 . CA . 152 . C  1 1 
        98 . 1 1  74 LYS N 1 1  74 LYS CA 1 1  74 LYS C  1 1  75 GLU N    -54.63999     -13.28 . 152 . N . 152 . CA . 152 . C  . 153 . N  1 1 
        99 . 1 1  74 LYS C 1 1  75 GLU N  1 1  75 GLU CA 1 1  75 GLU C       -74.56      -48.2 . 152 . C . 153 . N  . 153 . CA . 153 . C  1 1 
       100 . 1 1  75 GLU N 1 1  75 GLU CA 1 1  75 GLU C  1 1  76 LEU N       -64.39     -22.59 . 153 . N . 153 . CA . 153 . C  . 154 . N  1 1 
       101 . 1 1  75 GLU C 1 1  76 LEU N  1 1  76 LEU CA 1 1  76 LEU C       -77.56      -52.6 . 153 . C . 154 . N  . 154 . CA . 154 . C  1 1 
       102 . 1 1  76 LEU N 1 1  76 LEU CA 1 1  76 LEU C  1 1  77 GLU N       -50.68     -36.68 . 154 . N . 154 . CA . 154 . C  . 155 . N  1 1 
       103 . 1 1  76 LEU C 1 1  77 GLU N  1 1  77 GLU CA 1 1  77 GLU C       -78.17 -50.009995 . 154 . C . 155 . N  . 155 . CA . 155 . C  1 1 
       104 . 1 1  77 GLU N 1 1  77 GLU CA 1 1  77 GLU C  1 1  78 GLU N       -53.71     -28.83 . 155 . N . 155 . CA . 155 . C  . 156 . N  1 1 
       105 . 1 1  77 GLU C 1 1  78 GLU N  1 1  78 GLU CA 1 1  78 GLU C       -64.52     -49.76 . 155 . C . 156 . N  . 156 . CA . 156 . C  1 1 
       106 . 1 1  78 GLU N 1 1  78 GLU CA 1 1  78 GLU C  1 1  79 LYS N       -62.05     -21.69 . 156 . N . 156 . CA . 156 . C  . 157 . N  1 1 
       107 . 1 1  78 GLU C 1 1  79 LYS N  1 1  79 LYS CA 1 1  79 LYS C       -73.12     -58.52 . 156 . C . 157 . N  . 157 . CA . 157 . C  1 1 
       108 . 1 1  79 LYS N 1 1  79 LYS CA 1 1  79 LYS C  1 1  80 VAL N       -53.06     -28.02 . 157 . N . 157 . CA . 157 . C  . 158 . N  1 1 
       109 . 1 1  79 LYS C 1 1  80 VAL N  1 1  80 VAL CA 1 1  80 VAL C       -66.93 -58.169994 . 157 . C . 158 . N  . 158 . CA . 158 . C  1 1 
       110 . 1 1  80 VAL N 1 1  80 VAL CA 1 1  80 VAL C  1 1  81 MET N       -52.83     -37.19 . 158 . N . 158 . CA . 158 . C  . 159 . N  1 1 
       111 . 1 1  80 VAL C 1 1  81 MET N  1 1  81 MET CA 1 1  81 MET C       -68.16     -49.72 . 158 . C . 159 . N  . 159 . CA . 159 . C  1 1 
       112 . 1 1  81 MET N 1 1  81 MET CA 1 1  81 MET C  1 1  82 GLU N       -49.08     -32.92 . 159 . N . 159 . CA . 159 . C  . 160 . N  1 1 
       113 . 1 1  81 MET C 1 1  82 GLU N  1 1  82 GLU CA 1 1  82 GLU C       -77.75     -51.11 . 159 . C . 160 . N  . 160 . CA . 160 . C  1 1 
       114 . 1 1  82 GLU N 1 1  82 GLU CA 1 1  82 GLU C  1 1  83 LEU N       -55.11     -28.39 . 160 . N . 160 . CA . 160 . C  . 161 . N  1 1 
       115 . 1 1  82 GLU C 1 1  83 LEU N  1 1  83 LEU CA 1 1  83 LEU C       -72.39     -56.87 . 160 . C . 161 . N  . 161 . CA . 161 . C  1 1 
       116 . 1 1  83 LEU N 1 1  83 LEU CA 1 1  83 LEU C  1 1  84 HIS N        -48.5     -31.82 . 161 . N . 161 . CA . 161 . C  . 162 . N  1 1 
       117 . 1 1  83 LEU C 1 1  84 HIS N  1 1  84 HIS CA 1 1  84 HIS C       -70.21     -54.49 . 161 . C . 162 . N  . 162 . CA . 162 . C  1 1 
       118 . 1 1  84 HIS N 1 1  84 HIS CA 1 1  84 HIS C  1 1  85 LYS N       -56.56     -34.92 . 162 . N . 162 . CA . 162 . C  . 163 . N  1 1 
       119 . 1 1  84 HIS C 1 1  85 LYS N  1 1  85 LYS CA 1 1  85 LYS C       -82.37     -44.53 . 162 . C . 163 . N  . 163 . CA . 163 . C  1 1 
       120 . 1 1  85 LYS N 1 1  85 LYS CA 1 1  85 LYS C  1 1  86 SER N       -58.45     -13.33 . 163 . N . 163 . CA . 163 . C  . 164 . N  1 1 
       121 . 1 1  85 LYS C 1 1  86 SER N  1 1  86 SER CA 1 1  86 SER C      -106.39     -54.71 . 163 . C . 164 . N  . 164 . CA . 164 . C  1 1 
       122 . 1 1  86 SER N 1 1  86 SER CA 1 1  86 SER C  1 1  87 TYR N       -58.03      23.57 . 164 . N . 164 . CA . 164 . C  . 165 . N  1 1 
       123 . 1 1  89 SER C 1 1  90 MET N  1 1  90 MET CA 1 1  90 MET C      -121.45     -42.05 . 167 . C . 168 . N  . 168 . CA . 168 . C  1 1 
       124 . 1 1  90 MET N 1 1  90 MET CA 1 1  90 MET C  1 1  91 THR N       104.21     166.93 . 168 . N . 168 . CA . 168 . C  . 169 . N  1 1 
       125 . 1 1  90 MET C 1 1  91 THR N  1 1  91 THR CA 1 1  91 THR C      -112.25     -53.53 . 168 . C . 169 . N  . 169 . CA . 169 . C  1 1 
       126 . 1 1  91 THR N 1 1  91 THR CA 1 1  91 THR C  1 1  92 PRO N        80.43     192.31 . 169 . N . 169 . CA . 169 . C  . 170 . N  1 1 
       127 . 1 1  92 PRO C 1 1  93 ALA N  1 1  93 ALA CA 1 1  93 ALA C       -76.05     -49.13 . 170 . C . 171 . N  . 171 . CA . 171 . C  1 1 
       128 . 1 1  93 ALA N 1 1  93 ALA CA 1 1  93 ALA C  1 1  94 GLN N       -57.05     -26.01 . 171 . N . 171 . CA . 171 . C  . 172 . N  1 1 
       129 . 1 1  93 ALA C 1 1  94 GLN N  1 1  94 GLN CA 1 1  94 GLN C       -71.91     -57.83 . 171 . C . 172 . N  . 172 . CA . 172 . C  1 1 
       130 . 1 1  94 GLN N 1 1  94 GLN CA 1 1  94 GLN C  1 1  95 ALA N       -51.03     -32.23 . 172 . N . 172 . CA . 172 . C  . 173 . N  1 1 
       131 . 1 1  94 GLN C 1 1  95 ALA N  1 1  95 ALA CA 1 1  95 ALA C       -84.42 -51.299995 . 172 . C . 173 . N  . 173 . CA . 173 . C  1 1 
       132 . 1 1  95 ALA N 1 1  95 ALA CA 1 1  95 ALA C  1 1  96 ASP N       -47.77     -25.33 . 173 . N . 173 . CA . 173 . C  . 174 . N  1 1 
       133 . 1 1  95 ALA C 1 1  96 ASP N  1 1  96 ASP CA 1 1  96 ASP C       -77.35 -57.390003 . 173 . C . 174 . N  . 174 . CA . 174 . C  1 1 
       134 . 1 1  96 ASP N 1 1  96 ASP CA 1 1  96 ASP C  1 1  97 LEU N   -51.379997 -30.699999 . 174 . N . 174 . CA . 174 . C  . 175 . N  1 1 
       135 . 1 1  96 ASP C 1 1  97 LEU N  1 1  97 LEU CA 1 1  97 LEU C        -71.5     -55.14 . 174 . C . 175 . N  . 175 . CA . 175 . C  1 1 
       136 . 1 1  97 LEU N 1 1  97 LEU CA 1 1  97 LEU C  1 1  98 GLU N       -52.95     -25.71 . 175 . N . 175 . CA . 175 . C  . 176 . N  1 1 
       137 . 1 1  97 LEU C 1 1  98 GLU N  1 1  98 GLU CA 1 1  98 GLU C       -81.16     -51.88 . 175 . C . 176 . N  . 176 . CA . 176 . C  1 1 
       138 . 1 1  98 GLU N 1 1  98 GLU CA 1 1  98 GLU C  1 1  99 PHE N       -54.25     -24.33 . 176 . N . 176 . CA . 176 . C  . 177 . N  1 1 
       139 . 1 1  98 GLU C 1 1  99 PHE N  1 1  99 PHE CA 1 1  99 PHE C       -77.34     -51.14 . 176 . C . 177 . N  . 177 . CA . 177 . C  1 1 
       140 . 1 1  99 PHE N 1 1  99 PHE CA 1 1  99 PHE C  1 1 100 LEU N       -57.09     -35.69 . 177 . N . 177 . CA . 177 . C  . 178 . N  1 1 
       141 . 1 1  99 PHE C 1 1 100 LEU N  1 1 100 LEU CA 1 1 100 LEU C        -81.0      -49.0 . 177 . C . 178 . N  . 178 . CA . 178 . C  1 1 
       142 . 1 1 100 LEU N 1 1 100 LEU CA 1 1 100 LEU C  1 1 101 GLU N       -52.04     -17.88 . 178 . N . 178 . CA . 178 . C  . 179 . N  1 1 
       143 . 1 1 100 LEU C 1 1 101 GLU N  1 1 101 GLU CA 1 1 101 GLU C       -76.86     -50.94 . 178 . C . 179 . N  . 179 . CA . 179 . C  1 1 
       144 . 1 1 101 GLU N 1 1 101 GLU CA 1 1 101 GLU C  1 1 102 ASN N       -52.35     -32.99 . 179 . N . 179 . CA . 179 . C  . 180 . N  1 1 
       145 . 1 1 101 GLU C 1 1 102 ASN N  1 1 102 ASN CA 1 1 102 ASN C       -73.59     -52.99 . 179 . C . 180 . N  . 180 . CA . 180 . C  1 1 
       146 . 1 1 102 ASN N 1 1 102 ASN CA 1 1 102 ASN C  1 1 103 ALA N       -48.98      -32.3 . 180 . N . 180 . CA . 180 . C  . 181 . N  1 1 
       147 . 1 1 102 ASN C 1 1 103 ALA N  1 1 103 ALA CA 1 1 103 ALA C       -71.77     -51.93 . 180 . C . 181 . N  . 181 . CA . 181 . C  1 1 
       148 . 1 1 103 ALA N 1 1 103 ALA CA 1 1 103 ALA C  1 1 104 LYS N   -46.669994     -38.07 . 181 . N . 181 . CA . 181 . C  . 182 . N  1 1 
       149 . 1 1 103 ALA C 1 1 104 LYS N  1 1 104 LYS CA 1 1 104 LYS C       -83.96     -54.28 . 181 . C . 182 . N  . 182 . CA . 182 . C  1 1 
       150 . 1 1 104 LYS N 1 1 104 LYS CA 1 1 104 LYS C  1 1 105 LYS N   -61.030003     -15.19 . 182 . N . 182 . CA . 182 . C  . 183 . N  1 1 
       151 . 1 1 104 LYS C 1 1 105 LYS N  1 1 105 LYS CA 1 1 105 LYS C       -77.41     -53.57 . 182 . C . 183 . N  . 183 . CA . 183 . C  1 1 
       152 . 1 1 105 LYS N 1 1 105 LYS CA 1 1 105 LYS C  1 1 106 LEU N       -46.77      -9.93 . 183 . N . 183 . CA . 183 . C  . 184 . N  1 1 
       153 . 1 1 105 LYS C 1 1 106 LEU N  1 1 106 LEU CA 1 1 106 LEU C   -123.36001     -62.92 . 183 . C . 184 . N  . 184 . CA . 184 . C  1 1 
       154 . 1 1 106 LEU N 1 1 106 LEU CA 1 1 106 LEU C  1 1 107 SER N       -24.41      27.47 . 184 . N . 184 . CA . 184 . C  . 185 . N  1 1 
       155 . 1 1  16 TYR N 1 1  16 TYR CA 1 1  16 TYR CB 1 1  16 TYR CG       150.0      210.0 .  94 . N .  94 . CA .  94 . CB .  94 . CG 1 1 
       156 . 1 1  17 TYR N 1 1  17 TYR CA 1 1  17 TYR CB 1 1  17 TYR CG   -89.99999      -30.0 .  95 . N .  95 . CA .  95 . CB .  95 . CG 1 1 
       157 . 1 1  35 PHE N 1 1  35 PHE CA 1 1  35 PHE CB 1 1  35 PHE CG       150.0      210.0 . 113 . N . 113 . CA . 113 . CB . 113 . CG 1 1 
       158 . 1 1  44 TYR N 1 1  44 TYR CA 1 1  44 TYR CB 1 1  44 TYR CG   -89.99999      -30.0 . 122 . N . 122 . CA . 122 . CB . 122 . CG 1 1 
       159 . 1 1  58 HIS N 1 1  58 HIS CA 1 1  58 HIS CB 1 1  58 HIS CG   -89.99999      -30.0 . 136 . N . 136 . CA . 136 . CB . 136 . CG 1 1 
       160 . 1 1  66 PHE N 1 1  66 PHE CA 1 1  66 PHE CB 1 1  66 PHE CG   -89.99999      -30.0 . 144 . N . 144 . CA . 144 . CB . 144 . CG 1 1 
       161 . 1 1  84 HIS N 1 1  84 HIS CA 1 1  84 HIS CB 1 1  84 HIS CG       150.0      210.0 . 162 . N . 162 . CA . 162 . CB . 162 . CG 1 1 
       162 . 1 1  87 TYR N 1 1  87 TYR CA 1 1  87 TYR CB 1 1  87 TYR CG   -89.99999      -30.0 . 165 . N . 165 . CA . 165 . CB . 165 . CG 1 1 
       163 . 1 1  99 PHE N 1 1  99 PHE CA 1 1  99 PHE CB 1 1  99 PHE CG       150.0      210.0 . 177 . N . 177 . CA . 177 . CB . 177 . CG 1 1 
    stop_

save_


save_CNS/XPLOR_dipolar_coupling_5
    _RDC_constraint_list.Sf_category         RDC_constraints
    _RDC_constraint_list.Entry_ID            1
    _RDC_constraint_list.ID                  1
    _RDC_constraint_list.Constraint_file_ID  .
    _RDC_constraint_list.Block_ID            .

    loop_
       _RDC_constraint.ID
       _RDC_constraint.Entity_assembly_ID_1
       _RDC_constraint.Entity_ID_1
       _RDC_constraint.Comp_index_ID_1
       _RDC_constraint.Comp_ID_1
       _RDC_constraint.Atom_ID_1
       _RDC_constraint.Entity_assembly_ID_2
       _RDC_constraint.Entity_ID_2
       _RDC_constraint.Comp_index_ID_2
       _RDC_constraint.Comp_ID_2
       _RDC_constraint.Atom_ID_2
       _RDC_constraint.RDC_val
       _RDC_constraint.RDC_lower_bound
       _RDC_constraint.RDC_upper_bound
       _RDC_constraint.RDC_val_err
       _RDC_constraint.Auth_asym_ID_1
       _RDC_constraint.Auth_seq_ID_1
       _RDC_constraint.Auth_comp_ID_1
       _RDC_constraint.Auth_atom_ID_1
       _RDC_constraint.Auth_asym_ID_2
       _RDC_constraint.Auth_seq_ID_2
       _RDC_constraint.Auth_comp_ID_2
       _RDC_constraint.Auth_atom_ID_2
       _RDC_constraint.Entry_ID
       _RDC_constraint.RDC_constraint_list_ID

        1 1 1  10 THR N 1 1  10 THR H  -1.98 . . . .  88 . N .  88 . HN 1 1 
        2 1 1  11 GLU N 1 1  11 GLU H   3.09 . . . .  89 . N .  89 . HN 1 1 
        3 1 1  12 ASP N 1 1  12 ASP H   5.73 . . . .  90 . N .  90 . HN 1 1 
        4 1 1  13 ILE N 1 1  13 ILE H   0.35 . . . .  91 . N .  91 . HN 1 1 
        5 1 1  14 THR N 1 1  14 THR H   2.08 . . . .  92 . N .  92 . HN 1 1 
        6 1 1  15 ARG N 1 1  15 ARG H   4.41 . . . .  93 . N .  93 . HN 1 1 
        7 1 1  16 TYR N 1 1  16 TYR H   7.05 . . . .  94 . N .  94 . HN 1 1 
        8 1 1  18 LEU N 1 1  18 LEU H   5.23 . . . .  96 . N .  96 . HN 1 1 
        9 1 1  22 LEU N 1 1  22 LEU H   6.95 . . . . 100 . N . 100 . HN 1 1 
       10 1 1  23 ARG N 1 1  23 ARG H   9.98 . . . . 101 . N . 101 . HN 1 1 
       11 1 1  24 GLN N 1 1  24 GLN H  -2.49 . . . . 102 . N . 102 . HN 1 1 
       12 1 1  25 ASP N 1 1  25 ASP H   2.89 . . . . 103 . N . 103 . HN 1 1 
       13 1 1  27 VAL N 1 1  27 VAL H   8.92 . . . . 105 . N . 105 . HN 1 1 
       14 1 1  28 ALA N 1 1  28 ALA H  -2.38 . . . . 106 . N . 106 . HN 1 1 
       15 1 1  29 GLY N 1 1  29 GLY H   1.93 . . . . 107 . N . 107 . HN 1 1 
       16 1 1  30 ARG N 1 1  30 ARG H   3.25 . . . . 108 . N . 108 . HN 1 1 
       17 1 1  31 LEU N 1 1  31 LEU H -18.96 . . . . 109 . N . 109 . HN 1 1 
       18 1 1  33 CYS N 1 1  33 CYS H   -3.6 . . . . 111 . N . 111 . HN 1 1 
       19 1 1  35 PHE N 1 1  35 PHE H  13.02 . . . . 113 . N . 113 . HN 1 1 
       20 1 1  36 ALA N 1 1  36 ALA H  10.09 . . . . 114 . N . 114 . HN 1 1 
       21 1 1  37 THR N 1 1  37 THR H   4.51 . . . . 115 . N . 115 . HN 1 1 
       22 1 1  39 ALA N 1 1  39 ALA H  14.24 . . . . 117 . N . 117 . HN 1 1 
       23 1 1  40 LEU N 1 1  40 LEU H   3.91 . . . . 118 . N . 118 . HN 1 1 
       24 1 1  41 LEU N 1 1  41 LEU H   8.21 . . . . 119 . N . 119 . HN 1 1 
       25 1 1  42 GLY N 1 1  42 GLY H  14.61 . . . . 120 . N . 120 . HN 1 1 
       26 1 1  43 SER N 1 1  43 SER H  11.76 . . . . 121 . N . 121 . HN 1 1 
       27 1 1  44 TYR N 1 1  44 TYR H   1.16 . . . . 122 . N . 122 . HN 1 1 
       28 1 1  46 ILE N 1 1  46 ILE H  13.68 . . . . 124 . N . 124 . HN 1 1 
       29 1 1  47 GLN N 1 1  47 GLN H   9.07 . . . . 125 . N . 125 . HN 1 1 
       30 1 1  48 SER N 1 1  48 SER H   6.24 . . . . 126 . N . 126 . HN 1 1 
       31 1 1  49 GLU N 1 1  49 GLU H  14.24 . . . . 127 . N . 127 . HN 1 1 
       32 1 1  50 LEU N 1 1  50 LEU H  13.93 . . . . 128 . N . 128 . HN 1 1 
       33 1 1  51 GLY N 1 1  51 GLY H -12.87 . . . . 129 . N . 129 . HN 1 1 
       34 1 1  52 ASP N 1 1  52 ASP H   8.92 . . . . 130 . N . 130 . HN 1 1 
       35 1 1  62 TYR N 1 1  62 TYR H   4.56 . . . . 140 . N . 140 . HN 1 1 
       36 1 1  64 SER N 1 1  64 SER H -16.64 . . . . 142 . N . 142 . HN 1 1 
       37 1 1  65 ASP N 1 1  65 ASP H   1.87 . . . . 143 . N . 143 . HN 1 1 
       38 1 1  67 LYS N 1 1  67 LYS H  10.03 . . . . 145 . N . 145 . HN 1 1 
       39 1 1  68 LEU N 1 1  68 LEU H -15.46 . . . . 146 . N . 146 . HN 1 1 
       40 1 1  69 ALA N 1 1  69 ALA H  -6.54 . . . . 147 . N . 147 . HN 1 1 
       41 1 1  73 THR N 1 1  73 THR H  -5.06 . . . . 151 . N . 151 . HN 1 1 
       42 1 1  74 LYS N 1 1  74 LYS H   3.15 . . . . 152 . N . 152 . HN 1 1 
       43 1 1  75 GLU N 1 1  75 GLU H   5.02 . . . . 153 . N . 153 . HN 1 1 
       44 1 1  77 GLU N 1 1  77 GLU H   5.83 . . . . 155 . N . 155 . HN 1 1 
       45 1 1  78 GLU N 1 1  78 GLU H   6.54 . . . . 156 . N . 156 . HN 1 1 
       46 1 1  79 LYS N 1 1  79 LYS H   6.03 . . . . 157 . N . 157 . HN 1 1 
       47 1 1  81 MET N 1 1  81 MET H   4.66 . . . . 159 . N . 159 . HN 1 1 
       48 1 1  82 GLU N 1 1  82 GLU H   4.86 . . . . 160 . N . 160 . HN 1 1 
       49 1 1  84 HIS N 1 1  84 HIS H    3.5 . . . . 162 . N . 162 . HN 1 1 
       50 1 1  86 SER N 1 1  86 SER H   2.63 . . . . 164 . N . 164 . HN 1 1 
       51 1 1  87 TYR N 1 1  87 TYR H    6.6 . . . . 165 . N . 165 . HN 1 1 
       52 1 1  88 ARG N 1 1  88 ARG H  -0.45 . . . . 166 . N . 166 . HN 1 1 
       53 1 1  89 SER N 1 1  89 SER H   5.27 . . . . 167 . N . 167 . HN 1 1 
       54 1 1  90 MET N 1 1  90 MET H  -5.78 . . . . 168 . N . 168 . HN 1 1 
       55 1 1  91 THR N 1 1  91 THR H  -0.31 . . . . 169 . N . 169 . HN 1 1 
       56 1 1  93 ALA N 1 1  93 ALA H   4.61 . . . . 171 . N . 171 . HN 1 1 
       57 1 1  97 LEU N 1 1  97 LEU H  -6.09 . . . . 175 . N . 175 . HN 1 1 
       58 1 1  99 PHE N 1 1  99 PHE H   4.76 . . . . 177 . N . 177 . HN 1 1 
       59 1 1 101 GLU N 1 1 101 GLU H  -11.2 . . . . 179 . N . 179 . HN 1 1 
       60 1 1 102 ASN N 1 1 102 ASN H  -0.26 . . . . 180 . N . 180 . HN 1 1 
       61 1 1 103 ALA N 1 1 103 ALA H   1.17 . . . . 181 . N . 181 . HN 1 1 
       62 1 1 104 LYS N 1 1 104 LYS H  -5.92 . . . . 182 . N . 182 . HN 1 1 
       63 1 1 105 LYS N 1 1 105 LYS H -13.59 . . . . 183 . N . 183 . HN 1 1 
       64 1 1 106 LEU N 1 1 106 LEU H   8.21 . . . . 184 . N . 184 . HN 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1   1 GLY C    C  22.998  19.228   1.393 1.00 . A A .  79 GLY C    1 1 
        1     2 1 1   1 GLY CA   C  23.568  19.824   2.664 1.00 . A A .  79 GLY CA   1 1 
        1     3 1 1   1 GLY H1   H  25.389  20.073   1.673 1.00 . A A .  79 GLY H1   1 1 
        1     4 1 1   1 GLY H2   H  25.462  19.005   2.982 1.00 . A A .  79 GLY H2   1 1 
        1     5 1 1   1 GLY H3   H  25.383  20.672   3.255 1.00 . A A .  79 GLY H3   1 1 
        1     6 1 1   1 GLY HA2  H  23.261  19.217   3.503 1.00 . A A .  79 GLY HA2  1 1 
        1     7 1 1   1 GLY HA3  H  23.170  20.821   2.791 1.00 . A A .  79 GLY HA3  1 1 
        1     8 1 1   1 GLY N    N  25.055  19.898   2.642 1.00 . A A .  79 GLY N    1 1 
        1     9 1 1   1 GLY O    O  23.257  18.067   1.073 1.00 . A A .  79 GLY O    1 1 
        1    10 1 1   2 SER C    C  20.681  18.383  -0.329 1.00 . A A .  80 SER C    1 1 
        1    11 1 1   2 SER CA   C  21.610  19.566  -0.579 1.00 . A A .  80 SER CA   1 1 
        1    12 1 1   2 SER CB   C  22.692  19.176  -1.587 1.00 . A A .  80 SER CB   1 1 
        1    13 1 1   2 SER H    H  22.050  20.937   0.973 1.00 . A A .  80 SER H    1 1 
        1    14 1 1   2 SER HA   H  21.032  20.383  -0.983 1.00 . A A .  80 SER HA   1 1 
        1    15 1 1   2 SER HB2  H  23.040  18.177  -1.371 1.00 . A A .  80 SER HB2  1 1 
        1    16 1 1   2 SER HB3  H  22.279  19.206  -2.585 1.00 . A A .  80 SER HB3  1 1 
        1    17 1 1   2 SER HG   H  24.573  19.637  -1.886 1.00 . A A .  80 SER HG   1 1 
        1    18 1 1   2 SER N    N  22.219  20.022   0.665 1.00 . A A .  80 SER N    1 1 
        1    19 1 1   2 SER O    O  21.129  17.296   0.036 1.00 . A A .  80 SER O    1 1 
        1    20 1 1   2 SER OG   O  23.794  20.065  -1.523 1.00 . A A .  80 SER OG   1 1 
        1    21 1 1   3 HIS C    C  17.789  17.110  -1.654 1.00 . A A .  81 HIS C    1 1 
        1    22 1 1   3 HIS CA   C  18.393  17.553  -0.325 1.00 . A A .  81 HIS CA   1 1 
        1    23 1 1   3 HIS CB   C  17.288  18.043   0.612 1.00 . A A .  81 HIS CB   1 1 
        1    24 1 1   3 HIS CD2  C  18.303  19.688   2.342 1.00 . A A .  81 HIS CD2  1 1 
        1    25 1 1   3 HIS CE1  C  18.309  18.358   4.084 1.00 . A A .  81 HIS CE1  1 1 
        1    26 1 1   3 HIS CG   C  17.793  18.498   1.946 1.00 . A A .  81 HIS CG   1 1 
        1    27 1 1   3 HIS H    H  19.090  19.489  -0.820 1.00 . A A .  81 HIS H    1 1 
        1    28 1 1   3 HIS HA   H  18.890  16.709   0.129 1.00 . A A .  81 HIS HA   1 1 
        1    29 1 1   3 HIS HB2  H  16.775  18.874   0.151 1.00 . A A .  81 HIS HB2  1 1 
        1    30 1 1   3 HIS HB3  H  16.584  17.240   0.779 1.00 . A A .  81 HIS HB3  1 1 
        1    31 1 1   3 HIS HD1  H  17.505  16.756   3.097 1.00 . A A .  81 HIS HD1  1 1 
        1    32 1 1   3 HIS HD2  H  18.438  20.565   1.724 1.00 . A A .  81 HIS HD2  1 1 
        1    33 1 1   3 HIS HE1  H  18.444  17.976   5.086 1.00 . A A .  81 HIS HE1  1 1 
        1    34 1 1   3 HIS HE2  H  19.077  20.252   4.210 1.00 . A A .  81 HIS HE2  1 1 
        1    35 1 1   3 HIS N    N  19.386  18.601  -0.529 1.00 . A A .  81 HIS N    1 1 
        1    36 1 1   3 HIS ND1  N  17.812  17.686   3.061 1.00 . A A .  81 HIS ND1  1 1 
        1    37 1 1   3 HIS NE2  N  18.615  19.575   3.674 1.00 . A A .  81 HIS NE2  1 1 
        1    38 1 1   3 HIS O    O  17.571  15.920  -1.883 1.00 . A A .  81 HIS O    1 1 
        1    39 1 1   4 MET C    C  17.994  17.213  -4.779 1.00 . A A .  82 MET C    1 1 
        1    40 1 1   4 MET CA   C  16.942  17.785  -3.834 1.00 . A A .  82 MET CA   1 1 
        1    41 1 1   4 MET CB   C  16.331  19.050  -4.438 1.00 . A A .  82 MET CB   1 1 
        1    42 1 1   4 MET CE   C  13.407  18.369  -5.186 1.00 . A A .  82 MET CE   1 1 
        1    43 1 1   4 MET CG   C  15.246  19.673  -3.575 1.00 . A A .  82 MET CG   1 1 
        1    44 1 1   4 MET H    H  17.717  19.005  -2.288 1.00 . A A .  82 MET H    1 1 
        1    45 1 1   4 MET HA   H  16.163  17.050  -3.696 1.00 . A A .  82 MET HA   1 1 
        1    46 1 1   4 MET HB2  H  17.113  19.782  -4.580 1.00 . A A .  82 MET HB2  1 1 
        1    47 1 1   4 MET HB3  H  15.901  18.805  -5.398 1.00 . A A .  82 MET HB3  1 1 
        1    48 1 1   4 MET HE1  H  13.918  17.481  -5.529 1.00 . A A .  82 MET HE1  1 1 
        1    49 1 1   4 MET HE2  H  13.739  19.220  -5.761 1.00 . A A .  82 MET HE2  1 1 
        1    50 1 1   4 MET HE3  H  12.342  18.243  -5.313 1.00 . A A .  82 MET HE3  1 1 
        1    51 1 1   4 MET HG2  H  15.641  19.830  -2.583 1.00 . A A .  82 MET HG2  1 1 
        1    52 1 1   4 MET HG3  H  14.966  20.624  -4.004 1.00 . A A .  82 MET HG3  1 1 
        1    53 1 1   4 MET N    N  17.521  18.075  -2.527 1.00 . A A .  82 MET N    1 1 
        1    54 1 1   4 MET O    O  19.171  17.568  -4.702 1.00 . A A .  82 MET O    1 1 
        1    55 1 1   4 MET SD   S  13.775  18.638  -3.454 1.00 . A A .  82 MET SD   1 1 
        1    56 1 1   5 ASP C    C  17.751  15.398  -7.942 1.00 . A A .  83 ASP C    1 1 
        1    57 1 1   5 ASP CA   C  18.470  15.703  -6.628 1.00 . A A .  83 ASP CA   1 1 
        1    58 1 1   5 ASP CB   C  19.056  14.416  -6.043 1.00 . A A .  83 ASP CB   1 1 
        1    59 1 1   5 ASP CG   C  20.467  14.608  -5.523 1.00 . A A .  83 ASP CG   1 1 
        1    60 1 1   5 ASP H    H  16.615  16.081  -5.681 1.00 . A A .  83 ASP H    1 1 
        1    61 1 1   5 ASP HA   H  19.274  16.397  -6.820 1.00 . A A .  83 ASP HA   1 1 
        1    62 1 1   5 ASP HB2  H  18.434  14.084  -5.225 1.00 . A A .  83 ASP HB2  1 1 
        1    63 1 1   5 ASP HB3  H  19.074  13.654  -6.809 1.00 . A A .  83 ASP HB3  1 1 
        1    64 1 1   5 ASP N    N  17.564  16.325  -5.669 1.00 . A A .  83 ASP N    1 1 
        1    65 1 1   5 ASP O    O  16.929  14.485  -8.008 1.00 . A A .  83 ASP O    1 1 
        1    66 1 1   5 ASP OD1  O  21.412  14.556  -6.338 1.00 . A A .  83 ASP OD1  1 1 
        1    67 1 1   5 ASP OD2  O  20.627  14.811  -4.301 1.00 . A A .  83 ASP OD2  1 1 
        1    68 1 1   6 PRO C    C  17.878  14.660 -10.993 1.00 . A A .  84 PRO C    1 1 
        1    69 1 1   6 PRO CA   C  17.426  15.956 -10.323 1.00 . A A .  84 PRO CA   1 1 
        1    70 1 1   6 PRO CB   C  17.894  17.167 -11.133 1.00 . A A .  84 PRO CB   1 1 
        1    71 1 1   6 PRO CD   C  19.022  17.271  -9.029 1.00 . A A .  84 PRO CD   1 1 
        1    72 1 1   6 PRO CG   C  19.173  17.579 -10.493 1.00 . A A .  84 PRO CG   1 1 
        1    73 1 1   6 PRO HA   H  16.348  15.963 -10.250 1.00 . A A .  84 PRO HA   1 1 
        1    74 1 1   6 PRO HB2  H  18.041  16.878 -12.164 1.00 . A A .  84 PRO HB2  1 1 
        1    75 1 1   6 PRO HB3  H  17.153  17.950 -11.075 1.00 . A A .  84 PRO HB3  1 1 
        1    76 1 1   6 PRO HD2  H  19.968  16.964  -8.609 1.00 . A A .  84 PRO HD2  1 1 
        1    77 1 1   6 PRO HD3  H  18.633  18.129  -8.501 1.00 . A A .  84 PRO HD3  1 1 
        1    78 1 1   6 PRO HG2  H  19.993  17.015 -10.913 1.00 . A A .  84 PRO HG2  1 1 
        1    79 1 1   6 PRO HG3  H  19.332  18.638 -10.638 1.00 . A A .  84 PRO HG3  1 1 
        1    80 1 1   6 PRO N    N  18.052  16.159  -9.012 1.00 . A A .  84 PRO N    1 1 
        1    81 1 1   6 PRO O    O  17.320  14.252 -12.012 1.00 . A A .  84 PRO O    1 1 
        1    82 1 1   7 ALA C    C  18.777  11.554 -10.288 1.00 . A A .  85 ALA C    1 1 
        1    83 1 1   7 ALA CA   C  19.411  12.768 -10.964 1.00 . A A .  85 ALA CA   1 1 
        1    84 1 1   7 ALA CB   C  20.925  12.722 -10.818 1.00 . A A .  85 ALA CB   1 1 
        1    85 1 1   7 ALA H    H  19.296  14.386  -9.608 1.00 . A A .  85 ALA H    1 1 
        1    86 1 1   7 ALA HA   H  19.176  12.743 -12.018 1.00 . A A .  85 ALA HA   1 1 
        1    87 1 1   7 ALA HB1  H  21.200  13.030  -9.820 1.00 . A A .  85 ALA HB1  1 1 
        1    88 1 1   7 ALA HB2  H  21.376  13.388 -11.538 1.00 . A A .  85 ALA HB2  1 1 
        1    89 1 1   7 ALA HB3  H  21.272  11.714 -10.992 1.00 . A A .  85 ALA HB3  1 1 
        1    90 1 1   7 ALA N    N  18.890  14.015 -10.418 1.00 . A A .  85 ALA N    1 1 
        1    91 1 1   7 ALA O    O  18.901  10.430 -10.773 1.00 . A A .  85 ALA O    1 1 
        1    92 1 1   8 GLN C    C  16.010  10.509  -8.911 1.00 . A A .  86 GLN C    1 1 
        1    93 1 1   8 GLN CA   C  17.446  10.705  -8.434 1.00 . A A .  86 GLN CA   1 1 
        1    94 1 1   8 GLN CB   C  17.464  10.999  -6.932 1.00 . A A .  86 GLN CB   1 1 
        1    95 1 1   8 GLN CD   C  18.748  10.719  -4.775 1.00 . A A .  86 GLN CD   1 1 
        1    96 1 1   8 GLN CG   C  18.825  10.794  -6.288 1.00 . A A .  86 GLN CG   1 1 
        1    97 1 1   8 GLN H    H  18.030  12.700  -8.826 1.00 . A A .  86 GLN H    1 1 
        1    98 1 1   8 GLN HA   H  18.001   9.797  -8.620 1.00 . A A .  86 GLN HA   1 1 
        1    99 1 1   8 GLN HB2  H  17.166  12.025  -6.775 1.00 . A A .  86 GLN HB2  1 1 
        1   100 1 1   8 GLN HB3  H  16.755  10.349  -6.441 1.00 . A A .  86 GLN HB3  1 1 
        1   101 1 1   8 GLN HE21 H  19.030   8.752  -4.833 1.00 . A A .  86 GLN HE21 1 1 
        1   102 1 1   8 GLN HE22 H  18.842   9.437  -3.259 1.00 . A A .  86 GLN HE22 1 1 
        1   103 1 1   8 GLN HG2  H  19.248   9.872  -6.657 1.00 . A A .  86 GLN HG2  1 1 
        1   104 1 1   8 GLN HG3  H  19.467  11.618  -6.561 1.00 . A A .  86 GLN HG3  1 1 
        1   105 1 1   8 GLN N    N  18.096  11.785  -9.167 1.00 . A A .  86 GLN N    1 1 
        1   106 1 1   8 GLN NE2  N  18.887   9.514  -4.234 1.00 . A A .  86 GLN NE2  1 1 
        1   107 1 1   8 GLN O    O  15.085  10.404  -8.104 1.00 . A A .  86 GLN O    1 1 
        1   108 1 1   8 GLN OE1  O  18.566  11.732  -4.101 1.00 . A A .  86 GLN OE1  1 1 
        1   109 1 1   9 LEU C    C  14.239   8.802 -11.104 1.00 . A A .  87 LEU C    1 1 
        1   110 1 1   9 LEU CA   C  14.507  10.276 -10.812 1.00 . A A .  87 LEU CA   1 1 
        1   111 1 1   9 LEU CB   C  14.378  11.092 -12.099 1.00 . A A .  87 LEU CB   1 1 
        1   112 1 1   9 LEU CD1  C  14.817  10.700 -14.540 1.00 . A A .  87 LEU CD1  1 1 
        1   113 1 1   9 LEU CD2  C  16.521  11.881 -13.139 1.00 . A A .  87 LEU CD2  1 1 
        1   114 1 1   9 LEU CG   C  15.446  10.804 -13.158 1.00 . A A .  87 LEU CG   1 1 
        1   115 1 1   9 LEU H    H  16.605  10.549 -10.818 1.00 . A A .  87 LEU H    1 1 
        1   116 1 1   9 LEU HA   H  13.777  10.628 -10.099 1.00 . A A .  87 LEU HA   1 1 
        1   117 1 1   9 LEU HB2  H  13.408  10.893 -12.530 1.00 . A A .  87 LEU HB2  1 1 
        1   118 1 1   9 LEU HB3  H  14.431  12.140 -11.843 1.00 . A A .  87 LEU HB3  1 1 
        1   119 1 1   9 LEU HD11 H  14.620   9.663 -14.769 1.00 . A A .  87 LEU HD11 1 1 
        1   120 1 1   9 LEU HD12 H  15.493  11.110 -15.275 1.00 . A A .  87 LEU HD12 1 1 
        1   121 1 1   9 LEU HD13 H  13.890  11.254 -14.555 1.00 . A A .  87 LEU HD13 1 1 
        1   122 1 1   9 LEU HD21 H  17.353  11.569 -13.753 1.00 . A A .  87 LEU HD21 1 1 
        1   123 1 1   9 LEU HD22 H  16.859  12.034 -12.125 1.00 . A A .  87 LEU HD22 1 1 
        1   124 1 1   9 LEU HD23 H  16.113  12.803 -13.527 1.00 . A A .  87 LEU HD23 1 1 
        1   125 1 1   9 LEU HG   H  15.917   9.857 -12.935 1.00 . A A .  87 LEU HG   1 1 
        1   126 1 1   9 LEU N    N  15.830  10.460 -10.226 1.00 . A A .  87 LEU N    1 1 
        1   127 1 1   9 LEU O    O  13.091   8.359 -11.102 1.00 . A A .  87 LEU O    1 1 
        1   128 1 1  10 THR C    C  14.482   5.886 -10.521 1.00 . A A .  88 THR C    1 1 
        1   129 1 1  10 THR CA   C  15.183   6.626 -11.655 1.00 . A A .  88 THR CA   1 1 
        1   130 1 1  10 THR CB   C  16.564   6.016 -11.900 1.00 . A A .  88 THR CB   1 1 
        1   131 1 1  10 THR CG2  C  16.993   6.068 -13.350 1.00 . A A .  88 THR CG2  1 1 
        1   132 1 1  10 THR H    H  16.195   8.459 -11.347 1.00 . A A .  88 THR H    1 1 
        1   133 1 1  10 THR HA   H  14.592   6.526 -12.553 1.00 . A A .  88 THR HA   1 1 
        1   134 1 1  10 THR HB   H  16.547   4.978 -11.597 1.00 . A A .  88 THR HB   1 1 
        1   135 1 1  10 THR HG1  H  17.497   6.399 -10.221 1.00 . A A .  88 THR HG1  1 1 
        1   136 1 1  10 THR HG21 H  17.335   7.064 -13.589 1.00 . A A .  88 THR HG21 1 1 
        1   137 1 1  10 THR HG22 H  16.155   5.814 -13.982 1.00 . A A .  88 THR HG22 1 1 
        1   138 1 1  10 THR HG23 H  17.795   5.363 -13.514 1.00 . A A .  88 THR HG23 1 1 
        1   139 1 1  10 THR N    N  15.305   8.049 -11.358 1.00 . A A .  88 THR N    1 1 
        1   140 1 1  10 THR O    O  13.519   5.152 -10.748 1.00 . A A .  88 THR O    1 1 
        1   141 1 1  10 THR OG1  O  17.551   6.686 -11.135 1.00 . A A .  88 THR OG1  1 1 
        1   142 1 1  11 GLU C    C  12.885   5.704  -8.047 1.00 . A A .  89 GLU C    1 1 
        1   143 1 1  11 GLU CA   C  14.383   5.429  -8.130 1.00 . A A .  89 GLU CA   1 1 
        1   144 1 1  11 GLU CB   C  15.071   5.898  -6.849 1.00 . A A .  89 GLU CB   1 1 
        1   145 1 1  11 GLU CD   C  17.300   5.194  -5.885 1.00 . A A .  89 GLU CD   1 1 
        1   146 1 1  11 GLU CG   C  16.585   5.985  -6.963 1.00 . A A .  89 GLU CG   1 1 
        1   147 1 1  11 GLU H    H  15.737   6.677  -9.179 1.00 . A A .  89 GLU H    1 1 
        1   148 1 1  11 GLU HA   H  14.534   4.365  -8.238 1.00 . A A .  89 GLU HA   1 1 
        1   149 1 1  11 GLU HB2  H  14.693   6.875  -6.588 1.00 . A A .  89 GLU HB2  1 1 
        1   150 1 1  11 GLU HB3  H  14.831   5.205  -6.056 1.00 . A A .  89 GLU HB3  1 1 
        1   151 1 1  11 GLU HG2  H  16.883   5.600  -7.927 1.00 . A A .  89 GLU HG2  1 1 
        1   152 1 1  11 GLU HG3  H  16.880   7.021  -6.884 1.00 . A A .  89 GLU HG3  1 1 
        1   153 1 1  11 GLU N    N  14.968   6.082  -9.298 1.00 . A A .  89 GLU N    1 1 
        1   154 1 1  11 GLU O    O  12.119   4.882  -7.545 1.00 . A A .  89 GLU O    1 1 
        1   155 1 1  11 GLU OE1  O  17.003   3.990  -5.737 1.00 . A A .  89 GLU OE1  1 1 
        1   156 1 1  11 GLU OE2  O  18.155   5.779  -5.188 1.00 . A A .  89 GLU OE2  1 1 
        1   157 1 1  12 ASP C    C  10.307   6.390  -9.569 1.00 . A A .  90 ASP C    1 1 
        1   158 1 1  12 ASP CA   C  11.061   7.226  -8.542 1.00 . A A .  90 ASP CA   1 1 
        1   159 1 1  12 ASP CB   C  10.891   8.715  -8.848 1.00 . A A .  90 ASP CB   1 1 
        1   160 1 1  12 ASP CG   C   9.555   9.254  -8.374 1.00 . A A .  90 ASP CG   1 1 
        1   161 1 1  12 ASP H    H  13.128   7.470  -8.946 1.00 . A A .  90 ASP H    1 1 
        1   162 1 1  12 ASP HA   H  10.666   7.016  -7.559 1.00 . A A .  90 ASP HA   1 1 
        1   163 1 1  12 ASP HB2  H  11.676   9.269  -8.355 1.00 . A A .  90 ASP HB2  1 1 
        1   164 1 1  12 ASP HB3  H  10.963   8.868  -9.915 1.00 . A A .  90 ASP HB3  1 1 
        1   165 1 1  12 ASP N    N  12.471   6.861  -8.552 1.00 . A A .  90 ASP N    1 1 
        1   166 1 1  12 ASP O    O   9.256   5.819  -9.275 1.00 . A A .  90 ASP O    1 1 
        1   167 1 1  12 ASP OD1  O   9.112   8.859  -7.275 1.00 . A A .  90 ASP OD1  1 1 
        1   168 1 1  12 ASP OD2  O   8.953  10.071  -9.101 1.00 . A A .  90 ASP OD2  1 1 
        1   169 1 1  13 ILE C    C  10.118   4.083 -11.471 1.00 . A A .  91 ILE C    1 1 
        1   170 1 1  13 ILE CA   C  10.261   5.553 -11.856 1.00 . A A .  91 ILE CA   1 1 
        1   171 1 1  13 ILE CB   C  11.104   5.654 -13.144 1.00 . A A .  91 ILE CB   1 1 
        1   172 1 1  13 ILE CD1  C   9.965   7.807 -13.882 1.00 . A A .  91 ILE CD1  1 1 
        1   173 1 1  13 ILE CG1  C  11.271   7.117 -13.558 1.00 . A A .  91 ILE CG1  1 1 
        1   174 1 1  13 ILE CG2  C  10.465   4.848 -14.266 1.00 . A A .  91 ILE CG2  1 1 
        1   175 1 1  13 ILE H    H  11.697   6.807 -10.939 1.00 . A A .  91 ILE H    1 1 
        1   176 1 1  13 ILE HA   H   9.282   5.963 -12.055 1.00 . A A .  91 ILE HA   1 1 
        1   177 1 1  13 ILE HB   H  12.077   5.232 -12.942 1.00 . A A .  91 ILE HB   1 1 
        1   178 1 1  13 ILE HD11 H   9.945   8.066 -14.930 1.00 . A A .  91 ILE HD11 1 1 
        1   179 1 1  13 ILE HD12 H   9.875   8.704 -13.287 1.00 . A A .  91 ILE HD12 1 1 
        1   180 1 1  13 ILE HD13 H   9.142   7.144 -13.660 1.00 . A A .  91 ILE HD13 1 1 
        1   181 1 1  13 ILE HG12 H  11.742   7.661 -12.753 1.00 . A A .  91 ILE HG12 1 1 
        1   182 1 1  13 ILE HG13 H  11.900   7.166 -14.435 1.00 . A A .  91 ILE HG13 1 1 
        1   183 1 1  13 ILE HG21 H  11.019   5.002 -15.180 1.00 . A A .  91 ILE HG21 1 1 
        1   184 1 1  13 ILE HG22 H   9.444   5.170 -14.404 1.00 . A A .  91 ILE HG22 1 1 
        1   185 1 1  13 ILE HG23 H  10.481   3.799 -14.007 1.00 . A A .  91 ILE HG23 1 1 
        1   186 1 1  13 ILE N    N  10.862   6.321 -10.773 1.00 . A A .  91 ILE N    1 1 
        1   187 1 1  13 ILE O    O   9.066   3.476 -11.678 1.00 . A A .  91 ILE O    1 1 
        1   188 1 1  14 THR C    C  10.153   1.891  -9.383 1.00 . A A .  92 THR C    1 1 
        1   189 1 1  14 THR CA   C  11.169   2.119 -10.502 1.00 . A A .  92 THR CA   1 1 
        1   190 1 1  14 THR CB   C  12.569   1.665 -10.065 1.00 . A A .  92 THR CB   1 1 
        1   191 1 1  14 THR CG2  C  13.005   2.237  -8.735 1.00 . A A .  92 THR CG2  1 1 
        1   192 1 1  14 THR H    H  11.989   4.054 -10.769 1.00 . A A .  92 THR H    1 1 
        1   193 1 1  14 THR HA   H  10.867   1.535 -11.359 1.00 . A A .  92 THR HA   1 1 
        1   194 1 1  14 THR HB   H  13.289   1.979 -10.811 1.00 . A A .  92 THR HB   1 1 
        1   195 1 1  14 THR HG1  H  13.512  -0.012  -9.703 1.00 . A A .  92 THR HG1  1 1 
        1   196 1 1  14 THR HG21 H  12.361   1.861  -7.953 1.00 . A A .  92 THR HG21 1 1 
        1   197 1 1  14 THR HG22 H  12.941   3.313  -8.771 1.00 . A A .  92 THR HG22 1 1 
        1   198 1 1  14 THR HG23 H  14.025   1.943  -8.535 1.00 . A A .  92 THR HG23 1 1 
        1   199 1 1  14 THR N    N  11.182   3.517 -10.910 1.00 . A A .  92 THR N    1 1 
        1   200 1 1  14 THR O    O   9.331   0.981  -9.463 1.00 . A A .  92 THR O    1 1 
        1   201 1 1  14 THR OG1  O  12.627   0.254  -9.962 1.00 . A A .  92 THR OG1  1 1 
        1   202 1 1  15 ARG C    C   7.861   2.601  -7.641 1.00 . A A .  93 ARG C    1 1 
        1   203 1 1  15 ARG CA   C   9.320   2.573  -7.196 1.00 . A A .  93 ARG CA   1 1 
        1   204 1 1  15 ARG CB   C   9.578   3.690  -6.186 1.00 . A A .  93 ARG CB   1 1 
        1   205 1 1  15 ARG CD   C   8.950   4.574  -3.918 1.00 . A A .  93 ARG CD   1 1 
        1   206 1 1  15 ARG CG   C   9.176   3.332  -4.765 1.00 . A A .  93 ARG CG   1 1 
        1   207 1 1  15 ARG CZ   C  11.188   5.506  -3.465 1.00 . A A .  93 ARG CZ   1 1 
        1   208 1 1  15 ARG H    H  10.918   3.398  -8.308 1.00 . A A .  93 ARG H    1 1 
        1   209 1 1  15 ARG HA   H   9.521   1.623  -6.725 1.00 . A A .  93 ARG HA   1 1 
        1   210 1 1  15 ARG HB2  H  10.633   3.924  -6.190 1.00 . A A .  93 ARG HB2  1 1 
        1   211 1 1  15 ARG HB3  H   9.023   4.566  -6.485 1.00 . A A .  93 ARG HB3  1 1 
        1   212 1 1  15 ARG HD2  H   8.780   5.416  -4.573 1.00 . A A .  93 ARG HD2  1 1 
        1   213 1 1  15 ARG HD3  H   8.078   4.419  -3.301 1.00 . A A .  93 ARG HD3  1 1 
        1   214 1 1  15 ARG HE   H  10.044   4.571  -2.124 1.00 . A A .  93 ARG HE   1 1 
        1   215 1 1  15 ARG HG2  H   8.263   2.757  -4.793 1.00 . A A .  93 ARG HG2  1 1 
        1   216 1 1  15 ARG HG3  H   9.962   2.740  -4.317 1.00 . A A .  93 ARG HG3  1 1 
        1   217 1 1  15 ARG HH11 H  10.551   5.761  -5.367 1.00 . A A .  93 ARG HH11 1 1 
        1   218 1 1  15 ARG HH12 H  12.120   6.402  -5.019 1.00 . A A .  93 ARG HH12 1 1 
        1   219 1 1  15 ARG HH21 H  12.105   5.421  -1.666 1.00 . A A .  93 ARG HH21 1 1 
        1   220 1 1  15 ARG HH22 H  13.001   6.212  -2.919 1.00 . A A .  93 ARG HH22 1 1 
        1   221 1 1  15 ARG N    N  10.224   2.708  -8.332 1.00 . A A .  93 ARG N    1 1 
        1   222 1 1  15 ARG NE   N  10.094   4.867  -3.057 1.00 . A A .  93 ARG NE   1 1 
        1   223 1 1  15 ARG NH1  N  11.294   5.924  -4.720 1.00 . A A .  93 ARG NH1  1 1 
        1   224 1 1  15 ARG NH2  N  12.179   5.731  -2.613 1.00 . A A .  93 ARG NH2  1 1 
        1   225 1 1  15 ARG O    O   7.080   1.721  -7.280 1.00 . A A .  93 ARG O    1 1 
        1   226 1 1  16 TYR C    C   5.667   2.456  -9.605 1.00 . A A .  94 TYR C    1 1 
        1   227 1 1  16 TYR CA   C   6.121   3.736  -8.909 1.00 . A A .  94 TYR CA   1 1 
        1   228 1 1  16 TYR CB   C   6.005   4.921  -9.869 1.00 . A A .  94 TYR CB   1 1 
        1   229 1 1  16 TYR CD1  C   3.553   5.251  -9.362 1.00 . A A .  94 TYR CD1  1 1 
        1   230 1 1  16 TYR CD2  C   4.274   5.469 -11.624 1.00 . A A .  94 TYR CD2  1 1 
        1   231 1 1  16 TYR CE1  C   2.254   5.522  -9.746 1.00 . A A .  94 TYR CE1  1 1 
        1   232 1 1  16 TYR CE2  C   2.977   5.742 -12.015 1.00 . A A .  94 TYR CE2  1 1 
        1   233 1 1  16 TYR CG   C   4.584   5.219 -10.293 1.00 . A A .  94 TYR CG   1 1 
        1   234 1 1  16 TYR CZ   C   1.971   5.767 -11.073 1.00 . A A .  94 TYR CZ   1 1 
        1   235 1 1  16 TYR H    H   8.150   4.291  -8.681 1.00 . A A .  94 TYR H    1 1 
        1   236 1 1  16 TYR HA   H   5.484   3.913  -8.056 1.00 . A A .  94 TYR HA   1 1 
        1   237 1 1  16 TYR HB2  H   6.399   5.804  -9.390 1.00 . A A .  94 TYR HB2  1 1 
        1   238 1 1  16 TYR HB3  H   6.581   4.712 -10.759 1.00 . A A .  94 TYR HB3  1 1 
        1   239 1 1  16 TYR HD1  H   3.778   5.059  -8.324 1.00 . A A .  94 TYR HD1  1 1 
        1   240 1 1  16 TYR HD2  H   5.064   5.448 -12.360 1.00 . A A .  94 TYR HD2  1 1 
        1   241 1 1  16 TYR HE1  H   1.466   5.542  -9.007 1.00 . A A .  94 TYR HE1  1 1 
        1   242 1 1  16 TYR HE2  H   2.756   5.933 -13.055 1.00 . A A .  94 TYR HE2  1 1 
        1   243 1 1  16 TYR HH   H   0.667   6.818 -12.018 1.00 . A A .  94 TYR HH   1 1 
        1   244 1 1  16 TYR N    N   7.492   3.611  -8.424 1.00 . A A .  94 TYR N    1 1 
        1   245 1 1  16 TYR O    O   4.647   1.869  -9.244 1.00 . A A .  94 TYR O    1 1 
        1   246 1 1  16 TYR OH   O   0.678   6.038 -11.459 1.00 . A A .  94 TYR OH   1 1 
        1   247 1 1  17 TYR C    C   6.065  -0.396 -10.422 1.00 . A A .  95 TYR C    1 1 
        1   248 1 1  17 TYR CA   C   6.108   0.816 -11.348 1.00 . A A .  95 TYR CA   1 1 
        1   249 1 1  17 TYR CB   C   7.132   0.586 -12.460 1.00 . A A .  95 TYR CB   1 1 
        1   250 1 1  17 TYR CD1  C   6.634   2.793 -13.582 1.00 . A A .  95 TYR CD1  1 1 
        1   251 1 1  17 TYR CD2  C   6.926   0.870 -14.961 1.00 . A A .  95 TYR CD2  1 1 
        1   252 1 1  17 TYR CE1  C   6.415   3.570 -14.704 1.00 . A A .  95 TYR CE1  1 1 
        1   253 1 1  17 TYR CE2  C   6.709   1.641 -16.088 1.00 . A A .  95 TYR CE2  1 1 
        1   254 1 1  17 TYR CG   C   6.893   1.432 -13.691 1.00 . A A .  95 TYR CG   1 1 
        1   255 1 1  17 TYR CZ   C   6.454   2.989 -15.954 1.00 . A A .  95 TYR CZ   1 1 
        1   256 1 1  17 TYR H    H   7.236   2.538 -10.846 1.00 . A A .  95 TYR H    1 1 
        1   257 1 1  17 TYR HA   H   5.133   0.950 -11.792 1.00 . A A .  95 TYR HA   1 1 
        1   258 1 1  17 TYR HB2  H   8.118   0.818 -12.086 1.00 . A A .  95 TYR HB2  1 1 
        1   259 1 1  17 TYR HB3  H   7.101  -0.452 -12.759 1.00 . A A .  95 TYR HB3  1 1 
        1   260 1 1  17 TYR HD1  H   6.605   3.245 -12.602 1.00 . A A .  95 TYR HD1  1 1 
        1   261 1 1  17 TYR HD2  H   7.126  -0.186 -15.062 1.00 . A A .  95 TYR HD2  1 1 
        1   262 1 1  17 TYR HE1  H   6.216   4.626 -14.599 1.00 . A A .  95 TYR HE1  1 1 
        1   263 1 1  17 TYR HE2  H   6.739   1.185 -17.066 1.00 . A A .  95 TYR HE2  1 1 
        1   264 1 1  17 TYR HH   H   5.678   3.280 -17.689 1.00 . A A .  95 TYR HH   1 1 
        1   265 1 1  17 TYR N    N   6.433   2.028 -10.604 1.00 . A A .  95 TYR N    1 1 
        1   266 1 1  17 TYR O    O   5.169  -1.235 -10.522 1.00 . A A .  95 TYR O    1 1 
        1   267 1 1  17 TYR OH   O   6.237   3.759 -17.073 1.00 . A A .  95 TYR OH   1 1 
        1   268 1 1  18 LEU C    C   5.810  -1.790  -7.836 1.00 . A A .  96 LEU C    1 1 
        1   269 1 1  18 LEU CA   C   7.128  -1.592  -8.579 1.00 . A A .  96 LEU CA   1 1 
        1   270 1 1  18 LEU CB   C   8.254  -1.335  -7.575 1.00 . A A .  96 LEU CB   1 1 
        1   271 1 1  18 LEU CD1  C   9.705  -3.152  -8.508 1.00 . A A .  96 LEU CD1  1 1 
        1   272 1 1  18 LEU CD2  C  10.225  -2.163  -6.271 1.00 . A A .  96 LEU CD2  1 1 
        1   273 1 1  18 LEU CG   C   9.118  -2.549  -7.241 1.00 . A A .  96 LEU CG   1 1 
        1   274 1 1  18 LEU H    H   7.729   0.213  -9.499 1.00 . A A .  96 LEU H    1 1 
        1   275 1 1  18 LEU HA   H   7.352  -2.489  -9.136 1.00 . A A .  96 LEU HA   1 1 
        1   276 1 1  18 LEU HB2  H   8.895  -0.564  -7.976 1.00 . A A .  96 LEU HB2  1 1 
        1   277 1 1  18 LEU HB3  H   7.816  -0.971  -6.658 1.00 . A A .  96 LEU HB3  1 1 
        1   278 1 1  18 LEU HD11 H   8.934  -3.686  -9.044 1.00 . A A .  96 LEU HD11 1 1 
        1   279 1 1  18 LEU HD12 H  10.500  -3.834  -8.247 1.00 . A A .  96 LEU HD12 1 1 
        1   280 1 1  18 LEU HD13 H  10.098  -2.363  -9.133 1.00 . A A .  96 LEU HD13 1 1 
        1   281 1 1  18 LEU HD21 H  10.957  -2.955  -6.226 1.00 . A A .  96 LEU HD21 1 1 
        1   282 1 1  18 LEU HD22 H   9.804  -2.004  -5.289 1.00 . A A .  96 LEU HD22 1 1 
        1   283 1 1  18 LEU HD23 H  10.699  -1.253  -6.611 1.00 . A A .  96 LEU HD23 1 1 
        1   284 1 1  18 LEU HG   H   8.502  -3.299  -6.767 1.00 . A A .  96 LEU HG   1 1 
        1   285 1 1  18 LEU N    N   7.042  -0.483  -9.525 1.00 . A A .  96 LEU N    1 1 
        1   286 1 1  18 LEU O    O   5.236  -2.878  -7.846 1.00 . A A .  96 LEU O    1 1 
        1   287 1 1  19 CYS C    C   2.929  -1.199  -7.341 1.00 . A A .  97 CYS C    1 1 
        1   288 1 1  19 CYS CA   C   4.088  -0.782  -6.441 1.00 . A A .  97 CYS CA   1 1 
        1   289 1 1  19 CYS CB   C   3.792   0.578  -5.807 1.00 . A A .  97 CYS CB   1 1 
        1   290 1 1  19 CYS H    H   5.844   0.110  -7.220 1.00 . A A .  97 CYS H    1 1 
        1   291 1 1  19 CYS HA   H   4.203  -1.516  -5.658 1.00 . A A .  97 CYS HA   1 1 
        1   292 1 1  19 CYS HB2  H   4.725   1.068  -5.570 1.00 . A A .  97 CYS HB2  1 1 
        1   293 1 1  19 CYS HB3  H   3.243   1.184  -6.513 1.00 . A A .  97 CYS HB3  1 1 
        1   294 1 1  19 CYS HG   H   2.452  -0.398  -4.221 1.00 . A A .  97 CYS HG   1 1 
        1   295 1 1  19 CYS N    N   5.338  -0.729  -7.192 1.00 . A A .  97 CYS N    1 1 
        1   296 1 1  19 CYS O    O   2.073  -1.987  -6.941 1.00 . A A .  97 CYS O    1 1 
        1   297 1 1  19 CYS SG   S   2.819   0.487  -4.285 1.00 . A A .  97 CYS SG   1 1 
        1   298 1 1  20 LEU C    C   1.840  -2.472  -9.838 1.00 . A A .  98 LEU C    1 1 
        1   299 1 1  20 LEU CA   C   1.854  -0.981  -9.513 1.00 . A A .  98 LEU CA   1 1 
        1   300 1 1  20 LEU CB   C   2.041  -0.171 -10.797 1.00 . A A .  98 LEU CB   1 1 
        1   301 1 1  20 LEU CD1  C   2.488   2.086 -11.791 1.00 . A A .  98 LEU CD1  1 1 
        1   302 1 1  20 LEU CD2  C   0.331   1.650 -10.603 1.00 . A A .  98 LEU CD2  1 1 
        1   303 1 1  20 LEU CG   C   1.818   1.335 -10.651 1.00 . A A .  98 LEU CG   1 1 
        1   304 1 1  20 LEU H    H   3.619  -0.041  -8.818 1.00 . A A .  98 LEU H    1 1 
        1   305 1 1  20 LEU HA   H   0.909  -0.714  -9.064 1.00 . A A .  98 LEU HA   1 1 
        1   306 1 1  20 LEU HB2  H   3.048  -0.332 -11.155 1.00 . A A .  98 LEU HB2  1 1 
        1   307 1 1  20 LEU HB3  H   1.349  -0.544 -11.537 1.00 . A A .  98 LEU HB3  1 1 
        1   308 1 1  20 LEU HD11 H   2.547   1.446 -12.658 1.00 . A A .  98 LEU HD11 1 1 
        1   309 1 1  20 LEU HD12 H   3.483   2.381 -11.492 1.00 . A A .  98 LEU HD12 1 1 
        1   310 1 1  20 LEU HD13 H   1.909   2.966 -12.031 1.00 . A A .  98 LEU HD13 1 1 
        1   311 1 1  20 LEU HD21 H   0.158   2.635 -11.010 1.00 . A A .  98 LEU HD21 1 1 
        1   312 1 1  20 LEU HD22 H  -0.011   1.619  -9.579 1.00 . A A .  98 LEU HD22 1 1 
        1   313 1 1  20 LEU HD23 H  -0.211   0.919 -11.185 1.00 . A A .  98 LEU HD23 1 1 
        1   314 1 1  20 LEU HG   H   2.262   1.670  -9.724 1.00 . A A .  98 LEU HG   1 1 
        1   315 1 1  20 LEU N    N   2.909  -0.664  -8.557 1.00 . A A .  98 LEU N    1 1 
        1   316 1 1  20 LEU O    O   0.790  -3.114  -9.806 1.00 . A A .  98 LEU O    1 1 
        1   317 1 1  21 GLN C    C   2.834  -5.309  -9.279 1.00 . A A .  99 GLN C    1 1 
        1   318 1 1  21 GLN CA   C   3.131  -4.430 -10.490 1.00 . A A .  99 GLN CA   1 1 
        1   319 1 1  21 GLN CB   C   4.534  -4.731 -11.020 1.00 . A A .  99 GLN CB   1 1 
        1   320 1 1  21 GLN CD   C   4.987  -5.642 -13.334 1.00 . A A .  99 GLN CD   1 1 
        1   321 1 1  21 GLN CG   C   4.709  -4.409 -12.495 1.00 . A A .  99 GLN CG   1 1 
        1   322 1 1  21 GLN H    H   3.813  -2.452 -10.166 1.00 . A A .  99 GLN H    1 1 
        1   323 1 1  21 GLN HA   H   2.411  -4.649 -11.263 1.00 . A A .  99 GLN HA   1 1 
        1   324 1 1  21 GLN HB2  H   5.251  -4.148 -10.459 1.00 . A A .  99 GLN HB2  1 1 
        1   325 1 1  21 GLN HB3  H   4.744  -5.780 -10.874 1.00 . A A .  99 GLN HB3  1 1 
        1   326 1 1  21 GLN HE21 H   4.424  -4.679 -14.980 1.00 . A A .  99 GLN HE21 1 1 
        1   327 1 1  21 GLN HE22 H   4.928  -6.316 -15.204 1.00 . A A .  99 GLN HE22 1 1 
        1   328 1 1  21 GLN HG2  H   3.806  -3.943 -12.858 1.00 . A A .  99 GLN HG2  1 1 
        1   329 1 1  21 GLN HG3  H   5.536  -3.723 -12.605 1.00 . A A .  99 GLN HG3  1 1 
        1   330 1 1  21 GLN N    N   3.011  -3.015 -10.155 1.00 . A A .  99 GLN N    1 1 
        1   331 1 1  21 GLN NE2  N   4.757  -5.535 -14.638 1.00 . A A .  99 GLN NE2  1 1 
        1   332 1 1  21 GLN O    O   2.059  -6.261  -9.366 1.00 . A A .  99 GLN O    1 1 
        1   333 1 1  21 GLN OE1  O   5.405  -6.677 -12.817 1.00 . A A .  99 GLN OE1  1 1 
        1   334 1 1  22 LEU C    C   1.786  -5.784  -6.528 1.00 . A A . 100 LEU C    1 1 
        1   335 1 1  22 LEU CA   C   3.260  -5.749  -6.921 1.00 . A A . 100 LEU CA   1 1 
        1   336 1 1  22 LEU CB   C   4.088  -5.146  -5.784 1.00 . A A . 100 LEU CB   1 1 
        1   337 1 1  22 LEU CD1  C   6.429  -4.653  -5.037 1.00 . A A . 100 LEU CD1  1 1 
        1   338 1 1  22 LEU CD2  C   5.513  -6.970  -4.823 1.00 . A A . 100 LEU CD2  1 1 
        1   339 1 1  22 LEU CG   C   5.509  -5.696  -5.653 1.00 . A A . 100 LEU CG   1 1 
        1   340 1 1  22 LEU H    H   4.066  -4.218  -8.141 1.00 . A A . 100 LEU H    1 1 
        1   341 1 1  22 LEU HA   H   3.596  -6.759  -7.102 1.00 . A A . 100 LEU HA   1 1 
        1   342 1 1  22 LEU HB2  H   4.149  -4.079  -5.939 1.00 . A A . 100 LEU HB2  1 1 
        1   343 1 1  22 LEU HB3  H   3.570  -5.329  -4.855 1.00 . A A . 100 LEU HB3  1 1 
        1   344 1 1  22 LEU HD11 H   5.985  -4.274  -4.128 1.00 . A A . 100 LEU HD11 1 1 
        1   345 1 1  22 LEU HD12 H   6.571  -3.841  -5.734 1.00 . A A . 100 LEU HD12 1 1 
        1   346 1 1  22 LEU HD13 H   7.384  -5.104  -4.810 1.00 . A A . 100 LEU HD13 1 1 
        1   347 1 1  22 LEU HD21 H   5.447  -7.827  -5.477 1.00 . A A . 100 LEU HD21 1 1 
        1   348 1 1  22 LEU HD22 H   4.667  -6.965  -4.151 1.00 . A A . 100 LEU HD22 1 1 
        1   349 1 1  22 LEU HD23 H   6.427  -7.024  -4.250 1.00 . A A . 100 LEU HD23 1 1 
        1   350 1 1  22 LEU HG   H   5.888  -5.934  -6.636 1.00 . A A . 100 LEU HG   1 1 
        1   351 1 1  22 LEU N    N   3.457  -4.986  -8.149 1.00 . A A . 100 LEU N    1 1 
        1   352 1 1  22 LEU O    O   1.221  -6.853  -6.291 1.00 . A A . 100 LEU O    1 1 
        1   353 1 1  23 ARG C    C  -1.124  -5.203  -7.123 1.00 . A A . 101 ARG C    1 1 
        1   354 1 1  23 ARG CA   C  -0.239  -4.505  -6.095 1.00 . A A . 101 ARG CA   1 1 
        1   355 1 1  23 ARG CB   C  -0.645  -3.036  -5.966 1.00 . A A . 101 ARG CB   1 1 
        1   356 1 1  23 ARG CD   C  -2.351  -1.444  -5.027 1.00 . A A . 101 ARG CD   1 1 
        1   357 1 1  23 ARG CG   C  -2.103  -2.837  -5.584 1.00 . A A . 101 ARG CG   1 1 
        1   358 1 1  23 ARG CZ   C  -1.263   0.277  -6.425 1.00 . A A . 101 ARG CZ   1 1 
        1   359 1 1  23 ARG H    H   1.671  -3.792  -6.662 1.00 . A A . 101 ARG H    1 1 
        1   360 1 1  23 ARG HA   H  -0.369  -4.990  -5.139 1.00 . A A . 101 ARG HA   1 1 
        1   361 1 1  23 ARG HB2  H  -0.031  -2.570  -5.210 1.00 . A A . 101 ARG HB2  1 1 
        1   362 1 1  23 ARG HB3  H  -0.473  -2.542  -6.912 1.00 . A A . 101 ARG HB3  1 1 
        1   363 1 1  23 ARG HD2  H  -3.314  -1.433  -4.540 1.00 . A A . 101 ARG HD2  1 1 
        1   364 1 1  23 ARG HD3  H  -1.582  -1.216  -4.305 1.00 . A A . 101 ARG HD3  1 1 
        1   365 1 1  23 ARG HE   H  -3.183  -0.252  -6.545 1.00 . A A . 101 ARG HE   1 1 
        1   366 1 1  23 ARG HG2  H  -2.717  -2.978  -6.460 1.00 . A A . 101 ARG HG2  1 1 
        1   367 1 1  23 ARG HG3  H  -2.370  -3.568  -4.834 1.00 . A A . 101 ARG HG3  1 1 
        1   368 1 1  23 ARG HH11 H  -0.022  -0.606  -5.093 1.00 . A A . 101 ARG HH11 1 1 
        1   369 1 1  23 ARG HH12 H   0.703   0.608  -6.089 1.00 . A A . 101 ARG HH12 1 1 
        1   370 1 1  23 ARG HH21 H  -2.222   1.341  -7.851 1.00 . A A . 101 ARG HH21 1 1 
        1   371 1 1  23 ARG HH22 H  -0.542   1.712  -7.652 1.00 . A A . 101 ARG HH22 1 1 
        1   372 1 1  23 ARG N    N   1.169  -4.609  -6.460 1.00 . A A . 101 ARG N    1 1 
        1   373 1 1  23 ARG NE   N  -2.340  -0.425  -6.076 1.00 . A A . 101 ARG NE   1 1 
        1   374 1 1  23 ARG NH1  N  -0.099   0.076  -5.818 1.00 . A A . 101 ARG NH1  1 1 
        1   375 1 1  23 ARG NH2  N  -1.349   1.185  -7.388 1.00 . A A . 101 ARG NH2  1 1 
        1   376 1 1  23 ARG O    O  -2.204  -5.694  -6.794 1.00 . A A . 101 ARG O    1 1 
        1   377 1 1  24 GLN C    C  -1.413  -7.404  -9.272 1.00 . A A . 102 GLN C    1 1 
        1   378 1 1  24 GLN CA   C  -1.413  -5.887  -9.440 1.00 . A A . 102 GLN CA   1 1 
        1   379 1 1  24 GLN CB   C  -0.824  -5.510 -10.802 1.00 . A A . 102 GLN CB   1 1 
        1   380 1 1  24 GLN CD   C  -2.890  -4.952 -12.142 1.00 . A A . 102 GLN CD   1 1 
        1   381 1 1  24 GLN CG   C  -1.609  -4.428 -11.524 1.00 . A A . 102 GLN CG   1 1 
        1   382 1 1  24 GLN H    H   0.209  -4.841  -8.571 1.00 . A A . 102 GLN H    1 1 
        1   383 1 1  24 GLN HA   H  -2.431  -5.531  -9.388 1.00 . A A . 102 GLN HA   1 1 
        1   384 1 1  24 GLN HB2  H   0.187  -5.157 -10.658 1.00 . A A . 102 GLN HB2  1 1 
        1   385 1 1  24 GLN HB3  H  -0.803  -6.389 -11.429 1.00 . A A . 102 GLN HB3  1 1 
        1   386 1 1  24 GLN HE21 H  -2.502  -3.977 -13.831 1.00 . A A . 102 GLN HE21 1 1 
        1   387 1 1  24 GLN HE22 H  -3.968  -4.893 -13.812 1.00 . A A . 102 GLN HE22 1 1 
        1   388 1 1  24 GLN HG2  H  -1.860  -3.651 -10.817 1.00 . A A . 102 GLN HG2  1 1 
        1   389 1 1  24 GLN HG3  H  -0.990  -4.014 -12.307 1.00 . A A . 102 GLN HG3  1 1 
        1   390 1 1  24 GLN N    N  -0.660  -5.246  -8.368 1.00 . A A . 102 GLN N    1 1 
        1   391 1 1  24 GLN NE2  N  -3.146  -4.569 -13.388 1.00 . A A . 102 GLN NE2  1 1 
        1   392 1 1  24 GLN O    O  -2.423  -8.064  -9.513 1.00 . A A . 102 GLN O    1 1 
        1   393 1 1  24 GLN OE1  O  -3.641  -5.693 -11.508 1.00 . A A . 102 GLN OE1  1 1 
        1   394 1 1  25 ASP C    C  -0.963  -9.849  -7.460 1.00 . A A . 103 ASP C    1 1 
        1   395 1 1  25 ASP CA   C  -0.142  -9.387  -8.660 1.00 . A A . 103 ASP CA   1 1 
        1   396 1 1  25 ASP CB   C   1.327  -9.763  -8.463 1.00 . A A . 103 ASP CB   1 1 
        1   397 1 1  25 ASP CG   C   2.118  -9.699  -9.755 1.00 . A A . 103 ASP CG   1 1 
        1   398 1 1  25 ASP H    H   0.497  -7.369  -8.684 1.00 . A A . 103 ASP H    1 1 
        1   399 1 1  25 ASP HA   H  -0.515  -9.879  -9.546 1.00 . A A . 103 ASP HA   1 1 
        1   400 1 1  25 ASP HB2  H   1.775  -9.083  -7.755 1.00 . A A . 103 ASP HB2  1 1 
        1   401 1 1  25 ASP HB3  H   1.386 -10.770  -8.076 1.00 . A A . 103 ASP HB3  1 1 
        1   402 1 1  25 ASP N    N  -0.274  -7.948  -8.859 1.00 . A A . 103 ASP N    1 1 
        1   403 1 1  25 ASP O    O  -1.523 -10.945  -7.463 1.00 . A A . 103 ASP O    1 1 
        1   404 1 1  25 ASP OD1  O   1.816  -8.824 -10.593 1.00 . A A . 103 ASP OD1  1 1 
        1   405 1 1  25 ASP OD2  O   3.040 -10.524  -9.929 1.00 . A A . 103 ASP OD2  1 1 
        1   406 1 1  26 ILE C    C  -3.278  -9.378  -5.500 1.00 . A A . 104 ILE C    1 1 
        1   407 1 1  26 ILE CA   C  -1.777  -9.332  -5.226 1.00 . A A . 104 ILE CA   1 1 
        1   408 1 1  26 ILE CB   C  -1.502  -8.313  -4.101 1.00 . A A . 104 ILE CB   1 1 
        1   409 1 1  26 ILE CD1  C   0.410  -6.788  -3.395 1.00 . A A . 104 ILE CD1  1 1 
        1   410 1 1  26 ILE CG1  C   0.003  -8.165  -3.873 1.00 . A A . 104 ILE CG1  1 1 
        1   411 1 1  26 ILE CG2  C  -2.197  -8.739  -2.816 1.00 . A A . 104 ILE CG2  1 1 
        1   412 1 1  26 ILE H    H  -0.558  -8.147  -6.488 1.00 . A A . 104 ILE H    1 1 
        1   413 1 1  26 ILE HA   H  -1.454 -10.305  -4.886 1.00 . A A . 104 ILE HA   1 1 
        1   414 1 1  26 ILE HB   H  -1.909  -7.360  -4.402 1.00 . A A . 104 ILE HB   1 1 
        1   415 1 1  26 ILE HD11 H  -0.469  -6.169  -3.291 1.00 . A A . 104 ILE HD11 1 1 
        1   416 1 1  26 ILE HD12 H   1.082  -6.342  -4.113 1.00 . A A . 104 ILE HD12 1 1 
        1   417 1 1  26 ILE HD13 H   0.907  -6.871  -2.440 1.00 . A A . 104 ILE HD13 1 1 
        1   418 1 1  26 ILE HG12 H   0.320  -8.881  -3.129 1.00 . A A . 104 ILE HG12 1 1 
        1   419 1 1  26 ILE HG13 H   0.522  -8.363  -4.800 1.00 . A A . 104 ILE HG13 1 1 
        1   420 1 1  26 ILE HG21 H  -1.706  -9.612  -2.413 1.00 . A A . 104 ILE HG21 1 1 
        1   421 1 1  26 ILE HG22 H  -3.231  -8.973  -3.025 1.00 . A A . 104 ILE HG22 1 1 
        1   422 1 1  26 ILE HG23 H  -2.149  -7.935  -2.096 1.00 . A A . 104 ILE HG23 1 1 
        1   423 1 1  26 ILE N    N  -1.027  -9.007  -6.433 1.00 . A A . 104 ILE N    1 1 
        1   424 1 1  26 ILE O    O  -3.945 -10.362  -5.183 1.00 . A A . 104 ILE O    1 1 
        1   425 1 1  27 VAL C    C  -5.673  -9.369  -7.300 1.00 . A A . 105 VAL C    1 1 
        1   426 1 1  27 VAL CA   C  -5.227  -8.225  -6.395 1.00 . A A . 105 VAL CA   1 1 
        1   427 1 1  27 VAL CB   C  -5.578  -6.888  -7.075 1.00 . A A . 105 VAL CB   1 1 
        1   428 1 1  27 VAL CG1  C  -5.355  -5.727  -6.119 1.00 . A A . 105 VAL CG1  1 1 
        1   429 1 1  27 VAL CG2  C  -4.764  -6.707  -8.347 1.00 . A A . 105 VAL CG2  1 1 
        1   430 1 1  27 VAL H    H  -3.226  -7.549  -6.312 1.00 . A A . 105 VAL H    1 1 
        1   431 1 1  27 VAL HA   H  -5.773  -8.283  -5.465 1.00 . A A . 105 VAL HA   1 1 
        1   432 1 1  27 VAL HB   H  -6.624  -6.908  -7.343 1.00 . A A . 105 VAL HB   1 1 
        1   433 1 1  27 VAL HG11 H  -5.738  -5.985  -5.143 1.00 . A A . 105 VAL HG11 1 1 
        1   434 1 1  27 VAL HG12 H  -5.871  -4.853  -6.488 1.00 . A A . 105 VAL HG12 1 1 
        1   435 1 1  27 VAL HG13 H  -4.298  -5.517  -6.048 1.00 . A A . 105 VAL HG13 1 1 
        1   436 1 1  27 VAL HG21 H  -3.712  -6.710  -8.105 1.00 . A A . 105 VAL HG21 1 1 
        1   437 1 1  27 VAL HG22 H  -5.025  -5.766  -8.810 1.00 . A A . 105 VAL HG22 1 1 
        1   438 1 1  27 VAL HG23 H  -4.979  -7.516  -9.030 1.00 . A A . 105 VAL HG23 1 1 
        1   439 1 1  27 VAL N    N  -3.804  -8.307  -6.086 1.00 . A A . 105 VAL N    1 1 
        1   440 1 1  27 VAL O    O  -6.809  -9.834  -7.211 1.00 . A A . 105 VAL O    1 1 
        1   441 1 1  28 ALA C    C  -4.842 -12.273  -8.451 1.00 . A A . 106 ALA C    1 1 
        1   442 1 1  28 ALA CA   C  -5.087 -10.907  -9.091 1.00 . A A . 106 ALA CA   1 1 
        1   443 1 1  28 ALA CB   C  -4.268 -10.767 -10.366 1.00 . A A . 106 ALA CB   1 1 
        1   444 1 1  28 ALA H    H  -3.885  -9.412  -8.199 1.00 . A A . 106 ALA H    1 1 
        1   445 1 1  28 ALA HA   H  -6.132 -10.829  -9.355 1.00 . A A . 106 ALA HA   1 1 
        1   446 1 1  28 ALA HB1  H  -4.857 -10.261 -11.117 1.00 . A A . 106 ALA HB1  1 1 
        1   447 1 1  28 ALA HB2  H  -3.991 -11.746 -10.726 1.00 . A A . 106 ALA HB2  1 1 
        1   448 1 1  28 ALA HB3  H  -3.377 -10.193 -10.160 1.00 . A A . 106 ALA HB3  1 1 
        1   449 1 1  28 ALA N    N  -4.776  -9.819  -8.172 1.00 . A A . 106 ALA N    1 1 
        1   450 1 1  28 ALA O    O  -5.107 -13.308  -9.063 1.00 . A A . 106 ALA O    1 1 
        1   451 1 1  29 GLY C    C  -2.945 -14.311  -7.189 1.00 . A A . 107 GLY C    1 1 
        1   452 1 1  29 GLY CA   C  -4.065 -13.525  -6.536 1.00 . A A . 107 GLY CA   1 1 
        1   453 1 1  29 GLY H    H  -4.137 -11.424  -6.777 1.00 . A A . 107 GLY H    1 1 
        1   454 1 1  29 GLY HA2  H  -3.791 -13.311  -5.513 1.00 . A A . 107 GLY HA2  1 1 
        1   455 1 1  29 GLY HA3  H  -4.962 -14.126  -6.540 1.00 . A A . 107 GLY HA3  1 1 
        1   456 1 1  29 GLY N    N  -4.333 -12.275  -7.221 1.00 . A A . 107 GLY N    1 1 
        1   457 1 1  29 GLY O    O  -2.970 -15.541  -7.209 1.00 . A A . 107 GLY O    1 1 
        1   458 1 1  30 ARG C    C   0.228 -14.681  -7.371 1.00 . A A . 108 ARG C    1 1 
        1   459 1 1  30 ARG CA   C  -0.825 -14.231  -8.384 1.00 . A A . 108 ARG CA   1 1 
        1   460 1 1  30 ARG CB   C  -0.196 -13.269  -9.393 1.00 . A A . 108 ARG CB   1 1 
        1   461 1 1  30 ARG CD   C   1.446 -12.948 -11.271 1.00 . A A . 108 ARG CD   1 1 
        1   462 1 1  30 ARG CG   C   0.696 -13.957 -10.414 1.00 . A A . 108 ARG CG   1 1 
        1   463 1 1  30 ARG CZ   C   2.154 -12.681 -13.616 1.00 . A A . 108 ARG CZ   1 1 
        1   464 1 1  30 ARG H    H  -2.000 -12.618  -7.675 1.00 . A A . 108 ARG H    1 1 
        1   465 1 1  30 ARG HA   H  -1.192 -15.098  -8.911 1.00 . A A . 108 ARG HA   1 1 
        1   466 1 1  30 ARG HB2  H  -0.984 -12.755  -9.924 1.00 . A A . 108 ARG HB2  1 1 
        1   467 1 1  30 ARG HB3  H   0.399 -12.543  -8.859 1.00 . A A . 108 ARG HB3  1 1 
        1   468 1 1  30 ARG HD2  H   0.953 -11.990 -11.191 1.00 . A A . 108 ARG HD2  1 1 
        1   469 1 1  30 ARG HD3  H   2.457 -12.863 -10.902 1.00 . A A . 108 ARG HD3  1 1 
        1   470 1 1  30 ARG HE   H   0.987 -14.149 -12.933 1.00 . A A . 108 ARG HE   1 1 
        1   471 1 1  30 ARG HG2  H   1.413 -14.574  -9.894 1.00 . A A . 108 ARG HG2  1 1 
        1   472 1 1  30 ARG HG3  H   0.084 -14.575 -11.054 1.00 . A A . 108 ARG HG3  1 1 
        1   473 1 1  30 ARG HH11 H   2.854 -11.256 -12.362 1.00 . A A . 108 ARG HH11 1 1 
        1   474 1 1  30 ARG HH12 H   3.339 -11.093 -14.017 1.00 . A A . 108 ARG HH12 1 1 
        1   475 1 1  30 ARG HH21 H   1.624 -13.936 -15.109 1.00 . A A . 108 ARG HH21 1 1 
        1   476 1 1  30 ARG HH22 H   2.641 -12.614 -15.576 1.00 . A A . 108 ARG HH22 1 1 
        1   477 1 1  30 ARG N    N  -1.961 -13.596  -7.725 1.00 . A A . 108 ARG N    1 1 
        1   478 1 1  30 ARG NE   N   1.485 -13.345 -12.676 1.00 . A A . 108 ARG NE   1 1 
        1   479 1 1  30 ARG NH1  N   2.838 -11.587 -13.306 1.00 . A A . 108 ARG NH1  1 1 
        1   480 1 1  30 ARG NH2  N   2.138 -13.112 -14.870 1.00 . A A . 108 ARG NH2  1 1 
        1   481 1 1  30 ARG O    O   1.267 -15.223  -7.747 1.00 . A A . 108 ARG O    1 1 
        1   482 1 1  31 LEU C    C   0.139 -15.147  -3.736 1.00 . A A . 109 LEU C    1 1 
        1   483 1 1  31 LEU CA   C   0.888 -14.843  -5.033 1.00 . A A . 109 LEU CA   1 1 
        1   484 1 1  31 LEU CB   C   1.910 -13.731  -4.796 1.00 . A A . 109 LEU CB   1 1 
        1   485 1 1  31 LEU CD1  C   4.328 -13.182  -4.430 1.00 . A A . 109 LEU CD1  1 1 
        1   486 1 1  31 LEU CD2  C   3.028 -14.349  -2.639 1.00 . A A . 109 LEU CD2  1 1 
        1   487 1 1  31 LEU CG   C   3.217 -14.179  -4.140 1.00 . A A . 109 LEU CG   1 1 
        1   488 1 1  31 LEU H    H  -0.884 -14.022  -5.840 1.00 . A A . 109 LEU H    1 1 
        1   489 1 1  31 LEU HA   H   1.404 -15.733  -5.359 1.00 . A A . 109 LEU HA   1 1 
        1   490 1 1  31 LEU HB2  H   2.146 -13.279  -5.749 1.00 . A A . 109 LEU HB2  1 1 
        1   491 1 1  31 LEU HB3  H   1.456 -12.982  -4.165 1.00 . A A . 109 LEU HB3  1 1 
        1   492 1 1  31 LEU HD11 H   4.074 -12.605  -5.308 1.00 . A A . 109 LEU HD11 1 1 
        1   493 1 1  31 LEU HD12 H   5.252 -13.713  -4.604 1.00 . A A . 109 LEU HD12 1 1 
        1   494 1 1  31 LEU HD13 H   4.447 -12.519  -3.586 1.00 . A A . 109 LEU HD13 1 1 
        1   495 1 1  31 LEU HD21 H   2.899 -15.397  -2.409 1.00 . A A . 109 LEU HD21 1 1 
        1   496 1 1  31 LEU HD22 H   2.154 -13.801  -2.321 1.00 . A A . 109 LEU HD22 1 1 
        1   497 1 1  31 LEU HD23 H   3.898 -13.972  -2.121 1.00 . A A . 109 LEU HD23 1 1 
        1   498 1 1  31 LEU HG   H   3.510 -15.134  -4.552 1.00 . A A . 109 LEU HG   1 1 
        1   499 1 1  31 LEU N    N  -0.042 -14.456  -6.087 1.00 . A A . 109 LEU N    1 1 
        1   500 1 1  31 LEU O    O  -0.723 -14.376  -3.316 1.00 . A A . 109 LEU O    1 1 
        1   501 1 1  32 PRO C    C   0.158 -15.737  -0.674 1.00 . A A . 110 PRO C    1 1 
        1   502 1 1  32 PRO CA   C  -0.197 -16.670  -1.827 1.00 . A A . 110 PRO CA   1 1 
        1   503 1 1  32 PRO CB   C   0.347 -18.077  -1.563 1.00 . A A . 110 PRO CB   1 1 
        1   504 1 1  32 PRO CD   C   1.472 -17.260  -3.504 1.00 . A A . 110 PRO CD   1 1 
        1   505 1 1  32 PRO CG   C   1.648 -18.122  -2.286 1.00 . A A . 110 PRO CG   1 1 
        1   506 1 1  32 PRO HA   H  -1.271 -16.711  -1.937 1.00 . A A . 110 PRO HA   1 1 
        1   507 1 1  32 PRO HB2  H   0.479 -18.221  -0.501 1.00 . A A . 110 PRO HB2  1 1 
        1   508 1 1  32 PRO HB3  H  -0.344 -18.811  -1.949 1.00 . A A . 110 PRO HB3  1 1 
        1   509 1 1  32 PRO HD2  H   2.401 -16.770  -3.758 1.00 . A A . 110 PRO HD2  1 1 
        1   510 1 1  32 PRO HD3  H   1.115 -17.849  -4.336 1.00 . A A . 110 PRO HD3  1 1 
        1   511 1 1  32 PRO HG2  H   2.432 -17.728  -1.657 1.00 . A A . 110 PRO HG2  1 1 
        1   512 1 1  32 PRO HG3  H   1.873 -19.138  -2.576 1.00 . A A . 110 PRO HG3  1 1 
        1   513 1 1  32 PRO N    N   0.457 -16.278  -3.080 1.00 . A A . 110 PRO N    1 1 
        1   514 1 1  32 PRO O    O   1.330 -15.574  -0.334 1.00 . A A . 110 PRO O    1 1 
        1   515 1 1  33 CYS C    C  -1.712 -14.428   2.116 1.00 . A A . 111 CYS C    1 1 
        1   516 1 1  33 CYS CA   C  -0.655 -14.210   1.038 1.00 . A A . 111 CYS CA   1 1 
        1   517 1 1  33 CYS CB   C  -0.697 -12.761   0.551 1.00 . A A . 111 CYS CB   1 1 
        1   518 1 1  33 CYS H    H  -1.773 -15.296  -0.390 1.00 . A A . 111 CYS H    1 1 
        1   519 1 1  33 CYS HA   H   0.318 -14.412   1.459 1.00 . A A . 111 CYS HA   1 1 
        1   520 1 1  33 CYS HB2  H  -1.691 -12.538   0.192 1.00 . A A . 111 CYS HB2  1 1 
        1   521 1 1  33 CYS HB3  H  -0.464 -12.105   1.377 1.00 . A A . 111 CYS HB3  1 1 
        1   522 1 1  33 CYS HG   H   1.194 -13.016  -0.720 1.00 . A A . 111 CYS HG   1 1 
        1   523 1 1  33 CYS N    N  -0.860 -15.127  -0.077 1.00 . A A . 111 CYS N    1 1 
        1   524 1 1  33 CYS O    O  -2.701 -15.128   1.895 1.00 . A A . 111 CYS O    1 1 
        1   525 1 1  33 CYS SG   S   0.464 -12.397  -0.786 1.00 . A A . 111 CYS SG   1 1 
        1   526 1 1  34 SER C    C  -3.291 -12.709   4.537 1.00 . A A . 112 SER C    1 1 
        1   527 1 1  34 SER CA   C  -2.432 -13.961   4.391 1.00 . A A . 112 SER CA   1 1 
        1   528 1 1  34 SER CB   C  -1.675 -14.229   5.693 1.00 . A A . 112 SER CB   1 1 
        1   529 1 1  34 SER H    H  -0.689 -13.285   3.398 1.00 . A A . 112 SER H    1 1 
        1   530 1 1  34 SER HA   H  -3.076 -14.802   4.180 1.00 . A A . 112 SER HA   1 1 
        1   531 1 1  34 SER HB2  H  -0.928 -13.464   5.837 1.00 . A A . 112 SER HB2  1 1 
        1   532 1 1  34 SER HB3  H  -2.370 -14.214   6.521 1.00 . A A . 112 SER HB3  1 1 
        1   533 1 1  34 SER HG   H  -1.174 -15.946   6.494 1.00 . A A . 112 SER HG   1 1 
        1   534 1 1  34 SER N    N  -1.496 -13.828   3.281 1.00 . A A . 112 SER N    1 1 
        1   535 1 1  34 SER O    O  -2.963 -11.652   3.995 1.00 . A A . 112 SER O    1 1 
        1   536 1 1  34 SER OG   O  -1.033 -15.492   5.660 1.00 . A A . 112 SER OG   1 1 
        1   537 1 1  35 PHE C    C  -4.564 -10.522   6.094 1.00 . A A . 113 PHE C    1 1 
        1   538 1 1  35 PHE CA   C  -5.302 -11.715   5.492 1.00 . A A . 113 PHE CA   1 1 
        1   539 1 1  35 PHE CB   C  -6.451 -12.141   6.411 1.00 . A A . 113 PHE CB   1 1 
        1   540 1 1  35 PHE CD1  C  -6.989 -10.134   7.820 1.00 . A A . 113 PHE CD1  1 1 
        1   541 1 1  35 PHE CD2  C  -8.581 -10.829   6.186 1.00 . A A . 113 PHE CD2  1 1 
        1   542 1 1  35 PHE CE1  C  -7.820  -9.095   8.193 1.00 . A A . 113 PHE CE1  1 1 
        1   543 1 1  35 PHE CE2  C  -9.416  -9.792   6.555 1.00 . A A . 113 PHE CE2  1 1 
        1   544 1 1  35 PHE CG   C  -7.359 -11.012   6.814 1.00 . A A . 113 PHE CG   1 1 
        1   545 1 1  35 PHE CZ   C  -9.036  -8.924   7.560 1.00 . A A . 113 PHE CZ   1 1 
        1   546 1 1  35 PHE H    H  -4.598 -13.703   5.677 1.00 . A A . 113 PHE H    1 1 
        1   547 1 1  35 PHE HA   H  -5.708 -11.423   4.535 1.00 . A A . 113 PHE HA   1 1 
        1   548 1 1  35 PHE HB2  H  -7.051 -12.882   5.905 1.00 . A A . 113 PHE HB2  1 1 
        1   549 1 1  35 PHE HB3  H  -6.039 -12.574   7.311 1.00 . A A . 113 PHE HB3  1 1 
        1   550 1 1  35 PHE HD1  H  -6.038 -10.267   8.316 1.00 . A A . 113 PHE HD1  1 1 
        1   551 1 1  35 PHE HD2  H  -8.880 -11.507   5.400 1.00 . A A . 113 PHE HD2  1 1 
        1   552 1 1  35 PHE HE1  H  -7.520  -8.418   8.979 1.00 . A A . 113 PHE HE1  1 1 
        1   553 1 1  35 PHE HE2  H -10.366  -9.660   6.058 1.00 . A A . 113 PHE HE2  1 1 
        1   554 1 1  35 PHE HZ   H  -9.687  -8.113   7.851 1.00 . A A . 113 PHE HZ   1 1 
        1   555 1 1  35 PHE N    N  -4.392 -12.835   5.272 1.00 . A A . 113 PHE N    1 1 
        1   556 1 1  35 PHE O    O  -4.736  -9.387   5.651 1.00 . A A . 113 PHE O    1 1 
        1   557 1 1  36 ALA C    C  -2.150  -8.938   6.818 1.00 . A A . 114 ALA C    1 1 
        1   558 1 1  36 ALA CA   C  -3.017  -9.726   7.792 1.00 . A A . 114 ALA CA   1 1 
        1   559 1 1  36 ALA CB   C  -2.159 -10.306   8.904 1.00 . A A . 114 ALA CB   1 1 
        1   560 1 1  36 ALA H    H  -3.684 -11.704   7.447 1.00 . A A . 114 ALA H    1 1 
        1   561 1 1  36 ALA HA   H  -3.734  -9.053   8.241 1.00 . A A . 114 ALA HA   1 1 
        1   562 1 1  36 ALA HB1  H  -2.750 -10.402   9.802 1.00 . A A . 114 ALA HB1  1 1 
        1   563 1 1  36 ALA HB2  H  -1.323  -9.648   9.091 1.00 . A A . 114 ALA HB2  1 1 
        1   564 1 1  36 ALA HB3  H  -1.793 -11.277   8.606 1.00 . A A . 114 ALA HB3  1 1 
        1   565 1 1  36 ALA N    N  -3.759 -10.784   7.118 1.00 . A A . 114 ALA N    1 1 
        1   566 1 1  36 ALA O    O  -2.169  -7.708   6.823 1.00 . A A . 114 ALA O    1 1 
        1   567 1 1  37 THR C    C  -1.361  -8.215   3.988 1.00 . A A . 115 THR C    1 1 
        1   568 1 1  37 THR CA   C  -0.529  -8.975   5.010 1.00 . A A . 115 THR CA   1 1 
        1   569 1 1  37 THR CB   C   0.363  -9.997   4.303 1.00 . A A . 115 THR CB   1 1 
        1   570 1 1  37 THR CG2  C   1.321  -9.373   3.312 1.00 . A A . 115 THR CG2  1 1 
        1   571 1 1  37 THR H    H  -1.398 -10.616   5.999 1.00 . A A . 115 THR H    1 1 
        1   572 1 1  37 THR HA   H   0.095  -8.273   5.544 1.00 . A A . 115 THR HA   1 1 
        1   573 1 1  37 THR HB   H  -0.264 -10.694   3.764 1.00 . A A . 115 THR HB   1 1 
        1   574 1 1  37 THR HG1  H   1.301 -11.609   4.903 1.00 . A A . 115 THR HG1  1 1 
        1   575 1 1  37 THR HG21 H   2.256  -9.912   3.327 1.00 . A A . 115 THR HG21 1 1 
        1   576 1 1  37 THR HG22 H   1.495  -8.341   3.581 1.00 . A A . 115 THR HG22 1 1 
        1   577 1 1  37 THR HG23 H   0.894  -9.419   2.321 1.00 . A A . 115 THR HG23 1 1 
        1   578 1 1  37 THR N    N  -1.390  -9.638   5.980 1.00 . A A . 115 THR N    1 1 
        1   579 1 1  37 THR O    O  -1.014  -7.103   3.594 1.00 . A A . 115 THR O    1 1 
        1   580 1 1  37 THR OG1  O   1.132 -10.727   5.243 1.00 . A A . 115 THR OG1  1 1 
        1   581 1 1  38 LEU C    C  -3.833  -6.839   3.126 1.00 . A A . 116 LEU C    1 1 
        1   582 1 1  38 LEU CA   C  -3.355  -8.184   2.598 1.00 . A A . 116 LEU CA   1 1 
        1   583 1 1  38 LEU CB   C  -4.556  -9.086   2.301 1.00 . A A . 116 LEU CB   1 1 
        1   584 1 1  38 LEU CD1  C  -5.594 -10.934   0.961 1.00 . A A . 116 LEU CD1  1 1 
        1   585 1 1  38 LEU CD2  C  -3.702  -9.608   0.001 1.00 . A A . 116 LEU CD2  1 1 
        1   586 1 1  38 LEU CG   C  -4.304 -10.190   1.272 1.00 . A A . 116 LEU CG   1 1 
        1   587 1 1  38 LEU H    H  -2.699  -9.700   3.921 1.00 . A A . 116 LEU H    1 1 
        1   588 1 1  38 LEU HA   H  -2.798  -8.024   1.688 1.00 . A A . 116 LEU HA   1 1 
        1   589 1 1  38 LEU HB2  H  -4.868  -9.549   3.226 1.00 . A A . 116 LEU HB2  1 1 
        1   590 1 1  38 LEU HB3  H  -5.363  -8.466   1.939 1.00 . A A . 116 LEU HB3  1 1 
        1   591 1 1  38 LEU HD11 H  -6.287 -10.811   1.780 1.00 . A A . 116 LEU HD11 1 1 
        1   592 1 1  38 LEU HD12 H  -5.380 -11.983   0.824 1.00 . A A . 116 LEU HD12 1 1 
        1   593 1 1  38 LEU HD13 H  -6.031 -10.535   0.057 1.00 . A A . 116 LEU HD13 1 1 
        1   594 1 1  38 LEU HD21 H  -4.063 -10.161  -0.854 1.00 . A A . 116 LEU HD21 1 1 
        1   595 1 1  38 LEU HD22 H  -2.626  -9.679   0.047 1.00 . A A . 116 LEU HD22 1 1 
        1   596 1 1  38 LEU HD23 H  -3.991  -8.572  -0.092 1.00 . A A . 116 LEU HD23 1 1 
        1   597 1 1  38 LEU HG   H  -3.600 -10.900   1.681 1.00 . A A . 116 LEU HG   1 1 
        1   598 1 1  38 LEU N    N  -2.469  -8.817   3.567 1.00 . A A . 116 LEU N    1 1 
        1   599 1 1  38 LEU O    O  -3.807  -5.833   2.417 1.00 . A A . 116 LEU O    1 1 
        1   600 1 1  39 ALA C    C  -3.630  -4.639   5.309 1.00 . A A . 117 ALA C    1 1 
        1   601 1 1  39 ALA CA   C  -4.762  -5.623   5.020 1.00 . A A . 117 ALA CA   1 1 
        1   602 1 1  39 ALA CB   C  -5.487  -5.987   6.305 1.00 . A A . 117 ALA CB   1 1 
        1   603 1 1  39 ALA H    H  -4.274  -7.666   4.895 1.00 . A A . 117 ALA H    1 1 
        1   604 1 1  39 ALA HA   H  -5.472  -5.156   4.353 1.00 . A A . 117 ALA HA   1 1 
        1   605 1 1  39 ALA HB1  H  -5.158  -6.963   6.638 1.00 . A A . 117 ALA HB1  1 1 
        1   606 1 1  39 ALA HB2  H  -6.552  -6.009   6.124 1.00 . A A . 117 ALA HB2  1 1 
        1   607 1 1  39 ALA HB3  H  -5.266  -5.254   7.066 1.00 . A A . 117 ALA HB3  1 1 
        1   608 1 1  39 ALA N    N  -4.271  -6.833   4.380 1.00 . A A . 117 ALA N    1 1 
        1   609 1 1  39 ALA O    O  -3.821  -3.426   5.231 1.00 . A A . 117 ALA O    1 1 
        1   610 1 1  40 LEU C    C  -0.788  -3.618   4.696 1.00 . A A . 118 LEU C    1 1 
        1   611 1 1  40 LEU CA   C  -1.306  -4.314   5.953 1.00 . A A . 118 LEU CA   1 1 
        1   612 1 1  40 LEU CB   C  -0.188  -5.143   6.588 1.00 . A A . 118 LEU CB   1 1 
        1   613 1 1  40 LEU CD1  C   1.731  -4.888   8.182 1.00 . A A . 118 LEU CD1  1 1 
        1   614 1 1  40 LEU CD2  C   2.072  -4.469   5.740 1.00 . A A . 118 LEU CD2  1 1 
        1   615 1 1  40 LEU CG   C   1.094  -4.370   6.902 1.00 . A A . 118 LEU CG   1 1 
        1   616 1 1  40 LEU H    H  -2.357  -6.139   5.699 1.00 . A A . 118 LEU H    1 1 
        1   617 1 1  40 LEU HA   H  -1.629  -3.563   6.658 1.00 . A A . 118 LEU HA   1 1 
        1   618 1 1  40 LEU HB2  H  -0.563  -5.568   7.508 1.00 . A A . 118 LEU HB2  1 1 
        1   619 1 1  40 LEU HB3  H   0.061  -5.949   5.914 1.00 . A A . 118 LEU HB3  1 1 
        1   620 1 1  40 LEU HD11 H   2.520  -4.217   8.488 1.00 . A A . 118 LEU HD11 1 1 
        1   621 1 1  40 LEU HD12 H   2.142  -5.871   8.008 1.00 . A A . 118 LEU HD12 1 1 
        1   622 1 1  40 LEU HD13 H   0.983  -4.942   8.959 1.00 . A A . 118 LEU HD13 1 1 
        1   623 1 1  40 LEU HD21 H   1.794  -3.759   4.975 1.00 . A A . 118 LEU HD21 1 1 
        1   624 1 1  40 LEU HD22 H   2.045  -5.468   5.332 1.00 . A A . 118 LEU HD22 1 1 
        1   625 1 1  40 LEU HD23 H   3.069  -4.249   6.090 1.00 . A A . 118 LEU HD23 1 1 
        1   626 1 1  40 LEU HG   H   0.851  -3.327   7.048 1.00 . A A . 118 LEU HG   1 1 
        1   627 1 1  40 LEU N    N  -2.455  -5.163   5.648 1.00 . A A . 118 LEU N    1 1 
        1   628 1 1  40 LEU O    O  -0.633  -2.395   4.670 1.00 . A A . 118 LEU O    1 1 
        1   629 1 1  41 LEU C    C  -1.052  -2.896   1.795 1.00 . A A . 119 LEU C    1 1 
        1   630 1 1  41 LEU CA   C  -0.033  -3.855   2.396 1.00 . A A . 119 LEU CA   1 1 
        1   631 1 1  41 LEU CB   C   0.269  -4.983   1.407 1.00 . A A . 119 LEU CB   1 1 
        1   632 1 1  41 LEU CD1  C   1.276  -7.239   0.984 1.00 . A A . 119 LEU CD1  1 1 
        1   633 1 1  41 LEU CD2  C   2.664  -5.423   1.998 1.00 . A A . 119 LEU CD2  1 1 
        1   634 1 1  41 LEU CG   C   1.271  -6.027   1.902 1.00 . A A . 119 LEU CG   1 1 
        1   635 1 1  41 LEU H    H  -0.673  -5.365   3.730 1.00 . A A . 119 LEU H    1 1 
        1   636 1 1  41 LEU HA   H   0.877  -3.313   2.602 1.00 . A A . 119 LEU HA   1 1 
        1   637 1 1  41 LEU HB2  H  -0.658  -5.486   1.174 1.00 . A A . 119 LEU HB2  1 1 
        1   638 1 1  41 LEU HB3  H   0.659  -4.544   0.501 1.00 . A A . 119 LEU HB3  1 1 
        1   639 1 1  41 LEU HD11 H   2.064  -7.914   1.283 1.00 . A A . 119 LEU HD11 1 1 
        1   640 1 1  41 LEU HD12 H   1.442  -6.919  -0.034 1.00 . A A . 119 LEU HD12 1 1 
        1   641 1 1  41 LEU HD13 H   0.324  -7.744   1.051 1.00 . A A . 119 LEU HD13 1 1 
        1   642 1 1  41 LEU HD21 H   2.760  -4.622   1.280 1.00 . A A . 119 LEU HD21 1 1 
        1   643 1 1  41 LEU HD22 H   3.402  -6.184   1.789 1.00 . A A . 119 LEU HD22 1 1 
        1   644 1 1  41 LEU HD23 H   2.820  -5.034   2.994 1.00 . A A . 119 LEU HD23 1 1 
        1   645 1 1  41 LEU HG   H   0.980  -6.357   2.889 1.00 . A A . 119 LEU HG   1 1 
        1   646 1 1  41 LEU N    N  -0.528  -4.400   3.654 1.00 . A A . 119 LEU N    1 1 
        1   647 1 1  41 LEU O    O  -0.693  -1.888   1.186 1.00 . A A . 119 LEU O    1 1 
        1   648 1 1  42 GLY C    C  -3.487  -1.064   2.239 1.00 . A A . 120 GLY C    1 1 
        1   649 1 1  42 GLY CA   C  -3.384  -2.366   1.473 1.00 . A A . 120 GLY CA   1 1 
        1   650 1 1  42 GLY H    H  -2.549  -4.022   2.494 1.00 . A A . 120 GLY H    1 1 
        1   651 1 1  42 GLY HA2  H  -3.186  -2.148   0.433 1.00 . A A . 120 GLY HA2  1 1 
        1   652 1 1  42 GLY HA3  H  -4.324  -2.892   1.548 1.00 . A A . 120 GLY HA3  1 1 
        1   653 1 1  42 GLY N    N  -2.328  -3.213   1.986 1.00 . A A . 120 GLY N    1 1 
        1   654 1 1  42 GLY O    O  -3.507   0.015   1.649 1.00 . A A . 120 GLY O    1 1 
        1   655 1 1  43 SER C    C  -2.540   1.005   4.134 1.00 . A A . 121 SER C    1 1 
        1   656 1 1  43 SER CA   C  -3.652   0.002   4.426 1.00 . A A . 121 SER CA   1 1 
        1   657 1 1  43 SER CB   C  -3.596  -0.418   5.894 1.00 . A A . 121 SER CB   1 1 
        1   658 1 1  43 SER H    H  -3.529  -2.059   3.972 1.00 . A A . 121 SER H    1 1 
        1   659 1 1  43 SER HA   H  -4.603   0.473   4.233 1.00 . A A . 121 SER HA   1 1 
        1   660 1 1  43 SER HB2  H  -2.777  -1.106   6.039 1.00 . A A . 121 SER HB2  1 1 
        1   661 1 1  43 SER HB3  H  -3.446   0.456   6.511 1.00 . A A . 121 SER HB3  1 1 
        1   662 1 1  43 SER HG   H  -5.457  -0.387   6.499 1.00 . A A . 121 SER HG   1 1 
        1   663 1 1  43 SER N    N  -3.550  -1.169   3.563 1.00 . A A . 121 SER N    1 1 
        1   664 1 1  43 SER O    O  -2.747   2.215   4.223 1.00 . A A . 121 SER O    1 1 
        1   665 1 1  43 SER OG   O  -4.799  -1.053   6.288 1.00 . A A . 121 SER OG   1 1 
        1   666 1 1  44 TYR C    C  -0.408   2.039   2.125 1.00 . A A . 122 TYR C    1 1 
        1   667 1 1  44 TYR CA   C  -0.228   1.364   3.480 1.00 . A A . 122 TYR CA   1 1 
        1   668 1 1  44 TYR CB   C   1.072   0.559   3.497 1.00 . A A . 122 TYR CB   1 1 
        1   669 1 1  44 TYR CD1  C   1.708   1.302   5.824 1.00 . A A . 122 TYR CD1  1 1 
        1   670 1 1  44 TYR CD2  C   1.954  -1.004   5.273 1.00 . A A . 122 TYR CD2  1 1 
        1   671 1 1  44 TYR CE1  C   2.177   1.052   7.099 1.00 . A A . 122 TYR CE1  1 1 
        1   672 1 1  44 TYR CE2  C   2.425  -1.262   6.546 1.00 . A A . 122 TYR CE2  1 1 
        1   673 1 1  44 TYR CG   C   1.588   0.280   4.891 1.00 . A A . 122 TYR CG   1 1 
        1   674 1 1  44 TYR CZ   C   2.535  -0.231   7.455 1.00 . A A . 122 TYR CZ   1 1 
        1   675 1 1  44 TYR H    H  -1.247  -0.474   3.720 1.00 . A A . 122 TYR H    1 1 
        1   676 1 1  44 TYR HA   H  -0.179   2.125   4.243 1.00 . A A . 122 TYR HA   1 1 
        1   677 1 1  44 TYR HB2  H   0.907  -0.389   3.008 1.00 . A A . 122 TYR HB2  1 1 
        1   678 1 1  44 TYR HB3  H   1.834   1.107   2.963 1.00 . A A . 122 TYR HB3  1 1 
        1   679 1 1  44 TYR HD1  H   1.427   2.306   5.542 1.00 . A A . 122 TYR HD1  1 1 
        1   680 1 1  44 TYR HD2  H   1.868  -1.810   4.558 1.00 . A A . 122 TYR HD2  1 1 
        1   681 1 1  44 TYR HE1  H   2.263   1.860   7.810 1.00 . A A . 122 TYR HE1  1 1 
        1   682 1 1  44 TYR HE2  H   2.705  -2.267   6.825 1.00 . A A . 122 TYR HE2  1 1 
        1   683 1 1  44 TYR HH   H   2.503   0.036   9.359 1.00 . A A . 122 TYR HH   1 1 
        1   684 1 1  44 TYR N    N  -1.361   0.500   3.783 1.00 . A A . 122 TYR N    1 1 
        1   685 1 1  44 TYR O    O  -0.206   3.246   1.990 1.00 . A A . 122 TYR O    1 1 
        1   686 1 1  44 TYR OH   O   3.002  -0.484   8.724 1.00 . A A . 122 TYR OH   1 1 
        1   687 1 1  45 THR C    C  -2.108   2.835  -0.217 1.00 . A A . 123 THR C    1 1 
        1   688 1 1  45 THR CA   C  -1.005   1.781  -0.219 1.00 . A A . 123 THR CA   1 1 
        1   689 1 1  45 THR CB   C  -1.363   0.651  -1.185 1.00 . A A . 123 THR CB   1 1 
        1   690 1 1  45 THR CG2  C  -1.554   1.120  -2.611 1.00 . A A . 123 THR CG2  1 1 
        1   691 1 1  45 THR H    H  -0.942   0.300   1.293 1.00 . A A . 123 THR H    1 1 
        1   692 1 1  45 THR HA   H  -0.084   2.243  -0.542 1.00 . A A . 123 THR HA   1 1 
        1   693 1 1  45 THR HB   H  -2.286   0.192  -0.861 1.00 . A A . 123 THR HB   1 1 
        1   694 1 1  45 THR HG1  H  -0.219  -0.671  -0.301 1.00 . A A . 123 THR HG1  1 1 
        1   695 1 1  45 THR HG21 H  -0.589   1.262  -3.076 1.00 . A A . 123 THR HG21 1 1 
        1   696 1 1  45 THR HG22 H  -2.095   2.055  -2.613 1.00 . A A . 123 THR HG22 1 1 
        1   697 1 1  45 THR HG23 H  -2.113   0.379  -3.162 1.00 . A A . 123 THR HG23 1 1 
        1   698 1 1  45 THR N    N  -0.794   1.254   1.124 1.00 . A A . 123 THR N    1 1 
        1   699 1 1  45 THR O    O  -2.004   3.857  -0.894 1.00 . A A . 123 THR O    1 1 
        1   700 1 1  45 THR OG1  O  -0.352  -0.342  -1.193 1.00 . A A . 123 THR OG1  1 1 
        1   701 1 1  46 ILE C    C  -3.829   4.838   1.258 1.00 . A A . 124 ILE C    1 1 
        1   702 1 1  46 ILE CA   C  -4.280   3.510   0.652 1.00 . A A . 124 ILE CA   1 1 
        1   703 1 1  46 ILE CB   C  -5.427   2.915   1.500 1.00 . A A . 124 ILE CB   1 1 
        1   704 1 1  46 ILE CD1  C  -6.719   1.903  -0.450 1.00 . A A . 124 ILE CD1  1 1 
        1   705 1 1  46 ILE CG1  C  -5.969   1.645   0.839 1.00 . A A . 124 ILE CG1  1 1 
        1   706 1 1  46 ILE CG2  C  -6.547   3.929   1.695 1.00 . A A . 124 ILE CG2  1 1 
        1   707 1 1  46 ILE H    H  -3.184   1.752   1.077 1.00 . A A . 124 ILE H    1 1 
        1   708 1 1  46 ILE HA   H  -4.652   3.689  -0.347 1.00 . A A . 124 ILE HA   1 1 
        1   709 1 1  46 ILE HB   H  -5.031   2.663   2.472 1.00 . A A . 124 ILE HB   1 1 
        1   710 1 1  46 ILE HD11 H  -6.334   1.258  -1.226 1.00 . A A . 124 ILE HD11 1 1 
        1   711 1 1  46 ILE HD12 H  -6.589   2.935  -0.742 1.00 . A A . 124 ILE HD12 1 1 
        1   712 1 1  46 ILE HD13 H  -7.770   1.701  -0.302 1.00 . A A . 124 ILE HD13 1 1 
        1   713 1 1  46 ILE HG12 H  -5.146   0.985   0.613 1.00 . A A . 124 ILE HG12 1 1 
        1   714 1 1  46 ILE HG13 H  -6.643   1.151   1.523 1.00 . A A . 124 ILE HG13 1 1 
        1   715 1 1  46 ILE HG21 H  -7.265   3.540   2.402 1.00 . A A . 124 ILE HG21 1 1 
        1   716 1 1  46 ILE HG22 H  -7.035   4.110   0.750 1.00 . A A . 124 ILE HG22 1 1 
        1   717 1 1  46 ILE HG23 H  -6.136   4.853   2.072 1.00 . A A . 124 ILE HG23 1 1 
        1   718 1 1  46 ILE N    N  -3.160   2.581   0.555 1.00 . A A . 124 ILE N    1 1 
        1   719 1 1  46 ILE O    O  -4.095   5.905   0.706 1.00 . A A . 124 ILE O    1 1 
        1   720 1 1  47 GLN C    C  -1.720   6.750   2.174 1.00 . A A . 125 GLN C    1 1 
        1   721 1 1  47 GLN CA   C  -2.658   5.955   3.077 1.00 . A A . 125 GLN CA   1 1 
        1   722 1 1  47 GLN CB   C  -1.939   5.571   4.372 1.00 . A A . 125 GLN CB   1 1 
        1   723 1 1  47 GLN CD   C  -1.101   6.931   6.330 1.00 . A A . 125 GLN CD   1 1 
        1   724 1 1  47 GLN CG   C  -2.313   6.447   5.558 1.00 . A A . 125 GLN CG   1 1 
        1   725 1 1  47 GLN H    H  -2.966   3.884   2.787 1.00 . A A . 125 GLN H    1 1 
        1   726 1 1  47 GLN HA   H  -3.512   6.571   3.318 1.00 . A A . 125 GLN HA   1 1 
        1   727 1 1  47 GLN HB2  H  -2.185   4.548   4.617 1.00 . A A . 125 GLN HB2  1 1 
        1   728 1 1  47 GLN HB3  H  -0.873   5.648   4.217 1.00 . A A . 125 GLN HB3  1 1 
        1   729 1 1  47 GLN HE21 H  -1.239   8.720   5.473 1.00 . A A . 125 GLN HE21 1 1 
        1   730 1 1  47 GLN HE22 H   0.058   8.525   6.597 1.00 . A A . 125 GLN HE22 1 1 
        1   731 1 1  47 GLN HG2  H  -2.857   7.306   5.197 1.00 . A A . 125 GLN HG2  1 1 
        1   732 1 1  47 GLN HG3  H  -2.942   5.876   6.225 1.00 . A A . 125 GLN HG3  1 1 
        1   733 1 1  47 GLN N    N  -3.146   4.762   2.396 1.00 . A A . 125 GLN N    1 1 
        1   734 1 1  47 GLN NE2  N  -0.723   8.185   6.112 1.00 . A A . 125 GLN NE2  1 1 
        1   735 1 1  47 GLN O    O  -1.700   7.978   2.212 1.00 . A A . 125 GLN O    1 1 
        1   736 1 1  47 GLN OE1  O  -0.512   6.188   7.115 1.00 . A A . 125 GLN OE1  1 1 
        1   737 1 1  48 SER C    C  -0.726   7.214  -0.790 1.00 . A A . 126 SER C    1 1 
        1   738 1 1  48 SER CA   C  -0.007   6.682   0.447 1.00 . A A . 126 SER CA   1 1 
        1   739 1 1  48 SER CB   C   1.086   5.697   0.029 1.00 . A A . 126 SER CB   1 1 
        1   740 1 1  48 SER H    H  -1.005   5.062   1.377 1.00 . A A . 126 SER H    1 1 
        1   741 1 1  48 SER HA   H   0.449   7.511   0.968 1.00 . A A . 126 SER HA   1 1 
        1   742 1 1  48 SER HB2  H   1.767   5.545   0.853 1.00 . A A . 126 SER HB2  1 1 
        1   743 1 1  48 SER HB3  H   0.633   4.755  -0.242 1.00 . A A . 126 SER HB3  1 1 
        1   744 1 1  48 SER HG   H   2.339   6.947  -0.811 1.00 . A A . 126 SER HG   1 1 
        1   745 1 1  48 SER N    N  -0.944   6.040   1.362 1.00 . A A . 126 SER N    1 1 
        1   746 1 1  48 SER O    O  -0.253   8.143  -1.444 1.00 . A A . 126 SER O    1 1 
        1   747 1 1  48 SER OG   O   1.818   6.188  -1.081 1.00 . A A . 126 SER OG   1 1 
        1   748 1 1  49 GLU C    C  -3.489   8.233  -1.974 1.00 . A A . 127 GLU C    1 1 
        1   749 1 1  49 GLU CA   C  -2.641   7.010  -2.278 1.00 . A A . 127 GLU CA   1 1 
        1   750 1 1  49 GLU CB   C  -3.543   5.862  -2.739 1.00 . A A . 127 GLU CB   1 1 
        1   751 1 1  49 GLU CD   C  -1.695   4.856  -4.137 1.00 . A A . 127 GLU CD   1 1 
        1   752 1 1  49 GLU CG   C  -3.149   5.282  -4.088 1.00 . A A . 127 GLU CG   1 1 
        1   753 1 1  49 GLU H    H  -2.182   5.866  -0.555 1.00 . A A . 127 GLU H    1 1 
        1   754 1 1  49 GLU HA   H  -1.949   7.253  -3.070 1.00 . A A . 127 GLU HA   1 1 
        1   755 1 1  49 GLU HB2  H  -3.502   5.070  -2.006 1.00 . A A . 127 GLU HB2  1 1 
        1   756 1 1  49 GLU HB3  H  -4.562   6.221  -2.810 1.00 . A A . 127 GLU HB3  1 1 
        1   757 1 1  49 GLU HG2  H  -3.767   4.421  -4.290 1.00 . A A . 127 GLU HG2  1 1 
        1   758 1 1  49 GLU HG3  H  -3.315   6.030  -4.849 1.00 . A A . 127 GLU HG3  1 1 
        1   759 1 1  49 GLU N    N  -1.865   6.608  -1.112 1.00 . A A . 127 GLU N    1 1 
        1   760 1 1  49 GLU O    O  -3.617   9.137  -2.799 1.00 . A A . 127 GLU O    1 1 
        1   761 1 1  49 GLU OE1  O  -1.291   4.026  -3.295 1.00 . A A . 127 GLU OE1  1 1 
        1   762 1 1  49 GLU OE2  O  -0.960   5.351  -5.017 1.00 . A A . 127 GLU OE2  1 1 
        1   763 1 1  50 LEU C    C  -4.346  10.167   0.732 1.00 . A A . 128 LEU C    1 1 
        1   764 1 1  50 LEU CA   C  -4.962   9.326  -0.385 1.00 . A A . 128 LEU CA   1 1 
        1   765 1 1  50 LEU CB   C  -6.286   8.735   0.077 1.00 . A A . 128 LEU CB   1 1 
        1   766 1 1  50 LEU CD1  C  -6.869   6.324  -0.284 1.00 . A A . 128 LEU CD1  1 1 
        1   767 1 1  50 LEU CD2  C  -8.316   8.106  -1.262 1.00 . A A . 128 LEU CD2  1 1 
        1   768 1 1  50 LEU CG   C  -6.896   7.716  -0.889 1.00 . A A . 128 LEU CG   1 1 
        1   769 1 1  50 LEU H    H  -3.978   7.477  -0.188 1.00 . A A . 128 LEU H    1 1 
        1   770 1 1  50 LEU HA   H  -5.141   9.956  -1.243 1.00 . A A . 128 LEU HA   1 1 
        1   771 1 1  50 LEU HB2  H  -6.113   8.242   1.025 1.00 . A A . 128 LEU HB2  1 1 
        1   772 1 1  50 LEU HB3  H  -6.991   9.537   0.224 1.00 . A A . 128 LEU HB3  1 1 
        1   773 1 1  50 LEU HD11 H  -6.836   6.402   0.792 1.00 . A A . 128 LEU HD11 1 1 
        1   774 1 1  50 LEU HD12 H  -5.994   5.796  -0.634 1.00 . A A . 128 LEU HD12 1 1 
        1   775 1 1  50 LEU HD13 H  -7.758   5.786  -0.579 1.00 . A A . 128 LEU HD13 1 1 
        1   776 1 1  50 LEU HD21 H  -9.012   7.593  -0.614 1.00 . A A . 128 LEU HD21 1 1 
        1   777 1 1  50 LEU HD22 H  -8.504   7.825  -2.288 1.00 . A A . 128 LEU HD22 1 1 
        1   778 1 1  50 LEU HD23 H  -8.437   9.173  -1.152 1.00 . A A . 128 LEU HD23 1 1 
        1   779 1 1  50 LEU HG   H  -6.307   7.692  -1.793 1.00 . A A . 128 LEU HG   1 1 
        1   780 1 1  50 LEU N    N  -4.093   8.238  -0.796 1.00 . A A . 128 LEU N    1 1 
        1   781 1 1  50 LEU O    O  -4.953  11.134   1.192 1.00 . A A . 128 LEU O    1 1 
        1   782 1 1  51 GLY C    C  -3.157  10.351   3.566 1.00 . A A . 129 GLY C    1 1 
        1   783 1 1  51 GLY CA   C  -2.488  10.546   2.223 1.00 . A A . 129 GLY CA   1 1 
        1   784 1 1  51 GLY H    H  -2.696   9.029   0.772 1.00 . A A . 129 GLY H    1 1 
        1   785 1 1  51 GLY HA2  H  -1.461  10.219   2.294 1.00 . A A . 129 GLY HA2  1 1 
        1   786 1 1  51 GLY HA3  H  -2.505  11.596   1.973 1.00 . A A . 129 GLY HA3  1 1 
        1   787 1 1  51 GLY N    N  -3.144   9.803   1.167 1.00 . A A . 129 GLY N    1 1 
        1   788 1 1  51 GLY O    O  -3.855   9.361   3.785 1.00 . A A . 129 GLY O    1 1 
        1   789 1 1  52 ASP C    C  -5.051  11.188   5.723 1.00 . A A . 130 ASP C    1 1 
        1   790 1 1  52 ASP CA   C  -3.528  11.239   5.800 1.00 . A A . 130 ASP CA   1 1 
        1   791 1 1  52 ASP CB   C  -3.088  12.446   6.630 1.00 . A A . 130 ASP CB   1 1 
        1   792 1 1  52 ASP CG   C  -2.844  12.091   8.083 1.00 . A A . 130 ASP CG   1 1 
        1   793 1 1  52 ASP H    H  -2.377  12.061   4.225 1.00 . A A . 130 ASP H    1 1 
        1   794 1 1  52 ASP HA   H  -3.173  10.337   6.276 1.00 . A A . 130 ASP HA   1 1 
        1   795 1 1  52 ASP HB2  H  -2.172  12.844   6.217 1.00 . A A . 130 ASP HB2  1 1 
        1   796 1 1  52 ASP HB3  H  -3.856  13.204   6.587 1.00 . A A . 130 ASP HB3  1 1 
        1   797 1 1  52 ASP N    N  -2.943  11.300   4.466 1.00 . A A . 130 ASP N    1 1 
        1   798 1 1  52 ASP O    O  -5.651  11.679   4.768 1.00 . A A . 130 ASP O    1 1 
        1   799 1 1  52 ASP OD1  O  -1.769  11.531   8.385 1.00 . A A . 130 ASP OD1  1 1 
        1   800 1 1  52 ASP OD2  O  -3.727  12.373   8.920 1.00 . A A . 130 ASP OD2  1 1 
        1   801 1 1  53 TYR C    C  -7.766  11.810   7.129 1.00 . A A . 131 TYR C    1 1 
        1   802 1 1  53 TYR CA   C  -7.122  10.472   6.782 1.00 . A A . 131 TYR CA   1 1 
        1   803 1 1  53 TYR CB   C  -7.536   9.413   7.804 1.00 . A A . 131 TYR CB   1 1 
        1   804 1 1  53 TYR CD1  C  -9.320   7.976   6.744 1.00 . A A . 131 TYR CD1  1 1 
        1   805 1 1  53 TYR CD2  C  -9.977   9.519   8.438 1.00 . A A . 131 TYR CD2  1 1 
        1   806 1 1  53 TYR CE1  C -10.631   7.560   6.609 1.00 . A A . 131 TYR CE1  1 1 
        1   807 1 1  53 TYR CE2  C -11.290   9.108   8.309 1.00 . A A . 131 TYR CE2  1 1 
        1   808 1 1  53 TYR CG   C  -8.972   8.960   7.660 1.00 . A A . 131 TYR CG   1 1 
        1   809 1 1  53 TYR CZ   C -11.612   8.129   7.393 1.00 . A A . 131 TYR CZ   1 1 
        1   810 1 1  53 TYR H    H  -5.136  10.215   7.468 1.00 . A A . 131 TYR H    1 1 
        1   811 1 1  53 TYR HA   H  -7.460  10.166   5.803 1.00 . A A . 131 TYR HA   1 1 
        1   812 1 1  53 TYR HB2  H  -6.903   8.546   7.691 1.00 . A A . 131 TYR HB2  1 1 
        1   813 1 1  53 TYR HB3  H  -7.413   9.815   8.799 1.00 . A A . 131 TYR HB3  1 1 
        1   814 1 1  53 TYR HD1  H  -8.550   7.532   6.131 1.00 . A A . 131 TYR HD1  1 1 
        1   815 1 1  53 TYR HD2  H  -9.722  10.285   9.154 1.00 . A A . 131 TYR HD2  1 1 
        1   816 1 1  53 TYR HE1  H -10.883   6.793   5.891 1.00 . A A . 131 TYR HE1  1 1 
        1   817 1 1  53 TYR HE2  H -12.058   9.554   8.923 1.00 . A A . 131 TYR HE2  1 1 
        1   818 1 1  53 TYR HH   H -13.186   7.788   6.342 1.00 . A A . 131 TYR HH   1 1 
        1   819 1 1  53 TYR N    N  -5.669  10.589   6.735 1.00 . A A . 131 TYR N    1 1 
        1   820 1 1  53 TYR O    O  -7.121  12.694   7.693 1.00 . A A . 131 TYR O    1 1 
        1   821 1 1  53 TYR OH   O -12.918   7.718   7.262 1.00 . A A . 131 TYR OH   1 1 
        1   822 1 1  54 ASP C    C -11.234  12.878   7.413 1.00 . A A . 132 ASP C    1 1 
        1   823 1 1  54 ASP CA   C  -9.778  13.181   7.064 1.00 . A A . 132 ASP CA   1 1 
        1   824 1 1  54 ASP CB   C  -9.715  14.119   5.857 1.00 . A A . 132 ASP CB   1 1 
        1   825 1 1  54 ASP CG   C  -8.556  15.093   5.942 1.00 . A A . 132 ASP CG   1 1 
        1   826 1 1  54 ASP H    H  -9.503  11.211   6.341 1.00 . A A . 132 ASP H    1 1 
        1   827 1 1  54 ASP HA   H  -9.310  13.664   7.909 1.00 . A A . 132 ASP HA   1 1 
        1   828 1 1  54 ASP HB2  H  -9.601  13.531   4.958 1.00 . A A . 132 ASP HB2  1 1 
        1   829 1 1  54 ASP HB3  H -10.633  14.684   5.799 1.00 . A A . 132 ASP HB3  1 1 
        1   830 1 1  54 ASP N    N  -9.043  11.952   6.788 1.00 . A A . 132 ASP N    1 1 
        1   831 1 1  54 ASP O    O -12.091  12.814   6.532 1.00 . A A . 132 ASP O    1 1 
        1   832 1 1  54 ASP OD1  O  -8.494  15.857   6.928 1.00 . A A . 132 ASP OD1  1 1 
        1   833 1 1  54 ASP OD2  O  -7.711  15.093   5.022 1.00 . A A . 132 ASP OD2  1 1 
        1   834 1 1  55 PRO C    C -13.888  13.484   8.807 1.00 . A A . 133 PRO C    1 1 
        1   835 1 1  55 PRO CA   C -12.893  12.385   9.172 1.00 . A A . 133 PRO CA   1 1 
        1   836 1 1  55 PRO CB   C -12.748  12.284  10.695 1.00 . A A . 133 PRO CB   1 1 
        1   837 1 1  55 PRO CD   C -10.573  12.740   9.825 1.00 . A A . 133 PRO CD   1 1 
        1   838 1 1  55 PRO CG   C -11.299  12.028  10.930 1.00 . A A . 133 PRO CG   1 1 
        1   839 1 1  55 PRO HA   H -13.244  11.442   8.779 1.00 . A A . 133 PRO HA   1 1 
        1   840 1 1  55 PRO HB2  H -13.064  13.211  11.151 1.00 . A A . 133 PRO HB2  1 1 
        1   841 1 1  55 PRO HB3  H -13.356  11.471  11.064 1.00 . A A . 133 PRO HB3  1 1 
        1   842 1 1  55 PRO HD2  H -10.365  13.762  10.107 1.00 . A A . 133 PRO HD2  1 1 
        1   843 1 1  55 PRO HD3  H  -9.660  12.221   9.575 1.00 . A A . 133 PRO HD3  1 1 
        1   844 1 1  55 PRO HG2  H -11.006  12.426  11.890 1.00 . A A . 133 PRO HG2  1 1 
        1   845 1 1  55 PRO HG3  H -11.101  10.967  10.885 1.00 . A A . 133 PRO HG3  1 1 
        1   846 1 1  55 PRO N    N -11.533  12.685   8.710 1.00 . A A . 133 PRO N    1 1 
        1   847 1 1  55 PRO O    O -15.095  13.248   8.756 1.00 . A A . 133 PRO O    1 1 
        1   848 1 1  56 GLU C    C -14.963  15.552   6.891 1.00 . A A . 134 GLU C    1 1 
        1   849 1 1  56 GLU CA   C -14.219  15.817   8.196 1.00 . A A . 134 GLU CA   1 1 
        1   850 1 1  56 GLU CB   C -13.376  17.087   8.066 1.00 . A A . 134 GLU CB   1 1 
        1   851 1 1  56 GLU CD   C -12.052  18.027   6.129 1.00 . A A . 134 GLU CD   1 1 
        1   852 1 1  56 GLU CG   C -12.165  16.922   7.161 1.00 . A A . 134 GLU CG   1 1 
        1   853 1 1  56 GLU H    H -12.405  14.812   8.612 1.00 . A A . 134 GLU H    1 1 
        1   854 1 1  56 GLU HA   H -14.941  15.955   8.986 1.00 . A A . 134 GLU HA   1 1 
        1   855 1 1  56 GLU HB2  H -13.995  17.876   7.664 1.00 . A A . 134 GLU HB2  1 1 
        1   856 1 1  56 GLU HB3  H -13.029  17.377   9.047 1.00 . A A . 134 GLU HB3  1 1 
        1   857 1 1  56 GLU HG2  H -11.273  16.928   7.770 1.00 . A A . 134 GLU HG2  1 1 
        1   858 1 1  56 GLU HG3  H -12.242  15.975   6.647 1.00 . A A . 134 GLU HG3  1 1 
        1   859 1 1  56 GLU N    N -13.374  14.684   8.555 1.00 . A A . 134 GLU N    1 1 
        1   860 1 1  56 GLU O    O -16.064  16.059   6.679 1.00 . A A . 134 GLU O    1 1 
        1   861 1 1  56 GLU OE1  O -13.084  18.377   5.519 1.00 . A A . 134 GLU OE1  1 1 
        1   862 1 1  56 GLU OE2  O -10.932  18.543   5.931 1.00 . A A . 134 GLU OE2  1 1 
        1   863 1 1  57 LEU C    C -15.682  13.086   4.796 1.00 . A A . 135 LEU C    1 1 
        1   864 1 1  57 LEU CA   C -14.958  14.428   4.734 1.00 . A A . 135 LEU CA   1 1 
        1   865 1 1  57 LEU CB   C -13.890  14.393   3.639 1.00 . A A . 135 LEU CB   1 1 
        1   866 1 1  57 LEU CD1  C -12.155  15.582   2.275 1.00 . A A . 135 LEU CD1  1 1 
        1   867 1 1  57 LEU CD2  C -14.144  16.833   3.131 1.00 . A A . 135 LEU CD2  1 1 
        1   868 1 1  57 LEU CG   C -13.153  15.714   3.414 1.00 . A A . 135 LEU CG   1 1 
        1   869 1 1  57 LEU H    H -13.475  14.383   6.243 1.00 . A A . 135 LEU H    1 1 
        1   870 1 1  57 LEU HA   H -15.675  15.199   4.500 1.00 . A A . 135 LEU HA   1 1 
        1   871 1 1  57 LEU HB2  H -13.163  13.638   3.898 1.00 . A A . 135 LEU HB2  1 1 
        1   872 1 1  57 LEU HB3  H -14.365  14.110   2.711 1.00 . A A . 135 LEU HB3  1 1 
        1   873 1 1  57 LEU HD11 H -12.086  16.520   1.745 1.00 . A A . 135 LEU HD11 1 1 
        1   874 1 1  57 LEU HD12 H -12.483  14.808   1.597 1.00 . A A . 135 LEU HD12 1 1 
        1   875 1 1  57 LEU HD13 H -11.185  15.322   2.675 1.00 . A A . 135 LEU HD13 1 1 
        1   876 1 1  57 LEU HD21 H -14.470  17.271   4.063 1.00 . A A . 135 LEU HD21 1 1 
        1   877 1 1  57 LEU HD22 H -14.997  16.433   2.603 1.00 . A A . 135 LEU HD22 1 1 
        1   878 1 1  57 LEU HD23 H -13.669  17.590   2.525 1.00 . A A . 135 LEU HD23 1 1 
        1   879 1 1  57 LEU HG   H -12.606  15.970   4.310 1.00 . A A . 135 LEU HG   1 1 
        1   880 1 1  57 LEU N    N -14.353  14.756   6.019 1.00 . A A . 135 LEU N    1 1 
        1   881 1 1  57 LEU O    O -16.655  12.862   4.076 1.00 . A A . 135 LEU O    1 1 
        1   882 1 1  58 HIS C    C -15.718  10.088   4.511 1.00 . A A . 136 HIS C    1 1 
        1   883 1 1  58 HIS CA   C -15.804  10.878   5.813 1.00 . A A . 136 HIS CA   1 1 
        1   884 1 1  58 HIS CB   C -17.265  11.008   6.249 1.00 . A A . 136 HIS CB   1 1 
        1   885 1 1  58 HIS CD2  C -16.722  10.546   8.743 1.00 . A A . 136 HIS CD2  1 1 
        1   886 1 1  58 HIS CE1  C -18.364  11.684   9.645 1.00 . A A . 136 HIS CE1  1 1 
        1   887 1 1  58 HIS CG   C -17.442  11.089   7.733 1.00 . A A . 136 HIS CG   1 1 
        1   888 1 1  58 HIS H    H -14.423  12.433   6.206 1.00 . A A . 136 HIS H    1 1 
        1   889 1 1  58 HIS HA   H -15.255  10.350   6.578 1.00 . A A . 136 HIS HA   1 1 
        1   890 1 1  58 HIS HB2  H -17.684  11.904   5.816 1.00 . A A . 136 HIS HB2  1 1 
        1   891 1 1  58 HIS HB3  H -17.817  10.150   5.893 1.00 . A A . 136 HIS HB3  1 1 
        1   892 1 1  58 HIS HD1  H -19.159  12.304   7.864 1.00 . A A . 136 HIS HD1  1 1 
        1   893 1 1  58 HIS HD2  H -15.843   9.925   8.641 1.00 . A A . 136 HIS HD2  1 1 
        1   894 1 1  58 HIS HE1  H -19.028  12.132  10.370 1.00 . A A . 136 HIS HE1  1 1 
        1   895 1 1  58 HIS HE2  H -17.076  10.601  10.812 1.00 . A A . 136 HIS HE2  1 1 
        1   896 1 1  58 HIS N    N -15.201  12.197   5.660 1.00 . A A . 136 HIS N    1 1 
        1   897 1 1  58 HIS ND1  N -18.464  11.795   8.332 1.00 . A A . 136 HIS ND1  1 1 
        1   898 1 1  58 HIS NE2  N -17.315  10.930   9.920 1.00 . A A . 136 HIS NE2  1 1 
        1   899 1 1  58 HIS O    O -15.242  10.595   3.496 1.00 . A A . 136 HIS O    1 1 
        1   900 1 1  59 GLY C    C -16.731   6.631   3.617 1.00 . A A . 137 GLY C    1 1 
        1   901 1 1  59 GLY CA   C -16.146   8.001   3.368 1.00 . A A . 137 GLY CA   1 1 
        1   902 1 1  59 GLY H    H -16.548   8.492   5.388 1.00 . A A . 137 GLY H    1 1 
        1   903 1 1  59 GLY HA2  H -16.706   8.480   2.580 1.00 . A A . 137 GLY HA2  1 1 
        1   904 1 1  59 GLY HA3  H -15.122   7.886   3.050 1.00 . A A . 137 GLY HA3  1 1 
        1   905 1 1  59 GLY N    N -16.180   8.842   4.550 1.00 . A A . 137 GLY N    1 1 
        1   906 1 1  59 GLY O    O -17.678   6.223   2.945 1.00 . A A . 137 GLY O    1 1 
        1   907 1 1  60 VAL C    C -16.351   3.597   3.793 1.00 . A A . 138 VAL C    1 1 
        1   908 1 1  60 VAL CA   C -16.626   4.583   4.928 1.00 . A A . 138 VAL CA   1 1 
        1   909 1 1  60 VAL CB   C -18.134   4.585   5.264 1.00 . A A . 138 VAL CB   1 1 
        1   910 1 1  60 VAL CG1  C -18.689   3.171   5.287 1.00 . A A . 138 VAL CG1  1 1 
        1   911 1 1  60 VAL CG2  C -18.380   5.281   6.594 1.00 . A A . 138 VAL CG2  1 1 
        1   912 1 1  60 VAL H    H -15.410   6.305   5.080 1.00 . A A . 138 VAL H    1 1 
        1   913 1 1  60 VAL HA   H -16.086   4.261   5.806 1.00 . A A . 138 VAL HA   1 1 
        1   914 1 1  60 VAL HB   H -18.654   5.136   4.496 1.00 . A A . 138 VAL HB   1 1 
        1   915 1 1  60 VAL HG11 H -18.647   2.756   4.291 1.00 . A A . 138 VAL HG11 1 1 
        1   916 1 1  60 VAL HG12 H -19.713   3.192   5.627 1.00 . A A . 138 VAL HG12 1 1 
        1   917 1 1  60 VAL HG13 H -18.098   2.564   5.955 1.00 . A A . 138 VAL HG13 1 1 
        1   918 1 1  60 VAL HG21 H -17.996   4.669   7.397 1.00 . A A . 138 VAL HG21 1 1 
        1   919 1 1  60 VAL HG22 H -19.441   5.430   6.732 1.00 . A A . 138 VAL HG22 1 1 
        1   920 1 1  60 VAL HG23 H -17.879   6.237   6.598 1.00 . A A . 138 VAL HG23 1 1 
        1   921 1 1  60 VAL N    N -16.163   5.920   4.584 1.00 . A A . 138 VAL N    1 1 
        1   922 1 1  60 VAL O    O -15.529   2.691   3.932 1.00 . A A . 138 VAL O    1 1 
        1   923 1 1  61 ASP C    C -15.915   3.507   0.501 1.00 . A A . 139 ASP C    1 1 
        1   924 1 1  61 ASP CA   C -16.875   2.899   1.521 1.00 . A A . 139 ASP CA   1 1 
        1   925 1 1  61 ASP CB   C -18.227   2.623   0.861 1.00 . A A . 139 ASP CB   1 1 
        1   926 1 1  61 ASP CG   C -19.257   2.106   1.847 1.00 . A A . 139 ASP CG   1 1 
        1   927 1 1  61 ASP H    H -17.688   4.514   2.622 1.00 . A A . 139 ASP H    1 1 
        1   928 1 1  61 ASP HA   H -16.461   1.966   1.873 1.00 . A A . 139 ASP HA   1 1 
        1   929 1 1  61 ASP HB2  H -18.602   3.537   0.425 1.00 . A A . 139 ASP HB2  1 1 
        1   930 1 1  61 ASP HB3  H -18.098   1.885   0.084 1.00 . A A . 139 ASP HB3  1 1 
        1   931 1 1  61 ASP N    N -17.044   3.776   2.673 1.00 . A A . 139 ASP N    1 1 
        1   932 1 1  61 ASP O    O -16.036   3.264  -0.699 1.00 . A A . 139 ASP O    1 1 
        1   933 1 1  61 ASP OD1  O -19.966   2.936   2.454 1.00 . A A . 139 ASP OD1  1 1 
        1   934 1 1  61 ASP OD2  O -19.354   0.872   2.012 1.00 . A A . 139 ASP OD2  1 1 
        1   935 1 1  62 TYR C    C -12.964   3.915  -0.396 1.00 . A A . 140 TYR C    1 1 
        1   936 1 1  62 TYR CA   C -13.982   4.932   0.111 1.00 . A A . 140 TYR CA   1 1 
        1   937 1 1  62 TYR CB   C -13.266   6.066   0.848 1.00 . A A . 140 TYR CB   1 1 
        1   938 1 1  62 TYR CD1  C -11.286   5.081   2.064 1.00 . A A . 140 TYR CD1  1 1 
        1   939 1 1  62 TYR CD2  C -13.181   5.743   3.349 1.00 . A A . 140 TYR CD2  1 1 
        1   940 1 1  62 TYR CE1  C -10.641   4.674   3.216 1.00 . A A . 140 TYR CE1  1 1 
        1   941 1 1  62 TYR CE2  C -12.543   5.338   4.506 1.00 . A A . 140 TYR CE2  1 1 
        1   942 1 1  62 TYR CG   C -12.564   5.622   2.111 1.00 . A A . 140 TYR CG   1 1 
        1   943 1 1  62 TYR CZ   C -11.274   4.804   4.434 1.00 . A A . 140 TYR CZ   1 1 
        1   944 1 1  62 TYR H    H -14.912   4.452   1.952 1.00 . A A . 140 TYR H    1 1 
        1   945 1 1  62 TYR HA   H -14.513   5.344  -0.735 1.00 . A A . 140 TYR HA   1 1 
        1   946 1 1  62 TYR HB2  H -12.525   6.500   0.193 1.00 . A A . 140 TYR HB2  1 1 
        1   947 1 1  62 TYR HB3  H -13.988   6.823   1.117 1.00 . A A . 140 TYR HB3  1 1 
        1   948 1 1  62 TYR HD1  H -10.793   4.981   1.108 1.00 . A A . 140 TYR HD1  1 1 
        1   949 1 1  62 TYR HD2  H -14.175   6.161   3.402 1.00 . A A . 140 TYR HD2  1 1 
        1   950 1 1  62 TYR HE1  H  -9.647   4.257   3.159 1.00 . A A . 140 TYR HE1  1 1 
        1   951 1 1  62 TYR HE2  H -13.039   5.440   5.460 1.00 . A A . 140 TYR HE2  1 1 
        1   952 1 1  62 TYR HH   H  -9.714   4.663   5.549 1.00 . A A . 140 TYR HH   1 1 
        1   953 1 1  62 TYR N    N -14.961   4.296   0.985 1.00 . A A . 140 TYR N    1 1 
        1   954 1 1  62 TYR O    O -12.440   4.045  -1.502 1.00 . A A . 140 TYR O    1 1 
        1   955 1 1  62 TYR OH   O -10.636   4.399   5.584 1.00 . A A . 140 TYR OH   1 1 
        1   956 1 1  63 VAL C    C -12.200   1.100  -1.192 1.00 . A A . 141 VAL C    1 1 
        1   957 1 1  63 VAL CA   C -11.740   1.858   0.052 1.00 . A A . 141 VAL CA   1 1 
        1   958 1 1  63 VAL CB   C -11.537   0.854   1.202 1.00 . A A . 141 VAL CB   1 1 
        1   959 1 1  63 VAL CG1  C -10.395  -0.097   0.884 1.00 . A A . 141 VAL CG1  1 1 
        1   960 1 1  63 VAL CG2  C -11.281   1.585   2.511 1.00 . A A . 141 VAL CG2  1 1 
        1   961 1 1  63 VAL H    H -13.144   2.850   1.286 1.00 . A A . 141 VAL H    1 1 
        1   962 1 1  63 VAL HA   H -10.791   2.331  -0.157 1.00 . A A . 141 VAL HA   1 1 
        1   963 1 1  63 VAL HB   H -12.440   0.272   1.309 1.00 . A A . 141 VAL HB   1 1 
        1   964 1 1  63 VAL HG11 H -10.297  -0.822   1.679 1.00 . A A . 141 VAL HG11 1 1 
        1   965 1 1  63 VAL HG12 H  -9.475   0.461   0.791 1.00 . A A . 141 VAL HG12 1 1 
        1   966 1 1  63 VAL HG13 H -10.601  -0.609  -0.045 1.00 . A A . 141 VAL HG13 1 1 
        1   967 1 1  63 VAL HG21 H -10.953   0.878   3.260 1.00 . A A . 141 VAL HG21 1 1 
        1   968 1 1  63 VAL HG22 H -12.193   2.061   2.842 1.00 . A A . 141 VAL HG22 1 1 
        1   969 1 1  63 VAL HG23 H -10.517   2.333   2.363 1.00 . A A . 141 VAL HG23 1 1 
        1   970 1 1  63 VAL N    N -12.692   2.901   0.419 1.00 . A A . 141 VAL N    1 1 
        1   971 1 1  63 VAL O    O -11.403   0.441  -1.860 1.00 . A A . 141 VAL O    1 1 
        1   972 1 1  64 SER C    C -13.461   1.049  -3.966 1.00 . A A . 142 SER C    1 1 
        1   973 1 1  64 SER CA   C -14.066   0.532  -2.661 1.00 . A A . 142 SER CA   1 1 
        1   974 1 1  64 SER CB   C -15.584   0.723  -2.683 1.00 . A A . 142 SER CB   1 1 
        1   975 1 1  64 SER H    H -14.078   1.742  -0.930 1.00 . A A . 142 SER H    1 1 
        1   976 1 1  64 SER HA   H -13.850  -0.522  -2.574 1.00 . A A . 142 SER HA   1 1 
        1   977 1 1  64 SER HB2  H -15.826   1.705  -2.303 1.00 . A A . 142 SER HB2  1 1 
        1   978 1 1  64 SER HB3  H -15.941   0.632  -3.698 1.00 . A A . 142 SER HB3  1 1 
        1   979 1 1  64 SER HG   H -15.968  -1.126  -2.166 1.00 . A A . 142 SER HG   1 1 
        1   980 1 1  64 SER N    N -13.491   1.201  -1.499 1.00 . A A . 142 SER N    1 1 
        1   981 1 1  64 SER O    O -13.622   0.431  -5.018 1.00 . A A . 142 SER O    1 1 
        1   982 1 1  64 SER OG   O -16.233  -0.248  -1.881 1.00 . A A . 142 SER OG   1 1 
        1   983 1 1  65 ASP C    C -10.778   2.129  -5.353 1.00 . A A . 143 ASP C    1 1 
        1   984 1 1  65 ASP CA   C -12.139   2.764  -5.077 1.00 . A A . 143 ASP CA   1 1 
        1   985 1 1  65 ASP CB   C -11.983   4.276  -4.901 1.00 . A A . 143 ASP CB   1 1 
        1   986 1 1  65 ASP CG   C -13.304   5.011  -5.012 1.00 . A A . 143 ASP CG   1 1 
        1   987 1 1  65 ASP H    H -12.652   2.624  -3.030 1.00 . A A . 143 ASP H    1 1 
        1   988 1 1  65 ASP HA   H -12.787   2.576  -5.920 1.00 . A A . 143 ASP HA   1 1 
        1   989 1 1  65 ASP HB2  H -11.561   4.477  -3.928 1.00 . A A . 143 ASP HB2  1 1 
        1   990 1 1  65 ASP HB3  H -11.317   4.654  -5.663 1.00 . A A . 143 ASP HB3  1 1 
        1   991 1 1  65 ASP N    N -12.763   2.180  -3.896 1.00 . A A . 143 ASP N    1 1 
        1   992 1 1  65 ASP O    O -10.281   2.172  -6.479 1.00 . A A . 143 ASP O    1 1 
        1   993 1 1  65 ASP OD1  O -13.984   4.858  -6.048 1.00 . A A . 143 ASP OD1  1 1 
        1   994 1 1  65 ASP OD2  O -13.660   5.739  -4.061 1.00 . A A . 143 ASP OD2  1 1 
        1   995 1 1  66 PHE C    C  -8.967  -0.601  -4.248 1.00 . A A . 144 PHE C    1 1 
        1   996 1 1  66 PHE CA   C  -8.870   0.906  -4.461 1.00 . A A . 144 PHE CA   1 1 
        1   997 1 1  66 PHE CB   C  -7.876   1.508  -3.466 1.00 . A A . 144 PHE CB   1 1 
        1   998 1 1  66 PHE CD1  C  -6.826   3.541  -4.494 1.00 . A A . 144 PHE CD1  1 1 
        1   999 1 1  66 PHE CD2  C  -8.493   3.851  -2.817 1.00 . A A . 144 PHE CD2  1 1 
        1  1000 1 1  66 PHE CE1  C  -6.688   4.911  -4.614 1.00 . A A . 144 PHE CE1  1 1 
        1  1001 1 1  66 PHE CE2  C  -8.360   5.222  -2.933 1.00 . A A . 144 PHE CE2  1 1 
        1  1002 1 1  66 PHE CG   C  -7.729   2.997  -3.595 1.00 . A A . 144 PHE CG   1 1 
        1  1003 1 1  66 PHE CZ   C  -7.456   5.753  -3.833 1.00 . A A . 144 PHE CZ   1 1 
        1  1004 1 1  66 PHE H    H -10.616   1.542  -3.446 1.00 . A A . 144 PHE H    1 1 
        1  1005 1 1  66 PHE HA   H  -8.517   1.093  -5.464 1.00 . A A . 144 PHE HA   1 1 
        1  1006 1 1  66 PHE HB2  H  -8.208   1.293  -2.462 1.00 . A A . 144 PHE HB2  1 1 
        1  1007 1 1  66 PHE HB3  H  -6.905   1.062  -3.623 1.00 . A A . 144 PHE HB3  1 1 
        1  1008 1 1  66 PHE HD1  H  -6.226   2.884  -5.105 1.00 . A A . 144 PHE HD1  1 1 
        1  1009 1 1  66 PHE HD2  H  -9.200   3.437  -2.113 1.00 . A A . 144 PHE HD2  1 1 
        1  1010 1 1  66 PHE HE1  H  -5.981   5.324  -5.319 1.00 . A A . 144 PHE HE1  1 1 
        1  1011 1 1  66 PHE HE2  H  -8.963   5.877  -2.321 1.00 . A A . 144 PHE HE2  1 1 
        1  1012 1 1  66 PHE HZ   H  -7.350   6.823  -3.926 1.00 . A A . 144 PHE HZ   1 1 
        1  1013 1 1  66 PHE N    N -10.175   1.544  -4.321 1.00 . A A . 144 PHE N    1 1 
        1  1014 1 1  66 PHE O    O  -9.372  -1.065  -3.182 1.00 . A A . 144 PHE O    1 1 
        1  1015 1 1  67 LYS C    C  -7.487  -3.363  -4.364 1.00 . A A . 145 LYS C    1 1 
        1  1016 1 1  67 LYS CA   C  -8.638  -2.817  -5.205 1.00 . A A . 145 LYS CA   1 1 
        1  1017 1 1  67 LYS CB   C  -8.583  -3.416  -6.612 1.00 . A A . 145 LYS CB   1 1 
        1  1018 1 1  67 LYS CD   C -10.100  -4.415  -8.347 1.00 . A A . 145 LYS CD   1 1 
        1  1019 1 1  67 LYS CE   C  -9.120  -4.379  -9.509 1.00 . A A . 145 LYS CE   1 1 
        1  1020 1 1  67 LYS CG   C  -9.877  -3.254  -7.393 1.00 . A A . 145 LYS CG   1 1 
        1  1021 1 1  67 LYS H    H  -8.284  -0.928  -6.097 1.00 . A A . 145 LYS H    1 1 
        1  1022 1 1  67 LYS HA   H  -9.571  -3.098  -4.741 1.00 . A A . 145 LYS HA   1 1 
        1  1023 1 1  67 LYS HB2  H  -7.791  -2.934  -7.165 1.00 . A A . 145 LYS HB2  1 1 
        1  1024 1 1  67 LYS HB3  H  -8.365  -4.471  -6.533 1.00 . A A . 145 LYS HB3  1 1 
        1  1025 1 1  67 LYS HD2  H  -9.970  -5.342  -7.809 1.00 . A A . 145 LYS HD2  1 1 
        1  1026 1 1  67 LYS HD3  H -11.107  -4.361  -8.735 1.00 . A A . 145 LYS HD3  1 1 
        1  1027 1 1  67 LYS HE2  H  -9.581  -3.861 -10.336 1.00 . A A . 145 LYS HE2  1 1 
        1  1028 1 1  67 LYS HE3  H  -8.234  -3.844  -9.198 1.00 . A A . 145 LYS HE3  1 1 
        1  1029 1 1  67 LYS HG2  H -10.702  -3.208  -6.698 1.00 . A A . 145 LYS HG2  1 1 
        1  1030 1 1  67 LYS HG3  H  -9.830  -2.336  -7.961 1.00 . A A . 145 LYS HG3  1 1 
        1  1031 1 1  67 LYS HZ1  H  -7.863  -5.704 -10.522 1.00 . A A . 145 LYS HZ1  1 1 
        1  1032 1 1  67 LYS HZ2  H  -9.489  -6.167 -10.525 1.00 . A A . 145 LYS HZ2  1 1 
        1  1033 1 1  67 LYS HZ3  H  -8.560  -6.354  -9.124 1.00 . A A . 145 LYS HZ3  1 1 
        1  1034 1 1  67 LYS N    N  -8.594  -1.360  -5.273 1.00 . A A . 145 LYS N    1 1 
        1  1035 1 1  67 LYS NZ   N  -8.731  -5.746  -9.951 1.00 . A A . 145 LYS NZ   1 1 
        1  1036 1 1  67 LYS O    O  -6.348  -3.432  -4.823 1.00 . A A . 145 LYS O    1 1 
        1  1037 1 1  68 LEU C    C  -6.645  -5.798  -2.384 1.00 . A A . 146 LEU C    1 1 
        1  1038 1 1  68 LEU CA   C  -6.788  -4.286  -2.220 1.00 . A A . 146 LEU CA   1 1 
        1  1039 1 1  68 LEU CB   C  -7.148  -3.958  -0.770 1.00 . A A . 146 LEU CB   1 1 
        1  1040 1 1  68 LEU CD1  C  -8.801  -2.585   0.525 1.00 . A A . 146 LEU CD1  1 1 
        1  1041 1 1  68 LEU CD2  C  -6.602  -1.592  -0.147 1.00 . A A . 146 LEU CD2  1 1 
        1  1042 1 1  68 LEU CG   C  -7.714  -2.555  -0.540 1.00 . A A . 146 LEU CG   1 1 
        1  1043 1 1  68 LEU H    H  -8.721  -3.664  -2.820 1.00 . A A . 146 LEU H    1 1 
        1  1044 1 1  68 LEU HA   H  -5.844  -3.820  -2.460 1.00 . A A . 146 LEU HA   1 1 
        1  1045 1 1  68 LEU HB2  H  -7.880  -4.678  -0.433 1.00 . A A . 146 LEU HB2  1 1 
        1  1046 1 1  68 LEU HB3  H  -6.259  -4.065  -0.168 1.00 . A A . 146 LEU HB3  1 1 
        1  1047 1 1  68 LEU HD11 H  -8.804  -3.550   1.010 1.00 . A A . 146 LEU HD11 1 1 
        1  1048 1 1  68 LEU HD12 H  -9.762  -2.413   0.063 1.00 . A A . 146 LEU HD12 1 1 
        1  1049 1 1  68 LEU HD13 H  -8.611  -1.815   1.257 1.00 . A A . 146 LEU HD13 1 1 
        1  1050 1 1  68 LEU HD21 H  -7.033  -0.651   0.162 1.00 . A A . 146 LEU HD21 1 1 
        1  1051 1 1  68 LEU HD22 H  -5.951  -1.430  -0.992 1.00 . A A . 146 LEU HD22 1 1 
        1  1052 1 1  68 LEU HD23 H  -6.034  -2.013   0.670 1.00 . A A . 146 LEU HD23 1 1 
        1  1053 1 1  68 LEU HG   H  -8.157  -2.197  -1.458 1.00 . A A . 146 LEU HG   1 1 
        1  1054 1 1  68 LEU N    N  -7.795  -3.747  -3.129 1.00 . A A . 146 LEU N    1 1 
        1  1055 1 1  68 LEU O    O  -5.637  -6.380  -1.984 1.00 . A A . 146 LEU O    1 1 
        1  1056 1 1  69 ALA C    C  -8.851  -8.333  -3.980 1.00 . A A . 147 ALA C    1 1 
        1  1057 1 1  69 ALA CA   C  -7.633  -7.873  -3.183 1.00 . A A . 147 ALA CA   1 1 
        1  1058 1 1  69 ALA CB   C  -7.569  -8.599  -1.847 1.00 . A A . 147 ALA CB   1 1 
        1  1059 1 1  69 ALA H    H  -8.435  -5.917  -3.273 1.00 . A A . 147 ALA H    1 1 
        1  1060 1 1  69 ALA HA   H  -6.739  -8.114  -3.740 1.00 . A A . 147 ALA HA   1 1 
        1  1061 1 1  69 ALA HB1  H  -7.294  -7.901  -1.071 1.00 . A A . 147 ALA HB1  1 1 
        1  1062 1 1  69 ALA HB2  H  -6.832  -9.387  -1.901 1.00 . A A . 147 ALA HB2  1 1 
        1  1063 1 1  69 ALA HB3  H  -8.535  -9.026  -1.621 1.00 . A A . 147 ALA HB3  1 1 
        1  1064 1 1  69 ALA N    N  -7.657  -6.431  -2.973 1.00 . A A . 147 ALA N    1 1 
        1  1065 1 1  69 ALA O    O  -9.819  -7.589  -4.136 1.00 . A A . 147 ALA O    1 1 
        1  1066 1 1  70 PRO C    C -11.139 -10.456  -4.418 1.00 . A A . 148 PRO C    1 1 
        1  1067 1 1  70 PRO CA   C  -9.925 -10.132  -5.281 1.00 . A A . 148 PRO CA   1 1 
        1  1068 1 1  70 PRO CB   C  -9.330 -11.412  -5.871 1.00 . A A . 148 PRO CB   1 1 
        1  1069 1 1  70 PRO CD   C  -7.702 -10.529  -4.359 1.00 . A A . 148 PRO CD   1 1 
        1  1070 1 1  70 PRO CG   C  -8.266 -11.811  -4.910 1.00 . A A . 148 PRO CG   1 1 
        1  1071 1 1  70 PRO HA   H -10.219  -9.466  -6.080 1.00 . A A . 148 PRO HA   1 1 
        1  1072 1 1  70 PRO HB2  H -10.099 -12.167  -5.947 1.00 . A A . 148 PRO HB2  1 1 
        1  1073 1 1  70 PRO HB3  H  -8.922 -11.206  -6.849 1.00 . A A . 148 PRO HB3  1 1 
        1  1074 1 1  70 PRO HD2  H  -7.427 -10.653  -3.322 1.00 . A A . 148 PRO HD2  1 1 
        1  1075 1 1  70 PRO HD3  H  -6.849 -10.211  -4.941 1.00 . A A . 148 PRO HD3  1 1 
        1  1076 1 1  70 PRO HG2  H  -8.692 -12.405  -4.115 1.00 . A A . 148 PRO HG2  1 1 
        1  1077 1 1  70 PRO HG3  H  -7.496 -12.368  -5.424 1.00 . A A . 148 PRO HG3  1 1 
        1  1078 1 1  70 PRO N    N  -8.818  -9.574  -4.498 1.00 . A A . 148 PRO N    1 1 
        1  1079 1 1  70 PRO O    O -12.277 -10.187  -4.804 1.00 . A A . 148 PRO O    1 1 
        1  1080 1 1  71 ASN C    C -11.998 -10.446  -1.137 1.00 . A A . 149 ASN C    1 1 
        1  1081 1 1  71 ASN CA   C -11.965 -11.395  -2.330 1.00 . A A . 149 ASN CA   1 1 
        1  1082 1 1  71 ASN CB   C -11.792 -12.838  -1.849 1.00 . A A . 149 ASN CB   1 1 
        1  1083 1 1  71 ASN CG   C -12.534 -13.831  -2.721 1.00 . A A . 149 ASN CG   1 1 
        1  1084 1 1  71 ASN H    H  -9.962 -11.225  -2.995 1.00 . A A . 149 ASN H    1 1 
        1  1085 1 1  71 ASN HA   H -12.899 -11.314  -2.866 1.00 . A A . 149 ASN HA   1 1 
        1  1086 1 1  71 ASN HB2  H -10.742 -13.091  -1.859 1.00 . A A . 149 ASN HB2  1 1 
        1  1087 1 1  71 ASN HB3  H -12.168 -12.921  -0.839 1.00 . A A . 149 ASN HB3  1 1 
        1  1088 1 1  71 ASN HD21 H -11.912 -12.893  -4.360 1.00 . A A . 149 ASN HD21 1 1 
        1  1089 1 1  71 ASN HD22 H -12.914 -14.276  -4.621 1.00 . A A . 149 ASN HD22 1 1 
        1  1090 1 1  71 ASN N    N -10.890 -11.036  -3.248 1.00 . A A . 149 ASN N    1 1 
        1  1091 1 1  71 ASN ND2  N -12.444 -13.648  -4.033 1.00 . A A . 149 ASN ND2  1 1 
        1  1092 1 1  71 ASN O    O -11.656 -10.825  -0.017 1.00 . A A . 149 ASN O    1 1 
        1  1093 1 1  71 ASN OD1  O -13.179 -14.753  -2.222 1.00 . A A . 149 ASN OD1  1 1 
        1  1094 1 1  72 GLN C    C -13.763  -8.359   0.484 1.00 . A A . 150 GLN C    1 1 
        1  1095 1 1  72 GLN CA   C -12.486  -8.200  -0.336 1.00 . A A . 150 GLN CA   1 1 
        1  1096 1 1  72 GLN CB   C -12.427  -6.797  -0.940 1.00 . A A . 150 GLN CB   1 1 
        1  1097 1 1  72 GLN CD   C -11.705  -4.400  -0.610 1.00 . A A . 150 GLN CD   1 1 
        1  1098 1 1  72 GLN CG   C -12.018  -5.725   0.056 1.00 . A A . 150 GLN CG   1 1 
        1  1099 1 1  72 GLN H    H -12.667  -8.965  -2.301 1.00 . A A . 150 GLN H    1 1 
        1  1100 1 1  72 GLN HA   H -11.636  -8.337   0.315 1.00 . A A . 150 GLN HA   1 1 
        1  1101 1 1  72 GLN HB2  H -11.714  -6.796  -1.751 1.00 . A A . 150 GLN HB2  1 1 
        1  1102 1 1  72 GLN HB3  H -13.402  -6.544  -1.329 1.00 . A A . 150 GLN HB3  1 1 
        1  1103 1 1  72 GLN HE21 H  -9.892  -5.049  -1.103 1.00 . A A . 150 GLN HE21 1 1 
        1  1104 1 1  72 GLN HE22 H -10.272  -3.437  -1.595 1.00 . A A . 150 GLN HE22 1 1 
        1  1105 1 1  72 GLN HG2  H -12.826  -5.576   0.756 1.00 . A A . 150 GLN HG2  1 1 
        1  1106 1 1  72 GLN HG3  H -11.140  -6.061   0.587 1.00 . A A . 150 GLN HG3  1 1 
        1  1107 1 1  72 GLN N    N -12.410  -9.208  -1.387 1.00 . A A . 150 GLN N    1 1 
        1  1108 1 1  72 GLN NE2  N -10.502  -4.283  -1.158 1.00 . A A . 150 GLN NE2  1 1 
        1  1109 1 1  72 GLN O    O -14.869  -8.289  -0.051 1.00 . A A . 150 GLN O    1 1 
        1  1110 1 1  72 GLN OE1  O -12.536  -3.491  -0.632 1.00 . A A . 150 GLN OE1  1 1 
        1  1111 1 1  73 THR C    C -14.738  -7.671   3.765 1.00 . A A . 151 THR C    1 1 
        1  1112 1 1  73 THR CA   C -14.739  -8.740   2.682 1.00 . A A . 151 THR CA   1 1 
        1  1113 1 1  73 THR CB   C -14.716 -10.127   3.331 1.00 . A A . 151 THR CB   1 1 
        1  1114 1 1  73 THR CG2  C -14.252 -11.223   2.398 1.00 . A A . 151 THR CG2  1 1 
        1  1115 1 1  73 THR H    H -12.689  -8.617   2.150 1.00 . A A . 151 THR H    1 1 
        1  1116 1 1  73 THR HA   H -15.640  -8.641   2.095 1.00 . A A . 151 THR HA   1 1 
        1  1117 1 1  73 THR HB   H -15.716 -10.375   3.659 1.00 . A A . 151 THR HB   1 1 
        1  1118 1 1  73 THR HG1  H -13.027  -9.724   4.236 1.00 . A A . 151 THR HG1  1 1 
        1  1119 1 1  73 THR HG21 H -14.040 -12.114   2.970 1.00 . A A . 151 THR HG21 1 1 
        1  1120 1 1  73 THR HG22 H -13.357 -10.903   1.886 1.00 . A A . 151 THR HG22 1 1 
        1  1121 1 1  73 THR HG23 H -15.026 -11.434   1.676 1.00 . A A . 151 THR HG23 1 1 
        1  1122 1 1  73 THR N    N -13.599  -8.572   1.785 1.00 . A A . 151 THR N    1 1 
        1  1123 1 1  73 THR O    O -13.750  -6.960   3.948 1.00 . A A . 151 THR O    1 1 
        1  1124 1 1  73 THR OG1  O -13.863 -10.139   4.461 1.00 . A A . 151 THR OG1  1 1 
        1  1125 1 1  74 LYS C    C -14.749  -6.629   6.472 1.00 . A A . 152 LYS C    1 1 
        1  1126 1 1  74 LYS CA   C -15.972  -6.584   5.562 1.00 . A A . 152 LYS CA   1 1 
        1  1127 1 1  74 LYS CB   C -17.242  -6.844   6.376 1.00 . A A . 152 LYS CB   1 1 
        1  1128 1 1  74 LYS CD   C -19.167  -5.888   7.678 1.00 . A A . 152 LYS CD   1 1 
        1  1129 1 1  74 LYS CE   C -20.169  -4.745   7.641 1.00 . A A . 152 LYS CE   1 1 
        1  1130 1 1  74 LYS CG   C -17.933  -5.575   6.848 1.00 . A A . 152 LYS CG   1 1 
        1  1131 1 1  74 LYS H    H -16.604  -8.161   4.299 1.00 . A A . 152 LYS H    1 1 
        1  1132 1 1  74 LYS HA   H -16.037  -5.605   5.111 1.00 . A A . 152 LYS HA   1 1 
        1  1133 1 1  74 LYS HB2  H -17.938  -7.402   5.768 1.00 . A A . 152 LYS HB2  1 1 
        1  1134 1 1  74 LYS HB3  H -16.984  -7.432   7.245 1.00 . A A . 152 LYS HB3  1 1 
        1  1135 1 1  74 LYS HD2  H -19.637  -6.778   7.285 1.00 . A A . 152 LYS HD2  1 1 
        1  1136 1 1  74 LYS HD3  H -18.867  -6.059   8.702 1.00 . A A . 152 LYS HD3  1 1 
        1  1137 1 1  74 LYS HE2  H -19.982  -4.092   8.480 1.00 . A A . 152 LYS HE2  1 1 
        1  1138 1 1  74 LYS HE3  H -20.035  -4.196   6.721 1.00 . A A . 152 LYS HE3  1 1 
        1  1139 1 1  74 LYS HG2  H -17.243  -5.003   7.450 1.00 . A A . 152 LYS HG2  1 1 
        1  1140 1 1  74 LYS HG3  H -18.227  -4.995   5.986 1.00 . A A . 152 LYS HG3  1 1 
        1  1141 1 1  74 LYS HZ1  H -22.234  -4.431   7.692 1.00 . A A . 152 LYS HZ1  1 1 
        1  1142 1 1  74 LYS HZ2  H -21.723  -5.767   8.593 1.00 . A A . 152 LYS HZ2  1 1 
        1  1143 1 1  74 LYS HZ3  H -21.777  -5.858   6.905 1.00 . A A . 152 LYS HZ3  1 1 
        1  1144 1 1  74 LYS N    N -15.850  -7.565   4.489 1.00 . A A . 152 LYS N    1 1 
        1  1145 1 1  74 LYS NZ   N -21.574  -5.235   7.713 1.00 . A A . 152 LYS NZ   1 1 
        1  1146 1 1  74 LYS O    O -14.299  -5.600   6.975 1.00 . A A . 152 LYS O    1 1 
        1  1147 1 1  75 GLU C    C -11.843  -7.266   6.943 1.00 . A A . 153 GLU C    1 1 
        1  1148 1 1  75 GLU CA   C -13.043  -8.007   7.524 1.00 . A A . 153 GLU CA   1 1 
        1  1149 1 1  75 GLU CB   C -12.716  -9.493   7.681 1.00 . A A . 153 GLU CB   1 1 
        1  1150 1 1  75 GLU CD   C -14.841 -10.181   8.860 1.00 . A A . 153 GLU CD   1 1 
        1  1151 1 1  75 GLU CG   C -13.328 -10.123   8.922 1.00 . A A . 153 GLU CG   1 1 
        1  1152 1 1  75 GLU H    H -14.623  -8.615   6.251 1.00 . A A . 153 GLU H    1 1 
        1  1153 1 1  75 GLU HA   H -13.270  -7.591   8.495 1.00 . A A . 153 GLU HA   1 1 
        1  1154 1 1  75 GLU HB2  H -13.085 -10.024   6.816 1.00 . A A . 153 GLU HB2  1 1 
        1  1155 1 1  75 GLU HB3  H -11.644  -9.612   7.735 1.00 . A A . 153 GLU HB3  1 1 
        1  1156 1 1  75 GLU HG2  H -12.948 -11.128   9.025 1.00 . A A . 153 GLU HG2  1 1 
        1  1157 1 1  75 GLU HG3  H -13.039  -9.540   9.785 1.00 . A A . 153 GLU HG3  1 1 
        1  1158 1 1  75 GLU N    N -14.216  -7.830   6.677 1.00 . A A . 153 GLU N    1 1 
        1  1159 1 1  75 GLU O    O -11.269  -6.390   7.591 1.00 . A A . 153 GLU O    1 1 
        1  1160 1 1  75 GLU OE1  O -15.477  -9.106   8.854 1.00 . A A . 153 GLU OE1  1 1 
        1  1161 1 1  75 GLU OE2  O -15.391 -11.302   8.818 1.00 . A A . 153 GLU OE2  1 1 
        1  1162 1 1  76 LEU C    C -10.587  -5.480   4.912 1.00 . A A . 154 LEU C    1 1 
        1  1163 1 1  76 LEU CA   C -10.346  -6.981   5.046 1.00 . A A . 154 LEU CA   1 1 
        1  1164 1 1  76 LEU CB   C -10.128  -7.610   3.667 1.00 . A A . 154 LEU CB   1 1 
        1  1165 1 1  76 LEU CD1  C  -7.708  -6.960   3.506 1.00 . A A . 154 LEU CD1  1 1 
        1  1166 1 1  76 LEU CD2  C  -8.966  -7.623   1.446 1.00 . A A . 154 LEU CD2  1 1 
        1  1167 1 1  76 LEU CG   C  -9.058  -6.939   2.802 1.00 . A A . 154 LEU CG   1 1 
        1  1168 1 1  76 LEU H    H -11.973  -8.320   5.248 1.00 . A A . 154 LEU H    1 1 
        1  1169 1 1  76 LEU HA   H  -9.466  -7.141   5.651 1.00 . A A . 154 LEU HA   1 1 
        1  1170 1 1  76 LEU HB2  H  -9.850  -8.644   3.807 1.00 . A A . 154 LEU HB2  1 1 
        1  1171 1 1  76 LEU HB3  H -11.064  -7.578   3.129 1.00 . A A . 154 LEU HB3  1 1 
        1  1172 1 1  76 LEU HD11 H  -7.541  -6.011   3.993 1.00 . A A . 154 LEU HD11 1 1 
        1  1173 1 1  76 LEU HD12 H  -6.925  -7.135   2.780 1.00 . A A . 154 LEU HD12 1 1 
        1  1174 1 1  76 LEU HD13 H  -7.698  -7.750   4.242 1.00 . A A . 154 LEU HD13 1 1 
        1  1175 1 1  76 LEU HD21 H  -8.808  -6.879   0.679 1.00 . A A . 154 LEU HD21 1 1 
        1  1176 1 1  76 LEU HD22 H  -9.884  -8.156   1.248 1.00 . A A . 154 LEU HD22 1 1 
        1  1177 1 1  76 LEU HD23 H  -8.139  -8.318   1.449 1.00 . A A . 154 LEU HD23 1 1 
        1  1178 1 1  76 LEU HG   H  -9.335  -5.908   2.639 1.00 . A A . 154 LEU HG   1 1 
        1  1179 1 1  76 LEU N    N -11.473  -7.619   5.716 1.00 . A A . 154 LEU N    1 1 
        1  1180 1 1  76 LEU O    O  -9.692  -4.672   5.155 1.00 . A A . 154 LEU O    1 1 
        1  1181 1 1  77 GLU C    C -11.987  -2.959   5.686 1.00 . A A . 155 GLU C    1 1 
        1  1182 1 1  77 GLU CA   C -12.177  -3.715   4.374 1.00 . A A . 155 GLU CA   1 1 
        1  1183 1 1  77 GLU CB   C -13.630  -3.594   3.910 1.00 . A A . 155 GLU CB   1 1 
        1  1184 1 1  77 GLU CD   C -15.327  -4.056   2.098 1.00 . A A . 155 GLU CD   1 1 
        1  1185 1 1  77 GLU CG   C -13.880  -4.181   2.530 1.00 . A A . 155 GLU CG   1 1 
        1  1186 1 1  77 GLU H    H -12.476  -5.816   4.364 1.00 . A A . 155 GLU H    1 1 
        1  1187 1 1  77 GLU HA   H -11.529  -3.284   3.625 1.00 . A A . 155 GLU HA   1 1 
        1  1188 1 1  77 GLU HB2  H -14.265  -4.107   4.616 1.00 . A A . 155 GLU HB2  1 1 
        1  1189 1 1  77 GLU HB3  H -13.902  -2.549   3.887 1.00 . A A . 155 GLU HB3  1 1 
        1  1190 1 1  77 GLU HG2  H -13.260  -3.662   1.814 1.00 . A A . 155 GLU HG2  1 1 
        1  1191 1 1  77 GLU HG3  H -13.613  -5.227   2.545 1.00 . A A . 155 GLU HG3  1 1 
        1  1192 1 1  77 GLU N    N -11.809  -5.119   4.533 1.00 . A A . 155 GLU N    1 1 
        1  1193 1 1  77 GLU O    O -11.302  -1.938   5.733 1.00 . A A . 155 GLU O    1 1 
        1  1194 1 1  77 GLU OE1  O -16.220  -4.335   2.925 1.00 . A A . 155 GLU OE1  1 1 
        1  1195 1 1  77 GLU OE2  O -15.568  -3.677   0.932 1.00 . A A . 155 GLU OE2  1 1 
        1  1196 1 1  78 GLU C    C -11.049  -2.630   8.460 1.00 . A A . 156 GLU C    1 1 
        1  1197 1 1  78 GLU CA   C -12.506  -2.848   8.065 1.00 . A A . 156 GLU CA   1 1 
        1  1198 1 1  78 GLU CB   C -13.207  -3.714   9.114 1.00 . A A . 156 GLU CB   1 1 
        1  1199 1 1  78 GLU CD   C -15.285  -2.839  10.257 1.00 . A A . 156 GLU CD   1 1 
        1  1200 1 1  78 GLU CG   C -14.723  -3.607   9.076 1.00 . A A . 156 GLU CG   1 1 
        1  1201 1 1  78 GLU H    H -13.138  -4.284   6.640 1.00 . A A . 156 GLU H    1 1 
        1  1202 1 1  78 GLU HA   H -13.000  -1.889   8.015 1.00 . A A . 156 GLU HA   1 1 
        1  1203 1 1  78 GLU HB2  H -12.936  -4.746   8.951 1.00 . A A . 156 GLU HB2  1 1 
        1  1204 1 1  78 GLU HB3  H -12.871  -3.413  10.095 1.00 . A A . 156 GLU HB3  1 1 
        1  1205 1 1  78 GLU HG2  H -15.013  -3.101   8.167 1.00 . A A . 156 GLU HG2  1 1 
        1  1206 1 1  78 GLU HG3  H -15.141  -4.603   9.081 1.00 . A A . 156 GLU HG3  1 1 
        1  1207 1 1  78 GLU N    N -12.602  -3.470   6.748 1.00 . A A . 156 GLU N    1 1 
        1  1208 1 1  78 GLU O    O -10.660  -1.533   8.858 1.00 . A A . 156 GLU O    1 1 
        1  1209 1 1  78 GLU OE1  O -14.925  -1.654  10.419 1.00 . A A . 156 GLU OE1  1 1 
        1  1210 1 1  78 GLU OE2  O -16.084  -3.423  11.019 1.00 . A A . 156 GLU OE2  1 1 
        1  1211 1 1  79 LYS C    C  -8.117  -2.546   7.904 1.00 . A A . 157 LYS C    1 1 
        1  1212 1 1  79 LYS CA   C  -8.839  -3.618   8.717 1.00 . A A . 157 LYS CA   1 1 
        1  1213 1 1  79 LYS CB   C  -8.169  -4.976   8.499 1.00 . A A . 157 LYS CB   1 1 
        1  1214 1 1  79 LYS CD   C  -7.690  -5.892  10.790 1.00 . A A . 157 LYS CD   1 1 
        1  1215 1 1  79 LYS CE   C  -6.608  -6.430  11.713 1.00 . A A . 157 LYS CE   1 1 
        1  1216 1 1  79 LYS CG   C  -7.094  -5.295   9.525 1.00 . A A . 157 LYS CG   1 1 
        1  1217 1 1  79 LYS H    H -10.628  -4.540   8.054 1.00 . A A . 157 LYS H    1 1 
        1  1218 1 1  79 LYS HA   H  -8.775  -3.361   9.764 1.00 . A A . 157 LYS HA   1 1 
        1  1219 1 1  79 LYS HB2  H  -8.922  -5.748   8.546 1.00 . A A . 157 LYS HB2  1 1 
        1  1220 1 1  79 LYS HB3  H  -7.715  -4.987   7.519 1.00 . A A . 157 LYS HB3  1 1 
        1  1221 1 1  79 LYS HD2  H  -8.245  -5.126  11.311 1.00 . A A . 157 LYS HD2  1 1 
        1  1222 1 1  79 LYS HD3  H  -8.354  -6.699  10.517 1.00 . A A . 157 LYS HD3  1 1 
        1  1223 1 1  79 LYS HE2  H  -6.211  -7.340  11.288 1.00 . A A . 157 LYS HE2  1 1 
        1  1224 1 1  79 LYS HE3  H  -5.820  -5.696  11.789 1.00 . A A . 157 LYS HE3  1 1 
        1  1225 1 1  79 LYS HG2  H  -6.401  -6.004   9.097 1.00 . A A . 157 LYS HG2  1 1 
        1  1226 1 1  79 LYS HG3  H  -6.571  -4.385   9.778 1.00 . A A . 157 LYS HG3  1 1 
        1  1227 1 1  79 LYS HZ1  H  -7.332  -7.738  13.172 1.00 . A A . 157 LYS HZ1  1 1 
        1  1228 1 1  79 LYS HZ2  H  -8.012  -6.191  13.242 1.00 . A A . 157 LYS HZ2  1 1 
        1  1229 1 1  79 LYS HZ3  H  -6.433  -6.446  13.794 1.00 . A A . 157 LYS HZ3  1 1 
        1  1230 1 1  79 LYS N    N -10.251  -3.688   8.359 1.00 . A A . 157 LYS N    1 1 
        1  1231 1 1  79 LYS NZ   N  -7.133  -6.722  13.076 1.00 . A A . 157 LYS NZ   1 1 
        1  1232 1 1  79 LYS O    O  -7.167  -1.928   8.384 1.00 . A A . 157 LYS O    1 1 
        1  1233 1 1  80 VAL C    C  -8.199   0.089   6.363 1.00 . A A . 158 VAL C    1 1 
        1  1234 1 1  80 VAL CA   C  -7.966  -1.316   5.812 1.00 . A A . 158 VAL CA   1 1 
        1  1235 1 1  80 VAL CB   C  -8.519  -1.394   4.373 1.00 . A A . 158 VAL CB   1 1 
        1  1236 1 1  80 VAL CG1  C  -7.874  -0.337   3.488 1.00 . A A . 158 VAL CG1  1 1 
        1  1237 1 1  80 VAL CG2  C  -8.306  -2.785   3.792 1.00 . A A . 158 VAL CG2  1 1 
        1  1238 1 1  80 VAL H    H  -9.338  -2.841   6.345 1.00 . A A . 158 VAL H    1 1 
        1  1239 1 1  80 VAL HA   H  -6.904  -1.507   5.777 1.00 . A A . 158 VAL HA   1 1 
        1  1240 1 1  80 VAL HB   H  -9.582  -1.202   4.407 1.00 . A A . 158 VAL HB   1 1 
        1  1241 1 1  80 VAL HG11 H  -8.368  -0.321   2.528 1.00 . A A . 158 VAL HG11 1 1 
        1  1242 1 1  80 VAL HG12 H  -6.829  -0.571   3.351 1.00 . A A . 158 VAL HG12 1 1 
        1  1243 1 1  80 VAL HG13 H  -7.967   0.632   3.956 1.00 . A A . 158 VAL HG13 1 1 
        1  1244 1 1  80 VAL HG21 H  -7.602  -2.731   2.975 1.00 . A A . 158 VAL HG21 1 1 
        1  1245 1 1  80 VAL HG22 H  -9.247  -3.173   3.431 1.00 . A A . 158 VAL HG22 1 1 
        1  1246 1 1  80 VAL HG23 H  -7.918  -3.441   4.558 1.00 . A A . 158 VAL HG23 1 1 
        1  1247 1 1  80 VAL N    N  -8.574  -2.322   6.676 1.00 . A A . 158 VAL N    1 1 
        1  1248 1 1  80 VAL O    O  -7.257   0.863   6.539 1.00 . A A . 158 VAL O    1 1 
        1  1249 1 1  81 MET C    C  -9.304   1.902   8.586 1.00 . A A . 159 MET C    1 1 
        1  1250 1 1  81 MET CA   C  -9.821   1.721   7.162 1.00 . A A . 159 MET CA   1 1 
        1  1251 1 1  81 MET CB   C -11.340   1.904   7.133 1.00 . A A . 159 MET CB   1 1 
        1  1252 1 1  81 MET CE   C -13.875  -0.080   4.709 1.00 . A A . 159 MET CE   1 1 
        1  1253 1 1  81 MET CG   C -11.962   1.617   5.777 1.00 . A A . 159 MET CG   1 1 
        1  1254 1 1  81 MET H    H -10.165  -0.251   6.471 1.00 . A A . 159 MET H    1 1 
        1  1255 1 1  81 MET HA   H  -9.367   2.469   6.530 1.00 . A A . 159 MET HA   1 1 
        1  1256 1 1  81 MET HB2  H -11.785   1.237   7.858 1.00 . A A . 159 MET HB2  1 1 
        1  1257 1 1  81 MET HB3  H -11.573   2.923   7.404 1.00 . A A . 159 MET HB3  1 1 
        1  1258 1 1  81 MET HE1  H -13.464  -0.981   5.141 1.00 . A A . 159 MET HE1  1 1 
        1  1259 1 1  81 MET HE2  H -13.333   0.167   3.808 1.00 . A A . 159 MET HE2  1 1 
        1  1260 1 1  81 MET HE3  H -14.917  -0.237   4.471 1.00 . A A . 159 MET HE3  1 1 
        1  1261 1 1  81 MET HG2  H -11.819   2.478   5.141 1.00 . A A . 159 MET HG2  1 1 
        1  1262 1 1  81 MET HG3  H -11.464   0.763   5.341 1.00 . A A . 159 MET HG3  1 1 
        1  1263 1 1  81 MET N    N  -9.460   0.410   6.633 1.00 . A A . 159 MET N    1 1 
        1  1264 1 1  81 MET O    O  -8.839   2.980   8.956 1.00 . A A . 159 MET O    1 1 
        1  1265 1 1  81 MET SD   S -13.727   1.266   5.882 1.00 . A A . 159 MET SD   1 1 
        1  1266 1 1  82 GLU C    C  -7.451   1.219  10.846 1.00 . A A . 160 GLU C    1 1 
        1  1267 1 1  82 GLU CA   C  -8.937   0.883  10.767 1.00 . A A . 160 GLU CA   1 1 
        1  1268 1 1  82 GLU CB   C  -9.207  -0.459  11.453 1.00 . A A . 160 GLU CB   1 1 
        1  1269 1 1  82 GLU CD   C -10.106  -0.753  13.797 1.00 . A A . 160 GLU CD   1 1 
        1  1270 1 1  82 GLU CG   C -10.436  -0.448  12.349 1.00 . A A . 160 GLU CG   1 1 
        1  1271 1 1  82 GLU H    H  -9.774   0.011   9.030 1.00 . A A . 160 GLU H    1 1 
        1  1272 1 1  82 GLU HA   H  -9.495   1.654  11.276 1.00 . A A . 160 GLU HA   1 1 
        1  1273 1 1  82 GLU HB2  H  -9.348  -1.215  10.695 1.00 . A A . 160 GLU HB2  1 1 
        1  1274 1 1  82 GLU HB3  H  -8.350  -0.722  12.056 1.00 . A A . 160 GLU HB3  1 1 
        1  1275 1 1  82 GLU HG2  H -10.893   0.528  12.299 1.00 . A A . 160 GLU HG2  1 1 
        1  1276 1 1  82 GLU HG3  H -11.133  -1.191  11.989 1.00 . A A . 160 GLU HG3  1 1 
        1  1277 1 1  82 GLU N    N  -9.392   0.841   9.382 1.00 . A A . 160 GLU N    1 1 
        1  1278 1 1  82 GLU O    O  -7.055   2.169  11.521 1.00 . A A . 160 GLU O    1 1 
        1  1279 1 1  82 GLU OE1  O  -9.889  -1.941  14.119 1.00 . A A . 160 GLU OE1  1 1 
        1  1280 1 1  82 GLU OE2  O -10.065   0.195  14.609 1.00 . A A . 160 GLU OE2  1 1 
        1  1281 1 1  83 LEU C    C  -4.846   2.032   9.612 1.00 . A A . 161 LEU C    1 1 
        1  1282 1 1  83 LEU CA   C  -5.191   0.646  10.147 1.00 . A A . 161 LEU CA   1 1 
        1  1283 1 1  83 LEU CB   C  -4.503  -0.423   9.298 1.00 . A A . 161 LEU CB   1 1 
        1  1284 1 1  83 LEU CD1  C  -4.210  -2.890   8.986 1.00 . A A . 161 LEU CD1  1 1 
        1  1285 1 1  83 LEU CD2  C  -2.991  -1.712  10.825 1.00 . A A . 161 LEU CD2  1 1 
        1  1286 1 1  83 LEU CG   C  -4.269  -1.760  10.002 1.00 . A A . 161 LEU CG   1 1 
        1  1287 1 1  83 LEU H    H  -7.009  -0.309   9.636 1.00 . A A . 161 LEU H    1 1 
        1  1288 1 1  83 LEU HA   H  -4.839   0.567  11.164 1.00 . A A . 161 LEU HA   1 1 
        1  1289 1 1  83 LEU HB2  H  -5.111  -0.602   8.425 1.00 . A A . 161 LEU HB2  1 1 
        1  1290 1 1  83 LEU HB3  H  -3.546  -0.039   8.978 1.00 . A A . 161 LEU HB3  1 1 
        1  1291 1 1  83 LEU HD11 H  -3.823  -2.512   8.051 1.00 . A A . 161 LEU HD11 1 1 
        1  1292 1 1  83 LEU HD12 H  -5.202  -3.287   8.832 1.00 . A A . 161 LEU HD12 1 1 
        1  1293 1 1  83 LEU HD13 H  -3.562  -3.672   9.355 1.00 . A A . 161 LEU HD13 1 1 
        1  1294 1 1  83 LEU HD21 H  -2.233  -1.170  10.281 1.00 . A A . 161 LEU HD21 1 1 
        1  1295 1 1  83 LEU HD22 H  -2.648  -2.718  11.016 1.00 . A A . 161 LEU HD22 1 1 
        1  1296 1 1  83 LEU HD23 H  -3.187  -1.215  11.764 1.00 . A A . 161 LEU HD23 1 1 
        1  1297 1 1  83 LEU HG   H  -5.094  -1.957  10.672 1.00 . A A . 161 LEU HG   1 1 
        1  1298 1 1  83 LEU N    N  -6.634   0.433  10.154 1.00 . A A . 161 LEU N    1 1 
        1  1299 1 1  83 LEU O    O  -3.936   2.693  10.114 1.00 . A A . 161 LEU O    1 1 
        1  1300 1 1  84 HIS C    C  -5.431   4.883   9.034 1.00 . A A . 162 HIS C    1 1 
        1  1301 1 1  84 HIS CA   C  -5.348   3.776   7.987 1.00 . A A . 162 HIS CA   1 1 
        1  1302 1 1  84 HIS CB   C  -6.367   4.034   6.876 1.00 . A A . 162 HIS CB   1 1 
        1  1303 1 1  84 HIS CD2  C  -5.616   6.475   6.421 1.00 . A A . 162 HIS CD2  1 1 
        1  1304 1 1  84 HIS CE1  C  -5.869   6.488   4.244 1.00 . A A . 162 HIS CE1  1 1 
        1  1305 1 1  84 HIS CG   C  -6.063   5.250   6.057 1.00 . A A . 162 HIS CG   1 1 
        1  1306 1 1  84 HIS H    H  -6.289   1.894   8.234 1.00 . A A . 162 HIS H    1 1 
        1  1307 1 1  84 HIS HA   H  -4.357   3.775   7.560 1.00 . A A . 162 HIS HA   1 1 
        1  1308 1 1  84 HIS HB2  H  -6.388   3.183   6.211 1.00 . A A . 162 HIS HB2  1 1 
        1  1309 1 1  84 HIS HB3  H  -7.345   4.164   7.317 1.00 . A A . 162 HIS HB3  1 1 
        1  1310 1 1  84 HIS HD1  H  -6.523   4.553   4.122 1.00 . A A . 162 HIS HD1  1 1 
        1  1311 1 1  84 HIS HD2  H  -5.390   6.802   7.426 1.00 . A A . 162 HIS HD2  1 1 
        1  1312 1 1  84 HIS HE1  H  -5.886   6.810   3.213 1.00 . A A . 162 HIS HE1  1 1 
        1  1313 1 1  84 HIS HE2  H  -5.117   8.124   5.220 1.00 . A A . 162 HIS HE2  1 1 
        1  1314 1 1  84 HIS N    N  -5.578   2.467   8.591 1.00 . A A . 162 HIS N    1 1 
        1  1315 1 1  84 HIS ND1  N  -6.213   5.291   4.686 1.00 . A A . 162 HIS ND1  1 1 
        1  1316 1 1  84 HIS NE2  N  -5.504   7.225   5.276 1.00 . A A . 162 HIS NE2  1 1 
        1  1317 1 1  84 HIS O    O  -4.502   5.675   9.189 1.00 . A A . 162 HIS O    1 1 
        1  1318 1 1  85 LYS C    C  -5.926   5.623  12.027 1.00 . A A . 163 LYS C    1 1 
        1  1319 1 1  85 LYS CA   C  -6.755   5.938  10.784 1.00 . A A . 163 LYS CA   1 1 
        1  1320 1 1  85 LYS CB   C  -8.236   6.021  11.157 1.00 . A A . 163 LYS CB   1 1 
        1  1321 1 1  85 LYS CD   C -10.577   6.496  10.378 1.00 . A A . 163 LYS CD   1 1 
        1  1322 1 1  85 LYS CE   C -10.980   7.080  11.724 1.00 . A A . 163 LYS CE   1 1 
        1  1323 1 1  85 LYS CG   C  -9.095   6.697  10.101 1.00 . A A . 163 LYS CG   1 1 
        1  1324 1 1  85 LYS H    H  -7.254   4.270   9.580 1.00 . A A . 163 LYS H    1 1 
        1  1325 1 1  85 LYS HA   H  -6.438   6.890  10.386 1.00 . A A . 163 LYS HA   1 1 
        1  1326 1 1  85 LYS HB2  H  -8.613   5.021  11.311 1.00 . A A . 163 LYS HB2  1 1 
        1  1327 1 1  85 LYS HB3  H  -8.332   6.577  12.078 1.00 . A A . 163 LYS HB3  1 1 
        1  1328 1 1  85 LYS HD2  H -11.148   6.983   9.602 1.00 . A A . 163 LYS HD2  1 1 
        1  1329 1 1  85 LYS HD3  H -10.793   5.438  10.376 1.00 . A A . 163 LYS HD3  1 1 
        1  1330 1 1  85 LYS HE2  H -11.388   6.289  12.337 1.00 . A A . 163 LYS HE2  1 1 
        1  1331 1 1  85 LYS HE3  H -10.102   7.489  12.204 1.00 . A A . 163 LYS HE3  1 1 
        1  1332 1 1  85 LYS HG2  H  -8.880   7.755  10.099 1.00 . A A . 163 LYS HG2  1 1 
        1  1333 1 1  85 LYS HG3  H  -8.858   6.276   9.135 1.00 . A A . 163 LYS HG3  1 1 
        1  1334 1 1  85 LYS HZ1  H -11.964   8.793  12.402 1.00 . A A . 163 LYS HZ1  1 1 
        1  1335 1 1  85 LYS HZ2  H -12.951   7.740  11.520 1.00 . A A . 163 LYS HZ2  1 1 
        1  1336 1 1  85 LYS HZ3  H -11.819   8.707  10.718 1.00 . A A . 163 LYS HZ3  1 1 
        1  1337 1 1  85 LYS N    N  -6.549   4.929   9.750 1.00 . A A . 163 LYS N    1 1 
        1  1338 1 1  85 LYS NZ   N -12.000   8.155  11.581 1.00 . A A . 163 LYS NZ   1 1 
        1  1339 1 1  85 LYS O    O  -5.573   6.520  12.793 1.00 . A A . 163 LYS O    1 1 
        1  1340 1 1  86 SER C    C  -3.437   4.508  13.347 1.00 . A A . 164 SER C    1 1 
        1  1341 1 1  86 SER CA   C  -4.841   3.910  13.375 1.00 . A A . 164 SER CA   1 1 
        1  1342 1 1  86 SER CB   C  -4.755   2.383  13.411 1.00 . A A . 164 SER CB   1 1 
        1  1343 1 1  86 SER H    H  -5.935   3.674  11.579 1.00 . A A . 164 SER H    1 1 
        1  1344 1 1  86 SER HA   H  -5.346   4.252  14.265 1.00 . A A . 164 SER HA   1 1 
        1  1345 1 1  86 SER HB2  H  -5.752   1.968  13.441 1.00 . A A . 164 SER HB2  1 1 
        1  1346 1 1  86 SER HB3  H  -4.246   2.032  12.525 1.00 . A A . 164 SER HB3  1 1 
        1  1347 1 1  86 SER HG   H  -4.451   1.139  14.894 1.00 . A A . 164 SER HG   1 1 
        1  1348 1 1  86 SER N    N  -5.624   4.343  12.223 1.00 . A A . 164 SER N    1 1 
        1  1349 1 1  86 SER O    O  -2.795   4.651  14.387 1.00 . A A . 164 SER O    1 1 
        1  1350 1 1  86 SER OG   O  -4.043   1.938  14.553 1.00 . A A . 164 SER OG   1 1 
        1  1351 1 1  87 TYR C    C  -1.622   6.900  12.411 1.00 . A A . 165 TYR C    1 1 
        1  1352 1 1  87 TYR CA   C  -1.631   5.431  12.002 1.00 . A A . 165 TYR CA   1 1 
        1  1353 1 1  87 TYR CB   C  -1.155   5.291  10.555 1.00 . A A . 165 TYR CB   1 1 
        1  1354 1 1  87 TYR CD1  C  -0.174   2.988  10.885 1.00 . A A . 165 TYR CD1  1 1 
        1  1355 1 1  87 TYR CD2  C  -1.510   3.376   8.949 1.00 . A A . 165 TYR CD2  1 1 
        1  1356 1 1  87 TYR CE1  C   0.023   1.678  10.491 1.00 . A A . 165 TYR CE1  1 1 
        1  1357 1 1  87 TYR CE2  C  -1.318   2.067   8.549 1.00 . A A . 165 TYR CE2  1 1 
        1  1358 1 1  87 TYR CG   C  -0.942   3.858  10.121 1.00 . A A . 165 TYR CG   1 1 
        1  1359 1 1  87 TYR CZ   C  -0.551   1.223   9.323 1.00 . A A . 165 TYR CZ   1 1 
        1  1360 1 1  87 TYR H    H  -3.514   4.715  11.356 1.00 . A A . 165 TYR H    1 1 
        1  1361 1 1  87 TYR HA   H  -0.958   4.886  12.646 1.00 . A A . 165 TYR HA   1 1 
        1  1362 1 1  87 TYR HB2  H  -1.890   5.730   9.897 1.00 . A A . 165 TYR HB2  1 1 
        1  1363 1 1  87 TYR HB3  H  -0.217   5.816  10.440 1.00 . A A . 165 TYR HB3  1 1 
        1  1364 1 1  87 TYR HD1  H   0.274   3.348  11.799 1.00 . A A . 165 TYR HD1  1 1 
        1  1365 1 1  87 TYR HD2  H  -2.109   4.041   8.344 1.00 . A A . 165 TYR HD2  1 1 
        1  1366 1 1  87 TYR HE1  H   0.624   1.017  11.098 1.00 . A A . 165 TYR HE1  1 1 
        1  1367 1 1  87 TYR HE2  H  -1.768   1.711   7.634 1.00 . A A . 165 TYR HE2  1 1 
        1  1368 1 1  87 TYR HH   H  -0.388  -0.657   9.696 1.00 . A A . 165 TYR HH   1 1 
        1  1369 1 1  87 TYR N    N  -2.962   4.853  12.154 1.00 . A A . 165 TYR N    1 1 
        1  1370 1 1  87 TYR O    O  -2.393   7.706  11.891 1.00 . A A . 165 TYR O    1 1 
        1  1371 1 1  87 TYR OH   O  -0.357  -0.081   8.928 1.00 . A A . 165 TYR OH   1 1 
        1  1372 1 1  88 ARG C    C  -0.126   9.535  12.710 1.00 . A A . 166 ARG C    1 1 
        1  1373 1 1  88 ARG CA   C  -0.622   8.613  13.825 1.00 . A A . 166 ARG CA   1 1 
        1  1374 1 1  88 ARG CB   C   0.325   8.667  15.029 1.00 . A A . 166 ARG CB   1 1 
        1  1375 1 1  88 ARG CD   C   0.159   8.081  17.468 1.00 . A A . 166 ARG CD   1 1 
        1  1376 1 1  88 ARG CG   C   0.087   7.559  16.042 1.00 . A A . 166 ARG CG   1 1 
        1  1377 1 1  88 ARG CZ   C  -1.487   6.737  18.717 1.00 . A A . 166 ARG CZ   1 1 
        1  1378 1 1  88 ARG H    H  -0.151   6.553  13.719 1.00 . A A . 166 ARG H    1 1 
        1  1379 1 1  88 ARG HA   H  -1.604   8.940  14.136 1.00 . A A . 166 ARG HA   1 1 
        1  1380 1 1  88 ARG HB2  H   1.342   8.590  14.675 1.00 . A A . 166 ARG HB2  1 1 
        1  1381 1 1  88 ARG HB3  H   0.198   9.616  15.529 1.00 . A A . 166 ARG HB3  1 1 
        1  1382 1 1  88 ARG HD2  H   1.171   8.397  17.672 1.00 . A A . 166 ARG HD2  1 1 
        1  1383 1 1  88 ARG HD3  H  -0.507   8.927  17.562 1.00 . A A . 166 ARG HD3  1 1 
        1  1384 1 1  88 ARG HE   H   0.494   6.601  18.922 1.00 . A A . 166 ARG HE   1 1 
        1  1385 1 1  88 ARG HG2  H  -0.891   7.134  15.874 1.00 . A A . 166 ARG HG2  1 1 
        1  1386 1 1  88 ARG HG3  H   0.840   6.796  15.909 1.00 . A A . 166 ARG HG3  1 1 
        1  1387 1 1  88 ARG HH11 H  -2.297   8.050  17.409 1.00 . A A . 166 ARG HH11 1 1 
        1  1388 1 1  88 ARG HH12 H  -3.432   7.092  18.299 1.00 . A A . 166 ARG HH12 1 1 
        1  1389 1 1  88 ARG HH21 H  -0.998   5.341  20.094 1.00 . A A . 166 ARG HH21 1 1 
        1  1390 1 1  88 ARG HH22 H  -2.696   5.555  19.824 1.00 . A A . 166 ARG HH22 1 1 
        1  1391 1 1  88 ARG N    N  -0.740   7.241  13.345 1.00 . A A . 166 ARG N    1 1 
        1  1392 1 1  88 ARG NE   N  -0.225   7.064  18.444 1.00 . A A . 166 ARG NE   1 1 
        1  1393 1 1  88 ARG NH1  N  -2.487   7.343  18.090 1.00 . A A . 166 ARG NH1  1 1 
        1  1394 1 1  88 ARG NH2  N  -1.748   5.801  19.619 1.00 . A A . 166 ARG NH2  1 1 
        1  1395 1 1  88 ARG O    O  -0.320   9.247  11.529 1.00 . A A . 166 ARG O    1 1 
        1  1396 1 1  89 SER C    C   2.172  10.981  11.306 1.00 . A A . 167 SER C    1 1 
        1  1397 1 1  89 SER CA   C   1.032  11.596  12.112 1.00 . A A . 167 SER CA   1 1 
        1  1398 1 1  89 SER CB   C   1.513  12.866  12.816 1.00 . A A . 167 SER CB   1 1 
        1  1399 1 1  89 SER H    H   0.639  10.822  14.039 1.00 . A A . 167 SER H    1 1 
        1  1400 1 1  89 SER HA   H   0.228  11.851  11.438 1.00 . A A . 167 SER HA   1 1 
        1  1401 1 1  89 SER HB2  H   1.946  12.605  13.770 1.00 . A A . 167 SER HB2  1 1 
        1  1402 1 1  89 SER HB3  H   2.259  13.353  12.204 1.00 . A A . 167 SER HB3  1 1 
        1  1403 1 1  89 SER HG   H  -0.079  13.845  12.230 1.00 . A A . 167 SER HG   1 1 
        1  1404 1 1  89 SER N    N   0.513  10.643  13.086 1.00 . A A . 167 SER N    1 1 
        1  1405 1 1  89 SER O    O   3.339  11.324  11.497 1.00 . A A . 167 SER O    1 1 
        1  1406 1 1  89 SER OG   O   0.441  13.767  13.033 1.00 . A A . 167 SER OG   1 1 
        1  1407 1 1  90 MET C    C   3.059  10.189   8.284 1.00 . A A . 168 MET C    1 1 
        1  1408 1 1  90 MET CA   C   2.811   9.403   9.567 1.00 . A A . 168 MET CA   1 1 
        1  1409 1 1  90 MET CB   C   2.346   7.985   9.227 1.00 . A A . 168 MET CB   1 1 
        1  1410 1 1  90 MET CE   C   2.320   4.675   9.138 1.00 . A A . 168 MET CE   1 1 
        1  1411 1 1  90 MET CG   C   3.403   7.151   8.520 1.00 . A A . 168 MET CG   1 1 
        1  1412 1 1  90 MET H    H   0.875   9.844  10.304 1.00 . A A . 168 MET H    1 1 
        1  1413 1 1  90 MET HA   H   3.734   9.345  10.124 1.00 . A A . 168 MET HA   1 1 
        1  1414 1 1  90 MET HB2  H   2.070   7.481  10.141 1.00 . A A . 168 MET HB2  1 1 
        1  1415 1 1  90 MET HB3  H   1.479   8.048   8.586 1.00 . A A . 168 MET HB3  1 1 
        1  1416 1 1  90 MET HE1  H   1.486   5.159   9.625 1.00 . A A . 168 MET HE1  1 1 
        1  1417 1 1  90 MET HE2  H   2.451   3.685   9.548 1.00 . A A . 168 MET HE2  1 1 
        1  1418 1 1  90 MET HE3  H   2.126   4.604   8.078 1.00 . A A . 168 MET HE3  1 1 
        1  1419 1 1  90 MET HG2  H   3.037   6.887   7.539 1.00 . A A . 168 MET HG2  1 1 
        1  1420 1 1  90 MET HG3  H   4.301   7.743   8.419 1.00 . A A . 168 MET HG3  1 1 
        1  1421 1 1  90 MET N    N   1.823  10.071  10.405 1.00 . A A . 168 MET N    1 1 
        1  1422 1 1  90 MET O    O   2.152  10.825   7.747 1.00 . A A . 168 MET O    1 1 
        1  1423 1 1  90 MET SD   S   3.808   5.635   9.409 1.00 . A A . 168 MET SD   1 1 
        1  1424 1 1  91 THR C    C   4.502   9.940   5.358 1.00 . A A . 169 THR C    1 1 
        1  1425 1 1  91 THR CA   C   4.664  10.846   6.575 1.00 . A A . 169 THR CA   1 1 
        1  1426 1 1  91 THR CB   C   6.107  11.345   6.666 1.00 . A A . 169 THR CB   1 1 
        1  1427 1 1  91 THR CG2  C   6.283  12.495   7.634 1.00 . A A . 169 THR CG2  1 1 
        1  1428 1 1  91 THR H    H   4.975   9.616   8.268 1.00 . A A . 169 THR H    1 1 
        1  1429 1 1  91 THR HA   H   4.004  11.694   6.468 1.00 . A A . 169 THR HA   1 1 
        1  1430 1 1  91 THR HB   H   6.423  11.683   5.689 1.00 . A A . 169 THR HB   1 1 
        1  1431 1 1  91 THR HG1  H   7.856  10.468   6.738 1.00 . A A . 169 THR HG1  1 1 
        1  1432 1 1  91 THR HG21 H   7.111  12.286   8.295 1.00 . A A . 169 THR HG21 1 1 
        1  1433 1 1  91 THR HG22 H   5.381  12.618   8.214 1.00 . A A . 169 THR HG22 1 1 
        1  1434 1 1  91 THR HG23 H   6.483  13.402   7.082 1.00 . A A . 169 THR HG23 1 1 
        1  1435 1 1  91 THR N    N   4.295  10.141   7.796 1.00 . A A . 169 THR N    1 1 
        1  1436 1 1  91 THR O    O   4.514   8.715   5.481 1.00 . A A . 169 THR O    1 1 
        1  1437 1 1  91 THR OG1  O   6.973  10.302   7.076 1.00 . A A . 169 THR OG1  1 1 
        1  1438 1 1  92 PRO C    C   5.306   8.747   2.729 1.00 . A A . 170 PRO C    1 1 
        1  1439 1 1  92 PRO CA   C   4.192   9.771   2.919 1.00 . A A . 170 PRO CA   1 1 
        1  1440 1 1  92 PRO CB   C   4.247  10.841   1.817 1.00 . A A . 170 PRO CB   1 1 
        1  1441 1 1  92 PRO CD   C   4.332  11.980   3.918 1.00 . A A . 170 PRO CD   1 1 
        1  1442 1 1  92 PRO CG   C   4.758  12.076   2.483 1.00 . A A . 170 PRO CG   1 1 
        1  1443 1 1  92 PRO HA   H   3.237   9.267   2.888 1.00 . A A . 170 PRO HA   1 1 
        1  1444 1 1  92 PRO HB2  H   4.913  10.515   1.031 1.00 . A A . 170 PRO HB2  1 1 
        1  1445 1 1  92 PRO HB3  H   3.257  10.993   1.414 1.00 . A A . 170 PRO HB3  1 1 
        1  1446 1 1  92 PRO HD2  H   5.035  12.492   4.558 1.00 . A A . 170 PRO HD2  1 1 
        1  1447 1 1  92 PRO HD3  H   3.337  12.379   4.046 1.00 . A A . 170 PRO HD3  1 1 
        1  1448 1 1  92 PRO HG2  H   5.835  12.112   2.413 1.00 . A A . 170 PRO HG2  1 1 
        1  1449 1 1  92 PRO HG3  H   4.322  12.949   2.020 1.00 . A A . 170 PRO HG3  1 1 
        1  1450 1 1  92 PRO N    N   4.353  10.531   4.161 1.00 . A A . 170 PRO N    1 1 
        1  1451 1 1  92 PRO O    O   5.044   7.564   2.511 1.00 . A A . 170 PRO O    1 1 
        1  1452 1 1  93 ALA C    C   7.604   7.107   3.547 1.00 . A A . 171 ALA C    1 1 
        1  1453 1 1  93 ALA CA   C   7.708   8.336   2.650 1.00 . A A . 171 ALA CA   1 1 
        1  1454 1 1  93 ALA CB   C   8.990   9.101   2.946 1.00 . A A . 171 ALA CB   1 1 
        1  1455 1 1  93 ALA H    H   6.695  10.163   2.985 1.00 . A A . 171 ALA H    1 1 
        1  1456 1 1  93 ALA HA   H   7.740   8.014   1.619 1.00 . A A . 171 ALA HA   1 1 
        1  1457 1 1  93 ALA HB1  H   8.764   9.952   3.571 1.00 . A A . 171 ALA HB1  1 1 
        1  1458 1 1  93 ALA HB2  H   9.428   9.441   2.019 1.00 . A A . 171 ALA HB2  1 1 
        1  1459 1 1  93 ALA HB3  H   9.687   8.453   3.457 1.00 . A A . 171 ALA HB3  1 1 
        1  1460 1 1  93 ALA N    N   6.550   9.210   2.812 1.00 . A A . 171 ALA N    1 1 
        1  1461 1 1  93 ALA O    O   7.971   6.002   3.147 1.00 . A A . 171 ALA O    1 1 
        1  1462 1 1  94 GLN C    C   6.062   5.111   5.121 1.00 . A A . 172 GLN C    1 1 
        1  1463 1 1  94 GLN CA   C   6.941   6.210   5.710 1.00 . A A . 172 GLN CA   1 1 
        1  1464 1 1  94 GLN CB   C   6.338   6.723   7.021 1.00 . A A . 172 GLN CB   1 1 
        1  1465 1 1  94 GLN CD   C   7.891   8.112   8.449 1.00 . A A . 172 GLN CD   1 1 
        1  1466 1 1  94 GLN CG   C   7.322   6.733   8.179 1.00 . A A . 172 GLN CG   1 1 
        1  1467 1 1  94 GLN H    H   6.819   8.208   5.021 1.00 . A A . 172 GLN H    1 1 
        1  1468 1 1  94 GLN HA   H   7.921   5.801   5.910 1.00 . A A . 172 GLN HA   1 1 
        1  1469 1 1  94 GLN HB2  H   5.983   7.731   6.869 1.00 . A A . 172 GLN HB2  1 1 
        1  1470 1 1  94 GLN HB3  H   5.503   6.094   7.292 1.00 . A A . 172 GLN HB3  1 1 
        1  1471 1 1  94 GLN HE21 H   6.341   8.552   9.614 1.00 . A A . 172 GLN HE21 1 1 
        1  1472 1 1  94 GLN HE22 H   7.525   9.797   9.439 1.00 . A A . 172 GLN HE22 1 1 
        1  1473 1 1  94 GLN HG2  H   6.814   6.391   9.069 1.00 . A A . 172 GLN HG2  1 1 
        1  1474 1 1  94 GLN HG3  H   8.136   6.062   7.950 1.00 . A A . 172 GLN HG3  1 1 
        1  1475 1 1  94 GLN N    N   7.097   7.305   4.761 1.00 . A A . 172 GLN N    1 1 
        1  1476 1 1  94 GLN NE2  N   7.180   8.900   9.248 1.00 . A A . 172 GLN NE2  1 1 
        1  1477 1 1  94 GLN O    O   6.381   3.927   5.220 1.00 . A A . 172 GLN O    1 1 
        1  1478 1 1  94 GLN OE1  O   8.957   8.466   7.944 1.00 . A A . 172 GLN OE1  1 1 
        1  1479 1 1  95 ALA C    C   4.696   3.862   2.710 1.00 . A A . 173 ALA C    1 1 
        1  1480 1 1  95 ALA CA   C   4.036   4.569   3.889 1.00 . A A . 173 ALA CA   1 1 
        1  1481 1 1  95 ALA CB   C   2.770   5.283   3.440 1.00 . A A . 173 ALA CB   1 1 
        1  1482 1 1  95 ALA H    H   4.762   6.475   4.452 1.00 . A A . 173 ALA H    1 1 
        1  1483 1 1  95 ALA HA   H   3.766   3.835   4.633 1.00 . A A . 173 ALA HA   1 1 
        1  1484 1 1  95 ALA HB1  H   2.062   5.305   4.256 1.00 . A A . 173 ALA HB1  1 1 
        1  1485 1 1  95 ALA HB2  H   2.338   4.756   2.602 1.00 . A A . 173 ALA HB2  1 1 
        1  1486 1 1  95 ALA HB3  H   3.012   6.294   3.145 1.00 . A A . 173 ALA HB3  1 1 
        1  1487 1 1  95 ALA N    N   4.958   5.516   4.502 1.00 . A A . 173 ALA N    1 1 
        1  1488 1 1  95 ALA O    O   4.611   2.640   2.577 1.00 . A A . 173 ALA O    1 1 
        1  1489 1 1  96 ASP C    C   7.070   3.040   1.121 1.00 . A A . 174 ASP C    1 1 
        1  1490 1 1  96 ASP CA   C   6.048   4.092   0.697 1.00 . A A . 174 ASP CA   1 1 
        1  1491 1 1  96 ASP CB   C   6.745   5.210  -0.080 1.00 . A A . 174 ASP CB   1 1 
        1  1492 1 1  96 ASP CG   C   5.769   6.242  -0.611 1.00 . A A . 174 ASP CG   1 1 
        1  1493 1 1  96 ASP H    H   5.399   5.605   2.026 1.00 . A A . 174 ASP H    1 1 
        1  1494 1 1  96 ASP HA   H   5.309   3.632   0.061 1.00 . A A . 174 ASP HA   1 1 
        1  1495 1 1  96 ASP HB2  H   7.448   5.709   0.571 1.00 . A A . 174 ASP HB2  1 1 
        1  1496 1 1  96 ASP HB3  H   7.278   4.781  -0.916 1.00 . A A . 174 ASP HB3  1 1 
        1  1497 1 1  96 ASP N    N   5.362   4.639   1.861 1.00 . A A . 174 ASP N    1 1 
        1  1498 1 1  96 ASP O    O   7.184   1.977   0.507 1.00 . A A . 174 ASP O    1 1 
        1  1499 1 1  96 ASP OD1  O   4.832   5.853  -1.340 1.00 . A A . 174 ASP OD1  1 1 
        1  1500 1 1  96 ASP OD2  O   5.941   7.439  -0.298 1.00 . A A . 174 ASP OD2  1 1 
        1  1501 1 1  97 LEU C    C   8.161   1.246   3.417 1.00 . A A . 175 LEU C    1 1 
        1  1502 1 1  97 LEU CA   C   8.808   2.441   2.722 1.00 . A A . 175 LEU CA   1 1 
        1  1503 1 1  97 LEU CB   C   9.718   3.184   3.702 1.00 . A A . 175 LEU CB   1 1 
        1  1504 1 1  97 LEU CD1  C  11.917   2.534   2.688 1.00 . A A . 175 LEU CD1  1 1 
        1  1505 1 1  97 LEU CD2  C  11.804   3.230   5.087 1.00 . A A . 175 LEU CD2  1 1 
        1  1506 1 1  97 LEU CG   C  11.075   2.525   3.954 1.00 . A A . 175 LEU CG   1 1 
        1  1507 1 1  97 LEU H    H   7.638   4.203   2.639 1.00 . A A . 175 LEU H    1 1 
        1  1508 1 1  97 LEU HA   H   9.402   2.083   1.895 1.00 . A A . 175 LEU HA   1 1 
        1  1509 1 1  97 LEU HB2  H   9.889   4.179   3.318 1.00 . A A . 175 LEU HB2  1 1 
        1  1510 1 1  97 LEU HB3  H   9.202   3.265   4.647 1.00 . A A . 175 LEU HB3  1 1 
        1  1511 1 1  97 LEU HD11 H  11.772   1.607   2.152 1.00 . A A . 175 LEU HD11 1 1 
        1  1512 1 1  97 LEU HD12 H  12.959   2.639   2.949 1.00 . A A . 175 LEU HD12 1 1 
        1  1513 1 1  97 LEU HD13 H  11.617   3.362   2.062 1.00 . A A . 175 LEU HD13 1 1 
        1  1514 1 1  97 LEU HD21 H  11.560   4.283   5.073 1.00 . A A . 175 LEU HD21 1 1 
        1  1515 1 1  97 LEU HD22 H  12.870   3.106   4.962 1.00 . A A . 175 LEU HD22 1 1 
        1  1516 1 1  97 LEU HD23 H  11.500   2.804   6.032 1.00 . A A . 175 LEU HD23 1 1 
        1  1517 1 1  97 LEU HG   H  10.919   1.496   4.245 1.00 . A A . 175 LEU HG   1 1 
        1  1518 1 1  97 LEU N    N   7.799   3.348   2.188 1.00 . A A . 175 LEU N    1 1 
        1  1519 1 1  97 LEU O    O   8.724   0.154   3.447 1.00 . A A . 175 LEU O    1 1 
        1  1520 1 1  98 GLU C    C   5.910  -0.751   3.790 1.00 . A A . 176 GLU C    1 1 
        1  1521 1 1  98 GLU CA   C   6.262   0.420   4.704 1.00 . A A . 176 GLU CA   1 1 
        1  1522 1 1  98 GLU CB   C   4.989   0.990   5.332 1.00 . A A . 176 GLU CB   1 1 
        1  1523 1 1  98 GLU CD   C   5.392   0.593   7.794 1.00 . A A . 176 GLU CD   1 1 
        1  1524 1 1  98 GLU CG   C   5.215   1.623   6.695 1.00 . A A . 176 GLU CG   1 1 
        1  1525 1 1  98 GLU H    H   6.592   2.367   3.941 1.00 . A A . 176 GLU H    1 1 
        1  1526 1 1  98 GLU HA   H   6.905   0.061   5.492 1.00 . A A . 176 GLU HA   1 1 
        1  1527 1 1  98 GLU HB2  H   4.581   1.742   4.672 1.00 . A A . 176 GLU HB2  1 1 
        1  1528 1 1  98 GLU HB3  H   4.269   0.193   5.444 1.00 . A A . 176 GLU HB3  1 1 
        1  1529 1 1  98 GLU HG2  H   6.104   2.234   6.651 1.00 . A A . 176 GLU HG2  1 1 
        1  1530 1 1  98 GLU HG3  H   4.364   2.243   6.936 1.00 . A A . 176 GLU HG3  1 1 
        1  1531 1 1  98 GLU N    N   6.982   1.470   3.990 1.00 . A A . 176 GLU N    1 1 
        1  1532 1 1  98 GLU O    O   6.217  -1.903   4.101 1.00 . A A . 176 GLU O    1 1 
        1  1533 1 1  98 GLU OE1  O   5.734  -0.564   7.473 1.00 . A A . 176 GLU OE1  1 1 
        1  1534 1 1  98 GLU OE2  O   5.189   0.945   8.975 1.00 . A A . 176 GLU OE2  1 1 
        1  1535 1 1  99 PHE C    C   6.103  -2.062   1.000 1.00 . A A . 177 PHE C    1 1 
        1  1536 1 1  99 PHE CA   C   4.880  -1.504   1.722 1.00 . A A . 177 PHE CA   1 1 
        1  1537 1 1  99 PHE CB   C   3.863  -0.967   0.710 1.00 . A A . 177 PHE CB   1 1 
        1  1538 1 1  99 PHE CD1  C   4.391  -1.953  -1.535 1.00 . A A . 177 PHE CD1  1 1 
        1  1539 1 1  99 PHE CD2  C   2.476  -2.762  -0.366 1.00 . A A . 177 PHE CD2  1 1 
        1  1540 1 1  99 PHE CE1  C   4.126  -2.821  -2.576 1.00 . A A . 177 PHE CE1  1 1 
        1  1541 1 1  99 PHE CE2  C   2.206  -3.632  -1.405 1.00 . A A . 177 PHE CE2  1 1 
        1  1542 1 1  99 PHE CG   C   3.570  -1.914  -0.419 1.00 . A A . 177 PHE CG   1 1 
        1  1543 1 1  99 PHE CZ   C   3.032  -3.661  -2.511 1.00 . A A . 177 PHE CZ   1 1 
        1  1544 1 1  99 PHE H    H   5.050   0.476   2.461 1.00 . A A . 177 PHE H    1 1 
        1  1545 1 1  99 PHE HA   H   4.421  -2.301   2.288 1.00 . A A . 177 PHE HA   1 1 
        1  1546 1 1  99 PHE HB2  H   2.933  -0.763   1.220 1.00 . A A . 177 PHE HB2  1 1 
        1  1547 1 1  99 PHE HB3  H   4.241  -0.052   0.285 1.00 . A A . 177 PHE HB3  1 1 
        1  1548 1 1  99 PHE HD1  H   5.246  -1.296  -1.586 1.00 . A A . 177 PHE HD1  1 1 
        1  1549 1 1  99 PHE HD2  H   1.829  -2.739   0.499 1.00 . A A . 177 PHE HD2  1 1 
        1  1550 1 1  99 PHE HE1  H   4.774  -2.842  -3.440 1.00 . A A . 177 PHE HE1  1 1 
        1  1551 1 1  99 PHE HE2  H   1.350  -4.289  -1.352 1.00 . A A . 177 PHE HE2  1 1 
        1  1552 1 1  99 PHE HZ   H   2.824  -4.340  -3.324 1.00 . A A . 177 PHE HZ   1 1 
        1  1553 1 1  99 PHE N    N   5.266  -0.459   2.665 1.00 . A A . 177 PHE N    1 1 
        1  1554 1 1  99 PHE O    O   6.243  -3.275   0.851 1.00 . A A . 177 PHE O    1 1 
        1  1555 1 1 100 LEU C    C   9.057  -2.479   0.755 1.00 . A A . 178 LEU C    1 1 
        1  1556 1 1 100 LEU CA   C   8.195  -1.598  -0.145 1.00 . A A . 178 LEU CA   1 1 
        1  1557 1 1 100 LEU CB   C   8.992  -0.381  -0.615 1.00 . A A . 178 LEU CB   1 1 
        1  1558 1 1 100 LEU CD1  C   9.278   1.519  -2.226 1.00 . A A . 178 LEU CD1  1 1 
        1  1559 1 1 100 LEU CD2  C   8.003  -0.520  -2.916 1.00 . A A . 178 LEU CD2  1 1 
        1  1560 1 1 100 LEU CG   C   8.351   0.407  -1.760 1.00 . A A . 178 LEU CG   1 1 
        1  1561 1 1 100 LEU H    H   6.828  -0.217   0.703 1.00 . A A . 178 LEU H    1 1 
        1  1562 1 1 100 LEU HA   H   7.892  -2.174  -1.007 1.00 . A A . 178 LEU HA   1 1 
        1  1563 1 1 100 LEU HB2  H   9.121   0.286   0.226 1.00 . A A . 178 LEU HB2  1 1 
        1  1564 1 1 100 LEU HB3  H   9.965  -0.717  -0.939 1.00 . A A . 178 LEU HB3  1 1 
        1  1565 1 1 100 LEU HD11 H   9.853   1.177  -3.074 1.00 . A A . 178 LEU HD11 1 1 
        1  1566 1 1 100 LEU HD12 H   9.947   1.790  -1.423 1.00 . A A . 178 LEU HD12 1 1 
        1  1567 1 1 100 LEU HD13 H   8.691   2.379  -2.513 1.00 . A A . 178 LEU HD13 1 1 
        1  1568 1 1 100 LEU HD21 H   8.811  -1.219  -3.074 1.00 . A A . 178 LEU HD21 1 1 
        1  1569 1 1 100 LEU HD22 H   7.850   0.063  -3.812 1.00 . A A . 178 LEU HD22 1 1 
        1  1570 1 1 100 LEU HD23 H   7.098  -1.063  -2.682 1.00 . A A . 178 LEU HD23 1 1 
        1  1571 1 1 100 LEU HG   H   7.437   0.861  -1.408 1.00 . A A . 178 LEU HG   1 1 
        1  1572 1 1 100 LEU N    N   6.988  -1.175   0.556 1.00 . A A . 178 LEU N    1 1 
        1  1573 1 1 100 LEU O    O   9.584  -3.502   0.320 1.00 . A A . 178 LEU O    1 1 
        1  1574 1 1 101 GLU C    C   9.308  -4.159   3.306 1.00 . A A . 179 GLU C    1 1 
        1  1575 1 1 101 GLU CA   C   9.972  -2.825   2.987 1.00 . A A . 179 GLU CA   1 1 
        1  1576 1 1 101 GLU CB   C  10.151  -2.010   4.268 1.00 . A A . 179 GLU CB   1 1 
        1  1577 1 1 101 GLU CD   C  12.450  -2.292   5.272 1.00 . A A . 179 GLU CD   1 1 
        1  1578 1 1 101 GLU CG   C  10.994  -2.711   5.318 1.00 . A A . 179 GLU CG   1 1 
        1  1579 1 1 101 GLU H    H   8.736  -1.255   2.302 1.00 . A A . 179 GLU H    1 1 
        1  1580 1 1 101 GLU HA   H  10.940  -3.015   2.553 1.00 . A A . 179 GLU HA   1 1 
        1  1581 1 1 101 GLU HB2  H  10.627  -1.073   4.021 1.00 . A A . 179 GLU HB2  1 1 
        1  1582 1 1 101 GLU HB3  H   9.179  -1.810   4.692 1.00 . A A . 179 GLU HB3  1 1 
        1  1583 1 1 101 GLU HG2  H  10.598  -2.475   6.294 1.00 . A A . 179 GLU HG2  1 1 
        1  1584 1 1 101 GLU HG3  H  10.935  -3.776   5.154 1.00 . A A . 179 GLU HG3  1 1 
        1  1585 1 1 101 GLU N    N   9.186  -2.076   2.015 1.00 . A A . 179 GLU N    1 1 
        1  1586 1 1 101 GLU O    O   9.982  -5.153   3.577 1.00 . A A . 179 GLU O    1 1 
        1  1587 1 1 101 GLU OE1  O  13.110  -2.551   4.244 1.00 . A A . 179 GLU OE1  1 1 
        1  1588 1 1 101 GLU OE2  O  12.930  -1.704   6.264 1.00 . A A . 179 GLU OE2  1 1 
        1  1589 1 1 102 ASN C    C   7.364  -6.368   2.374 1.00 . A A . 180 ASN C    1 1 
        1  1590 1 1 102 ASN CA   C   7.224  -5.386   3.534 1.00 . A A . 180 ASN CA   1 1 
        1  1591 1 1 102 ASN CB   C   5.752  -5.041   3.763 1.00 . A A . 180 ASN CB   1 1 
        1  1592 1 1 102 ASN CG   C   5.353  -5.153   5.222 1.00 . A A . 180 ASN CG   1 1 
        1  1593 1 1 102 ASN H    H   7.510  -3.348   3.019 1.00 . A A . 180 ASN H    1 1 
        1  1594 1 1 102 ASN HA   H   7.627  -5.838   4.428 1.00 . A A . 180 ASN HA   1 1 
        1  1595 1 1 102 ASN HB2  H   5.576  -4.027   3.438 1.00 . A A . 180 ASN HB2  1 1 
        1  1596 1 1 102 ASN HB3  H   5.134  -5.713   3.186 1.00 . A A . 180 ASN HB3  1 1 
        1  1597 1 1 102 ASN HD21 H   6.334  -3.476   5.646 1.00 . A A . 180 ASN HD21 1 1 
        1  1598 1 1 102 ASN HD22 H   5.543  -4.240   6.978 1.00 . A A . 180 ASN HD22 1 1 
        1  1599 1 1 102 ASN N    N   7.982  -4.172   3.261 1.00 . A A . 180 ASN N    1 1 
        1  1600 1 1 102 ASN ND2  N   5.787  -4.193   6.030 1.00 . A A . 180 ASN ND2  1 1 
        1  1601 1 1 102 ASN O    O   7.670  -7.544   2.573 1.00 . A A . 180 ASN O    1 1 
        1  1602 1 1 102 ASN OD1  O   4.661  -6.091   5.618 1.00 . A A . 180 ASN OD1  1 1 
        1  1603 1 1 103 ALA C    C   8.662  -7.234  -0.204 1.00 . A A . 181 ALA C    1 1 
        1  1604 1 1 103 ALA CA   C   7.247  -6.691  -0.038 1.00 . A A . 181 ALA CA   1 1 
        1  1605 1 1 103 ALA CB   C   6.840  -5.888  -1.264 1.00 . A A . 181 ALA CB   1 1 
        1  1606 1 1 103 ALA H    H   6.898  -4.925   1.078 1.00 . A A . 181 ALA H    1 1 
        1  1607 1 1 103 ALA HA   H   6.563  -7.520   0.065 1.00 . A A . 181 ALA HA   1 1 
        1  1608 1 1 103 ALA HB1  H   6.442  -6.554  -2.015 1.00 . A A . 181 ALA HB1  1 1 
        1  1609 1 1 103 ALA HB2  H   7.704  -5.374  -1.661 1.00 . A A . 181 ALA HB2  1 1 
        1  1610 1 1 103 ALA HB3  H   6.087  -5.165  -0.988 1.00 . A A . 181 ALA HB3  1 1 
        1  1611 1 1 103 ALA N    N   7.143  -5.869   1.162 1.00 . A A . 181 ALA N    1 1 
        1  1612 1 1 103 ALA O    O   8.856  -8.375  -0.624 1.00 . A A . 181 ALA O    1 1 
        1  1613 1 1 104 LYS C    C  11.405  -7.826   1.100 1.00 . A A . 182 LYS C    1 1 
        1  1614 1 1 104 LYS CA   C  11.048  -6.803   0.026 1.00 . A A . 182 LYS CA   1 1 
        1  1615 1 1 104 LYS CB   C  11.957  -5.578   0.145 1.00 . A A . 182 LYS CB   1 1 
        1  1616 1 1 104 LYS CD   C  12.841  -3.610  -1.144 1.00 . A A . 182 LYS CD   1 1 
        1  1617 1 1 104 LYS CE   C  13.940  -3.325  -0.133 1.00 . A A . 182 LYS CE   1 1 
        1  1618 1 1 104 LYS CG   C  12.495  -5.090  -1.190 1.00 . A A . 182 LYS CG   1 1 
        1  1619 1 1 104 LYS H    H   9.426  -5.514   0.466 1.00 . A A . 182 LYS H    1 1 
        1  1620 1 1 104 LYS HA   H  11.191  -7.254  -0.945 1.00 . A A . 182 LYS HA   1 1 
        1  1621 1 1 104 LYS HB2  H  11.400  -4.773   0.600 1.00 . A A . 182 LYS HB2  1 1 
        1  1622 1 1 104 LYS HB3  H  12.797  -5.825   0.778 1.00 . A A . 182 LYS HB3  1 1 
        1  1623 1 1 104 LYS HD2  H  13.176  -3.298  -2.122 1.00 . A A . 182 LYS HD2  1 1 
        1  1624 1 1 104 LYS HD3  H  11.957  -3.053  -0.870 1.00 . A A . 182 LYS HD3  1 1 
        1  1625 1 1 104 LYS HE2  H  14.471  -4.243   0.071 1.00 . A A . 182 LYS HE2  1 1 
        1  1626 1 1 104 LYS HE3  H  14.621  -2.602  -0.556 1.00 . A A . 182 LYS HE3  1 1 
        1  1627 1 1 104 LYS HG2  H  13.386  -5.649  -1.435 1.00 . A A . 182 LYS HG2  1 1 
        1  1628 1 1 104 LYS HG3  H  11.745  -5.252  -1.950 1.00 . A A . 182 LYS HG3  1 1 
        1  1629 1 1 104 LYS HZ1  H  13.092  -1.801   1.017 1.00 . A A . 182 LYS HZ1  1 1 
        1  1630 1 1 104 LYS HZ2  H  14.121  -2.823   1.886 1.00 . A A . 182 LYS HZ2  1 1 
        1  1631 1 1 104 LYS HZ3  H  12.576  -3.354   1.449 1.00 . A A . 182 LYS HZ3  1 1 
        1  1632 1 1 104 LYS N    N   9.648  -6.408   0.133 1.00 . A A . 182 LYS N    1 1 
        1  1633 1 1 104 LYS NZ   N  13.394  -2.788   1.144 1.00 . A A . 182 LYS NZ   1 1 
        1  1634 1 1 104 LYS O    O  12.242  -8.702   0.884 1.00 . A A . 182 LYS O    1 1 
        1  1635 1 1 105 LYS C    C  10.359  -9.983   3.109 1.00 . A A . 183 LYS C    1 1 
        1  1636 1 1 105 LYS CA   C  11.008  -8.625   3.365 1.00 . A A . 183 LYS CA   1 1 
        1  1637 1 1 105 LYS CB   C  10.475  -8.032   4.671 1.00 . A A . 183 LYS CB   1 1 
        1  1638 1 1 105 LYS CD   C  10.935  -6.643   6.713 1.00 . A A . 183 LYS CD   1 1 
        1  1639 1 1 105 LYS CE   C   9.725  -5.732   6.583 1.00 . A A . 183 LYS CE   1 1 
        1  1640 1 1 105 LYS CG   C  11.449  -7.085   5.353 1.00 . A A . 183 LYS CG   1 1 
        1  1641 1 1 105 LYS H    H  10.103  -6.992   2.369 1.00 . A A . 183 LYS H    1 1 
        1  1642 1 1 105 LYS HA   H  12.076  -8.760   3.452 1.00 . A A . 183 LYS HA   1 1 
        1  1643 1 1 105 LYS HB2  H   9.566  -7.489   4.462 1.00 . A A . 183 LYS HB2  1 1 
        1  1644 1 1 105 LYS HB3  H  10.253  -8.839   5.355 1.00 . A A . 183 LYS HB3  1 1 
        1  1645 1 1 105 LYS HD2  H  10.655  -7.516   7.283 1.00 . A A . 183 LYS HD2  1 1 
        1  1646 1 1 105 LYS HD3  H  11.722  -6.111   7.229 1.00 . A A . 183 LYS HD3  1 1 
        1  1647 1 1 105 LYS HE2  H  10.051  -4.707   6.678 1.00 . A A . 183 LYS HE2  1 1 
        1  1648 1 1 105 LYS HE3  H   9.282  -5.879   5.610 1.00 . A A . 183 LYS HE3  1 1 
        1  1649 1 1 105 LYS HG2  H  12.395  -7.589   5.483 1.00 . A A . 183 LYS HG2  1 1 
        1  1650 1 1 105 LYS HG3  H  11.586  -6.215   4.728 1.00 . A A . 183 LYS HG3  1 1 
        1  1651 1 1 105 LYS HZ1  H   8.840  -6.968   8.016 1.00 . A A . 183 LYS HZ1  1 1 
        1  1652 1 1 105 LYS HZ2  H   7.748  -5.949   7.222 1.00 . A A . 183 LYS HZ2  1 1 
        1  1653 1 1 105 LYS HZ3  H   8.784  -5.322   8.403 1.00 . A A . 183 LYS HZ3  1 1 
        1  1654 1 1 105 LYS N    N  10.761  -7.709   2.257 1.00 . A A . 183 LYS N    1 1 
        1  1655 1 1 105 LYS NZ   N   8.703  -6.012   7.629 1.00 . A A . 183 LYS NZ   1 1 
        1  1656 1 1 105 LYS O    O  10.756 -10.990   3.695 1.00 . A A . 183 LYS O    1 1 
        1  1657 1 1 106 LEU C    C   9.235 -11.882   0.634 1.00 . A A . 184 LEU C    1 1 
        1  1658 1 1 106 LEU CA   C   8.662 -11.240   1.897 1.00 . A A . 184 LEU CA   1 1 
        1  1659 1 1 106 LEU CB   C   7.166 -10.969   1.711 1.00 . A A . 184 LEU CB   1 1 
        1  1660 1 1 106 LEU CD1  C   5.025 -10.992   3.016 1.00 . A A . 184 LEU CD1  1 1 
        1  1661 1 1 106 LEU CD2  C   7.193 -10.721   4.224 1.00 . A A . 184 LEU CD2  1 1 
        1  1662 1 1 106 LEU CG   C   6.430 -10.417   2.941 1.00 . A A . 184 LEU CG   1 1 
        1  1663 1 1 106 LEU H    H   9.091  -9.171   1.792 1.00 . A A . 184 LEU H    1 1 
        1  1664 1 1 106 LEU HA   H   8.790 -11.924   2.723 1.00 . A A . 184 LEU HA   1 1 
        1  1665 1 1 106 LEU HB2  H   7.051 -10.260   0.904 1.00 . A A . 184 LEU HB2  1 1 
        1  1666 1 1 106 LEU HB3  H   6.690 -11.894   1.422 1.00 . A A . 184 LEU HB3  1 1 
        1  1667 1 1 106 LEU HD11 H   4.439 -10.618   2.190 1.00 . A A . 184 LEU HD11 1 1 
        1  1668 1 1 106 LEU HD12 H   4.565 -10.698   3.947 1.00 . A A . 184 LEU HD12 1 1 
        1  1669 1 1 106 LEU HD13 H   5.076 -12.070   2.963 1.00 . A A . 184 LEU HD13 1 1 
        1  1670 1 1 106 LEU HD21 H   7.393 -11.781   4.282 1.00 . A A . 184 LEU HD21 1 1 
        1  1671 1 1 106 LEU HD22 H   6.600 -10.420   5.075 1.00 . A A . 184 LEU HD22 1 1 
        1  1672 1 1 106 LEU HD23 H   8.126 -10.178   4.225 1.00 . A A . 184 LEU HD23 1 1 
        1  1673 1 1 106 LEU HG   H   6.344  -9.344   2.848 1.00 . A A . 184 LEU HG   1 1 
        1  1674 1 1 106 LEU N    N   9.362 -10.004   2.229 1.00 . A A . 184 LEU N    1 1 
        1  1675 1 1 106 LEU O    O   8.942 -13.038   0.330 1.00 . A A . 184 LEU O    1 1 
        1  1676 1 1 107 SER C    C   9.603 -11.871  -2.398 1.00 . A A . 185 SER C    1 1 
        1  1677 1 1 107 SER CA   C  10.661 -11.628  -1.327 1.00 . A A . 185 SER CA   1 1 
        1  1678 1 1 107 SER CB   C  11.436 -12.919  -1.053 1.00 . A A . 185 SER CB   1 1 
        1  1679 1 1 107 SER H    H  10.250 -10.213   0.191 1.00 . A A . 185 SER H    1 1 
        1  1680 1 1 107 SER HA   H  11.349 -10.876  -1.684 1.00 . A A . 185 SER HA   1 1 
        1  1681 1 1 107 SER HB2  H  10.740 -13.714  -0.831 1.00 . A A . 185 SER HB2  1 1 
        1  1682 1 1 107 SER HB3  H  12.016 -13.181  -1.926 1.00 . A A . 185 SER HB3  1 1 
        1  1683 1 1 107 SER HG   H  13.194 -13.058  -0.199 1.00 . A A . 185 SER HG   1 1 
        1  1684 1 1 107 SER N    N  10.053 -11.127  -0.099 1.00 . A A . 185 SER N    1 1 
        1  1685 1 1 107 SER O    O   9.612 -12.900  -3.074 1.00 . A A . 185 SER O    1 1 
        1  1686 1 1 107 SER OG   O  12.315 -12.763   0.048 1.00 . A A . 185 SER OG   1 1 
        1  1687 1 1 108 MET C    C   8.183 -10.922  -4.951 1.00 . A A . 186 MET C    1 1 
        1  1688 1 1 108 MET CA   C   7.624 -11.025  -3.535 1.00 . A A . 186 MET CA   1 1 
        1  1689 1 1 108 MET CB   C   6.576  -9.934  -3.308 1.00 . A A . 186 MET CB   1 1 
        1  1690 1 1 108 MET CE   C   3.421 -10.009  -2.338 1.00 . A A . 186 MET CE   1 1 
        1  1691 1 1 108 MET CG   C   6.142  -9.800  -1.857 1.00 . A A . 186 MET CG   1 1 
        1  1692 1 1 108 MET H    H   8.735 -10.119  -1.978 1.00 . A A . 186 MET H    1 1 
        1  1693 1 1 108 MET HA   H   7.157 -11.991  -3.415 1.00 . A A . 186 MET HA   1 1 
        1  1694 1 1 108 MET HB2  H   6.983  -8.987  -3.628 1.00 . A A . 186 MET HB2  1 1 
        1  1695 1 1 108 MET HB3  H   5.703 -10.160  -3.903 1.00 . A A . 186 MET HB3  1 1 
        1  1696 1 1 108 MET HE1  H   3.597 -10.140  -3.396 1.00 . A A . 186 MET HE1  1 1 
        1  1697 1 1 108 MET HE2  H   2.424  -9.623  -2.184 1.00 . A A . 186 MET HE2  1 1 
        1  1698 1 1 108 MET HE3  H   3.521 -10.960  -1.836 1.00 . A A . 186 MET HE3  1 1 
        1  1699 1 1 108 MET HG2  H   5.987 -10.787  -1.449 1.00 . A A . 186 MET HG2  1 1 
        1  1700 1 1 108 MET HG3  H   6.926  -9.303  -1.306 1.00 . A A . 186 MET HG3  1 1 
        1  1701 1 1 108 MET N    N   8.690 -10.917  -2.547 1.00 . A A . 186 MET N    1 1 
        1  1702 1 1 108 MET O    O   7.661 -11.535  -5.881 1.00 . A A . 186 MET O    1 1 
        1  1703 1 1 108 MET SD   S   4.618  -8.854  -1.673 1.00 . A A . 186 MET SD   1 1 
        1  1704 1 1 109 TYR C    C  11.398 -10.023  -6.290 1.00 . A A . 187 TYR C    1 1 
        1  1705 1 1 109 TYR CA   C   9.879  -9.957  -6.407 1.00 . A A . 187 TYR CA   1 1 
        1  1706 1 1 109 TYR CB   C   9.461  -8.616  -7.014 1.00 . A A . 187 TYR CB   1 1 
        1  1707 1 1 109 TYR CD1  C   9.307  -7.195  -4.933 1.00 . A A . 187 TYR CD1  1 1 
        1  1708 1 1 109 TYR CD2  C  10.817  -6.518  -6.649 1.00 . A A . 187 TYR CD2  1 1 
        1  1709 1 1 109 TYR CE1  C   9.677  -6.103  -4.171 1.00 . A A . 187 TYR CE1  1 1 
        1  1710 1 1 109 TYR CE2  C  11.192  -5.424  -5.893 1.00 . A A . 187 TYR CE2  1 1 
        1  1711 1 1 109 TYR CG   C   9.869  -7.421  -6.183 1.00 . A A . 187 TYR CG   1 1 
        1  1712 1 1 109 TYR CZ   C  10.619  -5.221  -4.655 1.00 . A A . 187 TYR CZ   1 1 
        1  1713 1 1 109 TYR H    H   9.618  -9.678  -4.325 1.00 . A A . 187 TYR H    1 1 
        1  1714 1 1 109 TYR HA   H   9.544 -10.754  -7.053 1.00 . A A . 187 TYR HA   1 1 
        1  1715 1 1 109 TYR HB2  H   9.915  -8.513  -7.988 1.00 . A A . 187 TYR HB2  1 1 
        1  1716 1 1 109 TYR HB3  H   8.386  -8.597  -7.120 1.00 . A A . 187 TYR HB3  1 1 
        1  1717 1 1 109 TYR HD1  H   8.569  -7.887  -4.556 1.00 . A A . 187 TYR HD1  1 1 
        1  1718 1 1 109 TYR HD2  H  11.263  -6.679  -7.619 1.00 . A A . 187 TYR HD2  1 1 
        1  1719 1 1 109 TYR HE1  H   9.228  -5.944  -3.202 1.00 . A A . 187 TYR HE1  1 1 
        1  1720 1 1 109 TYR HE2  H  11.930  -4.733  -6.272 1.00 . A A . 187 TYR HE2  1 1 
        1  1721 1 1 109 TYR HH   H  11.935  -3.989  -3.986 1.00 . A A . 187 TYR HH   1 1 
        1  1722 1 1 109 TYR N    N   9.248 -10.141  -5.105 1.00 . A A . 187 TYR N    1 1 
        1  1723 1 1 109 TYR O    O  12.024 -10.730  -7.109 1.00 . A A . 187 TYR O    1 1 
        1  1724 1 1 109 TYR OXT  O  11.950  -9.367  -5.382 1.00 . A A . 187 TYR OXT  1 1 
        1  1725 1 1 109 TYR OH   O  10.990  -4.133  -3.899 1.00 . A A . 187 TYR OH   1 1 
        2  1726 1 1   1 GLY C    C  12.198  23.492  -6.411 1.00 . A A .  79 GLY C    1 1 
        2  1727 1 1   1 GLY CA   C  10.741  23.371  -6.012 1.00 . A A .  79 GLY CA   1 1 
        2  1728 1 1   1 GLY H1   H  10.668  24.217  -4.104 1.00 . A A .  79 GLY H1   1 1 
        2  1729 1 1   1 GLY H2   H   9.283  24.502  -5.033 1.00 . A A .  79 GLY H2   1 1 
        2  1730 1 1   1 GLY H3   H  10.708  25.354  -5.357 1.00 . A A .  79 GLY H3   1 1 
        2  1731 1 1   1 GLY HA2  H  10.585  22.407  -5.550 1.00 . A A .  79 GLY HA2  1 1 
        2  1732 1 1   1 GLY HA3  H  10.129  23.435  -6.900 1.00 . A A .  79 GLY HA3  1 1 
        2  1733 1 1   1 GLY N    N  10.321  24.435  -5.060 1.00 . A A .  79 GLY N    1 1 
        2  1734 1 1   1 GLY O    O  12.568  23.171  -7.541 1.00 . A A .  79 GLY O    1 1 
        2  1735 1 1   2 SER C    C  15.275  23.142  -4.912 1.00 . A A .  80 SER C    1 1 
        2  1736 1 1   2 SER CA   C  14.453  24.122  -5.743 1.00 . A A .  80 SER CA   1 1 
        2  1737 1 1   2 SER CB   C  14.887  25.557  -5.439 1.00 . A A .  80 SER CB   1 1 
        2  1738 1 1   2 SER H    H  12.672  24.197  -4.601 1.00 . A A .  80 SER H    1 1 
        2  1739 1 1   2 SER HA   H  14.624  23.918  -6.790 1.00 . A A .  80 SER HA   1 1 
        2  1740 1 1   2 SER HB2  H  14.217  25.986  -4.709 1.00 . A A .  80 SER HB2  1 1 
        2  1741 1 1   2 SER HB3  H  15.892  25.552  -5.044 1.00 . A A .  80 SER HB3  1 1 
        2  1742 1 1   2 SER HG   H  15.371  25.932  -7.299 1.00 . A A .  80 SER HG   1 1 
        2  1743 1 1   2 SER N    N  13.028  23.958  -5.483 1.00 . A A .  80 SER N    1 1 
        2  1744 1 1   2 SER O    O  16.306  22.643  -5.362 1.00 . A A .  80 SER O    1 1 
        2  1745 1 1   2 SER OG   O  14.859  26.357  -6.608 1.00 . A A .  80 SER OG   1 1 
        2  1746 1 1   3 HIS C    C  15.000  20.524  -2.991 1.00 . A A .  81 HIS C    1 1 
        2  1747 1 1   3 HIS CA   C  15.505  21.952  -2.801 1.00 . A A .  81 HIS CA   1 1 
        2  1748 1 1   3 HIS CB   C  15.317  22.385  -1.345 1.00 . A A .  81 HIS CB   1 1 
        2  1749 1 1   3 HIS CD2  C  12.909  23.316  -1.082 1.00 . A A .  81 HIS CD2  1 1 
        2  1750 1 1   3 HIS CE1  C  12.047  21.655   0.059 1.00 . A A .  81 HIS CE1  1 1 
        2  1751 1 1   3 HIS CG   C  13.886  22.394  -0.904 1.00 . A A .  81 HIS CG   1 1 
        2  1752 1 1   3 HIS H    H  13.985  23.301  -3.392 1.00 . A A .  81 HIS H    1 1 
        2  1753 1 1   3 HIS HA   H  16.557  21.984  -3.043 1.00 . A A .  81 HIS HA   1 1 
        2  1754 1 1   3 HIS HB2  H  15.857  21.706  -0.702 1.00 . A A .  81 HIS HB2  1 1 
        2  1755 1 1   3 HIS HB3  H  15.711  23.383  -1.220 1.00 . A A .  81 HIS HB3  1 1 
        2  1756 1 1   3 HIS HD1  H  13.767  20.548   0.105 1.00 . A A .  81 HIS HD1  1 1 
        2  1757 1 1   3 HIS HD2  H  13.004  24.257  -1.605 1.00 . A A .  81 HIS HD2  1 1 
        2  1758 1 1   3 HIS HE1  H  11.351  21.033   0.604 1.00 . A A .  81 HIS HE1  1 1 
        2  1759 1 1   3 HIS HE2  H  10.888  23.243  -0.516 1.00 . A A .  81 HIS HE2  1 1 
        2  1760 1 1   3 HIS N    N  14.812  22.872  -3.695 1.00 . A A .  81 HIS N    1 1 
        2  1761 1 1   3 HIS ND1  N  13.313  21.367  -0.184 1.00 . A A .  81 HIS ND1  1 1 
        2  1762 1 1   3 HIS NE2  N  11.777  22.832  -0.474 1.00 . A A .  81 HIS NE2  1 1 
        2  1763 1 1   3 HIS O    O  14.621  19.854  -2.030 1.00 . A A .  81 HIS O    1 1 
        2  1764 1 1   4 MET C    C  15.700  17.852  -5.044 1.00 . A A .  82 MET C    1 1 
        2  1765 1 1   4 MET CA   C  14.542  18.717  -4.557 1.00 . A A .  82 MET CA   1 1 
        2  1766 1 1   4 MET CB   C  13.444  18.766  -5.621 1.00 . A A .  82 MET CB   1 1 
        2  1767 1 1   4 MET CE   C  11.249  15.442  -6.519 1.00 . A A .  82 MET CE   1 1 
        2  1768 1 1   4 MET CG   C  12.349  17.733  -5.412 1.00 . A A .  82 MET CG   1 1 
        2  1769 1 1   4 MET H    H  15.314  20.646  -4.963 1.00 . A A .  82 MET H    1 1 
        2  1770 1 1   4 MET HA   H  14.138  18.282  -3.655 1.00 . A A .  82 MET HA   1 1 
        2  1771 1 1   4 MET HB2  H  12.991  19.747  -5.609 1.00 . A A .  82 MET HB2  1 1 
        2  1772 1 1   4 MET HB3  H  13.889  18.597  -6.590 1.00 . A A .  82 MET HB3  1 1 
        2  1773 1 1   4 MET HE1  H  12.144  14.924  -6.205 1.00 . A A .  82 MET HE1  1 1 
        2  1774 1 1   4 MET HE2  H  10.822  14.937  -7.373 1.00 . A A .  82 MET HE2  1 1 
        2  1775 1 1   4 MET HE3  H  10.534  15.448  -5.710 1.00 . A A .  82 MET HE3  1 1 
        2  1776 1 1   4 MET HG2  H  12.761  16.896  -4.868 1.00 . A A .  82 MET HG2  1 1 
        2  1777 1 1   4 MET HG3  H  11.555  18.181  -4.833 1.00 . A A .  82 MET HG3  1 1 
        2  1778 1 1   4 MET N    N  14.999  20.065  -4.239 1.00 . A A .  82 MET N    1 1 
        2  1779 1 1   4 MET O    O  16.370  18.187  -6.021 1.00 . A A .  82 MET O    1 1 
        2  1780 1 1   4 MET SD   S  11.661  17.127  -6.965 1.00 . A A .  82 MET SD   1 1 
        2  1781 1 1   5 ASP C    C  16.762  15.215  -6.102 1.00 . A A .  83 ASP C    1 1 
        2  1782 1 1   5 ASP CA   C  17.006  15.824  -4.721 1.00 . A A .  83 ASP CA   1 1 
        2  1783 1 1   5 ASP CB   C  17.133  14.713  -3.675 1.00 . A A .  83 ASP CB   1 1 
        2  1784 1 1   5 ASP CG   C  18.547  14.578  -3.144 1.00 . A A .  83 ASP CG   1 1 
        2  1785 1 1   5 ASP H    H  15.360  16.524  -3.588 1.00 . A A .  83 ASP H    1 1 
        2  1786 1 1   5 ASP HA   H  17.925  16.390  -4.743 1.00 . A A .  83 ASP HA   1 1 
        2  1787 1 1   5 ASP HB2  H  16.478  14.933  -2.845 1.00 . A A .  83 ASP HB2  1 1 
        2  1788 1 1   5 ASP HB3  H  16.843  13.772  -4.118 1.00 . A A .  83 ASP HB3  1 1 
        2  1789 1 1   5 ASP N    N  15.929  16.737  -4.358 1.00 . A A .  83 ASP N    1 1 
        2  1790 1 1   5 ASP O    O  15.841  14.418  -6.281 1.00 . A A .  83 ASP O    1 1 
        2  1791 1 1   5 ASP OD1  O  19.179  15.619  -2.867 1.00 . A A .  83 ASP OD1  1 1 
        2  1792 1 1   5 ASP OD2  O  19.023  13.431  -3.007 1.00 . A A .  83 ASP OD2  1 1 
        2  1793 1 1   6 PRO C    C  17.897  13.609  -8.591 1.00 . A A .  84 PRO C    1 1 
        2  1794 1 1   6 PRO CA   C  17.444  15.062  -8.467 1.00 . A A .  84 PRO CA   1 1 
        2  1795 1 1   6 PRO CB   C  18.355  15.976  -9.286 1.00 . A A .  84 PRO CB   1 1 
        2  1796 1 1   6 PRO CD   C  18.712  16.527  -6.986 1.00 . A A .  84 PRO CD   1 1 
        2  1797 1 1   6 PRO CG   C  19.397  16.428  -8.322 1.00 . A A .  84 PRO CG   1 1 
        2  1798 1 1   6 PRO HA   H  16.428  15.152  -8.821 1.00 . A A .  84 PRO HA   1 1 
        2  1799 1 1   6 PRO HB2  H  18.787  15.419 -10.105 1.00 . A A .  84 PRO HB2  1 1 
        2  1800 1 1   6 PRO HB3  H  17.785  16.809  -9.669 1.00 . A A .  84 PRO HB3  1 1 
        2  1801 1 1   6 PRO HD2  H  19.384  16.229  -6.195 1.00 . A A .  84 PRO HD2  1 1 
        2  1802 1 1   6 PRO HD3  H  18.355  17.533  -6.820 1.00 . A A .  84 PRO HD3  1 1 
        2  1803 1 1   6 PRO HG2  H  20.197  15.704  -8.281 1.00 . A A .  84 PRO HG2  1 1 
        2  1804 1 1   6 PRO HG3  H  19.778  17.393  -8.620 1.00 . A A .  84 PRO HG3  1 1 
        2  1805 1 1   6 PRO N    N  17.584  15.581  -7.103 1.00 . A A .  84 PRO N    1 1 
        2  1806 1 1   6 PRO O    O  17.660  12.962  -9.612 1.00 . A A .  84 PRO O    1 1 
        2  1807 1 1   7 ALA C    C  17.904  10.737  -7.289 1.00 . A A .  85 ALA C    1 1 
        2  1808 1 1   7 ALA CA   C  19.036  11.726  -7.551 1.00 . A A .  85 ALA CA   1 1 
        2  1809 1 1   7 ALA CB   C  20.137  11.557  -6.514 1.00 . A A .  85 ALA CB   1 1 
        2  1810 1 1   7 ALA H    H  18.713  13.663  -6.765 1.00 . A A .  85 ALA H    1 1 
        2  1811 1 1   7 ALA HA   H  19.458  11.523  -8.524 1.00 . A A .  85 ALA HA   1 1 
        2  1812 1 1   7 ALA HB1  H  21.101  11.636  -6.997 1.00 . A A .  85 ALA HB1  1 1 
        2  1813 1 1   7 ALA HB2  H  20.048  10.587  -6.047 1.00 . A A .  85 ALA HB2  1 1 
        2  1814 1 1   7 ALA HB3  H  20.046  12.328  -5.764 1.00 . A A .  85 ALA HB3  1 1 
        2  1815 1 1   7 ALA N    N  18.551  13.101  -7.551 1.00 . A A .  85 ALA N    1 1 
        2  1816 1 1   7 ALA O    O  17.973   9.579  -7.702 1.00 . A A .  85 ALA O    1 1 
        2  1817 1 1   8 GLN C    C  14.694  10.343  -7.415 1.00 . A A .  86 GLN C    1 1 
        2  1818 1 1   8 GLN CA   C  15.722  10.345  -6.284 1.00 . A A .  86 GLN CA   1 1 
        2  1819 1 1   8 GLN CB   C  15.062  10.802  -4.982 1.00 . A A .  86 GLN CB   1 1 
        2  1820 1 1   8 GLN CD   C  13.213  12.326  -4.180 1.00 . A A .  86 GLN CD   1 1 
        2  1821 1 1   8 GLN CG   C  14.435  12.184  -5.067 1.00 . A A .  86 GLN CG   1 1 
        2  1822 1 1   8 GLN H    H  16.865  12.128  -6.294 1.00 . A A .  86 GLN H    1 1 
        2  1823 1 1   8 GLN HA   H  16.090   9.338  -6.153 1.00 . A A .  86 GLN HA   1 1 
        2  1824 1 1   8 GLN HB2  H  14.289  10.096  -4.716 1.00 . A A .  86 GLN HB2  1 1 
        2  1825 1 1   8 GLN HB3  H  15.807  10.816  -4.200 1.00 . A A .  86 GLN HB3  1 1 
        2  1826 1 1   8 GLN HE21 H  12.045  12.520  -5.777 1.00 . A A .  86 GLN HE21 1 1 
        2  1827 1 1   8 GLN HE22 H  11.244  12.590  -4.248 1.00 . A A .  86 GLN HE22 1 1 
        2  1828 1 1   8 GLN HG2  H  15.167  12.917  -4.763 1.00 . A A .  86 GLN HG2  1 1 
        2  1829 1 1   8 GLN HG3  H  14.143  12.371  -6.090 1.00 . A A .  86 GLN HG3  1 1 
        2  1830 1 1   8 GLN N    N  16.864  11.197  -6.599 1.00 . A A .  86 GLN N    1 1 
        2  1831 1 1   8 GLN NE2  N  12.050  12.495  -4.798 1.00 . A A .  86 GLN NE2  1 1 
        2  1832 1 1   8 GLN O    O  13.612   9.774  -7.276 1.00 . A A .  86 GLN O    1 1 
        2  1833 1 1   8 GLN OE1  O  13.314  12.282  -2.954 1.00 . A A .  86 GLN OE1  1 1 
        2  1834 1 1   9 LEU C    C  13.810   9.636 -10.189 1.00 . A A .  87 LEU C    1 1 
        2  1835 1 1   9 LEU CA   C  14.130  11.038  -9.679 1.00 . A A .  87 LEU CA   1 1 
        2  1836 1 1   9 LEU CB   C  14.749  11.878 -10.800 1.00 . A A .  87 LEU CB   1 1 
        2  1837 1 1   9 LEU CD1  C  12.742  13.227 -11.461 1.00 . A A .  87 LEU CD1  1 1 
        2  1838 1 1   9 LEU CD2  C  14.235  14.030  -9.621 1.00 . A A .  87 LEU CD2  1 1 
        2  1839 1 1   9 LEU CG   C  14.173  13.287 -10.948 1.00 . A A .  87 LEU CG   1 1 
        2  1840 1 1   9 LEU H    H  15.907  11.414  -8.595 1.00 . A A .  87 LEU H    1 1 
        2  1841 1 1   9 LEU HA   H  13.214  11.508  -9.354 1.00 . A A .  87 LEU HA   1 1 
        2  1842 1 1   9 LEU HB2  H  15.810  11.963 -10.613 1.00 . A A .  87 LEU HB2  1 1 
        2  1843 1 1   9 LEU HB3  H  14.607  11.356 -11.735 1.00 . A A .  87 LEU HB3  1 1 
        2  1844 1 1   9 LEU HD11 H  12.149  12.610 -10.802 1.00 . A A .  87 LEU HD11 1 1 
        2  1845 1 1   9 LEU HD12 H  12.734  12.805 -12.454 1.00 . A A .  87 LEU HD12 1 1 
        2  1846 1 1   9 LEU HD13 H  12.328  14.225 -11.489 1.00 . A A .  87 LEU HD13 1 1 
        2  1847 1 1   9 LEU HD21 H  14.476  15.067  -9.800 1.00 . A A .  87 LEU HD21 1 1 
        2  1848 1 1   9 LEU HD22 H  14.995  13.586  -8.995 1.00 . A A .  87 LEU HD22 1 1 
        2  1849 1 1   9 LEU HD23 H  13.277  13.963  -9.126 1.00 . A A .  87 LEU HD23 1 1 
        2  1850 1 1   9 LEU HG   H  14.762  13.836 -11.667 1.00 . A A .  87 LEU HG   1 1 
        2  1851 1 1   9 LEU N    N  15.033  10.979  -8.535 1.00 . A A .  87 LEU N    1 1 
        2  1852 1 1   9 LEU O    O  12.645   9.266 -10.330 1.00 . A A .  87 LEU O    1 1 
        2  1853 1 1  10 THR C    C  14.025   6.619  -9.895 1.00 . A A .  88 THR C    1 1 
        2  1854 1 1  10 THR CA   C  14.689   7.498 -10.950 1.00 . A A .  88 THR CA   1 1 
        2  1855 1 1  10 THR CB   C  16.042   6.909 -11.349 1.00 . A A .  88 THR CB   1 1 
        2  1856 1 1  10 THR CG2  C  16.379   7.121 -12.810 1.00 . A A .  88 THR CG2  1 1 
        2  1857 1 1  10 THR H    H  15.757   9.215 -10.321 1.00 . A A .  88 THR H    1 1 
        2  1858 1 1  10 THR HA   H  14.051   7.537 -11.821 1.00 . A A .  88 THR HA   1 1 
        2  1859 1 1  10 THR HB   H  16.029   5.844 -11.164 1.00 . A A .  88 THR HB   1 1 
        2  1860 1 1  10 THR HG1  H  17.000   7.202  -9.666 1.00 . A A .  88 THR HG1  1 1 
        2  1861 1 1  10 THR HG21 H  15.845   7.983 -13.181 1.00 . A A .  88 THR HG21 1 1 
        2  1862 1 1  10 THR HG22 H  16.091   6.247 -13.376 1.00 . A A .  88 THR HG22 1 1 
        2  1863 1 1  10 THR HG23 H  17.442   7.283 -12.914 1.00 . A A .  88 THR HG23 1 1 
        2  1864 1 1  10 THR N    N  14.854   8.861 -10.459 1.00 . A A .  88 THR N    1 1 
        2  1865 1 1  10 THR O    O  13.069   5.901 -10.186 1.00 . A A .  88 THR O    1 1 
        2  1866 1 1  10 THR OG1  O  17.085   7.481 -10.581 1.00 . A A .  88 THR OG1  1 1 
        2  1867 1 1  11 GLU C    C  12.485   6.145  -7.424 1.00 . A A .  89 GLU C    1 1 
        2  1868 1 1  11 GLU CA   C  13.983   5.894  -7.570 1.00 . A A .  89 GLU CA   1 1 
        2  1869 1 1  11 GLU CB   C  14.697   6.223  -6.259 1.00 . A A .  89 GLU CB   1 1 
        2  1870 1 1  11 GLU CD   C  16.921   6.191  -5.062 1.00 . A A .  89 GLU CD   1 1 
        2  1871 1 1  11 GLU CG   C  16.208   6.320  -6.394 1.00 . A A .  89 GLU CG   1 1 
        2  1872 1 1  11 GLU H    H  15.295   7.276  -8.495 1.00 . A A .  89 GLU H    1 1 
        2  1873 1 1  11 GLU HA   H  14.139   4.851  -7.802 1.00 . A A .  89 GLU HA   1 1 
        2  1874 1 1  11 GLU HB2  H  14.328   7.167  -5.889 1.00 . A A .  89 GLU HB2  1 1 
        2  1875 1 1  11 GLU HB3  H  14.471   5.450  -5.538 1.00 . A A .  89 GLU HB3  1 1 
        2  1876 1 1  11 GLU HG2  H  16.550   5.530  -7.045 1.00 . A A .  89 GLU HG2  1 1 
        2  1877 1 1  11 GLU HG3  H  16.456   7.277  -6.828 1.00 . A A .  89 GLU HG3  1 1 
        2  1878 1 1  11 GLU N    N  14.534   6.683  -8.667 1.00 . A A .  89 GLU N    1 1 
        2  1879 1 1  11 GLU O    O  11.735   5.265  -7.005 1.00 . A A .  89 GLU O    1 1 
        2  1880 1 1  11 GLU OE1  O  17.122   7.227  -4.394 1.00 . A A .  89 GLU OE1  1 1 
        2  1881 1 1  11 GLU OE2  O  17.278   5.055  -4.687 1.00 . A A .  89 GLU OE2  1 1 
        2  1882 1 1  12 ASP C    C   9.866   6.986  -8.795 1.00 . A A .  90 ASP C    1 1 
        2  1883 1 1  12 ASP CA   C  10.647   7.708  -7.703 1.00 . A A .  90 ASP CA   1 1 
        2  1884 1 1  12 ASP CB   C  10.470   9.221  -7.841 1.00 . A A .  90 ASP CB   1 1 
        2  1885 1 1  12 ASP CG   C   9.417   9.769  -6.898 1.00 . A A .  90 ASP CG   1 1 
        2  1886 1 1  12 ASP H    H  12.708   8.002  -8.115 1.00 . A A .  90 ASP H    1 1 
        2  1887 1 1  12 ASP HA   H  10.276   7.393  -6.739 1.00 . A A .  90 ASP HA   1 1 
        2  1888 1 1  12 ASP HB2  H  11.408   9.709  -7.625 1.00 . A A .  90 ASP HB2  1 1 
        2  1889 1 1  12 ASP HB3  H  10.175   9.452  -8.855 1.00 . A A .  90 ASP HB3  1 1 
        2  1890 1 1  12 ASP N    N  12.057   7.349  -7.782 1.00 . A A .  90 ASP N    1 1 
        2  1891 1 1  12 ASP O    O   8.818   6.392  -8.540 1.00 . A A .  90 ASP O    1 1 
        2  1892 1 1  12 ASP OD1  O   9.437   9.398  -5.706 1.00 . A A .  90 ASP OD1  1 1 
        2  1893 1 1  12 ASP OD2  O   8.572  10.570  -7.351 1.00 . A A .  90 ASP OD2  1 1 
        2  1894 1 1  13 ILE C    C   9.654   4.890 -10.954 1.00 . A A .  91 ILE C    1 1 
        2  1895 1 1  13 ILE CA   C   9.764   6.399 -11.157 1.00 . A A .  91 ILE CA   1 1 
        2  1896 1 1  13 ILE CB   C  10.557   6.676 -12.452 1.00 . A A .  91 ILE CB   1 1 
        2  1897 1 1  13 ILE CD1  C   9.329   8.886 -12.755 1.00 . A A .  91 ILE CD1  1 1 
        2  1898 1 1  13 ILE CG1  C  10.666   8.181 -12.700 1.00 . A A .  91 ILE CG1  1 1 
        2  1899 1 1  13 ILE CG2  C   9.903   5.985 -13.640 1.00 . A A .  91 ILE CG2  1 1 
        2  1900 1 1  13 ILE H    H  11.227   7.540 -10.144 1.00 . A A .  91 ILE H    1 1 
        2  1901 1 1  13 ILE HA   H   8.772   6.812 -11.271 1.00 . A A .  91 ILE HA   1 1 
        2  1902 1 1  13 ILE HB   H  11.550   6.267 -12.332 1.00 . A A .  91 ILE HB   1 1 
        2  1903 1 1  13 ILE HD11 H   8.953   9.021 -11.751 1.00 . A A .  91 ILE HD11 1 1 
        2  1904 1 1  13 ILE HD12 H   8.631   8.290 -13.324 1.00 . A A .  91 ILE HD12 1 1 
        2  1905 1 1  13 ILE HD13 H   9.450   9.850 -13.227 1.00 . A A .  91 ILE HD13 1 1 
        2  1906 1 1  13 ILE HG12 H  11.243   8.629 -11.906 1.00 . A A .  91 ILE HG12 1 1 
        2  1907 1 1  13 ILE HG13 H  11.169   8.348 -13.642 1.00 . A A .  91 ILE HG13 1 1 
        2  1908 1 1  13 ILE HG21 H   9.991   4.914 -13.525 1.00 . A A .  91 ILE HG21 1 1 
        2  1909 1 1  13 ILE HG22 H  10.394   6.292 -14.551 1.00 . A A .  91 ILE HG22 1 1 
        2  1910 1 1  13 ILE HG23 H   8.859   6.257 -13.684 1.00 . A A .  91 ILE HG23 1 1 
        2  1911 1 1  13 ILE N    N  10.393   7.043 -10.012 1.00 . A A .  91 ILE N    1 1 
        2  1912 1 1  13 ILE O    O   8.605   4.294 -11.205 1.00 . A A .  91 ILE O    1 1 
        2  1913 1 1  14 THR C    C   9.763   2.426  -9.204 1.00 . A A .  92 THR C    1 1 
        2  1914 1 1  14 THR CA   C  10.767   2.835 -10.281 1.00 . A A .  92 THR CA   1 1 
        2  1915 1 1  14 THR CB   C  12.180   2.370  -9.903 1.00 . A A .  92 THR CB   1 1 
        2  1916 1 1  14 THR CG2  C  12.607   2.787  -8.515 1.00 . A A .  92 THR CG2  1 1 
        2  1917 1 1  14 THR H    H  11.550   4.804 -10.327 1.00 . A A .  92 THR H    1 1 
        2  1918 1 1  14 THR HA   H  10.484   2.359 -11.208 1.00 . A A .  92 THR HA   1 1 
        2  1919 1 1  14 THR HB   H  12.886   2.793 -10.605 1.00 . A A .  92 THR HB   1 1 
        2  1920 1 1  14 THR HG1  H  11.629   0.563  -9.387 1.00 . A A .  92 THR HG1  1 1 
        2  1921 1 1  14 THR HG21 H  11.966   2.317  -7.784 1.00 . A A .  92 THR HG21 1 1 
        2  1922 1 1  14 THR HG22 H  12.533   3.859  -8.425 1.00 . A A .  92 THR HG22 1 1 
        2  1923 1 1  14 THR HG23 H  13.629   2.481  -8.346 1.00 . A A .  92 THR HG23 1 1 
        2  1924 1 1  14 THR N    N  10.744   4.276 -10.505 1.00 . A A .  92 THR N    1 1 
        2  1925 1 1  14 THR O    O   8.976   1.504  -9.403 1.00 . A A .  92 THR O    1 1 
        2  1926 1 1  14 THR OG1  O  12.277   0.959  -9.974 1.00 . A A .  92 THR OG1  1 1 
        2  1927 1 1  15 ARG C    C   7.450   2.815  -7.379 1.00 . A A .  93 ARG C    1 1 
        2  1928 1 1  15 ARG CA   C   8.914   2.791  -6.947 1.00 . A A .  93 ARG CA   1 1 
        2  1929 1 1  15 ARG CB   C   9.142   3.787  -5.810 1.00 . A A .  93 ARG CB   1 1 
        2  1930 1 1  15 ARG CD   C  10.778   3.542  -3.916 1.00 . A A .  93 ARG CD   1 1 
        2  1931 1 1  15 ARG CG   C   9.423   3.128  -4.469 1.00 . A A .  93 ARG CG   1 1 
        2  1932 1 1  15 ARG CZ   C  10.396   5.513  -2.481 1.00 . A A .  93 ARG CZ   1 1 
        2  1933 1 1  15 ARG H    H  10.471   3.812  -7.945 1.00 . A A .  93 ARG H    1 1 
        2  1934 1 1  15 ARG HA   H   9.156   1.800  -6.597 1.00 . A A .  93 ARG HA   1 1 
        2  1935 1 1  15 ARG HB2  H   9.985   4.411  -6.065 1.00 . A A .  93 ARG HB2  1 1 
        2  1936 1 1  15 ARG HB3  H   8.264   4.407  -5.706 1.00 . A A .  93 ARG HB3  1 1 
        2  1937 1 1  15 ARG HD2  H  10.969   2.987  -3.010 1.00 . A A .  93 ARG HD2  1 1 
        2  1938 1 1  15 ARG HD3  H  11.537   3.308  -4.648 1.00 . A A .  93 ARG HD3  1 1 
        2  1939 1 1  15 ARG HE   H  11.218   5.561  -4.300 1.00 . A A .  93 ARG HE   1 1 
        2  1940 1 1  15 ARG HG2  H   8.656   3.420  -3.768 1.00 . A A .  93 ARG HG2  1 1 
        2  1941 1 1  15 ARG HG3  H   9.409   2.055  -4.596 1.00 . A A .  93 ARG HG3  1 1 
        2  1942 1 1  15 ARG HH11 H   9.795   3.761  -1.667 1.00 . A A .  93 ARG HH11 1 1 
        2  1943 1 1  15 ARG HH12 H   9.543   5.163  -0.683 1.00 . A A .  93 ARG HH12 1 1 
        2  1944 1 1  15 ARG HH21 H  10.884   7.403  -3.005 1.00 . A A .  93 ARG HH21 1 1 
        2  1945 1 1  15 ARG HH22 H  10.158   7.229  -1.441 1.00 . A A .  93 ARG HH22 1 1 
        2  1946 1 1  15 ARG N    N   9.806   3.103  -8.058 1.00 . A A .  93 ARG N    1 1 
        2  1947 1 1  15 ARG NE   N  10.834   4.972  -3.617 1.00 . A A .  93 ARG NE   1 1 
        2  1948 1 1  15 ARG NH1  N   9.868   4.749  -1.533 1.00 . A A .  93 ARG NH1  1 1 
        2  1949 1 1  15 ARG NH2  N  10.487   6.822  -2.294 1.00 . A A .  93 ARG NH2  1 1 
        2  1950 1 1  15 ARG O    O   6.706   1.869  -7.124 1.00 . A A .  93 ARG O    1 1 
        2  1951 1 1  16 TYR C    C   5.256   2.840  -9.358 1.00 . A A .  94 TYR C    1 1 
        2  1952 1 1  16 TYR CA   C   5.661   4.030  -8.492 1.00 . A A .  94 TYR CA   1 1 
        2  1953 1 1  16 TYR CB   C   5.488   5.330  -9.278 1.00 . A A .  94 TYR CB   1 1 
        2  1954 1 1  16 TYR CD1  C   3.068   5.613  -8.615 1.00 . A A .  94 TYR CD1  1 1 
        2  1955 1 1  16 TYR CD2  C   3.666   6.008 -10.889 1.00 . A A .  94 TYR CD2  1 1 
        2  1956 1 1  16 TYR CE1  C   1.750   5.911  -8.906 1.00 . A A .  94 TYR CE1  1 1 
        2  1957 1 1  16 TYR CE2  C   2.351   6.308 -11.187 1.00 . A A .  94 TYR CE2  1 1 
        2  1958 1 1  16 TYR CG   C   4.047   5.657  -9.600 1.00 . A A .  94 TYR CG   1 1 
        2  1959 1 1  16 TYR CZ   C   1.397   6.257 -10.193 1.00 . A A .  94 TYR CZ   1 1 
        2  1960 1 1  16 TYR H    H   7.673   4.623  -8.207 1.00 . A A .  94 TYR H    1 1 
        2  1961 1 1  16 TYR HA   H   5.022   4.059  -7.621 1.00 . A A .  94 TYR HA   1 1 
        2  1962 1 1  16 TYR HB2  H   5.892   6.148  -8.701 1.00 . A A .  94 TYR HB2  1 1 
        2  1963 1 1  16 TYR HB3  H   6.028   5.252 -10.211 1.00 . A A .  94 TYR HB3  1 1 
        2  1964 1 1  16 TYR HD1  H   3.348   5.342  -7.608 1.00 . A A .  94 TYR HD1  1 1 
        2  1965 1 1  16 TYR HD2  H   4.416   6.047 -11.666 1.00 . A A .  94 TYR HD2  1 1 
        2  1966 1 1  16 TYR HE1  H   1.003   5.871  -8.127 1.00 . A A .  94 TYR HE1  1 1 
        2  1967 1 1  16 TYR HE2  H   2.074   6.579 -12.196 1.00 . A A .  94 TYR HE2  1 1 
        2  1968 1 1  16 TYR HH   H  -0.178   6.087 -11.282 1.00 . A A .  94 TYR HH   1 1 
        2  1969 1 1  16 TYR N    N   7.039   3.897  -8.031 1.00 . A A .  94 TYR N    1 1 
        2  1970 1 1  16 TYR O    O   4.234   2.197  -9.113 1.00 . A A .  94 TYR O    1 1 
        2  1971 1 1  16 TYR OH   O   0.086   6.555 -10.487 1.00 . A A .  94 TYR OH   1 1 
        2  1972 1 1  17 TYR C    C   5.894   0.102 -10.556 1.00 . A A .  95 TYR C    1 1 
        2  1973 1 1  17 TYR CA   C   5.793   1.442 -11.278 1.00 . A A .  95 TYR CA   1 1 
        2  1974 1 1  17 TYR CB   C   6.763   1.473 -12.460 1.00 . A A .  95 TYR CB   1 1 
        2  1975 1 1  17 TYR CD1  C   6.088   3.723 -13.382 1.00 . A A .  95 TYR CD1  1 1 
        2  1976 1 1  17 TYR CD2  C   6.101   1.857 -14.866 1.00 . A A .  95 TYR CD2  1 1 
        2  1977 1 1  17 TYR CE1  C   5.671   4.545 -14.412 1.00 . A A .  95 TYR CE1  1 1 
        2  1978 1 1  17 TYR CE2  C   5.684   2.672 -15.901 1.00 . A A .  95 TYR CE2  1 1 
        2  1979 1 1  17 TYR CG   C   6.309   2.368 -13.591 1.00 . A A .  95 TYR CG   1 1 
        2  1980 1 1  17 TYR CZ   C   5.471   4.015 -15.669 1.00 . A A .  95 TYR CZ   1 1 
        2  1981 1 1  17 TYR H    H   6.866   3.103 -10.518 1.00 . A A .  95 TYR H    1 1 
        2  1982 1 1  17 TYR HA   H   4.787   1.560 -11.651 1.00 . A A .  95 TYR HA   1 1 
        2  1983 1 1  17 TYR HB2  H   7.724   1.830 -12.120 1.00 . A A .  95 TYR HB2  1 1 
        2  1984 1 1  17 TYR HB3  H   6.875   0.472 -12.851 1.00 . A A .  95 TYR HB3  1 1 
        2  1985 1 1  17 TYR HD1  H   6.246   4.136 -12.397 1.00 . A A .  95 TYR HD1  1 1 
        2  1986 1 1  17 TYR HD2  H   6.268   0.805 -15.044 1.00 . A A .  95 TYR HD2  1 1 
        2  1987 1 1  17 TYR HE1  H   5.504   5.596 -14.230 1.00 . A A .  95 TYR HE1  1 1 
        2  1988 1 1  17 TYR HE2  H   5.527   2.257 -16.886 1.00 . A A .  95 TYR HE2  1 1 
        2  1989 1 1  17 TYR HH   H   4.293   5.340 -16.414 1.00 . A A .  95 TYR HH   1 1 
        2  1990 1 1  17 TYR N    N   6.066   2.553 -10.373 1.00 . A A .  95 TYR N    1 1 
        2  1991 1 1  17 TYR O    O   5.234  -0.867 -10.933 1.00 . A A .  95 TYR O    1 1 
        2  1992 1 1  17 TYR OH   O   5.056   4.830 -16.698 1.00 . A A .  95 TYR OH   1 1 
        2  1993 1 1  18 LEU C    C   5.642  -1.510  -7.954 1.00 . A A .  96 LEU C    1 1 
        2  1994 1 1  18 LEU CA   C   6.902  -1.175  -8.744 1.00 . A A .  96 LEU CA   1 1 
        2  1995 1 1  18 LEU CB   C   8.090  -1.031  -7.789 1.00 . A A .  96 LEU CB   1 1 
        2  1996 1 1  18 LEU CD1  C   9.521  -2.689  -9.007 1.00 . A A .  96 LEU CD1  1 1 
        2  1997 1 1  18 LEU CD2  C  10.098  -2.022  -6.667 1.00 . A A .  96 LEU CD2  1 1 
        2  1998 1 1  18 LEU CG   C   8.967  -2.275  -7.652 1.00 . A A .  96 LEU CG   1 1 
        2  1999 1 1  18 LEU H    H   7.219   0.853  -9.256 1.00 . A A .  96 LEU H    1 1 
        2  2000 1 1  18 LEU HA   H   7.103  -1.978  -9.437 1.00 . A A .  96 LEU HA   1 1 
        2  2001 1 1  18 LEU HB2  H   8.708  -0.219  -8.139 1.00 . A A .  96 LEU HB2  1 1 
        2  2002 1 1  18 LEU HB3  H   7.711  -0.777  -6.811 1.00 . A A .  96 LEU HB3  1 1 
        2  2003 1 1  18 LEU HD11 H  10.307  -3.416  -8.867 1.00 . A A .  96 LEU HD11 1 1 
        2  2004 1 1  18 LEU HD12 H   9.919  -1.821  -9.513 1.00 . A A .  96 LEU HD12 1 1 
        2  2005 1 1  18 LEU HD13 H   8.731  -3.122  -9.602 1.00 . A A .  96 LEU HD13 1 1 
        2  2006 1 1  18 LEU HD21 H  10.858  -2.778  -6.789 1.00 . A A .  96 LEU HD21 1 1 
        2  2007 1 1  18 LEU HD22 H   9.712  -2.058  -5.659 1.00 . A A .  96 LEU HD22 1 1 
        2  2008 1 1  18 LEU HD23 H  10.526  -1.047  -6.853 1.00 . A A .  96 LEU HD23 1 1 
        2  2009 1 1  18 LEU HG   H   8.367  -3.090  -7.273 1.00 . A A .  96 LEU HG   1 1 
        2  2010 1 1  18 LEU N    N   6.721   0.050  -9.515 1.00 . A A .  96 LEU N    1 1 
        2  2011 1 1  18 LEU O    O   5.092  -2.604  -8.076 1.00 . A A .  96 LEU O    1 1 
        2  2012 1 1  19 CYS C    C   2.803  -1.133  -7.203 1.00 . A A .  97 CYS C    1 1 
        2  2013 1 1  19 CYS CA   C   3.994  -0.746  -6.333 1.00 . A A .  97 CYS CA   1 1 
        2  2014 1 1  19 CYS CB   C   3.676   0.530  -5.551 1.00 . A A .  97 CYS CB   1 1 
        2  2015 1 1  19 CYS H    H   5.674   0.293  -7.092 1.00 . A A .  97 CYS H    1 1 
        2  2016 1 1  19 CYS HA   H   4.190  -1.546  -5.635 1.00 . A A .  97 CYS HA   1 1 
        2  2017 1 1  19 CYS HB2  H   3.403   1.310  -6.246 1.00 . A A .  97 CYS HB2  1 1 
        2  2018 1 1  19 CYS HB3  H   2.845   0.339  -4.888 1.00 . A A .  97 CYS HB3  1 1 
        2  2019 1 1  19 CYS HG   H   5.438   0.396  -4.088 1.00 . A A .  97 CYS HG   1 1 
        2  2020 1 1  19 CYS N    N   5.191  -0.557  -7.145 1.00 . A A .  97 CYS N    1 1 
        2  2021 1 1  19 CYS O    O   2.044  -2.040  -6.865 1.00 . A A .  97 CYS O    1 1 
        2  2022 1 1  19 CYS SG   S   5.050   1.143  -4.550 1.00 . A A .  97 CYS SG   1 1 
        2  2023 1 1  20 LEU C    C   1.569  -2.166  -9.710 1.00 . A A .  98 LEU C    1 1 
        2  2024 1 1  20 LEU CA   C   1.548  -0.712  -9.247 1.00 . A A .  98 LEU CA   1 1 
        2  2025 1 1  20 LEU CB   C   1.625   0.221 -10.457 1.00 . A A .  98 LEU CB   1 1 
        2  2026 1 1  20 LEU CD1  C   1.677   2.564 -11.347 1.00 . A A .  98 LEU CD1  1 1 
        2  2027 1 1  20 LEU CD2  C  -0.188   1.839  -9.847 1.00 . A A .  98 LEU CD2  1 1 
        2  2028 1 1  20 LEU CG   C   1.291   1.685 -10.167 1.00 . A A .  98 LEU CG   1 1 
        2  2029 1 1  20 LEU H    H   3.287   0.272  -8.543 1.00 . A A .  98 LEU H    1 1 
        2  2030 1 1  20 LEU HA   H   0.624  -0.528  -8.721 1.00 . A A .  98 LEU HA   1 1 
        2  2031 1 1  20 LEU HB2  H   2.628   0.174 -10.858 1.00 . A A .  98 LEU HB2  1 1 
        2  2032 1 1  20 LEU HB3  H   0.938  -0.140 -11.208 1.00 . A A .  98 LEU HB3  1 1 
        2  2033 1 1  20 LEU HD11 H   1.775   3.587 -11.016 1.00 . A A .  98 LEU HD11 1 1 
        2  2034 1 1  20 LEU HD12 H   0.912   2.503 -12.107 1.00 . A A .  98 LEU HD12 1 1 
        2  2035 1 1  20 LEU HD13 H   2.618   2.226 -11.755 1.00 . A A .  98 LEU HD13 1 1 
        2  2036 1 1  20 LEU HD21 H  -0.766   1.730 -10.753 1.00 . A A .  98 LEU HD21 1 1 
        2  2037 1 1  20 LEU HD22 H  -0.365   2.816  -9.423 1.00 . A A .  98 LEU HD22 1 1 
        2  2038 1 1  20 LEU HD23 H  -0.484   1.080  -9.139 1.00 . A A .  98 LEU HD23 1 1 
        2  2039 1 1  20 LEU HG   H   1.856   2.013  -9.307 1.00 . A A .  98 LEU HG   1 1 
        2  2040 1 1  20 LEU N    N   2.647  -0.440  -8.327 1.00 . A A .  98 LEU N    1 1 
        2  2041 1 1  20 LEU O    O   0.553  -2.859  -9.660 1.00 . A A .  98 LEU O    1 1 
        2  2042 1 1  21 GLN C    C   2.633  -4.995  -9.513 1.00 . A A .  99 GLN C    1 1 
        2  2043 1 1  21 GLN CA   C   2.886  -3.993 -10.637 1.00 . A A .  99 GLN CA   1 1 
        2  2044 1 1  21 GLN CB   C   4.286  -4.200 -11.218 1.00 . A A .  99 GLN CB   1 1 
        2  2045 1 1  21 GLN CD   C   5.072  -5.192 -13.405 1.00 . A A .  99 GLN CD   1 1 
        2  2046 1 1  21 GLN CG   C   4.347  -4.045 -12.729 1.00 . A A .  99 GLN CG   1 1 
        2  2047 1 1  21 GLN H    H   3.508  -2.021 -10.179 1.00 . A A .  99 GLN H    1 1 
        2  2048 1 1  21 GLN HA   H   2.156  -4.155 -11.417 1.00 . A A .  99 GLN HA   1 1 
        2  2049 1 1  21 GLN HB2  H   4.957  -3.477 -10.776 1.00 . A A .  99 GLN HB2  1 1 
        2  2050 1 1  21 GLN HB3  H   4.626  -5.194 -10.965 1.00 . A A .  99 GLN HB3  1 1 
        2  2051 1 1  21 GLN HE21 H   6.768  -4.155 -13.402 1.00 . A A .  99 GLN HE21 1 1 
        2  2052 1 1  21 GLN HE22 H   6.856  -5.734 -14.097 1.00 . A A .  99 GLN HE22 1 1 
        2  2053 1 1  21 GLN HG2  H   3.339  -4.000 -13.114 1.00 . A A .  99 GLN HG2  1 1 
        2  2054 1 1  21 GLN HG3  H   4.862  -3.125 -12.963 1.00 . A A .  99 GLN HG3  1 1 
        2  2055 1 1  21 GLN N    N   2.733  -2.622 -10.163 1.00 . A A .  99 GLN N    1 1 
        2  2056 1 1  21 GLN NE2  N   6.362  -5.009 -13.660 1.00 . A A .  99 GLN NE2  1 1 
        2  2057 1 1  21 GLN O    O   1.917  -5.979  -9.695 1.00 . A A .  99 GLN O    1 1 
        2  2058 1 1  21 GLN OE1  O   4.480  -6.232 -13.694 1.00 . A A .  99 GLN OE1  1 1 
        2  2059 1 1  22 LEU C    C   1.603  -5.711  -6.783 1.00 . A A . 100 LEU C    1 1 
        2  2060 1 1  22 LEU CA   C   3.068  -5.618  -7.200 1.00 . A A . 100 LEU CA   1 1 
        2  2061 1 1  22 LEU CB   C   3.916  -5.115  -6.029 1.00 . A A . 100 LEU CB   1 1 
        2  2062 1 1  22 LEU CD1  C   6.126  -5.116  -4.847 1.00 . A A . 100 LEU CD1  1 1 
        2  2063 1 1  22 LEU CD2  C   4.913  -7.271  -5.228 1.00 . A A . 100 LEU CD2  1 1 
        2  2064 1 1  22 LEU CG   C   5.213  -5.888  -5.788 1.00 . A A . 100 LEU CG   1 1 
        2  2065 1 1  22 LEU H    H   3.787  -3.937  -8.270 1.00 . A A . 100 LEU H    1 1 
        2  2066 1 1  22 LEU HA   H   3.412  -6.601  -7.485 1.00 . A A . 100 LEU HA   1 1 
        2  2067 1 1  22 LEU HB2  H   4.167  -4.080  -6.212 1.00 . A A . 100 LEU HB2  1 1 
        2  2068 1 1  22 LEU HB3  H   3.320  -5.168  -5.130 1.00 . A A . 100 LEU HB3  1 1 
        2  2069 1 1  22 LEU HD11 H   6.839  -5.794  -4.400 1.00 . A A . 100 LEU HD11 1 1 
        2  2070 1 1  22 LEU HD12 H   5.535  -4.652  -4.072 1.00 . A A . 100 LEU HD12 1 1 
        2  2071 1 1  22 LEU HD13 H   6.654  -4.354  -5.402 1.00 . A A . 100 LEU HD13 1 1 
        2  2072 1 1  22 LEU HD21 H   4.975  -8.002  -6.021 1.00 . A A . 100 LEU HD21 1 1 
        2  2073 1 1  22 LEU HD22 H   3.919  -7.281  -4.807 1.00 . A A . 100 LEU HD22 1 1 
        2  2074 1 1  22 LEU HD23 H   5.632  -7.513  -4.459 1.00 . A A . 100 LEU HD23 1 1 
        2  2075 1 1  22 LEU HG   H   5.731  -6.012  -6.728 1.00 . A A . 100 LEU HG   1 1 
        2  2076 1 1  22 LEU N    N   3.228  -4.738  -8.353 1.00 . A A . 100 LEU N    1 1 
        2  2077 1 1  22 LEU O    O   1.085  -6.799  -6.535 1.00 . A A . 100 LEU O    1 1 
        2  2078 1 1  23 ARG C    C  -1.347  -5.205  -7.348 1.00 . A A . 101 ARG C    1 1 
        2  2079 1 1  23 ARG CA   C  -0.462  -4.505  -6.320 1.00 . A A . 101 ARG CA   1 1 
        2  2080 1 1  23 ARG CB   C  -0.909  -3.051  -6.147 1.00 . A A . 101 ARG CB   1 1 
        2  2081 1 1  23 ARG CD   C  -2.692  -1.983  -4.730 1.00 . A A . 101 ARG CD   1 1 
        2  2082 1 1  23 ARG CG   C  -1.362  -2.719  -4.734 1.00 . A A . 101 ARG CG   1 1 
        2  2083 1 1  23 ARG CZ   C  -3.656   0.094  -5.641 1.00 . A A . 101 ARG CZ   1 1 
        2  2084 1 1  23 ARG H    H   1.412  -3.726  -6.918 1.00 . A A . 101 ARG H    1 1 
        2  2085 1 1  23 ARG HA   H  -0.562  -5.015  -5.374 1.00 . A A . 101 ARG HA   1 1 
        2  2086 1 1  23 ARG HB2  H  -0.085  -2.401  -6.399 1.00 . A A . 101 ARG HB2  1 1 
        2  2087 1 1  23 ARG HB3  H  -1.730  -2.853  -6.821 1.00 . A A . 101 ARG HB3  1 1 
        2  2088 1 1  23 ARG HD2  H  -3.456  -2.643  -5.115 1.00 . A A . 101 ARG HD2  1 1 
        2  2089 1 1  23 ARG HD3  H  -2.934  -1.707  -3.714 1.00 . A A . 101 ARG HD3  1 1 
        2  2090 1 1  23 ARG HE   H  -1.835  -0.604  -6.064 1.00 . A A . 101 ARG HE   1 1 
        2  2091 1 1  23 ARG HG2  H  -1.470  -3.637  -4.176 1.00 . A A . 101 ARG HG2  1 1 
        2  2092 1 1  23 ARG HG3  H  -0.615  -2.096  -4.264 1.00 . A A . 101 ARG HG3  1 1 
        2  2093 1 1  23 ARG HH11 H  -4.874  -0.912  -4.378 1.00 . A A . 101 ARG HH11 1 1 
        2  2094 1 1  23 ARG HH12 H  -5.529   0.551  -5.033 1.00 . A A . 101 ARG HH12 1 1 
        2  2095 1 1  23 ARG HH21 H  -2.693   1.321  -6.926 1.00 . A A . 101 ARG HH21 1 1 
        2  2096 1 1  23 ARG HH22 H  -4.290   1.819  -6.480 1.00 . A A . 101 ARG HH22 1 1 
        2  2097 1 1  23 ARG N    N   0.943  -4.561  -6.708 1.00 . A A . 101 ARG N    1 1 
        2  2098 1 1  23 ARG NE   N  -2.652  -0.776  -5.552 1.00 . A A . 101 ARG NE   1 1 
        2  2099 1 1  23 ARG NH1  N  -4.778  -0.106  -4.962 1.00 . A A . 101 ARG NH1  1 1 
        2  2100 1 1  23 ARG NH2  N  -3.537   1.166  -6.412 1.00 . A A . 101 ARG NH2  1 1 
        2  2101 1 1  23 ARG O    O  -2.414  -5.720  -7.012 1.00 . A A . 101 ARG O    1 1 
        2  2102 1 1  24 GLN C    C  -1.628  -7.378  -9.539 1.00 . A A . 102 GLN C    1 1 
        2  2103 1 1  24 GLN CA   C  -1.656  -5.857  -9.673 1.00 . A A . 102 GLN CA   1 1 
        2  2104 1 1  24 GLN CB   C  -1.095  -5.441 -11.035 1.00 . A A . 102 GLN CB   1 1 
        2  2105 1 1  24 GLN CD   C  -2.078  -4.669 -13.230 1.00 . A A . 102 GLN CD   1 1 
        2  2106 1 1  24 GLN CG   C  -1.938  -4.395 -11.745 1.00 . A A . 102 GLN CG   1 1 
        2  2107 1 1  24 GLN H    H  -0.039  -4.801  -8.808 1.00 . A A . 102 GLN H    1 1 
        2  2108 1 1  24 GLN HA   H  -2.680  -5.522  -9.600 1.00 . A A . 102 GLN HA   1 1 
        2  2109 1 1  24 GLN HB2  H  -0.103  -5.039 -10.895 1.00 . A A . 102 GLN HB2  1 1 
        2  2110 1 1  24 GLN HB3  H  -1.033  -6.313 -11.670 1.00 . A A . 102 GLN HB3  1 1 
        2  2111 1 1  24 GLN HE21 H  -2.806  -6.480 -12.851 1.00 . A A . 102 GLN HE21 1 1 
        2  2112 1 1  24 GLN HE22 H  -2.668  -6.061 -14.521 1.00 . A A . 102 GLN HE22 1 1 
        2  2113 1 1  24 GLN HG2  H  -2.922  -4.383 -11.303 1.00 . A A . 102 GLN HG2  1 1 
        2  2114 1 1  24 GLN HG3  H  -1.473  -3.428 -11.615 1.00 . A A . 102 GLN HG3  1 1 
        2  2115 1 1  24 GLN N    N  -0.901  -5.220  -8.600 1.00 . A A . 102 GLN N    1 1 
        2  2116 1 1  24 GLN NE2  N  -2.567  -5.857 -13.568 1.00 . A A . 102 GLN NE2  1 1 
        2  2117 1 1  24 GLN O    O  -2.639  -8.048  -9.753 1.00 . A A . 102 GLN O    1 1 
        2  2118 1 1  24 GLN OE1  O  -1.751  -3.824 -14.063 1.00 . A A . 102 GLN OE1  1 1 
        2  2119 1 1  25 ASP C    C  -1.028  -9.869  -7.798 1.00 . A A . 103 ASP C    1 1 
        2  2120 1 1  25 ASP CA   C  -0.303  -9.359  -9.040 1.00 . A A . 103 ASP CA   1 1 
        2  2121 1 1  25 ASP CB   C   1.181  -9.721  -8.959 1.00 . A A . 103 ASP CB   1 1 
        2  2122 1 1  25 ASP CG   C   1.866  -9.662 -10.311 1.00 . A A . 103 ASP CG   1 1 
        2  2123 1 1  25 ASP H    H   0.308  -7.332  -9.042 1.00 . A A . 103 ASP H    1 1 
        2  2124 1 1  25 ASP HA   H  -0.731  -9.834  -9.910 1.00 . A A . 103 ASP HA   1 1 
        2  2125 1 1  25 ASP HB2  H   1.679  -9.031  -8.294 1.00 . A A . 103 ASP HB2  1 1 
        2  2126 1 1  25 ASP HB3  H   1.280 -10.724  -8.569 1.00 . A A . 103 ASP HB3  1 1 
        2  2127 1 1  25 ASP N    N  -0.464  -7.917  -9.193 1.00 . A A . 103 ASP N    1 1 
        2  2128 1 1  25 ASP O    O  -1.659 -10.925  -7.825 1.00 . A A . 103 ASP O    1 1 
        2  2129 1 1  25 ASP OD1  O   1.758  -8.616 -10.985 1.00 . A A . 103 ASP OD1  1 1 
        2  2130 1 1  25 ASP OD2  O   2.509 -10.661 -10.696 1.00 . A A . 103 ASP OD2  1 1 
        2  2131 1 1  26 ILE C    C  -3.088  -9.537  -5.598 1.00 . A A . 104 ILE C    1 1 
        2  2132 1 1  26 ILE CA   C  -1.569  -9.497  -5.456 1.00 . A A . 104 ILE CA   1 1 
        2  2133 1 1  26 ILE CB   C  -1.194  -8.531  -4.314 1.00 . A A . 104 ILE CB   1 1 
        2  2134 1 1  26 ILE CD1  C   0.785  -7.059  -3.685 1.00 . A A . 104 ILE CD1  1 1 
        2  2135 1 1  26 ILE CG1  C   0.327  -8.404  -4.204 1.00 . A A . 104 ILE CG1  1 1 
        2  2136 1 1  26 ILE CG2  C  -1.787  -9.007  -2.996 1.00 . A A . 104 ILE CG2  1 1 
        2  2137 1 1  26 ILE H    H  -0.408  -8.286  -6.746 1.00 . A A . 104 ILE H    1 1 
        2  2138 1 1  26 ILE HA   H  -1.218 -10.484  -5.191 1.00 . A A . 104 ILE HA   1 1 
        2  2139 1 1  26 ILE HB   H  -1.613  -7.562  -4.540 1.00 . A A . 104 ILE HB   1 1 
        2  2140 1 1  26 ILE HD11 H  -0.056  -6.383  -3.643 1.00 . A A . 104 ILE HD11 1 1 
        2  2141 1 1  26 ILE HD12 H   1.539  -6.656  -4.345 1.00 . A A . 104 ILE HD12 1 1 
        2  2142 1 1  26 ILE HD13 H   1.201  -7.177  -2.695 1.00 . A A . 104 ILE HD13 1 1 
        2  2143 1 1  26 ILE HG12 H   0.696  -9.162  -3.529 1.00 . A A . 104 ILE HG12 1 1 
        2  2144 1 1  26 ILE HG13 H   0.767  -8.552  -5.179 1.00 . A A . 104 ILE HG13 1 1 
        2  2145 1 1  26 ILE HG21 H  -2.734  -8.514  -2.829 1.00 . A A . 104 ILE HG21 1 1 
        2  2146 1 1  26 ILE HG22 H  -1.110  -8.768  -2.189 1.00 . A A . 104 ILE HG22 1 1 
        2  2147 1 1  26 ILE HG23 H  -1.939 -10.075  -3.035 1.00 . A A . 104 ILE HG23 1 1 
        2  2148 1 1  26 ILE N    N  -0.928  -9.116  -6.708 1.00 . A A . 104 ILE N    1 1 
        2  2149 1 1  26 ILE O    O  -3.731 -10.514  -5.213 1.00 . A A . 104 ILE O    1 1 
        2  2150 1 1  27 VAL C    C  -5.620  -9.493  -7.236 1.00 . A A . 105 VAL C    1 1 
        2  2151 1 1  27 VAL CA   C  -5.103  -8.382  -6.328 1.00 . A A . 105 VAL CA   1 1 
        2  2152 1 1  27 VAL CB   C  -5.514  -7.020  -6.918 1.00 . A A . 105 VAL CB   1 1 
        2  2153 1 1  27 VAL CG1  C  -5.108  -5.891  -5.984 1.00 . A A . 105 VAL CG1  1 1 
        2  2154 1 1  27 VAL CG2  C  -4.901  -6.825  -8.297 1.00 . A A . 105 VAL CG2  1 1 
        2  2155 1 1  27 VAL H    H  -3.098  -7.716  -6.428 1.00 . A A . 105 VAL H    1 1 
        2  2156 1 1  27 VAL HA   H  -5.567  -8.482  -5.357 1.00 . A A . 105 VAL HA   1 1 
        2  2157 1 1  27 VAL HB   H  -6.589  -7.003  -7.020 1.00 . A A . 105 VAL HB   1 1 
        2  2158 1 1  27 VAL HG11 H  -4.118  -6.080  -5.599 1.00 . A A . 105 VAL HG11 1 1 
        2  2159 1 1  27 VAL HG12 H  -5.809  -5.834  -5.164 1.00 . A A . 105 VAL HG12 1 1 
        2  2160 1 1  27 VAL HG13 H  -5.112  -4.957  -6.526 1.00 . A A . 105 VAL HG13 1 1 
        2  2161 1 1  27 VAL HG21 H  -5.135  -5.835  -8.659 1.00 . A A . 105 VAL HG21 1 1 
        2  2162 1 1  27 VAL HG22 H  -5.303  -7.561  -8.977 1.00 . A A . 105 VAL HG22 1 1 
        2  2163 1 1  27 VAL HG23 H  -3.830  -6.941  -8.234 1.00 . A A . 105 VAL HG23 1 1 
        2  2164 1 1  27 VAL N    N  -3.659  -8.468  -6.144 1.00 . A A . 105 VAL N    1 1 
        2  2165 1 1  27 VAL O    O  -6.743  -9.970  -7.069 1.00 . A A . 105 VAL O    1 1 
        2  2166 1 1  28 ALA C    C  -4.992 -12.343  -8.519 1.00 . A A . 106 ALA C    1 1 
        2  2167 1 1  28 ALA CA   C  -5.183 -10.955  -9.130 1.00 . A A . 106 ALA CA   1 1 
        2  2168 1 1  28 ALA CB   C  -4.385 -10.832 -10.419 1.00 . A A . 106 ALA CB   1 1 
        2  2169 1 1  28 ALA H    H  -3.915  -9.487  -8.284 1.00 . A A . 106 ALA H    1 1 
        2  2170 1 1  28 ALA HA   H  -6.228 -10.821  -9.370 1.00 . A A . 106 ALA HA   1 1 
        2  2171 1 1  28 ALA HB1  H  -4.001  -9.827 -10.511 1.00 . A A . 106 ALA HB1  1 1 
        2  2172 1 1  28 ALA HB2  H  -5.025 -11.050 -11.261 1.00 . A A . 106 ALA HB2  1 1 
        2  2173 1 1  28 ALA HB3  H  -3.562 -11.531 -10.402 1.00 . A A . 106 ALA HB3  1 1 
        2  2174 1 1  28 ALA N    N  -4.799  -9.901  -8.198 1.00 . A A . 106 ALA N    1 1 
        2  2175 1 1  28 ALA O    O  -5.295 -13.353  -9.154 1.00 . A A . 106 ALA O    1 1 
        2  2176 1 1  29 GLY C    C  -3.147 -14.456  -7.268 1.00 . A A . 107 GLY C    1 1 
        2  2177 1 1  29 GLY CA   C  -4.269 -13.664  -6.629 1.00 . A A . 107 GLY CA   1 1 
        2  2178 1 1  29 GLY H    H  -4.261 -11.557  -6.826 1.00 . A A . 107 GLY H    1 1 
        2  2179 1 1  29 GLY HA2  H  -4.024 -13.483  -5.592 1.00 . A A . 107 GLY HA2  1 1 
        2  2180 1 1  29 GLY HA3  H  -5.179 -14.244  -6.678 1.00 . A A . 107 GLY HA3  1 1 
        2  2181 1 1  29 GLY N    N  -4.488 -12.390  -7.288 1.00 . A A . 107 GLY N    1 1 
        2  2182 1 1  29 GLY O    O  -3.186 -15.686  -7.303 1.00 . A A . 107 GLY O    1 1 
        2  2183 1 1  30 ARG C    C   0.040 -14.834  -7.399 1.00 . A A . 108 ARG C    1 1 
        2  2184 1 1  30 ARG CA   C  -1.004 -14.387  -8.423 1.00 . A A . 108 ARG CA   1 1 
        2  2185 1 1  30 ARG CB   C  -0.365 -13.433  -9.433 1.00 . A A . 108 ARG CB   1 1 
        2  2186 1 1  30 ARG CD   C  -0.187 -12.712 -11.833 1.00 . A A . 108 ARG CD   1 1 
        2  2187 1 1  30 ARG CG   C  -1.000 -13.491 -10.812 1.00 . A A . 108 ARG CG   1 1 
        2  2188 1 1  30 ARG CZ   C   0.953 -14.435 -13.178 1.00 . A A . 108 ARG CZ   1 1 
        2  2189 1 1  30 ARG H    H  -2.174 -12.769  -7.718 1.00 . A A . 108 ARG H    1 1 
        2  2190 1 1  30 ARG HA   H  -1.369 -15.258  -8.948 1.00 . A A . 108 ARG HA   1 1 
        2  2191 1 1  30 ARG HB2  H  -0.454 -12.422  -9.062 1.00 . A A . 108 ARG HB2  1 1 
        2  2192 1 1  30 ARG HB3  H   0.682 -13.680  -9.531 1.00 . A A . 108 ARG HB3  1 1 
        2  2193 1 1  30 ARG HD2  H  -0.812 -12.503 -12.688 1.00 . A A . 108 ARG HD2  1 1 
        2  2194 1 1  30 ARG HD3  H   0.134 -11.783 -11.386 1.00 . A A . 108 ARG HD3  1 1 
        2  2195 1 1  30 ARG HE   H   1.854 -13.213 -11.883 1.00 . A A . 108 ARG HE   1 1 
        2  2196 1 1  30 ARG HG2  H  -1.061 -14.522 -11.127 1.00 . A A . 108 ARG HG2  1 1 
        2  2197 1 1  30 ARG HG3  H  -1.993 -13.070 -10.759 1.00 . A A . 108 ARG HG3  1 1 
        2  2198 1 1  30 ARG HH11 H  -1.045 -14.325 -13.476 1.00 . A A . 108 ARG HH11 1 1 
        2  2199 1 1  30 ARG HH12 H  -0.221 -15.527 -14.410 1.00 . A A . 108 ARG HH12 1 1 
        2  2200 1 1  30 ARG HH21 H   2.941 -14.794 -13.111 1.00 . A A . 108 ARG HH21 1 1 
        2  2201 1 1  30 ARG HH22 H   2.042 -15.794 -14.202 1.00 . A A . 108 ARG HH22 1 1 
        2  2202 1 1  30 ARG N    N  -2.145 -13.747  -7.777 1.00 . A A . 108 ARG N    1 1 
        2  2203 1 1  30 ARG NE   N   0.990 -13.456 -12.277 1.00 . A A . 108 ARG NE   1 1 
        2  2204 1 1  30 ARG NH1  N  -0.199 -14.791 -13.733 1.00 . A A . 108 ARG NH1  1 1 
        2  2205 1 1  30 ARG NH2  N   2.070 -15.059 -13.526 1.00 . A A . 108 ARG NH2  1 1 
        2  2206 1 1  30 ARG O    O   1.093 -15.355  -7.767 1.00 . A A . 108 ARG O    1 1 
        2  2207 1 1  31 LEU C    C  -0.084 -15.243  -3.744 1.00 . A A . 109 LEU C    1 1 
        2  2208 1 1  31 LEU CA   C   0.669 -15.016  -5.055 1.00 . A A . 109 LEU CA   1 1 
        2  2209 1 1  31 LEU CB   C   1.740 -13.938  -4.864 1.00 . A A . 109 LEU CB   1 1 
        2  2210 1 1  31 LEU CD1  C   4.183 -13.470  -5.190 1.00 . A A . 109 LEU CD1  1 1 
        2  2211 1 1  31 LEU CD2  C   3.410 -14.754  -3.183 1.00 . A A . 109 LEU CD2  1 1 
        2  2212 1 1  31 LEU CG   C   3.161 -14.464  -4.656 1.00 . A A . 109 LEU CG   1 1 
        2  2213 1 1  31 LEU H    H  -1.103 -14.212  -5.873 1.00 . A A . 109 LEU H    1 1 
        2  2214 1 1  31 LEU HA   H   1.146 -15.938  -5.350 1.00 . A A . 109 LEU HA   1 1 
        2  2215 1 1  31 LEU HB2  H   1.738 -13.302  -5.737 1.00 . A A . 109 LEU HB2  1 1 
        2  2216 1 1  31 LEU HB3  H   1.472 -13.342  -4.005 1.00 . A A . 109 LEU HB3  1 1 
        2  2217 1 1  31 LEU HD11 H   3.677 -12.578  -5.532 1.00 . A A . 109 LEU HD11 1 1 
        2  2218 1 1  31 LEU HD12 H   4.722 -13.915  -6.014 1.00 . A A . 109 LEU HD12 1 1 
        2  2219 1 1  31 LEU HD13 H   4.879 -13.209  -4.406 1.00 . A A . 109 LEU HD13 1 1 
        2  2220 1 1  31 LEU HD21 H   4.127 -15.556  -3.090 1.00 . A A . 109 LEU HD21 1 1 
        2  2221 1 1  31 LEU HD22 H   2.483 -15.043  -2.711 1.00 . A A . 109 LEU HD22 1 1 
        2  2222 1 1  31 LEU HD23 H   3.797 -13.867  -2.703 1.00 . A A . 109 LEU HD23 1 1 
        2  2223 1 1  31 LEU HG   H   3.279 -15.388  -5.204 1.00 . A A . 109 LEU HG   1 1 
        2  2224 1 1  31 LEU N    N  -0.252 -14.630  -6.116 1.00 . A A . 109 LEU N    1 1 
        2  2225 1 1  31 LEU O    O  -0.942 -14.443  -3.369 1.00 . A A . 109 LEU O    1 1 
        2  2226 1 1  32 PRO C    C  -0.035 -15.700  -0.637 1.00 . A A . 110 PRO C    1 1 
        2  2227 1 1  32 PRO CA   C  -0.437 -16.656  -1.755 1.00 . A A . 110 PRO CA   1 1 
        2  2228 1 1  32 PRO CB   C   0.047 -18.074  -1.446 1.00 . A A . 110 PRO CB   1 1 
        2  2229 1 1  32 PRO CD   C   1.232 -17.351  -3.393 1.00 . A A . 110 PRO CD   1 1 
        2  2230 1 1  32 PRO CG   C   1.355 -18.188  -2.150 1.00 . A A . 110 PRO CG   1 1 
        2  2231 1 1  32 PRO HA   H  -1.513 -16.655  -1.858 1.00 . A A . 110 PRO HA   1 1 
        2  2232 1 1  32 PRO HB2  H   0.160 -18.194  -0.379 1.00 . A A . 110 PRO HB2  1 1 
        2  2233 1 1  32 PRO HB3  H  -0.666 -18.792  -1.822 1.00 . A A . 110 PRO HB3  1 1 
        2  2234 1 1  32 PRO HD2  H   2.177 -16.885  -3.629 1.00 . A A . 110 PRO HD2  1 1 
        2  2235 1 1  32 PRO HD3  H   0.889 -17.953  -4.221 1.00 . A A . 110 PRO HD3  1 1 
        2  2236 1 1  32 PRO HG2  H   2.146 -17.809  -1.519 1.00 . A A . 110 PRO HG2  1 1 
        2  2237 1 1  32 PRO HG3  H   1.543 -19.219  -2.410 1.00 . A A . 110 PRO HG3  1 1 
        2  2238 1 1  32 PRO N    N   0.223 -16.339  -3.026 1.00 . A A . 110 PRO N    1 1 
        2  2239 1 1  32 PRO O    O   1.150 -15.518  -0.360 1.00 . A A . 110 PRO O    1 1 
        2  2240 1 1  33 CYS C    C  -1.792 -14.359   2.218 1.00 . A A . 111 CYS C    1 1 
        2  2241 1 1  33 CYS CA   C  -0.781 -14.158   1.093 1.00 . A A . 111 CYS CA   1 1 
        2  2242 1 1  33 CYS CB   C  -0.846 -12.717   0.583 1.00 . A A . 111 CYS CB   1 1 
        2  2243 1 1  33 CYS H    H  -1.955 -15.280  -0.261 1.00 . A A . 111 CYS H    1 1 
        2  2244 1 1  33 CYS HA   H   0.210 -14.351   1.476 1.00 . A A . 111 CYS HA   1 1 
        2  2245 1 1  33 CYS HB2  H  -1.878 -12.451   0.408 1.00 . A A . 111 CYS HB2  1 1 
        2  2246 1 1  33 CYS HB3  H  -0.433 -12.058   1.334 1.00 . A A . 111 CYS HB3  1 1 
        2  2247 1 1  33 CYS HG   H   0.513 -13.251  -1.186 1.00 . A A . 111 CYS HG   1 1 
        2  2248 1 1  33 CYS N    N  -1.030 -15.094   0.003 1.00 . A A . 111 CYS N    1 1 
        2  2249 1 1  33 CYS O    O  -2.787 -15.063   2.051 1.00 . A A . 111 CYS O    1 1 
        2  2250 1 1  33 CYS SG   S   0.061 -12.436  -0.956 1.00 . A A . 111 CYS SG   1 1 
        2  2251 1 1  34 SER C    C  -3.280 -12.606   4.669 1.00 . A A . 112 SER C    1 1 
        2  2252 1 1  34 SER CA   C  -2.418 -13.855   4.513 1.00 . A A . 112 SER CA   1 1 
        2  2253 1 1  34 SER CB   C  -1.607 -14.092   5.788 1.00 . A A . 112 SER CB   1 1 
        2  2254 1 1  34 SER H    H  -0.719 -13.192   3.437 1.00 . A A . 112 SER H    1 1 
        2  2255 1 1  34 SER HA   H  -3.064 -14.704   4.346 1.00 . A A . 112 SER HA   1 1 
        2  2256 1 1  34 SER HB2  H  -0.929 -14.917   5.633 1.00 . A A . 112 SER HB2  1 1 
        2  2257 1 1  34 SER HB3  H  -1.042 -13.201   6.023 1.00 . A A . 112 SER HB3  1 1 
        2  2258 1 1  34 SER HG   H  -2.999 -15.156   6.664 1.00 . A A . 112 SER HG   1 1 
        2  2259 1 1  34 SER N    N  -1.529 -13.739   3.363 1.00 . A A . 112 SER N    1 1 
        2  2260 1 1  34 SER O    O  -2.972 -11.553   4.110 1.00 . A A . 112 SER O    1 1 
        2  2261 1 1  34 SER OG   O  -2.454 -14.397   6.883 1.00 . A A . 112 SER OG   1 1 
        2  2262 1 1  35 PHE C    C  -4.531 -10.420   6.259 1.00 . A A . 113 PHE C    1 1 
        2  2263 1 1  35 PHE CA   C  -5.272 -11.616   5.667 1.00 . A A . 113 PHE CA   1 1 
        2  2264 1 1  35 PHE CB   C  -6.406 -12.049   6.602 1.00 . A A . 113 PHE CB   1 1 
        2  2265 1 1  35 PHE CD1  C  -6.948 -10.020   7.977 1.00 . A A . 113 PHE CD1  1 1 
        2  2266 1 1  35 PHE CD2  C  -8.567 -10.786   6.402 1.00 . A A . 113 PHE CD2  1 1 
        2  2267 1 1  35 PHE CE1  C  -7.791  -8.990   8.348 1.00 . A A . 113 PHE CE1  1 1 
        2  2268 1 1  35 PHE CE2  C  -9.415  -9.757   6.769 1.00 . A A . 113 PHE CE2  1 1 
        2  2269 1 1  35 PHE CG   C  -7.326 -10.929   7.001 1.00 . A A . 113 PHE CG   1 1 
        2  2270 1 1  35 PHE CZ   C  -9.026  -8.858   7.743 1.00 . A A . 113 PHE CZ   1 1 
        2  2271 1 1  35 PHE H    H  -4.551 -13.598   5.850 1.00 . A A . 113 PHE H    1 1 
        2  2272 1 1  35 PHE HA   H  -5.693 -11.326   4.716 1.00 . A A . 113 PHE HA   1 1 
        2  2273 1 1  35 PHE HB2  H  -6.999 -12.804   6.109 1.00 . A A . 113 PHE HB2  1 1 
        2  2274 1 1  35 PHE HB3  H  -5.979 -12.466   7.502 1.00 . A A . 113 PHE HB3  1 1 
        2  2275 1 1  35 PHE HD1  H  -5.982 -10.122   8.450 1.00 . A A . 113 PHE HD1  1 1 
        2  2276 1 1  35 PHE HD2  H  -8.872 -11.488   5.640 1.00 . A A . 113 PHE HD2  1 1 
        2  2277 1 1  35 PHE HE1  H  -7.485  -8.289   9.110 1.00 . A A . 113 PHE HE1  1 1 
        2  2278 1 1  35 PHE HE2  H -10.380  -9.657   6.295 1.00 . A A . 113 PHE HE2  1 1 
        2  2279 1 1  35 PHE HZ   H  -9.686  -8.054   8.032 1.00 . A A . 113 PHE HZ   1 1 
        2  2280 1 1  35 PHE N    N  -4.361 -12.732   5.433 1.00 . A A . 113 PHE N    1 1 
        2  2281 1 1  35 PHE O    O  -4.715  -9.285   5.819 1.00 . A A . 113 PHE O    1 1 
        2  2282 1 1  36 ALA C    C  -2.111  -8.826   6.949 1.00 . A A . 114 ALA C    1 1 
        2  2283 1 1  36 ALA CA   C  -2.963  -9.616   7.935 1.00 . A A . 114 ALA CA   1 1 
        2  2284 1 1  36 ALA CB   C  -2.087 -10.191   9.034 1.00 . A A . 114 ALA CB   1 1 
        2  2285 1 1  36 ALA H    H  -3.624 -11.597   7.598 1.00 . A A . 114 ALA H    1 1 
        2  2286 1 1  36 ALA HA   H  -3.676  -8.946   8.392 1.00 . A A . 114 ALA HA   1 1 
        2  2287 1 1  36 ALA HB1  H  -1.705 -11.152   8.724 1.00 . A A . 114 ALA HB1  1 1 
        2  2288 1 1  36 ALA HB2  H  -2.671 -10.309   9.935 1.00 . A A . 114 ALA HB2  1 1 
        2  2289 1 1  36 ALA HB3  H  -1.263  -9.519   9.224 1.00 . A A . 114 ALA HB3  1 1 
        2  2290 1 1  36 ALA N    N  -3.709 -10.677   7.271 1.00 . A A . 114 ALA N    1 1 
        2  2291 1 1  36 ALA O    O  -2.141  -7.595   6.948 1.00 . A A . 114 ALA O    1 1 
        2  2292 1 1  37 THR C    C  -1.358  -8.102   4.113 1.00 . A A . 115 THR C    1 1 
        2  2293 1 1  37 THR CA   C  -0.508  -8.858   5.125 1.00 . A A . 115 THR CA   1 1 
        2  2294 1 1  37 THR CB   C   0.376  -9.879   4.406 1.00 . A A . 115 THR CB   1 1 
        2  2295 1 1  37 THR CG2  C   1.301  -9.256   3.382 1.00 . A A . 115 THR CG2  1 1 
        2  2296 1 1  37 THR H    H  -1.356 -10.501   6.130 1.00 . A A . 115 THR H    1 1 
        2  2297 1 1  37 THR HA   H   0.120  -8.154   5.649 1.00 . A A . 115 THR HA   1 1 
        2  2298 1 1  37 THR HB   H  -0.257 -10.588   3.892 1.00 . A A . 115 THR HB   1 1 
        2  2299 1 1  37 THR HG1  H   0.631 -11.210   5.820 1.00 . A A . 115 THR HG1  1 1 
        2  2300 1 1  37 THR HG21 H   2.306  -9.620   3.537 1.00 . A A . 115 THR HG21 1 1 
        2  2301 1 1  37 THR HG22 H   1.286  -8.182   3.490 1.00 . A A . 115 THR HG22 1 1 
        2  2302 1 1  37 THR HG23 H   0.970  -9.523   2.389 1.00 . A A . 115 THR HG23 1 1 
        2  2303 1 1  37 THR N    N  -1.354  -9.523   6.107 1.00 . A A . 115 THR N    1 1 
        2  2304 1 1  37 THR O    O  -1.023  -6.988   3.717 1.00 . A A . 115 THR O    1 1 
        2  2305 1 1  37 THR OG1  O   1.178 -10.589   5.334 1.00 . A A . 115 THR OG1  1 1 
        2  2306 1 1  38 LEU C    C  -3.853  -6.746   3.283 1.00 . A A . 116 LEU C    1 1 
        2  2307 1 1  38 LEU CA   C  -3.368  -8.087   2.748 1.00 . A A . 116 LEU CA   1 1 
        2  2308 1 1  38 LEU CB   C  -4.562  -9.000   2.463 1.00 . A A . 116 LEU CB   1 1 
        2  2309 1 1  38 LEU CD1  C  -5.529 -10.997   1.297 1.00 . A A . 116 LEU CD1  1 1 
        2  2310 1 1  38 LEU CD2  C  -3.744  -9.644   0.183 1.00 . A A . 116 LEU CD2  1 1 
        2  2311 1 1  38 LEU CG   C  -4.276 -10.163   1.511 1.00 . A A . 116 LEU CG   1 1 
        2  2312 1 1  38 LEU H    H  -2.684  -9.598   4.062 1.00 . A A . 116 LEU H    1 1 
        2  2313 1 1  38 LEU HA   H  -2.822  -7.921   1.832 1.00 . A A . 116 LEU HA   1 1 
        2  2314 1 1  38 LEU HB2  H  -4.908  -9.408   3.402 1.00 . A A . 116 LEU HB2  1 1 
        2  2315 1 1  38 LEU HB3  H  -5.352  -8.402   2.037 1.00 . A A . 116 LEU HB3  1 1 
        2  2316 1 1  38 LEU HD11 H  -5.532 -11.391   0.291 1.00 . A A . 116 LEU HD11 1 1 
        2  2317 1 1  38 LEU HD12 H  -6.402 -10.379   1.443 1.00 . A A . 116 LEU HD12 1 1 
        2  2318 1 1  38 LEU HD13 H  -5.544 -11.813   2.003 1.00 . A A . 116 LEU HD13 1 1 
        2  2319 1 1  38 LEU HD21 H  -2.665  -9.641   0.204 1.00 . A A . 116 LEU HD21 1 1 
        2  2320 1 1  38 LEU HD22 H  -4.104  -8.639   0.020 1.00 . A A . 116 LEU HD22 1 1 
        2  2321 1 1  38 LEU HD23 H  -4.087 -10.284  -0.616 1.00 . A A . 116 LEU HD23 1 1 
        2  2322 1 1  38 LEU HG   H  -3.521 -10.801   1.948 1.00 . A A . 116 LEU HG   1 1 
        2  2323 1 1  38 LEU N    N  -2.465  -8.712   3.706 1.00 . A A . 116 LEU N    1 1 
        2  2324 1 1  38 LEU O    O  -3.849  -5.741   2.572 1.00 . A A . 116 LEU O    1 1 
        2  2325 1 1  39 ALA C    C  -3.630  -4.542   5.446 1.00 . A A . 117 ALA C    1 1 
        2  2326 1 1  39 ALA CA   C  -4.761  -5.534   5.189 1.00 . A A . 117 ALA CA   1 1 
        2  2327 1 1  39 ALA CB   C  -5.455  -5.896   6.493 1.00 . A A . 117 ALA CB   1 1 
        2  2328 1 1  39 ALA H    H  -4.254  -7.574   5.063 1.00 . A A . 117 ALA H    1 1 
        2  2329 1 1  39 ALA HA   H  -5.489  -5.077   4.536 1.00 . A A . 117 ALA HA   1 1 
        2  2330 1 1  39 ALA HB1  H  -5.110  -6.866   6.826 1.00 . A A . 117 ALA HB1  1 1 
        2  2331 1 1  39 ALA HB2  H  -6.523  -5.929   6.336 1.00 . A A . 117 ALA HB2  1 1 
        2  2332 1 1  39 ALA HB3  H  -5.224  -5.155   7.244 1.00 . A A . 117 ALA HB3  1 1 
        2  2333 1 1  39 ALA N    N  -4.270  -6.742   4.544 1.00 . A A . 117 ALA N    1 1 
        2  2334 1 1  39 ALA O    O  -3.828  -3.330   5.364 1.00 . A A . 117 ALA O    1 1 
        2  2335 1 1  40 LEU C    C  -0.833  -3.494   4.756 1.00 . A A . 118 LEU C    1 1 
        2  2336 1 1  40 LEU CA   C  -1.290  -4.207   6.026 1.00 . A A . 118 LEU CA   1 1 
        2  2337 1 1  40 LEU CB   C  -0.141  -5.037   6.603 1.00 . A A . 118 LEU CB   1 1 
        2  2338 1 1  40 LEU CD1  C   1.885  -4.780   8.059 1.00 . A A . 118 LEU CD1  1 1 
        2  2339 1 1  40 LEU CD2  C   2.064  -4.404   5.593 1.00 . A A . 118 LEU CD2  1 1 
        2  2340 1 1  40 LEU CG   C   1.168  -4.275   6.816 1.00 . A A . 118 LEU CG   1 1 
        2  2341 1 1  40 LEU H    H  -2.342  -6.035   5.809 1.00 . A A . 118 LEU H    1 1 
        2  2342 1 1  40 LEU HA   H  -1.587  -3.466   6.754 1.00 . A A . 118 LEU HA   1 1 
        2  2343 1 1  40 LEU HB2  H  -0.459  -5.440   7.555 1.00 . A A . 118 LEU HB2  1 1 
        2  2344 1 1  40 LEU HB3  H   0.053  -5.860   5.931 1.00 . A A . 118 LEU HB3  1 1 
        2  2345 1 1  40 LEU HD11 H   2.347  -3.949   8.571 1.00 . A A . 118 LEU HD11 1 1 
        2  2346 1 1  40 LEU HD12 H   2.644  -5.493   7.772 1.00 . A A . 118 LEU HD12 1 1 
        2  2347 1 1  40 LEU HD13 H   1.173  -5.257   8.716 1.00 . A A . 118 LEU HD13 1 1 
        2  2348 1 1  40 LEU HD21 H   1.464  -4.659   4.732 1.00 . A A . 118 LEU HD21 1 1 
        2  2349 1 1  40 LEU HD22 H   2.796  -5.180   5.763 1.00 . A A . 118 LEU HD22 1 1 
        2  2350 1 1  40 LEU HD23 H   2.569  -3.467   5.415 1.00 . A A . 118 LEU HD23 1 1 
        2  2351 1 1  40 LEU HG   H   0.948  -3.227   6.961 1.00 . A A . 118 LEU HG   1 1 
        2  2352 1 1  40 LEU N    N  -2.445  -5.059   5.759 1.00 . A A . 118 LEU N    1 1 
        2  2353 1 1  40 LEU O    O  -0.682  -2.271   4.738 1.00 . A A . 118 LEU O    1 1 
        2  2354 1 1  41 LEU C    C  -1.231  -2.738   1.880 1.00 . A A . 119 LEU C    1 1 
        2  2355 1 1  41 LEU CA   C  -0.188  -3.708   2.419 1.00 . A A . 119 LEU CA   1 1 
        2  2356 1 1  41 LEU CB   C   0.058  -4.828   1.406 1.00 . A A . 119 LEU CB   1 1 
        2  2357 1 1  41 LEU CD1  C   0.863  -7.174   1.045 1.00 . A A . 119 LEU CD1  1 1 
        2  2358 1 1  41 LEU CD2  C   2.480  -5.392   1.723 1.00 . A A . 119 LEU CD2  1 1 
        2  2359 1 1  41 LEU CG   C   1.052  -5.901   1.854 1.00 . A A . 119 LEU CG   1 1 
        2  2360 1 1  41 LEU H    H  -0.763  -5.230   3.771 1.00 . A A . 119 LEU H    1 1 
        2  2361 1 1  41 LEU HA   H   0.735  -3.172   2.585 1.00 . A A . 119 LEU HA   1 1 
        2  2362 1 1  41 LEU HB2  H  -0.887  -5.308   1.197 1.00 . A A . 119 LEU HB2  1 1 
        2  2363 1 1  41 LEU HB3  H   0.427  -4.386   0.494 1.00 . A A . 119 LEU HB3  1 1 
        2  2364 1 1  41 LEU HD11 H   0.571  -6.920   0.036 1.00 . A A . 119 LEU HD11 1 1 
        2  2365 1 1  41 LEU HD12 H   0.093  -7.779   1.501 1.00 . A A . 119 LEU HD12 1 1 
        2  2366 1 1  41 LEU HD13 H   1.790  -7.728   1.023 1.00 . A A . 119 LEU HD13 1 1 
        2  2367 1 1  41 LEU HD21 H   2.674  -5.122   0.696 1.00 . A A . 119 LEU HD21 1 1 
        2  2368 1 1  41 LEU HD22 H   3.168  -6.168   2.028 1.00 . A A . 119 LEU HD22 1 1 
        2  2369 1 1  41 LEU HD23 H   2.613  -4.526   2.354 1.00 . A A . 119 LEU HD23 1 1 
        2  2370 1 1  41 LEU HG   H   0.874  -6.136   2.893 1.00 . A A . 119 LEU HG   1 1 
        2  2371 1 1  41 LEU N    N  -0.621  -4.265   3.695 1.00 . A A . 119 LEU N    1 1 
        2  2372 1 1  41 LEU O    O  -0.899  -1.726   1.262 1.00 . A A . 119 LEU O    1 1 
        2  2373 1 1  42 GLY C    C  -3.645  -0.902   2.461 1.00 . A A . 120 GLY C    1 1 
        2  2374 1 1  42 GLY CA   C  -3.577  -2.199   1.680 1.00 . A A . 120 GLY CA   1 1 
        2  2375 1 1  42 GLY H    H  -2.695  -3.865   2.642 1.00 . A A . 120 GLY H    1 1 
        2  2376 1 1  42 GLY HA2  H  -3.430  -1.971   0.634 1.00 . A A . 120 GLY HA2  1 1 
        2  2377 1 1  42 GLY HA3  H  -4.512  -2.726   1.796 1.00 . A A . 120 GLY HA3  1 1 
        2  2378 1 1  42 GLY N    N  -2.497  -3.052   2.131 1.00 . A A . 120 GLY N    1 1 
        2  2379 1 1  42 GLY O    O  -3.680   0.181   1.879 1.00 . A A . 120 GLY O    1 1 
        2  2380 1 1  43 SER C    C  -2.627   1.152   4.343 1.00 . A A . 121 SER C    1 1 
        2  2381 1 1  43 SER CA   C  -3.734   0.150   4.659 1.00 . A A . 121 SER CA   1 1 
        2  2382 1 1  43 SER CB   C  -3.638  -0.281   6.124 1.00 . A A . 121 SER CB   1 1 
        2  2383 1 1  43 SER H    H  -3.637  -1.910   4.187 1.00 . A A . 121 SER H    1 1 
        2  2384 1 1  43 SER HA   H  -4.689   0.626   4.499 1.00 . A A . 121 SER HA   1 1 
        2  2385 1 1  43 SER HB2  H  -2.691  -0.773   6.291 1.00 . A A . 121 SER HB2  1 1 
        2  2386 1 1  43 SER HB3  H  -3.708   0.590   6.758 1.00 . A A . 121 SER HB3  1 1 
        2  2387 1 1  43 SER HG   H  -4.615  -1.966   5.919 1.00 . A A . 121 SER HG   1 1 
        2  2388 1 1  43 SER N    N  -3.665  -1.017   3.785 1.00 . A A . 121 SER N    1 1 
        2  2389 1 1  43 SER O    O  -2.832   2.363   4.433 1.00 . A A . 121 SER O    1 1 
        2  2390 1 1  43 SER OG   O  -4.681  -1.177   6.462 1.00 . A A . 121 SER OG   1 1 
        2  2391 1 1  44 TYR C    C  -0.534   2.184   2.289 1.00 . A A . 122 TYR C    1 1 
        2  2392 1 1  44 TYR CA   C  -0.328   1.510   3.641 1.00 . A A . 122 TYR CA   1 1 
        2  2393 1 1  44 TYR CB   C   0.973   0.707   3.636 1.00 . A A . 122 TYR CB   1 1 
        2  2394 1 1  44 TYR CD1  C   1.607   1.413   5.975 1.00 . A A . 122 TYR CD1  1 1 
        2  2395 1 1  44 TYR CD2  C   1.893  -0.876   5.377 1.00 . A A . 122 TYR CD2  1 1 
        2  2396 1 1  44 TYR CE1  C   2.087   1.147   7.243 1.00 . A A . 122 TYR CE1  1 1 
        2  2397 1 1  44 TYR CE2  C   2.375  -1.151   6.643 1.00 . A A . 122 TYR CE2  1 1 
        2  2398 1 1  44 TYR CG   C   1.502   0.409   5.022 1.00 . A A . 122 TYR CG   1 1 
        2  2399 1 1  44 TYR CZ   C   2.470  -0.137   7.572 1.00 . A A . 122 TYR CZ   1 1 
        2  2400 1 1  44 TYR H    H  -1.342  -0.326   3.903 1.00 . A A . 122 TYR H    1 1 
        2  2401 1 1  44 TYR HA   H  -0.266   2.273   4.403 1.00 . A A . 122 TYR HA   1 1 
        2  2402 1 1  44 TYR HB2  H   0.806  -0.235   3.135 1.00 . A A . 122 TYR HB2  1 1 
        2  2403 1 1  44 TYR HB3  H   1.730   1.264   3.104 1.00 . A A . 122 TYR HB3  1 1 
        2  2404 1 1  44 TYR HD1  H   1.305   2.417   5.716 1.00 . A A . 122 TYR HD1  1 1 
        2  2405 1 1  44 TYR HD2  H   1.818  -1.669   4.647 1.00 . A A . 122 TYR HD2  1 1 
        2  2406 1 1  44 TYR HE1  H   2.162   1.942   7.970 1.00 . A A . 122 TYR HE1  1 1 
        2  2407 1 1  44 TYR HE2  H   2.674  -2.156   6.900 1.00 . A A . 122 TYR HE2  1 1 
        2  2408 1 1  44 TYR HH   H   3.447   0.347   9.157 1.00 . A A . 122 TYR HH   1 1 
        2  2409 1 1  44 TYR N    N  -1.456   0.646   3.968 1.00 . A A . 122 TYR N    1 1 
        2  2410 1 1  44 TYR O    O  -0.302   3.384   2.142 1.00 . A A . 122 TYR O    1 1 
        2  2411 1 1  44 TYR OH   O   2.949  -0.407   8.834 1.00 . A A . 122 TYR OH   1 1 
        2  2412 1 1  45 THR C    C  -2.258   3.053   0.016 1.00 . A A . 123 THR C    1 1 
        2  2413 1 1  45 THR CA   C  -1.219   1.940  -0.031 1.00 . A A . 123 THR CA   1 1 
        2  2414 1 1  45 THR CB   C  -1.683   0.828  -0.973 1.00 . A A . 123 THR CB   1 1 
        2  2415 1 1  45 THR CG2  C  -1.918   1.303  -2.391 1.00 . A A . 123 THR CG2  1 1 
        2  2416 1 1  45 THR H    H  -1.150   0.459   1.482 1.00 . A A . 123 THR H    1 1 
        2  2417 1 1  45 THR HA   H  -0.289   2.349  -0.398 1.00 . A A . 123 THR HA   1 1 
        2  2418 1 1  45 THR HB   H  -2.613   0.421  -0.603 1.00 . A A . 123 THR HB   1 1 
        2  2419 1 1  45 THR HG1  H  -0.581  -0.560  -0.139 1.00 . A A . 123 THR HG1  1 1 
        2  2420 1 1  45 THR HG21 H  -2.496   2.215  -2.373 1.00 . A A . 123 THR HG21 1 1 
        2  2421 1 1  45 THR HG22 H  -2.458   0.546  -2.940 1.00 . A A . 123 THR HG22 1 1 
        2  2422 1 1  45 THR HG23 H  -0.968   1.488  -2.871 1.00 . A A . 123 THR HG23 1 1 
        2  2423 1 1  45 THR N    N  -0.978   1.408   1.305 1.00 . A A . 123 THR N    1 1 
        2  2424 1 1  45 THR O    O  -2.100   4.091  -0.626 1.00 . A A . 123 THR O    1 1 
        2  2425 1 1  45 THR OG1  O  -0.729  -0.218  -1.024 1.00 . A A . 123 THR OG1  1 1 
        2  2426 1 1  46 ILE C    C  -3.813   5.108   1.551 1.00 . A A . 124 ILE C    1 1 
        2  2427 1 1  46 ILE CA   C  -4.370   3.833   0.928 1.00 . A A . 124 ILE CA   1 1 
        2  2428 1 1  46 ILE CB   C  -5.539   3.310   1.789 1.00 . A A . 124 ILE CB   1 1 
        2  2429 1 1  46 ILE CD1  C  -6.899   2.225  -0.080 1.00 . A A . 124 ILE CD1  1 1 
        2  2430 1 1  46 ILE CG1  C  -6.105   2.016   1.193 1.00 . A A . 124 ILE CG1  1 1 
        2  2431 1 1  46 ILE CG2  C  -6.631   4.365   1.909 1.00 . A A . 124 ILE CG2  1 1 
        2  2432 1 1  46 ILE H    H  -3.386   1.995   1.287 1.00 . A A . 124 ILE H    1 1 
        2  2433 1 1  46 ILE HA   H  -4.747   4.060  -0.060 1.00 . A A . 124 ILE HA   1 1 
        2  2434 1 1  46 ILE HB   H  -5.162   3.105   2.779 1.00 . A A . 124 ILE HB   1 1 
        2  2435 1 1  46 ILE HD11 H  -7.304   1.280  -0.410 1.00 . A A . 124 ILE HD11 1 1 
        2  2436 1 1  46 ILE HD12 H  -6.252   2.627  -0.846 1.00 . A A . 124 ILE HD12 1 1 
        2  2437 1 1  46 ILE HD13 H  -7.707   2.916   0.110 1.00 . A A . 124 ILE HD13 1 1 
        2  2438 1 1  46 ILE HG12 H  -5.290   1.346   0.966 1.00 . A A . 124 ILE HG12 1 1 
        2  2439 1 1  46 ILE HG13 H  -6.756   1.549   1.918 1.00 . A A . 124 ILE HG13 1 1 
        2  2440 1 1  46 ILE HG21 H  -6.193   5.302   2.221 1.00 . A A . 124 ILE HG21 1 1 
        2  2441 1 1  46 ILE HG22 H  -7.359   4.048   2.640 1.00 . A A . 124 ILE HG22 1 1 
        2  2442 1 1  46 ILE HG23 H  -7.113   4.494   0.952 1.00 . A A . 124 ILE HG23 1 1 
        2  2443 1 1  46 ILE N    N  -3.317   2.837   0.790 1.00 . A A . 124 ILE N    1 1 
        2  2444 1 1  46 ILE O    O  -4.056   6.208   1.059 1.00 . A A . 124 ILE O    1 1 
        2  2445 1 1  47 GLN C    C  -1.555   6.877   2.381 1.00 . A A . 125 GLN C    1 1 
        2  2446 1 1  47 GLN CA   C  -2.459   6.087   3.324 1.00 . A A . 125 GLN CA   1 1 
        2  2447 1 1  47 GLN CB   C  -1.657   5.606   4.537 1.00 . A A . 125 GLN CB   1 1 
        2  2448 1 1  47 GLN CD   C  -1.780   7.135   6.545 1.00 . A A . 125 GLN CD   1 1 
        2  2449 1 1  47 GLN CG   C  -0.991   6.729   5.316 1.00 . A A . 125 GLN CG   1 1 
        2  2450 1 1  47 GLN H    H  -2.901   4.048   2.980 1.00 . A A . 125 GLN H    1 1 
        2  2451 1 1  47 GLN HA   H  -3.257   6.730   3.662 1.00 . A A . 125 GLN HA   1 1 
        2  2452 1 1  47 GLN HB2  H  -2.321   5.079   5.205 1.00 . A A . 125 GLN HB2  1 1 
        2  2453 1 1  47 GLN HB3  H  -0.889   4.927   4.198 1.00 . A A . 125 GLN HB3  1 1 
        2  2454 1 1  47 GLN HE21 H  -1.305   9.043   6.253 1.00 . A A . 125 GLN HE21 1 1 
        2  2455 1 1  47 GLN HE22 H  -2.300   8.719   7.627 1.00 . A A . 125 GLN HE22 1 1 
        2  2456 1 1  47 GLN HG2  H  -0.011   6.400   5.629 1.00 . A A . 125 GLN HG2  1 1 
        2  2457 1 1  47 GLN HG3  H  -0.891   7.589   4.670 1.00 . A A . 125 GLN HG3  1 1 
        2  2458 1 1  47 GLN N    N  -3.058   4.951   2.635 1.00 . A A . 125 GLN N    1 1 
        2  2459 1 1  47 GLN NE2  N  -1.797   8.430   6.838 1.00 . A A . 125 GLN NE2  1 1 
        2  2460 1 1  47 GLN O    O  -1.505   8.104   2.435 1.00 . A A . 125 GLN O    1 1 
        2  2461 1 1  47 GLN OE1  O  -2.369   6.293   7.224 1.00 . A A . 125 GLN OE1  1 1 
        2  2462 1 1  48 SER C    C  -0.713   7.375  -0.625 1.00 . A A . 126 SER C    1 1 
        2  2463 1 1  48 SER CA   C   0.059   6.800   0.561 1.00 . A A . 126 SER CA   1 1 
        2  2464 1 1  48 SER CB   C   1.102   5.796   0.067 1.00 . A A . 126 SER CB   1 1 
        2  2465 1 1  48 SER H    H  -0.923   5.188   1.520 1.00 . A A . 126 SER H    1 1 
        2  2466 1 1  48 SER HA   H   0.564   7.606   1.070 1.00 . A A . 126 SER HA   1 1 
        2  2467 1 1  48 SER HB2  H   1.184   4.986   0.777 1.00 . A A . 126 SER HB2  1 1 
        2  2468 1 1  48 SER HB3  H   0.795   5.404  -0.892 1.00 . A A . 126 SER HB3  1 1 
        2  2469 1 1  48 SER HG   H   2.626   6.816   0.755 1.00 . A A . 126 SER HG   1 1 
        2  2470 1 1  48 SER N    N  -0.842   6.164   1.516 1.00 . A A . 126 SER N    1 1 
        2  2471 1 1  48 SER O    O  -0.259   8.314  -1.278 1.00 . A A . 126 SER O    1 1 
        2  2472 1 1  48 SER OG   O   2.372   6.408  -0.076 1.00 . A A . 126 SER OG   1 1 
        2  2473 1 1  49 GLU C    C  -3.508   8.471  -1.660 1.00 . A A . 127 GLU C    1 1 
        2  2474 1 1  49 GLU CA   C  -2.700   7.233  -2.023 1.00 . A A . 127 GLU CA   1 1 
        2  2475 1 1  49 GLU CB   C  -3.645   6.111  -2.460 1.00 . A A . 127 GLU CB   1 1 
        2  2476 1 1  49 GLU CD   C  -3.497   6.256  -4.978 1.00 . A A . 127 GLU CD   1 1 
        2  2477 1 1  49 GLU CG   C  -3.216   5.420  -3.744 1.00 . A A . 127 GLU CG   1 1 
        2  2478 1 1  49 GLU H    H  -2.170   6.039  -0.353 1.00 . A A . 127 GLU H    1 1 
        2  2479 1 1  49 GLU HA   H  -2.043   7.476  -2.844 1.00 . A A . 127 GLU HA   1 1 
        2  2480 1 1  49 GLU HB2  H  -3.692   5.370  -1.676 1.00 . A A . 127 GLU HB2  1 1 
        2  2481 1 1  49 GLU HB3  H  -4.634   6.525  -2.612 1.00 . A A . 127 GLU HB3  1 1 
        2  2482 1 1  49 GLU HG2  H  -2.155   5.225  -3.695 1.00 . A A . 127 GLU HG2  1 1 
        2  2483 1 1  49 GLU HG3  H  -3.750   4.485  -3.830 1.00 . A A . 127 GLU HG3  1 1 
        2  2484 1 1  49 GLU N    N  -1.874   6.792  -0.906 1.00 . A A . 127 GLU N    1 1 
        2  2485 1 1  49 GLU O    O  -3.664   9.383  -2.472 1.00 . A A . 127 GLU O    1 1 
        2  2486 1 1  49 GLU OE1  O  -2.787   7.261  -5.188 1.00 . A A . 127 GLU OE1  1 1 
        2  2487 1 1  49 GLU OE2  O  -4.429   5.905  -5.733 1.00 . A A . 127 GLU OE2  1 1 
        2  2488 1 1  50 LEU C    C  -4.201  10.387   1.130 1.00 . A A . 128 LEU C    1 1 
        2  2489 1 1  50 LEU CA   C  -4.871   9.592   0.009 1.00 . A A . 128 LEU CA   1 1 
        2  2490 1 1  50 LEU CB   C  -6.209   9.042   0.489 1.00 . A A . 128 LEU CB   1 1 
        2  2491 1 1  50 LEU CD1  C  -7.493   6.928   0.068 1.00 . A A . 128 LEU CD1  1 1 
        2  2492 1 1  50 LEU CD2  C  -8.102   9.019  -1.158 1.00 . A A . 128 LEU CD2  1 1 
        2  2493 1 1  50 LEU CG   C  -6.966   8.212  -0.551 1.00 . A A . 128 LEU CG   1 1 
        2  2494 1 1  50 LEU H    H  -3.915   7.721   0.149 1.00 . A A . 128 LEU H    1 1 
        2  2495 1 1  50 LEU HA   H  -5.044  10.248  -0.830 1.00 . A A . 128 LEU HA   1 1 
        2  2496 1 1  50 LEU HB2  H  -6.020   8.417   1.351 1.00 . A A . 128 LEU HB2  1 1 
        2  2497 1 1  50 LEU HB3  H  -6.834   9.870   0.789 1.00 . A A . 128 LEU HB3  1 1 
        2  2498 1 1  50 LEU HD11 H  -6.830   6.112  -0.179 1.00 . A A . 128 LEU HD11 1 1 
        2  2499 1 1  50 LEU HD12 H  -8.480   6.719  -0.319 1.00 . A A . 128 LEU HD12 1 1 
        2  2500 1 1  50 LEU HD13 H  -7.542   7.039   1.141 1.00 . A A . 128 LEU HD13 1 1 
        2  2501 1 1  50 LEU HD21 H  -9.029   8.765  -0.665 1.00 . A A . 128 LEU HD21 1 1 
        2  2502 1 1  50 LEU HD22 H  -8.180   8.791  -2.211 1.00 . A A . 128 LEU HD22 1 1 
        2  2503 1 1  50 LEU HD23 H  -7.903  10.073  -1.032 1.00 . A A . 128 LEU HD23 1 1 
        2  2504 1 1  50 LEU HG   H  -6.287   7.942  -1.346 1.00 . A A . 128 LEU HG   1 1 
        2  2505 1 1  50 LEU N    N  -4.047   8.484  -0.449 1.00 . A A . 128 LEU N    1 1 
        2  2506 1 1  50 LEU O    O  -4.777  11.348   1.641 1.00 . A A . 128 LEU O    1 1 
        2  2507 1 1  51 GLY C    C  -2.739  10.292   3.953 1.00 . A A . 129 GLY C    1 1 
        2  2508 1 1  51 GLY CA   C  -2.284  10.703   2.565 1.00 . A A . 129 GLY CA   1 1 
        2  2509 1 1  51 GLY H    H  -2.564   9.228   1.071 1.00 . A A . 129 GLY H    1 1 
        2  2510 1 1  51 GLY HA2  H  -1.227  10.503   2.472 1.00 . A A . 129 GLY HA2  1 1 
        2  2511 1 1  51 GLY HA3  H  -2.450  11.763   2.443 1.00 . A A . 129 GLY HA3  1 1 
        2  2512 1 1  51 GLY N    N  -2.989   9.995   1.510 1.00 . A A . 129 GLY N    1 1 
        2  2513 1 1  51 GLY O    O  -2.382   9.219   4.437 1.00 . A A . 129 GLY O    1 1 
        2  2514 1 1  52 ASP C    C  -5.487  10.430   5.895 1.00 . A A . 130 ASP C    1 1 
        2  2515 1 1  52 ASP CA   C  -4.025  10.863   5.938 1.00 . A A . 130 ASP CA   1 1 
        2  2516 1 1  52 ASP CB   C  -3.866  12.094   6.835 1.00 . A A . 130 ASP CB   1 1 
        2  2517 1 1  52 ASP CG   C  -3.128  11.780   8.122 1.00 . A A . 130 ASP CG   1 1 
        2  2518 1 1  52 ASP H    H  -3.778  11.990   4.163 1.00 . A A . 130 ASP H    1 1 
        2  2519 1 1  52 ASP HA   H  -3.435  10.056   6.344 1.00 . A A . 130 ASP HA   1 1 
        2  2520 1 1  52 ASP HB2  H  -3.311  12.852   6.301 1.00 . A A . 130 ASP HB2  1 1 
        2  2521 1 1  52 ASP HB3  H  -4.843  12.480   7.086 1.00 . A A . 130 ASP HB3  1 1 
        2  2522 1 1  52 ASP N    N  -3.526  11.148   4.597 1.00 . A A . 130 ASP N    1 1 
        2  2523 1 1  52 ASP O    O  -6.087  10.337   4.824 1.00 . A A . 130 ASP O    1 1 
        2  2524 1 1  52 ASP OD1  O  -2.048  11.156   8.051 1.00 . A A . 130 ASP OD1  1 1 
        2  2525 1 1  52 ASP OD2  O  -3.630  12.159   9.202 1.00 . A A . 130 ASP OD2  1 1 
        2  2526 1 1  53 TYR C    C  -8.352  10.908   7.534 1.00 . A A . 131 TYR C    1 1 
        2  2527 1 1  53 TYR CA   C  -7.447   9.737   7.164 1.00 . A A . 131 TYR CA   1 1 
        2  2528 1 1  53 TYR CB   C  -7.589   8.621   8.200 1.00 . A A . 131 TYR CB   1 1 
        2  2529 1 1  53 TYR CD1  C -10.067   8.248   7.892 1.00 . A A . 131 TYR CD1  1 1 
        2  2530 1 1  53 TYR CD2  C  -8.628   6.350   7.825 1.00 . A A . 131 TYR CD2  1 1 
        2  2531 1 1  53 TYR CE1  C -11.162   7.431   7.681 1.00 . A A . 131 TYR CE1  1 1 
        2  2532 1 1  53 TYR CE2  C  -9.717   5.526   7.614 1.00 . A A . 131 TYR CE2  1 1 
        2  2533 1 1  53 TYR CG   C  -8.784   7.723   7.967 1.00 . A A . 131 TYR CG   1 1 
        2  2534 1 1  53 TYR CZ   C -10.981   6.072   7.543 1.00 . A A . 131 TYR CZ   1 1 
        2  2535 1 1  53 TYR H    H  -5.525  10.253   7.888 1.00 . A A . 131 TYR H    1 1 
        2  2536 1 1  53 TYR HA   H  -7.745   9.358   6.198 1.00 . A A . 131 TYR HA   1 1 
        2  2537 1 1  53 TYR HB2  H  -6.703   8.004   8.178 1.00 . A A . 131 TYR HB2  1 1 
        2  2538 1 1  53 TYR HB3  H  -7.691   9.061   9.182 1.00 . A A . 131 TYR HB3  1 1 
        2  2539 1 1  53 TYR HD1  H -10.205   9.313   8.000 1.00 . A A . 131 TYR HD1  1 1 
        2  2540 1 1  53 TYR HD2  H  -7.636   5.927   7.882 1.00 . A A . 131 TYR HD2  1 1 
        2  2541 1 1  53 TYR HE1  H -12.152   7.859   7.625 1.00 . A A . 131 TYR HE1  1 1 
        2  2542 1 1  53 TYR HE2  H  -9.575   4.462   7.505 1.00 . A A . 131 TYR HE2  1 1 
        2  2543 1 1  53 TYR HH   H -12.058   4.934   6.429 1.00 . A A . 131 TYR HH   1 1 
        2  2544 1 1  53 TYR N    N  -6.055  10.163   7.068 1.00 . A A . 131 TYR N    1 1 
        2  2545 1 1  53 TYR O    O  -8.120  11.594   8.530 1.00 . A A . 131 TYR O    1 1 
        2  2546 1 1  53 TYR OH   O -12.069   5.255   7.334 1.00 . A A . 131 TYR OH   1 1 
        2  2547 1 1  54 ASP C    C -11.737  11.826   6.527 1.00 . A A . 132 ASP C    1 1 
        2  2548 1 1  54 ASP CA   C -10.327  12.217   6.970 1.00 . A A . 132 ASP CA   1 1 
        2  2549 1 1  54 ASP CB   C  -9.881  13.479   6.232 1.00 . A A . 132 ASP CB   1 1 
        2  2550 1 1  54 ASP CG   C  -8.529  13.979   6.703 1.00 . A A . 132 ASP CG   1 1 
        2  2551 1 1  54 ASP H    H  -9.518  10.548   5.950 1.00 . A A . 132 ASP H    1 1 
        2  2552 1 1  54 ASP HA   H -10.336  12.417   8.031 1.00 . A A . 132 ASP HA   1 1 
        2  2553 1 1  54 ASP HB2  H  -9.816  13.267   5.175 1.00 . A A . 132 ASP HB2  1 1 
        2  2554 1 1  54 ASP HB3  H -10.609  14.259   6.393 1.00 . A A . 132 ASP HB3  1 1 
        2  2555 1 1  54 ASP N    N  -9.385  11.130   6.727 1.00 . A A . 132 ASP N    1 1 
        2  2556 1 1  54 ASP O    O -12.094  11.982   5.360 1.00 . A A . 132 ASP O    1 1 
        2  2557 1 1  54 ASP OD1  O  -8.366  14.187   7.924 1.00 . A A . 132 ASP OD1  1 1 
        2  2558 1 1  54 ASP OD2  O  -7.634  14.161   5.852 1.00 . A A . 132 ASP OD2  1 1 
        2  2559 1 1  55 PRO C    C -14.817  12.053   6.723 1.00 . A A . 133 PRO C    1 1 
        2  2560 1 1  55 PRO CA   C -13.934  10.887   7.154 1.00 . A A . 133 PRO CA   1 1 
        2  2561 1 1  55 PRO CB   C -14.440  10.299   8.480 1.00 . A A . 133 PRO CB   1 1 
        2  2562 1 1  55 PRO CD   C -12.217  11.078   8.868 1.00 . A A . 133 PRO CD   1 1 
        2  2563 1 1  55 PRO CG   C -13.214  10.039   9.289 1.00 . A A . 133 PRO CG   1 1 
        2  2564 1 1  55 PRO HA   H -13.953  10.124   6.390 1.00 . A A . 133 PRO HA   1 1 
        2  2565 1 1  55 PRO HB2  H -15.089  11.012   8.967 1.00 . A A . 133 PRO HB2  1 1 
        2  2566 1 1  55 PRO HB3  H -14.983   9.386   8.286 1.00 . A A . 133 PRO HB3  1 1 
        2  2567 1 1  55 PRO HD2  H -12.343  11.981   9.448 1.00 . A A . 133 PRO HD2  1 1 
        2  2568 1 1  55 PRO HD3  H -11.211  10.700   8.966 1.00 . A A . 133 PRO HD3  1 1 
        2  2569 1 1  55 PRO HG2  H -13.439  10.139  10.340 1.00 . A A . 133 PRO HG2  1 1 
        2  2570 1 1  55 PRO HG3  H -12.837   9.050   9.077 1.00 . A A . 133 PRO HG3  1 1 
        2  2571 1 1  55 PRO N    N -12.559  11.305   7.456 1.00 . A A . 133 PRO N    1 1 
        2  2572 1 1  55 PRO O    O -15.717  11.891   5.899 1.00 . A A . 133 PRO O    1 1 
        2  2573 1 1  56 GLU C    C -14.946  14.976   5.596 1.00 . A A . 134 GLU C    1 1 
        2  2574 1 1  56 GLU CA   C -15.334  14.420   6.963 1.00 . A A . 134 GLU CA   1 1 
        2  2575 1 1  56 GLU CB   C -15.141  15.493   8.037 1.00 . A A . 134 GLU CB   1 1 
        2  2576 1 1  56 GLU CD   C -13.425  15.286   9.880 1.00 . A A . 134 GLU CD   1 1 
        2  2577 1 1  56 GLU CG   C -13.691  15.697   8.445 1.00 . A A . 134 GLU CG   1 1 
        2  2578 1 1  56 GLU H    H -13.829  13.293   7.940 1.00 . A A . 134 GLU H    1 1 
        2  2579 1 1  56 GLU HA   H -16.376  14.136   6.937 1.00 . A A . 134 GLU HA   1 1 
        2  2580 1 1  56 GLU HB2  H -15.522  16.432   7.662 1.00 . A A . 134 GLU HB2  1 1 
        2  2581 1 1  56 GLU HB3  H -15.704  15.212   8.915 1.00 . A A . 134 GLU HB3  1 1 
        2  2582 1 1  56 GLU HG2  H -13.062  15.106   7.796 1.00 . A A . 134 GLU HG2  1 1 
        2  2583 1 1  56 GLU HG3  H -13.442  16.742   8.332 1.00 . A A . 134 GLU HG3  1 1 
        2  2584 1 1  56 GLU N    N -14.557  13.228   7.288 1.00 . A A . 134 GLU N    1 1 
        2  2585 1 1  56 GLU O    O -15.766  15.584   4.908 1.00 . A A . 134 GLU O    1 1 
        2  2586 1 1  56 GLU OE1  O -13.699  14.117  10.224 1.00 . A A . 134 GLU OE1  1 1 
        2  2587 1 1  56 GLU OE2  O -12.942  16.134  10.661 1.00 . A A . 134 GLU OE2  1 1 
        2  2588 1 1  57 LEU C    C -13.577  14.298   2.795 1.00 . A A . 135 LEU C    1 1 
        2  2589 1 1  57 LEU CA   C -13.202  15.254   3.923 1.00 . A A . 135 LEU CA   1 1 
        2  2590 1 1  57 LEU CB   C -11.684  15.434   3.968 1.00 . A A . 135 LEU CB   1 1 
        2  2591 1 1  57 LEU CD1  C -11.865  17.933   3.933 1.00 . A A . 135 LEU CD1  1 1 
        2  2592 1 1  57 LEU CD2  C -11.483  16.740   6.101 1.00 . A A . 135 LEU CD2  1 1 
        2  2593 1 1  57 LEU CG   C -11.203  16.739   4.604 1.00 . A A . 135 LEU CG   1 1 
        2  2594 1 1  57 LEU H    H -13.082  14.279   5.799 1.00 . A A . 135 LEU H    1 1 
        2  2595 1 1  57 LEU HA   H -13.662  16.212   3.734 1.00 . A A . 135 LEU HA   1 1 
        2  2596 1 1  57 LEU HB2  H -11.262  14.610   4.525 1.00 . A A . 135 LEU HB2  1 1 
        2  2597 1 1  57 LEU HB3  H -11.307  15.393   2.957 1.00 . A A . 135 LEU HB3  1 1 
        2  2598 1 1  57 LEU HD11 H -11.339  18.836   4.205 1.00 . A A . 135 LEU HD11 1 1 
        2  2599 1 1  57 LEU HD12 H -12.893  18.004   4.257 1.00 . A A . 135 LEU HD12 1 1 
        2  2600 1 1  57 LEU HD13 H -11.833  17.807   2.861 1.00 . A A . 135 LEU HD13 1 1 
        2  2601 1 1  57 LEU HD21 H -11.872  15.777   6.396 1.00 . A A . 135 LEU HD21 1 1 
        2  2602 1 1  57 LEU HD22 H -12.209  17.506   6.333 1.00 . A A . 135 LEU HD22 1 1 
        2  2603 1 1  57 LEU HD23 H -10.567  16.938   6.638 1.00 . A A . 135 LEU HD23 1 1 
        2  2604 1 1  57 LEU HG   H -10.136  16.827   4.463 1.00 . A A . 135 LEU HG   1 1 
        2  2605 1 1  57 LEU N    N -13.692  14.768   5.208 1.00 . A A . 135 LEU N    1 1 
        2  2606 1 1  57 LEU O    O -14.040  14.723   1.737 1.00 . A A . 135 LEU O    1 1 
        2  2607 1 1  58 HIS C    C -14.823  11.089   2.507 1.00 . A A . 136 HIS C    1 1 
        2  2608 1 1  58 HIS CA   C -13.690  11.992   2.028 1.00 . A A . 136 HIS CA   1 1 
        2  2609 1 1  58 HIS CB   C -12.449  11.156   1.707 1.00 . A A . 136 HIS CB   1 1 
        2  2610 1 1  58 HIS CD2  C -10.720  13.035   1.242 1.00 . A A . 136 HIS CD2  1 1 
        2  2611 1 1  58 HIS CE1  C -10.039  12.363  -0.730 1.00 . A A . 136 HIS CE1  1 1 
        2  2612 1 1  58 HIS CG   C -11.404  11.906   0.938 1.00 . A A . 136 HIS CG   1 1 
        2  2613 1 1  58 HIS H    H -13.001  12.727   3.890 1.00 . A A . 136 HIS H    1 1 
        2  2614 1 1  58 HIS HA   H -14.010  12.500   1.133 1.00 . A A . 136 HIS HA   1 1 
        2  2615 1 1  58 HIS HB2  H -12.002  10.817   2.629 1.00 . A A . 136 HIS HB2  1 1 
        2  2616 1 1  58 HIS HB3  H -12.743  10.298   1.119 1.00 . A A . 136 HIS HB3  1 1 
        2  2617 1 1  58 HIS HD1  H -11.261  10.723  -0.800 1.00 . A A . 136 HIS HD1  1 1 
        2  2618 1 1  58 HIS HD2  H -10.818  13.620   2.146 1.00 . A A . 136 HIS HD2  1 1 
        2  2619 1 1  58 HIS HE1  H  -9.512  12.306  -1.671 1.00 . A A . 136 HIS HE1  1 1 
        2  2620 1 1  58 HIS HE2  H  -9.327  14.100   0.087 1.00 . A A . 136 HIS HE2  1 1 
        2  2621 1 1  58 HIS N    N -13.373  13.006   3.027 1.00 . A A . 136 HIS N    1 1 
        2  2622 1 1  58 HIS ND1  N -10.955  11.511  -0.304 1.00 . A A . 136 HIS ND1  1 1 
        2  2623 1 1  58 HIS NE2  N  -9.879  13.297   0.189 1.00 . A A . 136 HIS NE2  1 1 
        2  2624 1 1  58 HIS O    O -15.978  11.268   2.121 1.00 . A A . 136 HIS O    1 1 
        2  2625 1 1  59 GLY C    C -14.876   8.032   4.606 1.00 . A A . 137 GLY C    1 1 
        2  2626 1 1  59 GLY CA   C -15.485   9.207   3.869 1.00 . A A . 137 GLY CA   1 1 
        2  2627 1 1  59 GLY H    H -13.549  10.028   3.623 1.00 . A A . 137 GLY H    1 1 
        2  2628 1 1  59 GLY HA2  H -16.132   9.745   4.546 1.00 . A A . 137 GLY HA2  1 1 
        2  2629 1 1  59 GLY HA3  H -16.076   8.832   3.047 1.00 . A A . 137 GLY HA3  1 1 
        2  2630 1 1  59 GLY N    N -14.485  10.121   3.351 1.00 . A A . 137 GLY N    1 1 
        2  2631 1 1  59 GLY O    O -13.870   8.178   5.300 1.00 . A A . 137 GLY O    1 1 
        2  2632 1 1  60 VAL C    C -15.102   4.438   4.204 1.00 . A A . 138 VAL C    1 1 
        2  2633 1 1  60 VAL CA   C -15.007   5.658   5.118 1.00 . A A . 138 VAL CA   1 1 
        2  2634 1 1  60 VAL CB   C -15.794   5.375   6.411 1.00 . A A . 138 VAL CB   1 1 
        2  2635 1 1  60 VAL CG1  C -15.126   4.264   7.204 1.00 . A A . 138 VAL CG1  1 1 
        2  2636 1 1  60 VAL CG2  C -15.919   6.638   7.250 1.00 . A A . 138 VAL CG2  1 1 
        2  2637 1 1  60 VAL H    H -16.290   6.815   3.894 1.00 . A A . 138 VAL H    1 1 
        2  2638 1 1  60 VAL HA   H -13.972   5.816   5.381 1.00 . A A . 138 VAL HA   1 1 
        2  2639 1 1  60 VAL HB   H -16.787   5.047   6.141 1.00 . A A . 138 VAL HB   1 1 
        2  2640 1 1  60 VAL HG11 H -15.547   3.313   6.915 1.00 . A A . 138 VAL HG11 1 1 
        2  2641 1 1  60 VAL HG12 H -15.291   4.426   8.259 1.00 . A A . 138 VAL HG12 1 1 
        2  2642 1 1  60 VAL HG13 H -14.066   4.265   7.001 1.00 . A A . 138 VAL HG13 1 1 
        2  2643 1 1  60 VAL HG21 H -14.934   6.986   7.526 1.00 . A A . 138 VAL HG21 1 1 
        2  2644 1 1  60 VAL HG22 H -16.488   6.422   8.142 1.00 . A A . 138 VAL HG22 1 1 
        2  2645 1 1  60 VAL HG23 H -16.423   7.402   6.677 1.00 . A A . 138 VAL HG23 1 1 
        2  2646 1 1  60 VAL N    N -15.491   6.864   4.457 1.00 . A A . 138 VAL N    1 1 
        2  2647 1 1  60 VAL O    O -14.257   3.545   4.261 1.00 . A A . 138 VAL O    1 1 
        2  2648 1 1  61 ASP C    C -15.695   3.548   1.094 1.00 . A A . 139 ASP C    1 1 
        2  2649 1 1  61 ASP CA   C -16.336   3.280   2.454 1.00 . A A . 139 ASP CA   1 1 
        2  2650 1 1  61 ASP CB   C -17.830   3.003   2.277 1.00 . A A . 139 ASP CB   1 1 
        2  2651 1 1  61 ASP CG   C -18.495   2.572   3.569 1.00 . A A . 139 ASP CG   1 1 
        2  2652 1 1  61 ASP H    H -16.783   5.134   3.371 1.00 . A A . 139 ASP H    1 1 
        2  2653 1 1  61 ASP HA   H -15.870   2.410   2.891 1.00 . A A . 139 ASP HA   1 1 
        2  2654 1 1  61 ASP HB2  H -18.317   3.901   1.926 1.00 . A A . 139 ASP HB2  1 1 
        2  2655 1 1  61 ASP HB3  H -17.960   2.219   1.546 1.00 . A A . 139 ASP HB3  1 1 
        2  2656 1 1  61 ASP N    N -16.137   4.399   3.369 1.00 . A A . 139 ASP N    1 1 
        2  2657 1 1  61 ASP O    O -16.164   3.049   0.071 1.00 . A A . 139 ASP O    1 1 
        2  2658 1 1  61 ASP OD1  O -18.447   3.345   4.549 1.00 . A A . 139 ASP OD1  1 1 
        2  2659 1 1  61 ASP OD2  O -19.065   1.461   3.601 1.00 . A A . 139 ASP OD2  1 1 
        2  2660 1 1  62 TYR C    C -12.939   3.543  -0.538 1.00 . A A . 140 TYR C    1 1 
        2  2661 1 1  62 TYR CA   C -13.923   4.649  -0.158 1.00 . A A . 140 TYR CA   1 1 
        2  2662 1 1  62 TYR CB   C -13.185   5.988  -0.043 1.00 . A A . 140 TYR CB   1 1 
        2  2663 1 1  62 TYR CD1  C -11.673   5.239   1.843 1.00 . A A . 140 TYR CD1  1 1 
        2  2664 1 1  62 TYR CD2  C -12.681   7.394   1.992 1.00 . A A . 140 TYR CD2  1 1 
        2  2665 1 1  62 TYR CE1  C -11.048   5.442   3.058 1.00 . A A . 140 TYR CE1  1 1 
        2  2666 1 1  62 TYR CE2  C -12.059   7.605   3.207 1.00 . A A . 140 TYR CE2  1 1 
        2  2667 1 1  62 TYR CG   C -12.500   6.210   1.289 1.00 . A A . 140 TYR CG   1 1 
        2  2668 1 1  62 TYR CZ   C -11.244   6.627   3.736 1.00 . A A . 140 TYR CZ   1 1 
        2  2669 1 1  62 TYR H    H -14.288   4.699   1.929 1.00 . A A . 140 TYR H    1 1 
        2  2670 1 1  62 TYR HA   H -14.666   4.729  -0.938 1.00 . A A . 140 TYR HA   1 1 
        2  2671 1 1  62 TYR HB2  H -12.429   6.039  -0.812 1.00 . A A . 140 TYR HB2  1 1 
        2  2672 1 1  62 TYR HB3  H -13.892   6.792  -0.190 1.00 . A A . 140 TYR HB3  1 1 
        2  2673 1 1  62 TYR HD1  H -11.519   4.315   1.310 1.00 . A A . 140 TYR HD1  1 1 
        2  2674 1 1  62 TYR HD2  H -13.321   8.158   1.576 1.00 . A A . 140 TYR HD2  1 1 
        2  2675 1 1  62 TYR HE1  H -10.411   4.674   3.472 1.00 . A A . 140 TYR HE1  1 1 
        2  2676 1 1  62 TYR HE2  H -12.212   8.533   3.738 1.00 . A A . 140 TYR HE2  1 1 
        2  2677 1 1  62 TYR HH   H  -9.872   7.419   4.824 1.00 . A A . 140 TYR HH   1 1 
        2  2678 1 1  62 TYR N    N -14.621   4.332   1.085 1.00 . A A . 140 TYR N    1 1 
        2  2679 1 1  62 TYR O    O -12.403   3.534  -1.646 1.00 . A A . 140 TYR O    1 1 
        2  2680 1 1  62 TYR OH   O -10.623   6.834   4.946 1.00 . A A . 140 TYR OH   1 1 
        2  2681 1 1  63 VAL C    C -12.356   0.538  -0.890 1.00 . A A . 141 VAL C    1 1 
        2  2682 1 1  63 VAL CA   C -11.784   1.509   0.139 1.00 . A A . 141 VAL CA   1 1 
        2  2683 1 1  63 VAL CB   C -11.464   0.741   1.436 1.00 . A A . 141 VAL CB   1 1 
        2  2684 1 1  63 VAL CG1  C -10.287  -0.196   1.223 1.00 . A A . 141 VAL CG1  1 1 
        2  2685 1 1  63 VAL CG2  C -11.183   1.709   2.576 1.00 . A A . 141 VAL CG2  1 1 
        2  2686 1 1  63 VAL H    H -13.157   2.670   1.251 1.00 . A A . 141 VAL H    1 1 
        2  2687 1 1  63 VAL HA   H -10.863   1.923  -0.245 1.00 . A A . 141 VAL HA   1 1 
        2  2688 1 1  63 VAL HB   H -12.326   0.146   1.701 1.00 . A A . 141 VAL HB   1 1 
        2  2689 1 1  63 VAL HG11 H -10.652  -1.198   1.054 1.00 . A A . 141 VAL HG11 1 1 
        2  2690 1 1  63 VAL HG12 H  -9.656  -0.186   2.100 1.00 . A A . 141 VAL HG12 1 1 
        2  2691 1 1  63 VAL HG13 H  -9.718   0.130   0.366 1.00 . A A . 141 VAL HG13 1 1 
        2  2692 1 1  63 VAL HG21 H -12.104   2.183   2.881 1.00 . A A . 141 VAL HG21 1 1 
        2  2693 1 1  63 VAL HG22 H -10.482   2.461   2.246 1.00 . A A . 141 VAL HG22 1 1 
        2  2694 1 1  63 VAL HG23 H -10.764   1.168   3.412 1.00 . A A . 141 VAL HG23 1 1 
        2  2695 1 1  63 VAL N    N -12.703   2.613   0.386 1.00 . A A . 141 VAL N    1 1 
        2  2696 1 1  63 VAL O    O -11.614  -0.188  -1.552 1.00 . A A . 141 VAL O    1 1 
        2  2697 1 1  64 SER C    C -13.968  -0.013  -3.415 1.00 . A A . 142 SER C    1 1 
        2  2698 1 1  64 SER CA   C -14.361  -0.337  -1.974 1.00 . A A . 142 SER CA   1 1 
        2  2699 1 1  64 SER CB   C -15.877  -0.215  -1.810 1.00 . A A . 142 SER CB   1 1 
        2  2700 1 1  64 SER H    H -14.222   1.137  -0.473 1.00 . A A . 142 SER H    1 1 
        2  2701 1 1  64 SER HA   H -14.068  -1.353  -1.756 1.00 . A A . 142 SER HA   1 1 
        2  2702 1 1  64 SER HB2  H -16.142  -0.399  -0.779 1.00 . A A . 142 SER HB2  1 1 
        2  2703 1 1  64 SER HB3  H -16.187   0.781  -2.089 1.00 . A A . 142 SER HB3  1 1 
        2  2704 1 1  64 SER HG   H -17.426  -1.325  -2.264 1.00 . A A . 142 SER HG   1 1 
        2  2705 1 1  64 SER N    N -13.679   0.536  -1.024 1.00 . A A . 142 SER N    1 1 
        2  2706 1 1  64 SER O    O -14.227  -0.800  -4.325 1.00 . A A . 142 SER O    1 1 
        2  2707 1 1  64 SER OG   O -16.555  -1.151  -2.629 1.00 . A A . 142 SER OG   1 1 
        2  2708 1 1  65 ASP C    C -11.489   1.073  -5.233 1.00 . A A . 143 ASP C    1 1 
        2  2709 1 1  65 ASP CA   C -12.911   1.549  -4.952 1.00 . A A . 143 ASP CA   1 1 
        2  2710 1 1  65 ASP CB   C -12.991   3.070  -5.093 1.00 . A A . 143 ASP CB   1 1 
        2  2711 1 1  65 ASP CG   C -14.415   3.584  -5.016 1.00 . A A . 143 ASP CG   1 1 
        2  2712 1 1  65 ASP H    H -13.136   1.722  -2.859 1.00 . A A . 143 ASP H    1 1 
        2  2713 1 1  65 ASP HA   H -13.579   1.094  -5.669 1.00 . A A . 143 ASP HA   1 1 
        2  2714 1 1  65 ASP HB2  H -12.419   3.529  -4.301 1.00 . A A . 143 ASP HB2  1 1 
        2  2715 1 1  65 ASP HB3  H -12.574   3.359  -6.047 1.00 . A A . 143 ASP HB3  1 1 
        2  2716 1 1  65 ASP N    N -13.339   1.141  -3.620 1.00 . A A . 143 ASP N    1 1 
        2  2717 1 1  65 ASP O    O -11.112   0.856  -6.384 1.00 . A A . 143 ASP O    1 1 
        2  2718 1 1  65 ASP OD1  O -15.173   3.107  -4.145 1.00 . A A . 143 ASP OD1  1 1 
        2  2719 1 1  65 ASP OD2  O -14.774   4.463  -5.827 1.00 . A A . 143 ASP OD2  1 1 
        2  2720 1 1  66 PHE C    C  -9.237  -1.059  -4.221 1.00 . A A . 144 PHE C    1 1 
        2  2721 1 1  66 PHE CA   C  -9.322   0.462  -4.302 1.00 . A A . 144 PHE CA   1 1 
        2  2722 1 1  66 PHE CB   C  -8.453   1.092  -3.213 1.00 . A A . 144 PHE CB   1 1 
        2  2723 1 1  66 PHE CD1  C  -9.322   3.426  -2.901 1.00 . A A . 144 PHE CD1  1 1 
        2  2724 1 1  66 PHE CD2  C  -7.182   3.139  -3.913 1.00 . A A . 144 PHE CD2  1 1 
        2  2725 1 1  66 PHE CE1  C  -9.200   4.797  -3.022 1.00 . A A . 144 PHE CE1  1 1 
        2  2726 1 1  66 PHE CE2  C  -7.053   4.510  -4.037 1.00 . A A . 144 PHE CE2  1 1 
        2  2727 1 1  66 PHE CG   C  -8.316   2.582  -3.345 1.00 . A A . 144 PHE CG   1 1 
        2  2728 1 1  66 PHE CZ   C  -8.064   5.339  -3.591 1.00 . A A . 144 PHE CZ   1 1 
        2  2729 1 1  66 PHE H    H -11.060   1.102  -3.279 1.00 . A A . 144 PHE H    1 1 
        2  2730 1 1  66 PHE HA   H  -8.960   0.779  -5.269 1.00 . A A . 144 PHE HA   1 1 
        2  2731 1 1  66 PHE HB2  H  -8.889   0.883  -2.248 1.00 . A A . 144 PHE HB2  1 1 
        2  2732 1 1  66 PHE HB3  H  -7.463   0.661  -3.257 1.00 . A A . 144 PHE HB3  1 1 
        2  2733 1 1  66 PHE HD1  H -10.211   3.002  -2.456 1.00 . A A . 144 PHE HD1  1 1 
        2  2734 1 1  66 PHE HD2  H  -6.391   2.491  -4.263 1.00 . A A . 144 PHE HD2  1 1 
        2  2735 1 1  66 PHE HE1  H  -9.991   5.443  -2.673 1.00 . A A . 144 PHE HE1  1 1 
        2  2736 1 1  66 PHE HE2  H  -6.164   4.931  -4.482 1.00 . A A . 144 PHE HE2  1 1 
        2  2737 1 1  66 PHE HZ   H  -7.966   6.411  -3.687 1.00 . A A . 144 PHE HZ   1 1 
        2  2738 1 1  66 PHE N    N -10.703   0.913  -4.171 1.00 . A A . 144 PHE N    1 1 
        2  2739 1 1  66 PHE O    O  -9.738  -1.669  -3.276 1.00 . A A . 144 PHE O    1 1 
        2  2740 1 1  67 LYS C    C  -7.275  -3.571  -4.408 1.00 . A A . 145 LYS C    1 1 
        2  2741 1 1  67 LYS CA   C  -8.453  -3.116  -5.262 1.00 . A A . 145 LYS CA   1 1 
        2  2742 1 1  67 LYS CB   C  -8.261  -3.585  -6.705 1.00 . A A . 145 LYS CB   1 1 
        2  2743 1 1  67 LYS CD   C  -8.843  -2.137  -8.677 1.00 . A A . 145 LYS CD   1 1 
        2  2744 1 1  67 LYS CE   C  -9.490  -2.358 -10.035 1.00 . A A . 145 LYS CE   1 1 
        2  2745 1 1  67 LYS CG   C  -9.363  -3.126  -7.646 1.00 . A A . 145 LYS CG   1 1 
        2  2746 1 1  67 LYS H    H  -8.226  -1.124  -5.944 1.00 . A A . 145 LYS H    1 1 
        2  2747 1 1  67 LYS HA   H  -9.358  -3.553  -4.869 1.00 . A A . 145 LYS HA   1 1 
        2  2748 1 1  67 LYS HB2  H  -7.319  -3.205  -7.072 1.00 . A A . 145 LYS HB2  1 1 
        2  2749 1 1  67 LYS HB3  H  -8.232  -4.665  -6.718 1.00 . A A . 145 LYS HB3  1 1 
        2  2750 1 1  67 LYS HD2  H  -9.062  -1.134  -8.344 1.00 . A A . 145 LYS HD2  1 1 
        2  2751 1 1  67 LYS HD3  H  -7.774  -2.261  -8.773 1.00 . A A . 145 LYS HD3  1 1 
        2  2752 1 1  67 LYS HE2  H -10.521  -2.644  -9.886 1.00 . A A . 145 LYS HE2  1 1 
        2  2753 1 1  67 LYS HE3  H  -9.450  -1.434 -10.593 1.00 . A A . 145 LYS HE3  1 1 
        2  2754 1 1  67 LYS HG2  H  -9.767  -3.986  -8.158 1.00 . A A . 145 LYS HG2  1 1 
        2  2755 1 1  67 LYS HG3  H -10.142  -2.651  -7.066 1.00 . A A . 145 LYS HG3  1 1 
        2  2756 1 1  67 LYS HZ1  H  -7.956  -3.037 -11.280 1.00 . A A . 145 LYS HZ1  1 1 
        2  2757 1 1  67 LYS HZ2  H  -9.439  -3.808 -11.538 1.00 . A A . 145 LYS HZ2  1 1 
        2  2758 1 1  67 LYS HZ3  H  -8.509  -4.197 -10.179 1.00 . A A . 145 LYS HZ3  1 1 
        2  2759 1 1  67 LYS N    N  -8.602  -1.665  -5.219 1.00 . A A . 145 LYS N    1 1 
        2  2760 1 1  67 LYS NZ   N  -8.801  -3.424 -10.812 1.00 . A A . 145 LYS NZ   1 1 
        2  2761 1 1  67 LYS O    O  -6.140  -3.634  -4.880 1.00 . A A . 145 LYS O    1 1 
        2  2762 1 1  68 LEU C    C  -6.330  -5.847  -2.294 1.00 . A A . 146 LEU C    1 1 
        2  2763 1 1  68 LEU CA   C  -6.515  -4.333  -2.225 1.00 . A A . 146 LEU CA   1 1 
        2  2764 1 1  68 LEU CB   C  -6.864  -3.915  -0.796 1.00 . A A . 146 LEU CB   1 1 
        2  2765 1 1  68 LEU CD1  C  -8.426  -2.388   0.437 1.00 . A A . 146 LEU CD1  1 1 
        2  2766 1 1  68 LEU CD2  C  -6.207  -1.538  -0.349 1.00 . A A . 146 LEU CD2  1 1 
        2  2767 1 1  68 LEU CG   C  -7.365  -2.477  -0.650 1.00 . A A . 146 LEU CG   1 1 
        2  2768 1 1  68 LEU H    H  -8.475  -3.808  -2.828 1.00 . A A . 146 LEU H    1 1 
        2  2769 1 1  68 LEU HA   H  -5.590  -3.857  -2.512 1.00 . A A . 146 LEU HA   1 1 
        2  2770 1 1  68 LEU HB2  H  -7.629  -4.582  -0.425 1.00 . A A . 146 LEU HB2  1 1 
        2  2771 1 1  68 LEU HB3  H  -5.983  -4.028  -0.184 1.00 . A A . 146 LEU HB3  1 1 
        2  2772 1 1  68 LEU HD11 H  -8.428  -3.300   1.015 1.00 . A A . 146 LEU HD11 1 1 
        2  2773 1 1  68 LEU HD12 H  -9.395  -2.249  -0.019 1.00 . A A . 146 LEU HD12 1 1 
        2  2774 1 1  68 LEU HD13 H  -8.209  -1.552   1.084 1.00 . A A . 146 LEU HD13 1 1 
        2  2775 1 1  68 LEU HD21 H  -6.489  -0.527  -0.601 1.00 . A A . 146 LEU HD21 1 1 
        2  2776 1 1  68 LEU HD22 H  -5.347  -1.829  -0.934 1.00 . A A . 146 LEU HD22 1 1 
        2  2777 1 1  68 LEU HD23 H  -5.963  -1.593   0.702 1.00 . A A . 146 LEU HD23 1 1 
        2  2778 1 1  68 LEU HG   H  -7.817  -2.164  -1.581 1.00 . A A . 146 LEU HG   1 1 
        2  2779 1 1  68 LEU N    N  -7.552  -3.885  -3.147 1.00 . A A . 146 LEU N    1 1 
        2  2780 1 1  68 LEU O    O  -5.279  -6.369  -1.921 1.00 . A A . 146 LEU O    1 1 
        2  2781 1 1  69 ALA C    C  -8.419  -8.524  -3.782 1.00 . A A . 147 ALA C    1 1 
        2  2782 1 1  69 ALA CA   C  -7.297  -8.001  -2.889 1.00 . A A . 147 ALA CA   1 1 
        2  2783 1 1  69 ALA CB   C  -7.370  -8.643  -1.512 1.00 . A A . 147 ALA CB   1 1 
        2  2784 1 1  69 ALA H    H  -8.166  -6.079  -3.056 1.00 . A A . 147 ALA H    1 1 
        2  2785 1 1  69 ALA HA   H  -6.346  -8.262  -3.332 1.00 . A A . 147 ALA HA   1 1 
        2  2786 1 1  69 ALA HB1  H  -7.939  -9.559  -1.571 1.00 . A A . 147 ALA HB1  1 1 
        2  2787 1 1  69 ALA HB2  H  -7.851  -7.964  -0.823 1.00 . A A . 147 ALA HB2  1 1 
        2  2788 1 1  69 ALA HB3  H  -6.372  -8.862  -1.163 1.00 . A A . 147 ALA HB3  1 1 
        2  2789 1 1  69 ALA N    N  -7.354  -6.548  -2.773 1.00 . A A . 147 ALA N    1 1 
        2  2790 1 1  69 ALA O    O  -9.374  -7.805  -4.075 1.00 . A A . 147 ALA O    1 1 
        2  2791 1 1  70 PRO C    C -10.647 -10.644  -4.358 1.00 . A A . 148 PRO C    1 1 
        2  2792 1 1  70 PRO CA   C  -9.332 -10.401  -5.092 1.00 . A A . 148 PRO CA   1 1 
        2  2793 1 1  70 PRO CB   C  -8.695 -11.731  -5.503 1.00 . A A . 148 PRO CB   1 1 
        2  2794 1 1  70 PRO CD   C  -7.212 -10.716  -3.927 1.00 . A A . 148 PRO CD   1 1 
        2  2795 1 1  70 PRO CG   C  -7.729 -12.042  -4.414 1.00 . A A . 148 PRO CG   1 1 
        2  2796 1 1  70 PRO HA   H  -9.518  -9.801  -5.970 1.00 . A A . 148 PRO HA   1 1 
        2  2797 1 1  70 PRO HB2  H  -9.460 -12.489  -5.583 1.00 . A A . 148 PRO HB2  1 1 
        2  2798 1 1  70 PRO HB3  H  -8.195 -11.615  -6.453 1.00 . A A . 148 PRO HB3  1 1 
        2  2799 1 1  70 PRO HD2  H  -7.018 -10.754  -2.866 1.00 . A A . 148 PRO HD2  1 1 
        2  2800 1 1  70 PRO HD3  H  -6.319 -10.438  -4.467 1.00 . A A . 148 PRO HD3  1 1 
        2  2801 1 1  70 PRO HG2  H  -8.233 -12.565  -3.614 1.00 . A A . 148 PRO HG2  1 1 
        2  2802 1 1  70 PRO HG3  H  -6.918 -12.640  -4.802 1.00 . A A . 148 PRO HG3  1 1 
        2  2803 1 1  70 PRO N    N  -8.318  -9.788  -4.228 1.00 . A A . 148 PRO N    1 1 
        2  2804 1 1  70 PRO O    O -11.721 -10.324  -4.867 1.00 . A A . 148 PRO O    1 1 
        2  2805 1 1  71 ASN C    C -11.830 -10.536  -1.170 1.00 . A A . 149 ASN C    1 1 
        2  2806 1 1  71 ASN CA   C -11.737 -11.494  -2.355 1.00 . A A . 149 ASN CA   1 1 
        2  2807 1 1  71 ASN CB   C -11.706 -12.942  -1.861 1.00 . A A . 149 ASN CB   1 1 
        2  2808 1 1  71 ASN CG   C -13.078 -13.587  -1.875 1.00 . A A . 149 ASN CG   1 1 
        2  2809 1 1  71 ASN H    H  -9.669 -11.441  -2.807 1.00 . A A . 149 ASN H    1 1 
        2  2810 1 1  71 ASN HA   H -12.604 -11.356  -2.983 1.00 . A A . 149 ASN HA   1 1 
        2  2811 1 1  71 ASN HB2  H -11.052 -13.519  -2.497 1.00 . A A . 149 ASN HB2  1 1 
        2  2812 1 1  71 ASN HB3  H -11.328 -12.964  -0.849 1.00 . A A . 149 ASN HB3  1 1 
        2  2813 1 1  71 ASN HD21 H -13.670 -12.419  -0.378 1.00 . A A . 149 ASN HD21 1 1 
        2  2814 1 1  71 ASN HD22 H -14.849 -13.533  -0.973 1.00 . A A . 149 ASN HD22 1 1 
        2  2815 1 1  71 ASN N    N -10.554 -11.210  -3.159 1.00 . A A . 149 ASN N    1 1 
        2  2816 1 1  71 ASN ND2  N -13.954 -13.134  -0.985 1.00 . A A . 149 ASN ND2  1 1 
        2  2817 1 1  71 ASN O    O -11.719 -10.946  -0.014 1.00 . A A . 149 ASN O    1 1 
        2  2818 1 1  71 ASN OD1  O -13.348 -14.481  -2.676 1.00 . A A . 149 ASN OD1  1 1 
        2  2819 1 1  72 GLN C    C -13.379  -8.467   0.434 1.00 . A A . 150 GLN C    1 1 
        2  2820 1 1  72 GLN CA   C -12.140  -8.240  -0.426 1.00 . A A . 150 GLN CA   1 1 
        2  2821 1 1  72 GLN CB   C -12.187  -6.844  -1.049 1.00 . A A . 150 GLN CB   1 1 
        2  2822 1 1  72 GLN CD   C -11.817  -4.372  -0.695 1.00 . A A . 150 GLN CD   1 1 
        2  2823 1 1  72 GLN CG   C -12.021  -5.723  -0.038 1.00 . A A . 150 GLN CG   1 1 
        2  2824 1 1  72 GLN H    H -12.113  -8.990  -2.406 1.00 . A A . 150 GLN H    1 1 
        2  2825 1 1  72 GLN HA   H -11.264  -8.315   0.200 1.00 . A A . 150 GLN HA   1 1 
        2  2826 1 1  72 GLN HB2  H -11.396  -6.762  -1.780 1.00 . A A . 150 GLN HB2  1 1 
        2  2827 1 1  72 GLN HB3  H -13.138  -6.715  -1.544 1.00 . A A . 150 GLN HB3  1 1 
        2  2828 1 1  72 GLN HE21 H -11.404  -3.549   1.068 1.00 . A A . 150 GLN HE21 1 1 
        2  2829 1 1  72 GLN HE22 H -11.356  -2.482  -0.289 1.00 . A A . 150 GLN HE22 1 1 
        2  2830 1 1  72 GLN HG2  H -12.906  -5.676   0.578 1.00 . A A . 150 GLN HG2  1 1 
        2  2831 1 1  72 GLN HG3  H -11.163  -5.939   0.583 1.00 . A A . 150 GLN HG3  1 1 
        2  2832 1 1  72 GLN N    N -12.033  -9.257  -1.466 1.00 . A A . 150 GLN N    1 1 
        2  2833 1 1  72 GLN NE2  N -11.493  -3.366   0.109 1.00 . A A . 150 GLN NE2  1 1 
        2  2834 1 1  72 GLN O    O -14.507  -8.397  -0.054 1.00 . A A . 150 GLN O    1 1 
        2  2835 1 1  72 GLN OE1  O -11.949  -4.234  -1.911 1.00 . A A . 150 GLN OE1  1 1 
        2  2836 1 1  73 THR C    C -14.349  -7.856   3.674 1.00 . A A . 151 THR C    1 1 
        2  2837 1 1  73 THR CA   C -14.257  -8.976   2.645 1.00 . A A . 151 THR CA   1 1 
        2  2838 1 1  73 THR CB   C -14.075 -10.320   3.352 1.00 . A A . 151 THR CB   1 1 
        2  2839 1 1  73 THR CG2  C -12.704 -10.489   3.971 1.00 . A A . 151 THR CG2  1 1 
        2  2840 1 1  73 THR H    H -12.235  -8.781   2.042 1.00 . A A . 151 THR H    1 1 
        2  2841 1 1  73 THR HA   H -15.174  -9.002   2.076 1.00 . A A . 151 THR HA   1 1 
        2  2842 1 1  73 THR HB   H -14.214 -11.115   2.634 1.00 . A A . 151 THR HB   1 1 
        2  2843 1 1  73 THR HG1  H -15.916 -10.459   4.004 1.00 . A A . 151 THR HG1  1 1 
        2  2844 1 1  73 THR HG21 H -12.808 -10.844   4.986 1.00 . A A . 151 THR HG21 1 1 
        2  2845 1 1  73 THR HG22 H -12.190  -9.539   3.972 1.00 . A A . 151 THR HG22 1 1 
        2  2846 1 1  73 THR HG23 H -12.136 -11.205   3.396 1.00 . A A . 151 THR HG23 1 1 
        2  2847 1 1  73 THR N    N -13.159  -8.739   1.715 1.00 . A A . 151 THR N    1 1 
        2  2848 1 1  73 THR O    O -13.377  -7.140   3.913 1.00 . A A . 151 THR O    1 1 
        2  2849 1 1  73 THR OG1  O -15.034 -10.479   4.382 1.00 . A A . 151 THR OG1  1 1 
        2  2850 1 1  74 LYS C    C -14.596  -6.590   6.274 1.00 . A A . 152 LYS C    1 1 
        2  2851 1 1  74 LYS CA   C -15.752  -6.665   5.280 1.00 . A A . 152 LYS CA   1 1 
        2  2852 1 1  74 LYS CB   C -17.064  -6.924   6.024 1.00 . A A . 152 LYS CB   1 1 
        2  2853 1 1  74 LYS CD   C -19.567  -6.691   6.064 1.00 . A A . 152 LYS CD   1 1 
        2  2854 1 1  74 LYS CE   C -20.789  -6.121   5.359 1.00 . A A . 152 LYS CE   1 1 
        2  2855 1 1  74 LYS CG   C -18.285  -6.358   5.317 1.00 . A A . 152 LYS CG   1 1 
        2  2856 1 1  74 LYS H    H -16.267  -8.301   4.040 1.00 . A A . 152 LYS H    1 1 
        2  2857 1 1  74 LYS HA   H -15.826  -5.720   4.763 1.00 . A A . 152 LYS HA   1 1 
        2  2858 1 1  74 LYS HB2  H -17.198  -7.990   6.132 1.00 . A A . 152 LYS HB2  1 1 
        2  2859 1 1  74 LYS HB3  H -17.002  -6.476   7.005 1.00 . A A . 152 LYS HB3  1 1 
        2  2860 1 1  74 LYS HD2  H -19.668  -7.765   6.124 1.00 . A A . 152 LYS HD2  1 1 
        2  2861 1 1  74 LYS HD3  H -19.510  -6.277   7.059 1.00 . A A . 152 LYS HD3  1 1 
        2  2862 1 1  74 LYS HE2  H -20.484  -5.710   4.408 1.00 . A A . 152 LYS HE2  1 1 
        2  2863 1 1  74 LYS HE3  H -21.497  -6.919   5.194 1.00 . A A . 152 LYS HE3  1 1 
        2  2864 1 1  74 LYS HG2  H -18.186  -5.285   5.253 1.00 . A A . 152 LYS HG2  1 1 
        2  2865 1 1  74 LYS HG3  H -18.338  -6.776   4.323 1.00 . A A . 152 LYS HG3  1 1 
        2  2866 1 1  74 LYS HZ1  H -20.789  -4.694   6.886 1.00 . A A . 152 LYS HZ1  1 1 
        2  2867 1 1  74 LYS HZ2  H -22.293  -5.423   6.631 1.00 . A A . 152 LYS HZ2  1 1 
        2  2868 1 1  74 LYS HZ3  H -21.723  -4.261   5.542 1.00 . A A . 152 LYS HZ3  1 1 
        2  2869 1 1  74 LYS N    N -15.527  -7.704   4.278 1.00 . A A . 152 LYS N    1 1 
        2  2870 1 1  74 LYS NZ   N -21.444  -5.050   6.160 1.00 . A A . 152 LYS NZ   1 1 
        2  2871 1 1  74 LYS O    O -14.151  -5.503   6.642 1.00 . A A . 152 LYS O    1 1 
        2  2872 1 1  75 GLU C    C -11.780  -7.084   7.097 1.00 . A A . 153 GLU C    1 1 
        2  2873 1 1  75 GLU CA   C -13.002  -7.811   7.649 1.00 . A A . 153 GLU CA   1 1 
        2  2874 1 1  75 GLU CB   C -12.646  -9.265   7.963 1.00 . A A . 153 GLU CB   1 1 
        2  2875 1 1  75 GLU CD   C -13.814  -9.394  10.199 1.00 . A A . 153 GLU CD   1 1 
        2  2876 1 1  75 GLU CG   C -13.689  -9.979   8.806 1.00 . A A . 153 GLU CG   1 1 
        2  2877 1 1  75 GLU H    H -14.504  -8.586   6.373 1.00 . A A . 153 GLU H    1 1 
        2  2878 1 1  75 GLU HA   H -13.317  -7.321   8.558 1.00 . A A . 153 GLU HA   1 1 
        2  2879 1 1  75 GLU HB2  H -12.534  -9.805   7.035 1.00 . A A . 153 GLU HB2  1 1 
        2  2880 1 1  75 GLU HB3  H -11.707  -9.287   8.497 1.00 . A A . 153 GLU HB3  1 1 
        2  2881 1 1  75 GLU HG2  H -14.647  -9.901   8.313 1.00 . A A . 153 GLU HG2  1 1 
        2  2882 1 1  75 GLU HG3  H -13.413 -11.020   8.892 1.00 . A A . 153 GLU HG3  1 1 
        2  2883 1 1  75 GLU N    N -14.110  -7.751   6.702 1.00 . A A . 153 GLU N    1 1 
        2  2884 1 1  75 GLU O    O -11.155  -6.283   7.792 1.00 . A A . 153 GLU O    1 1 
        2  2885 1 1  75 GLU OE1  O -12.955  -9.704  11.052 1.00 . A A . 153 GLU OE1  1 1 
        2  2886 1 1  75 GLU OE2  O -14.769  -8.626  10.438 1.00 . A A . 153 GLU OE2  1 1 
        2  2887 1 1  76 LEU C    C -10.551  -5.237   5.029 1.00 . A A . 154 LEU C    1 1 
        2  2888 1 1  76 LEU CA   C -10.307  -6.734   5.194 1.00 . A A . 154 LEU CA   1 1 
        2  2889 1 1  76 LEU CB   C -10.048  -7.383   3.831 1.00 . A A . 154 LEU CB   1 1 
        2  2890 1 1  76 LEU CD1  C  -7.647  -6.658   3.745 1.00 . A A . 154 LEU CD1  1 1 
        2  2891 1 1  76 LEU CD2  C  -8.789  -7.453   1.666 1.00 . A A . 154 LEU CD2  1 1 
        2  2892 1 1  76 LEU CG   C  -8.964  -6.714   2.984 1.00 . A A . 154 LEU CG   1 1 
        2  2893 1 1  76 LEU H    H -11.988  -8.009   5.336 1.00 . A A . 154 LEU H    1 1 
        2  2894 1 1  76 LEU HA   H  -9.443  -6.880   5.825 1.00 . A A . 154 LEU HA   1 1 
        2  2895 1 1  76 LEU HB2  H  -9.762  -8.412   3.996 1.00 . A A . 154 LEU HB2  1 1 
        2  2896 1 1  76 LEU HB3  H -10.970  -7.370   3.270 1.00 . A A . 154 LEU HB3  1 1 
        2  2897 1 1  76 LEU HD11 H  -7.648  -7.409   4.522 1.00 . A A . 154 LEU HD11 1 1 
        2  2898 1 1  76 LEU HD12 H  -7.530  -5.681   4.190 1.00 . A A . 154 LEU HD12 1 1 
        2  2899 1 1  76 LEU HD13 H  -6.828  -6.845   3.065 1.00 . A A . 154 LEU HD13 1 1 
        2  2900 1 1  76 LEU HD21 H  -9.405  -6.990   0.909 1.00 . A A . 154 LEU HD21 1 1 
        2  2901 1 1  76 LEU HD22 H  -9.086  -8.484   1.789 1.00 . A A . 154 LEU HD22 1 1 
        2  2902 1 1  76 LEU HD23 H  -7.753  -7.410   1.363 1.00 . A A . 154 LEU HD23 1 1 
        2  2903 1 1  76 LEU HG   H  -9.265  -5.701   2.762 1.00 . A A . 154 LEU HG   1 1 
        2  2904 1 1  76 LEU N    N -11.449  -7.365   5.841 1.00 . A A . 154 LEU N    1 1 
        2  2905 1 1  76 LEU O    O  -9.662  -4.421   5.265 1.00 . A A . 154 LEU O    1 1 
        2  2906 1 1  77 GLU C    C -11.981  -2.707   5.737 1.00 . A A . 155 GLU C    1 1 
        2  2907 1 1  77 GLU CA   C -12.141  -3.490   4.437 1.00 . A A . 155 GLU CA   1 1 
        2  2908 1 1  77 GLU CB   C -13.585  -3.387   3.941 1.00 . A A . 155 GLU CB   1 1 
        2  2909 1 1  77 GLU CD   C -15.290  -4.080   2.211 1.00 . A A . 155 GLU CD   1 1 
        2  2910 1 1  77 GLU CG   C -13.843  -4.157   2.656 1.00 . A A . 155 GLU CG   1 1 
        2  2911 1 1  77 GLU H    H -12.432  -5.591   4.465 1.00 . A A . 155 GLU H    1 1 
        2  2912 1 1  77 GLU HA   H -11.481  -3.070   3.693 1.00 . A A . 155 GLU HA   1 1 
        2  2913 1 1  77 GLU HB2  H -14.245  -3.771   4.704 1.00 . A A . 155 GLU HB2  1 1 
        2  2914 1 1  77 GLU HB3  H -13.819  -2.347   3.764 1.00 . A A . 155 GLU HB3  1 1 
        2  2915 1 1  77 GLU HG2  H -13.220  -3.748   1.875 1.00 . A A . 155 GLU HG2  1 1 
        2  2916 1 1  77 GLU HG3  H -13.585  -5.194   2.816 1.00 . A A . 155 GLU HG3  1 1 
        2  2917 1 1  77 GLU N    N -11.770  -4.888   4.629 1.00 . A A . 155 GLU N    1 1 
        2  2918 1 1  77 GLU O    O -11.302  -1.680   5.777 1.00 . A A . 155 GLU O    1 1 
        2  2919 1 1  77 GLU OE1  O -16.183  -4.310   3.054 1.00 . A A . 155 GLU OE1  1 1 
        2  2920 1 1  77 GLU OE2  O -15.531  -3.790   1.021 1.00 . A A . 155 GLU OE2  1 1 
        2  2921 1 1  78 GLU C    C -11.095  -2.358   8.545 1.00 . A A . 156 GLU C    1 1 
        2  2922 1 1  78 GLU CA   C -12.544  -2.551   8.104 1.00 . A A . 156 GLU CA   1 1 
        2  2923 1 1  78 GLU CB   C -13.300  -3.376   9.147 1.00 . A A . 156 GLU CB   1 1 
        2  2924 1 1  78 GLU CD   C -15.561  -3.819  10.182 1.00 . A A . 156 GLU CD   1 1 
        2  2925 1 1  78 GLU CG   C -14.807  -3.378   8.944 1.00 . A A . 156 GLU CG   1 1 
        2  2926 1 1  78 GLU H    H -13.141  -4.020   6.698 1.00 . A A . 156 GLU H    1 1 
        2  2927 1 1  78 GLU HA   H -13.012  -1.582   8.016 1.00 . A A . 156 GLU HA   1 1 
        2  2928 1 1  78 GLU HB2  H -12.951  -4.397   9.104 1.00 . A A . 156 GLU HB2  1 1 
        2  2929 1 1  78 GLU HB3  H -13.091  -2.974  10.127 1.00 . A A . 156 GLU HB3  1 1 
        2  2930 1 1  78 GLU HG2  H -15.124  -2.379   8.685 1.00 . A A . 156 GLU HG2  1 1 
        2  2931 1 1  78 GLU HG3  H -15.047  -4.052   8.135 1.00 . A A . 156 GLU HG3  1 1 
        2  2932 1 1  78 GLU N    N -12.612  -3.200   6.799 1.00 . A A . 156 GLU N    1 1 
        2  2933 1 1  78 GLU O    O -10.695  -1.261   8.933 1.00 . A A . 156 GLU O    1 1 
        2  2934 1 1  78 GLU OE1  O -15.091  -4.755  10.862 1.00 . A A . 156 GLU OE1  1 1 
        2  2935 1 1  78 GLU OE2  O -16.623  -3.229  10.472 1.00 . A A . 156 GLU OE2  1 1 
        2  2936 1 1  79 LYS C    C  -8.143  -2.349   8.108 1.00 . A A . 157 LYS C    1 1 
        2  2937 1 1  79 LYS CA   C  -8.920  -3.390   8.910 1.00 . A A . 157 LYS CA   1 1 
        2  2938 1 1  79 LYS CB   C  -8.273  -4.766   8.742 1.00 . A A . 157 LYS CB   1 1 
        2  2939 1 1  79 LYS CD   C  -7.691  -5.440  11.092 1.00 . A A . 157 LYS CD   1 1 
        2  2940 1 1  79 LYS CE   C  -6.881  -4.822  12.220 1.00 . A A . 157 LYS CE   1 1 
        2  2941 1 1  79 LYS CG   C  -7.150  -5.034   9.730 1.00 . A A . 157 LYS CG   1 1 
        2  2942 1 1  79 LYS H    H -10.706  -4.287   8.203 1.00 . A A . 157 LYS H    1 1 
        2  2943 1 1  79 LYS HA   H  -8.892  -3.116   9.954 1.00 . A A . 157 LYS HA   1 1 
        2  2944 1 1  79 LYS HB2  H  -9.029  -5.525   8.875 1.00 . A A . 157 LYS HB2  1 1 
        2  2945 1 1  79 LYS HB3  H  -7.870  -4.842   7.743 1.00 . A A . 157 LYS HB3  1 1 
        2  2946 1 1  79 LYS HD2  H  -8.715  -5.109  11.175 1.00 . A A . 157 LYS HD2  1 1 
        2  2947 1 1  79 LYS HD3  H  -7.650  -6.516  11.178 1.00 . A A . 157 LYS HD3  1 1 
        2  2948 1 1  79 LYS HE2  H  -5.908  -4.548  11.841 1.00 . A A . 157 LYS HE2  1 1 
        2  2949 1 1  79 LYS HE3  H  -7.392  -3.937  12.570 1.00 . A A . 157 LYS HE3  1 1 
        2  2950 1 1  79 LYS HG2  H  -6.530  -5.831   9.349 1.00 . A A . 157 LYS HG2  1 1 
        2  2951 1 1  79 LYS HG3  H  -6.558  -4.137   9.841 1.00 . A A . 157 LYS HG3  1 1 
        2  2952 1 1  79 LYS HZ1  H  -6.696  -6.745  13.015 1.00 . A A . 157 LYS HZ1  1 1 
        2  2953 1 1  79 LYS HZ2  H  -7.489  -5.655  14.037 1.00 . A A . 157 LYS HZ2  1 1 
        2  2954 1 1  79 LYS HZ3  H  -5.810  -5.571  13.851 1.00 . A A . 157 LYS HZ3  1 1 
        2  2955 1 1  79 LYS N    N -10.319  -3.436   8.498 1.00 . A A . 157 LYS N    1 1 
        2  2956 1 1  79 LYS NZ   N  -6.707  -5.764  13.360 1.00 . A A . 157 LYS NZ   1 1 
        2  2957 1 1  79 LYS O    O  -7.198  -1.745   8.616 1.00 . A A . 157 LYS O    1 1 
        2  2958 1 1  80 VAL C    C  -8.114   0.262   6.544 1.00 . A A . 158 VAL C    1 1 
        2  2959 1 1  80 VAL CA   C  -7.885  -1.150   6.012 1.00 . A A . 158 VAL CA   1 1 
        2  2960 1 1  80 VAL CB   C  -8.383  -1.231   4.553 1.00 . A A . 158 VAL CB   1 1 
        2  2961 1 1  80 VAL CG1  C  -7.731  -0.152   3.698 1.00 . A A . 158 VAL CG1  1 1 
        2  2962 1 1  80 VAL CG2  C  -8.113  -2.612   3.972 1.00 . A A . 158 VAL CG2  1 1 
        2  2963 1 1  80 VAL H    H  -9.312  -2.635   6.509 1.00 . A A . 158 VAL H    1 1 
        2  2964 1 1  80 VAL HA   H  -6.826  -1.362   6.022 1.00 . A A . 158 VAL HA   1 1 
        2  2965 1 1  80 VAL HB   H  -9.451  -1.065   4.548 1.00 . A A . 158 VAL HB   1 1 
        2  2966 1 1  80 VAL HG11 H  -6.709  -0.010   4.016 1.00 . A A . 158 VAL HG11 1 1 
        2  2967 1 1  80 VAL HG12 H  -8.275   0.774   3.810 1.00 . A A . 158 VAL HG12 1 1 
        2  2968 1 1  80 VAL HG13 H  -7.747  -0.456   2.662 1.00 . A A . 158 VAL HG13 1 1 
        2  2969 1 1  80 VAL HG21 H  -7.802  -3.281   4.760 1.00 . A A . 158 VAL HG21 1 1 
        2  2970 1 1  80 VAL HG22 H  -7.332  -2.545   3.229 1.00 . A A . 158 VAL HG22 1 1 
        2  2971 1 1  80 VAL HG23 H  -9.014  -2.991   3.513 1.00 . A A . 158 VAL HG23 1 1 
        2  2972 1 1  80 VAL N    N  -8.548  -2.132   6.862 1.00 . A A . 158 VAL N    1 1 
        2  2973 1 1  80 VAL O    O  -7.172   1.037   6.704 1.00 . A A . 158 VAL O    1 1 
        2  2974 1 1  81 MET C    C  -9.210   2.091   8.756 1.00 . A A . 159 MET C    1 1 
        2  2975 1 1  81 MET CA   C  -9.733   1.899   7.336 1.00 . A A . 159 MET CA   1 1 
        2  2976 1 1  81 MET CB   C -11.252   2.080   7.311 1.00 . A A . 159 MET CB   1 1 
        2  2977 1 1  81 MET CE   C -13.815   0.202   4.736 1.00 . A A . 159 MET CE   1 1 
        2  2978 1 1  81 MET CG   C -11.880   1.761   5.965 1.00 . A A . 159 MET CG   1 1 
        2  2979 1 1  81 MET H    H -10.077  -0.082   6.671 1.00 . A A . 159 MET H    1 1 
        2  2980 1 1  81 MET HA   H  -9.281   2.641   6.695 1.00 . A A . 159 MET HA   1 1 
        2  2981 1 1  81 MET HB2  H -11.693   1.432   8.053 1.00 . A A . 159 MET HB2  1 1 
        2  2982 1 1  81 MET HB3  H -11.484   3.106   7.558 1.00 . A A . 159 MET HB3  1 1 
        2  2983 1 1  81 MET HE1  H -13.104   0.447   3.960 1.00 . A A . 159 MET HE1  1 1 
        2  2984 1 1  81 MET HE2  H -14.817   0.270   4.340 1.00 . A A . 159 MET HE2  1 1 
        2  2985 1 1  81 MET HE3  H -13.633  -0.804   5.087 1.00 . A A . 159 MET HE3  1 1 
        2  2986 1 1  81 MET HG2  H -11.774   2.620   5.320 1.00 . A A . 159 MET HG2  1 1 
        2  2987 1 1  81 MET HG3  H -11.360   0.920   5.530 1.00 . A A . 159 MET HG3  1 1 
        2  2988 1 1  81 MET N    N  -9.373   0.584   6.818 1.00 . A A . 159 MET N    1 1 
        2  2989 1 1  81 MET O    O  -8.717   3.162   9.108 1.00 . A A . 159 MET O    1 1 
        2  2990 1 1  81 MET SD   S -13.632   1.352   6.096 1.00 . A A . 159 MET SD   1 1 
        2  2991 1 1  82 GLU C    C  -7.368   1.355  11.028 1.00 . A A . 160 GLU C    1 1 
        2  2992 1 1  82 GLU CA   C  -8.870   1.100  10.954 1.00 . A A . 160 GLU CA   1 1 
        2  2993 1 1  82 GLU CB   C  -9.213  -0.204  11.676 1.00 . A A . 160 GLU CB   1 1 
        2  2994 1 1  82 GLU CD   C -10.457   0.034  13.861 1.00 . A A . 160 GLU CD   1 1 
        2  2995 1 1  82 GLU CG   C  -9.105  -0.107  13.189 1.00 . A A . 160 GLU CG   1 1 
        2  2996 1 1  82 GLU H    H  -9.730   0.221   9.232 1.00 . A A . 160 GLU H    1 1 
        2  2997 1 1  82 GLU HA   H  -9.385   1.915  11.440 1.00 . A A . 160 GLU HA   1 1 
        2  2998 1 1  82 GLU HB2  H -10.225  -0.485  11.425 1.00 . A A . 160 GLU HB2  1 1 
        2  2999 1 1  82 GLU HB3  H  -8.540  -0.977  11.337 1.00 . A A . 160 GLU HB3  1 1 
        2  3000 1 1  82 GLU HG2  H  -8.627  -1.000  13.561 1.00 . A A . 160 GLU HG2  1 1 
        2  3001 1 1  82 GLU HG3  H  -8.503   0.755  13.439 1.00 . A A . 160 GLU HG3  1 1 
        2  3002 1 1  82 GLU N    N  -9.326   1.046   9.569 1.00 . A A . 160 GLU N    1 1 
        2  3003 1 1  82 GLU O    O  -6.922   2.301  11.677 1.00 . A A . 160 GLU O    1 1 
        2  3004 1 1  82 GLU OE1  O -11.386  -0.712  13.488 1.00 . A A . 160 GLU OE1  1 1 
        2  3005 1 1  82 GLU OE2  O -10.586   0.891  14.761 1.00 . A A . 160 GLU OE2  1 1 
        2  3006 1 1  83 LEU C    C  -4.722   2.014   9.836 1.00 . A A . 161 LEU C    1 1 
        2  3007 1 1  83 LEU CA   C  -5.140   0.641  10.353 1.00 . A A . 161 LEU CA   1 1 
        2  3008 1 1  83 LEU CB   C  -4.511  -0.453   9.490 1.00 . A A . 161 LEU CB   1 1 
        2  3009 1 1  83 LEU CD1  C  -4.053  -2.888   9.100 1.00 . A A . 161 LEU CD1  1 1 
        2  3010 1 1  83 LEU CD2  C  -3.587  -1.869  11.340 1.00 . A A . 161 LEU CD2  1 1 
        2  3011 1 1  83 LEU CG   C  -4.495  -1.847  10.119 1.00 . A A . 161 LEU CG   1 1 
        2  3012 1 1  83 LEU H    H  -7.007  -0.229   9.862 1.00 . A A . 161 LEU H    1 1 
        2  3013 1 1  83 LEU HA   H  -4.792   0.531  11.369 1.00 . A A . 161 LEU HA   1 1 
        2  3014 1 1  83 LEU HB2  H  -5.057  -0.506   8.560 1.00 . A A . 161 LEU HB2  1 1 
        2  3015 1 1  83 LEU HB3  H  -3.492  -0.169   9.274 1.00 . A A . 161 LEU HB3  1 1 
        2  3016 1 1  83 LEU HD11 H  -3.874  -2.408   8.149 1.00 . A A . 161 LEU HD11 1 1 
        2  3017 1 1  83 LEU HD12 H  -4.828  -3.631   8.987 1.00 . A A . 161 LEU HD12 1 1 
        2  3018 1 1  83 LEU HD13 H  -3.145  -3.363   9.440 1.00 . A A . 161 LEU HD13 1 1 
        2  3019 1 1  83 LEU HD21 H  -4.175  -1.693  12.229 1.00 . A A . 161 LEU HD21 1 1 
        2  3020 1 1  83 LEU HD22 H  -2.837  -1.098  11.245 1.00 . A A . 161 LEU HD22 1 1 
        2  3021 1 1  83 LEU HD23 H  -3.105  -2.833  11.413 1.00 . A A . 161 LEU HD23 1 1 
        2  3022 1 1  83 LEU HG   H  -5.495  -2.100  10.440 1.00 . A A . 161 LEU HG   1 1 
        2  3023 1 1  83 LEU N    N  -6.593   0.506  10.361 1.00 . A A . 161 LEU N    1 1 
        2  3024 1 1  83 LEU O    O  -3.807   2.639  10.372 1.00 . A A . 161 LEU O    1 1 
        2  3025 1 1  84 HIS C    C  -5.224   4.890   9.226 1.00 . A A . 162 HIS C    1 1 
        2  3026 1 1  84 HIS CA   C  -5.099   3.773   8.194 1.00 . A A . 162 HIS CA   1 1 
        2  3027 1 1  84 HIS CB   C  -6.042   4.038   7.018 1.00 . A A . 162 HIS CB   1 1 
        2  3028 1 1  84 HIS CD2  C  -5.104   6.428   6.606 1.00 . A A . 162 HIS CD2  1 1 
        2  3029 1 1  84 HIS CE1  C  -5.612   6.602   4.480 1.00 . A A . 162 HIS CE1  1 1 
        2  3030 1 1  84 HIS CG   C  -5.712   5.274   6.236 1.00 . A A . 162 HIS CG   1 1 
        2  3031 1 1  84 HIS H    H  -6.115   1.927   8.406 1.00 . A A . 162 HIS H    1 1 
        2  3032 1 1  84 HIS HA   H  -4.082   3.746   7.830 1.00 . A A . 162 HIS HA   1 1 
        2  3033 1 1  84 HIS HB2  H  -5.999   3.200   6.339 1.00 . A A . 162 HIS HB2  1 1 
        2  3034 1 1  84 HIS HB3  H  -7.050   4.138   7.391 1.00 . A A . 162 HIS HB3  1 1 
        2  3035 1 1  84 HIS HD1  H  -6.468   4.750   4.342 1.00 . A A . 162 HIS HD1  1 1 
        2  3036 1 1  84 HIS HD2  H  -4.730   6.670   7.589 1.00 . A A . 162 HIS HD2  1 1 
        2  3037 1 1  84 HIS HE1  H  -5.718   6.988   3.477 1.00 . A A . 162 HIS HE1  1 1 
        2  3038 1 1  84 HIS HE2  H  -4.593   8.097   5.439 1.00 . A A . 162 HIS HE2  1 1 
        2  3039 1 1  84 HIS N    N  -5.398   2.475   8.789 1.00 . A A . 162 HIS N    1 1 
        2  3040 1 1  84 HIS ND1  N  -6.018   5.417   4.900 1.00 . A A . 162 HIS ND1  1 1 
        2  3041 1 1  84 HIS NE2  N  -5.055   7.235   5.495 1.00 . A A . 162 HIS NE2  1 1 
        2  3042 1 1  84 HIS O    O  -4.276   5.639   9.463 1.00 . A A . 162 HIS O    1 1 
        2  3043 1 1  85 LYS C    C  -5.814   5.771  12.100 1.00 . A A . 163 LYS C    1 1 
        2  3044 1 1  85 LYS CA   C  -6.646   6.021  10.847 1.00 . A A . 163 LYS CA   1 1 
        2  3045 1 1  85 LYS CB   C  -8.132   6.060  11.209 1.00 . A A . 163 LYS CB   1 1 
        2  3046 1 1  85 LYS CD   C  -9.857   6.899  12.834 1.00 . A A . 163 LYS CD   1 1 
        2  3047 1 1  85 LYS CE   C  -9.857   7.175  14.329 1.00 . A A . 163 LYS CE   1 1 
        2  3048 1 1  85 LYS CG   C  -8.484   7.134  12.225 1.00 . A A . 163 LYS CG   1 1 
        2  3049 1 1  85 LYS H    H  -7.115   4.368   9.610 1.00 . A A . 163 LYS H    1 1 
        2  3050 1 1  85 LYS HA   H  -6.363   6.974  10.426 1.00 . A A . 163 LYS HA   1 1 
        2  3051 1 1  85 LYS HB2  H  -8.705   6.242  10.311 1.00 . A A . 163 LYS HB2  1 1 
        2  3052 1 1  85 LYS HB3  H  -8.416   5.101  11.617 1.00 . A A . 163 LYS HB3  1 1 
        2  3053 1 1  85 LYS HD2  H -10.569   7.555  12.357 1.00 . A A . 163 LYS HD2  1 1 
        2  3054 1 1  85 LYS HD3  H -10.143   5.870  12.666 1.00 . A A . 163 LYS HD3  1 1 
        2  3055 1 1  85 LYS HE2  H  -9.087   7.899  14.548 1.00 . A A . 163 LYS HE2  1 1 
        2  3056 1 1  85 LYS HE3  H -10.820   7.578  14.607 1.00 . A A . 163 LYS HE3  1 1 
        2  3057 1 1  85 LYS HG2  H  -7.745   7.126  13.012 1.00 . A A . 163 LYS HG2  1 1 
        2  3058 1 1  85 LYS HG3  H  -8.478   8.096  11.733 1.00 . A A . 163 LYS HG3  1 1 
        2  3059 1 1  85 LYS HZ1  H -10.475   5.384  15.209 1.00 . A A . 163 LYS HZ1  1 1 
        2  3060 1 1  85 LYS HZ2  H  -9.266   6.191  16.075 1.00 . A A . 163 LYS HZ2  1 1 
        2  3061 1 1  85 LYS HZ3  H  -8.876   5.360  14.654 1.00 . A A . 163 LYS HZ3  1 1 
        2  3062 1 1  85 LYS N    N  -6.398   4.995   9.840 1.00 . A A . 163 LYS N    1 1 
        2  3063 1 1  85 LYS NZ   N  -9.601   5.941  15.122 1.00 . A A . 163 LYS NZ   1 1 
        2  3064 1 1  85 LYS O    O  -5.438   6.709  12.805 1.00 . A A . 163 LYS O    1 1 
        2  3065 1 1  86 SER C    C  -3.310   4.628  13.432 1.00 . A A . 164 SER C    1 1 
        2  3066 1 1  86 SER CA   C  -4.748   4.129  13.546 1.00 . A A . 164 SER CA   1 1 
        2  3067 1 1  86 SER CB   C  -4.757   2.611  13.729 1.00 . A A . 164 SER CB   1 1 
        2  3068 1 1  86 SER H    H  -5.862   3.800  11.777 1.00 . A A . 164 SER H    1 1 
        2  3069 1 1  86 SER HA   H  -5.206   4.587  14.410 1.00 . A A . 164 SER HA   1 1 
        2  3070 1 1  86 SER HB2  H  -4.431   2.369  14.730 1.00 . A A . 164 SER HB2  1 1 
        2  3071 1 1  86 SER HB3  H  -5.759   2.238  13.577 1.00 . A A . 164 SER HB3  1 1 
        2  3072 1 1  86 SER HG   H  -2.979   2.180  13.030 1.00 . A A . 164 SER HG   1 1 
        2  3073 1 1  86 SER N    N  -5.533   4.502  12.375 1.00 . A A . 164 SER N    1 1 
        2  3074 1 1  86 SER O    O  -2.614   4.770  14.437 1.00 . A A . 164 SER O    1 1 
        2  3075 1 1  86 SER OG   O  -3.890   1.981  12.803 1.00 . A A . 164 SER OG   1 1 
        2  3076 1 1  87 TYR C    C  -1.363   6.829  12.393 1.00 . A A . 165 TYR C    1 1 
        2  3077 1 1  87 TYR CA   C  -1.508   5.370  11.974 1.00 . A A . 165 TYR CA   1 1 
        2  3078 1 1  87 TYR CB   C  -1.132   5.210  10.500 1.00 . A A . 165 TYR CB   1 1 
        2  3079 1 1  87 TYR CD1  C  -0.219   2.886  10.880 1.00 . A A . 165 TYR CD1  1 1 
        2  3080 1 1  87 TYR CD2  C  -1.452   3.298   8.881 1.00 . A A . 165 TYR CD2  1 1 
        2  3081 1 1  87 TYR CE1  C  -0.033   1.571  10.499 1.00 . A A . 165 TYR CE1  1 1 
        2  3082 1 1  87 TYR CE2  C  -1.271   1.984   8.494 1.00 . A A . 165 TYR CE2  1 1 
        2  3083 1 1  87 TYR CG   C  -0.931   3.771  10.079 1.00 . A A . 165 TYR CG   1 1 
        2  3084 1 1  87 TYR CZ   C  -0.561   1.125   9.306 1.00 . A A . 165 TYR CZ   1 1 
        2  3085 1 1  87 TYR H    H  -3.460   4.760  11.437 1.00 . A A . 165 TYR H    1 1 
        2  3086 1 1  87 TYR HA   H  -0.840   4.769  12.573 1.00 . A A . 165 TYR HA   1 1 
        2  3087 1 1  87 TYR HB2  H  -1.917   5.628   9.887 1.00 . A A . 165 TYR HB2  1 1 
        2  3088 1 1  87 TYR HB3  H  -0.212   5.744  10.311 1.00 . A A . 165 TYR HB3  1 1 
        2  3089 1 1  87 TYR HD1  H   0.192   3.238  11.814 1.00 . A A . 165 TYR HD1  1 1 
        2  3090 1 1  87 TYR HD2  H  -2.007   3.973   8.247 1.00 . A A . 165 TYR HD2  1 1 
        2  3091 1 1  87 TYR HE1  H   0.523   0.898  11.135 1.00 . A A . 165 TYR HE1  1 1 
        2  3092 1 1  87 TYR HE2  H  -1.684   1.635   7.559 1.00 . A A . 165 TYR HE2  1 1 
        2  3093 1 1  87 TYR HH   H   0.510  -0.466   9.158 1.00 . A A . 165 TYR HH   1 1 
        2  3094 1 1  87 TYR N    N  -2.866   4.891  12.205 1.00 . A A . 165 TYR N    1 1 
        2  3095 1 1  87 TYR O    O  -2.120   7.693  11.950 1.00 . A A . 165 TYR O    1 1 
        2  3096 1 1  87 TYR OH   O  -0.378  -0.184   8.923 1.00 . A A . 165 TYR OH   1 1 
        2  3097 1 1  88 ARG C    C   0.310   9.360  12.587 1.00 . A A . 166 ARG C    1 1 
        2  3098 1 1  88 ARG CA   C  -0.129   8.448  13.733 1.00 . A A . 166 ARG CA   1 1 
        2  3099 1 1  88 ARG CB   C   0.936   8.420  14.834 1.00 . A A . 166 ARG CB   1 1 
        2  3100 1 1  88 ARG CD   C   1.657   7.461  17.047 1.00 . A A . 166 ARG CD   1 1 
        2  3101 1 1  88 ARG CG   C   0.728   7.310  15.853 1.00 . A A . 166 ARG CG   1 1 
        2  3102 1 1  88 ARG CZ   C   1.563   6.805  19.424 1.00 . A A . 166 ARG CZ   1 1 
        2  3103 1 1  88 ARG H    H   0.187   6.362  13.564 1.00 . A A . 166 ARG H    1 1 
        2  3104 1 1  88 ARG HA   H  -1.051   8.828  14.146 1.00 . A A . 166 ARG HA   1 1 
        2  3105 1 1  88 ARG HB2  H   1.905   8.284  14.377 1.00 . A A . 166 ARG HB2  1 1 
        2  3106 1 1  88 ARG HB3  H   0.923   9.365  15.356 1.00 . A A . 166 ARG HB3  1 1 
        2  3107 1 1  88 ARG HD2  H   2.462   6.749  16.950 1.00 . A A . 166 ARG HD2  1 1 
        2  3108 1 1  88 ARG HD3  H   2.061   8.463  17.049 1.00 . A A . 166 ARG HD3  1 1 
        2  3109 1 1  88 ARG HE   H  -0.004   7.386  18.332 1.00 . A A . 166 ARG HE   1 1 
        2  3110 1 1  88 ARG HG2  H  -0.294   7.341  16.200 1.00 . A A . 166 ARG HG2  1 1 
        2  3111 1 1  88 ARG HG3  H   0.919   6.359  15.378 1.00 . A A . 166 ARG HG3  1 1 
        2  3112 1 1  88 ARG HH11 H   3.415   6.728  18.615 1.00 . A A . 166 ARG HH11 1 1 
        2  3113 1 1  88 ARG HH12 H   3.313   6.266  20.280 1.00 . A A . 166 ARG HH12 1 1 
        2  3114 1 1  88 ARG HH21 H  -0.135   6.780  20.520 1.00 . A A . 166 ARG HH21 1 1 
        2  3115 1 1  88 ARG HH22 H   1.300   6.295  21.361 1.00 . A A . 166 ARG HH22 1 1 
        2  3116 1 1  88 ARG N    N  -0.382   7.095  13.249 1.00 . A A . 166 ARG N    1 1 
        2  3117 1 1  88 ARG NE   N   0.963   7.225  18.311 1.00 . A A . 166 ARG NE   1 1 
        2  3118 1 1  88 ARG NH1  N   2.871   6.582  19.440 1.00 . A A . 166 ARG NH1  1 1 
        2  3119 1 1  88 ARG NH2  N   0.851   6.611  20.525 1.00 . A A . 166 ARG NH2  1 1 
        2  3120 1 1  88 ARG O    O   0.063   9.060  11.419 1.00 . A A . 166 ARG O    1 1 
        2  3121 1 1  89 SER C    C   2.531  10.813  11.068 1.00 . A A . 167 SER C    1 1 
        2  3122 1 1  89 SER CA   C   1.425  11.424  11.924 1.00 . A A . 167 SER CA   1 1 
        2  3123 1 1  89 SER CB   C   1.931  12.700  12.600 1.00 . A A . 167 SER CB   1 1 
        2  3124 1 1  89 SER H    H   1.123  10.660  13.872 1.00 . A A . 167 SER H    1 1 
        2  3125 1 1  89 SER HA   H   0.589  11.672  11.287 1.00 . A A . 167 SER HA   1 1 
        2  3126 1 1  89 SER HB2  H   2.815  12.474  13.177 1.00 . A A . 167 SER HB2  1 1 
        2  3127 1 1  89 SER HB3  H   2.172  13.434  11.845 1.00 . A A . 167 SER HB3  1 1 
        2  3128 1 1  89 SER HG   H   0.163  13.462  12.961 1.00 . A A . 167 SER HG   1 1 
        2  3129 1 1  89 SER N    N   0.957  10.473  12.927 1.00 . A A . 167 SER N    1 1 
        2  3130 1 1  89 SER O    O   3.703  11.167  11.200 1.00 . A A . 167 SER O    1 1 
        2  3131 1 1  89 SER OG   O   0.949  13.242  13.466 1.00 . A A . 167 SER OG   1 1 
        2  3132 1 1  90 MET C    C   3.306  10.025   8.027 1.00 . A A . 168 MET C    1 1 
        2  3133 1 1  90 MET CA   C   3.096   9.226   9.311 1.00 . A A . 168 MET CA   1 1 
        2  3134 1 1  90 MET CB   C   2.604   7.818   8.974 1.00 . A A . 168 MET CB   1 1 
        2  3135 1 1  90 MET CE   C   2.841   4.485   9.367 1.00 . A A . 168 MET CE   1 1 
        2  3136 1 1  90 MET CG   C   3.673   6.930   8.361 1.00 . A A . 168 MET CG   1 1 
        2  3137 1 1  90 MET H    H   1.197   9.657  10.138 1.00 . A A . 168 MET H    1 1 
        2  3138 1 1  90 MET HA   H   4.038   9.153   9.833 1.00 . A A . 168 MET HA   1 1 
        2  3139 1 1  90 MET HB2  H   2.249   7.347   9.880 1.00 . A A . 168 MET HB2  1 1 
        2  3140 1 1  90 MET HB3  H   1.784   7.894   8.274 1.00 . A A . 168 MET HB3  1 1 
        2  3141 1 1  90 MET HE1  H   2.856   3.820  10.217 1.00 . A A . 168 MET HE1  1 1 
        2  3142 1 1  90 MET HE2  H   2.920   3.909   8.457 1.00 . A A . 168 MET HE2  1 1 
        2  3143 1 1  90 MET HE3  H   1.915   5.042   9.362 1.00 . A A . 168 MET HE3  1 1 
        2  3144 1 1  90 MET HG2  H   3.274   6.477   7.466 1.00 . A A . 168 MET HG2  1 1 
        2  3145 1 1  90 MET HG3  H   4.524   7.543   8.103 1.00 . A A . 168 MET HG3  1 1 
        2  3146 1 1  90 MET N    N   2.146   9.893  10.192 1.00 . A A . 168 MET N    1 1 
        2  3147 1 1  90 MET O    O   2.389  10.686   7.539 1.00 . A A . 168 MET O    1 1 
        2  3148 1 1  90 MET SD   S   4.220   5.622   9.476 1.00 . A A . 168 MET SD   1 1 
        2  3149 1 1  91 THR C    C   4.664   9.764   5.039 1.00 . A A . 169 THR C    1 1 
        2  3150 1 1  91 THR CA   C   4.848  10.668   6.254 1.00 . A A . 169 THR CA   1 1 
        2  3151 1 1  91 THR CB   C   6.289  11.179   6.310 1.00 . A A . 169 THR CB   1 1 
        2  3152 1 1  91 THR CG2  C   6.398  12.609   6.791 1.00 . A A . 169 THR CG2  1 1 
        2  3153 1 1  91 THR H    H   5.206   9.409   7.916 1.00 . A A . 169 THR H    1 1 
        2  3154 1 1  91 THR HA   H   4.180  11.509   6.165 1.00 . A A . 169 THR HA   1 1 
        2  3155 1 1  91 THR HB   H   6.716  11.131   5.318 1.00 . A A . 169 THR HB   1 1 
        2  3156 1 1  91 THR HG1  H   7.993  10.413   6.897 1.00 . A A . 169 THR HG1  1 1 
        2  3157 1 1  91 THR HG21 H   6.485  12.621   7.868 1.00 . A A . 169 THR HG21 1 1 
        2  3158 1 1  91 THR HG22 H   5.516  13.157   6.496 1.00 . A A . 169 THR HG22 1 1 
        2  3159 1 1  91 THR HG23 H   7.271  13.071   6.355 1.00 . A A . 169 THR HG23 1 1 
        2  3160 1 1  91 THR N    N   4.517   9.955   7.483 1.00 . A A . 169 THR N    1 1 
        2  3161 1 1  91 THR O    O   4.564   8.545   5.172 1.00 . A A . 169 THR O    1 1 
        2  3162 1 1  91 THR OG1  O   7.074  10.374   7.172 1.00 . A A . 169 THR OG1  1 1 
        2  3163 1 1  92 PRO C    C   5.533   8.524   2.434 1.00 . A A . 170 PRO C    1 1 
        2  3164 1 1  92 PRO CA   C   4.453   9.586   2.593 1.00 . A A . 170 PRO CA   1 1 
        2  3165 1 1  92 PRO CB   C   4.568  10.644   1.485 1.00 . A A . 170 PRO CB   1 1 
        2  3166 1 1  92 PRO CD   C   4.737  11.793   3.573 1.00 . A A . 170 PRO CD   1 1 
        2  3167 1 1  92 PRO CG   C   5.177  11.838   2.139 1.00 . A A . 170 PRO CG   1 1 
        2  3168 1 1  92 PRO HA   H   3.481   9.117   2.548 1.00 . A A . 170 PRO HA   1 1 
        2  3169 1 1  92 PRO HB2  H   5.195  10.267   0.690 1.00 . A A . 170 PRO HB2  1 1 
        2  3170 1 1  92 PRO HB3  H   3.585  10.867   1.097 1.00 . A A . 170 PRO HB3  1 1 
        2  3171 1 1  92 PRO HD2  H   5.482  12.243   4.212 1.00 . A A . 170 PRO HD2  1 1 
        2  3172 1 1  92 PRO HD3  H   3.784  12.286   3.693 1.00 . A A . 170 PRO HD3  1 1 
        2  3173 1 1  92 PRO HG2  H   6.254  11.783   2.075 1.00 . A A . 170 PRO HG2  1 1 
        2  3174 1 1  92 PRO HG3  H   4.817  12.740   1.665 1.00 . A A . 170 PRO HG3  1 1 
        2  3175 1 1  92 PRO N    N   4.620  10.350   3.831 1.00 . A A . 170 PRO N    1 1 
        2  3176 1 1  92 PRO O    O   5.237   7.356   2.182 1.00 . A A . 170 PRO O    1 1 
        2  3177 1 1  93 ALA C    C   7.783   6.843   3.409 1.00 . A A . 171 ALA C    1 1 
        2  3178 1 1  93 ALA CA   C   7.917   8.022   2.452 1.00 . A A . 171 ALA CA   1 1 
        2  3179 1 1  93 ALA CB   C   9.224   8.760   2.701 1.00 . A A . 171 ALA CB   1 1 
        2  3180 1 1  93 ALA H    H   6.962   9.883   2.775 1.00 . A A . 171 ALA H    1 1 
        2  3181 1 1  93 ALA HA   H   7.930   7.650   1.438 1.00 . A A . 171 ALA HA   1 1 
        2  3182 1 1  93 ALA HB1  H   9.047   9.593   3.365 1.00 . A A . 171 ALA HB1  1 1 
        2  3183 1 1  93 ALA HB2  H   9.617   9.123   1.763 1.00 . A A . 171 ALA HB2  1 1 
        2  3184 1 1  93 ALA HB3  H   9.937   8.086   3.153 1.00 . A A . 171 ALA HB3  1 1 
        2  3185 1 1  93 ALA N    N   6.788   8.938   2.581 1.00 . A A . 171 ALA N    1 1 
        2  3186 1 1  93 ALA O    O   8.120   5.710   3.064 1.00 . A A . 171 ALA O    1 1 
        2  3187 1 1  94 GLN C    C   6.200   4.967   5.085 1.00 . A A . 172 GLN C    1 1 
        2  3188 1 1  94 GLN CA   C   7.107   6.071   5.616 1.00 . A A . 172 GLN CA   1 1 
        2  3189 1 1  94 GLN CB   C   6.519   6.661   6.898 1.00 . A A . 172 GLN CB   1 1 
        2  3190 1 1  94 GLN CD   C   8.052   6.170   8.843 1.00 . A A . 172 GLN CD   1 1 
        2  3191 1 1  94 GLN CG   C   7.569   7.209   7.851 1.00 . A A . 172 GLN CG   1 1 
        2  3192 1 1  94 GLN H    H   7.034   8.036   4.830 1.00 . A A . 172 GLN H    1 1 
        2  3193 1 1  94 GLN HA   H   8.077   5.650   5.834 1.00 . A A . 172 GLN HA   1 1 
        2  3194 1 1  94 GLN HB2  H   5.848   7.465   6.635 1.00 . A A . 172 GLN HB2  1 1 
        2  3195 1 1  94 GLN HB3  H   5.962   5.892   7.413 1.00 . A A . 172 GLN HB3  1 1 
        2  3196 1 1  94 GLN HE21 H   9.796   6.043   7.897 1.00 . A A . 172 GLN HE21 1 1 
        2  3197 1 1  94 GLN HE22 H   9.618   5.026   9.282 1.00 . A A . 172 GLN HE22 1 1 
        2  3198 1 1  94 GLN HG2  H   8.414   7.554   7.275 1.00 . A A . 172 GLN HG2  1 1 
        2  3199 1 1  94 GLN HG3  H   7.143   8.038   8.397 1.00 . A A . 172 GLN HG3  1 1 
        2  3200 1 1  94 GLN N    N   7.287   7.114   4.613 1.00 . A A . 172 GLN N    1 1 
        2  3201 1 1  94 GLN NE2  N   9.279   5.699   8.655 1.00 . A A . 172 GLN NE2  1 1 
        2  3202 1 1  94 GLN O    O   6.473   3.781   5.269 1.00 . A A . 172 GLN O    1 1 
        2  3203 1 1  94 GLN OE1  O   7.332   5.795   9.768 1.00 . A A . 172 GLN OE1  1 1 
        2  3204 1 1  95 ALA C    C   4.815   3.657   2.688 1.00 . A A . 173 ALA C    1 1 
        2  3205 1 1  95 ALA CA   C   4.179   4.414   3.848 1.00 . A A . 173 ALA CA   1 1 
        2  3206 1 1  95 ALA CB   C   2.919   5.131   3.390 1.00 . A A . 173 ALA CB   1 1 
        2  3207 1 1  95 ALA H    H   4.964   6.326   4.297 1.00 . A A . 173 ALA H    1 1 
        2  3208 1 1  95 ALA HA   H   3.907   3.710   4.621 1.00 . A A . 173 ALA HA   1 1 
        2  3209 1 1  95 ALA HB1  H   3.156   6.158   3.152 1.00 . A A . 173 ALA HB1  1 1 
        2  3210 1 1  95 ALA HB2  H   2.183   5.106   4.181 1.00 . A A . 173 ALA HB2  1 1 
        2  3211 1 1  95 ALA HB3  H   2.523   4.640   2.514 1.00 . A A . 173 ALA HB3  1 1 
        2  3212 1 1  95 ALA N    N   5.123   5.367   4.417 1.00 . A A . 173 ALA N    1 1 
        2  3213 1 1  95 ALA O    O   4.694   2.435   2.586 1.00 . A A . 173 ALA O    1 1 
        2  3214 1 1  96 ASP C    C   7.163   2.735   1.113 1.00 . A A . 174 ASP C    1 1 
        2  3215 1 1  96 ASP CA   C   6.167   3.802   0.666 1.00 . A A . 174 ASP CA   1 1 
        2  3216 1 1  96 ASP CB   C   6.891   4.882  -0.139 1.00 . A A . 174 ASP CB   1 1 
        2  3217 1 1  96 ASP CG   C   5.970   5.591  -1.113 1.00 . A A . 174 ASP CG   1 1 
        2  3218 1 1  96 ASP H    H   5.564   5.363   1.960 1.00 . A A . 174 ASP H    1 1 
        2  3219 1 1  96 ASP HA   H   5.415   3.346   0.044 1.00 . A A . 174 ASP HA   1 1 
        2  3220 1 1  96 ASP HB2  H   7.299   5.616   0.539 1.00 . A A . 174 ASP HB2  1 1 
        2  3221 1 1  96 ASP HB3  H   7.695   4.427  -0.698 1.00 . A A . 174 ASP HB3  1 1 
        2  3222 1 1  96 ASP N    N   5.500   4.395   1.819 1.00 . A A . 174 ASP N    1 1 
        2  3223 1 1  96 ASP O    O   7.268   1.667   0.507 1.00 . A A . 174 ASP O    1 1 
        2  3224 1 1  96 ASP OD1  O   5.059   4.931  -1.656 1.00 . A A . 174 ASP OD1  1 1 
        2  3225 1 1  96 ASP OD2  O   6.160   6.805  -1.333 1.00 . A A . 174 ASP OD2  1 1 
        2  3226 1 1  97 LEU C    C   8.193   0.934   3.438 1.00 . A A . 175 LEU C    1 1 
        2  3227 1 1  97 LEU CA   C   8.868   2.114   2.742 1.00 . A A . 175 LEU CA   1 1 
        2  3228 1 1  97 LEU CB   C   9.780   2.848   3.727 1.00 . A A . 175 LEU CB   1 1 
        2  3229 1 1  97 LEU CD1  C  11.838   1.781   2.768 1.00 . A A . 175 LEU CD1  1 1 
        2  3230 1 1  97 LEU CD2  C  11.965   3.009   4.943 1.00 . A A . 175 LEU CD2  1 1 
        2  3231 1 1  97 LEU CG   C  11.097   2.138   4.048 1.00 . A A . 175 LEU CG   1 1 
        2  3232 1 1  97 LEU H    H   7.731   3.895   2.632 1.00 . A A . 175 LEU H    1 1 
        2  3233 1 1  97 LEU HA   H   9.466   1.739   1.925 1.00 . A A . 175 LEU HA   1 1 
        2  3234 1 1  97 LEU HB2  H  10.011   3.820   3.315 1.00 . A A . 175 LEU HB2  1 1 
        2  3235 1 1  97 LEU HB3  H   9.239   2.988   4.651 1.00 . A A . 175 LEU HB3  1 1 
        2  3236 1 1  97 LEU HD11 H  11.298   1.006   2.244 1.00 . A A . 175 LEU HD11 1 1 
        2  3237 1 1  97 LEU HD12 H  12.829   1.428   3.013 1.00 . A A . 175 LEU HD12 1 1 
        2  3238 1 1  97 LEU HD13 H  11.913   2.656   2.140 1.00 . A A . 175 LEU HD13 1 1 
        2  3239 1 1  97 LEU HD21 H  11.345   3.730   5.456 1.00 . A A . 175 LEU HD21 1 1 
        2  3240 1 1  97 LEU HD22 H  12.697   3.528   4.341 1.00 . A A . 175 LEU HD22 1 1 
        2  3241 1 1  97 LEU HD23 H  12.471   2.389   5.669 1.00 . A A . 175 LEU HD23 1 1 
        2  3242 1 1  97 LEU HG   H  10.884   1.221   4.577 1.00 . A A . 175 LEU HG   1 1 
        2  3243 1 1  97 LEU N    N   7.883   3.035   2.188 1.00 . A A . 175 LEU N    1 1 
        2  3244 1 1  97 LEU O    O   8.727  -0.174   3.461 1.00 . A A . 175 LEU O    1 1 
        2  3245 1 1  98 GLU C    C   5.896  -1.007   3.826 1.00 . A A . 176 GLU C    1 1 
        2  3246 1 1  98 GLU CA   C   6.285   0.153   4.739 1.00 . A A . 176 GLU CA   1 1 
        2  3247 1 1  98 GLU CB   C   5.031   0.753   5.378 1.00 . A A . 176 GLU CB   1 1 
        2  3248 1 1  98 GLU CD   C   5.550   0.384   7.822 1.00 . A A . 176 GLU CD   1 1 
        2  3249 1 1  98 GLU CG   C   5.288   1.401   6.728 1.00 . A A . 176 GLU CG   1 1 
        2  3250 1 1  98 GLU H    H   6.659   2.095   3.981 1.00 . A A . 176 GLU H    1 1 
        2  3251 1 1  98 GLU HA   H   6.924  -0.225   5.522 1.00 . A A . 176 GLU HA   1 1 
        2  3252 1 1  98 GLU HB2  H   4.626   1.502   4.714 1.00 . A A . 176 GLU HB2  1 1 
        2  3253 1 1  98 GLU HB3  H   4.299  -0.030   5.511 1.00 . A A . 176 GLU HB3  1 1 
        2  3254 1 1  98 GLU HG2  H   6.149   2.047   6.645 1.00 . A A . 176 GLU HG2  1 1 
        2  3255 1 1  98 GLU HG3  H   4.423   1.988   7.002 1.00 . A A . 176 GLU HG3  1 1 
        2  3256 1 1  98 GLU N    N   7.026   1.187   4.022 1.00 . A A . 176 GLU N    1 1 
        2  3257 1 1  98 GLU O    O   6.206  -2.164   4.114 1.00 . A A . 176 GLU O    1 1 
        2  3258 1 1  98 GLU OE1  O   5.887  -0.772   7.490 1.00 . A A . 176 GLU OE1  1 1 
        2  3259 1 1  98 GLU OE2  O   5.419   0.744   9.011 1.00 . A A . 176 GLU OE2  1 1 
        2  3260 1 1  99 PHE C    C   5.997  -2.300   1.035 1.00 . A A . 177 PHE C    1 1 
        2  3261 1 1  99 PHE CA   C   4.797  -1.732   1.785 1.00 . A A . 177 PHE CA   1 1 
        2  3262 1 1  99 PHE CB   C   3.764  -1.174   0.800 1.00 . A A . 177 PHE CB   1 1 
        2  3263 1 1  99 PHE CD1  C   4.352  -2.099  -1.458 1.00 . A A . 177 PHE CD1  1 1 
        2  3264 1 1  99 PHE CD2  C   2.373  -2.892  -0.389 1.00 . A A . 177 PHE CD2  1 1 
        2  3265 1 1  99 PHE CE1  C   4.105  -2.924  -2.537 1.00 . A A . 177 PHE CE1  1 1 
        2  3266 1 1  99 PHE CE2  C   2.120  -3.720  -1.467 1.00 . A A . 177 PHE CE2  1 1 
        2  3267 1 1  99 PHE CG   C   3.490  -2.074  -0.373 1.00 . A A . 177 PHE CG   1 1 
        2  3268 1 1  99 PHE CZ   C   2.987  -3.736  -2.542 1.00 . A A . 177 PHE CZ   1 1 
        2  3269 1 1  99 PHE H    H   5.002   0.240   2.537 1.00 . A A . 177 PHE H    1 1 
        2  3270 1 1  99 PHE HA   H   4.340  -2.526   2.356 1.00 . A A . 177 PHE HA   1 1 
        2  3271 1 1  99 PHE HB2  H   2.831  -1.018   1.319 1.00 . A A . 177 PHE HB2  1 1 
        2  3272 1 1  99 PHE HB3  H   4.117  -0.231   0.418 1.00 . A A . 177 PHE HB3  1 1 
        2  3273 1 1  99 PHE HD1  H   5.226  -1.465  -1.455 1.00 . A A . 177 PHE HD1  1 1 
        2  3274 1 1  99 PHE HD2  H   1.695  -2.880   0.451 1.00 . A A . 177 PHE HD2  1 1 
        2  3275 1 1  99 PHE HE1  H   4.784  -2.935  -3.377 1.00 . A A . 177 PHE HE1  1 1 
        2  3276 1 1  99 PHE HE2  H   1.246  -4.354  -1.468 1.00 . A A . 177 PHE HE2  1 1 
        2  3277 1 1  99 PHE HZ   H   2.792  -4.381  -3.385 1.00 . A A . 177 PHE HZ   1 1 
        2  3278 1 1  99 PHE N    N   5.219  -0.698   2.724 1.00 . A A . 177 PHE N    1 1 
        2  3279 1 1  99 PHE O    O   6.081  -3.507   0.808 1.00 . A A . 177 PHE O    1 1 
        2  3280 1 1 100 LEU C    C   8.952  -2.799   0.800 1.00 . A A . 178 LEU C    1 1 
        2  3281 1 1 100 LEU CA   C   8.117  -1.859  -0.062 1.00 . A A . 178 LEU CA   1 1 
        2  3282 1 1 100 LEU CB   C   8.951  -0.649  -0.485 1.00 . A A . 178 LEU CB   1 1 
        2  3283 1 1 100 LEU CD1  C   9.381   1.214  -2.107 1.00 . A A . 178 LEU CD1  1 1 
        2  3284 1 1 100 LEU CD2  C   8.156  -0.837  -2.857 1.00 . A A . 178 LEU CD2  1 1 
        2  3285 1 1 100 LEU CG   C   8.413   0.115  -1.696 1.00 . A A . 178 LEU CG   1 1 
        2  3286 1 1 100 LEU H    H   6.808  -0.477   0.866 1.00 . A A . 178 LEU H    1 1 
        2  3287 1 1 100 LEU HA   H   7.796  -2.391  -0.946 1.00 . A A . 178 LEU HA   1 1 
        2  3288 1 1 100 LEU HB2  H   9.005   0.033   0.351 1.00 . A A . 178 LEU HB2  1 1 
        2  3289 1 1 100 LEU HB3  H   9.949  -0.989  -0.716 1.00 . A A . 178 LEU HB3  1 1 
        2  3290 1 1 100 LEU HD11 H  10.113   1.361  -1.327 1.00 . A A . 178 LEU HD11 1 1 
        2  3291 1 1 100 LEU HD12 H   8.835   2.132  -2.265 1.00 . A A . 178 LEU HD12 1 1 
        2  3292 1 1 100 LEU HD13 H   9.882   0.931  -3.021 1.00 . A A . 178 LEU HD13 1 1 
        2  3293 1 1 100 LEU HD21 H   8.938  -1.581  -2.892 1.00 . A A . 178 LEU HD21 1 1 
        2  3294 1 1 100 LEU HD22 H   8.146  -0.281  -3.783 1.00 . A A . 178 LEU HD22 1 1 
        2  3295 1 1 100 LEU HD23 H   7.202  -1.324  -2.719 1.00 . A A . 178 LEU HD23 1 1 
        2  3296 1 1 100 LEU HG   H   7.475   0.580  -1.431 1.00 . A A . 178 LEU HG   1 1 
        2  3297 1 1 100 LEU N    N   6.925  -1.429   0.656 1.00 . A A . 178 LEU N    1 1 
        2  3298 1 1 100 LEU O    O   9.448  -3.818   0.322 1.00 . A A . 178 LEU O    1 1 
        2  3299 1 1 101 GLU C    C   9.160  -4.597   3.265 1.00 . A A . 179 GLU C    1 1 
        2  3300 1 1 101 GLU CA   C   9.860  -3.269   3.010 1.00 . A A . 179 GLU CA   1 1 
        2  3301 1 1 101 GLU CB   C  10.059  -2.523   4.330 1.00 . A A . 179 GLU CB   1 1 
        2  3302 1 1 101 GLU CD   C  12.491  -1.849   4.277 1.00 . A A . 179 GLU CD   1 1 
        2  3303 1 1 101 GLU CG   C  11.051  -1.377   4.237 1.00 . A A . 179 GLU CG   1 1 
        2  3304 1 1 101 GLU H    H   8.667  -1.632   2.397 1.00 . A A . 179 GLU H    1 1 
        2  3305 1 1 101 GLU HA   H  10.823  -3.464   2.568 1.00 . A A . 179 GLU HA   1 1 
        2  3306 1 1 101 GLU HB2  H   9.108  -2.123   4.651 1.00 . A A . 179 GLU HB2  1 1 
        2  3307 1 1 101 GLU HB3  H  10.415  -3.220   5.074 1.00 . A A . 179 GLU HB3  1 1 
        2  3308 1 1 101 GLU HG2  H  10.887  -0.852   3.308 1.00 . A A . 179 GLU HG2  1 1 
        2  3309 1 1 101 GLU HG3  H  10.883  -0.705   5.065 1.00 . A A . 179 GLU HG3  1 1 
        2  3310 1 1 101 GLU N    N   9.094  -2.453   2.075 1.00 . A A . 179 GLU N    1 1 
        2  3311 1 1 101 GLU O    O   9.805  -5.624   3.478 1.00 . A A . 179 GLU O    1 1 
        2  3312 1 1 101 GLU OE1  O  12.750  -3.002   3.873 1.00 . A A . 179 GLU OE1  1 1 
        2  3313 1 1 101 GLU OE2  O  13.360  -1.065   4.714 1.00 . A A . 179 GLU OE2  1 1 
        2  3314 1 1 102 ASN C    C   7.142  -6.693   2.231 1.00 . A A . 180 ASN C    1 1 
        2  3315 1 1 102 ASN CA   C   7.042  -5.769   3.442 1.00 . A A . 180 ASN CA   1 1 
        2  3316 1 1 102 ASN CB   C   5.583  -5.394   3.701 1.00 . A A . 180 ASN CB   1 1 
        2  3317 1 1 102 ASN CG   C   5.204  -5.524   5.163 1.00 . A A . 180 ASN CG   1 1 
        2  3318 1 1 102 ASN H    H   7.385  -3.717   3.035 1.00 . A A . 180 ASN H    1 1 
        2  3319 1 1 102 ASN HA   H   7.436  -6.280   4.307 1.00 . A A . 180 ASN HA   1 1 
        2  3320 1 1 102 ASN HB2  H   5.428  -4.369   3.398 1.00 . A A . 180 ASN HB2  1 1 
        2  3321 1 1 102 ASN HB3  H   4.940  -6.039   3.121 1.00 . A A . 180 ASN HB3  1 1 
        2  3322 1 1 102 ASN HD21 H   5.658  -3.613   5.476 1.00 . A A . 180 ASN HD21 1 1 
        2  3323 1 1 102 ASN HD22 H   5.094  -4.486   6.856 1.00 . A A . 180 ASN HD22 1 1 
        2  3324 1 1 102 ASN N    N   7.835  -4.568   3.228 1.00 . A A . 180 ASN N    1 1 
        2  3325 1 1 102 ASN ND2  N   5.331  -4.431   5.907 1.00 . A A . 180 ASN ND2  1 1 
        2  3326 1 1 102 ASN O    O   7.408  -7.887   2.366 1.00 . A A . 180 ASN O    1 1 
        2  3327 1 1 102 ASN OD1  O   4.802  -6.594   5.619 1.00 . A A . 180 ASN OD1  1 1 
        2  3328 1 1 103 ALA C    C   8.393  -7.457  -0.413 1.00 . A A . 181 ALA C    1 1 
        2  3329 1 1 103 ALA CA   C   6.996  -6.887  -0.192 1.00 . A A . 181 ALA CA   1 1 
        2  3330 1 1 103 ALA CB   C   6.587  -6.014  -1.368 1.00 . A A . 181 ALA CB   1 1 
        2  3331 1 1 103 ALA H    H   6.717  -5.170   1.015 1.00 . A A . 181 ALA H    1 1 
        2  3332 1 1 103 ALA HA   H   6.292  -7.704  -0.119 1.00 . A A . 181 ALA HA   1 1 
        2  3333 1 1 103 ALA HB1  H   6.961  -5.012  -1.220 1.00 . A A . 181 ALA HB1  1 1 
        2  3334 1 1 103 ALA HB2  H   5.510  -5.989  -1.442 1.00 . A A . 181 ALA HB2  1 1 
        2  3335 1 1 103 ALA HB3  H   7.001  -6.421  -2.279 1.00 . A A . 181 ALA HB3  1 1 
        2  3336 1 1 103 ALA N    N   6.929  -6.125   1.049 1.00 . A A . 181 ALA N    1 1 
        2  3337 1 1 103 ALA O    O   8.547  -8.579  -0.896 1.00 . A A . 181 ALA O    1 1 
        2  3338 1 1 104 LYS C    C  11.133  -8.222   0.770 1.00 . A A . 182 LYS C    1 1 
        2  3339 1 1 104 LYS CA   C  10.794  -7.110  -0.216 1.00 . A A . 182 LYS CA   1 1 
        2  3340 1 1 104 LYS CB   C  11.750  -5.931  -0.025 1.00 . A A . 182 LYS CB   1 1 
        2  3341 1 1 104 LYS CD   C  13.940  -4.873  -0.652 1.00 . A A . 182 LYS CD   1 1 
        2  3342 1 1 104 LYS CE   C  13.515  -3.495  -1.132 1.00 . A A . 182 LYS CE   1 1 
        2  3343 1 1 104 LYS CG   C  12.909  -5.930  -1.006 1.00 . A A . 182 LYS CG   1 1 
        2  3344 1 1 104 LYS H    H   9.223  -5.795   0.325 1.00 . A A . 182 LYS H    1 1 
        2  3345 1 1 104 LYS HA   H  10.908  -7.490  -1.220 1.00 . A A . 182 LYS HA   1 1 
        2  3346 1 1 104 LYS HB2  H  11.200  -5.012  -0.150 1.00 . A A . 182 LYS HB2  1 1 
        2  3347 1 1 104 LYS HB3  H  12.153  -5.967   0.976 1.00 . A A . 182 LYS HB3  1 1 
        2  3348 1 1 104 LYS HD2  H  14.062  -4.847   0.421 1.00 . A A . 182 LYS HD2  1 1 
        2  3349 1 1 104 LYS HD3  H  14.879  -5.133  -1.116 1.00 . A A . 182 LYS HD3  1 1 
        2  3350 1 1 104 LYS HE2  H  12.439  -3.424  -1.078 1.00 . A A . 182 LYS HE2  1 1 
        2  3351 1 1 104 LYS HE3  H  13.957  -2.750  -0.486 1.00 . A A . 182 LYS HE3  1 1 
        2  3352 1 1 104 LYS HG2  H  13.383  -6.900  -0.989 1.00 . A A . 182 LYS HG2  1 1 
        2  3353 1 1 104 LYS HG3  H  12.528  -5.731  -1.997 1.00 . A A . 182 LYS HG3  1 1 
        2  3354 1 1 104 LYS HZ1  H  13.506  -3.928  -3.176 1.00 . A A . 182 LYS HZ1  1 1 
        2  3355 1 1 104 LYS HZ2  H  14.980  -3.319  -2.612 1.00 . A A . 182 LYS HZ2  1 1 
        2  3356 1 1 104 LYS HZ3  H  13.662  -2.280  -2.826 1.00 . A A . 182 LYS HZ3  1 1 
        2  3357 1 1 104 LYS N    N   9.410  -6.678  -0.056 1.00 . A A . 182 LYS N    1 1 
        2  3358 1 1 104 LYS NZ   N  13.946  -3.238  -2.534 1.00 . A A . 182 LYS NZ   1 1 
        2  3359 1 1 104 LYS O    O  11.899  -9.132   0.454 1.00 . A A . 182 LYS O    1 1 
        2  3360 1 1 105 LYS C    C  10.063 -10.451   2.672 1.00 . A A . 183 LYS C    1 1 
        2  3361 1 1 105 LYS CA   C  10.797  -9.151   2.994 1.00 . A A . 183 LYS CA   1 1 
        2  3362 1 1 105 LYS CB   C  10.356  -8.625   4.363 1.00 . A A . 183 LYS CB   1 1 
        2  3363 1 1 105 LYS CD   C  11.051  -7.764   6.622 1.00 . A A . 183 LYS CD   1 1 
        2  3364 1 1 105 LYS CE   C  11.069  -6.265   6.878 1.00 . A A . 183 LYS CE   1 1 
        2  3365 1 1 105 LYS CG   C  11.504  -8.097   5.208 1.00 . A A . 183 LYS CG   1 1 
        2  3366 1 1 105 LYS H    H   9.950  -7.399   2.161 1.00 . A A . 183 LYS H    1 1 
        2  3367 1 1 105 LYS HA   H  11.858  -9.348   3.021 1.00 . A A . 183 LYS HA   1 1 
        2  3368 1 1 105 LYS HB2  H   9.647  -7.824   4.216 1.00 . A A . 183 LYS HB2  1 1 
        2  3369 1 1 105 LYS HB3  H   9.875  -9.425   4.907 1.00 . A A . 183 LYS HB3  1 1 
        2  3370 1 1 105 LYS HD2  H  10.045  -8.130   6.764 1.00 . A A . 183 LYS HD2  1 1 
        2  3371 1 1 105 LYS HD3  H  11.714  -8.248   7.324 1.00 . A A . 183 LYS HD3  1 1 
        2  3372 1 1 105 LYS HE2  H  11.207  -5.752   5.937 1.00 . A A . 183 LYS HE2  1 1 
        2  3373 1 1 105 LYS HE3  H  10.122  -5.975   7.308 1.00 . A A . 183 LYS HE3  1 1 
        2  3374 1 1 105 LYS HG2  H  12.277  -8.849   5.257 1.00 . A A . 183 LYS HG2  1 1 
        2  3375 1 1 105 LYS HG3  H  11.897  -7.204   4.745 1.00 . A A . 183 LYS HG3  1 1 
        2  3376 1 1 105 LYS HZ1  H  12.431  -6.682   8.406 1.00 . A A . 183 LYS HZ1  1 1 
        2  3377 1 1 105 LYS HZ2  H  11.852  -5.092   8.419 1.00 . A A . 183 LYS HZ2  1 1 
        2  3378 1 1 105 LYS HZ3  H  12.998  -5.565   7.268 1.00 . A A . 183 LYS HZ3  1 1 
        2  3379 1 1 105 LYS N    N  10.556  -8.145   1.966 1.00 . A A . 183 LYS N    1 1 
        2  3380 1 1 105 LYS NZ   N  12.164  -5.874   7.807 1.00 . A A . 183 LYS NZ   1 1 
        2  3381 1 1 105 LYS O    O  10.416 -11.515   3.181 1.00 . A A . 183 LYS O    1 1 
        2  3382 1 1 106 LEU C    C   8.785 -12.138   0.135 1.00 . A A . 184 LEU C    1 1 
        2  3383 1 1 106 LEU CA   C   8.263 -11.531   1.436 1.00 . A A . 184 LEU CA   1 1 
        2  3384 1 1 106 LEU CB   C   6.786 -11.158   1.281 1.00 . A A . 184 LEU CB   1 1 
        2  3385 1 1 106 LEU CD1  C   4.638 -11.204   2.573 1.00 . A A . 184 LEU CD1  1 1 
        2  3386 1 1 106 LEU CD2  C   6.807 -11.183   3.808 1.00 . A A . 184 LEU CD2  1 1 
        2  3387 1 1 106 LEU CG   C   6.072 -10.702   2.563 1.00 . A A . 184 LEU CG   1 1 
        2  3388 1 1 106 LEU H    H   8.807  -9.486   1.450 1.00 . A A . 184 LEU H    1 1 
        2  3389 1 1 106 LEU HA   H   8.355 -12.264   2.223 1.00 . A A . 184 LEU HA   1 1 
        2  3390 1 1 106 LEU HB2  H   6.716 -10.360   0.556 1.00 . A A . 184 LEU HB2  1 1 
        2  3391 1 1 106 LEU HB3  H   6.261 -12.018   0.892 1.00 . A A . 184 LEU HB3  1 1 
        2  3392 1 1 106 LEU HD11 H   4.628 -12.263   2.363 1.00 . A A . 184 LEU HD11 1 1 
        2  3393 1 1 106 LEU HD12 H   4.068 -10.681   1.819 1.00 . A A . 184 LEU HD12 1 1 
        2  3394 1 1 106 LEU HD13 H   4.201 -11.025   3.544 1.00 . A A . 184 LEU HD13 1 1 
        2  3395 1 1 106 LEU HD21 H   7.749 -10.662   3.894 1.00 . A A . 184 LEU HD21 1 1 
        2  3396 1 1 106 LEU HD22 H   6.990 -12.245   3.730 1.00 . A A . 184 LEU HD22 1 1 
        2  3397 1 1 106 LEU HD23 H   6.204 -10.985   4.681 1.00 . A A . 184 LEU HD23 1 1 
        2  3398 1 1 106 LEU HG   H   6.045  -9.623   2.586 1.00 . A A . 184 LEU HG   1 1 
        2  3399 1 1 106 LEU N    N   9.042 -10.360   1.825 1.00 . A A . 184 LEU N    1 1 
        2  3400 1 1 106 LEU O    O   8.379 -13.234  -0.252 1.00 . A A . 184 LEU O    1 1 
        2  3401 1 1 107 SER C    C   9.174 -12.070  -2.853 1.00 . A A . 185 SER C    1 1 
        2  3402 1 1 107 SER CA   C  10.257 -11.901  -1.792 1.00 . A A . 185 SER CA   1 1 
        2  3403 1 1 107 SER CB   C  10.989 -13.227  -1.576 1.00 . A A . 185 SER CB   1 1 
        2  3404 1 1 107 SER H    H   9.974 -10.558  -0.182 1.00 . A A . 185 SER H    1 1 
        2  3405 1 1 107 SER HA   H  10.965 -11.161  -2.135 1.00 . A A . 185 SER HA   1 1 
        2  3406 1 1 107 SER HB2  H  11.864 -13.057  -0.967 1.00 . A A . 185 SER HB2  1 1 
        2  3407 1 1 107 SER HB3  H  10.331 -13.922  -1.076 1.00 . A A . 185 SER HB3  1 1 
        2  3408 1 1 107 SER HG   H  11.774 -13.107  -3.367 1.00 . A A . 185 SER HG   1 1 
        2  3409 1 1 107 SER N    N   9.686 -11.424  -0.537 1.00 . A A . 185 SER N    1 1 
        2  3410 1 1 107 SER O    O   8.714 -13.182  -3.113 1.00 . A A . 185 SER O    1 1 
        2  3411 1 1 107 SER OG   O  11.396 -13.792  -2.810 1.00 . A A . 185 SER OG   1 1 
        2  3412 1 1 108 MET C    C   8.322 -10.584  -5.848 1.00 . A A . 186 MET C    1 1 
        2  3413 1 1 108 MET CA   C   7.743 -10.982  -4.494 1.00 . A A . 186 MET CA   1 1 
        2  3414 1 1 108 MET CB   C   6.596 -10.039  -4.122 1.00 . A A . 186 MET CB   1 1 
        2  3415 1 1 108 MET CE   C   3.406  -9.895  -2.489 1.00 . A A . 186 MET CE   1 1 
        2  3416 1 1 108 MET CG   C   6.159 -10.155  -2.671 1.00 . A A . 186 MET CG   1 1 
        2  3417 1 1 108 MET H    H   9.177 -10.103  -3.209 1.00 . A A . 186 MET H    1 1 
        2  3418 1 1 108 MET HA   H   7.361 -11.990  -4.561 1.00 . A A . 186 MET HA   1 1 
        2  3419 1 1 108 MET HB2  H   6.911  -9.022  -4.301 1.00 . A A . 186 MET HB2  1 1 
        2  3420 1 1 108 MET HB3  H   5.746 -10.260  -4.751 1.00 . A A . 186 MET HB3  1 1 
        2  3421 1 1 108 MET HE1  H   3.216 -10.512  -1.623 1.00 . A A . 186 MET HE1  1 1 
        2  3422 1 1 108 MET HE2  H   3.527 -10.523  -3.359 1.00 . A A . 186 MET HE2  1 1 
        2  3423 1 1 108 MET HE3  H   2.573  -9.225  -2.642 1.00 . A A . 186 MET HE3  1 1 
        2  3424 1 1 108 MET HG2  H   5.758 -11.144  -2.507 1.00 . A A . 186 MET HG2  1 1 
        2  3425 1 1 108 MET HG3  H   7.021 -10.007  -2.037 1.00 . A A . 186 MET HG3  1 1 
        2  3426 1 1 108 MET N    N   8.772 -10.959  -3.461 1.00 . A A . 186 MET N    1 1 
        2  3427 1 1 108 MET O    O   7.926 -11.116  -6.885 1.00 . A A . 186 MET O    1 1 
        2  3428 1 1 108 MET SD   S   4.900  -8.943  -2.228 1.00 . A A . 186 MET SD   1 1 
        2  3429 1 1 109 TYR C    C  11.412  -9.282  -6.961 1.00 . A A . 187 TYR C    1 1 
        2  3430 1 1 109 TYR CA   C   9.894  -9.171  -7.056 1.00 . A A . 187 TYR CA   1 1 
        2  3431 1 1 109 TYR CB   C   9.493  -7.722  -7.337 1.00 . A A . 187 TYR CB   1 1 
        2  3432 1 1 109 TYR CD1  C   9.070  -6.803  -5.022 1.00 . A A . 187 TYR CD1  1 1 
        2  3433 1 1 109 TYR CD2  C  10.838  -5.850  -6.307 1.00 . A A . 187 TYR CD2  1 1 
        2  3434 1 1 109 TYR CE1  C   9.354  -5.938  -3.983 1.00 . A A . 187 TYR CE1  1 1 
        2  3435 1 1 109 TYR CE2  C  11.127  -4.981  -5.271 1.00 . A A . 187 TYR CE2  1 1 
        2  3436 1 1 109 TYR CG   C   9.806  -6.774  -6.201 1.00 . A A . 187 TYR CG   1 1 
        2  3437 1 1 109 TYR CZ   C  10.383  -5.029  -4.112 1.00 . A A . 187 TYR CZ   1 1 
        2  3438 1 1 109 TYR H    H   9.533  -9.256  -4.972 1.00 . A A . 187 TYR H    1 1 
        2  3439 1 1 109 TYR HA   H   9.550  -9.794  -7.867 1.00 . A A . 187 TYR HA   1 1 
        2  3440 1 1 109 TYR HB2  H  10.018  -7.374  -8.213 1.00 . A A . 187 TYR HB2  1 1 
        2  3441 1 1 109 TYR HB3  H   8.429  -7.680  -7.521 1.00 . A A . 187 TYR HB3  1 1 
        2  3442 1 1 109 TYR HD1  H   8.266  -7.516  -4.923 1.00 . A A . 187 TYR HD1  1 1 
        2  3443 1 1 109 TYR HD2  H  11.419  -5.814  -7.216 1.00 . A A . 187 TYR HD2  1 1 
        2  3444 1 1 109 TYR HE1  H   8.770  -5.976  -3.075 1.00 . A A . 187 TYR HE1  1 1 
        2  3445 1 1 109 TYR HE2  H  11.933  -4.270  -5.373 1.00 . A A . 187 TYR HE2  1 1 
        2  3446 1 1 109 TYR HH   H  10.652  -3.263  -3.403 1.00 . A A . 187 TYR HH   1 1 
        2  3447 1 1 109 TYR N    N   9.260  -9.643  -5.830 1.00 . A A . 187 TYR N    1 1 
        2  3448 1 1 109 TYR O    O  12.086  -9.064  -7.991 1.00 . A A . 187 TYR O    1 1 
        2  3449 1 1 109 TYR OXT  O  11.916  -9.583  -5.859 1.00 . A A . 187 TYR OXT  1 1 
        2  3450 1 1 109 TYR OH   O  10.667  -4.166  -3.079 1.00 . A A . 187 TYR OH   1 1 
        3  3451 1 1   1 GLY C    C  20.021  17.963 -20.695 1.00 . A A .  79 GLY C    1 1 
        3  3452 1 1   1 GLY CA   C  20.150  19.190 -19.815 1.00 . A A .  79 GLY CA   1 1 
        3  3453 1 1   1 GLY H1   H  19.922  19.712 -17.805 1.00 . A A .  79 GLY H1   1 1 
        3  3454 1 1   1 GLY H2   H  19.842  18.047 -18.094 1.00 . A A .  79 GLY H2   1 1 
        3  3455 1 1   1 GLY H3   H  18.534  19.039 -18.500 1.00 . A A .  79 GLY H3   1 1 
        3  3456 1 1   1 GLY HA2  H  19.639  20.015 -20.289 1.00 . A A .  79 GLY HA2  1 1 
        3  3457 1 1   1 GLY HA3  H  21.196  19.439 -19.714 1.00 . A A .  79 GLY HA3  1 1 
        3  3458 1 1   1 GLY N    N  19.571  18.982 -18.459 1.00 . A A .  79 GLY N    1 1 
        3  3459 1 1   1 GLY O    O  20.903  17.676 -21.505 1.00 . A A .  79 GLY O    1 1 
        3  3460 1 1   2 SER C    C  19.623  14.908 -20.924 1.00 . A A .  80 SER C    1 1 
        3  3461 1 1   2 SER CA   C  18.670  16.031 -21.325 1.00 . A A .  80 SER CA   1 1 
        3  3462 1 1   2 SER CB   C  18.810  16.329 -22.821 1.00 . A A .  80 SER CB   1 1 
        3  3463 1 1   2 SER H    H  18.252  17.519 -19.877 1.00 . A A .  80 SER H    1 1 
        3  3464 1 1   2 SER HA   H  17.658  15.711 -21.126 1.00 . A A .  80 SER HA   1 1 
        3  3465 1 1   2 SER HB2  H  19.008  17.382 -22.959 1.00 . A A .  80 SER HB2  1 1 
        3  3466 1 1   2 SER HB3  H  19.628  15.753 -23.228 1.00 . A A .  80 SER HB3  1 1 
        3  3467 1 1   2 SER HG   H  16.923  16.603 -23.274 1.00 . A A .  80 SER HG   1 1 
        3  3468 1 1   2 SER N    N  18.918  17.236 -20.538 1.00 . A A .  80 SER N    1 1 
        3  3469 1 1   2 SER O    O  19.198  13.875 -20.407 1.00 . A A .  80 SER O    1 1 
        3  3470 1 1   2 SER OG   O  17.624  15.994 -23.520 1.00 . A A .  80 SER OG   1 1 
        3  3471 1 1   3 HIS C    C  22.485  14.352 -19.431 1.00 . A A .  81 HIS C    1 1 
        3  3472 1 1   3 HIS CA   C  21.926  14.119 -20.833 1.00 . A A .  81 HIS CA   1 1 
        3  3473 1 1   3 HIS CB   C  23.059  14.154 -21.862 1.00 . A A .  81 HIS CB   1 1 
        3  3474 1 1   3 HIS CD2  C  23.747  12.753 -23.935 1.00 . A A .  81 HIS CD2  1 1 
        3  3475 1 1   3 HIS CE1  C  21.843  11.720 -24.270 1.00 . A A .  81 HIS CE1  1 1 
        3  3476 1 1   3 HIS CG   C  22.881  13.176 -22.983 1.00 . A A .  81 HIS CG   1 1 
        3  3477 1 1   3 HIS H    H  21.192  15.958 -21.583 1.00 . A A .  81 HIS H    1 1 
        3  3478 1 1   3 HIS HA   H  21.455  13.148 -20.863 1.00 . A A .  81 HIS HA   1 1 
        3  3479 1 1   3 HIS HB2  H  23.116  15.142 -22.292 1.00 . A A .  81 HIS HB2  1 1 
        3  3480 1 1   3 HIS HB3  H  23.993  13.927 -21.369 1.00 . A A .  81 HIS HB3  1 1 
        3  3481 1 1   3 HIS HD1  H  20.873  12.603 -22.700 1.00 . A A .  81 HIS HD1  1 1 
        3  3482 1 1   3 HIS HD2  H  24.775  13.068 -24.052 1.00 . A A .  81 HIS HD2  1 1 
        3  3483 1 1   3 HIS HE1  H  21.082  11.077 -24.688 1.00 . A A .  81 HIS HE1  1 1 
        3  3484 1 1   3 HIS HE2  H  23.476  11.313 -25.438 1.00 . A A .  81 HIS HE2  1 1 
        3  3485 1 1   3 HIS N    N  20.914  15.116 -21.167 1.00 . A A .  81 HIS N    1 1 
        3  3486 1 1   3 HIS ND1  N  21.697  12.510 -23.222 1.00 . A A .  81 HIS ND1  1 1 
        3  3487 1 1   3 HIS NE2  N  23.077  11.849 -24.721 1.00 . A A .  81 HIS NE2  1 1 
        3  3488 1 1   3 HIS O    O  23.697  14.312 -19.220 1.00 . A A .  81 HIS O    1 1 
        3  3489 1 1   4 MET C    C  20.786  15.009 -16.189 1.00 . A A .  82 MET C    1 1 
        3  3490 1 1   4 MET CA   C  22.002  14.830 -17.093 1.00 . A A .  82 MET CA   1 1 
        3  3491 1 1   4 MET CB   C  22.901  16.066 -17.007 1.00 . A A .  82 MET CB   1 1 
        3  3492 1 1   4 MET CE   C  24.013  13.691 -14.424 1.00 . A A .  82 MET CE   1 1 
        3  3493 1 1   4 MET CG   C  23.755  16.110 -15.751 1.00 . A A .  82 MET CG   1 1 
        3  3494 1 1   4 MET H    H  20.641  14.612 -18.700 1.00 . A A .  82 MET H    1 1 
        3  3495 1 1   4 MET HA   H  22.559  13.968 -16.760 1.00 . A A .  82 MET HA   1 1 
        3  3496 1 1   4 MET HB2  H  23.558  16.079 -17.864 1.00 . A A .  82 MET HB2  1 1 
        3  3497 1 1   4 MET HB3  H  22.281  16.950 -17.027 1.00 . A A .  82 MET HB3  1 1 
        3  3498 1 1   4 MET HE1  H  23.386  12.978 -14.939 1.00 . A A .  82 MET HE1  1 1 
        3  3499 1 1   4 MET HE2  H  23.400  14.320 -13.795 1.00 . A A .  82 MET HE2  1 1 
        3  3500 1 1   4 MET HE3  H  24.732  13.163 -13.814 1.00 . A A .  82 MET HE3  1 1 
        3  3501 1 1   4 MET HG2  H  24.339  17.018 -15.761 1.00 . A A .  82 MET HG2  1 1 
        3  3502 1 1   4 MET HG3  H  23.103  16.113 -14.889 1.00 . A A .  82 MET HG3  1 1 
        3  3503 1 1   4 MET N    N  21.594  14.594 -18.474 1.00 . A A .  82 MET N    1 1 
        3  3504 1 1   4 MET O    O  19.891  15.801 -16.484 1.00 . A A .  82 MET O    1 1 
        3  3505 1 1   4 MET SD   S  24.876  14.704 -15.622 1.00 . A A .  82 MET SD   1 1 
        3  3506 1 1   5 ASP C    C  20.146  14.828 -12.771 1.00 . A A .  83 ASP C    1 1 
        3  3507 1 1   5 ASP CA   C  19.657  14.344 -14.136 1.00 . A A .  83 ASP CA   1 1 
        3  3508 1 1   5 ASP CB   C  18.987  12.976 -13.993 1.00 . A A .  83 ASP CB   1 1 
        3  3509 1 1   5 ASP CG   C  18.275  12.545 -15.260 1.00 . A A .  83 ASP CG   1 1 
        3  3510 1 1   5 ASP H    H  21.505  13.655 -14.905 1.00 . A A .  83 ASP H    1 1 
        3  3511 1 1   5 ASP HA   H  18.936  15.048 -14.521 1.00 . A A .  83 ASP HA   1 1 
        3  3512 1 1   5 ASP HB2  H  19.739  12.237 -13.756 1.00 . A A .  83 ASP HB2  1 1 
        3  3513 1 1   5 ASP HB3  H  18.265  13.018 -13.191 1.00 . A A .  83 ASP HB3  1 1 
        3  3514 1 1   5 ASP N    N  20.762  14.267 -15.085 1.00 . A A .  83 ASP N    1 1 
        3  3515 1 1   5 ASP O    O  20.709  14.054 -11.997 1.00 . A A .  83 ASP O    1 1 
        3  3516 1 1   5 ASP OD1  O  18.683  12.994 -16.352 1.00 . A A .  83 ASP OD1  1 1 
        3  3517 1 1   5 ASP OD2  O  17.309  11.761 -15.160 1.00 . A A .  83 ASP OD2  1 1 
        3  3518 1 1   6 PRO C    C  19.440  16.324 -10.027 1.00 . A A .  84 PRO C    1 1 
        3  3519 1 1   6 PRO CA   C  20.367  16.698 -11.180 1.00 . A A .  84 PRO CA   1 1 
        3  3520 1 1   6 PRO CB   C  20.307  18.201 -11.446 1.00 . A A .  84 PRO CB   1 1 
        3  3521 1 1   6 PRO CD   C  19.280  17.119 -13.321 1.00 . A A .  84 PRO CD   1 1 
        3  3522 1 1   6 PRO CG   C  19.229  18.357 -12.462 1.00 . A A .  84 PRO CG   1 1 
        3  3523 1 1   6 PRO HA   H  21.379  16.413 -10.935 1.00 . A A .  84 PRO HA   1 1 
        3  3524 1 1   6 PRO HB2  H  20.068  18.722 -10.530 1.00 . A A .  84 PRO HB2  1 1 
        3  3525 1 1   6 PRO HB3  H  21.259  18.542 -11.825 1.00 . A A .  84 PRO HB3  1 1 
        3  3526 1 1   6 PRO HD2  H  18.281  16.802 -13.582 1.00 . A A .  84 PRO HD2  1 1 
        3  3527 1 1   6 PRO HD3  H  19.863  17.303 -14.211 1.00 . A A .  84 PRO HD3  1 1 
        3  3528 1 1   6 PRO HG2  H  18.270  18.433 -11.971 1.00 . A A .  84 PRO HG2  1 1 
        3  3529 1 1   6 PRO HG3  H  19.415  19.235 -13.062 1.00 . A A .  84 PRO HG3  1 1 
        3  3530 1 1   6 PRO N    N  19.940  16.120 -12.457 1.00 . A A .  84 PRO N    1 1 
        3  3531 1 1   6 PRO O    O  19.844  16.340  -8.865 1.00 . A A .  84 PRO O    1 1 
        3  3532 1 1   7 ALA C    C  17.177  14.105  -9.145 1.00 . A A .  85 ALA C    1 1 
        3  3533 1 1   7 ALA CA   C  17.216  15.616  -9.341 1.00 . A A .  85 ALA CA   1 1 
        3  3534 1 1   7 ALA CB   C  15.838  16.136  -9.722 1.00 . A A .  85 ALA CB   1 1 
        3  3535 1 1   7 ALA H    H  17.928  15.995 -11.297 1.00 . A A .  85 ALA H    1 1 
        3  3536 1 1   7 ALA HA   H  17.506  16.082  -8.410 1.00 . A A .  85 ALA HA   1 1 
        3  3537 1 1   7 ALA HB1  H  15.111  15.788  -9.003 1.00 . A A .  85 ALA HB1  1 1 
        3  3538 1 1   7 ALA HB2  H  15.576  15.773 -10.704 1.00 . A A .  85 ALA HB2  1 1 
        3  3539 1 1   7 ALA HB3  H  15.850  17.216  -9.728 1.00 . A A .  85 ALA HB3  1 1 
        3  3540 1 1   7 ALA N    N  18.195  15.990 -10.354 1.00 . A A .  85 ALA N    1 1 
        3  3541 1 1   7 ALA O    O  16.965  13.618  -8.034 1.00 . A A .  85 ALA O    1 1 
        3  3542 1 1   8 GLN C    C  16.032  11.400  -9.643 1.00 . A A .  86 GLN C    1 1 
        3  3543 1 1   8 GLN CA   C  17.367  11.909 -10.178 1.00 . A A .  86 GLN CA   1 1 
        3  3544 1 1   8 GLN CB   C  18.513  11.399  -9.302 1.00 . A A .  86 GLN CB   1 1 
        3  3545 1 1   8 GLN CD   C  21.002  11.001  -9.145 1.00 . A A .  86 GLN CD   1 1 
        3  3546 1 1   8 GLN CG   C  19.890  11.780  -9.820 1.00 . A A .  86 GLN CG   1 1 
        3  3547 1 1   8 GLN H    H  17.544  13.812 -11.089 1.00 . A A .  86 GLN H    1 1 
        3  3548 1 1   8 GLN HA   H  17.503  11.540 -11.184 1.00 . A A .  86 GLN HA   1 1 
        3  3549 1 1   8 GLN HB2  H  18.400  11.808  -8.308 1.00 . A A .  86 GLN HB2  1 1 
        3  3550 1 1   8 GLN HB3  H  18.457  10.322  -9.247 1.00 . A A .  86 GLN HB3  1 1 
        3  3551 1 1   8 GLN HE21 H  20.598   9.407 -10.262 1.00 . A A .  86 GLN HE21 1 1 
        3  3552 1 1   8 GLN HE22 H  21.896   9.225  -9.137 1.00 . A A .  86 GLN HE22 1 1 
        3  3553 1 1   8 GLN HG2  H  19.928  11.585 -10.881 1.00 . A A .  86 GLN HG2  1 1 
        3  3554 1 1   8 GLN HG3  H  20.049  12.834  -9.643 1.00 . A A .  86 GLN HG3  1 1 
        3  3555 1 1   8 GLN N    N  17.381  13.366 -10.231 1.00 . A A .  86 GLN N    1 1 
        3  3556 1 1   8 GLN NE2  N  21.184   9.752  -9.556 1.00 . A A .  86 GLN NE2  1 1 
        3  3557 1 1   8 GLN O    O  15.962  10.835  -8.552 1.00 . A A .  86 GLN O    1 1 
        3  3558 1 1   8 GLN OE1  O  21.691  11.517  -8.264 1.00 . A A .  86 GLN OE1  1 1 
        3  3559 1 1   9 LEU C    C  13.358   9.740 -10.464 1.00 . A A .  87 LEU C    1 1 
        3  3560 1 1   9 LEU CA   C  13.638  11.177 -10.024 1.00 . A A .  87 LEU CA   1 1 
        3  3561 1 1   9 LEU CB   C  12.583  12.113 -10.617 1.00 . A A .  87 LEU CB   1 1 
        3  3562 1 1   9 LEU CD1  C  11.010  12.287 -12.562 1.00 . A A .  87 LEU CD1  1 1 
        3  3563 1 1   9 LEU CD2  C  13.369  13.086 -12.789 1.00 . A A .  87 LEU CD2  1 1 
        3  3564 1 1   9 LEU CG   C  12.453  12.059 -12.140 1.00 . A A .  87 LEU CG   1 1 
        3  3565 1 1   9 LEU H    H  15.094  12.070 -11.277 1.00 . A A .  87 LEU H    1 1 
        3  3566 1 1   9 LEU HA   H  13.581  11.226  -8.947 1.00 . A A .  87 LEU HA   1 1 
        3  3567 1 1   9 LEU HB2  H  11.626  11.862 -10.184 1.00 . A A .  87 LEU HB2  1 1 
        3  3568 1 1   9 LEU HB3  H  12.832  13.126 -10.335 1.00 . A A .  87 LEU HB3  1 1 
        3  3569 1 1   9 LEU HD11 H  10.748  13.323 -12.403 1.00 . A A .  87 LEU HD11 1 1 
        3  3570 1 1   9 LEU HD12 H  10.360  11.656 -11.974 1.00 . A A .  87 LEU HD12 1 1 
        3  3571 1 1   9 LEU HD13 H  10.899  12.044 -13.608 1.00 . A A .  87 LEU HD13 1 1 
        3  3572 1 1   9 LEU HD21 H  14.315  12.624 -13.031 1.00 . A A .  87 LEU HD21 1 1 
        3  3573 1 1   9 LEU HD22 H  13.534  13.905 -12.104 1.00 . A A .  87 LEU HD22 1 1 
        3  3574 1 1   9 LEU HD23 H  12.909  13.459 -13.692 1.00 . A A .  87 LEU HD23 1 1 
        3  3575 1 1   9 LEU HG   H  12.751  11.080 -12.485 1.00 . A A .  87 LEU HG   1 1 
        3  3576 1 1   9 LEU N    N  14.974  11.610 -10.419 1.00 . A A .  87 LEU N    1 1 
        3  3577 1 1   9 LEU O    O  12.222   9.273 -10.389 1.00 . A A .  87 LEU O    1 1 
        3  3578 1 1  10 THR C    C  13.627   6.795 -10.272 1.00 . A A .  88 THR C    1 1 
        3  3579 1 1  10 THR CA   C  14.241   7.658 -11.370 1.00 . A A .  88 THR CA   1 1 
        3  3580 1 1  10 THR CB   C  15.593   7.081 -11.793 1.00 . A A .  88 THR CB   1 1 
        3  3581 1 1  10 THR CG2  C  16.148   7.717 -13.050 1.00 . A A .  88 THR CG2  1 1 
        3  3582 1 1  10 THR H    H  15.278   9.458 -10.962 1.00 . A A .  88 THR H    1 1 
        3  3583 1 1  10 THR HA   H  13.577   7.659 -12.222 1.00 . A A .  88 THR HA   1 1 
        3  3584 1 1  10 THR HB   H  15.478   6.023 -11.981 1.00 . A A .  88 THR HB   1 1 
        3  3585 1 1  10 THR HG1  H  16.777   8.178 -10.683 1.00 . A A .  88 THR HG1  1 1 
        3  3586 1 1  10 THR HG21 H  16.601   8.666 -12.803 1.00 . A A .  88 THR HG21 1 1 
        3  3587 1 1  10 THR HG22 H  15.348   7.872 -13.758 1.00 . A A .  88 THR HG22 1 1 
        3  3588 1 1  10 THR HG23 H  16.892   7.065 -13.484 1.00 . A A .  88 THR HG23 1 1 
        3  3589 1 1  10 THR N    N  14.394   9.039 -10.923 1.00 . A A .  88 THR N    1 1 
        3  3590 1 1  10 THR O    O  12.663   6.067 -10.509 1.00 . A A .  88 THR O    1 1 
        3  3591 1 1  10 THR OG1  O  16.554   7.248 -10.766 1.00 . A A .  88 THR OG1  1 1 
        3  3592 1 1  11 GLU C    C  12.200   6.387  -7.715 1.00 . A A .  89 GLU C    1 1 
        3  3593 1 1  11 GLU CA   C  13.685   6.115  -7.934 1.00 . A A .  89 GLU CA   1 1 
        3  3594 1 1  11 GLU CB   C  14.477   6.453  -6.672 1.00 . A A .  89 GLU CB   1 1 
        3  3595 1 1  11 GLU CD   C  14.606   4.331  -5.307 1.00 . A A .  89 GLU CD   1 1 
        3  3596 1 1  11 GLU CG   C  13.999   5.715  -5.431 1.00 . A A .  89 GLU CG   1 1 
        3  3597 1 1  11 GLU H    H  14.949   7.486  -8.938 1.00 . A A .  89 GLU H    1 1 
        3  3598 1 1  11 GLU HA   H  13.817   5.068  -8.161 1.00 . A A .  89 GLU HA   1 1 
        3  3599 1 1  11 GLU HB2  H  15.513   6.200  -6.838 1.00 . A A .  89 GLU HB2  1 1 
        3  3600 1 1  11 GLU HB3  H  14.399   7.513  -6.487 1.00 . A A .  89 GLU HB3  1 1 
        3  3601 1 1  11 GLU HG2  H  14.272   6.289  -4.559 1.00 . A A .  89 GLU HG2  1 1 
        3  3602 1 1  11 GLU HG3  H  12.924   5.618  -5.476 1.00 . A A .  89 GLU HG3  1 1 
        3  3603 1 1  11 GLU N    N  14.186   6.885  -9.068 1.00 . A A .  89 GLU N    1 1 
        3  3604 1 1  11 GLU O    O  11.454   5.514  -7.271 1.00 . A A .  89 GLU O    1 1 
        3  3605 1 1  11 GLU OE1  O  14.966   3.745  -6.350 1.00 . A A .  89 GLU OE1  1 1 
        3  3606 1 1  11 GLU OE2  O  14.720   3.832  -4.168 1.00 . A A .  89 GLU OE2  1 1 
        3  3607 1 1  12 ASP C    C   9.548   7.270  -8.971 1.00 . A A .  90 ASP C    1 1 
        3  3608 1 1  12 ASP CA   C  10.377   7.978  -7.906 1.00 . A A .  90 ASP CA   1 1 
        3  3609 1 1  12 ASP CB   C  10.213   9.494  -8.032 1.00 . A A .  90 ASP CB   1 1 
        3  3610 1 1  12 ASP CG   C   8.832   9.962  -7.620 1.00 . A A .  90 ASP CG   1 1 
        3  3611 1 1  12 ASP H    H  12.422   8.244  -8.407 1.00 . A A .  90 ASP H    1 1 
        3  3612 1 1  12 ASP HA   H  10.041   7.661  -6.930 1.00 . A A .  90 ASP HA   1 1 
        3  3613 1 1  12 ASP HB2  H  10.941   9.981  -7.400 1.00 . A A .  90 ASP HB2  1 1 
        3  3614 1 1  12 ASP HB3  H  10.381   9.784  -9.059 1.00 . A A .  90 ASP HB3  1 1 
        3  3615 1 1  12 ASP N    N  11.776   7.601  -8.048 1.00 . A A .  90 ASP N    1 1 
        3  3616 1 1  12 ASP O    O   8.508   6.680  -8.679 1.00 . A A .  90 ASP O    1 1 
        3  3617 1 1  12 ASP OD1  O   8.254   9.360  -6.690 1.00 . A A .  90 ASP OD1  1 1 
        3  3618 1 1  12 ASP OD2  O   8.328  10.930  -8.226 1.00 . A A .  90 ASP OD2  1 1 
        3  3619 1 1  13 ILE C    C   9.293   5.185 -11.156 1.00 . A A .  91 ILE C    1 1 
        3  3620 1 1  13 ILE CA   C   9.352   6.699 -11.332 1.00 . A A .  91 ILE CA   1 1 
        3  3621 1 1  13 ILE CB   C  10.064   7.017 -12.662 1.00 . A A .  91 ILE CB   1 1 
        3  3622 1 1  13 ILE CD1  C   8.867   9.263 -12.757 1.00 . A A .  91 ILE CD1  1 1 
        3  3623 1 1  13 ILE CG1  C  10.186   8.530 -12.858 1.00 . A A .  91 ILE CG1  1 1 
        3  3624 1 1  13 ILE CG2  C   9.323   6.383 -13.829 1.00 . A A .  91 ILE CG2  1 1 
        3  3625 1 1  13 ILE H    H  10.859   7.828 -10.370 1.00 . A A .  91 ILE H    1 1 
        3  3626 1 1  13 ILE HA   H   8.346   7.089 -11.382 1.00 . A A .  91 ILE HA   1 1 
        3  3627 1 1  13 ILE HB   H  11.054   6.587 -12.624 1.00 . A A .  91 ILE HB   1 1 
        3  3628 1 1  13 ILE HD11 H   8.742   9.900 -13.621 1.00 . A A .  91 ILE HD11 1 1 
        3  3629 1 1  13 ILE HD12 H   8.859   9.866 -11.862 1.00 . A A .  91 ILE HD12 1 1 
        3  3630 1 1  13 ILE HD13 H   8.060   8.548 -12.717 1.00 . A A .  91 ILE HD13 1 1 
        3  3631 1 1  13 ILE HG12 H  10.846   8.932 -12.105 1.00 . A A .  91 ILE HG12 1 1 
        3  3632 1 1  13 ILE HG13 H  10.602   8.727 -13.836 1.00 . A A .  91 ILE HG13 1 1 
        3  3633 1 1  13 ILE HG21 H   9.810   6.651 -14.754 1.00 . A A .  91 ILE HG21 1 1 
        3  3634 1 1  13 ILE HG22 H   8.303   6.736 -13.842 1.00 . A A .  91 ILE HG22 1 1 
        3  3635 1 1  13 ILE HG23 H   9.331   5.308 -13.717 1.00 . A A .  91 ILE HG23 1 1 
        3  3636 1 1  13 ILE N    N  10.029   7.333 -10.208 1.00 . A A .  91 ILE N    1 1 
        3  3637 1 1  13 ILE O    O   8.246   4.568 -11.348 1.00 . A A .  91 ILE O    1 1 
        3  3638 1 1  14 THR C    C   9.584   2.694  -9.471 1.00 . A A .  92 THR C    1 1 
        3  3639 1 1  14 THR CA   C  10.503   3.149 -10.606 1.00 . A A .  92 THR CA   1 1 
        3  3640 1 1  14 THR CB   C  11.950   2.717 -10.334 1.00 . A A .  92 THR CB   1 1 
        3  3641 1 1  14 THR CG2  C  12.460   3.137  -8.976 1.00 . A A .  92 THR CG2  1 1 
        3  3642 1 1  14 THR H    H  11.230   5.138 -10.663 1.00 . A A .  92 THR H    1 1 
        3  3643 1 1  14 THR HA   H  10.170   2.684 -11.522 1.00 . A A .  92 THR HA   1 1 
        3  3644 1 1  14 THR HB   H  12.597   3.163 -11.080 1.00 . A A .  92 THR HB   1 1 
        3  3645 1 1  14 THR HG1  H  11.631   0.996 -11.213 1.00 . A A .  92 THR HG1  1 1 
        3  3646 1 1  14 THR HG21 H  13.530   2.995  -8.933 1.00 . A A .  92 THR HG21 1 1 
        3  3647 1 1  14 THR HG22 H  11.986   2.539  -8.212 1.00 . A A .  92 THR HG22 1 1 
        3  3648 1 1  14 THR HG23 H  12.228   4.177  -8.816 1.00 . A A .  92 THR HG23 1 1 
        3  3649 1 1  14 THR N    N  10.427   4.592 -10.797 1.00 . A A .  92 THR N    1 1 
        3  3650 1 1  14 THR O    O   8.797   1.765  -9.641 1.00 . A A .  92 THR O    1 1 
        3  3651 1 1  14 THR OG1  O  12.077   1.309 -10.422 1.00 . A A .  92 THR OG1  1 1 
        3  3652 1 1  15 ARG C    C   7.401   2.996  -7.475 1.00 . A A .  93 ARG C    1 1 
        3  3653 1 1  15 ARG CA   C   8.891   2.980  -7.149 1.00 . A A .  93 ARG CA   1 1 
        3  3654 1 1  15 ARG CB   C   9.184   3.940  -5.997 1.00 . A A .  93 ARG CB   1 1 
        3  3655 1 1  15 ARG CD   C   9.446   4.139  -3.504 1.00 . A A .  93 ARG CD   1 1 
        3  3656 1 1  15 ARG CG   C   8.737   3.420  -4.641 1.00 . A A .  93 ARG CG   1 1 
        3  3657 1 1  15 ARG CZ   C   9.342   6.587  -3.815 1.00 . A A .  93 ARG CZ   1 1 
        3  3658 1 1  15 ARG H    H  10.360   4.054  -8.221 1.00 . A A .  93 ARG H    1 1 
        3  3659 1 1  15 ARG HA   H   9.170   1.981  -6.849 1.00 . A A .  93 ARG HA   1 1 
        3  3660 1 1  15 ARG HB2  H  10.249   4.119  -5.957 1.00 . A A .  93 ARG HB2  1 1 
        3  3661 1 1  15 ARG HB3  H   8.678   4.876  -6.185 1.00 . A A .  93 ARG HB3  1 1 
        3  3662 1 1  15 ARG HD2  H   9.348   3.547  -2.606 1.00 . A A .  93 ARG HD2  1 1 
        3  3663 1 1  15 ARG HD3  H  10.492   4.239  -3.754 1.00 . A A .  93 ARG HD3  1 1 
        3  3664 1 1  15 ARG HE   H   8.125   5.526  -2.642 1.00 . A A .  93 ARG HE   1 1 
        3  3665 1 1  15 ARG HG2  H   7.673   3.574  -4.540 1.00 . A A .  93 ARG HG2  1 1 
        3  3666 1 1  15 ARG HG3  H   8.957   2.365  -4.581 1.00 . A A .  93 ARG HG3  1 1 
        3  3667 1 1  15 ARG HH11 H  10.803   5.683  -4.883 1.00 . A A .  93 ARG HH11 1 1 
        3  3668 1 1  15 ARG HH12 H  10.702   7.400  -5.070 1.00 . A A .  93 ARG HH12 1 1 
        3  3669 1 1  15 ARG HH21 H   7.996   7.781  -2.895 1.00 . A A .  93 ARG HH21 1 1 
        3  3670 1 1  15 ARG HH22 H   9.111   8.590  -3.944 1.00 . A A .  93 ARG HH22 1 1 
        3  3671 1 1  15 ARG N    N   9.699   3.339  -8.310 1.00 . A A .  93 ARG N    1 1 
        3  3672 1 1  15 ARG NE   N   8.884   5.466  -3.258 1.00 . A A .  93 ARG NE   1 1 
        3  3673 1 1  15 ARG NH1  N  10.366   6.553  -4.659 1.00 . A A .  93 ARG NH1  1 1 
        3  3674 1 1  15 ARG NH2  N   8.769   7.748  -3.528 1.00 . A A .  93 ARG NH2  1 1 
        3  3675 1 1  15 ARG O    O   6.667   2.082  -7.098 1.00 . A A .  93 ARG O    1 1 
        3  3676 1 1  16 TYR C    C   5.112   2.945  -9.384 1.00 . A A .  94 TYR C    1 1 
        3  3677 1 1  16 TYR CA   C   5.549   4.146  -8.550 1.00 . A A .  94 TYR CA   1 1 
        3  3678 1 1  16 TYR CB   C   5.310   5.439  -9.331 1.00 . A A .  94 TYR CB   1 1 
        3  3679 1 1  16 TYR CD1  C   2.868   5.515  -8.690 1.00 . A A .  94 TYR CD1  1 1 
        3  3680 1 1  16 TYR CD2  C   3.465   6.104 -10.922 1.00 . A A .  94 TYR CD2  1 1 
        3  3681 1 1  16 TYR CE1  C   1.537   5.744  -8.982 1.00 . A A .  94 TYR CE1  1 1 
        3  3682 1 1  16 TYR CE2  C   2.136   6.335 -11.221 1.00 . A A .  94 TYR CE2  1 1 
        3  3683 1 1  16 TYR CG   C   3.854   5.691  -9.654 1.00 . A A .  94 TYR CG   1 1 
        3  3684 1 1  16 TYR CZ   C   1.176   6.154 -10.248 1.00 . A A .  94 TYR CZ   1 1 
        3  3685 1 1  16 TYR H    H   7.584   4.729  -8.456 1.00 . A A .  94 TYR H    1 1 
        3  3686 1 1  16 TYR HA   H   4.967   4.170  -7.641 1.00 . A A .  94 TYR HA   1 1 
        3  3687 1 1  16 TYR HB2  H   5.669   6.275  -8.749 1.00 . A A .  94 TYR HB2  1 1 
        3  3688 1 1  16 TYR HB3  H   5.854   5.395 -10.263 1.00 . A A .  94 TYR HB3  1 1 
        3  3689 1 1  16 TYR HD1  H   3.154   5.195  -7.699 1.00 . A A .  94 TYR HD1  1 1 
        3  3690 1 1  16 TYR HD2  H   4.219   6.245 -11.682 1.00 . A A .  94 TYR HD2  1 1 
        3  3691 1 1  16 TYR HE1  H   0.786   5.602  -8.219 1.00 . A A .  94 TYR HE1  1 1 
        3  3692 1 1  16 TYR HE2  H   1.854   6.656 -12.213 1.00 . A A .  94 TYR HE2  1 1 
        3  3693 1 1  16 TYR HH   H  -0.545   5.577 -10.882 1.00 . A A .  94 TYR HH   1 1 
        3  3694 1 1  16 TYR N    N   6.955   4.031  -8.178 1.00 . A A .  94 TYR N    1 1 
        3  3695 1 1  16 TYR O    O   4.127   2.276  -9.064 1.00 . A A .  94 TYR O    1 1 
        3  3696 1 1  16 TYR OH   O  -0.149   6.383 -10.542 1.00 . A A .  94 TYR OH   1 1 
        3  3697 1 1  17 TYR C    C   5.726   0.225 -10.614 1.00 . A A .  95 TYR C    1 1 
        3  3698 1 1  17 TYR CA   C   5.553   1.558 -11.336 1.00 . A A .  95 TYR CA   1 1 
        3  3699 1 1  17 TYR CB   C   6.452   1.602 -12.573 1.00 . A A .  95 TYR CB   1 1 
        3  3700 1 1  17 TYR CD1  C   5.729   3.922 -13.260 1.00 . A A .  95 TYR CD1  1 1 
        3  3701 1 1  17 TYR CD2  C   5.852   2.236 -14.942 1.00 . A A .  95 TYR CD2  1 1 
        3  3702 1 1  17 TYR CE1  C   5.318   4.841 -14.206 1.00 . A A .  95 TYR CE1  1 1 
        3  3703 1 1  17 TYR CE2  C   5.442   3.151 -15.894 1.00 . A A .  95 TYR CE2  1 1 
        3  3704 1 1  17 TYR CG   C   6.003   2.606 -13.611 1.00 . A A .  95 TYR CG   1 1 
        3  3705 1 1  17 TYR CZ   C   5.176   4.451 -15.521 1.00 . A A .  95 TYR CZ   1 1 
        3  3706 1 1  17 TYR H    H   6.627   3.246 -10.651 1.00 . A A .  95 TYR H    1 1 
        3  3707 1 1  17 TYR HA   H   4.523   1.652 -11.649 1.00 . A A .  95 TYR HA   1 1 
        3  3708 1 1  17 TYR HB2  H   7.455   1.864 -12.271 1.00 . A A .  95 TYR HB2  1 1 
        3  3709 1 1  17 TYR HB3  H   6.464   0.626 -13.036 1.00 . A A .  95 TYR HB3  1 1 
        3  3710 1 1  17 TYR HD1  H   5.842   4.224 -12.230 1.00 . A A .  95 TYR HD1  1 1 
        3  3711 1 1  17 TYR HD2  H   6.061   1.217 -15.231 1.00 . A A .  95 TYR HD2  1 1 
        3  3712 1 1  17 TYR HE1  H   5.110   5.860 -13.913 1.00 . A A .  95 TYR HE1  1 1 
        3  3713 1 1  17 TYR HE2  H   5.330   2.844 -16.923 1.00 . A A .  95 TYR HE2  1 1 
        3  3714 1 1  17 TYR HH   H   3.961   5.052 -16.885 1.00 . A A .  95 TYR HH   1 1 
        3  3715 1 1  17 TYR N    N   5.854   2.677 -10.452 1.00 . A A .  95 TYR N    1 1 
        3  3716 1 1  17 TYR O    O   5.069  -0.762 -10.947 1.00 . A A .  95 TYR O    1 1 
        3  3717 1 1  17 TYR OH   O   4.767   5.364 -16.465 1.00 . A A .  95 TYR OH   1 1 
        3  3718 1 1  18 LEU C    C   5.656  -1.381  -8.008 1.00 . A A .  96 LEU C    1 1 
        3  3719 1 1  18 LEU CA   C   6.868  -1.012  -8.855 1.00 . A A .  96 LEU CA   1 1 
        3  3720 1 1  18 LEU CB   C   8.093  -0.820  -7.957 1.00 . A A .  96 LEU CB   1 1 
        3  3721 1 1  18 LEU CD1  C   9.551  -2.420  -9.225 1.00 . A A .  96 LEU CD1  1 1 
        3  3722 1 1  18 LEU CD2  C  10.166  -1.740  -6.896 1.00 . A A .  96 LEU CD2  1 1 
        3  3723 1 1  18 LEU CG   C   9.019  -2.031  -7.853 1.00 . A A .  96 LEU CG   1 1 
        3  3724 1 1  18 LEU H    H   7.104   1.018  -9.396 1.00 . A A .  96 LEU H    1 1 
        3  3725 1 1  18 LEU HA   H   7.064  -1.812  -9.552 1.00 . A A .  96 LEU HA   1 1 
        3  3726 1 1  18 LEU HB2  H   8.665   0.012  -8.339 1.00 . A A .  96 LEU HB2  1 1 
        3  3727 1 1  18 LEU HB3  H   7.750  -0.571  -6.964 1.00 . A A .  96 LEU HB3  1 1 
        3  3728 1 1  18 LEU HD11 H  10.592  -2.144  -9.299 1.00 . A A .  96 LEU HD11 1 1 
        3  3729 1 1  18 LEU HD12 H   8.987  -1.907  -9.990 1.00 . A A .  96 LEU HD12 1 1 
        3  3730 1 1  18 LEU HD13 H   9.451  -3.487  -9.360 1.00 . A A .  96 LEU HD13 1 1 
        3  3731 1 1  18 LEU HD21 H  10.916  -2.512  -6.987 1.00 . A A .  96 LEU HD21 1 1 
        3  3732 1 1  18 LEU HD22 H   9.793  -1.717  -5.883 1.00 . A A .  96 LEU HD22 1 1 
        3  3733 1 1  18 LEU HD23 H  10.604  -0.783  -7.140 1.00 . A A .  96 LEU HD23 1 1 
        3  3734 1 1  18 LEU HG   H   8.460  -2.869  -7.461 1.00 . A A .  96 LEU HG   1 1 
        3  3735 1 1  18 LEU N    N   6.612   0.201  -9.623 1.00 . A A .  96 LEU N    1 1 
        3  3736 1 1  18 LEU O    O   5.136  -2.493  -8.101 1.00 . A A .  96 LEU O    1 1 
        3  3737 1 1  19 CYS C    C   2.836  -1.070  -7.142 1.00 . A A .  97 CYS C    1 1 
        3  3738 1 1  19 CYS CA   C   4.055  -0.661  -6.321 1.00 . A A .  97 CYS CA   1 1 
        3  3739 1 1  19 CYS CB   C   3.746   0.603  -5.513 1.00 . A A .  97 CYS CB   1 1 
        3  3740 1 1  19 CYS H    H   5.666   0.427  -7.158 1.00 . A A .  97 CYS H    1 1 
        3  3741 1 1  19 CYS HA   H   4.300  -1.462  -5.640 1.00 . A A .  97 CYS HA   1 1 
        3  3742 1 1  19 CYS HB2  H   4.499   1.347  -5.721 1.00 . A A .  97 CYS HB2  1 1 
        3  3743 1 1  19 CYS HB3  H   2.779   0.985  -5.809 1.00 . A A .  97 CYS HB3  1 1 
        3  3744 1 1  19 CYS HG   H   3.549   1.192  -3.305 1.00 . A A .  97 CYS HG   1 1 
        3  3745 1 1  19 CYS N    N   5.209  -0.439  -7.185 1.00 . A A .  97 CYS N    1 1 
        3  3746 1 1  19 CYS O    O   2.084  -1.963  -6.753 1.00 . A A .  97 CYS O    1 1 
        3  3747 1 1  19 CYS SG   S   3.711   0.344  -3.724 1.00 . A A .  97 CYS SG   1 1 
        3  3748 1 1  20 LEU C    C   1.585  -2.155  -9.646 1.00 . A A .  98 LEU C    1 1 
        3  3749 1 1  20 LEU CA   C   1.525  -0.710  -9.160 1.00 . A A .  98 LEU CA   1 1 
        3  3750 1 1  20 LEU CB   C   1.517   0.244 -10.356 1.00 . A A .  98 LEU CB   1 1 
        3  3751 1 1  20 LEU CD1  C   1.418   2.594 -11.224 1.00 . A A .  98 LEU CD1  1 1 
        3  3752 1 1  20 LEU CD2  C  -0.289   1.799  -9.579 1.00 . A A .  98 LEU CD2  1 1 
        3  3753 1 1  20 LEU CG   C   1.162   1.694 -10.025 1.00 . A A .  98 LEU CG   1 1 
        3  3754 1 1  20 LEU H    H   3.286   0.290  -8.540 1.00 . A A .  98 LEU H    1 1 
        3  3755 1 1  20 LEU HA   H   0.617  -0.571  -8.593 1.00 . A A .  98 LEU HA   1 1 
        3  3756 1 1  20 LEU HB2  H   2.498   0.229 -10.808 1.00 . A A .  98 LEU HB2  1 1 
        3  3757 1 1  20 LEU HB3  H   0.802  -0.122 -11.077 1.00 . A A .  98 LEU HB3  1 1 
        3  3758 1 1  20 LEU HD11 H   0.973   3.562 -11.049 1.00 . A A .  98 LEU HD11 1 1 
        3  3759 1 1  20 LEU HD12 H   0.980   2.151 -12.107 1.00 . A A .  98 LEU HD12 1 1 
        3  3760 1 1  20 LEU HD13 H   2.482   2.707 -11.368 1.00 . A A .  98 LEU HD13 1 1 
        3  3761 1 1  20 LEU HD21 H  -0.697   2.746  -9.899 1.00 . A A .  98 LEU HD21 1 1 
        3  3762 1 1  20 LEU HD22 H  -0.340   1.730  -8.502 1.00 . A A .  98 LEU HD22 1 1 
        3  3763 1 1  20 LEU HD23 H  -0.859   0.994 -10.018 1.00 . A A .  98 LEU HD23 1 1 
        3  3764 1 1  20 LEU HG   H   1.788   2.035  -9.213 1.00 . A A .  98 LEU HG   1 1 
        3  3765 1 1  20 LEU N    N   2.650  -0.411  -8.282 1.00 . A A .  98 LEU N    1 1 
        3  3766 1 1  20 LEU O    O   0.567  -2.845  -9.699 1.00 . A A .  98 LEU O    1 1 
        3  3767 1 1  21 GLN C    C   2.754  -4.981  -9.359 1.00 . A A .  99 GLN C    1 1 
        3  3768 1 1  21 GLN CA   C   2.978  -3.970 -10.480 1.00 . A A .  99 GLN CA   1 1 
        3  3769 1 1  21 GLN CB   C   4.386  -4.134 -11.056 1.00 . A A .  99 GLN CB   1 1 
        3  3770 1 1  21 GLN CD   C   5.759  -4.392 -13.161 1.00 . A A .  99 GLN CD   1 1 
        3  3771 1 1  21 GLN CG   C   4.462  -3.891 -12.555 1.00 . A A .  99 GLN CG   1 1 
        3  3772 1 1  21 GLN H    H   3.559  -2.008  -9.933 1.00 . A A .  99 GLN H    1 1 
        3  3773 1 1  21 GLN HA   H   2.256  -4.151 -11.261 1.00 . A A .  99 GLN HA   1 1 
        3  3774 1 1  21 GLN HB2  H   5.047  -3.435 -10.566 1.00 . A A .  99 GLN HB2  1 1 
        3  3775 1 1  21 GLN HB3  H   4.729  -5.139 -10.859 1.00 . A A .  99 GLN HB3  1 1 
        3  3776 1 1  21 GLN HE21 H   6.234  -2.547 -13.731 1.00 . A A .  99 GLN HE21 1 1 
        3  3777 1 1  21 GLN HE22 H   7.380  -3.776 -14.132 1.00 . A A .  99 GLN HE22 1 1 
        3  3778 1 1  21 GLN HG2  H   3.639  -4.401 -13.032 1.00 . A A .  99 GLN HG2  1 1 
        3  3779 1 1  21 GLN HG3  H   4.382  -2.829 -12.739 1.00 . A A .  99 GLN HG3  1 1 
        3  3780 1 1  21 GLN N    N   2.785  -2.606  -9.999 1.00 . A A .  99 GLN N    1 1 
        3  3781 1 1  21 GLN NE2  N   6.536  -3.479 -13.733 1.00 . A A .  99 GLN NE2  1 1 
        3  3782 1 1  21 GLN O    O   2.038  -5.967  -9.533 1.00 . A A .  99 GLN O    1 1 
        3  3783 1 1  21 GLN OE1  O   6.059  -5.585 -13.115 1.00 . A A .  99 GLN OE1  1 1 
        3  3784 1 1  22 LEU C    C   1.783  -5.692  -6.602 1.00 . A A . 100 LEU C    1 1 
        3  3785 1 1  22 LEU CA   C   3.237  -5.614  -7.059 1.00 . A A . 100 LEU CA   1 1 
        3  3786 1 1  22 LEU CB   C   4.124  -5.128  -5.909 1.00 . A A . 100 LEU CB   1 1 
        3  3787 1 1  22 LEU CD1  C   6.406  -5.122  -4.871 1.00 . A A . 100 LEU CD1  1 1 
        3  3788 1 1  22 LEU CD2  C   5.120  -7.260  -5.049 1.00 . A A . 100 LEU CD2  1 1 
        3  3789 1 1  22 LEU CG   C   5.416  -5.920  -5.706 1.00 . A A . 100 LEU CG   1 1 
        3  3790 1 1  22 LEU H    H   3.926  -3.924  -8.132 1.00 . A A . 100 LEU H    1 1 
        3  3791 1 1  22 LEU HA   H   3.560  -6.599  -7.360 1.00 . A A . 100 LEU HA   1 1 
        3  3792 1 1  22 LEU HB2  H   4.384  -4.096  -6.096 1.00 . A A . 100 LEU HB2  1 1 
        3  3793 1 1  22 LEU HB3  H   3.552  -5.176  -4.994 1.00 . A A . 100 LEU HB3  1 1 
        3  3794 1 1  22 LEU HD11 H   6.280  -5.372  -3.828 1.00 . A A . 100 LEU HD11 1 1 
        3  3795 1 1  22 LEU HD12 H   6.228  -4.067  -5.013 1.00 . A A . 100 LEU HD12 1 1 
        3  3796 1 1  22 LEU HD13 H   7.412  -5.362  -5.180 1.00 . A A . 100 LEU HD13 1 1 
        3  3797 1 1  22 LEU HD21 H   5.778  -8.014  -5.456 1.00 . A A . 100 LEU HD21 1 1 
        3  3798 1 1  22 LEU HD22 H   4.094  -7.536  -5.242 1.00 . A A . 100 LEU HD22 1 1 
        3  3799 1 1  22 LEU HD23 H   5.278  -7.181  -3.984 1.00 . A A . 100 LEU HD23 1 1 
        3  3800 1 1  22 LEU HG   H   5.869  -6.111  -6.667 1.00 . A A . 100 LEU HG   1 1 
        3  3801 1 1  22 LEU N    N   3.370  -4.727  -8.209 1.00 . A A . 100 LEU N    1 1 
        3  3802 1 1  22 LEU O    O   1.264  -6.773  -6.325 1.00 . A A . 100 LEU O    1 1 
        3  3803 1 1  23 ARG C    C  -1.181  -5.125  -7.125 1.00 . A A . 101 ARG C    1 1 
        3  3804 1 1  23 ARG CA   C  -0.261  -4.464  -6.103 1.00 . A A . 101 ARG CA   1 1 
        3  3805 1 1  23 ARG CB   C  -0.676  -3.007  -5.893 1.00 . A A . 101 ARG CB   1 1 
        3  3806 1 1  23 ARG CD   C  -3.032  -2.313  -5.349 1.00 . A A . 101 ARG CD   1 1 
        3  3807 1 1  23 ARG CG   C  -1.711  -2.822  -4.794 1.00 . A A . 101 ARG CG   1 1 
        3  3808 1 1  23 ARG CZ   C  -3.969  -0.145  -6.053 1.00 . A A . 101 ARG CZ   1 1 
        3  3809 1 1  23 ARG H    H   1.603  -3.708  -6.761 1.00 . A A . 101 ARG H    1 1 
        3  3810 1 1  23 ARG HA   H  -0.349  -4.991  -5.165 1.00 . A A . 101 ARG HA   1 1 
        3  3811 1 1  23 ARG HB2  H   0.199  -2.430  -5.634 1.00 . A A . 101 ARG HB2  1 1 
        3  3812 1 1  23 ARG HB3  H  -1.088  -2.626  -6.816 1.00 . A A . 101 ARG HB3  1 1 
        3  3813 1 1  23 ARG HD2  H  -3.134  -2.652  -6.369 1.00 . A A . 101 ARG HD2  1 1 
        3  3814 1 1  23 ARG HD3  H  -3.838  -2.716  -4.754 1.00 . A A . 101 ARG HD3  1 1 
        3  3815 1 1  23 ARG HE   H  -2.486  -0.378  -4.737 1.00 . A A . 101 ARG HE   1 1 
        3  3816 1 1  23 ARG HG2  H  -1.879  -3.772  -4.309 1.00 . A A . 101 ARG HG2  1 1 
        3  3817 1 1  23 ARG HG3  H  -1.334  -2.110  -4.075 1.00 . A A . 101 ARG HG3  1 1 
        3  3818 1 1  23 ARG HH11 H  -4.830  -1.753  -6.926 1.00 . A A . 101 ARG HH11 1 1 
        3  3819 1 1  23 ARG HH12 H  -5.470  -0.217  -7.404 1.00 . A A . 101 ARG HH12 1 1 
        3  3820 1 1  23 ARG HH21 H  -3.327   1.644  -5.364 1.00 . A A . 101 ARG HH21 1 1 
        3  3821 1 1  23 ARG HH22 H  -4.617   1.712  -6.518 1.00 . A A . 101 ARG HH22 1 1 
        3  3822 1 1  23 ARG N    N   1.133  -4.536  -6.526 1.00 . A A . 101 ARG N    1 1 
        3  3823 1 1  23 ARG NE   N  -3.109  -0.854  -5.325 1.00 . A A . 101 ARG NE   1 1 
        3  3824 1 1  23 ARG NH1  N  -4.827  -0.756  -6.861 1.00 . A A . 101 ARG NH1  1 1 
        3  3825 1 1  23 ARG NH2  N  -3.971   1.179  -5.972 1.00 . A A . 101 ARG NH2  1 1 
        3  3826 1 1  23 ARG O    O  -2.244  -5.638  -6.776 1.00 . A A . 101 ARG O    1 1 
        3  3827 1 1  24 GLN C    C  -1.537  -7.237  -9.358 1.00 . A A . 102 GLN C    1 1 
        3  3828 1 1  24 GLN CA   C  -1.554  -5.714  -9.457 1.00 . A A . 102 GLN CA   1 1 
        3  3829 1 1  24 GLN CB   C  -1.021  -5.273 -10.822 1.00 . A A . 102 GLN CB   1 1 
        3  3830 1 1  24 GLN CD   C  -1.583  -3.928 -12.885 1.00 . A A . 102 GLN CD   1 1 
        3  3831 1 1  24 GLN CG   C  -1.720  -4.044 -11.379 1.00 . A A . 102 GLN CG   1 1 
        3  3832 1 1  24 GLN H    H   0.095  -4.697  -8.605 1.00 . A A . 102 GLN H    1 1 
        3  3833 1 1  24 GLN HA   H  -2.572  -5.370  -9.351 1.00 . A A . 102 GLN HA   1 1 
        3  3834 1 1  24 GLN HB2  H   0.032  -5.052 -10.730 1.00 . A A . 102 GLN HB2  1 1 
        3  3835 1 1  24 GLN HB3  H  -1.149  -6.083 -11.525 1.00 . A A . 102 GLN HB3  1 1 
        3  3836 1 1  24 GLN HE21 H  -3.336  -4.831 -13.138 1.00 . A A . 102 GLN HE21 1 1 
        3  3837 1 1  24 GLN HE22 H  -2.518  -4.363 -14.586 1.00 . A A . 102 GLN HE22 1 1 
        3  3838 1 1  24 GLN HG2  H  -2.769  -4.098 -11.132 1.00 . A A . 102 GLN HG2  1 1 
        3  3839 1 1  24 GLN HG3  H  -1.289  -3.164 -10.925 1.00 . A A . 102 GLN HG3  1 1 
        3  3840 1 1  24 GLN N    N  -0.766  -5.113  -8.388 1.00 . A A . 102 GLN N    1 1 
        3  3841 1 1  24 GLN NE2  N  -2.580  -4.424 -13.609 1.00 . A A . 102 GLN NE2  1 1 
        3  3842 1 1  24 GLN O    O  -2.548  -7.897  -9.597 1.00 . A A . 102 GLN O    1 1 
        3  3843 1 1  24 GLN OE1  O  -0.594  -3.399 -13.392 1.00 . A A . 102 GLN OE1  1 1 
        3  3844 1 1  25 ASP C    C  -0.970  -9.756  -7.653 1.00 . A A . 103 ASP C    1 1 
        3  3845 1 1  25 ASP CA   C  -0.226  -9.232  -8.877 1.00 . A A . 103 ASP CA   1 1 
        3  3846 1 1  25 ASP CB   C   1.256  -9.602  -8.784 1.00 . A A . 103 ASP CB   1 1 
        3  3847 1 1  25 ASP CG   C   1.847  -9.969 -10.131 1.00 . A A . 103 ASP CG   1 1 
        3  3848 1 1  25 ASP H    H   0.390  -7.207  -8.830 1.00 . A A . 103 ASP H    1 1 
        3  3849 1 1  25 ASP HA   H  -0.646  -9.689  -9.761 1.00 . A A . 103 ASP HA   1 1 
        3  3850 1 1  25 ASP HB2  H   1.806  -8.761  -8.388 1.00 . A A . 103 ASP HB2  1 1 
        3  3851 1 1  25 ASP HB3  H   1.369 -10.446  -8.119 1.00 . A A . 103 ASP HB3  1 1 
        3  3852 1 1  25 ASP N    N  -0.379  -7.787  -9.006 1.00 . A A . 103 ASP N    1 1 
        3  3853 1 1  25 ASP O    O  -1.577 -10.827  -7.694 1.00 . A A . 103 ASP O    1 1 
        3  3854 1 1  25 ASP OD1  O   1.116 -10.549 -10.961 1.00 . A A . 103 ASP OD1  1 1 
        3  3855 1 1  25 ASP OD2  O   3.041  -9.679 -10.354 1.00 . A A . 103 ASP OD2  1 1 
        3  3856 1 1  26 ILE C    C  -3.095  -9.416  -5.490 1.00 . A A . 104 ILE C    1 1 
        3  3857 1 1  26 ILE CA   C  -1.579  -9.390  -5.324 1.00 . A A . 104 ILE CA   1 1 
        3  3858 1 1  26 ILE CB   C  -1.214  -8.439  -4.167 1.00 . A A . 104 ILE CB   1 1 
        3  3859 1 1  26 ILE CD1  C   0.766  -6.965  -3.544 1.00 . A A . 104 ILE CD1  1 1 
        3  3860 1 1  26 ILE CG1  C   0.306  -8.320  -4.035 1.00 . A A . 104 ILE CG1  1 1 
        3  3861 1 1  26 ILE CG2  C  -1.825  -8.930  -2.862 1.00 . A A . 104 ILE CG2  1 1 
        3  3862 1 1  26 ILE H    H  -0.412  -8.158  -6.590 1.00 . A A . 104 ILE H    1 1 
        3  3863 1 1  26 ILE HA   H  -1.239 -10.383  -5.066 1.00 . A A . 104 ILE HA   1 1 
        3  3864 1 1  26 ILE HB   H  -1.626  -7.466  -4.385 1.00 . A A . 104 ILE HB   1 1 
        3  3865 1 1  26 ILE HD11 H   1.039  -7.034  -2.502 1.00 . A A . 104 ILE HD11 1 1 
        3  3866 1 1  26 ILE HD12 H  -0.034  -6.249  -3.660 1.00 . A A . 104 ILE HD12 1 1 
        3  3867 1 1  26 ILE HD13 H   1.622  -6.645  -4.120 1.00 . A A . 104 ILE HD13 1 1 
        3  3868 1 1  26 ILE HG12 H   0.660  -9.063  -3.336 1.00 . A A . 104 ILE HG12 1 1 
        3  3869 1 1  26 ILE HG13 H   0.759  -8.497  -5.000 1.00 . A A . 104 ILE HG13 1 1 
        3  3870 1 1  26 ILE HG21 H  -1.870 -10.009  -2.868 1.00 . A A . 104 ILE HG21 1 1 
        3  3871 1 1  26 ILE HG22 H  -2.822  -8.528  -2.758 1.00 . A A . 104 ILE HG22 1 1 
        3  3872 1 1  26 ILE HG23 H  -1.216  -8.600  -2.033 1.00 . A A . 104 ILE HG23 1 1 
        3  3873 1 1  26 ILE N    N  -0.915  -8.999  -6.562 1.00 . A A . 104 ILE N    1 1 
        3  3874 1 1  26 ILE O    O  -3.744 -10.416  -5.181 1.00 . A A . 104 ILE O    1 1 
        3  3875 1 1  27 VAL C    C  -5.604  -9.257  -7.157 1.00 . A A . 105 VAL C    1 1 
        3  3876 1 1  27 VAL CA   C  -5.098  -8.209  -6.171 1.00 . A A . 105 VAL CA   1 1 
        3  3877 1 1  27 VAL CB   C  -5.495  -6.811  -6.679 1.00 . A A . 105 VAL CB   1 1 
        3  3878 1 1  27 VAL CG1  C  -5.233  -5.761  -5.611 1.00 . A A . 105 VAL CG1  1 1 
        3  3879 1 1  27 VAL CG2  C  -4.750  -6.476  -7.962 1.00 . A A . 105 VAL CG2  1 1 
        3  3880 1 1  27 VAL H    H  -3.094  -7.543  -6.198 1.00 . A A . 105 VAL H    1 1 
        3  3881 1 1  27 VAL HA   H  -5.577  -8.370  -5.216 1.00 . A A . 105 VAL HA   1 1 
        3  3882 1 1  27 VAL HB   H  -6.554  -6.816  -6.894 1.00 . A A . 105 VAL HB   1 1 
        3  3883 1 1  27 VAL HG11 H  -6.124  -5.619  -5.018 1.00 . A A . 105 VAL HG11 1 1 
        3  3884 1 1  27 VAL HG12 H  -4.962  -4.828  -6.083 1.00 . A A . 105 VAL HG12 1 1 
        3  3885 1 1  27 VAL HG13 H  -4.425  -6.090  -4.974 1.00 . A A . 105 VAL HG13 1 1 
        3  3886 1 1  27 VAL HG21 H  -4.574  -5.412  -8.009 1.00 . A A . 105 VAL HG21 1 1 
        3  3887 1 1  27 VAL HG22 H  -5.341  -6.782  -8.812 1.00 . A A . 105 VAL HG22 1 1 
        3  3888 1 1  27 VAL HG23 H  -3.804  -6.998  -7.975 1.00 . A A . 105 VAL HG23 1 1 
        3  3889 1 1  27 VAL N    N  -3.657  -8.312  -5.972 1.00 . A A . 105 VAL N    1 1 
        3  3890 1 1  27 VAL O    O  -6.731  -9.738  -7.040 1.00 . A A . 105 VAL O    1 1 
        3  3891 1 1  28 ALA C    C  -5.030 -12.020  -8.587 1.00 . A A . 106 ALA C    1 1 
        3  3892 1 1  28 ALA CA   C  -5.138 -10.597  -9.133 1.00 . A A . 106 ALA CA   1 1 
        3  3893 1 1  28 ALA CB   C  -4.268 -10.440 -10.371 1.00 . A A . 106 ALA CB   1 1 
        3  3894 1 1  28 ALA H    H  -3.880  -9.193  -8.172 1.00 . A A . 106 ALA H    1 1 
        3  3895 1 1  28 ALA HA   H  -6.163 -10.411  -9.419 1.00 . A A . 106 ALA HA   1 1 
        3  3896 1 1  28 ALA HB1  H  -3.311 -10.027 -10.088 1.00 . A A . 106 ALA HB1  1 1 
        3  3897 1 1  28 ALA HB2  H  -4.754  -9.776 -11.070 1.00 . A A . 106 ALA HB2  1 1 
        3  3898 1 1  28 ALA HB3  H  -4.122 -11.405 -10.833 1.00 . A A . 106 ALA HB3  1 1 
        3  3899 1 1  28 ALA N    N  -4.767  -9.606  -8.129 1.00 . A A . 106 ALA N    1 1 
        3  3900 1 1  28 ALA O    O  -5.363 -12.983  -9.278 1.00 . A A . 106 ALA O    1 1 
        3  3901 1 1  29 GLY C    C  -3.331 -14.286  -7.399 1.00 . A A . 107 GLY C    1 1 
        3  3902 1 1  29 GLY CA   C  -4.424 -13.465  -6.746 1.00 . A A . 107 GLY CA   1 1 
        3  3903 1 1  29 GLY H    H  -4.310 -11.354  -6.838 1.00 . A A . 107 GLY H    1 1 
        3  3904 1 1  29 GLY HA2  H  -4.193 -13.346  -5.697 1.00 . A A . 107 GLY HA2  1 1 
        3  3905 1 1  29 GLY HA3  H  -5.361 -13.993  -6.840 1.00 . A A . 107 GLY HA3  1 1 
        3  3906 1 1  29 GLY N    N  -4.562 -12.152  -7.347 1.00 . A A . 107 GLY N    1 1 
        3  3907 1 1  29 GLY O    O  -3.433 -15.510  -7.487 1.00 . A A . 107 GLY O    1 1 
        3  3908 1 1  30 ARG C    C  -0.064 -14.635  -7.505 1.00 . A A . 108 ARG C    1 1 
        3  3909 1 1  30 ARG CA   C  -1.164 -14.286  -8.508 1.00 . A A . 108 ARG CA   1 1 
        3  3910 1 1  30 ARG CB   C  -0.592 -13.408  -9.622 1.00 . A A . 108 ARG CB   1 1 
        3  3911 1 1  30 ARG CD   C  -1.093 -13.214 -12.080 1.00 . A A . 108 ARG CD   1 1 
        3  3912 1 1  30 ARG CG   C  -1.620 -13.007 -10.669 1.00 . A A . 108 ARG CG   1 1 
        3  3913 1 1  30 ARG CZ   C  -0.557 -15.129 -13.535 1.00 . A A . 108 ARG CZ   1 1 
        3  3914 1 1  30 ARG H    H  -2.260 -12.637  -7.758 1.00 . A A . 108 ARG H    1 1 
        3  3915 1 1  30 ARG HA   H  -1.538 -15.201  -8.942 1.00 . A A . 108 ARG HA   1 1 
        3  3916 1 1  30 ARG HB2  H  -0.188 -12.507  -9.182 1.00 . A A . 108 ARG HB2  1 1 
        3  3917 1 1  30 ARG HB3  H   0.204 -13.945 -10.115 1.00 . A A . 108 ARG HB3  1 1 
        3  3918 1 1  30 ARG HD2  H  -1.864 -12.937 -12.783 1.00 . A A . 108 ARG HD2  1 1 
        3  3919 1 1  30 ARG HD3  H  -0.230 -12.580 -12.224 1.00 . A A . 108 ARG HD3  1 1 
        3  3920 1 1  30 ARG HE   H  -0.554 -15.172 -11.540 1.00 . A A . 108 ARG HE   1 1 
        3  3921 1 1  30 ARG HG2  H  -2.507 -13.609 -10.536 1.00 . A A . 108 ARG HG2  1 1 
        3  3922 1 1  30 ARG HG3  H  -1.867 -11.964 -10.535 1.00 . A A . 108 ARG HG3  1 1 
        3  3923 1 1  30 ARG HH11 H  -1.021 -13.427 -14.527 1.00 . A A . 108 ARG HH11 1 1 
        3  3924 1 1  30 ARG HH12 H  -0.641 -14.790 -15.526 1.00 . A A . 108 ARG HH12 1 1 
        3  3925 1 1  30 ARG HH21 H  -0.054 -16.964 -12.854 1.00 . A A . 108 ARG HH21 1 1 
        3  3926 1 1  30 ARG HH22 H  -0.094 -16.796 -14.577 1.00 . A A . 108 ARG HH22 1 1 
        3  3927 1 1  30 ARG N    N  -2.282 -13.612  -7.858 1.00 . A A . 108 ARG N    1 1 
        3  3928 1 1  30 ARG NE   N  -0.708 -14.602 -12.322 1.00 . A A . 108 ARG NE   1 1 
        3  3929 1 1  30 ARG NH1  N  -0.756 -14.387 -14.618 1.00 . A A . 108 ARG NH1  1 1 
        3  3930 1 1  30 ARG NH2  N  -0.206 -16.400 -13.666 1.00 . A A . 108 ARG NH2  1 1 
        3  3931 1 1  30 ARG O    O   0.993 -15.137  -7.885 1.00 . A A . 108 ARG O    1 1 
        3  3932 1 1  31 LEU C    C  -0.037 -14.889  -3.839 1.00 . A A . 109 LEU C    1 1 
        3  3933 1 1  31 LEU CA   C   0.660 -14.660  -5.180 1.00 . A A . 109 LEU CA   1 1 
        3  3934 1 1  31 LEU CB   C   1.663 -13.511  -5.056 1.00 . A A . 109 LEU CB   1 1 
        3  3935 1 1  31 LEU CD1  C   4.136 -13.140  -5.259 1.00 . A A . 109 LEU CD1  1 1 
        3  3936 1 1  31 LEU CD2  C   3.133 -13.683  -3.030 1.00 . A A . 109 LEU CD2  1 1 
        3  3937 1 1  31 LEU CG   C   3.044 -13.912  -4.533 1.00 . A A . 109 LEU CG   1 1 
        3  3938 1 1  31 LEU H    H  -1.172 -13.969  -5.973 1.00 . A A . 109 LEU H    1 1 
        3  3939 1 1  31 LEU HA   H   1.188 -15.558  -5.461 1.00 . A A . 109 LEU HA   1 1 
        3  3940 1 1  31 LEU HB2  H   1.785 -13.062  -6.031 1.00 . A A . 109 LEU HB2  1 1 
        3  3941 1 1  31 LEU HB3  H   1.250 -12.771  -4.387 1.00 . A A . 109 LEU HB3  1 1 
        3  3942 1 1  31 LEU HD11 H   3.924 -12.082  -5.206 1.00 . A A . 109 LEU HD11 1 1 
        3  3943 1 1  31 LEU HD12 H   4.169 -13.450  -6.293 1.00 . A A . 109 LEU HD12 1 1 
        3  3944 1 1  31 LEU HD13 H   5.089 -13.339  -4.792 1.00 . A A . 109 LEU HD13 1 1 
        3  3945 1 1  31 LEU HD21 H   3.529 -14.568  -2.554 1.00 . A A . 109 LEU HD21 1 1 
        3  3946 1 1  31 LEU HD22 H   2.149 -13.474  -2.637 1.00 . A A . 109 LEU HD22 1 1 
        3  3947 1 1  31 LEU HD23 H   3.785 -12.845  -2.830 1.00 . A A . 109 LEU HD23 1 1 
        3  3948 1 1  31 LEU HG   H   3.201 -14.965  -4.721 1.00 . A A . 109 LEU HG   1 1 
        3  3949 1 1  31 LEU N    N  -0.314 -14.369  -6.224 1.00 . A A . 109 LEU N    1 1 
        3  3950 1 1  31 LEU O    O  -0.634 -13.970  -3.279 1.00 . A A . 109 LEU O    1 1 
        3  3951 1 1  32 PRO C    C  -0.194 -15.512  -0.901 1.00 . A A . 110 PRO C    1 1 
        3  3952 1 1  32 PRO CA   C  -0.610 -16.458  -2.023 1.00 . A A . 110 PRO CA   1 1 
        3  3953 1 1  32 PRO CB   C  -0.112 -17.876  -1.737 1.00 . A A . 110 PRO CB   1 1 
        3  3954 1 1  32 PRO CD   C   0.711 -17.284  -3.899 1.00 . A A . 110 PRO CD   1 1 
        3  3955 1 1  32 PRO CG   C   0.216 -18.440  -3.075 1.00 . A A . 110 PRO CG   1 1 
        3  3956 1 1  32 PRO HA   H  -1.687 -16.462  -2.106 1.00 . A A . 110 PRO HA   1 1 
        3  3957 1 1  32 PRO HB2  H   0.760 -17.833  -1.101 1.00 . A A . 110 PRO HB2  1 1 
        3  3958 1 1  32 PRO HB3  H  -0.892 -18.444  -1.251 1.00 . A A . 110 PRO HB3  1 1 
        3  3959 1 1  32 PRO HD2  H   1.783 -17.187  -3.808 1.00 . A A . 110 PRO HD2  1 1 
        3  3960 1 1  32 PRO HD3  H   0.429 -17.409  -4.934 1.00 . A A . 110 PRO HD3  1 1 
        3  3961 1 1  32 PRO HG2  H   0.988 -19.190  -2.979 1.00 . A A . 110 PRO HG2  1 1 
        3  3962 1 1  32 PRO HG3  H  -0.670 -18.866  -3.522 1.00 . A A . 110 PRO HG3  1 1 
        3  3963 1 1  32 PRO N    N   0.025 -16.122  -3.303 1.00 . A A . 110 PRO N    1 1 
        3  3964 1 1  32 PRO O    O   0.994 -15.267  -0.690 1.00 . A A . 110 PRO O    1 1 
        3  3965 1 1  33 CYS C    C  -1.908 -14.307   2.064 1.00 . A A . 111 CYS C    1 1 
        3  3966 1 1  33 CYS CA   C  -0.921 -14.072   0.925 1.00 . A A . 111 CYS CA   1 1 
        3  3967 1 1  33 CYS CB   C  -1.007 -12.621   0.448 1.00 . A A . 111 CYS CB   1 1 
        3  3968 1 1  33 CYS H    H  -2.107 -15.225  -0.396 1.00 . A A . 111 CYS H    1 1 
        3  3969 1 1  33 CYS HA   H   0.079 -14.265   1.285 1.00 . A A . 111 CYS HA   1 1 
        3  3970 1 1  33 CYS HB2  H  -2.031 -12.394   0.192 1.00 . A A . 111 CYS HB2  1 1 
        3  3971 1 1  33 CYS HB3  H  -0.689 -11.968   1.247 1.00 . A A . 111 CYS HB3  1 1 
        3  3972 1 1  33 CYS HG   H  -0.510 -11.728  -1.605 1.00 . A A . 111 CYS HG   1 1 
        3  3973 1 1  33 CYS N    N  -1.181 -14.988  -0.181 1.00 . A A . 111 CYS N    1 1 
        3  3974 1 1  33 CYS O    O  -2.900 -15.017   1.902 1.00 . A A . 111 CYS O    1 1 
        3  3975 1 1  33 CYS SG   S   0.013 -12.258  -1.000 1.00 . A A . 111 CYS SG   1 1 
        3  3976 1 1  34 SER C    C  -3.359 -12.617   4.584 1.00 . A A . 112 SER C    1 1 
        3  3977 1 1  34 SER CA   C  -2.492 -13.856   4.383 1.00 . A A . 112 SER CA   1 1 
        3  3978 1 1  34 SER CB   C  -1.652 -14.113   5.636 1.00 . A A . 112 SER CB   1 1 
        3  3979 1 1  34 SER H    H  -0.822 -13.156   3.287 1.00 . A A . 112 SER H    1 1 
        3  3980 1 1  34 SER HA   H  -3.135 -14.706   4.212 1.00 . A A . 112 SER HA   1 1 
        3  3981 1 1  34 SER HB2  H  -2.144 -13.677   6.492 1.00 . A A . 112 SER HB2  1 1 
        3  3982 1 1  34 SER HB3  H  -1.548 -15.178   5.784 1.00 . A A . 112 SER HB3  1 1 
        3  3983 1 1  34 SER HG   H   0.271 -14.225   5.278 1.00 . A A . 112 SER HG   1 1 
        3  3984 1 1  34 SER N    N  -1.628 -13.708   3.217 1.00 . A A . 112 SER N    1 1 
        3  3985 1 1  34 SER O    O  -3.095 -11.561   4.009 1.00 . A A . 112 SER O    1 1 
        3  3986 1 1  34 SER OG   O  -0.361 -13.541   5.511 1.00 . A A . 112 SER OG   1 1 
        3  3987 1 1  35 PHE C    C  -4.549 -10.470   6.296 1.00 . A A . 113 PHE C    1 1 
        3  3988 1 1  35 PHE CA   C  -5.302 -11.648   5.688 1.00 . A A . 113 PHE CA   1 1 
        3  3989 1 1  35 PHE CB   C  -6.417 -12.106   6.633 1.00 . A A . 113 PHE CB   1 1 
        3  3990 1 1  35 PHE CD1  C  -6.950 -10.121   8.074 1.00 . A A . 113 PHE CD1  1 1 
        3  3991 1 1  35 PHE CD2  C  -8.576 -10.833   6.482 1.00 . A A . 113 PHE CD2  1 1 
        3  3992 1 1  35 PHE CE1  C  -7.788  -9.101   8.480 1.00 . A A . 113 PHE CE1  1 1 
        3  3993 1 1  35 PHE CE2  C  -9.420  -9.814   6.884 1.00 . A A . 113 PHE CE2  1 1 
        3  3994 1 1  35 PHE CG   C  -7.333 -10.998   7.072 1.00 . A A . 113 PHE CG   1 1 
        3  3995 1 1  35 PHE CZ   C  -9.025  -8.947   7.884 1.00 . A A . 113 PHE CZ   1 1 
        3  3996 1 1  35 PHE H    H  -4.552 -13.622   5.835 1.00 . A A . 113 PHE H    1 1 
        3  3997 1 1  35 PHE HA   H  -5.742 -11.333   4.753 1.00 . A A . 113 PHE HA   1 1 
        3  3998 1 1  35 PHE HB2  H  -7.017 -12.853   6.136 1.00 . A A . 113 PHE HB2  1 1 
        3  3999 1 1  35 PHE HB3  H  -5.973 -12.540   7.517 1.00 . A A . 113 PHE HB3  1 1 
        3  4000 1 1  35 PHE HD1  H  -5.983 -10.240   8.540 1.00 . A A . 113 PHE HD1  1 1 
        3  4001 1 1  35 PHE HD2  H  -8.886 -11.510   5.700 1.00 . A A . 113 PHE HD2  1 1 
        3  4002 1 1  35 PHE HE1  H  -7.478  -8.425   9.263 1.00 . A A . 113 PHE HE1  1 1 
        3  4003 1 1  35 PHE HE2  H -10.386  -9.697   6.416 1.00 . A A . 113 PHE HE2  1 1 
        3  4004 1 1  35 PHE HZ   H  -9.682  -8.151   8.200 1.00 . A A . 113 PHE HZ   1 1 
        3  4005 1 1  35 PHE N    N  -4.395 -12.755   5.406 1.00 . A A . 113 PHE N    1 1 
        3  4006 1 1  35 PHE O    O  -4.705  -9.330   5.859 1.00 . A A . 113 PHE O    1 1 
        3  4007 1 1  36 ALA C    C  -2.109  -8.929   7.026 1.00 . A A . 114 ALA C    1 1 
        3  4008 1 1  36 ALA CA   C  -2.988  -9.705   7.998 1.00 . A A . 114 ALA CA   1 1 
        3  4009 1 1  36 ALA CB   C  -2.139 -10.303   9.106 1.00 . A A . 114 ALA CB   1 1 
        3  4010 1 1  36 ALA H    H  -3.682 -11.672   7.641 1.00 . A A . 114 ALA H    1 1 
        3  4011 1 1  36 ALA HA   H  -3.694  -9.023   8.449 1.00 . A A . 114 ALA HA   1 1 
        3  4012 1 1  36 ALA HB1  H  -2.743 -10.438   9.990 1.00 . A A . 114 ALA HB1  1 1 
        3  4013 1 1  36 ALA HB2  H  -1.319  -9.635   9.327 1.00 . A A . 114 ALA HB2  1 1 
        3  4014 1 1  36 ALA HB3  H  -1.749 -11.258   8.785 1.00 . A A . 114 ALA HB3  1 1 
        3  4015 1 1  36 ALA N    N  -3.747 -10.748   7.319 1.00 . A A . 114 ALA N    1 1 
        3  4016 1 1  36 ALA O    O  -2.080  -7.699   7.059 1.00 . A A . 114 ALA O    1 1 
        3  4017 1 1  37 THR C    C  -1.359  -8.215   4.169 1.00 . A A . 115 THR C    1 1 
        3  4018 1 1  37 THR CA   C  -0.529  -8.989   5.183 1.00 . A A . 115 THR CA   1 1 
        3  4019 1 1  37 THR CB   C   0.339 -10.028   4.468 1.00 . A A . 115 THR CB   1 1 
        3  4020 1 1  37 THR CG2  C   1.236  -9.433   3.403 1.00 . A A . 115 THR CG2  1 1 
        3  4021 1 1  37 THR H    H  -1.445 -10.616   6.153 1.00 . A A . 115 THR H    1 1 
        3  4022 1 1  37 THR HA   H   0.110  -8.298   5.713 1.00 . A A . 115 THR HA   1 1 
        3  4023 1 1  37 THR HB   H  -0.305 -10.752   3.991 1.00 . A A . 115 THR HB   1 1 
        3  4024 1 1  37 THR HG1  H   0.621 -11.129   6.063 1.00 . A A . 115 THR HG1  1 1 
        3  4025 1 1  37 THR HG21 H   2.252  -9.760   3.565 1.00 . A A . 115 THR HG21 1 1 
        3  4026 1 1  37 THR HG22 H   1.192  -8.355   3.456 1.00 . A A . 115 THR HG22 1 1 
        3  4027 1 1  37 THR HG23 H   0.903  -9.760   2.429 1.00 . A A . 115 THR HG23 1 1 
        3  4028 1 1  37 THR N    N  -1.396  -9.639   6.156 1.00 . A A . 115 THR N    1 1 
        3  4029 1 1  37 THR O    O  -0.991  -7.115   3.760 1.00 . A A . 115 THR O    1 1 
        3  4030 1 1  37 THR OG1  O   1.166 -10.710   5.393 1.00 . A A . 115 THR OG1  1 1 
        3  4031 1 1  38 LEU C    C  -3.838  -6.802   3.353 1.00 . A A . 116 LEU C    1 1 
        3  4032 1 1  38 LEU CA   C  -3.377  -8.150   2.817 1.00 . A A . 116 LEU CA   1 1 
        3  4033 1 1  38 LEU CB   C  -4.588  -9.041   2.529 1.00 . A A . 116 LEU CB   1 1 
        3  4034 1 1  38 LEU CD1  C  -5.594 -11.007   1.345 1.00 . A A . 116 LEU CD1  1 1 
        3  4035 1 1  38 LEU CD2  C  -3.918  -9.568   0.172 1.00 . A A . 116 LEU CD2  1 1 
        3  4036 1 1  38 LEU CG   C  -4.346 -10.155   1.510 1.00 . A A . 116 LEU CG   1 1 
        3  4037 1 1  38 LEU H    H  -2.732  -9.668   4.141 1.00 . A A . 116 LEU H    1 1 
        3  4038 1 1  38 LEU HA   H  -2.827  -7.993   1.902 1.00 . A A . 116 LEU HA   1 1 
        3  4039 1 1  38 LEU HB2  H  -4.903  -9.493   3.458 1.00 . A A . 116 LEU HB2  1 1 
        3  4040 1 1  38 LEU HB3  H  -5.389  -8.416   2.163 1.00 . A A . 116 LEU HB3  1 1 
        3  4041 1 1  38 LEU HD11 H  -6.247 -10.553   0.614 1.00 . A A . 116 LEU HD11 1 1 
        3  4042 1 1  38 LEU HD12 H  -6.109 -11.079   2.292 1.00 . A A . 116 LEU HD12 1 1 
        3  4043 1 1  38 LEU HD13 H  -5.314 -11.996   1.011 1.00 . A A . 116 LEU HD13 1 1 
        3  4044 1 1  38 LEU HD21 H  -3.897 -10.350  -0.573 1.00 . A A . 116 LEU HD21 1 1 
        3  4045 1 1  38 LEU HD22 H  -2.934  -9.135   0.268 1.00 . A A . 116 LEU HD22 1 1 
        3  4046 1 1  38 LEU HD23 H  -4.621  -8.805  -0.127 1.00 . A A . 116 LEU HD23 1 1 
        3  4047 1 1  38 LEU HG   H  -3.551 -10.793   1.866 1.00 . A A . 116 LEU HG   1 1 
        3  4048 1 1  38 LEU N    N  -2.488  -8.793   3.774 1.00 . A A . 116 LEU N    1 1 
        3  4049 1 1  38 LEU O    O  -3.825  -5.798   2.640 1.00 . A A . 116 LEU O    1 1 
        3  4050 1 1  39 ALA C    C  -3.560  -4.608   5.538 1.00 . A A . 117 ALA C    1 1 
        3  4051 1 1  39 ALA CA   C  -4.711  -5.571   5.264 1.00 . A A . 117 ALA CA   1 1 
        3  4052 1 1  39 ALA CB   C  -5.429  -5.921   6.558 1.00 . A A . 117 ALA CB   1 1 
        3  4053 1 1  39 ALA H    H  -4.237  -7.619   5.139 1.00 . A A . 117 ALA H    1 1 
        3  4054 1 1  39 ALA HA   H  -5.420  -5.093   4.604 1.00 . A A . 117 ALA HA   1 1 
        3  4055 1 1  39 ALA HB1  H  -5.188  -5.190   7.314 1.00 . A A . 117 ALA HB1  1 1 
        3  4056 1 1  39 ALA HB2  H  -5.113  -6.901   6.889 1.00 . A A . 117 ALA HB2  1 1 
        3  4057 1 1  39 ALA HB3  H  -6.496  -5.926   6.388 1.00 . A A . 117 ALA HB3  1 1 
        3  4058 1 1  39 ALA N    N  -4.244  -6.788   4.618 1.00 . A A . 117 ALA N    1 1 
        3  4059 1 1  39 ALA O    O  -3.729  -3.391   5.465 1.00 . A A . 117 ALA O    1 1 
        3  4060 1 1  40 LEU C    C  -0.729  -3.626   4.876 1.00 . A A . 118 LEU C    1 1 
        3  4061 1 1  40 LEU CA   C  -1.218  -4.330   6.139 1.00 . A A . 118 LEU CA   1 1 
        3  4062 1 1  40 LEU CB   C  -0.094  -5.187   6.727 1.00 . A A . 118 LEU CB   1 1 
        3  4063 1 1  40 LEU CD1  C   1.879  -5.009   8.264 1.00 . A A . 118 LEU CD1  1 1 
        3  4064 1 1  40 LEU CD2  C   2.141  -4.491   5.832 1.00 . A A . 118 LEU CD2  1 1 
        3  4065 1 1  40 LEU CG   C   1.203  -4.435   7.028 1.00 . A A . 118 LEU CG   1 1 
        3  4066 1 1  40 LEU H    H  -2.307  -6.132   5.898 1.00 . A A . 118 LEU H    1 1 
        3  4067 1 1  40 LEU HA   H  -1.506  -3.583   6.864 1.00 . A A . 118 LEU HA   1 1 
        3  4068 1 1  40 LEU HB2  H  -0.452  -5.630   7.645 1.00 . A A . 118 LEU HB2  1 1 
        3  4069 1 1  40 LEU HB3  H   0.129  -5.978   6.028 1.00 . A A . 118 LEU HB3  1 1 
        3  4070 1 1  40 LEU HD11 H   2.401  -4.222   8.787 1.00 . A A . 118 LEU HD11 1 1 
        3  4071 1 1  40 LEU HD12 H   2.583  -5.773   7.967 1.00 . A A . 118 LEU HD12 1 1 
        3  4072 1 1  40 LEU HD13 H   1.133  -5.440   8.915 1.00 . A A . 118 LEU HD13 1 1 
        3  4073 1 1  40 LEU HD21 H   3.118  -4.134   6.123 1.00 . A A . 118 LEU HD21 1 1 
        3  4074 1 1  40 LEU HD22 H   1.752  -3.869   5.040 1.00 . A A . 118 LEU HD22 1 1 
        3  4075 1 1  40 LEU HD23 H   2.219  -5.510   5.484 1.00 . A A . 118 LEU HD23 1 1 
        3  4076 1 1  40 LEU HG   H   0.973  -3.398   7.226 1.00 . A A . 118 LEU HG   1 1 
        3  4077 1 1  40 LEU N    N  -2.388  -5.155   5.856 1.00 . A A . 118 LEU N    1 1 
        3  4078 1 1  40 LEU O    O  -0.552  -2.407   4.860 1.00 . A A . 118 LEU O    1 1 
        3  4079 1 1  41 LEU C    C  -1.095  -2.878   1.989 1.00 . A A . 119 LEU C    1 1 
        3  4080 1 1  41 LEU CA   C  -0.065  -3.852   2.546 1.00 . A A . 119 LEU CA   1 1 
        3  4081 1 1  41 LEU CB   C   0.187  -4.976   1.539 1.00 . A A . 119 LEU CB   1 1 
        3  4082 1 1  41 LEU CD1  C   1.014  -7.313   1.165 1.00 . A A . 119 LEU CD1  1 1 
        3  4083 1 1  41 LEU CD2  C   2.602  -5.533   1.916 1.00 . A A . 119 LEU CD2  1 1 
        3  4084 1 1  41 LEU CG   C   1.174  -6.051   1.999 1.00 . A A . 119 LEU CG   1 1 
        3  4085 1 1  41 LEU H    H  -0.689  -5.363   3.889 1.00 . A A . 119 LEU H    1 1 
        3  4086 1 1  41 LEU HA   H   0.858  -3.322   2.724 1.00 . A A . 119 LEU HA   1 1 
        3  4087 1 1  41 LEU HB2  H  -0.757  -5.454   1.321 1.00 . A A . 119 LEU HB2  1 1 
        3  4088 1 1  41 LEU HB3  H   0.567  -4.537   0.629 1.00 . A A . 119 LEU HB3  1 1 
        3  4089 1 1  41 LEU HD11 H   0.919  -7.046   0.123 1.00 . A A . 119 LEU HD11 1 1 
        3  4090 1 1  41 LEU HD12 H   0.128  -7.844   1.482 1.00 . A A . 119 LEU HD12 1 1 
        3  4091 1 1  41 LEU HD13 H   1.879  -7.945   1.299 1.00 . A A . 119 LEU HD13 1 1 
        3  4092 1 1  41 LEU HD21 H   3.288  -6.331   2.159 1.00 . A A . 119 LEU HD21 1 1 
        3  4093 1 1  41 LEU HD22 H   2.731  -4.721   2.616 1.00 . A A . 119 LEU HD22 1 1 
        3  4094 1 1  41 LEU HD23 H   2.799  -5.180   0.915 1.00 . A A . 119 LEU HD23 1 1 
        3  4095 1 1  41 LEU HG   H   0.967  -6.303   3.029 1.00 . A A . 119 LEU HG   1 1 
        3  4096 1 1  41 LEU N    N  -0.523  -4.401   3.816 1.00 . A A . 119 LEU N    1 1 
        3  4097 1 1  41 LEU O    O  -0.748  -1.873   1.368 1.00 . A A . 119 LEU O    1 1 
        3  4098 1 1  42 GLY C    C  -3.500  -1.021   2.541 1.00 . A A . 120 GLY C    1 1 
        3  4099 1 1  42 GLY CA   C  -3.435  -2.321   1.765 1.00 . A A . 120 GLY CA   1 1 
        3  4100 1 1  42 GLY H    H  -2.573  -3.988   2.747 1.00 . A A . 120 GLY H    1 1 
        3  4101 1 1  42 GLY HA2  H  -3.275  -2.099   0.720 1.00 . A A . 120 GLY HA2  1 1 
        3  4102 1 1  42 GLY HA3  H  -4.375  -2.841   1.874 1.00 . A A . 120 GLY HA3  1 1 
        3  4103 1 1  42 GLY N    N  -2.365  -3.180   2.232 1.00 . A A . 120 GLY N    1 1 
        3  4104 1 1  42 GLY O    O  -3.507   0.061   1.956 1.00 . A A . 120 GLY O    1 1 
        3  4105 1 1  43 SER C    C  -2.491   1.021   4.437 1.00 . A A . 121 SER C    1 1 
        3  4106 1 1  43 SER CA   C  -3.618   0.036   4.735 1.00 . A A . 121 SER CA   1 1 
        3  4107 1 1  43 SER CB   C  -3.555  -0.392   6.203 1.00 . A A . 121 SER CB   1 1 
        3  4108 1 1  43 SER H    H  -3.540  -2.026   4.268 1.00 . A A . 121 SER H    1 1 
        3  4109 1 1  43 SER HA   H  -4.563   0.526   4.555 1.00 . A A . 121 SER HA   1 1 
        3  4110 1 1  43 SER HB2  H  -2.620  -0.899   6.388 1.00 . A A . 121 SER HB2  1 1 
        3  4111 1 1  43 SER HB3  H  -3.621   0.482   6.834 1.00 . A A . 121 SER HB3  1 1 
        3  4112 1 1  43 SER HG   H  -4.596  -2.031   5.942 1.00 . A A . 121 SER HG   1 1 
        3  4113 1 1  43 SER N    N  -3.548  -1.133   3.865 1.00 . A A . 121 SER N    1 1 
        3  4114 1 1  43 SER O    O  -2.676   2.235   4.536 1.00 . A A . 121 SER O    1 1 
        3  4115 1 1  43 SER OG   O  -4.620  -1.269   6.525 1.00 . A A . 121 SER OG   1 1 
        3  4116 1 1  44 TYR C    C  -0.367   2.039   2.412 1.00 . A A . 122 TYR C    1 1 
        3  4117 1 1  44 TYR CA   C  -0.180   1.345   3.757 1.00 . A A . 122 TYR CA   1 1 
        3  4118 1 1  44 TYR CB   C   1.105   0.516   3.744 1.00 . A A . 122 TYR CB   1 1 
        3  4119 1 1  44 TYR CD1  C   1.865   1.246   6.037 1.00 . A A . 122 TYR CD1  1 1 
        3  4120 1 1  44 TYR CD2  C   1.945  -1.078   5.513 1.00 . A A . 122 TYR CD2  1 1 
        3  4121 1 1  44 TYR CE1  C   2.362   0.983   7.300 1.00 . A A . 122 TYR CE1  1 1 
        3  4122 1 1  44 TYR CE2  C   2.442  -1.350   6.774 1.00 . A A . 122 TYR CE2  1 1 
        3  4123 1 1  44 TYR CG   C   1.649   0.222   5.124 1.00 . A A . 122 TYR CG   1 1 
        3  4124 1 1  44 TYR CZ   C   2.649  -0.316   7.663 1.00 . A A . 122 TYR CZ   1 1 
        3  4125 1 1  44 TYR H    H  -1.228  -0.475   3.997 1.00 . A A . 122 TYR H    1 1 
        3  4126 1 1  44 TYR HA   H  -0.105   2.097   4.529 1.00 . A A . 122 TYR HA   1 1 
        3  4127 1 1  44 TYR HB2  H   0.911  -0.428   3.257 1.00 . A A . 122 TYR HB2  1 1 
        3  4128 1 1  44 TYR HB3  H   1.865   1.050   3.194 1.00 . A A . 122 TYR HB3  1 1 
        3  4129 1 1  44 TYR HD1  H   1.640   2.262   5.750 1.00 . A A . 122 TYR HD1  1 1 
        3  4130 1 1  44 TYR HD2  H   1.783  -1.886   4.814 1.00 . A A . 122 TYR HD2  1 1 
        3  4131 1 1  44 TYR HE1  H   2.523   1.793   7.995 1.00 . A A . 122 TYR HE1  1 1 
        3  4132 1 1  44 TYR HE2  H   2.667  -2.367   7.058 1.00 . A A . 122 TYR HE2  1 1 
        3  4133 1 1  44 TYR HH   H   2.523  -0.268   9.581 1.00 . A A . 122 TYR HH   1 1 
        3  4134 1 1  44 TYR N    N  -1.325   0.499   4.068 1.00 . A A . 122 TYR N    1 1 
        3  4135 1 1  44 TYR O    O  -0.153   3.245   2.290 1.00 . A A . 122 TYR O    1 1 
        3  4136 1 1  44 TYR OH   O   3.143  -0.582   8.919 1.00 . A A . 122 TYR OH   1 1 
        3  4137 1 1  45 THR C    C  -2.056   2.901   0.099 1.00 . A A . 123 THR C    1 1 
        3  4138 1 1  45 THR CA   C  -0.988   1.814   0.071 1.00 . A A . 123 THR CA   1 1 
        3  4139 1 1  45 THR CB   C  -1.398   0.702  -0.896 1.00 . A A . 123 THR CB   1 1 
        3  4140 1 1  45 THR CG2  C  -1.597   1.185  -2.316 1.00 . A A . 123 THR CG2  1 1 
        3  4141 1 1  45 THR H    H  -0.926   0.316   1.565 1.00 . A A . 123 THR H    1 1 
        3  4142 1 1  45 THR HA   H  -0.059   2.249  -0.266 1.00 . A A . 123 THR HA   1 1 
        3  4143 1 1  45 THR HB   H  -2.331   0.272  -0.559 1.00 . A A . 123 THR HB   1 1 
        3  4144 1 1  45 THR HG1  H  -0.328  -0.702  -0.047 1.00 . A A . 123 THR HG1  1 1 
        3  4145 1 1  45 THR HG21 H  -1.761   2.252  -2.313 1.00 . A A . 123 THR HG21 1 1 
        3  4146 1 1  45 THR HG22 H  -2.454   0.690  -2.748 1.00 . A A . 123 THR HG22 1 1 
        3  4147 1 1  45 THR HG23 H  -0.717   0.958  -2.900 1.00 . A A . 123 THR HG23 1 1 
        3  4148 1 1  45 THR N    N  -0.770   1.270   1.406 1.00 . A A . 123 THR N    1 1 
        3  4149 1 1  45 THR O    O  -1.929   3.926  -0.570 1.00 . A A . 123 THR O    1 1 
        3  4150 1 1  45 THR OG1  O  -0.421  -0.323  -0.924 1.00 . A A . 123 THR OG1  1 1 
        3  4151 1 1  46 ILE C    C  -3.678   4.941   1.623 1.00 . A A . 124 ILE C    1 1 
        3  4152 1 1  46 ILE CA   C  -4.187   3.641   1.006 1.00 . A A . 124 ILE CA   1 1 
        3  4153 1 1  46 ILE CB   C  -5.345   3.079   1.861 1.00 . A A . 124 ILE CB   1 1 
        3  4154 1 1  46 ILE CD1  C  -6.666   2.088  -0.081 1.00 . A A . 124 ILE CD1  1 1 
        3  4155 1 1  46 ILE CG1  C  -5.920   1.819   1.209 1.00 . A A . 124 ILE CG1  1 1 
        3  4156 1 1  46 ILE CG2  C  -6.439   4.123   2.053 1.00 . A A . 124 ILE CG2  1 1 
        3  4157 1 1  46 ILE H    H  -3.146   1.843   1.400 1.00 . A A . 124 ILE H    1 1 
        3  4158 1 1  46 ILE HA   H  -4.564   3.848   0.015 1.00 . A A . 124 ILE HA   1 1 
        3  4159 1 1  46 ILE HB   H  -4.953   2.824   2.834 1.00 . A A . 124 ILE HB   1 1 
        3  4160 1 1  46 ILE HD11 H  -7.715   1.871   0.058 1.00 . A A . 124 ILE HD11 1 1 
        3  4161 1 1  46 ILE HD12 H  -6.269   1.459  -0.864 1.00 . A A . 124 ILE HD12 1 1 
        3  4162 1 1  46 ILE HD13 H  -6.546   3.125  -0.357 1.00 . A A . 124 ILE HD13 1 1 
        3  4163 1 1  46 ILE HG12 H  -5.114   1.138   0.986 1.00 . A A . 124 ILE HG12 1 1 
        3  4164 1 1  46 ILE HG13 H  -6.605   1.346   1.897 1.00 . A A . 124 ILE HG13 1 1 
        3  4165 1 1  46 ILE HG21 H  -5.997   5.059   2.358 1.00 . A A . 124 ILE HG21 1 1 
        3  4166 1 1  46 ILE HG22 H  -7.128   3.786   2.814 1.00 . A A . 124 ILE HG22 1 1 
        3  4167 1 1  46 ILE HG23 H  -6.970   4.261   1.123 1.00 . A A . 124 ILE HG23 1 1 
        3  4168 1 1  46 ILE N    N  -3.104   2.675   0.885 1.00 . A A . 124 ILE N    1 1 
        3  4169 1 1  46 ILE O    O  -3.923   6.026   1.098 1.00 . A A . 124 ILE O    1 1 
        3  4170 1 1  47 GLN C    C  -1.494   6.771   2.492 1.00 . A A . 125 GLN C    1 1 
        3  4171 1 1  47 GLN CA   C  -2.413   5.985   3.421 1.00 . A A . 125 GLN CA   1 1 
        3  4172 1 1  47 GLN CB   C  -1.645   5.552   4.673 1.00 . A A . 125 GLN CB   1 1 
        3  4173 1 1  47 GLN CD   C  -1.650   6.882   6.823 1.00 . A A . 125 GLN CD   1 1 
        3  4174 1 1  47 GLN CG   C  -1.038   6.712   5.446 1.00 . A A . 125 GLN CG   1 1 
        3  4175 1 1  47 GLN H    H  -2.797   3.929   3.106 1.00 . A A . 125 GLN H    1 1 
        3  4176 1 1  47 GLN HA   H  -3.237   6.617   3.715 1.00 . A A . 125 GLN HA   1 1 
        3  4177 1 1  47 GLN HB2  H  -2.320   5.023   5.329 1.00 . A A . 125 GLN HB2  1 1 
        3  4178 1 1  47 GLN HB3  H  -0.847   4.886   4.379 1.00 . A A . 125 GLN HB3  1 1 
        3  4179 1 1  47 GLN HE21 H  -1.386   8.850   6.724 1.00 . A A . 125 GLN HE21 1 1 
        3  4180 1 1  47 GLN HE22 H  -2.116   8.262   8.175 1.00 . A A . 125 GLN HE22 1 1 
        3  4181 1 1  47 GLN HG2  H   0.022   6.536   5.560 1.00 . A A . 125 GLN HG2  1 1 
        3  4182 1 1  47 GLN HG3  H  -1.192   7.622   4.885 1.00 . A A . 125 GLN HG3  1 1 
        3  4183 1 1  47 GLN N    N  -2.962   4.821   2.737 1.00 . A A . 125 GLN N    1 1 
        3  4184 1 1  47 GLN NE2  N  -1.725   8.123   7.287 1.00 . A A . 125 GLN NE2  1 1 
        3  4185 1 1  47 GLN O    O  -1.469   7.999   2.523 1.00 . A A . 125 GLN O    1 1 
        3  4186 1 1  47 GLN OE1  O  -2.050   5.908   7.461 1.00 . A A . 125 GLN OE1  1 1 
        3  4187 1 1  48 SER C    C  -0.569   7.213  -0.499 1.00 . A A . 126 SER C    1 1 
        3  4188 1 1  48 SER CA   C   0.176   6.684   0.725 1.00 . A A . 126 SER CA   1 1 
        3  4189 1 1  48 SER CB   C   1.251   5.688   0.289 1.00 . A A . 126 SER CB   1 1 
        3  4190 1 1  48 SER H    H  -0.809   5.076   1.690 1.00 . A A . 126 SER H    1 1 
        3  4191 1 1  48 SER HA   H   0.649   7.511   1.229 1.00 . A A . 126 SER HA   1 1 
        3  4192 1 1  48 SER HB2  H   1.773   6.079  -0.572 1.00 . A A . 126 SER HB2  1 1 
        3  4193 1 1  48 SER HB3  H   1.951   5.540   1.098 1.00 . A A . 126 SER HB3  1 1 
        3  4194 1 1  48 SER HG   H  -0.020   4.571  -0.699 1.00 . A A . 126 SER HG   1 1 
        3  4195 1 1  48 SER N    N  -0.743   6.054   1.667 1.00 . A A . 126 SER N    1 1 
        3  4196 1 1  48 SER O    O  -0.107   8.139  -1.167 1.00 . A A . 126 SER O    1 1 
        3  4197 1 1  48 SER OG   O   0.680   4.438  -0.055 1.00 . A A . 126 SER OG   1 1 
        3  4198 1 1  49 GLU C    C  -3.344   8.236  -1.649 1.00 . A A . 127 GLU C    1 1 
        3  4199 1 1  49 GLU CA   C  -2.511   7.002  -1.951 1.00 . A A . 127 GLU CA   1 1 
        3  4200 1 1  49 GLU CB   C  -3.433   5.857  -2.380 1.00 . A A . 127 GLU CB   1 1 
        3  4201 1 1  49 GLU CD   C  -3.574   5.703  -4.897 1.00 . A A . 127 GLU CD   1 1 
        3  4202 1 1  49 GLU CG   C  -2.963   5.134  -3.631 1.00 . A A . 127 GLU CG   1 1 
        3  4203 1 1  49 GLU H    H  -2.015   5.865  -0.232 1.00 . A A . 127 GLU H    1 1 
        3  4204 1 1  49 GLU HA   H  -1.834   7.228  -2.761 1.00 . A A . 127 GLU HA   1 1 
        3  4205 1 1  49 GLU HB2  H  -3.493   5.139  -1.576 1.00 . A A . 127 GLU HB2  1 1 
        3  4206 1 1  49 GLU HB3  H  -4.422   6.255  -2.569 1.00 . A A . 127 GLU HB3  1 1 
        3  4207 1 1  49 GLU HG2  H  -1.888   5.220  -3.699 1.00 . A A . 127 GLU HG2  1 1 
        3  4208 1 1  49 GLU HG3  H  -3.236   4.092  -3.553 1.00 . A A . 127 GLU HG3  1 1 
        3  4209 1 1  49 GLU N    N  -1.714   6.606  -0.797 1.00 . A A . 127 GLU N    1 1 
        3  4210 1 1  49 GLU O    O  -3.533   9.098  -2.507 1.00 . A A . 127 GLU O    1 1 
        3  4211 1 1  49 GLU OE1  O  -3.937   6.898  -4.896 1.00 . A A . 127 GLU OE1  1 1 
        3  4212 1 1  49 GLU OE2  O  -3.688   4.953  -5.889 1.00 . A A . 127 GLU OE2  1 1 
        3  4213 1 1  50 LEU C    C  -4.103  10.232   1.092 1.00 . A A . 128 LEU C    1 1 
        3  4214 1 1  50 LEU CA   C  -4.724   9.401  -0.031 1.00 . A A . 128 LEU CA   1 1 
        3  4215 1 1  50 LEU CB   C  -6.062   8.832   0.419 1.00 . A A . 128 LEU CB   1 1 
        3  4216 1 1  50 LEU CD1  C  -6.706   6.446   0.002 1.00 . A A . 128 LEU CD1  1 1 
        3  4217 1 1  50 LEU CD2  C  -8.105   8.283  -0.936 1.00 . A A . 128 LEU CD2  1 1 
        3  4218 1 1  50 LEU CG   C  -6.696   7.851  -0.571 1.00 . A A . 128 LEU CG   1 1 
        3  4219 1 1  50 LEU H    H  -3.717   7.566   0.198 1.00 . A A . 128 LEU H    1 1 
        3  4220 1 1  50 LEU HA   H  -4.885  10.034  -0.889 1.00 . A A . 128 LEU HA   1 1 
        3  4221 1 1  50 LEU HB2  H  -5.901   8.313   1.354 1.00 . A A . 128 LEU HB2  1 1 
        3  4222 1 1  50 LEU HB3  H  -6.748   9.648   0.584 1.00 . A A . 128 LEU HB3  1 1 
        3  4223 1 1  50 LEU HD11 H  -6.877   6.495   1.066 1.00 . A A . 128 LEU HD11 1 1 
        3  4224 1 1  50 LEU HD12 H  -5.754   5.973  -0.189 1.00 . A A . 128 LEU HD12 1 1 
        3  4225 1 1  50 LEU HD13 H  -7.493   5.873  -0.465 1.00 . A A . 128 LEU HD13 1 1 
        3  4226 1 1  50 LEU HD21 H  -8.812   7.793  -0.283 1.00 . A A . 128 LEU HD21 1 1 
        3  4227 1 1  50 LEU HD22 H  -8.308   8.007  -1.960 1.00 . A A . 128 LEU HD22 1 1 
        3  4228 1 1  50 LEU HD23 H  -8.193   9.354  -0.827 1.00 . A A . 128 LEU HD23 1 1 
        3  4229 1 1  50 LEU HG   H  -6.107   7.833  -1.475 1.00 . A A . 128 LEU HG   1 1 
        3  4230 1 1  50 LEU N    N  -3.873   8.297  -0.437 1.00 . A A . 128 LEU N    1 1 
        3  4231 1 1  50 LEU O    O  -4.705  11.202   1.554 1.00 . A A . 128 LEU O    1 1 
        3  4232 1 1  51 GLY C    C  -3.045  10.579   3.878 1.00 . A A . 129 GLY C    1 1 
        3  4233 1 1  51 GLY CA   C  -2.249  10.593   2.591 1.00 . A A . 129 GLY CA   1 1 
        3  4234 1 1  51 GLY H    H  -2.463   9.082   1.132 1.00 . A A . 129 GLY H    1 1 
        3  4235 1 1  51 GLY HA2  H  -1.279  10.156   2.774 1.00 . A A . 129 GLY HA2  1 1 
        3  4236 1 1  51 GLY HA3  H  -2.116  11.617   2.275 1.00 . A A . 129 GLY HA3  1 1 
        3  4237 1 1  51 GLY N    N  -2.905   9.858   1.529 1.00 . A A . 129 GLY N    1 1 
        3  4238 1 1  51 GLY O    O  -3.691   9.584   4.208 1.00 . A A . 129 GLY O    1 1 
        3  4239 1 1  52 ASP C    C  -5.134  11.277   5.768 1.00 . A A . 130 ASP C    1 1 
        3  4240 1 1  52 ASP CA   C  -3.708  11.818   5.875 1.00 . A A . 130 ASP CA   1 1 
        3  4241 1 1  52 ASP CB   C  -3.738  13.283   6.317 1.00 . A A . 130 ASP CB   1 1 
        3  4242 1 1  52 ASP CG   C  -2.729  13.576   7.410 1.00 . A A . 130 ASP CG   1 1 
        3  4243 1 1  52 ASP H    H  -2.453  12.437   4.283 1.00 . A A . 130 ASP H    1 1 
        3  4244 1 1  52 ASP HA   H  -3.174  11.241   6.614 1.00 . A A . 130 ASP HA   1 1 
        3  4245 1 1  52 ASP HB2  H  -3.514  13.913   5.469 1.00 . A A . 130 ASP HB2  1 1 
        3  4246 1 1  52 ASP HB3  H  -4.724  13.522   6.688 1.00 . A A . 130 ASP HB3  1 1 
        3  4247 1 1  52 ASP N    N  -2.993  11.688   4.606 1.00 . A A . 130 ASP N    1 1 
        3  4248 1 1  52 ASP O    O  -5.763  11.360   4.714 1.00 . A A . 130 ASP O    1 1 
        3  4249 1 1  52 ASP OD1  O  -1.517  13.599   7.110 1.00 . A A . 130 ASP OD1  1 1 
        3  4250 1 1  52 ASP OD2  O  -3.152  13.782   8.568 1.00 . A A . 130 ASP OD2  1 1 
        3  4251 1 1  53 TYR C    C  -8.019  11.217   6.525 1.00 . A A . 131 TYR C    1 1 
        3  4252 1 1  53 TYR CA   C  -6.981  10.165   6.903 1.00 . A A . 131 TYR CA   1 1 
        3  4253 1 1  53 TYR CB   C  -7.287   9.608   8.295 1.00 . A A . 131 TYR CB   1 1 
        3  4254 1 1  53 TYR CD1  C  -8.981   7.871   7.598 1.00 . A A . 131 TYR CD1  1 1 
        3  4255 1 1  53 TYR CD2  C  -9.592   9.417   9.306 1.00 . A A . 131 TYR CD2  1 1 
        3  4256 1 1  53 TYR CE1  C -10.222   7.270   7.693 1.00 . A A . 131 TYR CE1  1 1 
        3  4257 1 1  53 TYR CE2  C -10.835   8.821   9.407 1.00 . A A . 131 TYR CE2  1 1 
        3  4258 1 1  53 TYR CG   C  -8.646   8.953   8.401 1.00 . A A . 131 TYR CG   1 1 
        3  4259 1 1  53 TYR CZ   C -11.145   7.748   8.599 1.00 . A A . 131 TYR CZ   1 1 
        3  4260 1 1  53 TYR H    H  -5.080  10.686   7.677 1.00 . A A . 131 TYR H    1 1 
        3  4261 1 1  53 TYR HA   H  -7.024   9.360   6.186 1.00 . A A . 131 TYR HA   1 1 
        3  4262 1 1  53 TYR HB2  H  -6.542   8.869   8.551 1.00 . A A . 131 TYR HB2  1 1 
        3  4263 1 1  53 TYR HB3  H  -7.249  10.414   9.013 1.00 . A A . 131 TYR HB3  1 1 
        3  4264 1 1  53 TYR HD1  H  -8.256   7.498   6.890 1.00 . A A . 131 TYR HD1  1 1 
        3  4265 1 1  53 TYR HD2  H  -9.347  10.258   9.938 1.00 . A A . 131 TYR HD2  1 1 
        3  4266 1 1  53 TYR HE1  H -10.464   6.429   7.059 1.00 . A A . 131 TYR HE1  1 1 
        3  4267 1 1  53 TYR HE2  H -11.557   9.196  10.117 1.00 . A A . 131 TYR HE2  1 1 
        3  4268 1 1  53 TYR HH   H -12.712   6.955   7.817 1.00 . A A . 131 TYR HH   1 1 
        3  4269 1 1  53 TYR N    N  -5.633  10.723   6.869 1.00 . A A . 131 TYR N    1 1 
        3  4270 1 1  53 TYR O    O  -7.813  12.412   6.735 1.00 . A A . 131 TYR O    1 1 
        3  4271 1 1  53 TYR OH   O -12.381   7.152   8.696 1.00 . A A . 131 TYR OH   1 1 
        3  4272 1 1  54 ASP C    C -11.569  11.117   5.995 1.00 . A A . 132 ASP C    1 1 
        3  4273 1 1  54 ASP CA   C -10.210  11.661   5.559 1.00 . A A . 132 ASP CA   1 1 
        3  4274 1 1  54 ASP CB   C -10.189  11.855   4.042 1.00 . A A . 132 ASP CB   1 1 
        3  4275 1 1  54 ASP CG   C  -9.342  13.041   3.622 1.00 . A A . 132 ASP CG   1 1 
        3  4276 1 1  54 ASP H    H  -9.242   9.798   5.827 1.00 . A A . 132 ASP H    1 1 
        3  4277 1 1  54 ASP HA   H -10.045  12.614   6.038 1.00 . A A . 132 ASP HA   1 1 
        3  4278 1 1  54 ASP HB2  H  -9.787  10.967   3.577 1.00 . A A . 132 ASP HB2  1 1 
        3  4279 1 1  54 ASP HB3  H -11.198  12.014   3.692 1.00 . A A . 132 ASP HB3  1 1 
        3  4280 1 1  54 ASP N    N  -9.137  10.762   5.967 1.00 . A A . 132 ASP N    1 1 
        3  4281 1 1  54 ASP O    O -12.209  10.364   5.261 1.00 . A A . 132 ASP O    1 1 
        3  4282 1 1  54 ASP OD1  O  -9.418  14.092   4.293 1.00 . A A . 132 ASP OD1  1 1 
        3  4283 1 1  54 ASP OD2  O  -8.604  12.918   2.622 1.00 . A A . 132 ASP OD2  1 1 
        3  4284 1 1  55 PRO C    C -14.496  11.543   6.912 1.00 . A A . 133 PRO C    1 1 
        3  4285 1 1  55 PRO CA   C -13.317  11.034   7.736 1.00 . A A . 133 PRO CA   1 1 
        3  4286 1 1  55 PRO CB   C -13.362  11.624   9.153 1.00 . A A . 133 PRO CB   1 1 
        3  4287 1 1  55 PRO CD   C -11.331  12.379   8.145 1.00 . A A . 133 PRO CD   1 1 
        3  4288 1 1  55 PRO CG   C -11.957  12.023   9.461 1.00 . A A . 133 PRO CG   1 1 
        3  4289 1 1  55 PRO HA   H -13.359   9.956   7.791 1.00 . A A . 133 PRO HA   1 1 
        3  4290 1 1  55 PRO HB2  H -14.025  12.476   9.170 1.00 . A A . 133 PRO HB2  1 1 
        3  4291 1 1  55 PRO HB3  H -13.717  10.874   9.844 1.00 . A A . 133 PRO HB3  1 1 
        3  4292 1 1  55 PRO HD2  H -11.514  13.416   7.906 1.00 . A A . 133 PRO HD2  1 1 
        3  4293 1 1  55 PRO HD3  H -10.272  12.171   8.160 1.00 . A A . 133 PRO HD3  1 1 
        3  4294 1 1  55 PRO HG2  H -11.955  12.879  10.120 1.00 . A A . 133 PRO HG2  1 1 
        3  4295 1 1  55 PRO HG3  H -11.432  11.196   9.915 1.00 . A A . 133 PRO HG3  1 1 
        3  4296 1 1  55 PRO N    N -12.028  11.490   7.203 1.00 . A A . 133 PRO N    1 1 
        3  4297 1 1  55 PRO O    O -15.207  10.761   6.280 1.00 . A A . 133 PRO O    1 1 
        3  4298 1 1  56 GLU C    C -15.379  13.767   4.743 1.00 . A A . 134 GLU C    1 1 
        3  4299 1 1  56 GLU CA   C -15.793  13.469   6.181 1.00 . A A . 134 GLU CA   1 1 
        3  4300 1 1  56 GLU CB   C -16.246  14.758   6.869 1.00 . A A . 134 GLU CB   1 1 
        3  4301 1 1  56 GLU CD   C -15.465  17.155   7.010 1.00 . A A . 134 GLU CD   1 1 
        3  4302 1 1  56 GLU CG   C -15.104  15.697   7.217 1.00 . A A . 134 GLU CG   1 1 
        3  4303 1 1  56 GLU H    H -14.098  13.428   7.448 1.00 . A A . 134 GLU H    1 1 
        3  4304 1 1  56 GLU HA   H -16.616  12.771   6.168 1.00 . A A . 134 GLU HA   1 1 
        3  4305 1 1  56 GLU HB2  H -16.927  15.281   6.214 1.00 . A A . 134 GLU HB2  1 1 
        3  4306 1 1  56 GLU HB3  H -16.764  14.502   7.781 1.00 . A A . 134 GLU HB3  1 1 
        3  4307 1 1  56 GLU HG2  H -14.837  15.552   8.253 1.00 . A A . 134 GLU HG2  1 1 
        3  4308 1 1  56 GLU HG3  H -14.255  15.459   6.591 1.00 . A A . 134 GLU HG3  1 1 
        3  4309 1 1  56 GLU N    N -14.698  12.857   6.925 1.00 . A A . 134 GLU N    1 1 
        3  4310 1 1  56 GLU O    O -16.208  13.753   3.833 1.00 . A A . 134 GLU O    1 1 
        3  4311 1 1  56 GLU OE1  O -16.148  17.462   6.010 1.00 . A A . 134 GLU OE1  1 1 
        3  4312 1 1  56 GLU OE2  O -15.065  17.991   7.848 1.00 . A A . 134 GLU OE2  1 1 
        3  4313 1 1  57 LEU C    C -13.867  13.203   2.242 1.00 . A A . 135 LEU C    1 1 
        3  4314 1 1  57 LEU CA   C -13.570  14.339   3.216 1.00 . A A . 135 LEU CA   1 1 
        3  4315 1 1  57 LEU CB   C -12.063  14.589   3.284 1.00 . A A . 135 LEU CB   1 1 
        3  4316 1 1  57 LEU CD1  C -12.233  17.003   2.629 1.00 . A A . 135 LEU CD1  1 1 
        3  4317 1 1  57 LEU CD2  C -12.119  16.370   5.046 1.00 . A A . 135 LEU CD2  1 1 
        3  4318 1 1  57 LEU CG   C -11.659  16.021   3.639 1.00 . A A . 135 LEU CG   1 1 
        3  4319 1 1  57 LEU H    H -13.480  14.034   5.309 1.00 . A A . 135 LEU H    1 1 
        3  4320 1 1  57 LEU HA   H -14.059  15.235   2.864 1.00 . A A . 135 LEU HA   1 1 
        3  4321 1 1  57 LEU HB2  H -11.642  13.925   4.025 1.00 . A A . 135 LEU HB2  1 1 
        3  4322 1 1  57 LEU HB3  H -11.635  14.346   2.323 1.00 . A A . 135 LEU HB3  1 1 
        3  4323 1 1  57 LEU HD11 H -12.026  16.654   1.629 1.00 . A A . 135 LEU HD11 1 1 
        3  4324 1 1  57 LEU HD12 H -11.779  17.973   2.773 1.00 . A A . 135 LEU HD12 1 1 
        3  4325 1 1  57 LEU HD13 H -13.301  17.082   2.770 1.00 . A A . 135 LEU HD13 1 1 
        3  4326 1 1  57 LEU HD21 H -11.831  17.385   5.278 1.00 . A A . 135 LEU HD21 1 1 
        3  4327 1 1  57 LEU HD22 H -11.660  15.695   5.753 1.00 . A A . 135 LEU HD22 1 1 
        3  4328 1 1  57 LEU HD23 H -13.194  16.278   5.107 1.00 . A A . 135 LEU HD23 1 1 
        3  4329 1 1  57 LEU HG   H -10.582  16.103   3.608 1.00 . A A . 135 LEU HG   1 1 
        3  4330 1 1  57 LEU N    N -14.093  14.037   4.545 1.00 . A A . 135 LEU N    1 1 
        3  4331 1 1  57 LEU O    O -14.053  13.429   1.046 1.00 . A A . 135 LEU O    1 1 
        3  4332 1 1  58 HIS C    C -15.459  10.109   2.410 1.00 . A A . 136 HIS C    1 1 
        3  4333 1 1  58 HIS CA   C -14.189  10.809   1.942 1.00 . A A . 136 HIS CA   1 1 
        3  4334 1 1  58 HIS CB   C -13.008   9.838   1.986 1.00 . A A . 136 HIS CB   1 1 
        3  4335 1 1  58 HIS CD2  C -11.068  11.220   0.959 1.00 . A A . 136 HIS CD2  1 1 
        3  4336 1 1  58 HIS CE1  C -10.622   9.924  -0.752 1.00 . A A . 136 HIS CE1  1 1 
        3  4337 1 1  58 HIS CG   C -11.923  10.171   1.010 1.00 . A A . 136 HIS CG   1 1 
        3  4338 1 1  58 HIS H    H -13.757  11.866   3.724 1.00 . A A . 136 HIS H    1 1 
        3  4339 1 1  58 HIS HA   H -14.332  11.142   0.927 1.00 . A A . 136 HIS HA   1 1 
        3  4340 1 1  58 HIS HB2  H -12.578   9.848   2.976 1.00 . A A . 136 HIS HB2  1 1 
        3  4341 1 1  58 HIS HB3  H -13.362   8.841   1.763 1.00 . A A . 136 HIS HB3  1 1 
        3  4342 1 1  58 HIS HD1  H -12.064   8.539  -0.317 1.00 . A A . 136 HIS HD1  1 1 
        3  4343 1 1  58 HIS HD2  H -11.022  12.043   1.658 1.00 . A A . 136 HIS HD2  1 1 
        3  4344 1 1  58 HIS HE1  H -10.172   9.524  -1.649 1.00 . A A . 136 HIS HE1  1 1 
        3  4345 1 1  58 HIS HE2  H  -9.498  11.596  -0.383 1.00 . A A . 136 HIS HE2  1 1 
        3  4346 1 1  58 HIS N    N -13.912  11.982   2.763 1.00 . A A . 136 HIS N    1 1 
        3  4347 1 1  58 HIS ND1  N -11.617   9.378  -0.077 1.00 . A A . 136 HIS ND1  1 1 
        3  4348 1 1  58 HIS NE2  N -10.271  11.042  -0.144 1.00 . A A . 136 HIS NE2  1 1 
        3  4349 1 1  58 HIS O    O -16.518  10.243   1.796 1.00 . A A . 136 HIS O    1 1 
        3  4350 1 1  59 GLY C    C -16.099   7.348   4.705 1.00 . A A . 137 GLY C    1 1 
        3  4351 1 1  59 GLY CA   C -16.489   8.652   4.039 1.00 . A A . 137 GLY CA   1 1 
        3  4352 1 1  59 GLY H    H -14.476   9.296   3.947 1.00 . A A . 137 GLY H    1 1 
        3  4353 1 1  59 GLY HA2  H -16.981   9.281   4.766 1.00 . A A . 137 GLY HA2  1 1 
        3  4354 1 1  59 GLY HA3  H -17.178   8.441   3.235 1.00 . A A . 137 GLY HA3  1 1 
        3  4355 1 1  59 GLY N    N -15.345   9.363   3.502 1.00 . A A . 137 GLY N    1 1 
        3  4356 1 1  59 GLY O    O -15.149   7.300   5.486 1.00 . A A . 137 GLY O    1 1 
        3  4357 1 1  60 VAL C    C -16.314   3.934   3.881 1.00 . A A . 138 VAL C    1 1 
        3  4358 1 1  60 VAL CA   C -16.566   4.974   4.969 1.00 . A A . 138 VAL CA   1 1 
        3  4359 1 1  60 VAL CB   C -17.731   4.498   5.856 1.00 . A A . 138 VAL CB   1 1 
        3  4360 1 1  60 VAL CG1  C -17.752   5.267   7.168 1.00 . A A . 138 VAL CG1  1 1 
        3  4361 1 1  60 VAL CG2  C -19.055   4.644   5.123 1.00 . A A . 138 VAL CG2  1 1 
        3  4362 1 1  60 VAL H    H -17.580   6.392   3.767 1.00 . A A . 138 VAL H    1 1 
        3  4363 1 1  60 VAL HA   H -15.682   5.055   5.585 1.00 . A A . 138 VAL HA   1 1 
        3  4364 1 1  60 VAL HB   H -17.582   3.452   6.081 1.00 . A A . 138 VAL HB   1 1 
        3  4365 1 1  60 VAL HG11 H -16.747   5.567   7.426 1.00 . A A . 138 VAL HG11 1 1 
        3  4366 1 1  60 VAL HG12 H -18.151   4.637   7.949 1.00 . A A . 138 VAL HG12 1 1 
        3  4367 1 1  60 VAL HG13 H -18.373   6.144   7.061 1.00 . A A . 138 VAL HG13 1 1 
        3  4368 1 1  60 VAL HG21 H -19.151   5.653   4.749 1.00 . A A . 138 VAL HG21 1 1 
        3  4369 1 1  60 VAL HG22 H -19.868   4.433   5.802 1.00 . A A . 138 VAL HG22 1 1 
        3  4370 1 1  60 VAL HG23 H -19.087   3.950   4.296 1.00 . A A . 138 VAL HG23 1 1 
        3  4371 1 1  60 VAL N    N -16.836   6.287   4.395 1.00 . A A . 138 VAL N    1 1 
        3  4372 1 1  60 VAL O    O -15.519   3.012   4.064 1.00 . A A . 138 VAL O    1 1 
        3  4373 1 1  61 ASP C    C -15.853   3.683   0.608 1.00 . A A . 139 ASP C    1 1 
        3  4374 1 1  61 ASP CA   C -16.848   3.153   1.637 1.00 . A A . 139 ASP CA   1 1 
        3  4375 1 1  61 ASP CB   C -18.202   2.901   0.972 1.00 . A A . 139 ASP CB   1 1 
        3  4376 1 1  61 ASP CG   C -18.395   1.448   0.584 1.00 . A A . 139 ASP CG   1 1 
        3  4377 1 1  61 ASP H    H -17.619   4.836   2.662 1.00 . A A . 139 ASP H    1 1 
        3  4378 1 1  61 ASP HA   H -16.474   2.222   2.034 1.00 . A A . 139 ASP HA   1 1 
        3  4379 1 1  61 ASP HB2  H -18.990   3.179   1.656 1.00 . A A . 139 ASP HB2  1 1 
        3  4380 1 1  61 ASP HB3  H -18.277   3.506   0.080 1.00 . A A . 139 ASP HB3  1 1 
        3  4381 1 1  61 ASP N    N -16.998   4.084   2.750 1.00 . A A . 139 ASP N    1 1 
        3  4382 1 1  61 ASP O    O -15.995   3.436  -0.590 1.00 . A A . 139 ASP O    1 1 
        3  4383 1 1  61 ASP OD1  O -17.837   0.571   1.276 1.00 . A A . 139 ASP OD1  1 1 
        3  4384 1 1  61 ASP OD2  O -19.104   1.188  -0.410 1.00 . A A . 139 ASP OD2  1 1 
        3  4385 1 1  62 TYR C    C -12.838   3.893  -0.238 1.00 . A A . 140 TYR C    1 1 
        3  4386 1 1  62 TYR CA   C -13.828   4.969   0.198 1.00 . A A . 140 TYR CA   1 1 
        3  4387 1 1  62 TYR CB   C -13.086   6.111   0.895 1.00 . A A . 140 TYR CB   1 1 
        3  4388 1 1  62 TYR CD1  C -11.157   5.192   2.238 1.00 . A A . 140 TYR CD1  1 1 
        3  4389 1 1  62 TYR CD2  C -13.129   5.847   3.406 1.00 . A A . 140 TYR CD2  1 1 
        3  4390 1 1  62 TYR CE1  C -10.568   4.823   3.432 1.00 . A A . 140 TYR CE1  1 1 
        3  4391 1 1  62 TYR CE2  C -12.546   5.481   4.604 1.00 . A A . 140 TYR CE2  1 1 
        3  4392 1 1  62 TYR CG   C -12.445   5.709   2.204 1.00 . A A . 140 TYR CG   1 1 
        3  4393 1 1  62 TYR CZ   C -11.266   4.970   4.612 1.00 . A A . 140 TYR CZ   1 1 
        3  4394 1 1  62 TYR H    H -14.783   4.572   2.045 1.00 . A A . 140 TYR H    1 1 
        3  4395 1 1  62 TYR HA   H -14.327   5.357  -0.677 1.00 . A A . 140 TYR HA   1 1 
        3  4396 1 1  62 TYR HB2  H -12.306   6.475   0.244 1.00 . A A . 140 TYR HB2  1 1 
        3  4397 1 1  62 TYR HB3  H -13.782   6.912   1.098 1.00 . A A . 140 TYR HB3  1 1 
        3  4398 1 1  62 TYR HD1  H -10.612   5.079   1.313 1.00 . A A . 140 TYR HD1  1 1 
        3  4399 1 1  62 TYR HD2  H -14.132   6.248   3.397 1.00 . A A . 140 TYR HD2  1 1 
        3  4400 1 1  62 TYR HE1  H  -9.565   4.423   3.438 1.00 . A A . 140 TYR HE1  1 1 
        3  4401 1 1  62 TYR HE2  H -13.093   5.596   5.528 1.00 . A A . 140 TYR HE2  1 1 
        3  4402 1 1  62 TYR HH   H  -9.779   4.927   5.830 1.00 . A A . 140 TYR HH   1 1 
        3  4403 1 1  62 TYR N    N -14.845   4.410   1.081 1.00 . A A . 140 TYR N    1 1 
        3  4404 1 1  62 TYR O    O -12.336   3.915  -1.361 1.00 . A A . 140 TYR O    1 1 
        3  4405 1 1  62 TYR OH   O -10.682   4.603   5.803 1.00 . A A . 140 TYR OH   1 1 
        3  4406 1 1  63 VAL C    C -12.175   0.973  -0.758 1.00 . A A . 141 VAL C    1 1 
        3  4407 1 1  63 VAL CA   C -11.643   1.859   0.366 1.00 . A A . 141 VAL CA   1 1 
        3  4408 1 1  63 VAL CB   C -11.388   0.990   1.612 1.00 . A A . 141 VAL CB   1 1 
        3  4409 1 1  63 VAL CG1  C -10.293  -0.029   1.339 1.00 . A A . 141 VAL CG1  1 1 
        3  4410 1 1  63 VAL CG2  C -11.029   1.862   2.806 1.00 . A A . 141 VAL CG2  1 1 
        3  4411 1 1  63 VAL H    H -13.003   2.983   1.535 1.00 . A A . 141 VAL H    1 1 
        3  4412 1 1  63 VAL HA   H -10.703   2.292   0.056 1.00 . A A . 141 VAL HA   1 1 
        3  4413 1 1  63 VAL HB   H -12.297   0.455   1.845 1.00 . A A . 141 VAL HB   1 1 
        3  4414 1 1  63 VAL HG11 H -10.550  -0.606   0.463 1.00 . A A . 141 VAL HG11 1 1 
        3  4415 1 1  63 VAL HG12 H -10.195  -0.688   2.189 1.00 . A A . 141 VAL HG12 1 1 
        3  4416 1 1  63 VAL HG13 H  -9.358   0.484   1.171 1.00 . A A . 141 VAL HG13 1 1 
        3  4417 1 1  63 VAL HG21 H -10.218   2.522   2.538 1.00 . A A . 141 VAL HG21 1 1 
        3  4418 1 1  63 VAL HG22 H -10.725   1.235   3.631 1.00 . A A . 141 VAL HG22 1 1 
        3  4419 1 1  63 VAL HG23 H -11.889   2.447   3.096 1.00 . A A . 141 VAL HG23 1 1 
        3  4420 1 1  63 VAL N    N -12.568   2.948   0.658 1.00 . A A . 141 VAL N    1 1 
        3  4421 1 1  63 VAL O    O -11.412   0.272  -1.424 1.00 . A A . 141 VAL O    1 1 
        3  4422 1 1  64 SER C    C -13.656   0.626  -3.401 1.00 . A A . 142 SER C    1 1 
        3  4423 1 1  64 SER CA   C -14.135   0.223  -2.006 1.00 . A A . 142 SER CA   1 1 
        3  4424 1 1  64 SER CB   C -15.654   0.376  -1.915 1.00 . A A . 142 SER CB   1 1 
        3  4425 1 1  64 SER H    H -14.045   1.592  -0.404 1.00 . A A . 142 SER H    1 1 
        3  4426 1 1  64 SER HA   H -13.880  -0.812  -1.839 1.00 . A A . 142 SER HA   1 1 
        3  4427 1 1  64 SER HB2  H -15.972   0.196  -0.899 1.00 . A A . 142 SER HB2  1 1 
        3  4428 1 1  64 SER HB3  H -15.931   1.379  -2.206 1.00 . A A . 142 SER HB3  1 1 
        3  4429 1 1  64 SER HG   H -16.990  -1.011  -2.274 1.00 . A A . 142 SER HG   1 1 
        3  4430 1 1  64 SER N    N -13.488   1.014  -0.965 1.00 . A A . 142 SER N    1 1 
        3  4431 1 1  64 SER O    O -13.884  -0.094  -4.372 1.00 . A A . 142 SER O    1 1 
        3  4432 1 1  64 SER OG   O -16.312  -0.544  -2.768 1.00 . A A . 142 SER OG   1 1 
        3  4433 1 1  65 ASP C    C -11.095   1.688  -5.060 1.00 . A A . 143 ASP C    1 1 
        3  4434 1 1  65 ASP CA   C -12.484   2.255  -4.777 1.00 . A A . 143 ASP CA   1 1 
        3  4435 1 1  65 ASP CB   C -12.435   3.784  -4.788 1.00 . A A . 143 ASP CB   1 1 
        3  4436 1 1  65 ASP CG   C -12.756   4.363  -6.152 1.00 . A A . 143 ASP CG   1 1 
        3  4437 1 1  65 ASP H    H -12.819   2.301  -2.690 1.00 . A A . 143 ASP H    1 1 
        3  4438 1 1  65 ASP HA   H -13.160   1.920  -5.548 1.00 . A A . 143 ASP HA   1 1 
        3  4439 1 1  65 ASP HB2  H -13.153   4.166  -4.078 1.00 . A A . 143 ASP HB2  1 1 
        3  4440 1 1  65 ASP HB3  H -11.445   4.109  -4.503 1.00 . A A . 143 ASP HB3  1 1 
        3  4441 1 1  65 ASP N    N -12.990   1.775  -3.497 1.00 . A A . 143 ASP N    1 1 
        3  4442 1 1  65 ASP O    O -10.703   1.529  -6.217 1.00 . A A . 143 ASP O    1 1 
        3  4443 1 1  65 ASP OD1  O -11.897   4.270  -7.053 1.00 . A A . 143 ASP OD1  1 1 
        3  4444 1 1  65 ASP OD2  O -13.867   4.910  -6.318 1.00 . A A . 143 ASP OD2  1 1 
        3  4445 1 1  66 PHE C    C  -9.025  -0.685  -4.013 1.00 . A A . 144 PHE C    1 1 
        3  4446 1 1  66 PHE CA   C  -9.009   0.836  -4.134 1.00 . A A . 144 PHE CA   1 1 
        3  4447 1 1  66 PHE CB   C  -8.082   1.433  -3.074 1.00 . A A . 144 PHE CB   1 1 
        3  4448 1 1  66 PHE CD1  C  -8.851   3.750  -2.495 1.00 . A A . 144 PHE CD1  1 1 
        3  4449 1 1  66 PHE CD2  C  -6.939   3.508  -3.901 1.00 . A A . 144 PHE CD2  1 1 
        3  4450 1 1  66 PHE CE1  C  -8.735   5.125  -2.569 1.00 . A A . 144 PHE CE1  1 1 
        3  4451 1 1  66 PHE CE2  C  -6.819   4.883  -3.979 1.00 . A A . 144 PHE CE2  1 1 
        3  4452 1 1  66 PHE CG   C  -7.955   2.927  -3.158 1.00 . A A . 144 PHE CG   1 1 
        3  4453 1 1  66 PHE CZ   C  -7.718   5.692  -3.313 1.00 . A A . 144 PHE CZ   1 1 
        3  4454 1 1  66 PHE H    H -10.720   1.534  -3.101 1.00 . A A . 144 PHE H    1 1 
        3  4455 1 1  66 PHE HA   H  -8.640   1.103  -5.113 1.00 . A A . 144 PHE HA   1 1 
        3  4456 1 1  66 PHE HB2  H  -8.463   1.188  -2.094 1.00 . A A . 144 PHE HB2  1 1 
        3  4457 1 1  66 PHE HB3  H  -7.096   1.007  -3.188 1.00 . A A . 144 PHE HB3  1 1 
        3  4458 1 1  66 PHE HD1  H  -9.646   3.308  -1.913 1.00 . A A . 144 PHE HD1  1 1 
        3  4459 1 1  66 PHE HD2  H  -6.236   2.876  -4.422 1.00 . A A . 144 PHE HD2  1 1 
        3  4460 1 1  66 PHE HE1  H  -9.440   5.756  -2.048 1.00 . A A . 144 PHE HE1  1 1 
        3  4461 1 1  66 PHE HE2  H  -6.023   5.323  -4.561 1.00 . A A . 144 PHE HE2  1 1 
        3  4462 1 1  66 PHE HZ   H  -7.626   6.767  -3.373 1.00 . A A . 144 PHE HZ   1 1 
        3  4463 1 1  66 PHE N    N -10.354   1.385  -3.998 1.00 . A A . 144 PHE N    1 1 
        3  4464 1 1  66 PHE O    O  -9.481  -1.233  -3.010 1.00 . A A . 144 PHE O    1 1 
        3  4465 1 1  67 LYS C    C  -7.354  -3.339  -4.166 1.00 . A A . 145 LYS C    1 1 
        3  4466 1 1  67 LYS CA   C  -8.480  -2.818  -5.054 1.00 . A A . 145 LYS CA   1 1 
        3  4467 1 1  67 LYS CB   C  -8.297  -3.333  -6.482 1.00 . A A . 145 LYS CB   1 1 
        3  4468 1 1  67 LYS CD   C  -9.924  -3.722  -8.361 1.00 . A A . 145 LYS CD   1 1 
        3  4469 1 1  67 LYS CE   C  -9.952  -3.295  -9.820 1.00 . A A . 145 LYS CE   1 1 
        3  4470 1 1  67 LYS CG   C  -9.235  -2.685  -7.489 1.00 . A A . 145 LYS CG   1 1 
        3  4471 1 1  67 LYS H    H  -8.177  -0.866  -5.814 1.00 . A A . 145 LYS H    1 1 
        3  4472 1 1  67 LYS HA   H  -9.422  -3.181  -4.669 1.00 . A A . 145 LYS HA   1 1 
        3  4473 1 1  67 LYS HB2  H  -7.281  -3.140  -6.794 1.00 . A A . 145 LYS HB2  1 1 
        3  4474 1 1  67 LYS HB3  H  -8.471  -4.399  -6.493 1.00 . A A . 145 LYS HB3  1 1 
        3  4475 1 1  67 LYS HD2  H  -9.391  -4.658  -8.282 1.00 . A A . 145 LYS HD2  1 1 
        3  4476 1 1  67 LYS HD3  H -10.939  -3.853  -8.014 1.00 . A A . 145 LYS HD3  1 1 
        3  4477 1 1  67 LYS HE2  H -10.822  -2.675  -9.984 1.00 . A A . 145 LYS HE2  1 1 
        3  4478 1 1  67 LYS HE3  H  -9.060  -2.725 -10.032 1.00 . A A . 145 LYS HE3  1 1 
        3  4479 1 1  67 LYS HG2  H  -9.986  -2.123  -6.955 1.00 . A A . 145 LYS HG2  1 1 
        3  4480 1 1  67 LYS HG3  H  -8.664  -2.018  -8.119 1.00 . A A . 145 LYS HG3  1 1 
        3  4481 1 1  67 LYS HZ1  H  -9.155  -5.045 -10.636 1.00 . A A . 145 LYS HZ1  1 1 
        3  4482 1 1  67 LYS HZ2  H -10.079  -4.140 -11.726 1.00 . A A . 145 LYS HZ2  1 1 
        3  4483 1 1  67 LYS HZ3  H -10.844  -5.048 -10.522 1.00 . A A . 145 LYS HZ3  1 1 
        3  4484 1 1  67 LYS N    N  -8.524  -1.360  -5.043 1.00 . A A . 145 LYS N    1 1 
        3  4485 1 1  67 LYS NZ   N -10.012  -4.464 -10.740 1.00 . A A . 145 LYS NZ   1 1 
        3  4486 1 1  67 LYS O    O  -6.201  -3.416  -4.591 1.00 . A A . 145 LYS O    1 1 
        3  4487 1 1  68 LEU C    C  -6.506  -5.712  -2.163 1.00 . A A . 146 LEU C    1 1 
        3  4488 1 1  68 LEU CA   C  -6.711  -4.210  -1.985 1.00 . A A . 146 LEU CA   1 1 
        3  4489 1 1  68 LEU CB   C  -7.149  -3.915  -0.550 1.00 . A A . 146 LEU CB   1 1 
        3  4490 1 1  68 LEU CD1  C  -8.599  -2.452   0.877 1.00 . A A . 146 LEU CD1  1 1 
        3  4491 1 1  68 LEU CD2  C  -6.455  -1.554  -0.060 1.00 . A A . 146 LEU CD2  1 1 
        3  4492 1 1  68 LEU CG   C  -7.636  -2.487  -0.301 1.00 . A A . 146 LEU CG   1 1 
        3  4493 1 1  68 LEU H    H  -8.630  -3.610  -2.651 1.00 . A A . 146 LEU H    1 1 
        3  4494 1 1  68 LEU HA   H  -5.775  -3.707  -2.176 1.00 . A A . 146 LEU HA   1 1 
        3  4495 1 1  68 LEU HB2  H  -7.947  -4.596  -0.293 1.00 . A A . 146 LEU HB2  1 1 
        3  4496 1 1  68 LEU HB3  H  -6.312  -4.104   0.105 1.00 . A A . 146 LEU HB3  1 1 
        3  4497 1 1  68 LEU HD11 H  -9.611  -2.357   0.511 1.00 . A A . 146 LEU HD11 1 1 
        3  4498 1 1  68 LEU HD12 H  -8.366  -1.609   1.509 1.00 . A A . 146 LEU HD12 1 1 
        3  4499 1 1  68 LEU HD13 H  -8.507  -3.365   1.446 1.00 . A A . 146 LEU HD13 1 1 
        3  4500 1 1  68 LEU HD21 H  -6.521  -1.137   0.934 1.00 . A A . 146 LEU HD21 1 1 
        3  4501 1 1  68 LEU HD22 H  -6.475  -0.755  -0.787 1.00 . A A . 146 LEU HD22 1 1 
        3  4502 1 1  68 LEU HD23 H  -5.532  -2.106  -0.158 1.00 . A A . 146 LEU HD23 1 1 
        3  4503 1 1  68 LEU HG   H  -8.166  -2.137  -1.175 1.00 . A A . 146 LEU HG   1 1 
        3  4504 1 1  68 LEU N    N  -7.695  -3.696  -2.932 1.00 . A A . 146 LEU N    1 1 
        3  4505 1 1  68 LEU O    O  -5.471  -6.255  -1.778 1.00 . A A . 146 LEU O    1 1 
        3  4506 1 1  69 ALA C    C  -8.566  -8.305  -3.852 1.00 . A A . 147 ALA C    1 1 
        3  4507 1 1  69 ALA CA   C  -7.417  -7.819  -2.971 1.00 . A A . 147 ALA CA   1 1 
        3  4508 1 1  69 ALA CB   C  -7.418  -8.559  -1.641 1.00 . A A . 147 ALA CB   1 1 
        3  4509 1 1  69 ALA H    H  -8.299  -5.897  -3.034 1.00 . A A . 147 ALA H    1 1 
        3  4510 1 1  69 ALA HA   H  -6.482  -8.027  -3.470 1.00 . A A . 147 ALA HA   1 1 
        3  4511 1 1  69 ALA HB1  H  -7.238  -7.858  -0.839 1.00 . A A . 147 ALA HB1  1 1 
        3  4512 1 1  69 ALA HB2  H  -6.641  -9.309  -1.645 1.00 . A A . 147 ALA HB2  1 1 
        3  4513 1 1  69 ALA HB3  H  -8.377  -9.036  -1.493 1.00 . A A . 147 ALA HB3  1 1 
        3  4514 1 1  69 ALA N    N  -7.497  -6.381  -2.747 1.00 . A A . 147 ALA N    1 1 
        3  4515 1 1  69 ALA O    O  -9.547  -7.590  -4.057 1.00 . A A . 147 ALA O    1 1 
        3  4516 1 1  70 PRO C    C -10.776 -10.422  -4.479 1.00 . A A . 148 PRO C    1 1 
        3  4517 1 1  70 PRO CA   C  -9.495 -10.114  -5.246 1.00 . A A . 148 PRO CA   1 1 
        3  4518 1 1  70 PRO CB   C  -8.854 -11.406  -5.758 1.00 . A A . 148 PRO CB   1 1 
        3  4519 1 1  70 PRO CD   C  -7.324 -10.455  -4.189 1.00 . A A . 148 PRO CD   1 1 
        3  4520 1 1  70 PRO CG   C  -7.840 -11.760  -4.727 1.00 . A A . 148 PRO CG   1 1 
        3  4521 1 1  70 PRO HA   H  -9.724  -9.466  -6.080 1.00 . A A . 148 PRO HA   1 1 
        3  4522 1 1  70 PRO HB2  H  -9.609 -12.173  -5.851 1.00 . A A . 148 PRO HB2  1 1 
        3  4523 1 1  70 PRO HB3  H  -8.394 -11.228  -6.718 1.00 . A A . 148 PRO HB3  1 1 
        3  4524 1 1  70 PRO HD2  H  -7.079 -10.548  -3.142 1.00 . A A . 148 PRO HD2  1 1 
        3  4525 1 1  70 PRO HD3  H  -6.462 -10.128  -4.752 1.00 . A A . 148 PRO HD3  1 1 
        3  4526 1 1  70 PRO HG2  H  -8.303 -12.334  -3.938 1.00 . A A . 148 PRO HG2  1 1 
        3  4527 1 1  70 PRO HG3  H  -7.036 -12.323  -5.179 1.00 . A A . 148 PRO HG3  1 1 
        3  4528 1 1  70 PRO N    N  -8.459  -9.534  -4.385 1.00 . A A . 148 PRO N    1 1 
        3  4529 1 1  70 PRO O    O -11.880 -10.232  -4.992 1.00 . A A . 148 PRO O    1 1 
        3  4530 1 1  71 ASN C    C -11.820 -10.322  -1.182 1.00 . A A . 149 ASN C    1 1 
        3  4531 1 1  71 ASN CA   C -11.766 -11.230  -2.408 1.00 . A A . 149 ASN CA   1 1 
        3  4532 1 1  71 ASN CB   C -11.696 -12.698  -1.976 1.00 . A A . 149 ASN CB   1 1 
        3  4533 1 1  71 ASN CG   C -12.614 -13.585  -2.793 1.00 . A A . 149 ASN CG   1 1 
        3  4534 1 1  71 ASN H    H  -9.717 -11.025  -2.895 1.00 . A A . 149 ASN H    1 1 
        3  4535 1 1  71 ASN HA   H -12.661 -11.078  -2.992 1.00 . A A . 149 ASN HA   1 1 
        3  4536 1 1  71 ASN HB2  H -10.684 -13.054  -2.094 1.00 . A A . 149 ASN HB2  1 1 
        3  4537 1 1  71 ASN HB3  H -11.982 -12.777  -0.937 1.00 . A A . 149 ASN HB3  1 1 
        3  4538 1 1  71 ASN HD21 H -13.916 -13.663  -1.292 1.00 . A A . 149 ASN HD21 1 1 
        3  4539 1 1  71 ASN HD22 H -14.354 -14.545  -2.712 1.00 . A A . 149 ASN HD22 1 1 
        3  4540 1 1  71 ASN N    N -10.622 -10.897  -3.248 1.00 . A A . 149 ASN N    1 1 
        3  4541 1 1  71 ASN ND2  N -13.742 -13.970  -2.207 1.00 . A A . 149 ASN ND2  1 1 
        3  4542 1 1  71 ASN O    O -11.655 -10.777  -0.049 1.00 . A A . 149 ASN O    1 1 
        3  4543 1 1  71 ASN OD1  O -12.313 -13.922  -3.939 1.00 . A A . 149 ASN OD1  1 1 
        3  4544 1 1  72 GLN C    C -13.370  -8.290   0.518 1.00 . A A . 150 GLN C    1 1 
        3  4545 1 1  72 GLN CA   C -12.124  -8.063  -0.331 1.00 . A A . 150 GLN CA   1 1 
        3  4546 1 1  72 GLN CB   C -12.127  -6.639  -0.890 1.00 . A A . 150 GLN CB   1 1 
        3  4547 1 1  72 GLN CD   C -12.101  -4.164  -0.387 1.00 . A A . 150 GLN CD   1 1 
        3  4548 1 1  72 GLN CG   C -12.053  -5.567   0.185 1.00 . A A . 150 GLN CG   1 1 
        3  4549 1 1  72 GLN H    H -12.172  -8.730  -2.340 1.00 . A A . 150 GLN H    1 1 
        3  4550 1 1  72 GLN HA   H -11.251  -8.194   0.290 1.00 . A A . 150 GLN HA   1 1 
        3  4551 1 1  72 GLN HB2  H -11.278  -6.521  -1.546 1.00 . A A . 150 GLN HB2  1 1 
        3  4552 1 1  72 GLN HB3  H -13.034  -6.489  -1.456 1.00 . A A . 150 GLN HB3  1 1 
        3  4553 1 1  72 GLN HE21 H -11.555  -3.404   1.367 1.00 . A A . 150 GLN HE21 1 1 
        3  4554 1 1  72 GLN HE22 H -11.817  -2.258   0.101 1.00 . A A . 150 GLN HE22 1 1 
        3  4555 1 1  72 GLN HG2  H -12.887  -5.692   0.859 1.00 . A A . 150 GLN HG2  1 1 
        3  4556 1 1  72 GLN HG3  H -11.129  -5.686   0.731 1.00 . A A . 150 GLN HG3  1 1 
        3  4557 1 1  72 GLN N    N -12.050  -9.034  -1.416 1.00 . A A . 150 GLN N    1 1 
        3  4558 1 1  72 GLN NE2  N -11.793  -3.175   0.444 1.00 . A A . 150 GLN NE2  1 1 
        3  4559 1 1  72 GLN O    O -14.494  -8.222   0.021 1.00 . A A . 150 GLN O    1 1 
        3  4560 1 1  72 GLN OE1  O -12.411  -3.970  -1.562 1.00 . A A . 150 GLN OE1  1 1 
        3  4561 1 1  73 THR C    C -14.334  -7.716   3.788 1.00 . A A . 151 THR C    1 1 
        3  4562 1 1  73 THR CA   C -14.268  -8.802   2.722 1.00 . A A . 151 THR CA   1 1 
        3  4563 1 1  73 THR CB   C -14.121 -10.173   3.382 1.00 . A A . 151 THR CB   1 1 
        3  4564 1 1  73 THR CG2  C -12.817 -10.340   4.129 1.00 . A A . 151 THR CG2  1 1 
        3  4565 1 1  73 THR H    H -12.240  -8.604   2.136 1.00 . A A . 151 THR H    1 1 
        3  4566 1 1  73 THR HA   H -15.183  -8.784   2.150 1.00 . A A . 151 THR HA   1 1 
        3  4567 1 1  73 THR HB   H -14.165 -10.936   2.618 1.00 . A A . 151 THR HB   1 1 
        3  4568 1 1  73 THR HG1  H -16.018 -10.331   3.845 1.00 . A A . 151 THR HG1  1 1 
        3  4569 1 1  73 THR HG21 H -12.262  -9.414   4.095 1.00 . A A . 151 THR HG21 1 1 
        3  4570 1 1  73 THR HG22 H -12.236 -11.125   3.669 1.00 . A A . 151 THR HG22 1 1 
        3  4571 1 1  73 THR HG23 H -13.021 -10.599   5.157 1.00 . A A . 151 THR HG23 1 1 
        3  4572 1 1  73 THR N    N -13.161  -8.562   1.802 1.00 . A A . 151 THR N    1 1 
        3  4573 1 1  73 THR O    O -13.360  -6.998   4.017 1.00 . A A . 151 THR O    1 1 
        3  4574 1 1  73 THR OG1  O -15.175 -10.402   4.300 1.00 . A A . 151 THR OG1  1 1 
        3  4575 1 1  74 LYS C    C -14.508  -6.546   6.440 1.00 . A A . 152 LYS C    1 1 
        3  4576 1 1  74 LYS CA   C -15.694  -6.595   5.480 1.00 . A A . 152 LYS CA   1 1 
        3  4577 1 1  74 LYS CB   C -16.979  -6.892   6.256 1.00 . A A . 152 LYS CB   1 1 
        3  4578 1 1  74 LYS CD   C -19.441  -7.373   6.102 1.00 . A A . 152 LYS CD   1 1 
        3  4579 1 1  74 LYS CE   C -19.702  -8.772   5.568 1.00 . A A . 152 LYS CE   1 1 
        3  4580 1 1  74 LYS CG   C -18.242  -6.732   5.424 1.00 . A A . 152 LYS CG   1 1 
        3  4581 1 1  74 LYS H    H -16.232  -8.196   4.204 1.00 . A A . 152 LYS H    1 1 
        3  4582 1 1  74 LYS HA   H -15.790  -5.634   4.999 1.00 . A A . 152 LYS HA   1 1 
        3  4583 1 1  74 LYS HB2  H -16.941  -7.908   6.620 1.00 . A A . 152 LYS HB2  1 1 
        3  4584 1 1  74 LYS HB3  H -17.042  -6.219   7.098 1.00 . A A . 152 LYS HB3  1 1 
        3  4585 1 1  74 LYS HD2  H -19.253  -7.433   7.164 1.00 . A A . 152 LYS HD2  1 1 
        3  4586 1 1  74 LYS HD3  H -20.313  -6.760   5.924 1.00 . A A . 152 LYS HD3  1 1 
        3  4587 1 1  74 LYS HE2  H -20.759  -8.981   5.644 1.00 . A A . 152 LYS HE2  1 1 
        3  4588 1 1  74 LYS HE3  H -19.401  -8.809   4.531 1.00 . A A . 152 LYS HE3  1 1 
        3  4589 1 1  74 LYS HG2  H -18.439  -5.679   5.286 1.00 . A A . 152 LYS HG2  1 1 
        3  4590 1 1  74 LYS HG3  H -18.089  -7.201   4.463 1.00 . A A . 152 LYS HG3  1 1 
        3  4591 1 1  74 LYS HZ1  H -19.519 -10.672   6.416 1.00 . A A . 152 LYS HZ1  1 1 
        3  4592 1 1  74 LYS HZ2  H -18.723  -9.457   7.282 1.00 . A A . 152 LYS HZ2  1 1 
        3  4593 1 1  74 LYS HZ3  H -18.061 -10.037   5.838 1.00 . A A . 152 LYS HZ3  1 1 
        3  4594 1 1  74 LYS N    N -15.491  -7.598   4.436 1.00 . A A . 152 LYS N    1 1 
        3  4595 1 1  74 LYS NZ   N -18.949  -9.807   6.329 1.00 . A A . 152 LYS NZ   1 1 
        3  4596 1 1  74 LYS O    O -14.044  -5.469   6.813 1.00 . A A . 152 LYS O    1 1 
        3  4597 1 1  75 GLU C    C -11.683  -7.051   7.190 1.00 . A A . 153 GLU C    1 1 
        3  4598 1 1  75 GLU CA   C -12.886  -7.804   7.749 1.00 . A A . 153 GLU CA   1 1 
        3  4599 1 1  75 GLU CB   C -12.516  -9.266   8.003 1.00 . A A . 153 GLU CB   1 1 
        3  4600 1 1  75 GLU CD   C -12.929 -11.215   9.557 1.00 . A A . 153 GLU CD   1 1 
        3  4601 1 1  75 GLU CG   C -13.530 -10.012   8.856 1.00 . A A . 153 GLU CG   1 1 
        3  4602 1 1  75 GLU H    H -14.431  -8.544   6.505 1.00 . A A . 153 GLU H    1 1 
        3  4603 1 1  75 GLU HA   H -13.178  -7.347   8.683 1.00 . A A . 153 GLU HA   1 1 
        3  4604 1 1  75 GLU HB2  H -12.433  -9.775   7.054 1.00 . A A . 153 GLU HB2  1 1 
        3  4605 1 1  75 GLU HB3  H -11.560  -9.302   8.505 1.00 . A A . 153 GLU HB3  1 1 
        3  4606 1 1  75 GLU HG2  H -13.919  -9.337   9.603 1.00 . A A . 153 GLU HG2  1 1 
        3  4607 1 1  75 GLU HG3  H -14.336 -10.349   8.221 1.00 . A A . 153 GLU HG3  1 1 
        3  4608 1 1  75 GLU N    N -14.020  -7.718   6.835 1.00 . A A . 153 GLU N    1 1 
        3  4609 1 1  75 GLU O    O -11.050  -6.263   7.892 1.00 . A A . 153 GLU O    1 1 
        3  4610 1 1  75 GLU OE1  O -11.906 -11.047  10.253 1.00 . A A . 153 GLU OE1  1 1 
        3  4611 1 1  75 GLU OE2  O -13.482 -12.325   9.410 1.00 . A A . 153 GLU OE2  1 1 
        3  4612 1 1  76 LEU C    C -10.530  -5.141   5.123 1.00 . A A . 154 LEU C    1 1 
        3  4613 1 1  76 LEU CA   C -10.257  -6.635   5.265 1.00 . A A . 154 LEU CA   1 1 
        3  4614 1 1  76 LEU CB   C -10.006  -7.261   3.890 1.00 . A A . 154 LEU CB   1 1 
        3  4615 1 1  76 LEU CD1  C  -7.606  -6.535   3.783 1.00 . A A . 154 LEU CD1  1 1 
        3  4616 1 1  76 LEU CD2  C  -8.783  -7.276   1.702 1.00 . A A . 154 LEU CD2  1 1 
        3  4617 1 1  76 LEU CG   C  -8.935  -6.571   3.043 1.00 . A A . 154 LEU CG   1 1 
        3  4618 1 1  76 LEU H    H -11.923  -7.930   5.410 1.00 . A A . 154 LEU H    1 1 
        3  4619 1 1  76 LEU HA   H  -9.381  -6.774   5.881 1.00 . A A . 154 LEU HA   1 1 
        3  4620 1 1  76 LEU HB2  H  -9.711  -8.290   4.036 1.00 . A A . 154 LEU HB2  1 1 
        3  4621 1 1  76 LEU HB3  H -10.933  -7.246   3.337 1.00 . A A . 154 LEU HB3  1 1 
        3  4622 1 1  76 LEU HD11 H  -6.799  -6.721   3.088 1.00 . A A . 154 LEU HD11 1 1 
        3  4623 1 1  76 LEU HD12 H  -7.601  -7.294   4.551 1.00 . A A . 154 LEU HD12 1 1 
        3  4624 1 1  76 LEU HD13 H  -7.473  -5.564   4.237 1.00 . A A . 154 LEU HD13 1 1 
        3  4625 1 1  76 LEU HD21 H  -9.539  -6.917   1.020 1.00 . A A . 154 LEU HD21 1 1 
        3  4626 1 1  76 LEU HD22 H  -8.898  -8.341   1.840 1.00 . A A . 154 LEU HD22 1 1 
        3  4627 1 1  76 LEU HD23 H  -7.804  -7.069   1.296 1.00 . A A . 154 LEU HD23 1 1 
        3  4628 1 1  76 LEU HG   H  -9.240  -5.553   2.852 1.00 . A A . 154 LEU HG   1 1 
        3  4629 1 1  76 LEU N    N -11.378  -7.295   5.920 1.00 . A A . 154 LEU N    1 1 
        3  4630 1 1  76 LEU O    O  -9.635  -4.315   5.300 1.00 . A A . 154 LEU O    1 1 
        3  4631 1 1  77 GLU C    C -11.966  -2.640   5.949 1.00 . A A . 155 GLU C    1 1 
        3  4632 1 1  77 GLU CA   C -12.178  -3.412   4.651 1.00 . A A . 155 GLU CA   1 1 
        3  4633 1 1  77 GLU CB   C -13.645  -3.326   4.227 1.00 . A A . 155 GLU CB   1 1 
        3  4634 1 1  77 GLU CD   C -15.409  -3.991   2.546 1.00 . A A . 155 GLU CD   1 1 
        3  4635 1 1  77 GLU CG   C -13.932  -3.986   2.889 1.00 . A A . 155 GLU CG   1 1 
        3  4636 1 1  77 GLU H    H -12.441  -5.517   4.691 1.00 . A A . 155 GLU H    1 1 
        3  4637 1 1  77 GLU HA   H -11.561  -2.975   3.880 1.00 . A A . 155 GLU HA   1 1 
        3  4638 1 1  77 GLU HB2  H -14.254  -3.806   4.979 1.00 . A A . 155 GLU HB2  1 1 
        3  4639 1 1  77 GLU HB3  H -13.927  -2.286   4.159 1.00 . A A . 155 GLU HB3  1 1 
        3  4640 1 1  77 GLU HG2  H -13.402  -3.451   2.116 1.00 . A A . 155 GLU HG2  1 1 
        3  4641 1 1  77 GLU HG3  H -13.582  -5.008   2.923 1.00 . A A . 155 GLU HG3  1 1 
        3  4642 1 1  77 GLU N    N -11.777  -4.806   4.810 1.00 . A A . 155 GLU N    1 1 
        3  4643 1 1  77 GLU O    O -11.302  -1.603   5.967 1.00 . A A . 155 GLU O    1 1 
        3  4644 1 1  77 GLU OE1  O -16.236  -4.040   3.481 1.00 . A A . 155 GLU OE1  1 1 
        3  4645 1 1  77 GLU OE2  O -15.739  -3.945   1.342 1.00 . A A . 155 GLU OE2  1 1 
        3  4646 1 1  78 GLU C    C -10.953  -2.296   8.712 1.00 . A A . 156 GLU C    1 1 
        3  4647 1 1  78 GLU CA   C -12.417  -2.515   8.342 1.00 . A A . 156 GLU CA   1 1 
        3  4648 1 1  78 GLU CB   C -13.103  -3.366   9.412 1.00 . A A . 156 GLU CB   1 1 
        3  4649 1 1  78 GLU CD   C -15.396  -3.496  10.463 1.00 . A A . 156 GLU CD   1 1 
        3  4650 1 1  78 GLU CG   C -14.593  -3.554   9.178 1.00 . A A . 156 GLU CG   1 1 
        3  4651 1 1  78 GLU H    H -13.058  -3.979   6.950 1.00 . A A . 156 GLU H    1 1 
        3  4652 1 1  78 GLU HA   H -12.909  -1.556   8.288 1.00 . A A . 156 GLU HA   1 1 
        3  4653 1 1  78 GLU HB2  H -12.638  -4.340   9.434 1.00 . A A . 156 GLU HB2  1 1 
        3  4654 1 1  78 GLU HB3  H -12.968  -2.891  10.373 1.00 . A A . 156 GLU HB3  1 1 
        3  4655 1 1  78 GLU HG2  H -14.942  -2.774   8.519 1.00 . A A . 156 GLU HG2  1 1 
        3  4656 1 1  78 GLU HG3  H -14.752  -4.516   8.713 1.00 . A A . 156 GLU HG3  1 1 
        3  4657 1 1  78 GLU N    N -12.538  -3.153   7.034 1.00 . A A . 156 GLU N    1 1 
        3  4658 1 1  78 GLU O    O -10.558  -1.198   9.100 1.00 . A A . 156 GLU O    1 1 
        3  4659 1 1  78 GLU OE1  O -15.411  -2.426  11.107 1.00 . A A . 156 GLU OE1  1 1 
        3  4660 1 1  78 GLU OE2  O -16.011  -4.522  10.825 1.00 . A A . 156 GLU OE2  1 1 
        3  4661 1 1  79 LYS C    C  -8.020  -2.216   8.130 1.00 . A A . 157 LYS C    1 1 
        3  4662 1 1  79 LYS CA   C  -8.740  -3.286   8.950 1.00 . A A . 157 LYS CA   1 1 
        3  4663 1 1  79 LYS CB   C  -8.076  -4.648   8.731 1.00 . A A . 157 LYS CB   1 1 
        3  4664 1 1  79 LYS CD   C  -8.313  -5.464  11.096 1.00 . A A . 157 LYS CD   1 1 
        3  4665 1 1  79 LYS CE   C  -7.632  -6.224  12.223 1.00 . A A . 157 LYS CE   1 1 
        3  4666 1 1  79 LYS CG   C  -7.348  -5.173   9.958 1.00 . A A . 157 LYS CG   1 1 
        3  4667 1 1  79 LYS H    H -10.541  -4.210   8.318 1.00 . A A . 157 LYS H    1 1 
        3  4668 1 1  79 LYS HA   H  -8.667  -3.027   9.995 1.00 . A A . 157 LYS HA   1 1 
        3  4669 1 1  79 LYS HB2  H  -8.836  -5.365   8.456 1.00 . A A . 157 LYS HB2  1 1 
        3  4670 1 1  79 LYS HB3  H  -7.363  -4.565   7.924 1.00 . A A . 157 LYS HB3  1 1 
        3  4671 1 1  79 LYS HD2  H  -8.691  -4.530  11.482 1.00 . A A . 157 LYS HD2  1 1 
        3  4672 1 1  79 LYS HD3  H  -9.132  -6.058  10.717 1.00 . A A . 157 LYS HD3  1 1 
        3  4673 1 1  79 LYS HE2  H  -7.309  -7.184  11.849 1.00 . A A . 157 LYS HE2  1 1 
        3  4674 1 1  79 LYS HE3  H  -6.772  -5.659  12.552 1.00 . A A . 157 LYS HE3  1 1 
        3  4675 1 1  79 LYS HG2  H  -6.832  -6.085   9.695 1.00 . A A . 157 LYS HG2  1 1 
        3  4676 1 1  79 LYS HG3  H  -6.633  -4.433  10.284 1.00 . A A . 157 LYS HG3  1 1 
        3  4677 1 1  79 LYS HZ1  H  -8.176  -7.195  13.990 1.00 . A A . 157 LYS HZ1  1 1 
        3  4678 1 1  79 LYS HZ2  H  -9.491  -6.705  13.045 1.00 . A A . 157 LYS HZ2  1 1 
        3  4679 1 1  79 LYS HZ3  H  -8.621  -5.563  13.940 1.00 . A A . 157 LYS HZ3  1 1 
        3  4680 1 1  79 LYS N    N -10.157  -3.355   8.607 1.00 . A A . 157 LYS N    1 1 
        3  4681 1 1  79 LYS NZ   N  -8.544  -6.437  13.380 1.00 . A A . 157 LYS NZ   1 1 
        3  4682 1 1  79 LYS O    O  -7.084  -1.581   8.615 1.00 . A A . 157 LYS O    1 1 
        3  4683 1 1  80 VAL C    C  -8.104   0.396   6.550 1.00 . A A . 158 VAL C    1 1 
        3  4684 1 1  80 VAL CA   C  -7.847  -1.015   6.024 1.00 . A A . 158 VAL CA   1 1 
        3  4685 1 1  80 VAL CB   C  -8.373  -1.120   4.577 1.00 . A A . 158 VAL CB   1 1 
        3  4686 1 1  80 VAL CG1  C  -7.752  -0.044   3.695 1.00 . A A . 158 VAL CG1  1 1 
        3  4687 1 1  80 VAL CG2  C  -8.096  -2.504   4.008 1.00 . A A . 158 VAL CG2  1 1 
        3  4688 1 1  80 VAL H    H  -9.211  -2.548   6.556 1.00 . A A . 158 VAL H    1 1 
        3  4689 1 1  80 VAL HA   H  -6.782  -1.194   6.012 1.00 . A A . 158 VAL HA   1 1 
        3  4690 1 1  80 VAL HB   H  -9.442  -0.968   4.592 1.00 . A A . 158 VAL HB   1 1 
        3  4691 1 1  80 VAL HG11 H  -8.211  -0.070   2.718 1.00 . A A . 158 VAL HG11 1 1 
        3  4692 1 1  80 VAL HG12 H  -6.691  -0.225   3.599 1.00 . A A . 158 VAL HG12 1 1 
        3  4693 1 1  80 VAL HG13 H  -7.912   0.926   4.142 1.00 . A A . 158 VAL HG13 1 1 
        3  4694 1 1  80 VAL HG21 H  -7.316  -2.440   3.264 1.00 . A A . 158 VAL HG21 1 1 
        3  4695 1 1  80 VAL HG22 H  -8.996  -2.892   3.553 1.00 . A A . 158 VAL HG22 1 1 
        3  4696 1 1  80 VAL HG23 H  -7.782  -3.165   4.803 1.00 . A A . 158 VAL HG23 1 1 
        3  4697 1 1  80 VAL N    N  -8.460  -2.016   6.892 1.00 . A A . 158 VAL N    1 1 
        3  4698 1 1  80 VAL O    O  -7.176   1.190   6.704 1.00 . A A . 158 VAL O    1 1 
        3  4699 1 1  81 MET C    C  -9.231   2.239   8.739 1.00 . A A . 159 MET C    1 1 
        3  4700 1 1  81 MET CA   C  -9.751   2.016   7.322 1.00 . A A . 159 MET CA   1 1 
        3  4701 1 1  81 MET CB   C -11.272   2.170   7.296 1.00 . A A . 159 MET CB   1 1 
        3  4702 1 1  81 MET CE   C -14.031   0.129   5.487 1.00 . A A . 159 MET CE   1 1 
        3  4703 1 1  81 MET CG   C -11.896   1.833   5.952 1.00 . A A . 159 MET CG   1 1 
        3  4704 1 1  81 MET H    H -10.063   0.025   6.672 1.00 . A A . 159 MET H    1 1 
        3  4705 1 1  81 MET HA   H  -9.313   2.758   6.671 1.00 . A A . 159 MET HA   1 1 
        3  4706 1 1  81 MET HB2  H -11.701   1.517   8.041 1.00 . A A . 159 MET HB2  1 1 
        3  4707 1 1  81 MET HB3  H -11.524   3.192   7.539 1.00 . A A . 159 MET HB3  1 1 
        3  4708 1 1  81 MET HE1  H -13.101  -0.365   5.246 1.00 . A A . 159 MET HE1  1 1 
        3  4709 1 1  81 MET HE2  H -14.668   0.142   4.616 1.00 . A A . 159 MET HE2  1 1 
        3  4710 1 1  81 MET HE3  H -14.525  -0.405   6.286 1.00 . A A . 159 MET HE3  1 1 
        3  4711 1 1  81 MET HG2  H -11.583   2.573   5.229 1.00 . A A . 159 MET HG2  1 1 
        3  4712 1 1  81 MET HG3  H -11.546   0.859   5.642 1.00 . A A . 159 MET HG3  1 1 
        3  4713 1 1  81 MET N    N  -9.369   0.701   6.819 1.00 . A A . 159 MET N    1 1 
        3  4714 1 1  81 MET O    O  -8.743   3.320   9.069 1.00 . A A . 159 MET O    1 1 
        3  4715 1 1  81 MET SD   S -13.698   1.810   6.008 1.00 . A A . 159 MET SD   1 1 
        3  4716 1 1  82 GLU C    C  -7.386   1.541  11.029 1.00 . A A . 160 GLU C    1 1 
        3  4717 1 1  82 GLU CA   C  -8.890   1.294  10.957 1.00 . A A . 160 GLU CA   1 1 
        3  4718 1 1  82 GLU CB   C  -9.243   0.009  11.709 1.00 . A A . 160 GLU CB   1 1 
        3  4719 1 1  82 GLU CD   C -10.600  -0.575  13.758 1.00 . A A . 160 GLU CD   1 1 
        3  4720 1 1  82 GLU CG   C -10.608   0.052  12.378 1.00 . A A . 160 GLU CG   1 1 
        3  4721 1 1  82 GLU H    H  -9.743   0.378   9.251 1.00 . A A . 160 GLU H    1 1 
        3  4722 1 1  82 GLU HA   H  -9.401   2.124  11.423 1.00 . A A . 160 GLU HA   1 1 
        3  4723 1 1  82 GLU HB2  H  -9.234  -0.816  11.012 1.00 . A A . 160 GLU HB2  1 1 
        3  4724 1 1  82 GLU HB3  H  -8.498  -0.166  12.470 1.00 . A A . 160 GLU HB3  1 1 
        3  4725 1 1  82 GLU HG2  H -10.918   1.082  12.470 1.00 . A A . 160 GLU HG2  1 1 
        3  4726 1 1  82 GLU HG3  H -11.314  -0.482  11.759 1.00 . A A . 160 GLU HG3  1 1 
        3  4727 1 1  82 GLU N    N  -9.343   1.211   9.573 1.00 . A A . 160 GLU N    1 1 
        3  4728 1 1  82 GLU O    O  -6.928   2.429  11.748 1.00 . A A . 160 GLU O    1 1 
        3  4729 1 1  82 GLU OE1  O -10.318  -1.788  13.858 1.00 . A A . 160 GLU OE1  1 1 
        3  4730 1 1  82 GLU OE2  O -10.876   0.146  14.740 1.00 . A A . 160 GLU OE2  1 1 
        3  4731 1 1  83 LEU C    C  -4.752   2.260   9.758 1.00 . A A . 161 LEU C    1 1 
        3  4732 1 1  83 LEU CA   C  -5.170   0.883  10.267 1.00 . A A . 161 LEU CA   1 1 
        3  4733 1 1  83 LEU CB   C  -4.548  -0.206   9.392 1.00 . A A . 161 LEU CB   1 1 
        3  4734 1 1  83 LEU CD1  C  -4.299  -2.653   8.907 1.00 . A A . 161 LEU CD1  1 1 
        3  4735 1 1  83 LEU CD2  C  -3.631  -1.750  11.141 1.00 . A A . 161 LEU CD2  1 1 
        3  4736 1 1  83 LEU CG   C  -4.603  -1.618   9.979 1.00 . A A . 161 LEU CG   1 1 
        3  4737 1 1  83 LEU H    H  -7.046   0.059   9.732 1.00 . A A . 161 LEU H    1 1 
        3  4738 1 1  83 LEU HA   H  -4.816   0.765  11.280 1.00 . A A . 161 LEU HA   1 1 
        3  4739 1 1  83 LEU HB2  H  -5.062  -0.213   8.442 1.00 . A A . 161 LEU HB2  1 1 
        3  4740 1 1  83 LEU HB3  H  -3.513   0.047   9.220 1.00 . A A . 161 LEU HB3  1 1 
        3  4741 1 1  83 LEU HD11 H  -3.478  -2.308   8.296 1.00 . A A . 161 LEU HD11 1 1 
        3  4742 1 1  83 LEU HD12 H  -5.172  -2.798   8.288 1.00 . A A . 161 LEU HD12 1 1 
        3  4743 1 1  83 LEU HD13 H  -4.031  -3.589   9.376 1.00 . A A . 161 LEU HD13 1 1 
        3  4744 1 1  83 LEU HD21 H  -3.430  -0.773  11.555 1.00 . A A . 161 LEU HD21 1 1 
        3  4745 1 1  83 LEU HD22 H  -2.709  -2.189  10.791 1.00 . A A . 161 LEU HD22 1 1 
        3  4746 1 1  83 LEU HD23 H  -4.064  -2.382  11.903 1.00 . A A . 161 LEU HD23 1 1 
        3  4747 1 1  83 LEU HG   H  -5.600  -1.807  10.351 1.00 . A A . 161 LEU HG   1 1 
        3  4748 1 1  83 LEU N    N  -6.623   0.750  10.283 1.00 . A A . 161 LEU N    1 1 
        3  4749 1 1  83 LEU O    O  -3.840   2.882  10.302 1.00 . A A . 161 LEU O    1 1 
        3  4750 1 1  84 HIS C    C  -5.248   5.142   9.164 1.00 . A A . 162 HIS C    1 1 
        3  4751 1 1  84 HIS CA   C  -5.118   4.031   8.126 1.00 . A A . 162 HIS CA   1 1 
        3  4752 1 1  84 HIS CB   C  -6.047   4.310   6.944 1.00 . A A . 162 HIS CB   1 1 
        3  4753 1 1  84 HIS CD2  C  -4.770   6.503   6.402 1.00 . A A . 162 HIS CD2  1 1 
        3  4754 1 1  84 HIS CE1  C  -5.629   6.893   4.423 1.00 . A A . 162 HIS CE1  1 1 
        3  4755 1 1  84 HIS CG   C  -5.646   5.505   6.136 1.00 . A A . 162 HIS CG   1 1 
        3  4756 1 1  84 HIS H    H  -6.138   2.185   8.319 1.00 . A A . 162 HIS H    1 1 
        3  4757 1 1  84 HIS HA   H  -4.098   4.003   7.772 1.00 . A A . 162 HIS HA   1 1 
        3  4758 1 1  84 HIS HB2  H  -6.050   3.453   6.287 1.00 . A A . 162 HIS HB2  1 1 
        3  4759 1 1  84 HIS HB3  H  -7.048   4.478   7.313 1.00 . A A . 162 HIS HB3  1 1 
        3  4760 1 1  84 HIS HD1  H  -6.832   5.238   4.414 1.00 . A A . 162 HIS HD1  1 1 
        3  4761 1 1  84 HIS HD2  H  -4.174   6.611   7.298 1.00 . A A . 162 HIS HD2  1 1 
        3  4762 1 1  84 HIS HE1  H  -5.848   7.350   3.470 1.00 . A A . 162 HIS HE1  1 1 
        3  4763 1 1  84 HIS HE2  H  -4.306   8.208   5.268 1.00 . A A . 162 HIS HE2  1 1 
        3  4764 1 1  84 HIS N    N  -5.422   2.728   8.711 1.00 . A A . 162 HIS N    1 1 
        3  4765 1 1  84 HIS ND1  N  -6.167   5.779   4.889 1.00 . A A . 162 HIS ND1  1 1 
        3  4766 1 1  84 HIS NE2  N  -4.779   7.352   5.323 1.00 . A A . 162 HIS NE2  1 1 
        3  4767 1 1  84 HIS O    O  -4.302   5.892   9.405 1.00 . A A . 162 HIS O    1 1 
        3  4768 1 1  85 LYS C    C  -5.879   5.988  12.053 1.00 . A A . 163 LYS C    1 1 
        3  4769 1 1  85 LYS CA   C  -6.677   6.265  10.783 1.00 . A A . 163 LYS CA   1 1 
        3  4770 1 1  85 LYS CB   C  -8.171   6.328  11.109 1.00 . A A . 163 LYS CB   1 1 
        3  4771 1 1  85 LYS CD   C  -9.586   7.043  13.061 1.00 . A A . 163 LYS CD   1 1 
        3  4772 1 1  85 LYS CE   C -10.658   8.106  13.243 1.00 . A A . 163 LYS CE   1 1 
        3  4773 1 1  85 LYS CG   C  -8.543   7.471  12.040 1.00 . A A . 163 LYS CG   1 1 
        3  4774 1 1  85 LYS H    H  -7.140   4.617   9.537 1.00 . A A . 163 LYS H    1 1 
        3  4775 1 1  85 LYS HA   H  -6.366   7.216  10.377 1.00 . A A . 163 LYS HA   1 1 
        3  4776 1 1  85 LYS HB2  H  -8.723   6.447  10.189 1.00 . A A . 163 LYS HB2  1 1 
        3  4777 1 1  85 LYS HB3  H  -8.464   5.400  11.577 1.00 . A A . 163 LYS HB3  1 1 
        3  4778 1 1  85 LYS HD2  H -10.053   6.130  12.723 1.00 . A A . 163 LYS HD2  1 1 
        3  4779 1 1  85 LYS HD3  H  -9.097   6.870  14.009 1.00 . A A . 163 LYS HD3  1 1 
        3  4780 1 1  85 LYS HE2  H -10.198   8.997  13.644 1.00 . A A . 163 LYS HE2  1 1 
        3  4781 1 1  85 LYS HE3  H -11.093   8.328  12.280 1.00 . A A . 163 LYS HE3  1 1 
        3  4782 1 1  85 LYS HG2  H  -7.657   7.800  12.562 1.00 . A A . 163 LYS HG2  1 1 
        3  4783 1 1  85 LYS HG3  H  -8.940   8.286  11.452 1.00 . A A . 163 LYS HG3  1 1 
        3  4784 1 1  85 LYS HZ1  H -11.553   8.019  15.128 1.00 . A A . 163 LYS HZ1  1 1 
        3  4785 1 1  85 LYS HZ2  H -11.765   6.618  14.205 1.00 . A A . 163 LYS HZ2  1 1 
        3  4786 1 1  85 LYS HZ3  H -12.656   8.010  13.845 1.00 . A A . 163 LYS HZ3  1 1 
        3  4787 1 1  85 LYS N    N  -6.424   5.243   9.773 1.00 . A A . 163 LYS N    1 1 
        3  4788 1 1  85 LYS NZ   N -11.733   7.657  14.170 1.00 . A A . 163 LYS NZ   1 1 
        3  4789 1 1  85 LYS O    O  -5.509   6.910  12.780 1.00 . A A . 163 LYS O    1 1 
        3  4790 1 1  86 SER C    C  -3.410   4.758  13.408 1.00 . A A . 164 SER C    1 1 
        3  4791 1 1  86 SER CA   C  -4.867   4.312  13.501 1.00 . A A . 164 SER CA   1 1 
        3  4792 1 1  86 SER CB   C  -4.935   2.795  13.684 1.00 . A A . 164 SER CB   1 1 
        3  4793 1 1  86 SER H    H  -5.942   4.021  11.701 1.00 . A A . 164 SER H    1 1 
        3  4794 1 1  86 SER HA   H  -5.321   4.788  14.356 1.00 . A A . 164 SER HA   1 1 
        3  4795 1 1  86 SER HB2  H  -5.968   2.492  13.778 1.00 . A A . 164 SER HB2  1 1 
        3  4796 1 1  86 SER HB3  H  -4.495   2.310  12.825 1.00 . A A . 164 SER HB3  1 1 
        3  4797 1 1  86 SER HG   H  -3.452   1.894  14.592 1.00 . A A . 164 SER HG   1 1 
        3  4798 1 1  86 SER N    N  -5.618   4.712  12.316 1.00 . A A . 164 SER N    1 1 
        3  4799 1 1  86 SER O    O  -2.735   4.915  14.425 1.00 . A A . 164 SER O    1 1 
        3  4800 1 1  86 SER OG   O  -4.234   2.389  14.847 1.00 . A A . 164 SER OG   1 1 
        3  4801 1 1  87 TYR C    C  -1.356   6.842  12.373 1.00 . A A . 165 TYR C    1 1 
        3  4802 1 1  87 TYR CA   C  -1.549   5.384  11.969 1.00 . A A . 165 TYR CA   1 1 
        3  4803 1 1  87 TYR CB   C  -1.158   5.193  10.502 1.00 . A A . 165 TYR CB   1 1 
        3  4804 1 1  87 TYR CD1  C  -0.021   2.983  10.949 1.00 . A A . 165 TYR CD1  1 1 
        3  4805 1 1  87 TYR CD2  C  -1.368   3.180   8.992 1.00 . A A . 165 TYR CD2  1 1 
        3  4806 1 1  87 TYR CE1  C   0.269   1.672  10.622 1.00 . A A . 165 TYR CE1  1 1 
        3  4807 1 1  87 TYR CE2  C  -1.083   1.870   8.659 1.00 . A A . 165 TYR CE2  1 1 
        3  4808 1 1  87 TYR CG   C  -0.843   3.759  10.141 1.00 . A A . 165 TYR CG   1 1 
        3  4809 1 1  87 TYR CZ   C  -0.265   1.120   9.477 1.00 . A A . 165 TYR CZ   1 1 
        3  4810 1 1  87 TYR H    H  -3.509   4.817  11.409 1.00 . A A . 165 TYR H    1 1 
        3  4811 1 1  87 TYR HA   H  -0.912   4.766  12.584 1.00 . A A . 165 TYR HA   1 1 
        3  4812 1 1  87 TYR HB2  H  -1.973   5.521   9.874 1.00 . A A . 165 TYR HB2  1 1 
        3  4813 1 1  87 TYR HB3  H  -0.283   5.789  10.289 1.00 . A A . 165 TYR HB3  1 1 
        3  4814 1 1  87 TYR HD1  H   0.394   3.418  11.846 1.00 . A A . 165 TYR HD1  1 1 
        3  4815 1 1  87 TYR HD2  H  -2.009   3.770   8.353 1.00 . A A . 165 TYR HD2  1 1 
        3  4816 1 1  87 TYR HE1  H   0.910   1.085  11.263 1.00 . A A . 165 TYR HE1  1 1 
        3  4817 1 1  87 TYR HE2  H  -1.501   1.438   7.761 1.00 . A A . 165 TYR HE2  1 1 
        3  4818 1 1  87 TYR HH   H   0.160  -0.254   8.201 1.00 . A A . 165 TYR HH   1 1 
        3  4819 1 1  87 TYR N    N  -2.927   4.959  12.184 1.00 . A A . 165 TYR N    1 1 
        3  4820 1 1  87 TYR O    O  -2.097   7.722  11.934 1.00 . A A . 165 TYR O    1 1 
        3  4821 1 1  87 TYR OH   O   0.022  -0.185   9.148 1.00 . A A . 165 TYR OH   1 1 
        3  4822 1 1  88 ARG C    C   0.399   9.326  12.522 1.00 . A A . 166 ARG C    1 1 
        3  4823 1 1  88 ARG CA   C  -0.062   8.440  13.678 1.00 . A A . 166 ARG CA   1 1 
        3  4824 1 1  88 ARG CB   C   1.008   8.397  14.773 1.00 . A A . 166 ARG CB   1 1 
        3  4825 1 1  88 ARG CD   C   1.480   7.644  17.126 1.00 . A A . 166 ARG CD   1 1 
        3  4826 1 1  88 ARG CG   C   0.760   7.328  15.824 1.00 . A A . 166 ARG CG   1 1 
        3  4827 1 1  88 ARG CZ   C   1.486  10.069  17.597 1.00 . A A . 166 ARG CZ   1 1 
        3  4828 1 1  88 ARG H    H   0.199   6.345  13.527 1.00 . A A . 166 ARG H    1 1 
        3  4829 1 1  88 ARG HA   H  -0.970   8.852  14.091 1.00 . A A . 166 ARG HA   1 1 
        3  4830 1 1  88 ARG HB2  H   1.968   8.207  14.316 1.00 . A A . 166 ARG HB2  1 1 
        3  4831 1 1  88 ARG HB3  H   1.038   9.356  15.267 1.00 . A A . 166 ARG HB3  1 1 
        3  4832 1 1  88 ARG HD2  H   1.350   6.813  17.803 1.00 . A A . 166 ARG HD2  1 1 
        3  4833 1 1  88 ARG HD3  H   2.531   7.776  16.920 1.00 . A A . 166 ARG HD3  1 1 
        3  4834 1 1  88 ARG HE   H   0.181   8.758  18.347 1.00 . A A . 166 ARG HE   1 1 
        3  4835 1 1  88 ARG HG2  H  -0.301   7.267  16.017 1.00 . A A . 166 ARG HG2  1 1 
        3  4836 1 1  88 ARG HG3  H   1.114   6.379  15.448 1.00 . A A . 166 ARG HG3  1 1 
        3  4837 1 1  88 ARG HH11 H   2.944   9.474  16.327 1.00 . A A . 166 ARG HH11 1 1 
        3  4838 1 1  88 ARG HH12 H   2.922  11.165  16.690 1.00 . A A . 166 ARG HH12 1 1 
        3  4839 1 1  88 ARG HH21 H   0.157  10.982  18.816 1.00 . A A . 166 ARG HH21 1 1 
        3  4840 1 1  88 ARG HH22 H   1.343  12.021  18.100 1.00 . A A . 166 ARG HH22 1 1 
        3  4841 1 1  88 ARG N    N  -0.356   7.089  13.212 1.00 . A A . 166 ARG N    1 1 
        3  4842 1 1  88 ARG NE   N   0.962   8.855  17.762 1.00 . A A . 166 ARG NE   1 1 
        3  4843 1 1  88 ARG NH1  N   2.537  10.250  16.806 1.00 . A A . 166 ARG NH1  1 1 
        3  4844 1 1  88 ARG NH2  N   0.952  11.109  18.222 1.00 . A A . 166 ARG NH2  1 1 
        3  4845 1 1  88 ARG O    O   0.164   9.009  11.356 1.00 . A A . 166 ARG O    1 1 
        3  4846 1 1  89 SER C    C   2.662  10.735  11.015 1.00 . A A . 167 SER C    1 1 
        3  4847 1 1  89 SER CA   C   1.544  11.367  11.839 1.00 . A A . 167 SER CA   1 1 
        3  4848 1 1  89 SER CB   C   2.044  12.654  12.498 1.00 . A A . 167 SER CB   1 1 
        3  4849 1 1  89 SER H    H   1.210  10.638  13.795 1.00 . A A . 167 SER H    1 1 
        3  4850 1 1  89 SER HA   H   0.721  11.606  11.183 1.00 . A A . 167 SER HA   1 1 
        3  4851 1 1  89 SER HB2  H   2.895  12.430  13.123 1.00 . A A . 167 SER HB2  1 1 
        3  4852 1 1  89 SER HB3  H   2.335  13.358  11.732 1.00 . A A . 167 SER HB3  1 1 
        3  4853 1 1  89 SER HG   H   0.624  13.966  12.818 1.00 . A A . 167 SER HG   1 1 
        3  4854 1 1  89 SER N    N   1.054  10.438  12.851 1.00 . A A . 167 SER N    1 1 
        3  4855 1 1  89 SER O    O   3.832  11.089  11.159 1.00 . A A . 167 SER O    1 1 
        3  4856 1 1  89 SER OG   O   1.034  13.243  13.299 1.00 . A A . 167 SER OG   1 1 
        3  4857 1 1  90 MET C    C   3.494   9.900   8.011 1.00 . A A . 168 MET C    1 1 
        3  4858 1 1  90 MET CA   C   3.256   9.116   9.298 1.00 . A A . 168 MET CA   1 1 
        3  4859 1 1  90 MET CB   C   2.768   7.705   8.966 1.00 . A A . 168 MET CB   1 1 
        3  4860 1 1  90 MET CE   C   3.024   4.442   9.138 1.00 . A A . 168 MET CE   1 1 
        3  4861 1 1  90 MET CG   C   3.736   6.913   8.102 1.00 . A A . 168 MET CG   1 1 
        3  4862 1 1  90 MET H    H   1.341   9.565  10.083 1.00 . A A . 168 MET H    1 1 
        3  4863 1 1  90 MET HA   H   4.187   9.048   9.840 1.00 . A A . 168 MET HA   1 1 
        3  4864 1 1  90 MET HB2  H   2.616   7.163   9.888 1.00 . A A . 168 MET HB2  1 1 
        3  4865 1 1  90 MET HB3  H   1.826   7.776   8.442 1.00 . A A . 168 MET HB3  1 1 
        3  4866 1 1  90 MET HE1  H   3.498   3.479   9.018 1.00 . A A . 168 MET HE1  1 1 
        3  4867 1 1  90 MET HE2  H   2.000   4.303   9.449 1.00 . A A . 168 MET HE2  1 1 
        3  4868 1 1  90 MET HE3  H   3.554   5.013   9.887 1.00 . A A . 168 MET HE3  1 1 
        3  4869 1 1  90 MET HG2  H   3.970   7.494   7.223 1.00 . A A . 168 MET HG2  1 1 
        3  4870 1 1  90 MET HG3  H   4.639   6.736   8.667 1.00 . A A . 168 MET HG3  1 1 
        3  4871 1 1  90 MET N    N   2.290   9.800  10.150 1.00 . A A . 168 MET N    1 1 
        3  4872 1 1  90 MET O    O   2.602  10.595   7.523 1.00 . A A . 168 MET O    1 1 
        3  4873 1 1  90 MET SD   S   3.060   5.325   7.580 1.00 . A A . 168 MET SD   1 1 
        3  4874 1 1  91 THR C    C   4.902   9.556   5.028 1.00 . A A . 169 THR C    1 1 
        3  4875 1 1  91 THR CA   C   5.052  10.479   6.232 1.00 . A A . 169 THR CA   1 1 
        3  4876 1 1  91 THR CB   C   6.486  11.004   6.312 1.00 . A A . 169 THR CB   1 1 
        3  4877 1 1  91 THR CG2  C   6.577  12.421   6.835 1.00 . A A . 169 THR CG2  1 1 
        3  4878 1 1  91 THR H    H   5.369   9.213   7.896 1.00 . A A . 169 THR H    1 1 
        3  4879 1 1  91 THR HA   H   4.378  11.314   6.116 1.00 . A A . 169 THR HA   1 1 
        3  4880 1 1  91 THR HB   H   6.920  10.989   5.323 1.00 . A A . 169 THR HB   1 1 
        3  4881 1 1  91 THR HG1  H   7.410   9.330   6.738 1.00 . A A . 169 THR HG1  1 1 
        3  4882 1 1  91 THR HG21 H   6.471  13.116   6.015 1.00 . A A . 169 THR HG21 1 1 
        3  4883 1 1  91 THR HG22 H   7.536  12.569   7.310 1.00 . A A . 169 THR HG22 1 1 
        3  4884 1 1  91 THR HG23 H   5.789  12.591   7.554 1.00 . A A . 169 THR HG23 1 1 
        3  4885 1 1  91 THR N    N   4.699   9.783   7.464 1.00 . A A . 169 THR N    1 1 
        3  4886 1 1  91 THR O    O   4.832   8.336   5.176 1.00 . A A . 169 THR O    1 1 
        3  4887 1 1  91 THR OG1  O   7.274  10.184   7.156 1.00 . A A . 169 THR OG1  1 1 
        3  4888 1 1  92 PRO C    C   5.813   8.289   2.462 1.00 . A A . 170 PRO C    1 1 
        3  4889 1 1  92 PRO CA   C   4.722   9.345   2.582 1.00 . A A . 170 PRO CA   1 1 
        3  4890 1 1  92 PRO CB   C   4.853  10.388   1.462 1.00 . A A . 170 PRO CB   1 1 
        3  4891 1 1  92 PRO CD   C   4.942  11.567   3.539 1.00 . A A . 170 PRO CD   1 1 
        3  4892 1 1  92 PRO CG   C   5.418  11.604   2.116 1.00 . A A . 170 PRO CG   1 1 
        3  4893 1 1  92 PRO HA   H   3.755   8.867   2.523 1.00 . A A . 170 PRO HA   1 1 
        3  4894 1 1  92 PRO HB2  H   5.512  10.012   0.694 1.00 . A A . 170 PRO HB2  1 1 
        3  4895 1 1  92 PRO HB3  H   3.879  10.587   1.039 1.00 . A A . 170 PRO HB3  1 1 
        3  4896 1 1  92 PRO HD2  H   5.659  12.045   4.191 1.00 . A A . 170 PRO HD2  1 1 
        3  4897 1 1  92 PRO HD3  H   3.974  12.035   3.628 1.00 . A A . 170 PRO HD3  1 1 
        3  4898 1 1  92 PRO HG2  H   6.497  11.573   2.081 1.00 . A A . 170 PRO HG2  1 1 
        3  4899 1 1  92 PRO HG3  H   5.052  12.492   1.622 1.00 . A A . 170 PRO HG3  1 1 
        3  4900 1 1  92 PRO N    N   4.857  10.126   3.813 1.00 . A A . 170 PRO N    1 1 
        3  4901 1 1  92 PRO O    O   5.531   7.112   2.235 1.00 . A A . 170 PRO O    1 1 
        3  4902 1 1  93 ALA C    C   8.042   6.625   3.468 1.00 . A A . 171 ALA C    1 1 
        3  4903 1 1  93 ALA CA   C   8.201   7.812   2.523 1.00 . A A . 171 ALA CA   1 1 
        3  4904 1 1  93 ALA CB   C   9.492   8.557   2.825 1.00 . A A . 171 ALA CB   1 1 
        3  4905 1 1  93 ALA H    H   7.224   9.669   2.788 1.00 . A A . 171 ALA H    1 1 
        3  4906 1 1  93 ALA HA   H   8.255   7.446   1.508 1.00 . A A . 171 ALA HA   1 1 
        3  4907 1 1  93 ALA HB1  H   9.881   8.988   1.915 1.00 . A A . 171 ALA HB1  1 1 
        3  4908 1 1  93 ALA HB2  H  10.217   7.870   3.236 1.00 . A A . 171 ALA HB2  1 1 
        3  4909 1 1  93 ALA HB3  H   9.295   9.343   3.540 1.00 . A A . 171 ALA HB3  1 1 
        3  4910 1 1  93 ALA N    N   7.062   8.718   2.614 1.00 . A A . 171 ALA N    1 1 
        3  4911 1 1  93 ALA O    O   8.366   5.491   3.114 1.00 . A A . 171 ALA O    1 1 
        3  4912 1 1  94 GLN C    C   6.420   4.755   5.114 1.00 . A A . 172 GLN C    1 1 
        3  4913 1 1  94 GLN CA   C   7.338   5.842   5.662 1.00 . A A . 172 GLN CA   1 1 
        3  4914 1 1  94 GLN CB   C   6.750   6.431   6.947 1.00 . A A . 172 GLN CB   1 1 
        3  4915 1 1  94 GLN CD   C   7.397   7.667   9.054 1.00 . A A . 172 GLN CD   1 1 
        3  4916 1 1  94 GLN CG   C   7.766   6.575   8.069 1.00 . A A . 172 GLN CG   1 1 
        3  4917 1 1  94 GLN H    H   7.300   7.815   4.894 1.00 . A A . 172 GLN H    1 1 
        3  4918 1 1  94 GLN HA   H   8.300   5.405   5.883 1.00 . A A . 172 GLN HA   1 1 
        3  4919 1 1  94 GLN HB2  H   6.346   7.409   6.729 1.00 . A A . 172 GLN HB2  1 1 
        3  4920 1 1  94 GLN HB3  H   5.952   5.791   7.293 1.00 . A A . 172 GLN HB3  1 1 
        3  4921 1 1  94 GLN HE21 H   8.971   8.742   8.489 1.00 . A A . 172 GLN HE21 1 1 
        3  4922 1 1  94 GLN HE22 H   7.983   9.447   9.718 1.00 . A A . 172 GLN HE22 1 1 
        3  4923 1 1  94 GLN HG2  H   7.829   5.638   8.602 1.00 . A A . 172 GLN HG2  1 1 
        3  4924 1 1  94 GLN HG3  H   8.728   6.808   7.638 1.00 . A A . 172 GLN HG3  1 1 
        3  4925 1 1  94 GLN N    N   7.540   6.892   4.670 1.00 . A A . 172 GLN N    1 1 
        3  4926 1 1  94 GLN NE2  N   8.198   8.726   9.090 1.00 . A A . 172 GLN NE2  1 1 
        3  4927 1 1  94 GLN O    O   6.703   3.564   5.246 1.00 . A A . 172 GLN O    1 1 
        3  4928 1 1  94 GLN OE1  O   6.404   7.561   9.773 1.00 . A A . 172 GLN OE1  1 1 
        3  4929 1 1  95 ALA C    C   5.012   3.463   2.762 1.00 . A A . 173 ALA C    1 1 
        3  4930 1 1  95 ALA CA   C   4.372   4.232   3.911 1.00 . A A . 173 ALA CA   1 1 
        3  4931 1 1  95 ALA CB   C   3.127   4.966   3.434 1.00 . A A . 173 ALA CB   1 1 
        3  4932 1 1  95 ALA H    H   5.156   6.135   4.408 1.00 . A A . 173 ALA H    1 1 
        3  4933 1 1  95 ALA HA   H   4.080   3.534   4.683 1.00 . A A . 173 ALA HA   1 1 
        3  4934 1 1  95 ALA HB1  H   2.702   4.442   2.591 1.00 . A A . 173 ALA HB1  1 1 
        3  4935 1 1  95 ALA HB2  H   3.393   5.970   3.137 1.00 . A A . 173 ALA HB2  1 1 
        3  4936 1 1  95 ALA HB3  H   2.404   5.006   4.235 1.00 . A A . 173 ALA HB3  1 1 
        3  4937 1 1  95 ALA N    N   5.324   5.172   4.489 1.00 . A A . 173 ALA N    1 1 
        3  4938 1 1  95 ALA O    O   4.863   2.244   2.654 1.00 . A A . 173 ALA O    1 1 
        3  4939 1 1  96 ASP C    C   7.382   2.498   1.244 1.00 . A A . 174 ASP C    1 1 
        3  4940 1 1  96 ASP CA   C   6.414   3.579   0.774 1.00 . A A . 174 ASP CA   1 1 
        3  4941 1 1  96 ASP CB   C   7.172   4.645  -0.020 1.00 . A A . 174 ASP CB   1 1 
        3  4942 1 1  96 ASP CG   C   6.244   5.544  -0.813 1.00 . A A . 174 ASP CG   1 1 
        3  4943 1 1  96 ASP H    H   5.822   5.151   2.059 1.00 . A A . 174 ASP H    1 1 
        3  4944 1 1  96 ASP HA   H   5.667   3.134   0.138 1.00 . A A . 174 ASP HA   1 1 
        3  4945 1 1  96 ASP HB2  H   7.739   5.259   0.664 1.00 . A A . 174 ASP HB2  1 1 
        3  4946 1 1  96 ASP HB3  H   7.849   4.160  -0.708 1.00 . A A . 174 ASP HB3  1 1 
        3  4947 1 1  96 ASP N    N   5.736   4.186   1.912 1.00 . A A . 174 ASP N    1 1 
        3  4948 1 1  96 ASP O    O   7.490   1.430   0.639 1.00 . A A . 174 ASP O    1 1 
        3  4949 1 1  96 ASP OD1  O   5.103   5.120  -1.093 1.00 . A A . 174 ASP OD1  1 1 
        3  4950 1 1  96 ASP OD2  O   6.658   6.672  -1.154 1.00 . A A . 174 ASP OD2  1 1 
        3  4951 1 1  97 LEU C    C   8.326   0.680   3.595 1.00 . A A . 175 LEU C    1 1 
        3  4952 1 1  97 LEU CA   C   9.032   1.854   2.920 1.00 . A A . 175 LEU CA   1 1 
        3  4953 1 1  97 LEU CB   C   9.922   2.577   3.934 1.00 . A A . 175 LEU CB   1 1 
        3  4954 1 1  97 LEU CD1  C  12.016   1.993   2.684 1.00 . A A . 175 LEU CD1  1 1 
        3  4955 1 1  97 LEU CD2  C  12.160   2.885   5.017 1.00 . A A . 175 LEU CD2  1 1 
        3  4956 1 1  97 LEU CG   C  11.348   2.036   4.050 1.00 . A A . 175 LEU CG   1 1 
        3  4957 1 1  97 LEU H    H   7.922   3.649   2.781 1.00 . A A . 175 LEU H    1 1 
        3  4958 1 1  97 LEU HA   H   9.650   1.474   2.121 1.00 . A A . 175 LEU HA   1 1 
        3  4959 1 1  97 LEU HB2  H   9.976   3.619   3.654 1.00 . A A . 175 LEU HB2  1 1 
        3  4960 1 1  97 LEU HB3  H   9.455   2.506   4.905 1.00 . A A . 175 LEU HB3  1 1 
        3  4961 1 1  97 LEU HD11 H  13.058   2.260   2.783 1.00 . A A . 175 LEU HD11 1 1 
        3  4962 1 1  97 LEU HD12 H  11.527   2.692   2.021 1.00 . A A . 175 LEU HD12 1 1 
        3  4963 1 1  97 LEU HD13 H  11.938   0.995   2.277 1.00 . A A . 175 LEU HD13 1 1 
        3  4964 1 1  97 LEU HD21 H  13.182   2.946   4.672 1.00 . A A . 175 LEU HD21 1 1 
        3  4965 1 1  97 LEU HD22 H  12.137   2.435   5.998 1.00 . A A . 175 LEU HD22 1 1 
        3  4966 1 1  97 LEU HD23 H  11.738   3.878   5.067 1.00 . A A . 175 LEU HD23 1 1 
        3  4967 1 1  97 LEU HG   H  11.313   1.029   4.437 1.00 . A A . 175 LEU HG   1 1 
        3  4968 1 1  97 LEU N    N   8.075   2.787   2.340 1.00 . A A . 175 LEU N    1 1 
        3  4969 1 1  97 LEU O    O   8.839  -0.438   3.614 1.00 . A A . 175 LEU O    1 1 
        3  4970 1 1  98 GLU C    C   5.991  -1.228   3.936 1.00 . A A . 176 GLU C    1 1 
        3  4971 1 1  98 GLU CA   C   6.386  -0.080   4.863 1.00 . A A . 176 GLU CA   1 1 
        3  4972 1 1  98 GLU CB   C   5.133   0.536   5.488 1.00 . A A . 176 GLU CB   1 1 
        3  4973 1 1  98 GLU CD   C   5.533   0.414   7.980 1.00 . A A . 176 GLU CD   1 1 
        3  4974 1 1  98 GLU CG   C   5.411   1.312   6.765 1.00 . A A . 176 GLU CG   1 1 
        3  4975 1 1  98 GLU H    H   6.805   1.862   4.128 1.00 . A A . 176 GLU H    1 1 
        3  4976 1 1  98 GLU HA   H   7.008  -0.474   5.652 1.00 . A A . 176 GLU HA   1 1 
        3  4977 1 1  98 GLU HB2  H   4.681   1.208   4.774 1.00 . A A . 176 GLU HB2  1 1 
        3  4978 1 1  98 GLU HB3  H   4.434  -0.255   5.718 1.00 . A A . 176 GLU HB3  1 1 
        3  4979 1 1  98 GLU HG2  H   6.336   1.856   6.646 1.00 . A A . 176 GLU HG2  1 1 
        3  4980 1 1  98 GLU HG3  H   4.603   2.010   6.930 1.00 . A A . 176 GLU HG3  1 1 
        3  4981 1 1  98 GLU N    N   7.155   0.948   4.165 1.00 . A A . 176 GLU N    1 1 
        3  4982 1 1  98 GLU O    O   6.276  -2.392   4.223 1.00 . A A . 176 GLU O    1 1 
        3  4983 1 1  98 GLU OE1  O   5.995  -0.736   7.824 1.00 . A A . 176 GLU OE1  1 1 
        3  4984 1 1  98 GLU OE2  O   5.167   0.860   9.088 1.00 . A A . 176 GLU OE2  1 1 
        3  4985 1 1  99 PHE C    C   6.109  -2.520   1.148 1.00 . A A . 177 PHE C    1 1 
        3  4986 1 1  99 PHE CA   C   4.909  -1.925   1.877 1.00 . A A . 177 PHE CA   1 1 
        3  4987 1 1  99 PHE CB   C   3.906  -1.345   0.874 1.00 . A A . 177 PHE CB   1 1 
        3  4988 1 1  99 PHE CD1  C   4.477  -2.349  -1.353 1.00 . A A . 177 PHE CD1  1 1 
        3  4989 1 1  99 PHE CD2  C   2.448  -3.021  -0.296 1.00 . A A . 177 PHE CD2  1 1 
        3  4990 1 1  99 PHE CE1  C   4.203  -3.185  -2.418 1.00 . A A . 177 PHE CE1  1 1 
        3  4991 1 1  99 PHE CE2  C   2.169  -3.859  -1.358 1.00 . A A . 177 PHE CE2  1 1 
        3  4992 1 1  99 PHE CG   C   3.604  -2.258  -0.281 1.00 . A A . 177 PHE CG   1 1 
        3  4993 1 1  99 PHE CZ   C   3.048  -3.941  -2.421 1.00 . A A . 177 PHE CZ   1 1 
        3  4994 1 1  99 PHE H    H   5.135   0.040   2.642 1.00 . A A . 177 PHE H    1 1 
        3  4995 1 1  99 PHE HA   H   4.425  -2.711   2.439 1.00 . A A . 177 PHE HA   1 1 
        3  4996 1 1  99 PHE HB2  H   2.977  -1.140   1.384 1.00 . A A . 177 PHE HB2  1 1 
        3  4997 1 1  99 PHE HB3  H   4.300  -0.426   0.476 1.00 . A A . 177 PHE HB3  1 1 
        3  4998 1 1  99 PHE HD1  H   5.381  -1.758  -1.352 1.00 . A A . 177 PHE HD1  1 1 
        3  4999 1 1  99 PHE HD2  H   1.760  -2.957   0.535 1.00 . A A . 177 PHE HD2  1 1 
        3  5000 1 1  99 PHE HE1  H   4.892  -3.247  -3.248 1.00 . A A . 177 PHE HE1  1 1 
        3  5001 1 1  99 PHE HE2  H   1.265  -4.450  -1.358 1.00 . A A . 177 PHE HE2  1 1 
        3  5002 1 1  99 PHE HZ   H   2.833  -4.595  -3.252 1.00 . A A . 177 PHE HZ   1 1 
        3  5003 1 1  99 PHE N    N   5.335  -0.903   2.827 1.00 . A A . 177 PHE N    1 1 
        3  5004 1 1  99 PHE O    O   6.206  -3.737   0.988 1.00 . A A . 177 PHE O    1 1 
        3  5005 1 1 100 LEU C    C   9.039  -3.046   0.891 1.00 . A A . 178 LEU C    1 1 
        3  5006 1 1 100 LEU CA   C   8.214  -2.116   0.006 1.00 . A A . 178 LEU CA   1 1 
        3  5007 1 1 100 LEU CB   C   9.060  -0.922  -0.439 1.00 . A A . 178 LEU CB   1 1 
        3  5008 1 1 100 LEU CD1  C   9.434   0.991  -2.014 1.00 . A A . 178 LEU CD1  1 1 
        3  5009 1 1 100 LEU CD2  C   8.179  -1.032  -2.785 1.00 . A A . 178 LEU CD2  1 1 
        3  5010 1 1 100 LEU CG   C   8.479  -0.119  -1.604 1.00 . A A . 178 LEU CG   1 1 
        3  5011 1 1 100 LEU H    H   6.897  -0.700   0.870 1.00 . A A . 178 LEU H    1 1 
        3  5012 1 1 100 LEU HA   H   7.892  -2.664  -0.867 1.00 . A A . 178 LEU HA   1 1 
        3  5013 1 1 100 LEU HB2  H   9.180  -0.259   0.405 1.00 . A A . 178 LEU HB2  1 1 
        3  5014 1 1 100 LEU HB3  H  10.033  -1.286  -0.732 1.00 . A A . 178 LEU HB3  1 1 
        3  5015 1 1 100 LEU HD11 H   9.163   1.905  -1.507 1.00 . A A . 178 LEU HD11 1 1 
        3  5016 1 1 100 LEU HD12 H   9.375   1.141  -3.082 1.00 . A A . 178 LEU HD12 1 1 
        3  5017 1 1 100 LEU HD13 H  10.443   0.715  -1.745 1.00 . A A . 178 LEU HD13 1 1 
        3  5018 1 1 100 LEU HD21 H   7.896  -0.434  -3.639 1.00 . A A . 178 LEU HD21 1 1 
        3  5019 1 1 100 LEU HD22 H   7.369  -1.699  -2.528 1.00 . A A . 178 LEU HD22 1 1 
        3  5020 1 1 100 LEU HD23 H   9.059  -1.609  -3.025 1.00 . A A . 178 LEU HD23 1 1 
        3  5021 1 1 100 LEU HG   H   7.552   0.339  -1.291 1.00 . A A . 178 LEU HG   1 1 
        3  5022 1 1 100 LEU N    N   7.024  -1.660   0.712 1.00 . A A . 178 LEU N    1 1 
        3  5023 1 1 100 LEU O    O   9.552  -4.065   0.431 1.00 . A A . 178 LEU O    1 1 
        3  5024 1 1 101 GLU C    C   9.211  -4.814   3.387 1.00 . A A . 179 GLU C    1 1 
        3  5025 1 1 101 GLU CA   C   9.912  -3.486   3.122 1.00 . A A . 179 GLU CA   1 1 
        3  5026 1 1 101 GLU CB   C  10.092  -2.715   4.430 1.00 . A A . 179 GLU CB   1 1 
        3  5027 1 1 101 GLU CD   C  12.353  -3.452   5.281 1.00 . A A . 179 GLU CD   1 1 
        3  5028 1 1 101 GLU CG   C  10.852  -3.487   5.494 1.00 . A A . 179 GLU CG   1 1 
        3  5029 1 1 101 GLU H    H   8.723  -1.865   2.472 1.00 . A A . 179 GLU H    1 1 
        3  5030 1 1 101 GLU HA   H  10.880  -3.686   2.694 1.00 . A A . 179 GLU HA   1 1 
        3  5031 1 1 101 GLU HB2  H  10.632  -1.802   4.224 1.00 . A A . 179 GLU HB2  1 1 
        3  5032 1 1 101 GLU HB3  H   9.118  -2.465   4.824 1.00 . A A . 179 GLU HB3  1 1 
        3  5033 1 1 101 GLU HG2  H  10.631  -3.057   6.459 1.00 . A A . 179 GLU HG2  1 1 
        3  5034 1 1 101 GLU HG3  H  10.524  -4.516   5.475 1.00 . A A . 179 GLU HG3  1 1 
        3  5035 1 1 101 GLU N    N   9.157  -2.687   2.166 1.00 . A A . 179 GLU N    1 1 
        3  5036 1 1 101 GLU O    O   9.858  -5.834   3.627 1.00 . A A . 179 GLU O    1 1 
        3  5037 1 1 101 GLU OE1  O  12.785  -3.331   4.115 1.00 . A A . 179 GLU OE1  1 1 
        3  5038 1 1 101 GLU OE2  O  13.097  -3.544   6.281 1.00 . A A . 179 GLU OE2  1 1 
        3  5039 1 1 102 ASN C    C   7.205  -6.939   2.359 1.00 . A A . 180 ASN C    1 1 
        3  5040 1 1 102 ASN CA   C   7.097  -5.999   3.557 1.00 . A A . 180 ASN CA   1 1 
        3  5041 1 1 102 ASN CB   C   5.636  -5.629   3.808 1.00 . A A . 180 ASN CB   1 1 
        3  5042 1 1 102 ASN CG   C   5.229  -5.829   5.254 1.00 . A A . 180 ASN CG   1 1 
        3  5043 1 1 102 ASN H    H   7.431  -3.951   3.121 1.00 . A A . 180 ASN H    1 1 
        3  5044 1 1 102 ASN HA   H   7.491  -6.498   4.430 1.00 . A A . 180 ASN HA   1 1 
        3  5045 1 1 102 ASN HB2  H   5.491  -4.589   3.553 1.00 . A A . 180 ASN HB2  1 1 
        3  5046 1 1 102 ASN HB3  H   5.000  -6.241   3.184 1.00 . A A . 180 ASN HB3  1 1 
        3  5047 1 1 102 ASN HD21 H   6.500  -4.413   5.832 1.00 . A A . 180 ASN HD21 1 1 
        3  5048 1 1 102 ASN HD22 H   5.591  -5.166   7.093 1.00 . A A . 180 ASN HD22 1 1 
        3  5049 1 1 102 ASN N    N   7.885  -4.795   3.332 1.00 . A A . 180 ASN N    1 1 
        3  5050 1 1 102 ASN ND2  N   5.834  -5.058   6.150 1.00 . A A . 180 ASN ND2  1 1 
        3  5051 1 1 102 ASN O    O   7.478  -8.129   2.510 1.00 . A A . 180 ASN O    1 1 
        3  5052 1 1 102 ASN OD1  O   4.380  -6.665   5.563 1.00 . A A . 180 ASN OD1  1 1 
        3  5053 1 1 103 ALA C    C   8.460  -7.758  -0.253 1.00 . A A . 181 ALA C    1 1 
        3  5054 1 1 103 ALA CA   C   7.066  -7.169  -0.062 1.00 . A A . 181 ALA CA   1 1 
        3  5055 1 1 103 ALA CB   C   6.685  -6.308  -1.258 1.00 . A A . 181 ALA CB   1 1 
        3  5056 1 1 103 ALA H    H   6.774  -5.435   1.119 1.00 . A A . 181 ALA H    1 1 
        3  5057 1 1 103 ALA HA   H   6.352  -7.977   0.012 1.00 . A A . 181 ALA HA   1 1 
        3  5058 1 1 103 ALA HB1  H   5.621  -6.123  -1.244 1.00 . A A . 181 ALA HB1  1 1 
        3  5059 1 1 103 ALA HB2  H   6.949  -6.821  -2.171 1.00 . A A . 181 ALA HB2  1 1 
        3  5060 1 1 103 ALA HB3  H   7.215  -5.368  -1.208 1.00 . A A . 181 ALA HB3  1 1 
        3  5061 1 1 103 ALA N    N   6.991  -6.389   1.168 1.00 . A A . 181 ALA N    1 1 
        3  5062 1 1 103 ALA O    O   8.610  -8.886  -0.722 1.00 . A A . 181 ALA O    1 1 
        3  5063 1 1 104 LYS C    C  11.205  -8.464   1.050 1.00 . A A . 182 LYS C    1 1 
        3  5064 1 1 104 LYS CA   C  10.860  -7.426  -0.014 1.00 . A A . 182 LYS CA   1 1 
        3  5065 1 1 104 LYS CB   C  11.813  -6.233   0.090 1.00 . A A . 182 LYS CB   1 1 
        3  5066 1 1 104 LYS CD   C  12.820  -4.297  -1.156 1.00 . A A . 182 LYS CD   1 1 
        3  5067 1 1 104 LYS CE   C  13.622  -3.912  -2.389 1.00 . A A . 182 LYS CE   1 1 
        3  5068 1 1 104 LYS CG   C  12.293  -5.719  -1.257 1.00 . A A . 182 LYS CG   1 1 
        3  5069 1 1 104 LYS H    H   9.288  -6.096   0.485 1.00 . A A . 182 LYS H    1 1 
        3  5070 1 1 104 LYS HA   H  10.972  -7.879  -0.989 1.00 . A A . 182 LYS HA   1 1 
        3  5071 1 1 104 LYS HB2  H  11.307  -5.427   0.600 1.00 . A A . 182 LYS HB2  1 1 
        3  5072 1 1 104 LYS HB3  H  12.677  -6.525   0.668 1.00 . A A . 182 LYS HB3  1 1 
        3  5073 1 1 104 LYS HD2  H  11.985  -3.620  -1.056 1.00 . A A . 182 LYS HD2  1 1 
        3  5074 1 1 104 LYS HD3  H  13.455  -4.220  -0.285 1.00 . A A . 182 LYS HD3  1 1 
        3  5075 1 1 104 LYS HE2  H  14.287  -4.725  -2.639 1.00 . A A . 182 LYS HE2  1 1 
        3  5076 1 1 104 LYS HE3  H  12.939  -3.741  -3.208 1.00 . A A . 182 LYS HE3  1 1 
        3  5077 1 1 104 LYS HG2  H  13.084  -6.361  -1.615 1.00 . A A . 182 LYS HG2  1 1 
        3  5078 1 1 104 LYS HG3  H  11.468  -5.739  -1.954 1.00 . A A . 182 LYS HG3  1 1 
        3  5079 1 1 104 LYS HZ1  H  15.411  -2.933  -1.934 1.00 . A A . 182 LYS HZ1  1 1 
        3  5080 1 1 104 LYS HZ2  H  14.031  -2.130  -1.377 1.00 . A A . 182 LYS HZ2  1 1 
        3  5081 1 1 104 LYS HZ3  H  14.425  -2.090  -3.021 1.00 . A A . 182 LYS HZ3  1 1 
        3  5082 1 1 104 LYS N    N   9.476  -6.984   0.115 1.00 . A A . 182 LYS N    1 1 
        3  5083 1 1 104 LYS NZ   N  14.429  -2.680  -2.165 1.00 . A A . 182 LYS NZ   1 1 
        3  5084 1 1 104 LYS O    O  12.031  -9.348   0.822 1.00 . A A . 182 LYS O    1 1 
        3  5085 1 1 105 LYS C    C  10.094 -10.613   3.070 1.00 . A A . 183 LYS C    1 1 
        3  5086 1 1 105 LYS CA   C  10.811  -9.286   3.308 1.00 . A A . 183 LYS CA   1 1 
        3  5087 1 1 105 LYS CB   C  10.354  -8.677   4.635 1.00 . A A . 183 LYS CB   1 1 
        3  5088 1 1 105 LYS CD   C  10.342  -8.824   7.144 1.00 . A A . 183 LYS CD   1 1 
        3  5089 1 1 105 LYS CE   C   9.246  -9.719   7.699 1.00 . A A . 183 LYS CE   1 1 
        3  5090 1 1 105 LYS CG   C  10.921  -9.385   5.855 1.00 . A A . 183 LYS CG   1 1 
        3  5091 1 1 105 LYS H    H   9.917  -7.631   2.339 1.00 . A A . 183 LYS H    1 1 
        3  5092 1 1 105 LYS HA   H  11.874  -9.470   3.355 1.00 . A A . 183 LYS HA   1 1 
        3  5093 1 1 105 LYS HB2  H  10.664  -7.643   4.669 1.00 . A A . 183 LYS HB2  1 1 
        3  5094 1 1 105 LYS HB3  H   9.276  -8.723   4.686 1.00 . A A . 183 LYS HB3  1 1 
        3  5095 1 1 105 LYS HD2  H  11.132  -8.742   7.876 1.00 . A A . 183 LYS HD2  1 1 
        3  5096 1 1 105 LYS HD3  H   9.930  -7.845   6.946 1.00 . A A . 183 LYS HD3  1 1 
        3  5097 1 1 105 LYS HE2  H   8.288  -9.318   7.405 1.00 . A A . 183 LYS HE2  1 1 
        3  5098 1 1 105 LYS HE3  H   9.364 -10.710   7.285 1.00 . A A . 183 LYS HE3  1 1 
        3  5099 1 1 105 LYS HG2  H  10.682 -10.436   5.793 1.00 . A A . 183 LYS HG2  1 1 
        3  5100 1 1 105 LYS HG3  H  11.993  -9.258   5.866 1.00 . A A . 183 LYS HG3  1 1 
        3  5101 1 1 105 LYS HZ1  H   8.596  -9.165   9.606 1.00 . A A . 183 LYS HZ1  1 1 
        3  5102 1 1 105 LYS HZ2  H  10.243  -9.539   9.527 1.00 . A A . 183 LYS HZ2  1 1 
        3  5103 1 1 105 LYS HZ3  H   9.093 -10.779   9.493 1.00 . A A . 183 LYS HZ3  1 1 
        3  5104 1 1 105 LYS N    N  10.568  -8.353   2.213 1.00 . A A . 183 LYS N    1 1 
        3  5105 1 1 105 LYS NZ   N   9.298  -9.807   9.185 1.00 . A A . 183 LYS NZ   1 1 
        3  5106 1 1 105 LYS O    O  10.481 -11.644   3.619 1.00 . A A . 183 LYS O    1 1 
        3  5107 1 1 106 LEU C    C   8.880 -12.534   0.751 1.00 . A A . 184 LEU C    1 1 
        3  5108 1 1 106 LEU CA   C   8.282 -11.784   1.941 1.00 . A A . 184 LEU CA   1 1 
        3  5109 1 1 106 LEU CB   C   6.821 -11.426   1.649 1.00 . A A . 184 LEU CB   1 1 
        3  5110 1 1 106 LEU CD1  C   4.593 -11.352   2.797 1.00 . A A . 184 LEU CD1  1 1 
        3  5111 1 1 106 LEU CD2  C   6.678 -11.183   4.161 1.00 . A A . 184 LEU CD2  1 1 
        3  5112 1 1 106 LEU CG   C   6.025 -10.843   2.826 1.00 . A A . 184 LEU CG   1 1 
        3  5113 1 1 106 LEU H    H   8.787  -9.731   1.837 1.00 . A A . 184 LEU H    1 1 
        3  5114 1 1 106 LEU HA   H   8.316 -12.427   2.807 1.00 . A A . 184 LEU HA   1 1 
        3  5115 1 1 106 LEU HB2  H   6.807 -10.705   0.844 1.00 . A A . 184 LEU HB2  1 1 
        3  5116 1 1 106 LEU HB3  H   6.318 -12.320   1.313 1.00 . A A . 184 LEU HB3  1 1 
        3  5117 1 1 106 LEU HD11 H   4.075 -10.922   1.953 1.00 . A A . 184 LEU HD11 1 1 
        3  5118 1 1 106 LEU HD12 H   4.092 -11.069   3.710 1.00 . A A . 184 LEU HD12 1 1 
        3  5119 1 1 106 LEU HD13 H   4.597 -12.428   2.706 1.00 . A A . 184 LEU HD13 1 1 
        3  5120 1 1 106 LEU HD21 H   7.675 -10.768   4.189 1.00 . A A . 184 LEU HD21 1 1 
        3  5121 1 1 106 LEU HD22 H   6.731 -12.255   4.273 1.00 . A A . 184 LEU HD22 1 1 
        3  5122 1 1 106 LEU HD23 H   6.091 -10.765   4.965 1.00 . A A . 184 LEU HD23 1 1 
        3  5123 1 1 106 LEU HG   H   5.995  -9.767   2.732 1.00 . A A . 184 LEU HG   1 1 
        3  5124 1 1 106 LEU N    N   9.048 -10.581   2.248 1.00 . A A . 184 LEU N    1 1 
        3  5125 1 1 106 LEU O    O   8.486 -13.664   0.461 1.00 . A A . 184 LEU O    1 1 
        3  5126 1 1 107 SER C    C   9.469 -12.746  -2.216 1.00 . A A . 185 SER C    1 1 
        3  5127 1 1 107 SER CA   C  10.474 -12.520  -1.092 1.00 . A A . 185 SER CA   1 1 
        3  5128 1 1 107 SER CB   C  11.123 -13.848  -0.696 1.00 . A A . 185 SER CB   1 1 
        3  5129 1 1 107 SER H    H  10.105 -11.005   0.338 1.00 . A A . 185 SER H    1 1 
        3  5130 1 1 107 SER HA   H  11.241 -11.845  -1.442 1.00 . A A . 185 SER HA   1 1 
        3  5131 1 1 107 SER HB2  H  11.345 -13.837   0.361 1.00 . A A . 185 SER HB2  1 1 
        3  5132 1 1 107 SER HB3  H  10.440 -14.657  -0.911 1.00 . A A . 185 SER HB3  1 1 
        3  5133 1 1 107 SER HG   H  12.664 -14.939  -1.216 1.00 . A A . 185 SER HG   1 1 
        3  5134 1 1 107 SER N    N   9.830 -11.904   0.064 1.00 . A A . 185 SER N    1 1 
        3  5135 1 1 107 SER O    O   9.564 -13.722  -2.960 1.00 . A A . 185 SER O    1 1 
        3  5136 1 1 107 SER OG   O  12.326 -14.062  -1.413 1.00 . A A . 185 SER OG   1 1 
        3  5137 1 1 108 MET C    C   7.781 -10.990  -4.526 1.00 . A A . 186 MET C    1 1 
        3  5138 1 1 108 MET CA   C   7.483 -11.938  -3.368 1.00 . A A . 186 MET CA   1 1 
        3  5139 1 1 108 MET CB   C   6.104 -11.630  -2.782 1.00 . A A . 186 MET CB   1 1 
        3  5140 1 1 108 MET CE   C   3.206  -9.921  -2.380 1.00 . A A . 186 MET CE   1 1 
        3  5141 1 1 108 MET CG   C   5.961 -10.202  -2.278 1.00 . A A . 186 MET CG   1 1 
        3  5142 1 1 108 MET H    H   8.483 -11.081  -1.711 1.00 . A A . 186 MET H    1 1 
        3  5143 1 1 108 MET HA   H   7.487 -12.952  -3.739 1.00 . A A . 186 MET HA   1 1 
        3  5144 1 1 108 MET HB2  H   5.357 -11.796  -3.544 1.00 . A A . 186 MET HB2  1 1 
        3  5145 1 1 108 MET HB3  H   5.918 -12.300  -1.956 1.00 . A A . 186 MET HB3  1 1 
        3  5146 1 1 108 MET HE1  H   3.429  -9.174  -3.127 1.00 . A A . 186 MET HE1  1 1 
        3  5147 1 1 108 MET HE2  H   2.286  -9.663  -1.876 1.00 . A A . 186 MET HE2  1 1 
        3  5148 1 1 108 MET HE3  H   3.098 -10.885  -2.856 1.00 . A A . 186 MET HE3  1 1 
        3  5149 1 1 108 MET HG2  H   6.855  -9.935  -1.736 1.00 . A A . 186 MET HG2  1 1 
        3  5150 1 1 108 MET HG3  H   5.847  -9.545  -3.128 1.00 . A A . 186 MET HG3  1 1 
        3  5151 1 1 108 MET N    N   8.506 -11.837  -2.334 1.00 . A A . 186 MET N    1 1 
        3  5152 1 1 108 MET O    O   6.870 -10.541  -5.222 1.00 . A A . 186 MET O    1 1 
        3  5153 1 1 108 MET SD   S   4.540  -9.990  -1.188 1.00 . A A . 186 MET SD   1 1 
        3  5154 1 1 109 TYR C    C   9.819 -10.584  -7.063 1.00 . A A . 187 TYR C    1 1 
        3  5155 1 1 109 TYR CA   C   9.474  -9.796  -5.803 1.00 . A A . 187 TYR CA   1 1 
        3  5156 1 1 109 TYR CB   C  10.677  -8.959  -5.363 1.00 . A A . 187 TYR CB   1 1 
        3  5157 1 1 109 TYR CD1  C   9.714  -7.343  -3.679 1.00 . A A . 187 TYR CD1  1 1 
        3  5158 1 1 109 TYR CD2  C  10.561  -6.463  -5.727 1.00 . A A . 187 TYR CD2  1 1 
        3  5159 1 1 109 TYR CE1  C   9.377  -6.069  -3.266 1.00 . A A . 187 TYR CE1  1 1 
        3  5160 1 1 109 TYR CE2  C  10.227  -5.186  -5.320 1.00 . A A . 187 TYR CE2  1 1 
        3  5161 1 1 109 TYR CG   C  10.311  -7.562  -4.915 1.00 . A A . 187 TYR CG   1 1 
        3  5162 1 1 109 TYR CZ   C   9.635  -4.994  -4.090 1.00 . A A . 187 TYR CZ   1 1 
        3  5163 1 1 109 TYR H    H   9.742 -11.079  -4.141 1.00 . A A . 187 TYR H    1 1 
        3  5164 1 1 109 TYR HA   H   8.648  -9.136  -6.021 1.00 . A A . 187 TYR HA   1 1 
        3  5165 1 1 109 TYR HB2  H  11.169  -9.453  -4.539 1.00 . A A . 187 TYR HB2  1 1 
        3  5166 1 1 109 TYR HB3  H  11.369  -8.872  -6.189 1.00 . A A . 187 TYR HB3  1 1 
        3  5167 1 1 109 TYR HD1  H   9.513  -8.188  -3.036 1.00 . A A . 187 TYR HD1  1 1 
        3  5168 1 1 109 TYR HD2  H  11.023  -6.617  -6.690 1.00 . A A . 187 TYR HD2  1 1 
        3  5169 1 1 109 TYR HE1  H   8.915  -5.919  -2.302 1.00 . A A . 187 TYR HE1  1 1 
        3  5170 1 1 109 TYR HE2  H  10.429  -4.344  -5.966 1.00 . A A . 187 TYR HE2  1 1 
        3  5171 1 1 109 TYR HH   H   8.689  -3.335  -4.311 1.00 . A A . 187 TYR HH   1 1 
        3  5172 1 1 109 TYR N    N   9.060 -10.690  -4.728 1.00 . A A . 187 TYR N    1 1 
        3  5173 1 1 109 TYR O    O   9.500 -10.099  -8.169 1.00 . A A . 187 TYR O    1 1 
        3  5174 1 1 109 TYR OXT  O  10.405 -11.680  -6.933 1.00 . A A . 187 TYR OXT  1 1 
        3  5175 1 1 109 TYR OH   O   9.302  -3.723  -3.681 1.00 . A A . 187 TYR OH   1 1 
        4  5176 1 1   1 GLY C    C  28.348  13.774  -0.134 1.00 . A A .  79 GLY C    1 1 
        4  5177 1 1   1 GLY CA   C  29.660  14.527  -0.233 1.00 . A A .  79 GLY CA   1 1 
        4  5178 1 1   1 GLY H1   H  30.357  16.264   0.695 1.00 . A A .  79 GLY H1   1 1 
        4  5179 1 1   1 GLY H2   H  28.674  16.095   0.733 1.00 . A A .  79 GLY H2   1 1 
        4  5180 1 1   1 GLY H3   H  29.446  16.552  -0.701 1.00 . A A .  79 GLY H3   1 1 
        4  5181 1 1   1 GLY HA2  H  30.018  14.470  -1.251 1.00 . A A .  79 GLY HA2  1 1 
        4  5182 1 1   1 GLY HA3  H  30.382  14.058   0.418 1.00 . A A .  79 GLY HA3  1 1 
        4  5183 1 1   1 GLY N    N  29.525  15.960   0.150 1.00 . A A .  79 GLY N    1 1 
        4  5184 1 1   1 GLY O    O  27.781  13.642   0.951 1.00 . A A .  79 GLY O    1 1 
        4  5185 1 1   2 SER C    C  26.597  11.549  -2.468 1.00 . A A .  80 SER C    1 1 
        4  5186 1 1   2 SER CA   C  26.611  12.535  -1.305 1.00 . A A .  80 SER CA   1 1 
        4  5187 1 1   2 SER CB   C  25.427  13.496  -1.421 1.00 . A A .  80 SER CB   1 1 
        4  5188 1 1   2 SER H    H  28.363  13.417  -2.101 1.00 . A A .  80 SER H    1 1 
        4  5189 1 1   2 SER HA   H  26.526  11.983  -0.380 1.00 . A A .  80 SER HA   1 1 
        4  5190 1 1   2 SER HB2  H  25.708  14.460  -1.025 1.00 . A A .  80 SER HB2  1 1 
        4  5191 1 1   2 SER HB3  H  25.151  13.600  -2.461 1.00 . A A .  80 SER HB3  1 1 
        4  5192 1 1   2 SER HG   H  23.972  12.220  -1.118 1.00 . A A .  80 SER HG   1 1 
        4  5193 1 1   2 SER N    N  27.865  13.279  -1.268 1.00 . A A .  80 SER N    1 1 
        4  5194 1 1   2 SER O    O  26.609  11.948  -3.633 1.00 . A A .  80 SER O    1 1 
        4  5195 1 1   2 SER OG   O  24.307  13.015  -0.698 1.00 . A A .  80 SER OG   1 1 
        4  5196 1 1   3 HIS C    C  25.153   9.047  -3.744 1.00 . A A .  81 HIS C    1 1 
        4  5197 1 1   3 HIS CA   C  26.553   9.217  -3.164 1.00 . A A .  81 HIS CA   1 1 
        4  5198 1 1   3 HIS CB   C  27.039   7.892  -2.576 1.00 . A A .  81 HIS CB   1 1 
        4  5199 1 1   3 HIS CD2  C  29.039   7.112  -4.033 1.00 . A A .  81 HIS CD2  1 1 
        4  5200 1 1   3 HIS CE1  C  28.086   5.383  -4.985 1.00 . A A .  81 HIS CE1  1 1 
        4  5201 1 1   3 HIS CG   C  27.773   7.033  -3.559 1.00 . A A .  81 HIS CG   1 1 
        4  5202 1 1   3 HIS H    H  26.562  10.004  -1.199 1.00 . A A .  81 HIS H    1 1 
        4  5203 1 1   3 HIS HA   H  27.224   9.516  -3.956 1.00 . A A .  81 HIS HA   1 1 
        4  5204 1 1   3 HIS HB2  H  27.706   8.095  -1.751 1.00 . A A .  81 HIS HB2  1 1 
        4  5205 1 1   3 HIS HB3  H  26.188   7.333  -2.215 1.00 . A A .  81 HIS HB3  1 1 
        4  5206 1 1   3 HIS HD1  H  26.286   5.619  -4.041 1.00 . A A .  81 HIS HD1  1 1 
        4  5207 1 1   3 HIS HD2  H  29.779   7.854  -3.765 1.00 . A A .  81 HIS HD2  1 1 
        4  5208 1 1   3 HIS HE1  H  27.919   4.510  -5.599 1.00 . A A .  81 HIS HE1  1 1 
        4  5209 1 1   3 HIS HE2  H  29.996   5.930  -5.480 1.00 . A A .  81 HIS HE2  1 1 
        4  5210 1 1   3 HIS N    N  26.570  10.260  -2.145 1.00 . A A .  81 HIS N    1 1 
        4  5211 1 1   3 HIS ND1  N  27.203   5.940  -4.176 1.00 . A A .  81 HIS ND1  1 1 
        4  5212 1 1   3 HIS NE2  N  29.208   6.076  -4.917 1.00 . A A .  81 HIS NE2  1 1 
        4  5213 1 1   3 HIS O    O  24.945   9.200  -4.948 1.00 . A A .  81 HIS O    1 1 
        4  5214 1 1   4 MET C    C  22.232   9.839  -3.854 1.00 . A A .  82 MET C    1 1 
        4  5215 1 1   4 MET CA   C  22.813   8.540  -3.305 1.00 . A A .  82 MET CA   1 1 
        4  5216 1 1   4 MET CB   C  21.961   8.038  -2.136 1.00 . A A .  82 MET CB   1 1 
        4  5217 1 1   4 MET CE   C  19.471   5.905  -0.672 1.00 . A A .  82 MET CE   1 1 
        4  5218 1 1   4 MET CG   C  21.725   6.536  -2.157 1.00 . A A .  82 MET CG   1 1 
        4  5219 1 1   4 MET H    H  24.422   8.622  -1.932 1.00 . A A .  82 MET H    1 1 
        4  5220 1 1   4 MET HA   H  22.807   7.797  -4.089 1.00 . A A .  82 MET HA   1 1 
        4  5221 1 1   4 MET HB2  H  22.457   8.289  -1.211 1.00 . A A .  82 MET HB2  1 1 
        4  5222 1 1   4 MET HB3  H  21.001   8.532  -2.166 1.00 . A A .  82 MET HB3  1 1 
        4  5223 1 1   4 MET HE1  H  19.085   4.914  -0.484 1.00 . A A .  82 MET HE1  1 1 
        4  5224 1 1   4 MET HE2  H  19.186   6.221  -1.664 1.00 . A A .  82 MET HE2  1 1 
        4  5225 1 1   4 MET HE3  H  19.065   6.594   0.055 1.00 . A A .  82 MET HE3  1 1 
        4  5226 1 1   4 MET HG2  H  20.933   6.319  -2.859 1.00 . A A .  82 MET HG2  1 1 
        4  5227 1 1   4 MET HG3  H  22.633   6.047  -2.478 1.00 . A A .  82 MET HG3  1 1 
        4  5228 1 1   4 MET N    N  24.195   8.730  -2.879 1.00 . A A .  82 MET N    1 1 
        4  5229 1 1   4 MET O    O  22.761  10.922  -3.605 1.00 . A A .  82 MET O    1 1 
        4  5230 1 1   4 MET SD   S  21.257   5.884  -0.542 1.00 . A A .  82 MET SD   1 1 
        4  5231 1 1   5 ASP C    C  19.765  11.703  -4.114 1.00 . A A .  83 ASP C    1 1 
        4  5232 1 1   5 ASP CA   C  20.489  10.890  -5.187 1.00 . A A .  83 ASP CA   1 1 
        4  5233 1 1   5 ASP CB   C  19.497  10.457  -6.268 1.00 . A A .  83 ASP CB   1 1 
        4  5234 1 1   5 ASP CG   C  20.185  10.061  -7.560 1.00 . A A .  83 ASP CG   1 1 
        4  5235 1 1   5 ASP H    H  20.764   8.834  -4.767 1.00 . A A .  83 ASP H    1 1 
        4  5236 1 1   5 ASP HA   H  21.253  11.504  -5.637 1.00 . A A .  83 ASP HA   1 1 
        4  5237 1 1   5 ASP HB2  H  18.930   9.611  -5.910 1.00 . A A .  83 ASP HB2  1 1 
        4  5238 1 1   5 ASP HB3  H  18.822  11.275  -6.476 1.00 . A A .  83 ASP HB3  1 1 
        4  5239 1 1   5 ASP N    N  21.140   9.724  -4.603 1.00 . A A .  83 ASP N    1 1 
        4  5240 1 1   5 ASP O    O  19.014  11.151  -3.310 1.00 . A A .  83 ASP O    1 1 
        4  5241 1 1   5 ASP OD1  O  21.359   9.640  -7.502 1.00 . A A .  83 ASP OD1  1 1 
        4  5242 1 1   5 ASP OD2  O  19.549  10.172  -8.629 1.00 . A A .  83 ASP OD2  1 1 
        4  5243 1 1   6 PRO C    C  17.860  14.127  -3.392 1.00 . A A .  84 PRO C    1 1 
        4  5244 1 1   6 PRO CA   C  19.342  13.911  -3.100 1.00 . A A .  84 PRO CA   1 1 
        4  5245 1 1   6 PRO CB   C  20.112  15.223  -3.248 1.00 . A A .  84 PRO CB   1 1 
        4  5246 1 1   6 PRO CD   C  20.861  13.780  -5.003 1.00 . A A .  84 PRO CD   1 1 
        4  5247 1 1   6 PRO CG   C  20.590  15.220  -4.658 1.00 . A A .  84 PRO CG   1 1 
        4  5248 1 1   6 PRO HA   H  19.459  13.532  -2.096 1.00 . A A .  84 PRO HA   1 1 
        4  5249 1 1   6 PRO HB2  H  19.451  16.055  -3.056 1.00 . A A .  84 PRO HB2  1 1 
        4  5250 1 1   6 PRO HB3  H  20.937  15.241  -2.552 1.00 . A A .  84 PRO HB3  1 1 
        4  5251 1 1   6 PRO HD2  H  20.600  13.583  -6.032 1.00 . A A .  84 PRO HD2  1 1 
        4  5252 1 1   6 PRO HD3  H  21.899  13.538  -4.824 1.00 . A A .  84 PRO HD3  1 1 
        4  5253 1 1   6 PRO HG2  H  19.826  15.623  -5.306 1.00 . A A .  84 PRO HG2  1 1 
        4  5254 1 1   6 PRO HG3  H  21.497  15.801  -4.740 1.00 . A A .  84 PRO HG3  1 1 
        4  5255 1 1   6 PRO N    N  19.981  13.032  -4.084 1.00 . A A .  84 PRO N    1 1 
        4  5256 1 1   6 PRO O    O  17.073  14.402  -2.486 1.00 . A A .  84 PRO O    1 1 
        4  5257 1 1   7 ALA C    C  15.376  12.848  -5.183 1.00 . A A .  85 ALA C    1 1 
        4  5258 1 1   7 ALA CA   C  16.101  14.186  -5.072 1.00 . A A .  85 ALA CA   1 1 
        4  5259 1 1   7 ALA CB   C  16.038  14.933  -6.395 1.00 . A A .  85 ALA CB   1 1 
        4  5260 1 1   7 ALA H    H  18.161  13.783  -5.338 1.00 . A A .  85 ALA H    1 1 
        4  5261 1 1   7 ALA HA   H  15.609  14.789  -4.323 1.00 . A A .  85 ALA HA   1 1 
        4  5262 1 1   7 ALA HB1  H  15.006  15.112  -6.660 1.00 . A A .  85 ALA HB1  1 1 
        4  5263 1 1   7 ALA HB2  H  16.510  14.341  -7.166 1.00 . A A .  85 ALA HB2  1 1 
        4  5264 1 1   7 ALA HB3  H  16.554  15.877  -6.300 1.00 . A A .  85 ALA HB3  1 1 
        4  5265 1 1   7 ALA N    N  17.487  14.002  -4.661 1.00 . A A .  85 ALA N    1 1 
        4  5266 1 1   7 ALA O    O  14.158  12.777  -5.018 1.00 . A A .  85 ALA O    1 1 
        4  5267 1 1   8 GLN C    C  14.538  10.421  -6.737 1.00 . A A .  86 GLN C    1 1 
        4  5268 1 1   8 GLN CA   C  15.552  10.457  -5.598 1.00 . A A .  86 GLN CA   1 1 
        4  5269 1 1   8 GLN CB   C  14.884  10.036  -4.288 1.00 . A A .  86 GLN CB   1 1 
        4  5270 1 1   8 GLN CD   C  15.109   9.736  -1.790 1.00 . A A .  86 GLN CD   1 1 
        4  5271 1 1   8 GLN CG   C  15.782  10.187  -3.071 1.00 . A A .  86 GLN CG   1 1 
        4  5272 1 1   8 GLN H    H  17.095  11.907  -5.587 1.00 . A A .  86 GLN H    1 1 
        4  5273 1 1   8 GLN HA   H  16.353   9.769  -5.822 1.00 . A A .  86 GLN HA   1 1 
        4  5274 1 1   8 GLN HB2  H  14.002  10.641  -4.136 1.00 . A A .  86 GLN HB2  1 1 
        4  5275 1 1   8 GLN HB3  H  14.589   8.999  -4.364 1.00 . A A .  86 GLN HB3  1 1 
        4  5276 1 1   8 GLN HE21 H  14.992  11.619  -1.160 1.00 . A A .  86 GLN HE21 1 1 
        4  5277 1 1   8 GLN HE22 H  14.346  10.427  -0.088 1.00 . A A .  86 GLN HE22 1 1 
        4  5278 1 1   8 GLN HG2  H  16.671   9.593  -3.220 1.00 . A A .  86 GLN HG2  1 1 
        4  5279 1 1   8 GLN HG3  H  16.057  11.227  -2.970 1.00 . A A .  86 GLN HG3  1 1 
        4  5280 1 1   8 GLN N    N  16.130  11.790  -5.465 1.00 . A A .  86 GLN N    1 1 
        4  5281 1 1   8 GLN NE2  N  14.783  10.690  -0.925 1.00 . A A .  86 GLN NE2  1 1 
        4  5282 1 1   8 GLN O    O  13.462   9.837  -6.608 1.00 . A A .  86 GLN O    1 1 
        4  5283 1 1   8 GLN OE1  O  14.884   8.545  -1.579 1.00 . A A .  86 GLN OE1  1 1 
        4  5284 1 1   9 LEU C    C  13.717   9.699  -9.541 1.00 . A A .  87 LEU C    1 1 
        4  5285 1 1   9 LEU CA   C  14.012  11.101  -9.015 1.00 . A A .  87 LEU CA   1 1 
        4  5286 1 1   9 LEU CB   C  14.644  11.948 -10.122 1.00 . A A .  87 LEU CB   1 1 
        4  5287 1 1   9 LEU CD1  C  15.713  14.090 -10.866 1.00 . A A .  87 LEU CD1  1 1 
        4  5288 1 1   9 LEU CD2  C  14.025  14.114  -9.022 1.00 . A A .  87 LEU CD2  1 1 
        4  5289 1 1   9 LEU CG   C  15.146  13.324  -9.681 1.00 . A A .  87 LEU CG   1 1 
        4  5290 1 1   9 LEU H    H  15.760  11.503  -7.892 1.00 . A A .  87 LEU H    1 1 
        4  5291 1 1   9 LEU HA   H  13.084  11.560  -8.711 1.00 . A A .  87 LEU HA   1 1 
        4  5292 1 1   9 LEU HB2  H  15.479  11.399 -10.534 1.00 . A A .  87 LEU HB2  1 1 
        4  5293 1 1   9 LEU HB3  H  13.910  12.090 -10.901 1.00 . A A .  87 LEU HB3  1 1 
        4  5294 1 1   9 LEU HD11 H  16.223  14.974 -10.514 1.00 . A A .  87 LEU HD11 1 1 
        4  5295 1 1   9 LEU HD12 H  14.908  14.377 -11.527 1.00 . A A .  87 LEU HD12 1 1 
        4  5296 1 1   9 LEU HD13 H  16.410  13.461 -11.401 1.00 . A A .  87 LEU HD13 1 1 
        4  5297 1 1   9 LEU HD21 H  14.317  15.150  -8.936 1.00 . A A .  87 LEU HD21 1 1 
        4  5298 1 1   9 LEU HD22 H  13.831  13.712  -8.038 1.00 . A A .  87 LEU HD22 1 1 
        4  5299 1 1   9 LEU HD23 H  13.131  14.041  -9.623 1.00 . A A .  87 LEU HD23 1 1 
        4  5300 1 1   9 LEU HG   H  15.937  13.197  -8.957 1.00 . A A .  87 LEU HG   1 1 
        4  5301 1 1   9 LEU N    N  14.890  11.054  -7.852 1.00 . A A .  87 LEU N    1 1 
        4  5302 1 1   9 LEU O    O  12.566   9.265  -9.564 1.00 . A A .  87 LEU O    1 1 
        4  5303 1 1  10 THR C    C  13.951   6.722  -9.484 1.00 . A A .  88 THR C    1 1 
        4  5304 1 1  10 THR CA   C  14.614   7.647 -10.499 1.00 . A A .  88 THR CA   1 1 
        4  5305 1 1  10 THR CB   C  15.977   7.083 -10.904 1.00 . A A .  88 THR CB   1 1 
        4  5306 1 1  10 THR CG2  C  16.567   7.760 -12.122 1.00 . A A .  88 THR CG2  1 1 
        4  5307 1 1  10 THR H    H  15.656   9.397  -9.928 1.00 . A A .  88 THR H    1 1 
        4  5308 1 1  10 THR HA   H  13.985   7.706 -11.376 1.00 . A A .  88 THR HA   1 1 
        4  5309 1 1  10 THR HB   H  15.867   6.032 -11.131 1.00 . A A .  88 THR HB   1 1 
        4  5310 1 1  10 THR HG1  H  17.611   6.570  -9.954 1.00 . A A .  88 THR HG1  1 1 
        4  5311 1 1  10 THR HG21 H  17.434   8.334 -11.831 1.00 . A A .  88 THR HG21 1 1 
        4  5312 1 1  10 THR HG22 H  15.831   8.417 -12.561 1.00 . A A .  88 THR HG22 1 1 
        4  5313 1 1  10 THR HG23 H  16.857   7.011 -12.845 1.00 . A A .  88 THR HG23 1 1 
        4  5314 1 1  10 THR N    N  14.763   8.997  -9.967 1.00 . A A .  88 THR N    1 1 
        4  5315 1 1  10 THR O    O  12.995   6.017  -9.807 1.00 . A A .  88 THR O    1 1 
        4  5316 1 1  10 THR OG1  O  16.908   7.215  -9.846 1.00 . A A .  88 THR OG1  1 1 
        4  5317 1 1  11 GLU C    C  12.419   6.157  -7.016 1.00 . A A .  89 GLU C    1 1 
        4  5318 1 1  11 GLU CA   C  13.909   5.883  -7.200 1.00 . A A .  89 GLU CA   1 1 
        4  5319 1 1  11 GLU CB   C  14.650   6.113  -5.884 1.00 . A A .  89 GLU CB   1 1 
        4  5320 1 1  11 GLU CD   C  16.867   7.163  -5.279 1.00 . A A .  89 GLU CD   1 1 
        4  5321 1 1  11 GLU CG   C  16.163   6.039  -6.014 1.00 . A A .  89 GLU CG   1 1 
        4  5322 1 1  11 GLU H    H  15.223   7.309  -8.054 1.00 . A A .  89 GLU H    1 1 
        4  5323 1 1  11 GLU HA   H  14.039   4.854  -7.499 1.00 . A A .  89 GLU HA   1 1 
        4  5324 1 1  11 GLU HB2  H  14.388   7.088  -5.504 1.00 . A A .  89 GLU HB2  1 1 
        4  5325 1 1  11 GLU HB3  H  14.334   5.362  -5.175 1.00 . A A .  89 GLU HB3  1 1 
        4  5326 1 1  11 GLU HG2  H  16.501   5.097  -5.608 1.00 . A A .  89 GLU HG2  1 1 
        4  5327 1 1  11 GLU HG3  H  16.425   6.093  -7.061 1.00 . A A .  89 GLU HG3  1 1 
        4  5328 1 1  11 GLU N    N  14.461   6.726  -8.255 1.00 . A A .  89 GLU N    1 1 
        4  5329 1 1  11 GLU O    O  11.653   5.267  -6.648 1.00 . A A .  89 GLU O    1 1 
        4  5330 1 1  11 GLU OE1  O  16.350   7.601  -4.230 1.00 . A A .  89 GLU OE1  1 1 
        4  5331 1 1  11 GLU OE2  O  17.935   7.604  -5.752 1.00 . A A .  89 GLU OE2  1 1 
        4  5332 1 1  12 ASP C    C   9.809   7.112  -8.278 1.00 . A A .  90 ASP C    1 1 
        4  5333 1 1  12 ASP CA   C  10.616   7.774  -7.169 1.00 . A A .  90 ASP CA   1 1 
        4  5334 1 1  12 ASP CB   C  10.466   9.295  -7.244 1.00 . A A .  90 ASP CB   1 1 
        4  5335 1 1  12 ASP CG   C   9.095   9.765  -6.799 1.00 . A A .  90 ASP CG   1 1 
        4  5336 1 1  12 ASP H    H  12.678   8.051  -7.585 1.00 . A A .  90 ASP H    1 1 
        4  5337 1 1  12 ASP HA   H  10.253   7.426  -6.213 1.00 . A A .  90 ASP HA   1 1 
        4  5338 1 1  12 ASP HB2  H  11.207   9.756  -6.607 1.00 . A A .  90 ASP HB2  1 1 
        4  5339 1 1  12 ASP HB3  H  10.624   9.616  -8.263 1.00 . A A .  90 ASP HB3  1 1 
        4  5340 1 1  12 ASP N    N  12.016   7.392  -7.288 1.00 . A A .  90 ASP N    1 1 
        4  5341 1 1  12 ASP O    O   8.755   6.524  -8.034 1.00 . A A .  90 ASP O    1 1 
        4  5342 1 1  12 ASP OD1  O   8.128   9.590  -7.571 1.00 . A A .  90 ASP OD1  1 1 
        4  5343 1 1  12 ASP OD2  O   8.987  10.308  -5.680 1.00 . A A .  90 ASP OD2  1 1 
        4  5344 1 1  13 ILE C    C   9.596   5.106 -10.546 1.00 . A A .  91 ILE C    1 1 
        4  5345 1 1  13 ILE CA   C   9.669   6.627 -10.661 1.00 . A A .  91 ILE CA   1 1 
        4  5346 1 1  13 ILE CB   C  10.414   6.992 -11.960 1.00 . A A .  91 ILE CB   1 1 
        4  5347 1 1  13 ILE CD1  C   9.259   9.262 -11.979 1.00 . A A .  91 ILE CD1  1 1 
        4  5348 1 1  13 ILE CG1  C  10.567   8.510 -12.083 1.00 . A A .  91 ILE CG1  1 1 
        4  5349 1 1  13 ILE CG2  C   9.686   6.427 -13.169 1.00 . A A .  91 ILE CG2  1 1 
        4  5350 1 1  13 ILE H    H  11.162   7.702  -9.621 1.00 . A A .  91 ILE H    1 1 
        4  5351 1 1  13 ILE HA   H   8.666   7.025 -10.720 1.00 . A A .  91 ILE HA   1 1 
        4  5352 1 1  13 ILE HB   H  11.395   6.543 -11.922 1.00 . A A .  91 ILE HB   1 1 
        4  5353 1 1  13 ILE HD11 H   8.437   8.564 -12.041 1.00 . A A .  91 ILE HD11 1 1 
        4  5354 1 1  13 ILE HD12 H   9.189   9.975 -12.786 1.00 . A A .  91 ILE HD12 1 1 
        4  5355 1 1  13 ILE HD13 H   9.218   9.782 -11.034 1.00 . A A .  91 ILE HD13 1 1 
        4  5356 1 1  13 ILE HG12 H  11.215   8.864 -11.296 1.00 . A A .  91 ILE HG12 1 1 
        4  5357 1 1  13 ILE HG13 H  11.010   8.744 -13.040 1.00 . A A .  91 ILE HG13 1 1 
        4  5358 1 1  13 ILE HG21 H   9.684   5.348 -13.114 1.00 . A A .  91 ILE HG21 1 1 
        4  5359 1 1  13 ILE HG22 H  10.188   6.741 -14.072 1.00 . A A .  91 ILE HG22 1 1 
        4  5360 1 1  13 ILE HG23 H   8.668   6.788 -13.178 1.00 . A A .  91 ILE HG23 1 1 
        4  5361 1 1  13 ILE N    N  10.322   7.213  -9.499 1.00 . A A .  91 ILE N    1 1 
        4  5362 1 1  13 ILE O    O   8.542   4.507 -10.762 1.00 . A A .  91 ILE O    1 1 
        4  5363 1 1  14 THR C    C   9.828   2.538  -9.001 1.00 . A A .  92 THR C    1 1 
        4  5364 1 1  14 THR CA   C  10.786   3.037 -10.083 1.00 . A A .  92 THR CA   1 1 
        4  5365 1 1  14 THR CB   C  12.220   2.582  -9.779 1.00 . A A .  92 THR CB   1 1 
        4  5366 1 1  14 THR CG2  C  12.686   2.945  -8.389 1.00 . A A .  92 THR CG2  1 1 
        4  5367 1 1  14 THR H    H  11.532   5.021 -10.060 1.00 . A A .  92 THR H    1 1 
        4  5368 1 1  14 THR HA   H  10.483   2.613 -11.029 1.00 . A A .  92 THR HA   1 1 
        4  5369 1 1  14 THR HB   H  12.894   3.050 -10.484 1.00 . A A .  92 THR HB   1 1 
        4  5370 1 1  14 THR HG1  H  11.676   0.745  -9.374 1.00 . A A .  92 THR HG1  1 1 
        4  5371 1 1  14 THR HG21 H  12.469   3.984  -8.201 1.00 . A A .  92 THR HG21 1 1 
        4  5372 1 1  14 THR HG22 H  13.750   2.778  -8.311 1.00 . A A .  92 THR HG22 1 1 
        4  5373 1 1  14 THR HG23 H  12.171   2.331  -7.664 1.00 . A A .  92 THR HG23 1 1 
        4  5374 1 1  14 THR N    N  10.724   4.488 -10.214 1.00 . A A .  92 THR N    1 1 
        4  5375 1 1  14 THR O    O   9.044   1.620  -9.235 1.00 . A A .  92 THR O    1 1 
        4  5376 1 1  14 THR OG1  O  12.339   1.178  -9.917 1.00 . A A .  92 THR OG1  1 1 
        4  5377 1 1  15 ARG C    C   7.579   2.775  -7.066 1.00 . A A .  93 ARG C    1 1 
        4  5378 1 1  15 ARG CA   C   9.059   2.735  -6.694 1.00 . A A .  93 ARG CA   1 1 
        4  5379 1 1  15 ARG CB   C   9.320   3.647  -5.495 1.00 . A A .  93 ARG CB   1 1 
        4  5380 1 1  15 ARG CD   C   9.127   3.835  -2.996 1.00 . A A .  93 ARG CD   1 1 
        4  5381 1 1  15 ARG CG   C   8.492   3.298  -4.269 1.00 . A A .  93 ARG CG   1 1 
        4  5382 1 1  15 ARG CZ   C   9.428   5.997  -1.851 1.00 . A A .  93 ARG CZ   1 1 
        4  5383 1 1  15 ARG H    H  10.563   3.846  -7.673 1.00 . A A .  93 ARG H    1 1 
        4  5384 1 1  15 ARG HA   H   9.322   1.723  -6.426 1.00 . A A .  93 ARG HA   1 1 
        4  5385 1 1  15 ARG HB2  H  10.365   3.580  -5.230 1.00 . A A .  93 ARG HB2  1 1 
        4  5386 1 1  15 ARG HB3  H   9.095   4.665  -5.778 1.00 . A A .  93 ARG HB3  1 1 
        4  5387 1 1  15 ARG HD2  H   8.680   3.337  -2.149 1.00 . A A .  93 ARG HD2  1 1 
        4  5388 1 1  15 ARG HD3  H  10.186   3.623  -3.020 1.00 . A A .  93 ARG HD3  1 1 
        4  5389 1 1  15 ARG HE   H   8.406   5.731  -3.544 1.00 . A A .  93 ARG HE   1 1 
        4  5390 1 1  15 ARG HG2  H   7.508   3.729  -4.377 1.00 . A A .  93 ARG HG2  1 1 
        4  5391 1 1  15 ARG HG3  H   8.411   2.223  -4.196 1.00 . A A .  93 ARG HG3  1 1 
        4  5392 1 1  15 ARG HH11 H  10.322   4.432  -0.932 1.00 . A A .  93 ARG HH11 1 1 
        4  5393 1 1  15 ARG HH12 H  10.517   5.964  -0.148 1.00 . A A .  93 ARG HH12 1 1 
        4  5394 1 1  15 ARG HH21 H   8.662   7.745  -2.515 1.00 . A A .  93 ARG HH21 1 1 
        4  5395 1 1  15 ARG HH22 H   9.574   7.845  -1.046 1.00 . A A .  93 ARG HH22 1 1 
        4  5396 1 1  15 ARG N    N   9.905   3.135  -7.812 1.00 . A A .  93 ARG N    1 1 
        4  5397 1 1  15 ARG NE   N   8.934   5.276  -2.855 1.00 . A A .  93 ARG NE   1 1 
        4  5398 1 1  15 ARG NH1  N  10.148   5.416  -0.899 1.00 . A A .  93 ARG NH1  1 1 
        4  5399 1 1  15 ARG NH2  N   9.203   7.303  -1.800 1.00 . A A .  93 ARG NH2  1 1 
        4  5400 1 1  15 ARG O    O   6.834   1.839  -6.777 1.00 . A A .  93 ARG O    1 1 
        4  5401 1 1  16 TYR C    C   5.330   2.845  -9.003 1.00 . A A .  94 TYR C    1 1 
        4  5402 1 1  16 TYR CA   C   5.763   4.006  -8.113 1.00 . A A .  94 TYR CA   1 1 
        4  5403 1 1  16 TYR CB   C   5.561   5.332  -8.848 1.00 . A A .  94 TYR CB   1 1 
        4  5404 1 1  16 TYR CD1  C   3.180   5.596  -8.053 1.00 . A A .  94 TYR CD1  1 1 
        4  5405 1 1  16 TYR CD2  C   3.665   6.090 -10.334 1.00 . A A .  94 TYR CD2  1 1 
        4  5406 1 1  16 TYR CE1  C   1.851   5.913  -8.263 1.00 . A A .  94 TYR CE1  1 1 
        4  5407 1 1  16 TYR CE2  C   2.338   6.408 -10.552 1.00 . A A .  94 TYR CE2  1 1 
        4  5408 1 1  16 TYR CG   C   4.108   5.679  -9.083 1.00 . A A .  94 TYR CG   1 1 
        4  5409 1 1  16 TYR CZ   C   1.436   6.318  -9.514 1.00 . A A .  94 TYR CZ   1 1 
        4  5410 1 1  16 TYR H    H   7.794   4.575  -7.912 1.00 . A A .  94 TYR H    1 1 
        4  5411 1 1  16 TYR HA   H   5.157   4.004  -7.219 1.00 . A A .  94 TYR HA   1 1 
        4  5412 1 1  16 TYR HB2  H   6.002   6.128  -8.268 1.00 . A A .  94 TYR HB2  1 1 
        4  5413 1 1  16 TYR HB3  H   6.050   5.280  -9.810 1.00 . A A .  94 TYR HB3  1 1 
        4  5414 1 1  16 TYR HD1  H   3.508   5.279  -7.074 1.00 . A A .  94 TYR HD1  1 1 
        4  5415 1 1  16 TYR HD2  H   4.375   6.159 -11.146 1.00 . A A .  94 TYR HD2  1 1 
        4  5416 1 1  16 TYR HE1  H   1.145   5.842  -7.449 1.00 . A A .  94 TYR HE1  1 1 
        4  5417 1 1  16 TYR HE2  H   2.013   6.725 -11.532 1.00 . A A .  94 TYR HE2  1 1 
        4  5418 1 1  16 TYR HH   H   0.056   7.422 -10.272 1.00 . A A .  94 TYR HH   1 1 
        4  5419 1 1  16 TYR N    N   7.157   3.859  -7.707 1.00 . A A .  94 TYR N    1 1 
        4  5420 1 1  16 TYR O    O   4.318   2.193  -8.745 1.00 . A A .  94 TYR O    1 1 
        4  5421 1 1  16 TYR OH   O   0.114   6.634  -9.727 1.00 . A A .  94 TYR OH   1 1 
        4  5422 1 1  17 TYR C    C   5.962   0.150 -10.321 1.00 . A A .  95 TYR C    1 1 
        4  5423 1 1  17 TYR CA   C   5.807   1.515 -10.987 1.00 . A A .  95 TYR CA   1 1 
        4  5424 1 1  17 TYR CB   C   6.720   1.607 -12.211 1.00 . A A .  95 TYR CB   1 1 
        4  5425 1 1  17 TYR CD1  C   5.190   3.284 -13.319 1.00 . A A .  95 TYR CD1  1 1 
        4  5426 1 1  17 TYR CD2  C   7.544   3.561 -13.583 1.00 . A A .  95 TYR CD2  1 1 
        4  5427 1 1  17 TYR CE1  C   4.967   4.410 -14.089 1.00 . A A .  95 TYR CE1  1 1 
        4  5428 1 1  17 TYR CE2  C   7.329   4.688 -14.352 1.00 . A A .  95 TYR CE2  1 1 
        4  5429 1 1  17 TYR CG   C   6.480   2.840 -13.054 1.00 . A A .  95 TYR CG   1 1 
        4  5430 1 1  17 TYR CZ   C   6.039   5.108 -14.602 1.00 . A A .  95 TYR CZ   1 1 
        4  5431 1 1  17 TYR H    H   6.898   3.150 -10.204 1.00 . A A .  95 TYR H    1 1 
        4  5432 1 1  17 TYR HA   H   4.782   1.629 -11.307 1.00 . A A .  95 TYR HA   1 1 
        4  5433 1 1  17 TYR HB2  H   7.749   1.624 -11.883 1.00 . A A .  95 TYR HB2  1 1 
        4  5434 1 1  17 TYR HB3  H   6.561   0.740 -12.836 1.00 . A A .  95 TYR HB3  1 1 
        4  5435 1 1  17 TYR HD1  H   4.353   2.735 -12.915 1.00 . A A .  95 TYR HD1  1 1 
        4  5436 1 1  17 TYR HD2  H   8.552   3.229 -13.385 1.00 . A A .  95 TYR HD2  1 1 
        4  5437 1 1  17 TYR HE1  H   3.957   4.739 -14.284 1.00 . A A .  95 TYR HE1  1 1 
        4  5438 1 1  17 TYR HE2  H   8.169   5.235 -14.755 1.00 . A A .  95 TYR HE2  1 1 
        4  5439 1 1  17 TYR HH   H   5.854   7.011 -14.810 1.00 . A A .  95 TYR HH   1 1 
        4  5440 1 1  17 TYR N    N   6.105   2.594 -10.053 1.00 . A A .  95 TYR N    1 1 
        4  5441 1 1  17 TYR O    O   5.301  -0.815 -10.705 1.00 . A A .  95 TYR O    1 1 
        4  5442 1 1  17 TYR OH   O   5.822   6.230 -15.368 1.00 . A A .  95 TYR OH   1 1 
        4  5443 1 1  18 LEU C    C   5.849  -1.571  -7.789 1.00 . A A .  96 LEU C    1 1 
        4  5444 1 1  18 LEU CA   C   7.074  -1.175  -8.607 1.00 . A A .  96 LEU CA   1 1 
        4  5445 1 1  18 LEU CB   C   8.291  -1.039  -7.690 1.00 . A A .  96 LEU CB   1 1 
        4  5446 1 1  18 LEU CD1  C   9.725  -2.620  -9.004 1.00 . A A .  96 LEU CD1  1 1 
        4  5447 1 1  18 LEU CD2  C  10.343  -2.033  -6.653 1.00 . A A .  96 LEU CD2  1 1 
        4  5448 1 1  18 LEU CG   C   9.195  -2.271  -7.622 1.00 . A A .  96 LEU CG   1 1 
        4  5449 1 1  18 LEU H    H   7.334   0.876  -9.057 1.00 . A A .  96 LEU H    1 1 
        4  5450 1 1  18 LEU HA   H   7.268  -1.945  -9.338 1.00 . A A .  96 LEU HA   1 1 
        4  5451 1 1  18 LEU HB2  H   8.883  -0.204  -8.034 1.00 . A A .  96 LEU HB2  1 1 
        4  5452 1 1  18 LEU HB3  H   7.942  -0.822  -6.691 1.00 . A A .  96 LEU HB3  1 1 
        4  5453 1 1  18 LEU HD11 H  10.510  -3.357  -8.912 1.00 . A A .  96 LEU HD11 1 1 
        4  5454 1 1  18 LEU HD12 H  10.119  -1.731  -9.474 1.00 . A A .  96 LEU HD12 1 1 
        4  5455 1 1  18 LEU HD13 H   8.924  -3.022  -9.606 1.00 . A A .  96 LEU HD13 1 1 
        4  5456 1 1  18 LEU HD21 H   9.977  -2.098  -5.639 1.00 . A A .  96 LEU HD21 1 1 
        4  5457 1 1  18 LEU HD22 H  10.760  -1.051  -6.823 1.00 . A A .  96 LEU HD22 1 1 
        4  5458 1 1  18 LEU HD23 H  11.107  -2.780  -6.809 1.00 . A A .  96 LEU HD23 1 1 
        4  5459 1 1  18 LEU HG   H   8.620  -3.111  -7.263 1.00 . A A .  96 LEU HG   1 1 
        4  5460 1 1  18 LEU N    N   6.837   0.074  -9.323 1.00 . A A .  96 LEU N    1 1 
        4  5461 1 1  18 LEU O    O   5.322  -2.674  -7.936 1.00 . A A .  96 LEU O    1 1 
        4  5462 1 1  19 CYS C    C   3.013  -1.236  -6.936 1.00 . A A .  97 CYS C    1 1 
        4  5463 1 1  19 CYS CA   C   4.238  -0.915  -6.087 1.00 . A A .  97 CYS CA   1 1 
        4  5464 1 1  19 CYS CB   C   3.952   0.298  -5.199 1.00 . A A .  97 CYS CB   1 1 
        4  5465 1 1  19 CYS H    H   5.865   0.198  -6.858 1.00 . A A .  97 CYS H    1 1 
        4  5466 1 1  19 CYS HA   H   4.459  -1.765  -5.459 1.00 . A A .  97 CYS HA   1 1 
        4  5467 1 1  19 CYS HB2  H   4.889   0.732  -4.882 1.00 . A A .  97 CYS HB2  1 1 
        4  5468 1 1  19 CYS HB3  H   3.397   1.029  -5.769 1.00 . A A .  97 CYS HB3  1 1 
        4  5469 1 1  19 CYS HG   H   3.569  -0.555  -3.105 1.00 . A A .  97 CYS HG   1 1 
        4  5470 1 1  19 CYS N    N   5.401  -0.663  -6.929 1.00 . A A .  97 CYS N    1 1 
        4  5471 1 1  19 CYS O    O   2.235  -2.130  -6.608 1.00 . A A .  97 CYS O    1 1 
        4  5472 1 1  19 CYS SG   S   2.995  -0.084  -3.713 1.00 . A A .  97 CYS SG   1 1 
        4  5473 1 1  20 LEU C    C   1.704  -2.130  -9.472 1.00 . A A .  98 LEU C    1 1 
        4  5474 1 1  20 LEU CA   C   1.719  -0.704  -8.929 1.00 . A A .  98 LEU CA   1 1 
        4  5475 1 1  20 LEU CB   C   1.774   0.294 -10.087 1.00 . A A .  98 LEU CB   1 1 
        4  5476 1 1  20 LEU CD1  C   1.307   2.586 -10.989 1.00 . A A .  98 LEU CD1  1 1 
        4  5477 1 1  20 LEU CD2  C  -0.169   1.616  -9.217 1.00 . A A .  98 LEU CD2  1 1 
        4  5478 1 1  20 LEU CG   C   1.251   1.693  -9.759 1.00 . A A .  98 LEU CG   1 1 
        4  5479 1 1  20 LEU H    H   3.505   0.201  -8.239 1.00 . A A .  98 LEU H    1 1 
        4  5480 1 1  20 LEU HA   H   0.814  -0.537  -8.365 1.00 . A A .  98 LEU HA   1 1 
        4  5481 1 1  20 LEU HB2  H   2.801   0.382 -10.410 1.00 . A A .  98 LEU HB2  1 1 
        4  5482 1 1  20 LEU HB3  H   1.190  -0.101 -10.904 1.00 . A A .  98 LEU HB3  1 1 
        4  5483 1 1  20 LEU HD11 H   1.577   3.589 -10.693 1.00 . A A .  98 LEU HD11 1 1 
        4  5484 1 1  20 LEU HD12 H   0.340   2.600 -11.468 1.00 . A A .  98 LEU HD12 1 1 
        4  5485 1 1  20 LEU HD13 H   2.045   2.203 -11.678 1.00 . A A .  98 LEU HD13 1 1 
        4  5486 1 1  20 LEU HD21 H  -0.654   0.733  -9.606 1.00 . A A .  98 LEU HD21 1 1 
        4  5487 1 1  20 LEU HD22 H  -0.719   2.494  -9.523 1.00 . A A .  98 LEU HD22 1 1 
        4  5488 1 1  20 LEU HD23 H  -0.140   1.566  -8.139 1.00 . A A .  98 LEU HD23 1 1 
        4  5489 1 1  20 LEU HG   H   1.877   2.135  -8.997 1.00 . A A .  98 LEU HG   1 1 
        4  5490 1 1  20 LEU N    N   2.849  -0.499  -8.031 1.00 . A A .  98 LEU N    1 1 
        4  5491 1 1  20 LEU O    O   0.663  -2.788  -9.486 1.00 . A A .  98 LEU O    1 1 
        4  5492 1 1  21 GLN C    C   2.742  -4.998  -9.382 1.00 . A A .  99 GLN C    1 1 
        4  5493 1 1  21 GLN CA   C   2.982  -3.949 -10.464 1.00 . A A .  99 GLN CA   1 1 
        4  5494 1 1  21 GLN CB   C   4.365  -4.148 -11.087 1.00 . A A .  99 GLN CB   1 1 
        4  5495 1 1  21 GLN CD   C   5.271  -4.457 -13.425 1.00 . A A .  99 GLN CD   1 1 
        4  5496 1 1  21 GLN CG   C   4.493  -3.559 -12.482 1.00 . A A .  99 GLN CG   1 1 
        4  5497 1 1  21 GLN H    H   3.658  -2.029  -9.882 1.00 . A A .  99 GLN H    1 1 
        4  5498 1 1  21 GLN HA   H   2.232  -4.063 -11.231 1.00 . A A .  99 GLN HA   1 1 
        4  5499 1 1  21 GLN HB2  H   5.104  -3.681 -10.453 1.00 . A A .  99 GLN HB2  1 1 
        4  5500 1 1  21 GLN HB3  H   4.571  -5.207 -11.147 1.00 . A A .  99 GLN HB3  1 1 
        4  5501 1 1  21 GLN HE21 H   3.605  -5.423 -13.919 1.00 . A A .  99 GLN HE21 1 1 
        4  5502 1 1  21 GLN HE22 H   5.048  -5.970 -14.695 1.00 . A A .  99 GLN HE22 1 1 
        4  5503 1 1  21 GLN HG2  H   3.504  -3.408 -12.888 1.00 . A A .  99 GLN HG2  1 1 
        4  5504 1 1  21 GLN HG3  H   5.001  -2.608 -12.412 1.00 . A A .  99 GLN HG3  1 1 
        4  5505 1 1  21 GLN N    N   2.863  -2.601  -9.919 1.00 . A A .  99 GLN N    1 1 
        4  5506 1 1  21 GLN NE2  N   4.571  -5.376 -14.079 1.00 . A A .  99 GLN NE2  1 1 
        4  5507 1 1  21 GLN O    O   2.049  -5.990  -9.608 1.00 . A A .  99 GLN O    1 1 
        4  5508 1 1  21 GLN OE1  O   6.487  -4.325 -13.564 1.00 . A A .  99 GLN OE1  1 1 
        4  5509 1 1  22 LEU C    C   1.709  -5.766  -6.641 1.00 . A A . 100 LEU C    1 1 
        4  5510 1 1  22 LEU CA   C   3.166  -5.695  -7.090 1.00 . A A . 100 LEU CA   1 1 
        4  5511 1 1  22 LEU CB   C   4.057  -5.267  -5.920 1.00 . A A . 100 LEU CB   1 1 
        4  5512 1 1  22 LEU CD1  C   6.312  -5.299  -4.822 1.00 . A A . 100 LEU CD1  1 1 
        4  5513 1 1  22 LEU CD2  C   5.228  -7.445  -5.508 1.00 . A A . 100 LEU CD2  1 1 
        4  5514 1 1  22 LEU CG   C   5.412  -5.974  -5.846 1.00 . A A . 100 LEU CG   1 1 
        4  5515 1 1  22 LEU H    H   3.858  -3.960  -8.090 1.00 . A A . 100 LEU H    1 1 
        4  5516 1 1  22 LEU HA   H   3.474  -6.674  -7.426 1.00 . A A . 100 LEU HA   1 1 
        4  5517 1 1  22 LEU HB2  H   4.232  -4.204  -5.999 1.00 . A A . 100 LEU HB2  1 1 
        4  5518 1 1  22 LEU HB3  H   3.527  -5.460  -5.000 1.00 . A A . 100 LEU HB3  1 1 
        4  5519 1 1  22 LEU HD11 H   7.238  -5.847  -4.741 1.00 . A A . 100 LEU HD11 1 1 
        4  5520 1 1  22 LEU HD12 H   5.817  -5.284  -3.862 1.00 . A A . 100 LEU HD12 1 1 
        4  5521 1 1  22 LEU HD13 H   6.519  -4.286  -5.136 1.00 . A A . 100 LEU HD13 1 1 
        4  5522 1 1  22 LEU HD21 H   4.561  -7.899  -6.227 1.00 . A A . 100 LEU HD21 1 1 
        4  5523 1 1  22 LEU HD22 H   4.806  -7.537  -4.518 1.00 . A A . 100 LEU HD22 1 1 
        4  5524 1 1  22 LEU HD23 H   6.185  -7.944  -5.540 1.00 . A A . 100 LEU HD23 1 1 
        4  5525 1 1  22 LEU HG   H   5.898  -5.909  -6.809 1.00 . A A . 100 LEU HG   1 1 
        4  5526 1 1  22 LEU N    N   3.319  -4.770  -8.207 1.00 . A A . 100 LEU N    1 1 
        4  5527 1 1  22 LEU O    O   1.186  -6.845  -6.366 1.00 . A A . 100 LEU O    1 1 
        4  5528 1 1  23 ARG C    C  -1.252  -5.171  -7.202 1.00 . A A . 101 ARG C    1 1 
        4  5529 1 1  23 ARG CA   C  -0.337  -4.534  -6.160 1.00 . A A . 101 ARG CA   1 1 
        4  5530 1 1  23 ARG CB   C  -0.745  -3.078  -5.921 1.00 . A A . 101 ARG CB   1 1 
        4  5531 1 1  23 ARG CD   C  -2.399  -3.393  -4.053 1.00 . A A . 101 ARG CD   1 1 
        4  5532 1 1  23 ARG CG   C  -1.075  -2.771  -4.469 1.00 . A A . 101 ARG CG   1 1 
        4  5533 1 1  23 ARG CZ   C  -3.991  -1.511  -4.069 1.00 . A A . 101 ARG CZ   1 1 
        4  5534 1 1  23 ARG H    H   1.533  -3.782  -6.806 1.00 . A A . 101 ARG H    1 1 
        4  5535 1 1  23 ARG HA   H  -0.435  -5.080  -5.234 1.00 . A A . 101 ARG HA   1 1 
        4  5536 1 1  23 ARG HB2  H   0.065  -2.434  -6.228 1.00 . A A . 101 ARG HB2  1 1 
        4  5537 1 1  23 ARG HB3  H  -1.617  -2.855  -6.520 1.00 . A A . 101 ARG HB3  1 1 
        4  5538 1 1  23 ARG HD2  H  -2.893  -3.783  -4.930 1.00 . A A . 101 ARG HD2  1 1 
        4  5539 1 1  23 ARG HD3  H  -2.202  -4.200  -3.362 1.00 . A A . 101 ARG HD3  1 1 
        4  5540 1 1  23 ARG HE   H  -3.344  -2.448  -2.430 1.00 . A A . 101 ARG HE   1 1 
        4  5541 1 1  23 ARG HG2  H  -0.291  -3.166  -3.841 1.00 . A A . 101 ARG HG2  1 1 
        4  5542 1 1  23 ARG HG3  H  -1.134  -1.700  -4.343 1.00 . A A . 101 ARG HG3  1 1 
        4  5543 1 1  23 ARG HH11 H  -3.352  -2.084  -5.901 1.00 . A A . 101 ARG HH11 1 1 
        4  5544 1 1  23 ARG HH12 H  -4.469  -0.761  -5.885 1.00 . A A . 101 ARG HH12 1 1 
        4  5545 1 1  23 ARG HH21 H  -4.813  -0.708  -2.407 1.00 . A A . 101 ARG HH21 1 1 
        4  5546 1 1  23 ARG HH22 H  -5.298   0.021  -3.902 1.00 . A A . 101 ARG HH22 1 1 
        4  5547 1 1  23 ARG N    N   1.061  -4.608  -6.573 1.00 . A A . 101 ARG N    1 1 
        4  5548 1 1  23 ARG NE   N  -3.280  -2.422  -3.408 1.00 . A A . 101 ARG NE   1 1 
        4  5549 1 1  23 ARG NH1  N  -3.932  -1.447  -5.394 1.00 . A A . 101 ARG NH1  1 1 
        4  5550 1 1  23 ARG NH2  N  -4.764  -0.663  -3.405 1.00 . A A . 101 ARG NH2  1 1 
        4  5551 1 1  23 ARG O    O  -2.322  -5.682  -6.872 1.00 . A A . 101 ARG O    1 1 
        4  5552 1 1  24 GLN C    C  -1.597  -7.243  -9.470 1.00 . A A . 102 GLN C    1 1 
        4  5553 1 1  24 GLN CA   C  -1.607  -5.720  -9.546 1.00 . A A . 102 GLN CA   1 1 
        4  5554 1 1  24 GLN CB   C  -1.058  -5.263 -10.899 1.00 . A A . 102 GLN CB   1 1 
        4  5555 1 1  24 GLN CD   C  -2.724  -3.923 -12.243 1.00 . A A . 102 GLN CD   1 1 
        4  5556 1 1  24 GLN CG   C  -1.529  -3.878 -11.311 1.00 . A A . 102 GLN CG   1 1 
        4  5557 1 1  24 GLN H    H   0.042  -4.731  -8.663 1.00 . A A . 102 GLN H    1 1 
        4  5558 1 1  24 GLN HA   H  -2.624  -5.373  -9.444 1.00 . A A . 102 GLN HA   1 1 
        4  5559 1 1  24 GLN HB2  H   0.021  -5.254 -10.853 1.00 . A A . 102 GLN HB2  1 1 
        4  5560 1 1  24 GLN HB3  H  -1.371  -5.966 -11.657 1.00 . A A . 102 GLN HB3  1 1 
        4  5561 1 1  24 GLN HE21 H  -3.884  -4.571 -10.764 1.00 . A A . 102 GLN HE21 1 1 
        4  5562 1 1  24 GLN HE22 H  -4.661  -4.366 -12.293 1.00 . A A . 102 GLN HE22 1 1 
        4  5563 1 1  24 GLN HG2  H  -1.804  -3.327 -10.424 1.00 . A A . 102 GLN HG2  1 1 
        4  5564 1 1  24 GLN HG3  H  -0.718  -3.370 -11.812 1.00 . A A . 102 GLN HG3  1 1 
        4  5565 1 1  24 GLN N    N  -0.825  -5.141  -8.460 1.00 . A A . 102 GLN N    1 1 
        4  5566 1 1  24 GLN NE2  N  -3.872  -4.327 -11.713 1.00 . A A . 102 GLN NE2  1 1 
        4  5567 1 1  24 GLN O    O  -2.613  -7.895  -9.707 1.00 . A A . 102 GLN O    1 1 
        4  5568 1 1  24 GLN OE1  O  -2.616  -3.597 -13.425 1.00 . A A . 102 GLN OE1  1 1 
        4  5569 1 1  25 ASP C    C  -1.013  -9.795  -7.811 1.00 . A A . 103 ASP C    1 1 
        4  5570 1 1  25 ASP CA   C  -0.287  -9.250  -9.037 1.00 . A A . 103 ASP CA   1 1 
        4  5571 1 1  25 ASP CB   C   1.194  -9.625  -8.974 1.00 . A A . 103 ASP CB   1 1 
        4  5572 1 1  25 ASP CG   C   1.799  -9.818 -10.350 1.00 . A A . 103 ASP CG   1 1 
        4  5573 1 1  25 ASP H    H   0.338  -7.228  -8.968 1.00 . A A . 103 ASP H    1 1 
        4  5574 1 1  25 ASP HA   H  -0.722  -9.692  -9.922 1.00 . A A . 103 ASP HA   1 1 
        4  5575 1 1  25 ASP HB2  H   1.737  -8.838  -8.470 1.00 . A A . 103 ASP HB2  1 1 
        4  5576 1 1  25 ASP HB3  H   1.303 -10.545  -8.419 1.00 . A A . 103 ASP HB3  1 1 
        4  5577 1 1  25 ASP N    N  -0.437  -7.803  -9.142 1.00 . A A . 103 ASP N    1 1 
        4  5578 1 1  25 ASP O    O  -1.586 -10.884  -7.850 1.00 . A A . 103 ASP O    1 1 
        4  5579 1 1  25 ASP OD1  O   1.241 -10.611 -11.138 1.00 . A A . 103 ASP OD1  1 1 
        4  5580 1 1  25 ASP OD2  O   2.831  -9.178 -10.641 1.00 . A A . 103 ASP OD2  1 1 
        4  5581 1 1  26 ILE C    C  -3.148  -9.457  -5.623 1.00 . A A . 104 ILE C    1 1 
        4  5582 1 1  26 ILE CA   C  -1.628  -9.450  -5.482 1.00 . A A . 104 ILE CA   1 1 
        4  5583 1 1  26 ILE CB   C  -1.234  -8.533  -4.306 1.00 . A A . 104 ILE CB   1 1 
        4  5584 1 1  26 ILE CD1  C   0.793  -7.138  -3.653 1.00 . A A . 104 ILE CD1  1 1 
        4  5585 1 1  26 ILE CG1  C   0.289  -8.468  -4.170 1.00 . A A . 104 ILE CG1  1 1 
        4  5586 1 1  26 ILE CG2  C  -1.862  -9.027  -3.010 1.00 . A A . 104 ILE CG2  1 1 
        4  5587 1 1  26 ILE H    H  -0.502  -8.180  -6.748 1.00 . A A . 104 ILE H    1 1 
        4  5588 1 1  26 ILE HA   H  -1.296 -10.452  -5.254 1.00 . A A . 104 ILE HA   1 1 
        4  5589 1 1  26 ILE HB   H  -1.613  -7.543  -4.506 1.00 . A A . 104 ILE HB   1 1 
        4  5590 1 1  26 ILE HD11 H   0.041  -6.380  -3.817 1.00 . A A . 104 ILE HD11 1 1 
        4  5591 1 1  26 ILE HD12 H   1.698  -6.867  -4.177 1.00 . A A . 104 ILE HD12 1 1 
        4  5592 1 1  26 ILE HD13 H   0.999  -7.217  -2.596 1.00 . A A . 104 ILE HD13 1 1 
        4  5593 1 1  26 ILE HG12 H   0.615  -9.234  -3.483 1.00 . A A . 104 ILE HG12 1 1 
        4  5594 1 1  26 ILE HG13 H   0.738  -8.642  -5.136 1.00 . A A . 104 ILE HG13 1 1 
        4  5595 1 1  26 ILE HG21 H  -1.517  -8.418  -2.188 1.00 . A A . 104 ILE HG21 1 1 
        4  5596 1 1  26 ILE HG22 H  -1.577 -10.055  -2.841 1.00 . A A . 104 ILE HG22 1 1 
        4  5597 1 1  26 ILE HG23 H  -2.937  -8.959  -3.083 1.00 . A A . 104 ILE HG23 1 1 
        4  5598 1 1  26 ILE N    N  -0.979  -9.036  -6.721 1.00 . A A . 104 ILE N    1 1 
        4  5599 1 1  26 ILE O    O  -3.802 -10.455  -5.319 1.00 . A A . 104 ILE O    1 1 
        4  5600 1 1  27 VAL C    C  -5.681  -9.264  -7.234 1.00 . A A . 105 VAL C    1 1 
        4  5601 1 1  27 VAL CA   C  -5.151  -8.225  -6.252 1.00 . A A . 105 VAL CA   1 1 
        4  5602 1 1  27 VAL CB   C  -5.554  -6.818  -6.735 1.00 . A A . 105 VAL CB   1 1 
        4  5603 1 1  27 VAL CG1  C  -5.185  -5.773  -5.694 1.00 . A A . 105 VAL CG1  1 1 
        4  5604 1 1  27 VAL CG2  C  -4.907  -6.498  -8.077 1.00 . A A . 105 VAL CG2  1 1 
        4  5605 1 1  27 VAL H    H  -3.141  -7.573  -6.305 1.00 . A A . 105 VAL H    1 1 
        4  5606 1 1  27 VAL HA   H  -5.611  -8.394  -5.289 1.00 . A A . 105 VAL HA   1 1 
        4  5607 1 1  27 VAL HB   H  -6.627  -6.799  -6.864 1.00 . A A . 105 VAL HB   1 1 
        4  5608 1 1  27 VAL HG11 H  -5.180  -4.795  -6.151 1.00 . A A . 105 VAL HG11 1 1 
        4  5609 1 1  27 VAL HG12 H  -4.204  -5.990  -5.298 1.00 . A A . 105 VAL HG12 1 1 
        4  5610 1 1  27 VAL HG13 H  -5.909  -5.792  -4.892 1.00 . A A . 105 VAL HG13 1 1 
        4  5611 1 1  27 VAL HG21 H  -5.677  -6.319  -8.813 1.00 . A A . 105 VAL HG21 1 1 
        4  5612 1 1  27 VAL HG22 H  -4.297  -7.330  -8.391 1.00 . A A . 105 VAL HG22 1 1 
        4  5613 1 1  27 VAL HG23 H  -4.290  -5.617  -7.980 1.00 . A A . 105 VAL HG23 1 1 
        4  5614 1 1  27 VAL N    N  -3.707  -8.340  -6.080 1.00 . A A . 105 VAL N    1 1 
        4  5615 1 1  27 VAL O    O  -6.811  -9.736  -7.101 1.00 . A A . 105 VAL O    1 1 
        4  5616 1 1  28 ALA C    C  -5.130 -12.029  -8.685 1.00 . A A . 106 ALA C    1 1 
        4  5617 1 1  28 ALA CA   C  -5.258 -10.603  -9.220 1.00 . A A . 106 ALA CA   1 1 
        4  5618 1 1  28 ALA CB   C  -4.422 -10.435 -10.480 1.00 . A A . 106 ALA CB   1 1 
        4  5619 1 1  28 ALA H    H  -3.973  -9.214  -8.275 1.00 . A A . 106 ALA H    1 1 
        4  5620 1 1  28 ALA HA   H  -6.291 -10.420  -9.478 1.00 . A A . 106 ALA HA   1 1 
        4  5621 1 1  28 ALA HB1  H  -4.929  -9.769 -11.162 1.00 . A A . 106 ALA HB1  1 1 
        4  5622 1 1  28 ALA HB2  H  -4.284 -11.397 -10.952 1.00 . A A . 106 ALA HB2  1 1 
        4  5623 1 1  28 ALA HB3  H  -3.459 -10.020 -10.220 1.00 . A A . 106 ALA HB3  1 1 
        4  5624 1 1  28 ALA N    N  -4.864  -9.619  -8.220 1.00 . A A . 106 ALA N    1 1 
        4  5625 1 1  28 ALA O    O  -5.470 -12.990  -9.375 1.00 . A A . 106 ALA O    1 1 
        4  5626 1 1  29 GLY C    C  -3.351 -14.268  -7.500 1.00 . A A . 107 GLY C    1 1 
        4  5627 1 1  29 GLY CA   C  -4.477 -13.478  -6.863 1.00 . A A . 107 GLY CA   1 1 
        4  5628 1 1  29 GLY H    H  -4.380 -11.367  -6.948 1.00 . A A . 107 GLY H    1 1 
        4  5629 1 1  29 GLY HA2  H  -4.270 -13.363  -5.809 1.00 . A A . 107 GLY HA2  1 1 
        4  5630 1 1  29 GLY HA3  H  -5.399 -14.028  -6.979 1.00 . A A . 107 GLY HA3  1 1 
        4  5631 1 1  29 GLY N    N  -4.637 -12.163  -7.455 1.00 . A A . 107 GLY N    1 1 
        4  5632 1 1  29 GLY O    O  -3.361 -15.499  -7.483 1.00 . A A . 107 GLY O    1 1 
        4  5633 1 1  30 ARG C    C  -0.160 -14.573  -7.695 1.00 . A A . 108 ARG C    1 1 
        4  5634 1 1  30 ARG CA   C  -1.240 -14.202  -8.710 1.00 . A A . 108 ARG CA   1 1 
        4  5635 1 1  30 ARG CB   C  -0.652 -13.282  -9.782 1.00 . A A . 108 ARG CB   1 1 
        4  5636 1 1  30 ARG CD   C  -0.818 -14.196 -12.118 1.00 . A A . 108 ARG CD   1 1 
        4  5637 1 1  30 ARG CG   C   0.068 -14.028 -10.894 1.00 . A A . 108 ARG CG   1 1 
        4  5638 1 1  30 ARG CZ   C   0.609 -15.347 -13.764 1.00 . A A . 108 ARG CZ   1 1 
        4  5639 1 1  30 ARG H    H  -2.427 -12.580  -8.045 1.00 . A A . 108 ARG H    1 1 
        4  5640 1 1  30 ARG HA   H  -1.597 -15.105  -9.183 1.00 . A A . 108 ARG HA   1 1 
        4  5641 1 1  30 ARG HB2  H  -1.452 -12.706 -10.223 1.00 . A A . 108 ARG HB2  1 1 
        4  5642 1 1  30 ARG HB3  H   0.051 -12.608  -9.315 1.00 . A A . 108 ARG HB3  1 1 
        4  5643 1 1  30 ARG HD2  H  -1.384 -15.110 -12.013 1.00 . A A . 108 ARG HD2  1 1 
        4  5644 1 1  30 ARG HD3  H  -1.496 -13.358 -12.173 1.00 . A A . 108 ARG HD3  1 1 
        4  5645 1 1  30 ARG HE   H   0.003 -13.450 -13.903 1.00 . A A . 108 ARG HE   1 1 
        4  5646 1 1  30 ARG HG2  H   0.950 -13.471 -11.175 1.00 . A A . 108 ARG HG2  1 1 
        4  5647 1 1  30 ARG HG3  H   0.356 -15.004 -10.532 1.00 . A A . 108 ARG HG3  1 1 
        4  5648 1 1  30 ARG HH11 H   0.062 -16.489 -12.187 1.00 . A A . 108 ARG HH11 1 1 
        4  5649 1 1  30 ARG HH12 H   1.065 -17.274 -13.359 1.00 . A A . 108 ARG HH12 1 1 
        4  5650 1 1  30 ARG HH21 H   1.323 -14.482 -15.446 1.00 . A A . 108 ARG HH21 1 1 
        4  5651 1 1  30 ARG HH22 H   1.782 -16.135 -15.209 1.00 . A A . 108 ARG HH22 1 1 
        4  5652 1 1  30 ARG N    N  -2.379 -13.559  -8.064 1.00 . A A . 108 ARG N    1 1 
        4  5653 1 1  30 ARG NE   N  -0.039 -14.260 -13.352 1.00 . A A . 108 ARG NE   1 1 
        4  5654 1 1  30 ARG NH1  N   0.576 -16.461 -13.044 1.00 . A A . 108 ARG NH1  1 1 
        4  5655 1 1  30 ARG NH2  N   1.294 -15.319 -14.900 1.00 . A A . 108 ARG NH2  1 1 
        4  5656 1 1  30 ARG O    O   0.890 -15.100  -8.063 1.00 . A A . 108 ARG O    1 1 
        4  5657 1 1  31 LEU C    C  -0.182 -14.867  -4.039 1.00 . A A . 109 LEU C    1 1 
        4  5658 1 1  31 LEU CA   C   0.539 -14.610  -5.362 1.00 . A A . 109 LEU CA   1 1 
        4  5659 1 1  31 LEU CB   C   1.537 -13.461  -5.197 1.00 . A A . 109 LEU CB   1 1 
        4  5660 1 1  31 LEU CD1  C   3.984 -12.952  -5.391 1.00 . A A . 109 LEU CD1  1 1 
        4  5661 1 1  31 LEU CD2  C   3.073 -13.900  -3.264 1.00 . A A . 109 LEU CD2  1 1 
        4  5662 1 1  31 LEU CG   C   2.948 -13.882  -4.781 1.00 . A A . 109 LEU CG   1 1 
        4  5663 1 1  31 LEU H    H  -1.269 -13.880  -6.175 1.00 . A A . 109 LEU H    1 1 
        4  5664 1 1  31 LEU HA   H   1.073 -15.502  -5.652 1.00 . A A . 109 LEU HA   1 1 
        4  5665 1 1  31 LEU HB2  H   1.604 -12.933  -6.137 1.00 . A A . 109 LEU HB2  1 1 
        4  5666 1 1  31 LEU HB3  H   1.154 -12.784  -4.449 1.00 . A A . 109 LEU HB3  1 1 
        4  5667 1 1  31 LEU HD11 H   4.950 -13.149  -4.950 1.00 . A A . 109 LEU HD11 1 1 
        4  5668 1 1  31 LEU HD12 H   3.705 -11.926  -5.200 1.00 . A A . 109 LEU HD12 1 1 
        4  5669 1 1  31 LEU HD13 H   4.034 -13.119  -6.457 1.00 . A A . 109 LEU HD13 1 1 
        4  5670 1 1  31 LEU HD21 H   4.092 -13.677  -2.984 1.00 . A A . 109 LEU HD21 1 1 
        4  5671 1 1  31 LEU HD22 H   2.803 -14.877  -2.892 1.00 . A A . 109 LEU HD22 1 1 
        4  5672 1 1  31 LEU HD23 H   2.413 -13.157  -2.840 1.00 . A A . 109 LEU HD23 1 1 
        4  5673 1 1  31 LEU HG   H   3.141 -14.881  -5.145 1.00 . A A . 109 LEU HG   1 1 
        4  5674 1 1  31 LEU N    N  -0.417 -14.299  -6.417 1.00 . A A . 109 LEU N    1 1 
        4  5675 1 1  31 LEU O    O  -1.060 -14.099  -3.645 1.00 . A A . 109 LEU O    1 1 
        4  5676 1 1  32 PRO C    C  -0.039 -15.351  -0.930 1.00 . A A . 110 PRO C    1 1 
        4  5677 1 1  32 PRO CA   C  -0.448 -16.300  -2.051 1.00 . A A . 110 PRO CA   1 1 
        4  5678 1 1  32 PRO CB   C   0.072 -17.711  -1.771 1.00 . A A . 110 PRO CB   1 1 
        4  5679 1 1  32 PRO CD   C   1.213 -16.930  -3.721 1.00 . A A . 110 PRO CD   1 1 
        4  5680 1 1  32 PRO CG   C   1.372 -17.784  -2.493 1.00 . A A . 110 PRO CG   1 1 
        4  5681 1 1  32 PRO HA   H  -1.525 -16.319  -2.129 1.00 . A A . 110 PRO HA   1 1 
        4  5682 1 1  32 PRO HB2  H   0.201 -17.845  -0.707 1.00 . A A . 110 PRO HB2  1 1 
        4  5683 1 1  32 PRO HB3  H  -0.631 -18.438  -2.150 1.00 . A A . 110 PRO HB3  1 1 
        4  5684 1 1  32 PRO HD2  H   2.142 -16.432  -3.957 1.00 . A A . 110 PRO HD2  1 1 
        4  5685 1 1  32 PRO HD3  H   0.883 -17.529  -4.557 1.00 . A A . 110 PRO HD3  1 1 
        4  5686 1 1  32 PRO HG2  H   2.162 -17.397  -1.866 1.00 . A A . 110 PRO HG2  1 1 
        4  5687 1 1  32 PRO HG3  H   1.580 -18.806  -2.772 1.00 . A A . 110 PRO HG3  1 1 
        4  5688 1 1  32 PRO N    N   0.177 -15.954  -3.331 1.00 . A A . 110 PRO N    1 1 
        4  5689 1 1  32 PRO O    O   1.149 -15.122  -0.699 1.00 . A A . 110 PRO O    1 1 
        4  5690 1 1  33 CYS C    C  -1.733 -14.136   2.021 1.00 . A A . 111 CYS C    1 1 
        4  5691 1 1  33 CYS CA   C  -0.773 -13.879   0.865 1.00 . A A . 111 CYS CA   1 1 
        4  5692 1 1  33 CYS CB   C  -0.904 -12.432   0.387 1.00 . A A . 111 CYS CB   1 1 
        4  5693 1 1  33 CYS H    H  -1.956 -15.024  -0.463 1.00 . A A . 111 CYS H    1 1 
        4  5694 1 1  33 CYS HA   H   0.237 -14.046   1.208 1.00 . A A . 111 CYS HA   1 1 
        4  5695 1 1  33 CYS HB2  H  -1.949 -12.196   0.258 1.00 . A A . 111 CYS HB2  1 1 
        4  5696 1 1  33 CYS HB3  H  -0.482 -11.775   1.133 1.00 . A A . 111 CYS HB3  1 1 
        4  5697 1 1  33 CYS HG   H   0.809 -12.484  -1.139 1.00 . A A . 111 CYS HG   1 1 
        4  5698 1 1  33 CYS N    N  -1.030 -14.803  -0.234 1.00 . A A . 111 CYS N    1 1 
        4  5699 1 1  33 CYS O    O  -2.709 -14.873   1.878 1.00 . A A . 111 CYS O    1 1 
        4  5700 1 1  33 CYS SG   S  -0.068 -12.095  -1.181 1.00 . A A . 111 CYS SG   1 1 
        4  5701 1 1  34 SER C    C  -3.194 -12.483   4.553 1.00 . A A . 112 SER C    1 1 
        4  5702 1 1  34 SER CA   C  -2.291 -13.694   4.347 1.00 . A A . 112 SER CA   1 1 
        4  5703 1 1  34 SER CB   C  -1.424 -13.915   5.588 1.00 . A A . 112 SER CB   1 1 
        4  5704 1 1  34 SER H    H  -0.658 -12.952   3.221 1.00 . A A . 112 SER H    1 1 
        4  5705 1 1  34 SER HA   H  -2.908 -14.566   4.192 1.00 . A A . 112 SER HA   1 1 
        4  5706 1 1  34 SER HB2  H  -1.961 -13.581   6.464 1.00 . A A . 112 SER HB2  1 1 
        4  5707 1 1  34 SER HB3  H  -1.198 -14.967   5.684 1.00 . A A . 112 SER HB3  1 1 
        4  5708 1 1  34 SER HG   H  -0.387 -12.301   5.193 1.00 . A A . 112 SER HG   1 1 
        4  5709 1 1  34 SER N    N  -1.450 -13.527   3.167 1.00 . A A . 112 SER N    1 1 
        4  5710 1 1  34 SER O    O  -2.983 -11.427   3.956 1.00 . A A . 112 SER O    1 1 
        4  5711 1 1  34 SER OG   O  -0.208 -13.193   5.497 1.00 . A A . 112 SER OG   1 1 
        4  5712 1 1  35 PHE C    C  -4.416 -10.357   6.278 1.00 . A A . 113 PHE C    1 1 
        4  5713 1 1  35 PHE CA   C  -5.141 -11.567   5.696 1.00 . A A . 113 PHE CA   1 1 
        4  5714 1 1  35 PHE CB   C  -6.218 -12.053   6.669 1.00 . A A . 113 PHE CB   1 1 
        4  5715 1 1  35 PHE CD1  C  -6.815 -10.046   8.052 1.00 . A A . 113 PHE CD1  1 1 
        4  5716 1 1  35 PHE CD2  C  -8.448 -10.904   6.540 1.00 . A A . 113 PHE CD2  1 1 
        4  5717 1 1  35 PHE CE1  C  -7.696  -9.058   8.448 1.00 . A A . 113 PHE CE1  1 1 
        4  5718 1 1  35 PHE CE2  C  -9.333  -9.918   6.932 1.00 . A A . 113 PHE CE2  1 1 
        4  5719 1 1  35 PHE CG   C  -7.180 -10.979   7.095 1.00 . A A . 113 PHE CG   1 1 
        4  5720 1 1  35 PHE CZ   C  -8.956  -8.994   7.887 1.00 . A A . 113 PHE CZ   1 1 
        4  5721 1 1  35 PHE H    H  -4.316 -13.509   5.850 1.00 . A A . 113 PHE H    1 1 
        4  5722 1 1  35 PHE HA   H  -5.611 -11.276   4.768 1.00 . A A . 113 PHE HA   1 1 
        4  5723 1 1  35 PHE HB2  H  -6.789 -12.840   6.198 1.00 . A A . 113 PHE HB2  1 1 
        4  5724 1 1  35 PHE HB3  H  -5.741 -12.444   7.556 1.00 . A A . 113 PHE HB3  1 1 
        4  5725 1 1  35 PHE HD1  H  -5.829 -10.095   8.490 1.00 . A A . 113 PHE HD1  1 1 
        4  5726 1 1  35 PHE HD2  H  -8.744 -11.626   5.793 1.00 . A A . 113 PHE HD2  1 1 
        4  5727 1 1  35 PHE HE1  H  -7.399  -8.337   9.195 1.00 . A A . 113 PHE HE1  1 1 
        4  5728 1 1  35 PHE HE2  H -10.318  -9.870   6.493 1.00 . A A . 113 PHE HE2  1 1 
        4  5729 1 1  35 PHE HZ   H  -9.646  -8.222   8.195 1.00 . A A . 113 PHE HZ   1 1 
        4  5730 1 1  35 PHE N    N  -4.202 -12.644   5.405 1.00 . A A . 113 PHE N    1 1 
        4  5731 1 1  35 PHE O    O  -4.592  -9.232   5.810 1.00 . A A . 113 PHE O    1 1 
        4  5732 1 1  36 ALA C    C  -2.012  -8.749   6.983 1.00 . A A . 114 ALA C    1 1 
        4  5733 1 1  36 ALA CA   C  -2.884  -9.517   7.969 1.00 . A A . 114 ALA CA   1 1 
        4  5734 1 1  36 ALA CB   C  -2.031 -10.070   9.098 1.00 . A A . 114 ALA CB   1 1 
        4  5735 1 1  36 ALA H    H  -3.535 -11.506   7.659 1.00 . A A . 114 ALA H    1 1 
        4  5736 1 1  36 ALA HA   H  -3.606  -8.838   8.398 1.00 . A A . 114 ALA HA   1 1 
        4  5737 1 1  36 ALA HB1  H  -1.645 -11.038   8.817 1.00 . A A . 114 ALA HB1  1 1 
        4  5738 1 1  36 ALA HB2  H  -2.632 -10.166   9.990 1.00 . A A . 114 ALA HB2  1 1 
        4  5739 1 1  36 ALA HB3  H  -1.209  -9.395   9.288 1.00 . A A . 114 ALA HB3  1 1 
        4  5740 1 1  36 ALA N    N  -3.616 -10.593   7.312 1.00 . A A . 114 ALA N    1 1 
        4  5741 1 1  36 ALA O    O  -1.996  -7.518   6.995 1.00 . A A . 114 ALA O    1 1 
        4  5742 1 1  37 THR C    C  -1.268  -8.072   4.116 1.00 . A A . 115 THR C    1 1 
        4  5743 1 1  37 THR CA   C  -0.431  -8.824   5.142 1.00 . A A . 115 THR CA   1 1 
        4  5744 1 1  37 THR CB   C   0.445  -9.866   4.442 1.00 . A A . 115 THR CB   1 1 
        4  5745 1 1  37 THR CG2  C   1.367  -9.273   3.399 1.00 . A A . 115 THR CG2  1 1 
        4  5746 1 1  37 THR H    H  -1.331 -10.444   6.141 1.00 . A A . 115 THR H    1 1 
        4  5747 1 1  37 THR HA   H   0.202  -8.121   5.661 1.00 . A A . 115 THR HA   1 1 
        4  5748 1 1  37 THR HB   H  -0.194 -10.585   3.949 1.00 . A A . 115 THR HB   1 1 
        4  5749 1 1  37 THR HG1  H   1.418 -11.447   5.065 1.00 . A A . 115 THR HG1  1 1 
        4  5750 1 1  37 THR HG21 H   1.457  -8.209   3.561 1.00 . A A . 115 THR HG21 1 1 
        4  5751 1 1  37 THR HG22 H   0.960  -9.454   2.415 1.00 . A A . 115 THR HG22 1 1 
        4  5752 1 1  37 THR HG23 H   2.341  -9.733   3.476 1.00 . A A . 115 THR HG23 1 1 
        4  5753 1 1  37 THR N    N  -1.292  -9.466   6.127 1.00 . A A . 115 THR N    1 1 
        4  5754 1 1  37 THR O    O  -0.916  -6.969   3.702 1.00 . A A . 115 THR O    1 1 
        4  5755 1 1  37 THR OG1  O   1.248 -10.557   5.382 1.00 . A A . 115 THR OG1  1 1 
        4  5756 1 1  38 LEU C    C  -3.751  -6.699   3.268 1.00 . A A . 116 LEU C    1 1 
        4  5757 1 1  38 LEU CA   C  -3.277  -8.050   2.750 1.00 . A A . 116 LEU CA   1 1 
        4  5758 1 1  38 LEU CB   C  -4.478  -8.956   2.471 1.00 . A A . 116 LEU CB   1 1 
        4  5759 1 1  38 LEU CD1  C  -5.492 -10.884   1.228 1.00 . A A . 116 LEU CD1  1 1 
        4  5760 1 1  38 LEU CD2  C  -3.727  -9.485   0.139 1.00 . A A . 116 LEU CD2  1 1 
        4  5761 1 1  38 LEU CG   C  -4.227 -10.069   1.452 1.00 . A A . 116 LEU CG   1 1 
        4  5762 1 1  38 LEU H    H  -2.617  -9.549   4.090 1.00 . A A . 116 LEU H    1 1 
        4  5763 1 1  38 LEU HA   H  -2.726  -7.900   1.834 1.00 . A A . 116 LEU HA   1 1 
        4  5764 1 1  38 LEU HB2  H  -4.783  -9.411   3.402 1.00 . A A . 116 LEU HB2  1 1 
        4  5765 1 1  38 LEU HB3  H  -5.288  -8.342   2.107 1.00 . A A . 116 LEU HB3  1 1 
        4  5766 1 1  38 LEU HD11 H  -5.233 -11.925   1.107 1.00 . A A . 116 LEU HD11 1 1 
        4  5767 1 1  38 LEU HD12 H  -5.994 -10.532   0.339 1.00 . A A . 116 LEU HD12 1 1 
        4  5768 1 1  38 LEU HD13 H  -6.147 -10.773   2.079 1.00 . A A . 116 LEU HD13 1 1 
        4  5769 1 1  38 LEU HD21 H  -4.361  -8.661  -0.153 1.00 . A A . 116 LEU HD21 1 1 
        4  5770 1 1  38 LEU HD22 H  -3.751 -10.247  -0.626 1.00 . A A . 116 LEU HD22 1 1 
        4  5771 1 1  38 LEU HD23 H  -2.714  -9.133   0.265 1.00 . A A . 116 LEU HD23 1 1 
        4  5772 1 1  38 LEU HG   H  -3.466 -10.733   1.835 1.00 . A A . 116 LEU HG   1 1 
        4  5773 1 1  38 LEU N    N  -2.384  -8.672   3.718 1.00 . A A . 116 LEU N    1 1 
        4  5774 1 1  38 LEU O    O  -3.719  -5.698   2.551 1.00 . A A . 116 LEU O    1 1 
        4  5775 1 1  39 ALA C    C  -3.530  -4.478   5.403 1.00 . A A . 117 ALA C    1 1 
        4  5776 1 1  39 ALA CA   C  -4.670  -5.461   5.151 1.00 . A A . 117 ALA CA   1 1 
        4  5777 1 1  39 ALA CB   C  -5.374  -5.801   6.456 1.00 . A A . 117 ALA CB   1 1 
        4  5778 1 1  39 ALA H    H  -4.193  -7.508   5.046 1.00 . A A . 117 ALA H    1 1 
        4  5779 1 1  39 ALA HA   H  -5.390  -5.003   4.489 1.00 . A A . 117 ALA HA   1 1 
        4  5780 1 1  39 ALA HB1  H  -6.443  -5.754   6.312 1.00 . A A . 117 ALA HB1  1 1 
        4  5781 1 1  39 ALA HB2  H  -5.082  -5.096   7.220 1.00 . A A . 117 ALA HB2  1 1 
        4  5782 1 1  39 ALA HB3  H  -5.096  -6.800   6.762 1.00 . A A . 117 ALA HB3  1 1 
        4  5783 1 1  39 ALA N    N  -4.189  -6.680   4.522 1.00 . A A . 117 ALA N    1 1 
        4  5784 1 1  39 ALA O    O  -3.713  -3.265   5.302 1.00 . A A . 117 ALA O    1 1 
        4  5785 1 1  40 LEU C    C  -0.729  -3.461   4.719 1.00 . A A . 118 LEU C    1 1 
        4  5786 1 1  40 LEU CA   C  -1.190  -4.164   5.994 1.00 . A A . 118 LEU CA   1 1 
        4  5787 1 1  40 LEU CB   C  -0.048  -5.006   6.569 1.00 . A A . 118 LEU CB   1 1 
        4  5788 1 1  40 LEU CD1  C   2.003  -4.794   7.996 1.00 . A A . 118 LEU CD1  1 1 
        4  5789 1 1  40 LEU CD2  C   2.142  -4.362   5.536 1.00 . A A . 118 LEU CD2  1 1 
        4  5790 1 1  40 LEU CG   C   1.269  -4.256   6.778 1.00 . A A . 118 LEU CG   1 1 
        4  5791 1 1  40 LEU H    H  -2.263  -5.981   5.794 1.00 . A A . 118 LEU H    1 1 
        4  5792 1 1  40 LEU HA   H  -1.477  -3.418   6.719 1.00 . A A . 118 LEU HA   1 1 
        4  5793 1 1  40 LEU HB2  H  -0.368  -5.403   7.522 1.00 . A A . 118 LEU HB2  1 1 
        4  5794 1 1  40 LEU HB3  H   0.136  -5.831   5.898 1.00 . A A . 118 LEU HB3  1 1 
        4  5795 1 1  40 LEU HD11 H   2.746  -5.512   7.681 1.00 . A A . 118 LEU HD11 1 1 
        4  5796 1 1  40 LEU HD12 H   1.298  -5.274   8.659 1.00 . A A . 118 LEU HD12 1 1 
        4  5797 1 1  40 LEU HD13 H   2.487  -3.979   8.514 1.00 . A A . 118 LEU HD13 1 1 
        4  5798 1 1  40 LEU HD21 H   1.759  -3.703   4.771 1.00 . A A . 118 LEU HD21 1 1 
        4  5799 1 1  40 LEU HD22 H   2.131  -5.379   5.174 1.00 . A A . 118 LEU HD22 1 1 
        4  5800 1 1  40 LEU HD23 H   3.154  -4.078   5.783 1.00 . A A . 118 LEU HD23 1 1 
        4  5801 1 1  40 LEU HG   H   1.057  -3.211   6.951 1.00 . A A . 118 LEU HG   1 1 
        4  5802 1 1  40 LEU N    N  -2.353  -5.005   5.730 1.00 . A A . 118 LEU N    1 1 
        4  5803 1 1  40 LEU O    O  -0.569  -2.239   4.694 1.00 . A A . 118 LEU O    1 1 
        4  5804 1 1  41 LEU C    C  -1.134  -2.709   1.851 1.00 . A A . 119 LEU C    1 1 
        4  5805 1 1  41 LEU CA   C  -0.098  -3.692   2.381 1.00 . A A . 119 LEU CA   1 1 
        4  5806 1 1  41 LEU CB   C   0.125  -4.816   1.367 1.00 . A A . 119 LEU CB   1 1 
        4  5807 1 1  41 LEU CD1  C   0.883  -7.180   1.019 1.00 . A A . 119 LEU CD1  1 1 
        4  5808 1 1  41 LEU CD2  C   2.546  -5.415   1.623 1.00 . A A . 119 LEU CD2  1 1 
        4  5809 1 1  41 LEU CG   C   1.115  -5.898   1.803 1.00 . A A . 119 LEU CG   1 1 
        4  5810 1 1  41 LEU H    H  -0.683  -5.203   3.744 1.00 . A A . 119 LEU H    1 1 
        4  5811 1 1  41 LEU HA   H   0.833  -3.168   2.540 1.00 . A A . 119 LEU HA   1 1 
        4  5812 1 1  41 LEU HB2  H  -0.827  -5.287   1.169 1.00 . A A . 119 LEU HB2  1 1 
        4  5813 1 1  41 LEU HB3  H   0.488  -4.377   0.449 1.00 . A A . 119 LEU HB3  1 1 
        4  5814 1 1  41 LEU HD11 H   0.121  -7.768   1.508 1.00 . A A . 119 LEU HD11 1 1 
        4  5815 1 1  41 LEU HD12 H   1.802  -7.746   0.975 1.00 . A A . 119 LEU HD12 1 1 
        4  5816 1 1  41 LEU HD13 H   0.562  -6.937   0.017 1.00 . A A . 119 LEU HD13 1 1 
        4  5817 1 1  41 LEU HD21 H   2.693  -4.507   2.189 1.00 . A A . 119 LEU HD21 1 1 
        4  5818 1 1  41 LEU HD22 H   2.732  -5.222   0.577 1.00 . A A . 119 LEU HD22 1 1 
        4  5819 1 1  41 LEU HD23 H   3.228  -6.174   1.976 1.00 . A A . 119 LEU HD23 1 1 
        4  5820 1 1  41 LEU HG   H   0.963  -6.115   2.850 1.00 . A A . 119 LEU HG   1 1 
        4  5821 1 1  41 LEU N    N  -0.529  -4.240   3.661 1.00 . A A . 119 LEU N    1 1 
        4  5822 1 1  41 LEU O    O  -0.795  -1.712   1.212 1.00 . A A . 119 LEU O    1 1 
        4  5823 1 1  42 GLY C    C  -3.495  -0.817   2.461 1.00 . A A . 120 GLY C    1 1 
        4  5824 1 1  42 GLY CA   C  -3.471  -2.125   1.696 1.00 . A A . 120 GLY CA   1 1 
        4  5825 1 1  42 GLY H    H  -2.602  -3.796   2.662 1.00 . A A . 120 GLY H    1 1 
        4  5826 1 1  42 GLY HA2  H  -3.343  -1.914   0.645 1.00 . A A . 120 GLY HA2  1 1 
        4  5827 1 1  42 GLY HA3  H  -4.414  -2.631   1.840 1.00 . A A . 120 GLY HA3  1 1 
        4  5828 1 1  42 GLY N    N  -2.399  -2.994   2.135 1.00 . A A . 120 GLY N    1 1 
        4  5829 1 1  42 GLY O    O  -3.516   0.259   1.866 1.00 . A A . 120 GLY O    1 1 
        4  5830 1 1  43 SER C    C  -2.400   1.241   4.291 1.00 . A A . 121 SER C    1 1 
        4  5831 1 1  43 SER CA   C  -3.520   0.267   4.645 1.00 . A A . 121 SER CA   1 1 
        4  5832 1 1  43 SER CB   C  -3.402  -0.141   6.114 1.00 . A A . 121 SER CB   1 1 
        4  5833 1 1  43 SER H    H  -3.479  -1.801   4.202 1.00 . A A . 121 SER H    1 1 
        4  5834 1 1  43 SER HA   H  -4.468   0.761   4.496 1.00 . A A . 121 SER HA   1 1 
        4  5835 1 1  43 SER HB2  H  -3.249   0.740   6.718 1.00 . A A . 121 SER HB2  1 1 
        4  5836 1 1  43 SER HB3  H  -4.311  -0.635   6.421 1.00 . A A . 121 SER HB3  1 1 
        4  5837 1 1  43 SER HG   H  -1.927  -0.868   7.179 1.00 . A A . 121 SER HG   1 1 
        4  5838 1 1  43 SER N    N  -3.493  -0.913   3.788 1.00 . A A . 121 SER N    1 1 
        4  5839 1 1  43 SER O    O  -2.580   2.457   4.367 1.00 . A A . 121 SER O    1 1 
        4  5840 1 1  43 SER OG   O  -2.312  -1.025   6.313 1.00 . A A . 121 SER OG   1 1 
        4  5841 1 1  44 TYR C    C  -0.340   2.195   2.170 1.00 . A A . 122 TYR C    1 1 
        4  5842 1 1  44 TYR CA   C  -0.113   1.547   3.531 1.00 . A A . 122 TYR CA   1 1 
        4  5843 1 1  44 TYR CB   C   1.174   0.722   3.513 1.00 . A A . 122 TYR CB   1 1 
        4  5844 1 1  44 TYR CD1  C   1.821   1.359   5.869 1.00 . A A . 122 TYR CD1  1 1 
        4  5845 1 1  44 TYR CD2  C   2.044  -0.924   5.218 1.00 . A A . 122 TYR CD2  1 1 
        4  5846 1 1  44 TYR CE1  C   2.291   1.049   7.131 1.00 . A A . 122 TYR CE1  1 1 
        4  5847 1 1  44 TYR CE2  C   2.514  -1.241   6.478 1.00 . A A . 122 TYR CE2  1 1 
        4  5848 1 1  44 TYR CG   C   1.690   0.379   4.892 1.00 . A A . 122 TYR CG   1 1 
        4  5849 1 1  44 TYR CZ   C   2.635  -0.252   7.431 1.00 . A A . 122 TYR CZ   1 1 
        4  5850 1 1  44 TYR H    H  -1.151  -0.268   3.841 1.00 . A A . 122 TYR H    1 1 
        4  5851 1 1  44 TYR HA   H  -0.023   2.324   4.275 1.00 . A A . 122 TYR HA   1 1 
        4  5852 1 1  44 TYR HB2  H   0.994  -0.203   2.987 1.00 . A A . 122 TYR HB2  1 1 
        4  5853 1 1  44 TYR HB3  H   1.944   1.280   2.999 1.00 . A A . 122 TYR HB3  1 1 
        4  5854 1 1  44 TYR HD1  H   1.550   2.377   5.631 1.00 . A A . 122 TYR HD1  1 1 
        4  5855 1 1  44 TYR HD2  H   1.948  -1.697   4.470 1.00 . A A . 122 TYR HD2  1 1 
        4  5856 1 1  44 TYR HE1  H   2.386   1.825   7.876 1.00 . A A . 122 TYR HE1  1 1 
        4  5857 1 1  44 TYR HE2  H   2.784  -2.260   6.712 1.00 . A A . 122 TYR HE2  1 1 
        4  5858 1 1  44 TYR HH   H   3.778  -1.242   8.619 1.00 . A A . 122 TYR HH   1 1 
        4  5859 1 1  44 TYR N    N  -1.247   0.708   3.897 1.00 . A A . 122 TYR N    1 1 
        4  5860 1 1  44 TYR O    O  -0.068   3.382   1.985 1.00 . A A . 122 TYR O    1 1 
        4  5861 1 1  44 TYR OH   O   3.102  -0.564   8.687 1.00 . A A . 122 TYR OH   1 1 
        4  5862 1 1  45 THR C    C  -2.178   3.006  -0.075 1.00 . A A . 123 THR C    1 1 
        4  5863 1 1  45 THR CA   C  -1.114   1.916  -0.118 1.00 . A A . 123 THR CA   1 1 
        4  5864 1 1  45 THR CB   C  -1.564   0.778  -1.036 1.00 . A A . 123 THR CB   1 1 
        4  5865 1 1  45 THR CG2  C  -1.807   1.220  -2.463 1.00 . A A . 123 THR CG2  1 1 
        4  5866 1 1  45 THR H    H  -1.045   0.475   1.432 1.00 . A A . 123 THR H    1 1 
        4  5867 1 1  45 THR HA   H  -0.197   2.339  -0.503 1.00 . A A . 123 THR HA   1 1 
        4  5868 1 1  45 THR HB   H  -2.488   0.367  -0.655 1.00 . A A . 123 THR HB   1 1 
        4  5869 1 1  45 THR HG1  H  -0.493  -0.624  -0.184 1.00 . A A . 123 THR HG1  1 1 
        4  5870 1 1  45 THR HG21 H  -2.430   2.102  -2.466 1.00 . A A . 123 THR HG21 1 1 
        4  5871 1 1  45 THR HG22 H  -2.302   0.428  -3.005 1.00 . A A . 123 THR HG22 1 1 
        4  5872 1 1  45 THR HG23 H  -0.862   1.444  -2.936 1.00 . A A . 123 THR HG23 1 1 
        4  5873 1 1  45 THR N    N  -0.845   1.412   1.223 1.00 . A A . 123 THR N    1 1 
        4  5874 1 1  45 THR O    O  -2.076   4.014  -0.774 1.00 . A A . 123 THR O    1 1 
        4  5875 1 1  45 THR OG1  O  -0.596  -0.256  -1.065 1.00 . A A . 123 THR OG1  1 1 
        4  5876 1 1  46 ILE C    C  -3.729   5.091   1.444 1.00 . A A . 124 ILE C    1 1 
        4  5877 1 1  46 ILE CA   C  -4.271   3.773   0.899 1.00 . A A . 124 ILE CA   1 1 
        4  5878 1 1  46 ILE CB   C  -5.385   3.244   1.830 1.00 . A A . 124 ILE CB   1 1 
        4  5879 1 1  46 ILE CD1  C  -6.830   2.202   0.005 1.00 . A A . 124 ILE CD1  1 1 
        4  5880 1 1  46 ILE CG1  C  -6.000   1.967   1.249 1.00 . A A . 124 ILE CG1  1 1 
        4  5881 1 1  46 ILE CG2  C  -6.462   4.301   2.048 1.00 . A A . 124 ILE CG2  1 1 
        4  5882 1 1  46 ILE H    H  -3.217   1.982   1.295 1.00 . A A . 124 ILE H    1 1 
        4  5883 1 1  46 ILE HA   H  -4.696   3.945  -0.079 1.00 . A A . 124 ILE HA   1 1 
        4  5884 1 1  46 ILE HB   H  -4.943   3.016   2.788 1.00 . A A . 124 ILE HB   1 1 
        4  5885 1 1  46 ILE HD11 H  -6.408   3.020  -0.561 1.00 . A A . 124 ILE HD11 1 1 
        4  5886 1 1  46 ILE HD12 H  -7.843   2.445   0.289 1.00 . A A . 124 ILE HD12 1 1 
        4  5887 1 1  46 ILE HD13 H  -6.831   1.308  -0.601 1.00 . A A . 124 ILE HD13 1 1 
        4  5888 1 1  46 ILE HG12 H  -5.209   1.281   0.991 1.00 . A A . 124 ILE HG12 1 1 
        4  5889 1 1  46 ILE HG13 H  -6.637   1.512   1.993 1.00 . A A . 124 ILE HG13 1 1 
        4  5890 1 1  46 ILE HG21 H  -7.103   3.999   2.864 1.00 . A A . 124 ILE HG21 1 1 
        4  5891 1 1  46 ILE HG22 H  -7.051   4.405   1.149 1.00 . A A . 124 ILE HG22 1 1 
        4  5892 1 1  46 ILE HG23 H  -5.999   5.247   2.287 1.00 . A A . 124 ILE HG23 1 1 
        4  5893 1 1  46 ILE N    N  -3.194   2.801   0.757 1.00 . A A . 124 ILE N    1 1 
        4  5894 1 1  46 ILE O    O  -4.001   6.158   0.896 1.00 . A A . 124 ILE O    1 1 
        4  5895 1 1  47 GLN C    C  -1.513   6.957   2.144 1.00 . A A . 125 GLN C    1 1 
        4  5896 1 1  47 GLN CA   C  -2.378   6.195   3.143 1.00 . A A . 125 GLN CA   1 1 
        4  5897 1 1  47 GLN CB   C  -1.544   5.801   4.365 1.00 . A A . 125 GLN CB   1 1 
        4  5898 1 1  47 GLN CD   C  -0.463   7.615   5.752 1.00 . A A . 125 GLN CD   1 1 
        4  5899 1 1  47 GLN CG   C  -1.694   6.756   5.538 1.00 . A A . 125 GLN CG   1 1 
        4  5900 1 1  47 GLN H    H  -2.780   4.130   2.919 1.00 . A A . 125 GLN H    1 1 
        4  5901 1 1  47 GLN HA   H  -3.188   6.834   3.462 1.00 . A A . 125 GLN HA   1 1 
        4  5902 1 1  47 GLN HB2  H  -1.847   4.816   4.690 1.00 . A A . 125 GLN HB2  1 1 
        4  5903 1 1  47 GLN HB3  H  -0.503   5.773   4.082 1.00 . A A . 125 GLN HB3  1 1 
        4  5904 1 1  47 GLN HE21 H  -1.548   8.973   6.718 1.00 . A A . 125 GLN HE21 1 1 
        4  5905 1 1  47 GLN HE22 H   0.135   9.329   6.563 1.00 . A A . 125 GLN HE22 1 1 
        4  5906 1 1  47 GLN HG2  H  -2.539   7.403   5.354 1.00 . A A . 125 GLN HG2  1 1 
        4  5907 1 1  47 GLN HG3  H  -1.873   6.179   6.434 1.00 . A A . 125 GLN HG3  1 1 
        4  5908 1 1  47 GLN N    N  -2.960   5.009   2.526 1.00 . A A . 125 GLN N    1 1 
        4  5909 1 1  47 GLN NE2  N  -0.644   8.754   6.411 1.00 . A A . 125 GLN NE2  1 1 
        4  5910 1 1  47 GLN O    O  -1.482   8.186   2.145 1.00 . A A . 125 GLN O    1 1 
        4  5911 1 1  47 GLN OE1  O   0.637   7.260   5.330 1.00 . A A . 125 GLN OE1  1 1 
        4  5912 1 1  48 SER C    C  -0.769   7.341  -0.901 1.00 . A A . 126 SER C    1 1 
        4  5913 1 1  48 SER CA   C   0.048   6.829   0.284 1.00 . A A . 126 SER CA   1 1 
        4  5914 1 1  48 SER CB   C   1.092   5.821  -0.201 1.00 . A A . 126 SER CB   1 1 
        4  5915 1 1  48 SER H    H  -0.878   5.243   1.334 1.00 . A A . 126 SER H    1 1 
        4  5916 1 1  48 SER HA   H   0.555   7.663   0.744 1.00 . A A . 126 SER HA   1 1 
        4  5917 1 1  48 SER HB2  H   1.231   5.060   0.552 1.00 . A A . 126 SER HB2  1 1 
        4  5918 1 1  48 SER HB3  H   0.748   5.363  -1.117 1.00 . A A . 126 SER HB3  1 1 
        4  5919 1 1  48 SER HG   H   2.553   6.381  -1.379 1.00 . A A . 126 SER HG   1 1 
        4  5920 1 1  48 SER N    N  -0.813   6.220   1.290 1.00 . A A . 126 SER N    1 1 
        4  5921 1 1  48 SER O    O  -0.328   8.226  -1.634 1.00 . A A . 126 SER O    1 1 
        4  5922 1 1  48 SER OG   O   2.336   6.452  -0.447 1.00 . A A . 126 SER OG   1 1 
        4  5923 1 1  49 GLU C    C  -3.619   8.406  -1.851 1.00 . A A . 127 GLU C    1 1 
        4  5924 1 1  49 GLU CA   C  -2.823   7.158  -2.193 1.00 . A A . 127 GLU CA   1 1 
        4  5925 1 1  49 GLU CB   C  -3.785   6.017  -2.540 1.00 . A A . 127 GLU CB   1 1 
        4  5926 1 1  49 GLU CD   C  -2.238   4.794  -4.118 1.00 . A A . 127 GLU CD   1 1 
        4  5927 1 1  49 GLU CG   C  -3.589   5.460  -3.940 1.00 . A A . 127 GLU CG   1 1 
        4  5928 1 1  49 GLU H    H  -2.242   6.061  -0.475 1.00 . A A . 127 GLU H    1 1 
        4  5929 1 1  49 GLU HA   H  -2.200   7.364  -3.049 1.00 . A A . 127 GLU HA   1 1 
        4  5930 1 1  49 GLU HB2  H  -3.643   5.214  -1.833 1.00 . A A . 127 GLU HB2  1 1 
        4  5931 1 1  49 GLU HB3  H  -4.803   6.379  -2.459 1.00 . A A . 127 GLU HB3  1 1 
        4  5932 1 1  49 GLU HG2  H  -4.361   4.732  -4.136 1.00 . A A . 127 GLU HG2  1 1 
        4  5933 1 1  49 GLU HG3  H  -3.671   6.270  -4.650 1.00 . A A . 127 GLU HG3  1 1 
        4  5934 1 1  49 GLU N    N  -1.955   6.769  -1.089 1.00 . A A . 127 GLU N    1 1 
        4  5935 1 1  49 GLU O    O  -3.774   9.305  -2.678 1.00 . A A . 127 GLU O    1 1 
        4  5936 1 1  49 GLU OE1  O  -1.211   5.460  -3.873 1.00 . A A . 127 GLU OE1  1 1 
        4  5937 1 1  49 GLU OE2  O  -2.209   3.606  -4.501 1.00 . A A . 127 GLU OE2  1 1 
        4  5938 1 1  50 LEU C    C  -4.278  10.385   0.884 1.00 . A A . 128 LEU C    1 1 
        4  5939 1 1  50 LEU CA   C  -4.971   9.550  -0.192 1.00 . A A . 128 LEU CA   1 1 
        4  5940 1 1  50 LEU CB   C  -6.281   8.992   0.344 1.00 . A A . 128 LEU CB   1 1 
        4  5941 1 1  50 LEU CD1  C  -6.920   6.593  -0.006 1.00 . A A . 128 LEU CD1  1 1 
        4  5942 1 1  50 LEU CD2  C  -8.411   8.405  -0.851 1.00 . A A . 128 LEU CD2  1 1 
        4  5943 1 1  50 LEU CG   C  -6.973   7.994  -0.588 1.00 . A A . 128 LEU CG   1 1 
        4  5944 1 1  50 LEU H    H  -4.024   7.681  -0.033 1.00 . A A . 128 LEU H    1 1 
        4  5945 1 1  50 LEU HA   H  -5.181  10.178  -1.044 1.00 . A A . 128 LEU HA   1 1 
        4  5946 1 1  50 LEU HB2  H  -6.066   8.490   1.279 1.00 . A A . 128 LEU HB2  1 1 
        4  5947 1 1  50 LEU HB3  H  -6.954   9.812   0.534 1.00 . A A . 128 LEU HB3  1 1 
        4  5948 1 1  50 LEU HD11 H  -5.954   6.155  -0.209 1.00 . A A . 128 LEU HD11 1 1 
        4  5949 1 1  50 LEU HD12 H  -7.693   5.987  -0.456 1.00 . A A . 128 LEU HD12 1 1 
        4  5950 1 1  50 LEU HD13 H  -7.076   6.643   1.060 1.00 . A A . 128 LEU HD13 1 1 
        4  5951 1 1  50 LEU HD21 H  -9.061   7.914  -0.141 1.00 . A A . 128 LEU HD21 1 1 
        4  5952 1 1  50 LEU HD22 H  -8.687   8.114  -1.854 1.00 . A A . 128 LEU HD22 1 1 
        4  5953 1 1  50 LEU HD23 H  -8.505   9.475  -0.747 1.00 . A A . 128 LEU HD23 1 1 
        4  5954 1 1  50 LEU HG   H  -6.452   7.977  -1.533 1.00 . A A . 128 LEU HG   1 1 
        4  5955 1 1  50 LEU N    N  -4.153   8.438  -0.640 1.00 . A A . 128 LEU N    1 1 
        4  5956 1 1  50 LEU O    O  -4.848  11.356   1.383 1.00 . A A . 128 LEU O    1 1 
        4  5957 1 1  51 GLY C    C  -2.721  10.374   3.663 1.00 . A A . 129 GLY C    1 1 
        4  5958 1 1  51 GLY CA   C  -2.323  10.759   2.251 1.00 . A A . 129 GLY CA   1 1 
        4  5959 1 1  51 GLY H    H  -2.634   9.239   0.810 1.00 . A A . 129 GLY H    1 1 
        4  5960 1 1  51 GLY HA2  H  -1.266  10.574   2.125 1.00 . A A . 129 GLY HA2  1 1 
        4  5961 1 1  51 GLY HA3  H  -2.511  11.813   2.111 1.00 . A A . 129 GLY HA3  1 1 
        4  5962 1 1  51 GLY N    N  -3.052  10.015   1.239 1.00 . A A . 129 GLY N    1 1 
        4  5963 1 1  51 GLY O    O  -2.423   9.271   4.122 1.00 . A A . 129 GLY O    1 1 
        4  5964 1 1  52 ASP C    C  -5.316  10.698   5.773 1.00 . A A . 130 ASP C    1 1 
        4  5965 1 1  52 ASP CA   C  -3.830  11.035   5.726 1.00 . A A . 130 ASP CA   1 1 
        4  5966 1 1  52 ASP CB   C  -3.545  12.253   6.605 1.00 . A A . 130 ASP CB   1 1 
        4  5967 1 1  52 ASP CG   C  -2.181  12.185   7.264 1.00 . A A . 130 ASP CG   1 1 
        4  5968 1 1  52 ASP H    H  -3.602  12.148   3.940 1.00 . A A . 130 ASP H    1 1 
        4  5969 1 1  52 ASP HA   H  -3.270  10.192   6.102 1.00 . A A . 130 ASP HA   1 1 
        4  5970 1 1  52 ASP HB2  H  -3.586  13.146   5.999 1.00 . A A . 130 ASP HB2  1 1 
        4  5971 1 1  52 ASP HB3  H  -4.296  12.314   7.379 1.00 . A A . 130 ASP HB3  1 1 
        4  5972 1 1  52 ASP N    N  -3.395  11.286   4.357 1.00 . A A . 130 ASP N    1 1 
        4  5973 1 1  52 ASP O    O  -6.034  10.869   4.788 1.00 . A A . 130 ASP O    1 1 
        4  5974 1 1  52 ASP OD1  O  -1.273  11.553   6.684 1.00 . A A . 130 ASP OD1  1 1 
        4  5975 1 1  52 ASP OD2  O  -2.021  12.764   8.359 1.00 . A A . 130 ASP OD2  1 1 
        4  5976 1 1  53 TYR C    C  -8.039  11.104   7.253 1.00 . A A . 131 TYR C    1 1 
        4  5977 1 1  53 TYR CA   C  -7.172   9.857   7.105 1.00 . A A . 131 TYR CA   1 1 
        4  5978 1 1  53 TYR CB   C  -7.335   8.958   8.331 1.00 . A A . 131 TYR CB   1 1 
        4  5979 1 1  53 TYR CD1  C  -9.227   7.373   7.797 1.00 . A A . 131 TYR CD1  1 1 
        4  5980 1 1  53 TYR CD2  C  -9.597   9.051   9.449 1.00 . A A . 131 TYR CD2  1 1 
        4  5981 1 1  53 TYR CE1  C -10.516   6.908   7.975 1.00 . A A . 131 TYR CE1  1 1 
        4  5982 1 1  53 TYR CE2  C -10.887   8.591   9.634 1.00 . A A . 131 TYR CE2  1 1 
        4  5983 1 1  53 TYR CG   C  -8.746   8.451   8.529 1.00 . A A . 131 TYR CG   1 1 
        4  5984 1 1  53 TYR CZ   C -11.341   7.520   8.894 1.00 . A A . 131 TYR CZ   1 1 
        4  5985 1 1  53 TYR H    H  -5.150  10.105   7.675 1.00 . A A . 131 TYR H    1 1 
        4  5986 1 1  53 TYR HA   H  -7.490   9.315   6.227 1.00 . A A . 131 TYR HA   1 1 
        4  5987 1 1  53 TYR HB2  H  -6.687   8.100   8.229 1.00 . A A . 131 TYR HB2  1 1 
        4  5988 1 1  53 TYR HB3  H  -7.053   9.512   9.215 1.00 . A A . 131 TYR HB3  1 1 
        4  5989 1 1  53 TYR HD1  H  -8.578   6.896   7.078 1.00 . A A . 131 TYR HD1  1 1 
        4  5990 1 1  53 TYR HD2  H  -9.238   9.890  10.027 1.00 . A A . 131 TYR HD2  1 1 
        4  5991 1 1  53 TYR HE1  H -10.872   6.069   7.396 1.00 . A A . 131 TYR HE1  1 1 
        4  5992 1 1  53 TYR HE2  H -11.533   9.071  10.354 1.00 . A A . 131 TYR HE2  1 1 
        4  5993 1 1  53 TYR HH   H -12.599   6.153   9.390 1.00 . A A . 131 TYR HH   1 1 
        4  5994 1 1  53 TYR N    N  -5.771  10.218   6.926 1.00 . A A . 131 TYR N    1 1 
        4  5995 1 1  53 TYR O    O  -7.771  11.962   8.094 1.00 . A A . 131 TYR O    1 1 
        4  5996 1 1  53 TYR OH   O -12.625   7.059   9.075 1.00 . A A . 131 TYR OH   1 1 
        4  5997 1 1  54 ASP C    C -11.441  11.879   6.466 1.00 . A A . 132 ASP C    1 1 
        4  5998 1 1  54 ASP CA   C  -9.984  12.339   6.467 1.00 . A A . 132 ASP CA   1 1 
        4  5999 1 1  54 ASP CB   C  -9.728  13.257   5.270 1.00 . A A . 132 ASP CB   1 1 
        4  6000 1 1  54 ASP CG   C  -8.613  14.252   5.532 1.00 . A A . 132 ASP CG   1 1 
        4  6001 1 1  54 ASP H    H  -9.238  10.481   5.780 1.00 . A A . 132 ASP H    1 1 
        4  6002 1 1  54 ASP HA   H  -9.791  12.887   7.377 1.00 . A A . 132 ASP HA   1 1 
        4  6003 1 1  54 ASP HB2  H  -9.454  12.656   4.416 1.00 . A A . 132 ASP HB2  1 1 
        4  6004 1 1  54 ASP HB3  H -10.630  13.805   5.045 1.00 . A A . 132 ASP HB3  1 1 
        4  6005 1 1  54 ASP N    N  -9.078  11.197   6.429 1.00 . A A . 132 ASP N    1 1 
        4  6006 1 1  54 ASP O    O -12.021  11.636   5.408 1.00 . A A . 132 ASP O    1 1 
        4  6007 1 1  54 ASP OD1  O  -7.581  13.849   6.109 1.00 . A A . 132 ASP OD1  1 1 
        4  6008 1 1  54 ASP OD2  O  -8.773  15.433   5.160 1.00 . A A . 132 ASP OD2  1 1 
        4  6009 1 1  55 PRO C    C -14.434  12.390   7.332 1.00 . A A . 133 PRO C    1 1 
        4  6010 1 1  55 PRO CA   C -13.450  11.316   7.782 1.00 . A A . 133 PRO CA   1 1 
        4  6011 1 1  55 PRO CB   C -13.602  11.045   9.279 1.00 . A A . 133 PRO CB   1 1 
        4  6012 1 1  55 PRO CD   C -11.439  12.019   8.971 1.00 . A A . 133 PRO CD   1 1 
        4  6013 1 1  55 PRO CG   C -12.599  11.935   9.926 1.00 . A A . 133 PRO CG   1 1 
        4  6014 1 1  55 PRO HA   H -13.632  10.407   7.227 1.00 . A A . 133 PRO HA   1 1 
        4  6015 1 1  55 PRO HB2  H -14.608  11.288   9.591 1.00 . A A . 133 PRO HB2  1 1 
        4  6016 1 1  55 PRO HB3  H -13.396  10.005   9.483 1.00 . A A . 133 PRO HB3  1 1 
        4  6017 1 1  55 PRO HD2  H -11.000  13.005   8.997 1.00 . A A . 133 PRO HD2  1 1 
        4  6018 1 1  55 PRO HD3  H -10.700  11.269   9.209 1.00 . A A . 133 PRO HD3  1 1 
        4  6019 1 1  55 PRO HG2  H -13.026  12.914  10.085 1.00 . A A . 133 PRO HG2  1 1 
        4  6020 1 1  55 PRO HG3  H -12.280  11.507  10.865 1.00 . A A . 133 PRO HG3  1 1 
        4  6021 1 1  55 PRO N    N -12.055  11.751   7.657 1.00 . A A . 133 PRO N    1 1 
        4  6022 1 1  55 PRO O    O -15.517  12.084   6.832 1.00 . A A . 133 PRO O    1 1 
        4  6023 1 1  56 GLU C    C -15.060  14.831   5.610 1.00 . A A . 134 GLU C    1 1 
        4  6024 1 1  56 GLU CA   C -14.899  14.770   7.125 1.00 . A A . 134 GLU CA   1 1 
        4  6025 1 1  56 GLU CB   C -14.308  16.084   7.640 1.00 . A A . 134 GLU CB   1 1 
        4  6026 1 1  56 GLU CD   C -12.389  17.683   7.261 1.00 . A A . 134 GLU CD   1 1 
        4  6027 1 1  56 GLU CG   C -12.822  16.233   7.356 1.00 . A A . 134 GLU CG   1 1 
        4  6028 1 1  56 GLU H    H -13.176  13.829   7.916 1.00 . A A . 134 GLU H    1 1 
        4  6029 1 1  56 GLU HA   H -15.870  14.622   7.574 1.00 . A A . 134 GLU HA   1 1 
        4  6030 1 1  56 GLU HB2  H -14.827  16.907   7.172 1.00 . A A . 134 GLU HB2  1 1 
        4  6031 1 1  56 GLU HB3  H -14.455  16.137   8.709 1.00 . A A . 134 GLU HB3  1 1 
        4  6032 1 1  56 GLU HG2  H -12.267  15.759   8.151 1.00 . A A . 134 GLU HG2  1 1 
        4  6033 1 1  56 GLU HG3  H -12.597  15.743   6.420 1.00 . A A . 134 GLU HG3  1 1 
        4  6034 1 1  56 GLU N    N -14.051  13.649   7.513 1.00 . A A . 134 GLU N    1 1 
        4  6035 1 1  56 GLU O    O -16.097  15.258   5.102 1.00 . A A . 134 GLU O    1 1 
        4  6036 1 1  56 GLU OE1  O -12.851  18.496   8.088 1.00 . A A . 134 GLU OE1  1 1 
        4  6037 1 1  56 GLU OE2  O -11.587  18.005   6.359 1.00 . A A . 134 GLU OE2  1 1 
        4  6038 1 1  57 LEU C    C -14.421  13.030   2.892 1.00 . A A . 135 LEU C    1 1 
        4  6039 1 1  57 LEU CA   C -14.052  14.407   3.435 1.00 . A A . 135 LEU CA   1 1 
        4  6040 1 1  57 LEU CB   C -12.693  14.838   2.882 1.00 . A A . 135 LEU CB   1 1 
        4  6041 1 1  57 LEU CD1  C -10.795  16.475   2.840 1.00 . A A . 135 LEU CD1  1 1 
        4  6042 1 1  57 LEU CD2  C -13.110  17.262   3.365 1.00 . A A . 135 LEU CD2  1 1 
        4  6043 1 1  57 LEU CG   C -12.119  16.116   3.497 1.00 . A A . 135 LEU CG   1 1 
        4  6044 1 1  57 LEU H    H -13.228  14.073   5.356 1.00 . A A . 135 LEU H    1 1 
        4  6045 1 1  57 LEU HA   H -14.801  15.117   3.119 1.00 . A A . 135 LEU HA   1 1 
        4  6046 1 1  57 LEU HB2  H -11.989  14.035   3.049 1.00 . A A . 135 LEU HB2  1 1 
        4  6047 1 1  57 LEU HB3  H -12.792  14.991   1.818 1.00 . A A . 135 LEU HB3  1 1 
        4  6048 1 1  57 LEU HD11 H -10.800  16.141   1.813 1.00 . A A . 135 LEU HD11 1 1 
        4  6049 1 1  57 LEU HD12 H  -9.987  15.994   3.371 1.00 . A A . 135 LEU HD12 1 1 
        4  6050 1 1  57 LEU HD13 H -10.658  17.546   2.870 1.00 . A A . 135 LEU HD13 1 1 
        4  6051 1 1  57 LEU HD21 H -12.820  18.066   4.025 1.00 . A A . 135 LEU HD21 1 1 
        4  6052 1 1  57 LEU HD22 H -14.098  16.916   3.632 1.00 . A A . 135 LEU HD22 1 1 
        4  6053 1 1  57 LEU HD23 H -13.116  17.618   2.346 1.00 . A A . 135 LEU HD23 1 1 
        4  6054 1 1  57 LEU HG   H -11.935  15.950   4.548 1.00 . A A . 135 LEU HG   1 1 
        4  6055 1 1  57 LEU N    N -14.027  14.402   4.893 1.00 . A A . 135 LEU N    1 1 
        4  6056 1 1  57 LEU O    O -15.213  12.912   1.957 1.00 . A A . 135 LEU O    1 1 
        4  6057 1 1  58 HIS C    C -15.236  10.008   3.882 1.00 . A A . 136 HIS C    1 1 
        4  6058 1 1  58 HIS CA   C -14.108  10.621   3.059 1.00 . A A . 136 HIS CA   1 1 
        4  6059 1 1  58 HIS CB   C -12.846   9.768   3.189 1.00 . A A . 136 HIS CB   1 1 
        4  6060 1 1  58 HIS CD2  C -11.505  10.252   1.021 1.00 . A A . 136 HIS CD2  1 1 
        4  6061 1 1  58 HIS CE1  C  -9.740  11.176   1.937 1.00 . A A . 136 HIS CE1  1 1 
        4  6062 1 1  58 HIS CG   C -11.699  10.261   2.362 1.00 . A A . 136 HIS CG   1 1 
        4  6063 1 1  58 HIS H    H -13.218  12.148   4.224 1.00 . A A . 136 HIS H    1 1 
        4  6064 1 1  58 HIS HA   H -14.409  10.649   2.022 1.00 . A A . 136 HIS HA   1 1 
        4  6065 1 1  58 HIS HB2  H -12.530   9.759   4.221 1.00 . A A . 136 HIS HB2  1 1 
        4  6066 1 1  58 HIS HB3  H -13.070   8.757   2.878 1.00 . A A . 136 HIS HB3  1 1 
        4  6067 1 1  58 HIS HD1  H -10.414  10.997   3.860 1.00 . A A . 136 HIS HD1  1 1 
        4  6068 1 1  58 HIS HD2  H -12.187   9.866   0.277 1.00 . A A . 136 HIS HD2  1 1 
        4  6069 1 1  58 HIS HE1  H  -8.778  11.650   2.066 1.00 . A A . 136 HIS HE1  1 1 
        4  6070 1 1  58 HIS HE2  H  -9.823  10.853  -0.083 1.00 . A A . 136 HIS HE2  1 1 
        4  6071 1 1  58 HIS N    N -13.841  11.991   3.484 1.00 . A A . 136 HIS N    1 1 
        4  6072 1 1  58 HIS ND1  N -10.575  10.846   2.906 1.00 . A A . 136 HIS ND1  1 1 
        4  6073 1 1  58 HIS NE2  N -10.279  10.826   0.784 1.00 . A A . 136 HIS NE2  1 1 
        4  6074 1 1  58 HIS O    O -15.719  10.612   4.840 1.00 . A A . 136 HIS O    1 1 
        4  6075 1 1  59 GLY C    C -16.280   6.803   4.805 1.00 . A A . 137 GLY C    1 1 
        4  6076 1 1  59 GLY CA   C -16.721   8.129   4.216 1.00 . A A . 137 GLY CA   1 1 
        4  6077 1 1  59 GLY H    H -15.231   8.370   2.731 1.00 . A A . 137 GLY H    1 1 
        4  6078 1 1  59 GLY HA2  H -17.065   8.768   5.015 1.00 . A A . 137 GLY HA2  1 1 
        4  6079 1 1  59 GLY HA3  H -17.539   7.952   3.533 1.00 . A A . 137 GLY HA3  1 1 
        4  6080 1 1  59 GLY N    N -15.653   8.804   3.502 1.00 . A A . 137 GLY N    1 1 
        4  6081 1 1  59 GLY O    O -15.231   6.718   5.444 1.00 . A A . 137 GLY O    1 1 
        4  6082 1 1  60 VAL C    C -16.475   3.460   3.972 1.00 . A A . 138 VAL C    1 1 
        4  6083 1 1  60 VAL CA   C -16.772   4.437   5.105 1.00 . A A . 138 VAL CA   1 1 
        4  6084 1 1  60 VAL CB   C -17.928   3.877   5.955 1.00 . A A . 138 VAL CB   1 1 
        4  6085 1 1  60 VAL CG1  C -18.036   4.628   7.273 1.00 . A A . 138 VAL CG1  1 1 
        4  6086 1 1  60 VAL CG2  C -19.239   3.946   5.185 1.00 . A A . 138 VAL CG2  1 1 
        4  6087 1 1  60 VAL H    H -17.906   5.897   4.074 1.00 . A A . 138 VAL H    1 1 
        4  6088 1 1  60 VAL HA   H -15.898   4.519   5.734 1.00 . A A . 138 VAL HA   1 1 
        4  6089 1 1  60 VAL HB   H -17.718   2.840   6.174 1.00 . A A . 138 VAL HB   1 1 
        4  6090 1 1  60 VAL HG11 H -18.562   4.017   7.993 1.00 . A A . 138 VAL HG11 1 1 
        4  6091 1 1  60 VAL HG12 H -18.578   5.549   7.120 1.00 . A A . 138 VAL HG12 1 1 
        4  6092 1 1  60 VAL HG13 H -17.047   4.849   7.644 1.00 . A A . 138 VAL HG13 1 1 
        4  6093 1 1  60 VAL HG21 H -19.037   3.893   4.126 1.00 . A A . 138 VAL HG21 1 1 
        4  6094 1 1  60 VAL HG22 H -19.741   4.875   5.411 1.00 . A A . 138 VAL HG22 1 1 
        4  6095 1 1  60 VAL HG23 H -19.869   3.117   5.473 1.00 . A A . 138 VAL HG23 1 1 
        4  6096 1 1  60 VAL N    N -17.084   5.766   4.590 1.00 . A A . 138 VAL N    1 1 
        4  6097 1 1  60 VAL O    O -15.699   2.519   4.138 1.00 . A A . 138 VAL O    1 1 
        4  6098 1 1  61 ASP C    C -15.899   3.438   0.688 1.00 . A A . 139 ASP C    1 1 
        4  6099 1 1  61 ASP CA   C -16.901   2.824   1.662 1.00 . A A . 139 ASP CA   1 1 
        4  6100 1 1  61 ASP CB   C -18.235   2.571   0.955 1.00 . A A . 139 ASP CB   1 1 
        4  6101 1 1  61 ASP CG   C -18.513   1.094   0.756 1.00 . A A . 139 ASP CG   1 1 
        4  6102 1 1  61 ASP H    H -17.707   4.452   2.748 1.00 . A A . 139 ASP H    1 1 
        4  6103 1 1  61 ASP HA   H -16.508   1.882   2.016 1.00 . A A . 139 ASP HA   1 1 
        4  6104 1 1  61 ASP HB2  H -19.034   2.992   1.546 1.00 . A A . 139 ASP HB2  1 1 
        4  6105 1 1  61 ASP HB3  H -18.220   3.050  -0.014 1.00 . A A . 139 ASP HB3  1 1 
        4  6106 1 1  61 ASP N    N -17.099   3.687   2.820 1.00 . A A . 139 ASP N    1 1 
        4  6107 1 1  61 ASP O    O -15.986   3.226  -0.521 1.00 . A A . 139 ASP O    1 1 
        4  6108 1 1  61 ASP OD1  O -18.313   0.318   1.715 1.00 . A A . 139 ASP OD1  1 1 
        4  6109 1 1  61 ASP OD2  O -18.931   0.713  -0.357 1.00 . A A . 139 ASP OD2  1 1 
        4  6110 1 1  62 TYR C    C -12.879   3.828  -0.048 1.00 . A A . 140 TYR C    1 1 
        4  6111 1 1  62 TYR CA   C -13.930   4.839   0.401 1.00 . A A . 140 TYR CA   1 1 
        4  6112 1 1  62 TYR CB   C -13.266   5.985   1.168 1.00 . A A . 140 TYR CB   1 1 
        4  6113 1 1  62 TYR CD1  C -13.288   5.472   3.641 1.00 . A A . 140 TYR CD1  1 1 
        4  6114 1 1  62 TYR CD2  C -11.235   5.217   2.456 1.00 . A A . 140 TYR CD2  1 1 
        4  6115 1 1  62 TYR CE1  C -12.667   5.077   4.810 1.00 . A A . 140 TYR CE1  1 1 
        4  6116 1 1  62 TYR CE2  C -10.608   4.820   3.621 1.00 . A A . 140 TYR CE2  1 1 
        4  6117 1 1  62 TYR CG   C -12.584   5.549   2.445 1.00 . A A . 140 TYR CG   1 1 
        4  6118 1 1  62 TYR CZ   C -11.327   4.752   4.795 1.00 . A A . 140 TYR CZ   1 1 
        4  6119 1 1  62 TYR H    H -14.931   4.327   2.195 1.00 . A A . 140 TYR H    1 1 
        4  6120 1 1  62 TYR HA   H -14.419   5.241  -0.474 1.00 . A A . 140 TYR HA   1 1 
        4  6121 1 1  62 TYR HB2  H -12.522   6.447   0.537 1.00 . A A . 140 TYR HB2  1 1 
        4  6122 1 1  62 TYR HB3  H -14.017   6.718   1.426 1.00 . A A . 140 TYR HB3  1 1 
        4  6123 1 1  62 TYR HD1  H -14.337   5.727   3.649 1.00 . A A . 140 TYR HD1  1 1 
        4  6124 1 1  62 TYR HD2  H -10.674   5.272   1.535 1.00 . A A . 140 TYR HD2  1 1 
        4  6125 1 1  62 TYR HE1  H -13.231   5.023   5.729 1.00 . A A . 140 TYR HE1  1 1 
        4  6126 1 1  62 TYR HE2  H  -9.559   4.566   3.609 1.00 . A A . 140 TYR HE2  1 1 
        4  6127 1 1  62 TYR HH   H  -9.835   4.759   6.007 1.00 . A A . 140 TYR HH   1 1 
        4  6128 1 1  62 TYR N    N -14.949   4.197   1.224 1.00 . A A . 140 TYR N    1 1 
        4  6129 1 1  62 TYR O    O -12.298   3.959  -1.125 1.00 . A A . 140 TYR O    1 1 
        4  6130 1 1  62 TYR OH   O -10.705   4.356   5.957 1.00 . A A . 140 TYR OH   1 1 
        4  6131 1 1  63 VAL C    C -12.201   0.834  -0.609 1.00 . A A . 141 VAL C    1 1 
        4  6132 1 1  63 VAL CA   C -11.667   1.779   0.467 1.00 . A A . 141 VAL CA   1 1 
        4  6133 1 1  63 VAL CB   C -11.292   0.959   1.717 1.00 . A A . 141 VAL CB   1 1 
        4  6134 1 1  63 VAL CG1  C -10.090   0.071   1.435 1.00 . A A . 141 VAL CG1  1 1 
        4  6135 1 1  63 VAL CG2  C -11.013   1.878   2.896 1.00 . A A . 141 VAL CG2  1 1 
        4  6136 1 1  63 VAL H    H -13.141   2.763   1.625 1.00 . A A . 141 VAL H    1 1 
        4  6137 1 1  63 VAL HA   H -10.774   2.262   0.097 1.00 . A A . 141 VAL HA   1 1 
        4  6138 1 1  63 VAL HB   H -12.128   0.324   1.972 1.00 . A A . 141 VAL HB   1 1 
        4  6139 1 1  63 VAL HG11 H -10.024  -0.695   2.193 1.00 . A A . 141 VAL HG11 1 1 
        4  6140 1 1  63 VAL HG12 H  -9.191   0.669   1.448 1.00 . A A . 141 VAL HG12 1 1 
        4  6141 1 1  63 VAL HG13 H -10.202  -0.390   0.466 1.00 . A A . 141 VAL HG13 1 1 
        4  6142 1 1  63 VAL HG21 H -10.233   2.576   2.630 1.00 . A A . 141 VAL HG21 1 1 
        4  6143 1 1  63 VAL HG22 H -10.695   1.288   3.743 1.00 . A A . 141 VAL HG22 1 1 
        4  6144 1 1  63 VAL HG23 H -11.911   2.420   3.151 1.00 . A A . 141 VAL HG23 1 1 
        4  6145 1 1  63 VAL N    N -12.643   2.816   0.782 1.00 . A A . 141 VAL N    1 1 
        4  6146 1 1  63 VAL O    O -11.433   0.155  -1.290 1.00 . A A . 141 VAL O    1 1 
        4  6147 1 1  64 SER C    C -13.805   0.370  -3.175 1.00 . A A . 142 SER C    1 1 
        4  6148 1 1  64 SER CA   C -14.171  -0.048  -1.751 1.00 . A A . 142 SER CA   1 1 
        4  6149 1 1  64 SER CB   C -15.690  -0.004  -1.572 1.00 . A A . 142 SER CB   1 1 
        4  6150 1 1  64 SER H    H -14.083   1.370  -0.191 1.00 . A A . 142 SER H    1 1 
        4  6151 1 1  64 SER HA   H -13.831  -1.060  -1.590 1.00 . A A . 142 SER HA   1 1 
        4  6152 1 1  64 SER HB2  H -16.131  -0.869  -2.043 1.00 . A A . 142 SER HB2  1 1 
        4  6153 1 1  64 SER HB3  H -15.926  -0.007  -0.518 1.00 . A A . 142 SER HB3  1 1 
        4  6154 1 1  64 SER HG   H -15.699   1.923  -1.927 1.00 . A A . 142 SER HG   1 1 
        4  6155 1 1  64 SER N    N -13.522   0.803  -0.759 1.00 . A A . 142 SER N    1 1 
        4  6156 1 1  64 SER O    O -14.037  -0.375  -4.126 1.00 . A A . 142 SER O    1 1 
        4  6157 1 1  64 SER OG   O -16.239   1.163  -2.159 1.00 . A A . 142 SER OG   1 1 
        4  6158 1 1  65 ASP C    C -11.459   1.524  -5.025 1.00 . A A . 143 ASP C    1 1 
        4  6159 1 1  65 ASP CA   C -12.831   2.064  -4.628 1.00 . A A . 143 ASP CA   1 1 
        4  6160 1 1  65 ASP CB   C -12.810   3.595  -4.625 1.00 . A A . 143 ASP CB   1 1 
        4  6161 1 1  65 ASP CG   C -13.897   4.190  -5.498 1.00 . A A . 143 ASP CG   1 1 
        4  6162 1 1  65 ASP H    H -13.047   2.106  -2.525 1.00 . A A . 143 ASP H    1 1 
        4  6163 1 1  65 ASP HA   H -13.560   1.724  -5.349 1.00 . A A . 143 ASP HA   1 1 
        4  6164 1 1  65 ASP HB2  H -12.953   3.948  -3.615 1.00 . A A . 143 ASP HB2  1 1 
        4  6165 1 1  65 ASP HB3  H -11.853   3.938  -4.990 1.00 . A A . 143 ASP HB3  1 1 
        4  6166 1 1  65 ASP N    N -13.228   1.561  -3.318 1.00 . A A . 143 ASP N    1 1 
        4  6167 1 1  65 ASP O    O -11.155   1.384  -6.210 1.00 . A A . 143 ASP O    1 1 
        4  6168 1 1  65 ASP OD1  O -14.971   3.562  -5.620 1.00 . A A . 143 ASP OD1  1 1 
        4  6169 1 1  65 ASP OD2  O -13.676   5.283  -6.060 1.00 . A A . 143 ASP OD2  1 1 
        4  6170 1 1  66 PHE C    C  -9.274  -0.820  -4.180 1.00 . A A . 144 PHE C    1 1 
        4  6171 1 1  66 PHE CA   C  -9.293   0.703  -4.273 1.00 . A A . 144 PHE CA   1 1 
        4  6172 1 1  66 PHE CB   C  -8.301   1.300  -3.273 1.00 . A A . 144 PHE CB   1 1 
        4  6173 1 1  66 PHE CD1  C  -7.449   3.468  -4.206 1.00 . A A . 144 PHE CD1  1 1 
        4  6174 1 1  66 PHE CD2  C  -9.022   3.546  -2.415 1.00 . A A . 144 PHE CD2  1 1 
        4  6175 1 1  66 PHE CE1  C  -7.407   4.849  -4.233 1.00 . A A . 144 PHE CE1  1 1 
        4  6176 1 1  66 PHE CE2  C  -8.984   4.927  -2.437 1.00 . A A . 144 PHE CE2  1 1 
        4  6177 1 1  66 PHE CG   C  -8.257   2.802  -3.298 1.00 . A A . 144 PHE CG   1 1 
        4  6178 1 1  66 PHE CZ   C  -8.175   5.580  -3.347 1.00 . A A . 144 PHE CZ   1 1 
        4  6179 1 1  66 PHE H    H -10.930   1.359  -3.103 1.00 . A A . 144 PHE H    1 1 
        4  6180 1 1  66 PHE HA   H  -9.002   0.994  -5.271 1.00 . A A . 144 PHE HA   1 1 
        4  6181 1 1  66 PHE HB2  H  -8.578   0.993  -2.275 1.00 . A A . 144 PHE HB2  1 1 
        4  6182 1 1  66 PHE HB3  H  -7.310   0.933  -3.496 1.00 . A A . 144 PHE HB3  1 1 
        4  6183 1 1  66 PHE HD1  H  -6.848   2.898  -4.899 1.00 . A A . 144 PHE HD1  1 1 
        4  6184 1 1  66 PHE HD2  H  -9.655   3.037  -1.703 1.00 . A A . 144 PHE HD2  1 1 
        4  6185 1 1  66 PHE HE1  H  -6.774   5.357  -4.946 1.00 . A A . 144 PHE HE1  1 1 
        4  6186 1 1  66 PHE HE2  H  -9.586   5.496  -1.744 1.00 . A A . 144 PHE HE2  1 1 
        4  6187 1 1  66 PHE HZ   H  -8.144   6.659  -3.367 1.00 . A A . 144 PHE HZ   1 1 
        4  6188 1 1  66 PHE N    N -10.633   1.224  -4.027 1.00 . A A . 144 PHE N    1 1 
        4  6189 1 1  66 PHE O    O  -9.775  -1.400  -3.217 1.00 . A A . 144 PHE O    1 1 
        4  6190 1 1  67 LYS C    C  -7.508  -3.423  -4.293 1.00 . A A . 145 LYS C    1 1 
        4  6191 1 1  67 LYS CA   C  -8.607  -2.918  -5.223 1.00 . A A . 145 LYS CA   1 1 
        4  6192 1 1  67 LYS CB   C  -8.343  -3.400  -6.651 1.00 . A A . 145 LYS CB   1 1 
        4  6193 1 1  67 LYS CD   C  -9.319  -4.440  -8.721 1.00 . A A . 145 LYS CD   1 1 
        4  6194 1 1  67 LYS CE   C  -8.558  -3.599  -9.733 1.00 . A A . 145 LYS CE   1 1 
        4  6195 1 1  67 LYS CG   C  -9.610  -3.658  -7.450 1.00 . A A . 145 LYS CG   1 1 
        4  6196 1 1  67 LYS H    H  -8.311  -0.943  -5.928 1.00 . A A . 145 LYS H    1 1 
        4  6197 1 1  67 LYS HA   H  -9.555  -3.313  -4.889 1.00 . A A . 145 LYS HA   1 1 
        4  6198 1 1  67 LYS HB2  H  -7.762  -2.652  -7.170 1.00 . A A . 145 LYS HB2  1 1 
        4  6199 1 1  67 LYS HB3  H  -7.777  -4.319  -6.610 1.00 . A A . 145 LYS HB3  1 1 
        4  6200 1 1  67 LYS HD2  H  -8.725  -5.307  -8.470 1.00 . A A . 145 LYS HD2  1 1 
        4  6201 1 1  67 LYS HD3  H -10.254  -4.757  -9.159 1.00 . A A . 145 LYS HD3  1 1 
        4  6202 1 1  67 LYS HE2  H  -8.993  -3.752 -10.709 1.00 . A A . 145 LYS HE2  1 1 
        4  6203 1 1  67 LYS HE3  H  -8.650  -2.558  -9.459 1.00 . A A . 145 LYS HE3  1 1 
        4  6204 1 1  67 LYS HG2  H -10.300  -4.223  -6.841 1.00 . A A . 145 LYS HG2  1 1 
        4  6205 1 1  67 LYS HG3  H -10.056  -2.710  -7.716 1.00 . A A . 145 LYS HG3  1 1 
        4  6206 1 1  67 LYS HZ1  H  -6.550  -3.139 -10.079 1.00 . A A . 145 LYS HZ1  1 1 
        4  6207 1 1  67 LYS HZ2  H  -6.964  -4.733 -10.465 1.00 . A A . 145 LYS HZ2  1 1 
        4  6208 1 1  67 LYS HZ3  H  -6.791  -4.274  -8.847 1.00 . A A . 145 LYS HZ3  1 1 
        4  6209 1 1  67 LYS N    N  -8.692  -1.462  -5.189 1.00 . A A . 145 LYS N    1 1 
        4  6210 1 1  67 LYS NZ   N  -7.115  -3.962  -9.785 1.00 . A A . 145 LYS NZ   1 1 
        4  6211 1 1  67 LYS O    O  -6.345  -3.515  -4.683 1.00 . A A . 145 LYS O    1 1 
        4  6212 1 1  68 LEU C    C  -6.682  -5.738  -2.248 1.00 . A A . 146 LEU C    1 1 
        4  6213 1 1  68 LEU CA   C  -6.930  -4.242  -2.072 1.00 . A A . 146 LEU CA   1 1 
        4  6214 1 1  68 LEU CB   C  -7.434  -3.966  -0.654 1.00 . A A . 146 LEU CB   1 1 
        4  6215 1 1  68 LEU CD1  C  -9.218  -2.721   0.595 1.00 . A A . 146 LEU CD1  1 1 
        4  6216 1 1  68 LEU CD2  C  -7.103  -1.553  -0.057 1.00 . A A . 146 LEU CD2  1 1 
        4  6217 1 1  68 LEU CG   C  -8.121  -2.613  -0.454 1.00 . A A . 146 LEU CG   1 1 
        4  6218 1 1  68 LEU H    H  -8.827  -3.649  -2.806 1.00 . A A . 146 LEU H    1 1 
        4  6219 1 1  68 LEU HA   H  -5.999  -3.716  -2.222 1.00 . A A . 146 LEU HA   1 1 
        4  6220 1 1  68 LEU HB2  H  -8.135  -4.744  -0.387 1.00 . A A . 146 LEU HB2  1 1 
        4  6221 1 1  68 LEU HB3  H  -6.592  -4.018   0.020 1.00 . A A . 146 LEU HB3  1 1 
        4  6222 1 1  68 LEU HD11 H  -8.936  -2.159   1.473 1.00 . A A . 146 LEU HD11 1 1 
        4  6223 1 1  68 LEU HD12 H  -9.361  -3.758   0.862 1.00 . A A . 146 LEU HD12 1 1 
        4  6224 1 1  68 LEU HD13 H -10.139  -2.325   0.194 1.00 . A A . 146 LEU HD13 1 1 
        4  6225 1 1  68 LEU HD21 H  -6.756  -1.038  -0.940 1.00 . A A . 146 LEU HD21 1 1 
        4  6226 1 1  68 LEU HD22 H  -6.266  -2.025   0.436 1.00 . A A . 146 LEU HD22 1 1 
        4  6227 1 1  68 LEU HD23 H  -7.564  -0.845   0.615 1.00 . A A . 146 LEU HD23 1 1 
        4  6228 1 1  68 LEU HG   H  -8.578  -2.306  -1.383 1.00 . A A . 146 LEU HG   1 1 
        4  6229 1 1  68 LEU N    N  -7.885  -3.748  -3.059 1.00 . A A . 146 LEU N    1 1 
        4  6230 1 1  68 LEU O    O  -5.638  -6.254  -1.849 1.00 . A A . 146 LEU O    1 1 
        4  6231 1 1  69 ALA C    C  -8.700  -8.394  -3.896 1.00 . A A . 147 ALA C    1 1 
        4  6232 1 1  69 ALA CA   C  -7.526  -7.868  -3.073 1.00 . A A . 147 ALA CA   1 1 
        4  6233 1 1  69 ALA CB   C  -7.435  -8.604  -1.744 1.00 . A A . 147 ALA CB   1 1 
        4  6234 1 1  69 ALA H    H  -8.456  -5.968  -3.146 1.00 . A A . 147 ALA H    1 1 
        4  6235 1 1  69 ALA HA   H  -6.610  -8.043  -3.618 1.00 . A A . 147 ALA HA   1 1 
        4  6236 1 1  69 ALA HB1  H  -8.366  -9.116  -1.551 1.00 . A A . 147 ALA HB1  1 1 
        4  6237 1 1  69 ALA HB2  H  -7.243  -7.895  -0.952 1.00 . A A . 147 ALA HB2  1 1 
        4  6238 1 1  69 ALA HB3  H  -6.631  -9.324  -1.786 1.00 . A A . 147 ALA HB3  1 1 
        4  6239 1 1  69 ALA N    N  -7.646  -6.432  -2.847 1.00 . A A . 147 ALA N    1 1 
        4  6240 1 1  69 ALA O    O  -9.704  -7.704  -4.070 1.00 . A A . 147 ALA O    1 1 
        4  6241 1 1  70 PRO C    C -10.884 -10.578  -4.396 1.00 . A A . 148 PRO C    1 1 
        4  6242 1 1  70 PRO CA   C  -9.647 -10.244  -5.222 1.00 . A A . 148 PRO CA   1 1 
        4  6243 1 1  70 PRO CB   C  -8.996 -11.524  -5.751 1.00 . A A . 148 PRO CB   1 1 
        4  6244 1 1  70 PRO CD   C  -7.425 -10.522  -4.256 1.00 . A A . 148 PRO CD   1 1 
        4  6245 1 1  70 PRO CG   C  -7.930 -11.845  -4.762 1.00 . A A . 148 PRO CG   1 1 
        4  6246 1 1  70 PRO HA   H  -9.930  -9.611  -6.051 1.00 . A A . 148 PRO HA   1 1 
        4  6247 1 1  70 PRO HB2  H  -9.735 -12.310  -5.807 1.00 . A A . 148 PRO HB2  1 1 
        4  6248 1 1  70 PRO HB3  H  -8.582 -11.342  -6.732 1.00 . A A . 148 PRO HB3  1 1 
        4  6249 1 1  70 PRO HD2  H  -7.138 -10.601  -3.217 1.00 . A A . 148 PRO HD2  1 1 
        4  6250 1 1  70 PRO HD3  H  -6.593 -10.182  -4.854 1.00 . A A . 148 PRO HD3  1 1 
        4  6251 1 1  70 PRO HG2  H  -8.345 -12.424  -3.950 1.00 . A A . 148 PRO HG2  1 1 
        4  6252 1 1  70 PRO HG3  H  -7.133 -12.391  -5.245 1.00 . A A . 148 PRO HG3  1 1 
        4  6253 1 1  70 PRO N    N  -8.588  -9.629  -4.415 1.00 . A A . 148 PRO N    1 1 
        4  6254 1 1  70 PRO O    O -12.013 -10.393  -4.848 1.00 . A A . 148 PRO O    1 1 
        4  6255 1 1  71 ASN C    C -11.800 -10.502  -1.078 1.00 . A A . 149 ASN C    1 1 
        4  6256 1 1  71 ASN CA   C -11.759 -11.428  -2.290 1.00 . A A . 149 ASN CA   1 1 
        4  6257 1 1  71 ASN CB   C -11.619 -12.883  -1.834 1.00 . A A . 149 ASN CB   1 1 
        4  6258 1 1  71 ASN CG   C -12.960 -13.570  -1.673 1.00 . A A . 149 ASN CG   1 1 
        4  6259 1 1  71 ASN H    H  -9.739 -11.194  -2.876 1.00 . A A . 149 ASN H    1 1 
        4  6260 1 1  71 ASN HA   H -12.682 -11.321  -2.841 1.00 . A A . 149 ASN HA   1 1 
        4  6261 1 1  71 ASN HB2  H -11.042 -13.429  -2.566 1.00 . A A . 149 ASN HB2  1 1 
        4  6262 1 1  71 ASN HB3  H -11.105 -12.908  -0.885 1.00 . A A . 149 ASN HB3  1 1 
        4  6263 1 1  71 ASN HD21 H -12.729 -14.486  -3.423 1.00 . A A . 149 ASN HD21 1 1 
        4  6264 1 1  71 ASN HD22 H -14.195 -14.838  -2.580 1.00 . A A . 149 ASN HD22 1 1 
        4  6265 1 1  71 ASN N    N -10.662 -11.070  -3.181 1.00 . A A . 149 ASN N    1 1 
        4  6266 1 1  71 ASN ND2  N -13.333 -14.379  -2.658 1.00 . A A . 149 ASN ND2  1 1 
        4  6267 1 1  71 ASN O    O -11.556 -10.928   0.051 1.00 . A A . 149 ASN O    1 1 
        4  6268 1 1  71 ASN OD1  O -13.654 -13.377  -0.674 1.00 . A A . 149 ASN OD1  1 1 
        4  6269 1 1  72 GLN C    C -13.425  -8.461   0.605 1.00 . A A . 150 GLN C    1 1 
        4  6270 1 1  72 GLN CA   C -12.181  -8.247  -0.250 1.00 . A A . 150 GLN CA   1 1 
        4  6271 1 1  72 GLN CB   C -12.184  -6.831  -0.827 1.00 . A A . 150 GLN CB   1 1 
        4  6272 1 1  72 GLN CD   C -11.676  -4.393  -0.413 1.00 . A A . 150 GLN CD   1 1 
        4  6273 1 1  72 GLN CG   C -11.923  -5.752   0.210 1.00 . A A . 150 GLN CG   1 1 
        4  6274 1 1  72 GLN H    H -12.293  -8.952  -2.242 1.00 . A A . 150 GLN H    1 1 
        4  6275 1 1  72 GLN HA   H -11.307  -8.370   0.372 1.00 . A A . 150 GLN HA   1 1 
        4  6276 1 1  72 GLN HB2  H -11.419  -6.763  -1.587 1.00 . A A . 150 GLN HB2  1 1 
        4  6277 1 1  72 GLN HB3  H -13.146  -6.641  -1.279 1.00 . A A . 150 GLN HB3  1 1 
        4  6278 1 1  72 GLN HE21 H -10.135  -5.120  -1.437 1.00 . A A . 150 GLN HE21 1 1 
        4  6279 1 1  72 GLN HE22 H -10.477  -3.444  -1.683 1.00 . A A . 150 GLN HE22 1 1 
        4  6280 1 1  72 GLN HG2  H -12.782  -5.682   0.861 1.00 . A A . 150 GLN HG2  1 1 
        4  6281 1 1  72 GLN HG3  H -11.055  -6.030   0.790 1.00 . A A . 150 GLN HG3  1 1 
        4  6282 1 1  72 GLN N    N -12.109  -9.233  -1.321 1.00 . A A . 150 GLN N    1 1 
        4  6283 1 1  72 GLN NE2  N -10.660  -4.311  -1.264 1.00 . A A . 150 GLN NE2  1 1 
        4  6284 1 1  72 GLN O    O -14.550  -8.404   0.109 1.00 . A A . 150 GLN O    1 1 
        4  6285 1 1  72 GLN OE1  O -12.390  -3.430  -0.135 1.00 . A A . 150 GLN OE1  1 1 
        4  6286 1 1  73 THR C    C -14.371  -7.835   3.876 1.00 . A A . 151 THR C    1 1 
        4  6287 1 1  73 THR CA   C -14.316  -8.933   2.820 1.00 . A A . 151 THR CA   1 1 
        4  6288 1 1  73 THR CB   C -14.175 -10.299   3.494 1.00 . A A . 151 THR CB   1 1 
        4  6289 1 1  73 THR CG2  C -12.768 -10.589   3.970 1.00 . A A . 151 THR CG2  1 1 
        4  6290 1 1  73 THR H    H -12.291  -8.742   2.226 1.00 . A A . 151 THR H    1 1 
        4  6291 1 1  73 THR HA   H -15.234  -8.916   2.252 1.00 . A A . 151 THR HA   1 1 
        4  6292 1 1  73 THR HB   H -14.449 -11.068   2.786 1.00 . A A . 151 THR HB   1 1 
        4  6293 1 1  73 THR HG1  H -15.949 -10.412   4.315 1.00 . A A . 151 THR HG1  1 1 
        4  6294 1 1  73 THR HG21 H -12.195 -11.015   3.160 1.00 . A A . 151 THR HG21 1 1 
        4  6295 1 1  73 THR HG22 H -12.804 -11.288   4.793 1.00 . A A . 151 THR HG22 1 1 
        4  6296 1 1  73 THR HG23 H -12.303  -9.671   4.298 1.00 . A A . 151 THR HG23 1 1 
        4  6297 1 1  73 THR N    N -13.213  -8.709   1.893 1.00 . A A . 151 THR N    1 1 
        4  6298 1 1  73 THR O    O -13.390  -7.124   4.096 1.00 . A A . 151 THR O    1 1 
        4  6299 1 1  73 THR OG1  O -15.037 -10.397   4.613 1.00 . A A . 151 THR OG1  1 1 
        4  6300 1 1  74 LYS C    C -14.529  -6.634   6.514 1.00 . A A . 152 LYS C    1 1 
        4  6301 1 1  74 LYS CA   C -15.717  -6.681   5.558 1.00 . A A . 152 LYS CA   1 1 
        4  6302 1 1  74 LYS CB   C -17.004  -6.954   6.340 1.00 . A A . 152 LYS CB   1 1 
        4  6303 1 1  74 LYS CD   C -17.531  -8.663   8.110 1.00 . A A . 152 LYS CD   1 1 
        4  6304 1 1  74 LYS CE   C -16.301  -9.173   8.843 1.00 . A A . 152 LYS CE   1 1 
        4  6305 1 1  74 LYS CG   C -17.244  -8.427   6.636 1.00 . A A . 152 LYS CG   1 1 
        4  6306 1 1  74 LYS H    H -16.273  -8.291   4.299 1.00 . A A . 152 LYS H    1 1 
        4  6307 1 1  74 LYS HA   H -15.804  -5.724   5.066 1.00 . A A . 152 LYS HA   1 1 
        4  6308 1 1  74 LYS HB2  H -16.959  -6.422   7.279 1.00 . A A . 152 LYS HB2  1 1 
        4  6309 1 1  74 LYS HB3  H -17.840  -6.585   5.768 1.00 . A A . 152 LYS HB3  1 1 
        4  6310 1 1  74 LYS HD2  H -17.844  -7.732   8.559 1.00 . A A . 152 LYS HD2  1 1 
        4  6311 1 1  74 LYS HD3  H -18.322  -9.393   8.201 1.00 . A A . 152 LYS HD3  1 1 
        4  6312 1 1  74 LYS HE2  H -16.031 -10.137   8.439 1.00 . A A . 152 LYS HE2  1 1 
        4  6313 1 1  74 LYS HE3  H -15.489  -8.478   8.685 1.00 . A A . 152 LYS HE3  1 1 
        4  6314 1 1  74 LYS HG2  H -18.091  -8.766   6.057 1.00 . A A . 152 LYS HG2  1 1 
        4  6315 1 1  74 LYS HG3  H -16.367  -8.989   6.354 1.00 . A A . 152 LYS HG3  1 1 
        4  6316 1 1  74 LYS HZ1  H -17.079 -10.181  10.498 1.00 . A A . 152 LYS HZ1  1 1 
        4  6317 1 1  74 LYS HZ2  H -17.087  -8.498  10.657 1.00 . A A . 152 LYS HZ2  1 1 
        4  6318 1 1  74 LYS HZ3  H -15.637  -9.355  10.816 1.00 . A A . 152 LYS HZ3  1 1 
        4  6319 1 1  74 LYS N    N -15.526  -7.698   4.524 1.00 . A A . 152 LYS N    1 1 
        4  6320 1 1  74 LYS NZ   N -16.543  -9.311  10.306 1.00 . A A . 152 LYS NZ   1 1 
        4  6321 1 1  74 LYS O    O -14.054  -5.558   6.877 1.00 . A A . 152 LYS O    1 1 
        4  6322 1 1  75 GLU C    C -11.706  -7.172   7.258 1.00 . A A . 153 GLU C    1 1 
        4  6323 1 1  75 GLU CA   C -12.920  -7.901   7.828 1.00 . A A . 153 GLU CA   1 1 
        4  6324 1 1  75 GLU CB   C -12.572  -9.367   8.096 1.00 . A A . 153 GLU CB   1 1 
        4  6325 1 1  75 GLU CD   C -12.239 -11.014   9.982 1.00 . A A . 153 GLU CD   1 1 
        4  6326 1 1  75 GLU CG   C -13.081  -9.878   9.434 1.00 . A A . 153 GLU CG   1 1 
        4  6327 1 1  75 GLU H    H -14.477  -8.629   6.591 1.00 . A A . 153 GLU H    1 1 
        4  6328 1 1  75 GLU HA   H -13.203  -7.430   8.757 1.00 . A A . 153 GLU HA   1 1 
        4  6329 1 1  75 GLU HB2  H -13.004  -9.976   7.316 1.00 . A A . 153 GLU HB2  1 1 
        4  6330 1 1  75 GLU HB3  H -11.499  -9.482   8.077 1.00 . A A . 153 GLU HB3  1 1 
        4  6331 1 1  75 GLU HG2  H -13.066  -9.065  10.145 1.00 . A A . 153 GLU HG2  1 1 
        4  6332 1 1  75 GLU HG3  H -14.095 -10.228   9.310 1.00 . A A . 153 GLU HG3  1 1 
        4  6333 1 1  75 GLU N    N -14.055  -7.807   6.916 1.00 . A A . 153 GLU N    1 1 
        4  6334 1 1  75 GLU O    O -11.092  -6.345   7.934 1.00 . A A . 153 GLU O    1 1 
        4  6335 1 1  75 GLU OE1  O -11.825 -11.884   9.187 1.00 . A A . 153 GLU OE1  1 1 
        4  6336 1 1  75 GLU OE2  O -11.995 -11.035  11.207 1.00 . A A . 153 GLU OE2  1 1 
        4  6337 1 1  76 LEU C    C -10.481  -5.353   5.175 1.00 . A A . 154 LEU C    1 1 
        4  6338 1 1  76 LEU CA   C -10.235  -6.849   5.348 1.00 . A A . 154 LEU CA   1 1 
        4  6339 1 1  76 LEU CB   C  -9.985  -7.505   3.987 1.00 . A A . 154 LEU CB   1 1 
        4  6340 1 1  76 LEU CD1  C  -7.567  -6.853   3.836 1.00 . A A . 154 LEU CD1  1 1 
        4  6341 1 1  76 LEU CD2  C  -8.811  -7.526   1.773 1.00 . A A . 154 LEU CD2  1 1 
        4  6342 1 1  76 LEU CG   C  -8.912  -6.836   3.125 1.00 . A A . 154 LEU CG   1 1 
        4  6343 1 1  76 LEU H    H -11.900  -8.142   5.520 1.00 . A A . 154 LEU H    1 1 
        4  6344 1 1  76 LEU HA   H  -9.365  -6.990   5.973 1.00 . A A . 154 LEU HA   1 1 
        4  6345 1 1  76 LEU HB2  H  -9.693  -8.532   4.155 1.00 . A A . 154 LEU HB2  1 1 
        4  6346 1 1  76 LEU HB3  H -10.913  -7.500   3.434 1.00 . A A . 154 LEU HB3  1 1 
        4  6347 1 1  76 LEU HD11 H  -6.779  -7.014   3.114 1.00 . A A . 154 LEU HD11 1 1 
        4  6348 1 1  76 LEU HD12 H  -7.555  -7.650   4.565 1.00 . A A . 154 LEU HD12 1 1 
        4  6349 1 1  76 LEU HD13 H  -7.411  -5.908   4.334 1.00 . A A . 154 LEU HD13 1 1 
        4  6350 1 1  76 LEU HD21 H  -9.741  -8.030   1.555 1.00 . A A . 154 LEU HD21 1 1 
        4  6351 1 1  76 LEU HD22 H  -8.008  -8.248   1.796 1.00 . A A . 154 LEU HD22 1 1 
        4  6352 1 1  76 LEU HD23 H  -8.612  -6.791   1.008 1.00 . A A . 154 LEU HD23 1 1 
        4  6353 1 1  76 LEU HG   H  -9.188  -5.806   2.956 1.00 . A A . 154 LEU HG   1 1 
        4  6354 1 1  76 LEU N    N -11.370  -7.479   6.010 1.00 . A A . 154 LEU N    1 1 
        4  6355 1 1  76 LEU O    O  -9.574  -4.539   5.346 1.00 . A A . 154 LEU O    1 1 
        4  6356 1 1  77 GLU C    C -11.872  -2.809   5.931 1.00 . A A . 155 GLU C    1 1 
        4  6357 1 1  77 GLU CA   C -12.091  -3.605   4.649 1.00 . A A . 155 GLU CA   1 1 
        4  6358 1 1  77 GLU CB   C -13.554  -3.501   4.213 1.00 . A A . 155 GLU CB   1 1 
        4  6359 1 1  77 GLU CD   C -15.243  -3.829   2.364 1.00 . A A . 155 GLU CD   1 1 
        4  6360 1 1  77 GLU CG   C -13.776  -3.834   2.747 1.00 . A A . 155 GLU CG   1 1 
        4  6361 1 1  77 GLU H    H -12.392  -5.704   4.724 1.00 . A A . 155 GLU H    1 1 
        4  6362 1 1  77 GLU HA   H -11.462  -3.196   3.872 1.00 . A A . 155 GLU HA   1 1 
        4  6363 1 1  77 GLU HB2  H -14.144  -4.183   4.808 1.00 . A A . 155 GLU HB2  1 1 
        4  6364 1 1  77 GLU HB3  H -13.899  -2.493   4.388 1.00 . A A . 155 GLU HB3  1 1 
        4  6365 1 1  77 GLU HG2  H -13.260  -3.103   2.143 1.00 . A A . 155 GLU HG2  1 1 
        4  6366 1 1  77 GLU HG3  H -13.371  -4.815   2.549 1.00 . A A . 155 GLU HG3  1 1 
        4  6367 1 1  77 GLU N    N -11.718  -5.002   4.840 1.00 . A A . 155 GLU N    1 1 
        4  6368 1 1  77 GLU O    O -11.186  -1.787   5.930 1.00 . A A . 155 GLU O    1 1 
        4  6369 1 1  77 GLU OE1  O -15.821  -2.728   2.241 1.00 . A A . 155 GLU OE1  1 1 
        4  6370 1 1  77 GLU OE2  O -15.814  -4.925   2.187 1.00 . A A . 155 GLU OE2  1 1 
        4  6371 1 1  78 GLU C    C -10.864  -2.432   8.690 1.00 . A A . 156 GLU C    1 1 
        4  6372 1 1  78 GLU CA   C -12.332  -2.617   8.316 1.00 . A A . 156 GLU CA   1 1 
        4  6373 1 1  78 GLU CB   C -13.051  -3.420   9.402 1.00 . A A . 156 GLU CB   1 1 
        4  6374 1 1  78 GLU CD   C -15.296  -2.275   9.593 1.00 . A A . 156 GLU CD   1 1 
        4  6375 1 1  78 GLU CG   C -14.552  -3.531   9.183 1.00 . A A . 156 GLU CG   1 1 
        4  6376 1 1  78 GLU H    H -13.000  -4.101   6.956 1.00 . A A . 156 GLU H    1 1 
        4  6377 1 1  78 GLU HA   H -12.795  -1.645   8.233 1.00 . A A . 156 GLU HA   1 1 
        4  6378 1 1  78 GLU HB2  H -12.638  -4.417   9.430 1.00 . A A . 156 GLU HB2  1 1 
        4  6379 1 1  78 GLU HB3  H -12.883  -2.943  10.356 1.00 . A A . 156 GLU HB3  1 1 
        4  6380 1 1  78 GLU HG2  H -14.737  -3.715   8.136 1.00 . A A . 156 GLU HG2  1 1 
        4  6381 1 1  78 GLU HG3  H -14.926  -4.361   9.765 1.00 . A A . 156 GLU HG3  1 1 
        4  6382 1 1  78 GLU N    N -12.461  -3.284   7.024 1.00 . A A . 156 GLU N    1 1 
        4  6383 1 1  78 GLU O    O -10.444  -1.341   9.074 1.00 . A A . 156 GLU O    1 1 
        4  6384 1 1  78 GLU OE1  O -14.809  -1.168   9.282 1.00 . A A . 156 GLU OE1  1 1 
        4  6385 1 1  78 GLU OE2  O -16.367  -2.399  10.223 1.00 . A A . 156 GLU OE2  1 1 
        4  6386 1 1  79 LYS C    C  -7.937  -2.420   8.105 1.00 . A A . 157 LYS C    1 1 
        4  6387 1 1  79 LYS CA   C  -8.675  -3.470   8.932 1.00 . A A . 157 LYS CA   1 1 
        4  6388 1 1  79 LYS CB   C  -8.038  -4.844   8.715 1.00 . A A . 157 LYS CB   1 1 
        4  6389 1 1  79 LYS CD   C  -7.471  -5.399  11.099 1.00 . A A . 157 LYS CD   1 1 
        4  6390 1 1  79 LYS CE   C  -6.528  -4.863  12.164 1.00 . A A . 157 LYS CE   1 1 
        4  6391 1 1  79 LYS CG   C  -6.926  -5.162   9.701 1.00 . A A . 157 LYS CG   1 1 
        4  6392 1 1  79 LYS H    H -10.494  -4.355   8.299 1.00 . A A . 157 LYS H    1 1 
        4  6393 1 1  79 LYS HA   H  -8.594  -3.209   9.976 1.00 . A A . 157 LYS HA   1 1 
        4  6394 1 1  79 LYS HB2  H  -8.802  -5.602   8.811 1.00 . A A . 157 LYS HB2  1 1 
        4  6395 1 1  79 LYS HB3  H  -7.628  -4.885   7.717 1.00 . A A . 157 LYS HB3  1 1 
        4  6396 1 1  79 LYS HD2  H  -8.424  -4.899  11.193 1.00 . A A . 157 LYS HD2  1 1 
        4  6397 1 1  79 LYS HD3  H  -7.603  -6.460  11.249 1.00 . A A . 157 LYS HD3  1 1 
        4  6398 1 1  79 LYS HE2  H  -6.562  -3.783  12.147 1.00 . A A . 157 LYS HE2  1 1 
        4  6399 1 1  79 LYS HE3  H  -6.856  -5.217  13.130 1.00 . A A . 157 LYS HE3  1 1 
        4  6400 1 1  79 LYS HG2  H  -6.409  -6.051   9.372 1.00 . A A . 157 LYS HG2  1 1 
        4  6401 1 1  79 LYS HG3  H  -6.235  -4.331   9.729 1.00 . A A . 157 LYS HG3  1 1 
        4  6402 1 1  79 LYS HZ1  H  -5.089  -6.338  11.823 1.00 . A A . 157 LYS HZ1  1 1 
        4  6403 1 1  79 LYS HZ2  H  -4.529  -5.036  12.744 1.00 . A A . 157 LYS HZ2  1 1 
        4  6404 1 1  79 LYS HZ3  H  -4.744  -4.860  11.076 1.00 . A A . 157 LYS HZ3  1 1 
        4  6405 1 1  79 LYS N    N -10.093  -3.510   8.590 1.00 . A A . 157 LYS N    1 1 
        4  6406 1 1  79 LYS NZ   N  -5.124  -5.305  11.936 1.00 . A A . 157 LYS NZ   1 1 
        4  6407 1 1  79 LYS O    O  -6.989  -1.797   8.583 1.00 . A A . 157 LYS O    1 1 
        4  6408 1 1  80 VAL C    C  -7.994   0.180   6.514 1.00 . A A . 158 VAL C    1 1 
        4  6409 1 1  80 VAL CA   C  -7.757  -1.235   5.991 1.00 . A A . 158 VAL CA   1 1 
        4  6410 1 1  80 VAL CB   C  -8.293  -1.342   4.548 1.00 . A A . 158 VAL CB   1 1 
        4  6411 1 1  80 VAL CG1  C  -7.651  -0.289   3.651 1.00 . A A . 158 VAL CG1  1 1 
        4  6412 1 1  80 VAL CG2  C  -8.055  -2.740   3.993 1.00 . A A . 158 VAL CG2  1 1 
        4  6413 1 1  80 VAL H    H  -9.143  -2.740   6.540 1.00 . A A . 158 VAL H    1 1 
        4  6414 1 1  80 VAL HA   H  -6.694  -1.428   5.975 1.00 . A A . 158 VAL HA   1 1 
        4  6415 1 1  80 VAL HB   H  -9.358  -1.163   4.567 1.00 . A A . 158 VAL HB   1 1 
        4  6416 1 1  80 VAL HG11 H  -7.145  -0.774   2.829 1.00 . A A . 158 VAL HG11 1 1 
        4  6417 1 1  80 VAL HG12 H  -6.939   0.286   4.224 1.00 . A A . 158 VAL HG12 1 1 
        4  6418 1 1  80 VAL HG13 H  -8.416   0.368   3.265 1.00 . A A . 158 VAL HG13 1 1 
        4  6419 1 1  80 VAL HG21 H  -7.290  -2.701   3.231 1.00 . A A . 158 VAL HG21 1 1 
        4  6420 1 1  80 VAL HG22 H  -8.971  -3.117   3.563 1.00 . A A . 158 VAL HG22 1 1 
        4  6421 1 1  80 VAL HG23 H  -7.736  -3.395   4.790 1.00 . A A . 158 VAL HG23 1 1 
        4  6422 1 1  80 VAL N    N  -8.379  -2.220   6.868 1.00 . A A . 158 VAL N    1 1 
        4  6423 1 1  80 VAL O    O  -7.063   0.978   6.621 1.00 . A A . 158 VAL O    1 1 
        4  6424 1 1  81 MET C    C  -9.029   2.022   8.746 1.00 . A A . 159 MET C    1 1 
        4  6425 1 1  81 MET CA   C  -9.611   1.797   7.354 1.00 . A A . 159 MET CA   1 1 
        4  6426 1 1  81 MET CB   C -11.132   1.948   7.395 1.00 . A A . 159 MET CB   1 1 
        4  6427 1 1  81 MET CE   C -13.994   0.031   5.409 1.00 . A A . 159 MET CE   1 1 
        4  6428 1 1  81 MET CG   C -11.813   1.605   6.080 1.00 . A A . 159 MET CG   1 1 
        4  6429 1 1  81 MET H    H  -9.946  -0.198   6.733 1.00 . A A . 159 MET H    1 1 
        4  6430 1 1  81 MET HA   H  -9.203   2.538   6.683 1.00 . A A . 159 MET HA   1 1 
        4  6431 1 1  81 MET HB2  H -11.527   1.297   8.161 1.00 . A A . 159 MET HB2  1 1 
        4  6432 1 1  81 MET HB3  H -11.375   2.970   7.645 1.00 . A A . 159 MET HB3  1 1 
        4  6433 1 1  81 MET HE1  H -13.170  -0.655   5.540 1.00 . A A . 159 MET HE1  1 1 
        4  6434 1 1  81 MET HE2  H -14.156   0.202   4.355 1.00 . A A . 159 MET HE2  1 1 
        4  6435 1 1  81 MET HE3  H -14.886  -0.391   5.847 1.00 . A A . 159 MET HE3  1 1 
        4  6436 1 1  81 MET HG2  H -11.531   2.340   5.342 1.00 . A A . 159 MET HG2  1 1 
        4  6437 1 1  81 MET HG3  H -11.479   0.629   5.761 1.00 . A A . 159 MET HG3  1 1 
        4  6438 1 1  81 MET N    N  -9.247   0.481   6.840 1.00 . A A . 159 MET N    1 1 
        4  6439 1 1  81 MET O    O  -8.563   3.116   9.066 1.00 . A A . 159 MET O    1 1 
        4  6440 1 1  81 MET SD   S -13.611   1.585   6.214 1.00 . A A . 159 MET SD   1 1 
        4  6441 1 1  82 GLU C    C  -7.059   1.431  10.922 1.00 . A A . 160 GLU C    1 1 
        4  6442 1 1  82 GLU CA   C  -8.539   1.063  10.930 1.00 . A A . 160 GLU CA   1 1 
        4  6443 1 1  82 GLU CB   C  -8.745  -0.266  11.662 1.00 . A A . 160 GLU CB   1 1 
        4  6444 1 1  82 GLU CD   C  -8.702  -0.995  14.080 1.00 . A A . 160 GLU CD   1 1 
        4  6445 1 1  82 GLU CG   C  -9.363  -0.110  13.042 1.00 . A A . 160 GLU CG   1 1 
        4  6446 1 1  82 GLU H    H  -9.446   0.135   9.258 1.00 . A A . 160 GLU H    1 1 
        4  6447 1 1  82 GLU HA   H  -9.086   1.837  11.448 1.00 . A A . 160 GLU HA   1 1 
        4  6448 1 1  82 GLU HB2  H  -9.395  -0.893  11.069 1.00 . A A . 160 GLU HB2  1 1 
        4  6449 1 1  82 GLU HB3  H  -7.789  -0.757  11.772 1.00 . A A . 160 GLU HB3  1 1 
        4  6450 1 1  82 GLU HG2  H  -9.264   0.919  13.353 1.00 . A A . 160 GLU HG2  1 1 
        4  6451 1 1  82 GLU HG3  H -10.411  -0.369  12.984 1.00 . A A . 160 GLU HG3  1 1 
        4  6452 1 1  82 GLU N    N  -9.061   0.980   9.571 1.00 . A A . 160 GLU N    1 1 
        4  6453 1 1  82 GLU O    O  -6.639   2.373  11.593 1.00 . A A . 160 GLU O    1 1 
        4  6454 1 1  82 GLU OE1  O  -7.456  -0.976  14.170 1.00 . A A . 160 GLU OE1  1 1 
        4  6455 1 1  82 GLU OE2  O  -9.429  -1.707  14.804 1.00 . A A . 160 GLU OE2  1 1 
        4  6456 1 1  83 LEU C    C  -4.573   2.305   9.454 1.00 . A A . 161 LEU C    1 1 
        4  6457 1 1  83 LEU CA   C  -4.842   0.931  10.058 1.00 . A A . 161 LEU CA   1 1 
        4  6458 1 1  83 LEU CB   C  -4.171  -0.152   9.211 1.00 . A A . 161 LEU CB   1 1 
        4  6459 1 1  83 LEU CD1  C  -4.003  -2.631   8.883 1.00 . A A . 161 LEU CD1  1 1 
        4  6460 1 1  83 LEU CD2  C  -2.719  -1.526  10.722 1.00 . A A . 161 LEU CD2  1 1 
        4  6461 1 1  83 LEU CG   C  -4.001  -1.505   9.904 1.00 . A A . 161 LEU CG   1 1 
        4  6462 1 1  83 LEU H    H  -6.668  -0.054   9.642 1.00 . A A . 161 LEU H    1 1 
        4  6463 1 1  83 LEU HA   H  -4.431   0.902  11.056 1.00 . A A . 161 LEU HA   1 1 
        4  6464 1 1  83 LEU HB2  H  -4.763  -0.299   8.320 1.00 . A A . 161 LEU HB2  1 1 
        4  6465 1 1  83 LEU HB3  H  -3.194   0.202   8.920 1.00 . A A . 161 LEU HB3  1 1 
        4  6466 1 1  83 LEU HD11 H  -4.285  -3.555   9.366 1.00 . A A . 161 LEU HD11 1 1 
        4  6467 1 1  83 LEU HD12 H  -3.015  -2.734   8.458 1.00 . A A . 161 LEU HD12 1 1 
        4  6468 1 1  83 LEU HD13 H  -4.710  -2.405   8.098 1.00 . A A . 161 LEU HD13 1 1 
        4  6469 1 1  83 LEU HD21 H  -2.905  -1.099  11.696 1.00 . A A . 161 LEU HD21 1 1 
        4  6470 1 1  83 LEU HD22 H  -1.959  -0.950  10.215 1.00 . A A . 161 LEU HD22 1 1 
        4  6471 1 1  83 LEU HD23 H  -2.381  -2.546  10.835 1.00 . A A . 161 LEU HD23 1 1 
        4  6472 1 1  83 LEU HG   H  -4.831  -1.664  10.578 1.00 . A A . 161 LEU HG   1 1 
        4  6473 1 1  83 LEU N    N  -6.274   0.682  10.155 1.00 . A A . 161 LEU N    1 1 
        4  6474 1 1  83 LEU O    O  -3.630   2.993   9.846 1.00 . A A . 161 LEU O    1 1 
        4  6475 1 1  84 HIS C    C  -5.404   5.129   8.856 1.00 . A A . 162 HIS C    1 1 
        4  6476 1 1  84 HIS CA   C  -5.266   3.995   7.846 1.00 . A A . 162 HIS CA   1 1 
        4  6477 1 1  84 HIS CB   C  -6.311   4.150   6.739 1.00 . A A . 162 HIS CB   1 1 
        4  6478 1 1  84 HIS CD2  C  -5.296   6.445   6.081 1.00 . A A . 162 HIS CD2  1 1 
        4  6479 1 1  84 HIS CE1  C  -6.598   6.893   4.375 1.00 . A A . 162 HIS CE1  1 1 
        4  6480 1 1  84 HIS CG   C  -6.162   5.412   5.948 1.00 . A A . 162 HIS CG   1 1 
        4  6481 1 1  84 HIS H    H  -6.145   2.109   8.234 1.00 . A A . 162 HIS H    1 1 
        4  6482 1 1  84 HIS HA   H  -4.280   4.037   7.407 1.00 . A A . 162 HIS HA   1 1 
        4  6483 1 1  84 HIS HB2  H  -6.228   3.319   6.056 1.00 . A A . 162 HIS HB2  1 1 
        4  6484 1 1  84 HIS HB3  H  -7.296   4.149   7.182 1.00 . A A . 162 HIS HB3  1 1 
        4  6485 1 1  84 HIS HD1  H  -7.694   5.171   4.521 1.00 . A A . 162 HIS HD1  1 1 
        4  6486 1 1  84 HIS HD2  H  -4.520   6.539   6.827 1.00 . A A . 162 HIS HD2  1 1 
        4  6487 1 1  84 HIS HE1  H  -7.048   7.390   3.528 1.00 . A A . 162 HIS HE1  1 1 
        4  6488 1 1  84 HIS HE2  H  -5.182   8.237   4.993 1.00 . A A . 162 HIS HE2  1 1 
        4  6489 1 1  84 HIS N    N  -5.411   2.701   8.501 1.00 . A A . 162 HIS N    1 1 
        4  6490 1 1  84 HIS ND1  N  -6.964   5.724   4.870 1.00 . A A . 162 HIS ND1  1 1 
        4  6491 1 1  84 HIS NE2  N  -5.589   7.351   5.092 1.00 . A A . 162 HIS NE2  1 1 
        4  6492 1 1  84 HIS O    O  -4.508   5.961   8.997 1.00 . A A . 162 HIS O    1 1 
        4  6493 1 1  85 LYS C    C  -5.827   6.032  11.741 1.00 . A A . 163 LYS C    1 1 
        4  6494 1 1  85 LYS CA   C  -6.785   6.180  10.562 1.00 . A A . 163 LYS CA   1 1 
        4  6495 1 1  85 LYS CB   C  -8.233   6.098  11.051 1.00 . A A . 163 LYS CB   1 1 
        4  6496 1 1  85 LYS CD   C  -9.482   6.556  13.184 1.00 . A A . 163 LYS CD   1 1 
        4  6497 1 1  85 LYS CE   C -10.407   7.613  13.766 1.00 . A A . 163 LYS CE   1 1 
        4  6498 1 1  85 LYS CG   C  -8.581   7.137  12.106 1.00 . A A . 163 LYS CG   1 1 
        4  6499 1 1  85 LYS H    H  -7.206   4.458   9.405 1.00 . A A . 163 LYS H    1 1 
        4  6500 1 1  85 LYS HA   H  -6.623   7.142  10.099 1.00 . A A . 163 LYS HA   1 1 
        4  6501 1 1  85 LYS HB2  H  -8.893   6.238  10.208 1.00 . A A . 163 LYS HB2  1 1 
        4  6502 1 1  85 LYS HB3  H  -8.403   5.118  11.471 1.00 . A A . 163 LYS HB3  1 1 
        4  6503 1 1  85 LYS HD2  H -10.080   5.767  12.752 1.00 . A A . 163 LYS HD2  1 1 
        4  6504 1 1  85 LYS HD3  H  -8.867   6.152  13.975 1.00 . A A . 163 LYS HD3  1 1 
        4  6505 1 1  85 LYS HE2  H -10.704   7.306  14.757 1.00 . A A . 163 LYS HE2  1 1 
        4  6506 1 1  85 LYS HE3  H  -9.871   8.548  13.825 1.00 . A A . 163 LYS HE3  1 1 
        4  6507 1 1  85 LYS HG2  H  -7.669   7.489  12.565 1.00 . A A . 163 LYS HG2  1 1 
        4  6508 1 1  85 LYS HG3  H  -9.089   7.963  11.631 1.00 . A A . 163 LYS HG3  1 1 
        4  6509 1 1  85 LYS HZ1  H -12.451   7.979  13.542 1.00 . A A . 163 LYS HZ1  1 1 
        4  6510 1 1  85 LYS HZ2  H -11.805   6.955  12.360 1.00 . A A . 163 LYS HZ2  1 1 
        4  6511 1 1  85 LYS HZ3  H -11.500   8.618  12.297 1.00 . A A . 163 LYS HZ3  1 1 
        4  6512 1 1  85 LYS N    N  -6.531   5.152   9.560 1.00 . A A . 163 LYS N    1 1 
        4  6513 1 1  85 LYS NZ   N -11.626   7.804  12.933 1.00 . A A . 163 LYS NZ   1 1 
        4  6514 1 1  85 LYS O    O  -5.482   7.013  12.400 1.00 . A A . 163 LYS O    1 1 
        4  6515 1 1  86 SER C    C  -3.226   5.375  12.997 1.00 . A A . 164 SER C    1 1 
        4  6516 1 1  86 SER CA   C  -4.485   4.518  13.098 1.00 . A A . 164 SER CA   1 1 
        4  6517 1 1  86 SER CB   C  -4.107   3.035  13.106 1.00 . A A . 164 SER CB   1 1 
        4  6518 1 1  86 SER H    H  -5.716   4.059  11.439 1.00 . A A . 164 SER H    1 1 
        4  6519 1 1  86 SER HA   H  -4.993   4.754  14.021 1.00 . A A . 164 SER HA   1 1 
        4  6520 1 1  86 SER HB2  H  -4.248   2.625  12.117 1.00 . A A . 164 SER HB2  1 1 
        4  6521 1 1  86 SER HB3  H  -3.071   2.931  13.394 1.00 . A A . 164 SER HB3  1 1 
        4  6522 1 1  86 SER HG   H  -5.826   2.581  13.928 1.00 . A A . 164 SER HG   1 1 
        4  6523 1 1  86 SER N    N  -5.402   4.799  11.999 1.00 . A A . 164 SER N    1 1 
        4  6524 1 1  86 SER O    O  -2.566   5.643  14.001 1.00 . A A . 164 SER O    1 1 
        4  6525 1 1  86 SER OG   O  -4.910   2.308  14.019 1.00 . A A . 164 SER OG   1 1 
        4  6526 1 1  87 TYR C    C  -2.099   8.113  11.539 1.00 . A A . 165 TYR C    1 1 
        4  6527 1 1  87 TYR CA   C  -1.721   6.635  11.558 1.00 . A A . 165 TYR CA   1 1 
        4  6528 1 1  87 TYR CB   C  -1.051   6.249  10.239 1.00 . A A . 165 TYR CB   1 1 
        4  6529 1 1  87 TYR CD1  C  -0.130   4.069  11.104 1.00 . A A . 165 TYR CD1  1 1 
        4  6530 1 1  87 TYR CD2  C  -1.244   4.058   8.997 1.00 . A A . 165 TYR CD2  1 1 
        4  6531 1 1  87 TYR CE1  C   0.098   2.713  10.997 1.00 . A A . 165 TYR CE1  1 1 
        4  6532 1 1  87 TYR CE2  C  -1.020   2.699   8.882 1.00 . A A . 165 TYR CE2  1 1 
        4  6533 1 1  87 TYR CG   C  -0.803   4.764  10.109 1.00 . A A . 165 TYR CG   1 1 
        4  6534 1 1  87 TYR CZ   C  -0.349   2.031   9.884 1.00 . A A . 165 TYR CZ   1 1 
        4  6535 1 1  87 TYR H    H  -3.461   5.566  11.017 1.00 . A A . 165 TYR H    1 1 
        4  6536 1 1  87 TYR HA   H  -1.030   6.457  12.368 1.00 . A A . 165 TYR HA   1 1 
        4  6537 1 1  87 TYR HB2  H  -1.683   6.553   9.418 1.00 . A A . 165 TYR HB2  1 1 
        4  6538 1 1  87 TYR HB3  H  -0.099   6.754  10.163 1.00 . A A . 165 TYR HB3  1 1 
        4  6539 1 1  87 TYR HD1  H   0.219   4.605  11.974 1.00 . A A . 165 TYR HD1  1 1 
        4  6540 1 1  87 TYR HD2  H  -1.769   4.585   8.214 1.00 . A A . 165 TYR HD2  1 1 
        4  6541 1 1  87 TYR HE1  H   0.622   2.192  11.783 1.00 . A A . 165 TYR HE1  1 1 
        4  6542 1 1  87 TYR HE2  H  -1.371   2.166   8.010 1.00 . A A . 165 TYR HE2  1 1 
        4  6543 1 1  87 TYR HH   H   0.751   0.470  10.112 1.00 . A A . 165 TYR HH   1 1 
        4  6544 1 1  87 TYR N    N  -2.899   5.806  11.782 1.00 . A A . 165 TYR N    1 1 
        4  6545 1 1  87 TYR O    O  -3.069   8.505  10.890 1.00 . A A . 165 TYR O    1 1 
        4  6546 1 1  87 TYR OH   O  -0.124   0.678   9.774 1.00 . A A . 165 TYR OH   1 1 
        4  6547 1 1  88 ARG C    C  -0.333  11.194  12.134 1.00 . A A . 166 ARG C    1 1 
        4  6548 1 1  88 ARG CA   C  -1.604  10.363  12.317 1.00 . A A . 166 ARG CA   1 1 
        4  6549 1 1  88 ARG CB   C  -2.267  10.719  13.649 1.00 . A A . 166 ARG CB   1 1 
        4  6550 1 1  88 ARG CD   C  -4.256  10.470  15.166 1.00 . A A . 166 ARG CD   1 1 
        4  6551 1 1  88 ARG CG   C  -3.601  10.024  13.869 1.00 . A A . 166 ARG CG   1 1 
        4  6552 1 1  88 ARG CZ   C  -6.058  11.979  15.904 1.00 . A A . 166 ARG CZ   1 1 
        4  6553 1 1  88 ARG H    H  -0.577   8.561  12.756 1.00 . A A . 166 ARG H    1 1 
        4  6554 1 1  88 ARG HA   H  -2.287  10.601  11.517 1.00 . A A . 166 ARG HA   1 1 
        4  6555 1 1  88 ARG HB2  H  -1.603  10.440  14.455 1.00 . A A . 166 ARG HB2  1 1 
        4  6556 1 1  88 ARG HB3  H  -2.432  11.786  13.683 1.00 . A A . 166 ARG HB3  1 1 
        4  6557 1 1  88 ARG HD2  H  -4.694   9.608  15.648 1.00 . A A . 166 ARG HD2  1 1 
        4  6558 1 1  88 ARG HD3  H  -3.499  10.895  15.809 1.00 . A A . 166 ARG HD3  1 1 
        4  6559 1 1  88 ARG HE   H  -5.443  11.769  14.017 1.00 . A A . 166 ARG HE   1 1 
        4  6560 1 1  88 ARG HG2  H  -4.259  10.260  13.046 1.00 . A A . 166 ARG HG2  1 1 
        4  6561 1 1  88 ARG HG3  H  -3.438   8.957  13.906 1.00 . A A . 166 ARG HG3  1 1 
        4  6562 1 1  88 ARG HH11 H  -5.197  10.913  17.391 1.00 . A A . 166 ARG HH11 1 1 
        4  6563 1 1  88 ARG HH12 H  -6.467  11.982  17.884 1.00 . A A . 166 ARG HH12 1 1 
        4  6564 1 1  88 ARG HH21 H  -7.113  13.176  14.663 1.00 . A A . 166 ARG HH21 1 1 
        4  6565 1 1  88 ARG HH22 H  -7.556  13.266  16.335 1.00 . A A . 166 ARG HH22 1 1 
        4  6566 1 1  88 ARG N    N  -1.334   8.930  12.257 1.00 . A A . 166 ARG N    1 1 
        4  6567 1 1  88 ARG NE   N  -5.300  11.466  14.938 1.00 . A A . 166 ARG NE   1 1 
        4  6568 1 1  88 ARG NH1  N  -5.894  11.593  17.163 1.00 . A A . 166 ARG NH1  1 1 
        4  6569 1 1  88 ARG NH2  N  -6.985  12.881  15.610 1.00 . A A . 166 ARG NH2  1 1 
        4  6570 1 1  88 ARG O    O  -0.392  12.423  12.098 1.00 . A A . 166 ARG O    1 1 
        4  6571 1 1  89 SER C    C   2.985  10.531  10.828 1.00 . A A . 167 SER C    1 1 
        4  6572 1 1  89 SER CA   C   2.082  11.231  11.845 1.00 . A A . 167 SER CA   1 1 
        4  6573 1 1  89 SER CB   C   2.808  11.348  13.186 1.00 . A A . 167 SER CB   1 1 
        4  6574 1 1  89 SER H    H   0.809   9.552  12.058 1.00 . A A . 167 SER H    1 1 
        4  6575 1 1  89 SER HA   H   1.860  12.223  11.483 1.00 . A A . 167 SER HA   1 1 
        4  6576 1 1  89 SER HB2  H   2.538  10.512  13.814 1.00 . A A . 167 SER HB2  1 1 
        4  6577 1 1  89 SER HB3  H   3.875  11.341  13.017 1.00 . A A . 167 SER HB3  1 1 
        4  6578 1 1  89 SER HG   H   3.061  12.695  14.586 1.00 . A A . 167 SER HG   1 1 
        4  6579 1 1  89 SER N    N   0.814  10.529  12.020 1.00 . A A . 167 SER N    1 1 
        4  6580 1 1  89 SER O    O   4.132  10.933  10.633 1.00 . A A . 167 SER O    1 1 
        4  6581 1 1  89 SER OG   O   2.459  12.549  13.852 1.00 . A A . 167 SER OG   1 1 
        4  6582 1 1  90 MET C    C   3.505   9.589   7.952 1.00 . A A . 168 MET C    1 1 
        4  6583 1 1  90 MET CA   C   3.253   8.745   9.198 1.00 . A A . 168 MET CA   1 1 
        4  6584 1 1  90 MET CB   C   2.533   7.451   8.813 1.00 . A A . 168 MET CB   1 1 
        4  6585 1 1  90 MET CE   C   2.594   4.200   9.273 1.00 . A A . 168 MET CE   1 1 
        4  6586 1 1  90 MET CG   C   3.380   6.513   7.967 1.00 . A A . 168 MET CG   1 1 
        4  6587 1 1  90 MET H    H   1.558   9.198  10.375 1.00 . A A . 168 MET H    1 1 
        4  6588 1 1  90 MET HA   H   4.203   8.497   9.646 1.00 . A A . 168 MET HA   1 1 
        4  6589 1 1  90 MET HB2  H   2.247   6.930   9.714 1.00 . A A . 168 MET HB2  1 1 
        4  6590 1 1  90 MET HB3  H   1.643   7.701   8.254 1.00 . A A . 168 MET HB3  1 1 
        4  6591 1 1  90 MET HE1  H   1.902   4.294   8.449 1.00 . A A . 168 MET HE1  1 1 
        4  6592 1 1  90 MET HE2  H   2.133   4.572  10.175 1.00 . A A . 168 MET HE2  1 1 
        4  6593 1 1  90 MET HE3  H   2.857   3.161   9.405 1.00 . A A . 168 MET HE3  1 1 
        4  6594 1 1  90 MET HG2  H   2.764   6.106   7.180 1.00 . A A . 168 MET HG2  1 1 
        4  6595 1 1  90 MET HG3  H   4.191   7.078   7.531 1.00 . A A . 168 MET HG3  1 1 
        4  6596 1 1  90 MET N    N   2.474   9.484  10.184 1.00 . A A . 168 MET N    1 1 
        4  6597 1 1  90 MET O    O   2.604  10.262   7.452 1.00 . A A . 168 MET O    1 1 
        4  6598 1 1  90 MET SD   S   4.072   5.149   8.922 1.00 . A A . 168 MET SD   1 1 
        4  6599 1 1  91 THR C    C   4.946   9.439   5.013 1.00 . A A . 169 THR C    1 1 
        4  6600 1 1  91 THR CA   C   5.112  10.295   6.263 1.00 . A A . 169 THR CA   1 1 
        4  6601 1 1  91 THR CB   C   6.559  10.777   6.377 1.00 . A A . 169 THR CB   1 1 
        4  6602 1 1  91 THR CG2  C   6.715  12.002   7.253 1.00 . A A . 169 THR CG2  1 1 
        4  6603 1 1  91 THR H    H   5.410   8.984   7.896 1.00 . A A . 169 THR H    1 1 
        4  6604 1 1  91 THR HA   H   4.461  11.151   6.187 1.00 . A A . 169 THR HA   1 1 
        4  6605 1 1  91 THR HB   H   6.924  11.028   5.391 1.00 . A A . 169 THR HB   1 1 
        4  6606 1 1  91 THR HG1  H   8.075   9.540   6.279 1.00 . A A . 169 THR HG1  1 1 
        4  6607 1 1  91 THR HG21 H   7.707  12.409   7.130 1.00 . A A . 169 THR HG21 1 1 
        4  6608 1 1  91 THR HG22 H   6.564  11.726   8.287 1.00 . A A . 169 THR HG22 1 1 
        4  6609 1 1  91 THR HG23 H   5.983  12.743   6.969 1.00 . A A . 169 THR HG23 1 1 
        4  6610 1 1  91 THR N    N   4.736   9.543   7.454 1.00 . A A . 169 THR N    1 1 
        4  6611 1 1  91 THR O    O   4.911   8.211   5.094 1.00 . A A . 169 THR O    1 1 
        4  6612 1 1  91 THR OG1  O   7.386   9.759   6.911 1.00 . A A . 169 THR OG1  1 1 
        4  6613 1 1  92 PRO C    C   5.766   8.286   2.392 1.00 . A A . 170 PRO C    1 1 
        4  6614 1 1  92 PRO CA   C   4.691   9.351   2.569 1.00 . A A . 170 PRO CA   1 1 
        4  6615 1 1  92 PRO CB   C   4.828  10.444   1.496 1.00 . A A . 170 PRO CB   1 1 
        4  6616 1 1  92 PRO CD   C   4.884  11.525   3.631 1.00 . A A . 170 PRO CD   1 1 
        4  6617 1 1  92 PRO CG   C   5.356  11.645   2.211 1.00 . A A . 170 PRO CG   1 1 
        4  6618 1 1  92 PRO HA   H   3.717   8.889   2.495 1.00 . A A . 170 PRO HA   1 1 
        4  6619 1 1  92 PRO HB2  H   5.512  10.112   0.729 1.00 . A A . 170 PRO HB2  1 1 
        4  6620 1 1  92 PRO HB3  H   3.861  10.641   1.059 1.00 . A A . 170 PRO HB3  1 1 
        4  6621 1 1  92 PRO HD2  H   5.586  11.994   4.305 1.00 . A A . 170 PRO HD2  1 1 
        4  6622 1 1  92 PRO HD3  H   3.901  11.957   3.742 1.00 . A A . 170 PRO HD3  1 1 
        4  6623 1 1  92 PRO HG2  H   6.435  11.649   2.174 1.00 . A A . 170 PRO HG2  1 1 
        4  6624 1 1  92 PRO HG3  H   4.960  12.543   1.760 1.00 . A A . 170 PRO HG3  1 1 
        4  6625 1 1  92 PRO N    N   4.846  10.071   3.833 1.00 . A A . 170 PRO N    1 1 
        4  6626 1 1  92 PRO O    O   5.463   7.118   2.147 1.00 . A A . 170 PRO O    1 1 
        4  6627 1 1  93 ALA C    C   8.000   6.563   3.278 1.00 . A A . 171 ALA C    1 1 
        4  6628 1 1  93 ALA CA   C   8.149   7.780   2.369 1.00 . A A . 171 ALA CA   1 1 
        4  6629 1 1  93 ALA CB   C   9.456   8.500   2.664 1.00 . A A . 171 ALA CB   1 1 
        4  6630 1 1  93 ALA H    H   7.204   9.642   2.705 1.00 . A A . 171 ALA H    1 1 
        4  6631 1 1  93 ALA HA   H   8.175   7.447   1.342 1.00 . A A . 171 ALA HA   1 1 
        4  6632 1 1  93 ALA HB1  H   9.352   9.079   3.570 1.00 . A A . 171 ALA HB1  1 1 
        4  6633 1 1  93 ALA HB2  H   9.698   9.158   1.842 1.00 . A A . 171 ALA HB2  1 1 
        4  6634 1 1  93 ALA HB3  H  10.247   7.775   2.790 1.00 . A A . 171 ALA HB3  1 1 
        4  6635 1 1  93 ALA N    N   7.024   8.697   2.517 1.00 . A A . 171 ALA N    1 1 
        4  6636 1 1  93 ALA O    O   8.310   5.440   2.881 1.00 . A A . 171 ALA O    1 1 
        4  6637 1 1  94 GLN C    C   6.402   4.642   4.889 1.00 . A A . 172 GLN C    1 1 
        4  6638 1 1  94 GLN CA   C   7.334   5.707   5.457 1.00 . A A . 172 GLN CA   1 1 
        4  6639 1 1  94 GLN CB   C   6.771   6.249   6.773 1.00 . A A . 172 GLN CB   1 1 
        4  6640 1 1  94 GLN CD   C   7.277   7.140   9.083 1.00 . A A . 172 GLN CD   1 1 
        4  6641 1 1  94 GLN CG   C   7.839   6.759   7.727 1.00 . A A . 172 GLN CG   1 1 
        4  6642 1 1  94 GLN H    H   7.291   7.707   4.759 1.00 . A A . 172 GLN H    1 1 
        4  6643 1 1  94 GLN HA   H   8.299   5.260   5.645 1.00 . A A . 172 GLN HA   1 1 
        4  6644 1 1  94 GLN HB2  H   6.096   7.062   6.556 1.00 . A A . 172 GLN HB2  1 1 
        4  6645 1 1  94 GLN HB3  H   6.224   5.460   7.269 1.00 . A A . 172 GLN HB3  1 1 
        4  6646 1 1  94 GLN HE21 H   7.612   9.064   8.709 1.00 . A A . 172 GLN HE21 1 1 
        4  6647 1 1  94 GLN HE22 H   6.906   8.710  10.245 1.00 . A A . 172 GLN HE22 1 1 
        4  6648 1 1  94 GLN HG2  H   8.579   5.985   7.866 1.00 . A A . 172 GLN HG2  1 1 
        4  6649 1 1  94 GLN HG3  H   8.307   7.629   7.290 1.00 . A A . 172 GLN HG3  1 1 
        4  6650 1 1  94 GLN N    N   7.522   6.791   4.498 1.00 . A A . 172 GLN N    1 1 
        4  6651 1 1  94 GLN NE2  N   7.264   8.436   9.375 1.00 . A A . 172 GLN NE2  1 1 
        4  6652 1 1  94 GLN O    O   6.667   3.445   5.006 1.00 . A A . 172 GLN O    1 1 
        4  6653 1 1  94 GLN OE1  O   6.860   6.281   9.859 1.00 . A A . 172 GLN OE1  1 1 
        4  6654 1 1  95 ALA C    C   4.981   3.424   2.494 1.00 . A A . 173 ALA C    1 1 
        4  6655 1 1  95 ALA CA   C   4.354   4.167   3.667 1.00 . A A . 173 ALA CA   1 1 
        4  6656 1 1  95 ALA CB   C   3.112   4.922   3.218 1.00 . A A . 173 ALA CB   1 1 
        4  6657 1 1  95 ALA H    H   5.163   6.050   4.195 1.00 . A A . 173 ALA H    1 1 
        4  6658 1 1  95 ALA HA   H   4.061   3.451   4.421 1.00 . A A . 173 ALA HA   1 1 
        4  6659 1 1  95 ALA HB1  H   2.695   4.442   2.345 1.00 . A A . 173 ALA HB1  1 1 
        4  6660 1 1  95 ALA HB2  H   3.377   5.941   2.976 1.00 . A A . 173 ALA HB2  1 1 
        4  6661 1 1  95 ALA HB3  H   2.382   4.919   4.013 1.00 . A A . 173 ALA HB3  1 1 
        4  6662 1 1  95 ALA N    N   5.316   5.084   4.264 1.00 . A A . 173 ALA N    1 1 
        4  6663 1 1  95 ALA O    O   4.806   2.215   2.343 1.00 . A A . 173 ALA O    1 1 
        4  6664 1 1  96 ASP C    C   7.371   2.490   0.954 1.00 . A A . 174 ASP C    1 1 
        4  6665 1 1  96 ASP CA   C   6.391   3.577   0.515 1.00 . A A . 174 ASP CA   1 1 
        4  6666 1 1  96 ASP CB   C   7.133   4.664  -0.266 1.00 . A A . 174 ASP CB   1 1 
        4  6667 1 1  96 ASP CG   C   6.415   5.048  -1.545 1.00 . A A . 174 ASP CG   1 1 
        4  6668 1 1  96 ASP H    H   5.828   5.117   1.851 1.00 . A A . 174 ASP H    1 1 
        4  6669 1 1  96 ASP HA   H   5.639   3.142  -0.122 1.00 . A A . 174 ASP HA   1 1 
        4  6670 1 1  96 ASP HB2  H   7.222   5.545   0.352 1.00 . A A . 174 ASP HB2  1 1 
        4  6671 1 1  96 ASP HB3  H   8.120   4.308  -0.521 1.00 . A A . 174 ASP HB3  1 1 
        4  6672 1 1  96 ASP N    N   5.723   4.159   1.671 1.00 . A A . 174 ASP N    1 1 
        4  6673 1 1  96 ASP O    O   7.449   1.417   0.350 1.00 . A A . 174 ASP O    1 1 
        4  6674 1 1  96 ASP OD1  O   5.906   4.140  -2.235 1.00 . A A . 174 ASP OD1  1 1 
        4  6675 1 1  96 ASP OD2  O   6.363   6.256  -1.856 1.00 . A A . 174 ASP OD2  1 1 
        4  6676 1 1  97 LEU C    C   8.371   0.679   3.278 1.00 . A A . 175 LEU C    1 1 
        4  6677 1 1  97 LEU CA   C   9.070   1.841   2.579 1.00 . A A . 175 LEU CA   1 1 
        4  6678 1 1  97 LEU CB   C   9.998   2.559   3.561 1.00 . A A . 175 LEU CB   1 1 
        4  6679 1 1  97 LEU CD1  C  12.150   1.908   2.455 1.00 . A A . 175 LEU CD1  1 1 
        4  6680 1 1  97 LEU CD2  C  12.145   2.618   4.853 1.00 . A A . 175 LEU CD2  1 1 
        4  6681 1 1  97 LEU CG   C  11.366   1.905   3.758 1.00 . A A . 175 LEU CG   1 1 
        4  6682 1 1  97 LEU H    H   7.962   3.642   2.471 1.00 . A A . 175 LEU H    1 1 
        4  6683 1 1  97 LEU HA   H   9.658   1.453   1.761 1.00 . A A . 175 LEU HA   1 1 
        4  6684 1 1  97 LEU HB2  H  10.152   3.568   3.206 1.00 . A A . 175 LEU HB2  1 1 
        4  6685 1 1  97 LEU HB3  H   9.505   2.606   4.521 1.00 . A A . 175 LEU HB3  1 1 
        4  6686 1 1  97 LEU HD11 H  11.824   2.734   1.840 1.00 . A A . 175 LEU HD11 1 1 
        4  6687 1 1  97 LEU HD12 H  11.980   0.979   1.930 1.00 . A A . 175 LEU HD12 1 1 
        4  6688 1 1  97 LEU HD13 H  13.203   2.012   2.669 1.00 . A A . 175 LEU HD13 1 1 
        4  6689 1 1  97 LEU HD21 H  11.898   3.670   4.843 1.00 . A A . 175 LEU HD21 1 1 
        4  6690 1 1  97 LEU HD22 H  13.204   2.495   4.680 1.00 . A A . 175 LEU HD22 1 1 
        4  6691 1 1  97 LEU HD23 H  11.885   2.196   5.813 1.00 . A A . 175 LEU HD23 1 1 
        4  6692 1 1  97 LEU HG   H  11.225   0.877   4.061 1.00 . A A . 175 LEU HG   1 1 
        4  6693 1 1  97 LEU N    N   8.100   2.779   2.026 1.00 . A A . 175 LEU N    1 1 
        4  6694 1 1  97 LEU O    O   8.879  -0.441   3.301 1.00 . A A . 175 LEU O    1 1 
        4  6695 1 1  98 GLU C    C   6.042  -1.210   3.671 1.00 . A A . 176 GLU C    1 1 
        4  6696 1 1  98 GLU CA   C   6.443  -0.050   4.580 1.00 . A A . 176 GLU CA   1 1 
        4  6697 1 1  98 GLU CB   C   5.195   0.580   5.200 1.00 . A A . 176 GLU CB   1 1 
        4  6698 1 1  98 GLU CD   C   5.585   0.204   7.667 1.00 . A A . 176 GLU CD   1 1 
        4  6699 1 1  98 GLU CG   C   5.450   1.223   6.553 1.00 . A A . 176 GLU CG   1 1 
        4  6700 1 1  98 GLU H    H   6.865   1.877   3.816 1.00 . A A . 176 GLU H    1 1 
        4  6701 1 1  98 GLU HA   H   7.069  -0.434   5.372 1.00 . A A . 176 GLU HA   1 1 
        4  6702 1 1  98 GLU HB2  H   4.818   1.338   4.530 1.00 . A A . 176 GLU HB2  1 1 
        4  6703 1 1  98 GLU HB3  H   4.444  -0.185   5.324 1.00 . A A . 176 GLU HB3  1 1 
        4  6704 1 1  98 GLU HG2  H   6.363   1.797   6.498 1.00 . A A . 176 GLU HG2  1 1 
        4  6705 1 1  98 GLU HG3  H   4.625   1.881   6.785 1.00 . A A . 176 GLU HG3  1 1 
        4  6706 1 1  98 GLU N    N   7.210   0.961   3.861 1.00 . A A . 176 GLU N    1 1 
        4  6707 1 1  98 GLU O    O   6.321  -2.370   3.976 1.00 . A A . 176 GLU O    1 1 
        4  6708 1 1  98 GLU OE1  O   5.928  -0.960   7.369 1.00 . A A . 176 GLU OE1  1 1 
        4  6709 1 1  98 GLU OE2  O   5.349   0.569   8.838 1.00 . A A . 176 GLU OE2  1 1 
        4  6710 1 1  99 PHE C    C   6.152  -2.572   0.935 1.00 . A A . 177 PHE C    1 1 
        4  6711 1 1  99 PHE CA   C   4.953  -1.931   1.623 1.00 . A A . 177 PHE CA   1 1 
        4  6712 1 1  99 PHE CB   C   3.990  -1.353   0.582 1.00 . A A . 177 PHE CB   1 1 
        4  6713 1 1  99 PHE CD1  C   4.504  -2.547  -1.563 1.00 . A A . 177 PHE CD1  1 1 
        4  6714 1 1  99 PHE CD2  C   2.420  -2.992  -0.492 1.00 . A A . 177 PHE CD2  1 1 
        4  6715 1 1  99 PHE CE1  C   4.179  -3.432  -2.572 1.00 . A A . 177 PHE CE1  1 1 
        4  6716 1 1  99 PHE CE2  C   2.089  -3.878  -1.499 1.00 . A A . 177 PHE CE2  1 1 
        4  6717 1 1  99 PHE CG   C   3.630  -2.317  -0.513 1.00 . A A . 177 PHE CG   1 1 
        4  6718 1 1  99 PHE CZ   C   2.970  -4.098  -2.540 1.00 . A A . 177 PHE CZ   1 1 
        4  6719 1 1  99 PHE H    H   5.189   0.042   2.361 1.00 . A A . 177 PHE H    1 1 
        4  6720 1 1  99 PHE HA   H   4.437  -2.690   2.192 1.00 . A A . 177 PHE HA   1 1 
        4  6721 1 1  99 PHE HB2  H   3.076  -1.055   1.074 1.00 . A A . 177 PHE HB2  1 1 
        4  6722 1 1  99 PHE HB3  H   4.444  -0.490   0.126 1.00 . A A . 177 PHE HB3  1 1 
        4  6723 1 1  99 PHE HD1  H   5.450  -2.027  -1.588 1.00 . A A . 177 PHE HD1  1 1 
        4  6724 1 1  99 PHE HD2  H   1.731  -2.819   0.322 1.00 . A A . 177 PHE HD2  1 1 
        4  6725 1 1  99 PHE HE1  H   4.869  -3.602  -3.385 1.00 . A A . 177 PHE HE1  1 1 
        4  6726 1 1  99 PHE HE2  H   1.143  -4.398  -1.472 1.00 . A A . 177 PHE HE2  1 1 
        4  6727 1 1  99 PHE HZ   H   2.714  -4.790  -3.328 1.00 . A A . 177 PHE HZ   1 1 
        4  6728 1 1  99 PHE N    N   5.386  -0.898   2.558 1.00 . A A . 177 PHE N    1 1 
        4  6729 1 1  99 PHE O    O   6.239  -3.795   0.841 1.00 . A A . 177 PHE O    1 1 
        4  6730 1 1 100 LEU C    C   9.058  -3.168   0.722 1.00 . A A . 178 LEU C    1 1 
        4  6731 1 1 100 LEU CA   C   8.268  -2.258  -0.215 1.00 . A A . 178 LEU CA   1 1 
        4  6732 1 1 100 LEU CB   C   9.151  -1.106  -0.699 1.00 . A A . 178 LEU CB   1 1 
        4  6733 1 1 100 LEU CD1  C   9.666   0.614  -2.449 1.00 . A A . 178 LEU CD1  1 1 
        4  6734 1 1 100 LEU CD2  C   8.090  -1.255  -2.974 1.00 . A A . 178 LEU CD2  1 1 
        4  6735 1 1 100 LEU CG   C   8.599  -0.315  -1.890 1.00 . A A . 178 LEU CG   1 1 
        4  6736 1 1 100 LEU H    H   6.964  -0.774   0.560 1.00 . A A . 178 LEU H    1 1 
        4  6737 1 1 100 LEU HA   H   7.943  -2.836  -1.067 1.00 . A A . 178 LEU HA   1 1 
        4  6738 1 1 100 LEU HB2  H   9.296  -0.421   0.124 1.00 . A A . 178 LEU HB2  1 1 
        4  6739 1 1 100 LEU HB3  H  10.111  -1.511  -0.981 1.00 . A A . 178 LEU HB3  1 1 
        4  6740 1 1 100 LEU HD11 H  10.643   0.199  -2.252 1.00 . A A . 178 LEU HD11 1 1 
        4  6741 1 1 100 LEU HD12 H   9.584   1.581  -1.978 1.00 . A A . 178 LEU HD12 1 1 
        4  6742 1 1 100 LEU HD13 H   9.528   0.720  -3.515 1.00 . A A . 178 LEU HD13 1 1 
        4  6743 1 1 100 LEU HD21 H   8.789  -2.068  -3.103 1.00 . A A . 178 LEU HD21 1 1 
        4  6744 1 1 100 LEU HD22 H   7.991  -0.714  -3.903 1.00 . A A . 178 LEU HD22 1 1 
        4  6745 1 1 100 LEU HD23 H   7.127  -1.651  -2.684 1.00 . A A . 178 LEU HD23 1 1 
        4  6746 1 1 100 LEU HG   H   7.771   0.293  -1.556 1.00 . A A . 178 LEU HG   1 1 
        4  6747 1 1 100 LEU N    N   7.079  -1.745   0.456 1.00 . A A . 178 LEU N    1 1 
        4  6748 1 1 100 LEU O    O   9.592  -4.195   0.304 1.00 . A A . 178 LEU O    1 1 
        4  6749 1 1 101 GLU C    C   9.135  -4.886   3.255 1.00 . A A . 179 GLU C    1 1 
        4  6750 1 1 101 GLU CA   C   9.834  -3.556   2.997 1.00 . A A . 179 GLU CA   1 1 
        4  6751 1 1 101 GLU CB   C   9.929  -2.755   4.296 1.00 . A A . 179 GLU CB   1 1 
        4  6752 1 1 101 GLU CD   C   9.702  -4.398   6.197 1.00 . A A . 179 GLU CD   1 1 
        4  6753 1 1 101 GLU CG   C  10.635  -3.493   5.416 1.00 . A A . 179 GLU CG   1 1 
        4  6754 1 1 101 GLU H    H   8.673  -1.955   2.263 1.00 . A A . 179 GLU H    1 1 
        4  6755 1 1 101 GLU HA   H  10.827  -3.749   2.627 1.00 . A A . 179 GLU HA   1 1 
        4  6756 1 1 101 GLU HB2  H  10.470  -1.840   4.102 1.00 . A A . 179 GLU HB2  1 1 
        4  6757 1 1 101 GLU HB3  H   8.931  -2.509   4.627 1.00 . A A . 179 GLU HB3  1 1 
        4  6758 1 1 101 GLU HG2  H  11.422  -4.094   4.991 1.00 . A A . 179 GLU HG2  1 1 
        4  6759 1 1 101 GLU HG3  H  11.059  -2.768   6.093 1.00 . A A . 179 GLU HG3  1 1 
        4  6760 1 1 101 GLU N    N   9.120  -2.782   1.992 1.00 . A A . 179 GLU N    1 1 
        4  6761 1 1 101 GLU O    O   9.781  -5.903   3.509 1.00 . A A . 179 GLU O    1 1 
        4  6762 1 1 101 GLU OE1  O   8.917  -3.877   7.017 1.00 . A A . 179 GLU OE1  1 1 
        4  6763 1 1 101 GLU OE2  O   9.758  -5.629   5.990 1.00 . A A . 179 GLU OE2  1 1 
        4  6764 1 1 102 ASN C    C   7.142  -7.011   2.193 1.00 . A A . 180 ASN C    1 1 
        4  6765 1 1 102 ASN CA   C   7.020  -6.071   3.388 1.00 . A A . 180 ASN CA   1 1 
        4  6766 1 1 102 ASN CB   C   5.556  -5.697   3.619 1.00 . A A . 180 ASN CB   1 1 
        4  6767 1 1 102 ASN CG   C   5.129  -5.901   5.059 1.00 . A A . 180 ASN CG   1 1 
        4  6768 1 1 102 ASN H    H   7.362  -4.027   2.952 1.00 . A A . 180 ASN H    1 1 
        4  6769 1 1 102 ASN HA   H   7.401  -6.570   4.266 1.00 . A A . 180 ASN HA   1 1 
        4  6770 1 1 102 ASN HB2  H   5.418  -4.657   3.365 1.00 . A A . 180 ASN HB2  1 1 
        4  6771 1 1 102 ASN HB3  H   4.928  -6.306   2.985 1.00 . A A . 180 ASN HB3  1 1 
        4  6772 1 1 102 ASN HD21 H   6.396  -4.491   5.659 1.00 . A A . 180 ASN HD21 1 1 
        4  6773 1 1 102 ASN HD22 H   5.468  -5.245   6.904 1.00 . A A . 180 ASN HD22 1 1 
        4  6774 1 1 102 ASN N    N   7.812  -4.869   3.174 1.00 . A A . 180 ASN N    1 1 
        4  6775 1 1 102 ASN ND2  N   5.724  -5.135   5.966 1.00 . A A . 180 ASN ND2  1 1 
        4  6776 1 1 102 ASN O    O   7.414  -8.201   2.350 1.00 . A A . 180 ASN O    1 1 
        4  6777 1 1 102 ASN OD1  O   4.274  -6.736   5.353 1.00 . A A . 180 ASN OD1  1 1 
        4  6778 1 1 103 ALA C    C   8.441  -7.829  -0.385 1.00 . A A . 181 ALA C    1 1 
        4  6779 1 1 103 ALA CA   C   7.041  -7.250  -0.225 1.00 . A A . 181 ALA CA   1 1 
        4  6780 1 1 103 ALA CB   C   6.675  -6.400  -1.432 1.00 . A A . 181 ALA CB   1 1 
        4  6781 1 1 103 ALA H    H   6.734  -5.510   0.940 1.00 . A A . 181 ALA H    1 1 
        4  6782 1 1 103 ALA HA   H   6.332  -8.062  -0.155 1.00 . A A . 181 ALA HA   1 1 
        4  6783 1 1 103 ALA HB1  H   5.605  -6.256  -1.460 1.00 . A A . 181 ALA HB1  1 1 
        4  6784 1 1 103 ALA HB2  H   6.994  -6.899  -2.335 1.00 . A A . 181 ALA HB2  1 1 
        4  6785 1 1 103 ALA HB3  H   7.165  -5.440  -1.359 1.00 . A A . 181 ALA HB3  1 1 
        4  6786 1 1 103 ALA N    N   6.947  -6.464   0.998 1.00 . A A . 181 ALA N    1 1 
        4  6787 1 1 103 ALA O    O   8.608  -8.963  -0.834 1.00 . A A . 181 ALA O    1 1 
        4  6788 1 1 104 LYS C    C  11.130  -8.572   0.907 1.00 . A A . 182 LYS C    1 1 
        4  6789 1 1 104 LYS CA   C  10.832  -7.474  -0.109 1.00 . A A . 182 LYS CA   1 1 
        4  6790 1 1 104 LYS CB   C  11.775  -6.290   0.111 1.00 . A A . 182 LYS CB   1 1 
        4  6791 1 1 104 LYS CD   C  13.267  -4.626  -1.040 1.00 . A A . 182 LYS CD   1 1 
        4  6792 1 1 104 LYS CE   C  12.986  -3.198  -0.602 1.00 . A A . 182 LYS CE   1 1 
        4  6793 1 1 104 LYS CG   C  11.988  -5.442  -1.133 1.00 . A A . 182 LYS CG   1 1 
        4  6794 1 1 104 LYS H    H   9.247  -6.149   0.340 1.00 . A A . 182 LYS H    1 1 
        4  6795 1 1 104 LYS HA   H  10.988  -7.868  -1.102 1.00 . A A . 182 LYS HA   1 1 
        4  6796 1 1 104 LYS HB2  H  11.367  -5.658   0.885 1.00 . A A . 182 LYS HB2  1 1 
        4  6797 1 1 104 LYS HB3  H  12.736  -6.664   0.433 1.00 . A A . 182 LYS HB3  1 1 
        4  6798 1 1 104 LYS HD2  H  13.926  -5.089  -0.321 1.00 . A A . 182 LYS HD2  1 1 
        4  6799 1 1 104 LYS HD3  H  13.743  -4.609  -2.009 1.00 . A A . 182 LYS HD3  1 1 
        4  6800 1 1 104 LYS HE2  H  12.009  -2.910  -0.959 1.00 . A A . 182 LYS HE2  1 1 
        4  6801 1 1 104 LYS HE3  H  13.000  -3.157   0.478 1.00 . A A . 182 LYS HE3  1 1 
        4  6802 1 1 104 LYS HG2  H  12.049  -6.092  -1.993 1.00 . A A . 182 LYS HG2  1 1 
        4  6803 1 1 104 LYS HG3  H  11.150  -4.770  -1.246 1.00 . A A . 182 LYS HG3  1 1 
        4  6804 1 1 104 LYS HZ1  H  14.379  -2.595  -2.038 1.00 . A A . 182 LYS HZ1  1 1 
        4  6805 1 1 104 LYS HZ2  H  14.779  -2.134  -0.460 1.00 . A A . 182 LYS HZ2  1 1 
        4  6806 1 1 104 LYS HZ3  H  13.560  -1.313  -1.296 1.00 . A A . 182 LYS HZ3  1 1 
        4  6807 1 1 104 LYS N    N   9.445  -7.042  -0.011 1.00 . A A . 182 LYS N    1 1 
        4  6808 1 1 104 LYS NZ   N  13.997  -2.243  -1.136 1.00 . A A . 182 LYS NZ   1 1 
        4  6809 1 1 104 LYS O    O  11.904  -9.490   0.633 1.00 . A A . 182 LYS O    1 1 
        4  6810 1 1 105 LYS C    C   9.916 -10.740   2.845 1.00 . A A . 183 LYS C    1 1 
        4  6811 1 1 105 LYS CA   C  10.708  -9.466   3.132 1.00 . A A . 183 LYS CA   1 1 
        4  6812 1 1 105 LYS CB   C  10.293  -8.890   4.487 1.00 . A A . 183 LYS CB   1 1 
        4  6813 1 1 105 LYS CD   C   9.787  -9.613   6.839 1.00 . A A . 183 LYS CD   1 1 
        4  6814 1 1 105 LYS CE   C  10.108  -8.412   7.713 1.00 . A A . 183 LYS CE   1 1 
        4  6815 1 1 105 LYS CG   C  10.752  -9.726   5.670 1.00 . A A . 183 LYS CG   1 1 
        4  6816 1 1 105 LYS H    H   9.899  -7.725   2.242 1.00 . A A . 183 LYS H    1 1 
        4  6817 1 1 105 LYS HA   H  11.759  -9.710   3.162 1.00 . A A . 183 LYS HA   1 1 
        4  6818 1 1 105 LYS HB2  H  10.713  -7.900   4.588 1.00 . A A . 183 LYS HB2  1 1 
        4  6819 1 1 105 LYS HB3  H   9.216  -8.819   4.520 1.00 . A A . 183 LYS HB3  1 1 
        4  6820 1 1 105 LYS HD2  H   8.783  -9.509   6.455 1.00 . A A . 183 LYS HD2  1 1 
        4  6821 1 1 105 LYS HD3  H   9.855 -10.511   7.436 1.00 . A A . 183 LYS HD3  1 1 
        4  6822 1 1 105 LYS HE2  H  10.712  -7.720   7.145 1.00 . A A . 183 LYS HE2  1 1 
        4  6823 1 1 105 LYS HE3  H   9.183  -7.932   7.996 1.00 . A A . 183 LYS HE3  1 1 
        4  6824 1 1 105 LYS HG2  H  10.814 -10.760   5.365 1.00 . A A . 183 LYS HG2  1 1 
        4  6825 1 1 105 LYS HG3  H  11.727  -9.382   5.984 1.00 . A A . 183 LYS HG3  1 1 
        4  6826 1 1 105 LYS HZ1  H  10.568  -9.759   9.242 1.00 . A A . 183 LYS HZ1  1 1 
        4  6827 1 1 105 LYS HZ2  H  10.639  -8.136   9.714 1.00 . A A . 183 LYS HZ2  1 1 
        4  6828 1 1 105 LYS HZ3  H  11.873  -8.794   8.762 1.00 . A A . 183 LYS HZ3  1 1 
        4  6829 1 1 105 LYS N    N  10.509  -8.476   2.079 1.00 . A A . 183 LYS N    1 1 
        4  6830 1 1 105 LYS NZ   N  10.849  -8.802   8.944 1.00 . A A . 183 LYS NZ   1 1 
        4  6831 1 1 105 LYS O    O  10.243 -11.811   3.356 1.00 . A A . 183 LYS O    1 1 
        4  6832 1 1 106 LEU C    C   8.530 -12.438   0.395 1.00 . A A . 184 LEU C    1 1 
        4  6833 1 1 106 LEU CA   C   8.040 -11.763   1.676 1.00 . A A . 184 LEU CA   1 1 
        4  6834 1 1 106 LEU CB   C   6.581 -11.326   1.507 1.00 . A A . 184 LEU CB   1 1 
        4  6835 1 1 106 LEU CD1  C   4.427 -11.282   2.791 1.00 . A A . 184 LEU CD1  1 1 
        4  6836 1 1 106 LEU CD2  C   6.590 -11.319   4.036 1.00 . A A . 184 LEU CD2  1 1 
        4  6837 1 1 106 LEU CG   C   5.877 -10.830   2.780 1.00 . A A . 184 LEU CG   1 1 
        4  6838 1 1 106 LEU H    H   8.663  -9.739   1.648 1.00 . A A . 184 LEU H    1 1 
        4  6839 1 1 106 LEU HA   H   8.098 -12.474   2.485 1.00 . A A . 184 LEU HA   1 1 
        4  6840 1 1 106 LEU HB2  H   6.551 -10.531   0.776 1.00 . A A . 184 LEU HB2  1 1 
        4  6841 1 1 106 LEU HB3  H   6.022 -12.165   1.120 1.00 . A A . 184 LEU HB3  1 1 
        4  6842 1 1 106 LEU HD11 H   3.854 -10.671   2.108 1.00 . A A . 184 LEU HD11 1 1 
        4  6843 1 1 106 LEU HD12 H   4.025 -11.181   3.788 1.00 . A A . 184 LEU HD12 1 1 
        4  6844 1 1 106 LEU HD13 H   4.371 -12.315   2.483 1.00 . A A . 184 LEU HD13 1 1 
        4  6845 1 1 106 LEU HD21 H   6.578 -12.398   4.059 1.00 . A A . 184 LEU HD21 1 1 
        4  6846 1 1 106 LEU HD22 H   6.086 -10.934   4.909 1.00 . A A . 184 LEU HD22 1 1 
        4  6847 1 1 106 LEU HD23 H   7.613 -10.970   4.027 1.00 . A A . 184 LEU HD23 1 1 
        4  6848 1 1 106 LEU HG   H   5.887  -9.749   2.789 1.00 . A A . 184 LEU HG   1 1 
        4  6849 1 1 106 LEU N    N   8.874 -10.618   2.027 1.00 . A A . 184 LEU N    1 1 
        4  6850 1 1 106 LEU O    O   7.992 -13.466  -0.016 1.00 . A A . 184 LEU O    1 1 
        4  6851 1 1 107 SER C    C   9.057 -12.423  -2.575 1.00 . A A . 185 SER C    1 1 
        4  6852 1 1 107 SER CA   C  10.103 -12.413  -1.464 1.00 . A A . 185 SER CA   1 1 
        4  6853 1 1 107 SER CB   C  10.623 -13.832  -1.221 1.00 . A A . 185 SER CB   1 1 
        4  6854 1 1 107 SER H    H   9.942 -11.041   0.137 1.00 . A A . 185 SER H    1 1 
        4  6855 1 1 107 SER HA   H  10.928 -11.786  -1.769 1.00 . A A . 185 SER HA   1 1 
        4  6856 1 1 107 SER HB2  H  10.030 -14.304  -0.451 1.00 . A A . 185 SER HB2  1 1 
        4  6857 1 1 107 SER HB3  H  10.547 -14.403  -2.134 1.00 . A A . 185 SER HB3  1 1 
        4  6858 1 1 107 SER HG   H  12.272 -14.712  -0.632 1.00 . A A . 185 SER HG   1 1 
        4  6859 1 1 107 SER N    N   9.551 -11.859  -0.234 1.00 . A A . 185 SER N    1 1 
        4  6860 1 1 107 SER O    O   8.933 -13.398  -3.317 1.00 . A A . 185 SER O    1 1 
        4  6861 1 1 107 SER OG   O  11.978 -13.815  -0.805 1.00 . A A . 185 SER OG   1 1 
        4  6862 1 1 108 MET C    C   7.882 -10.944  -5.081 1.00 . A A . 186 MET C    1 1 
        4  6863 1 1 108 MET CA   C   7.272 -11.213  -3.706 1.00 . A A . 186 MET CA   1 1 
        4  6864 1 1 108 MET CB   C   6.295 -10.092  -3.346 1.00 . A A . 186 MET CB   1 1 
        4  6865 1 1 108 MET CE   C   3.061 -10.207  -2.226 1.00 . A A . 186 MET CE   1 1 
        4  6866 1 1 108 MET CG   C   5.814 -10.140  -1.905 1.00 . A A . 186 MET CG   1 1 
        4  6867 1 1 108 MET H    H   8.454 -10.586  -2.065 1.00 . A A . 186 MET H    1 1 
        4  6868 1 1 108 MET HA   H   6.735 -12.148  -3.742 1.00 . A A . 186 MET HA   1 1 
        4  6869 1 1 108 MET HB2  H   6.779  -9.141  -3.510 1.00 . A A . 186 MET HB2  1 1 
        4  6870 1 1 108 MET HB3  H   5.432 -10.162  -3.993 1.00 . A A . 186 MET HB3  1 1 
        4  6871 1 1 108 MET HE1  H   2.445 -10.755  -2.924 1.00 . A A . 186 MET HE1  1 1 
        4  6872 1 1 108 MET HE2  H   3.459  -9.328  -2.710 1.00 . A A . 186 MET HE2  1 1 
        4  6873 1 1 108 MET HE3  H   2.465  -9.912  -1.375 1.00 . A A . 186 MET HE3  1 1 
        4  6874 1 1 108 MET HG2  H   6.627 -10.478  -1.280 1.00 . A A . 186 MET HG2  1 1 
        4  6875 1 1 108 MET HG3  H   5.521  -9.145  -1.605 1.00 . A A . 186 MET HG3  1 1 
        4  6876 1 1 108 MET N    N   8.307 -11.331  -2.684 1.00 . A A . 186 MET N    1 1 
        4  6877 1 1 108 MET O    O   7.207 -11.071  -6.102 1.00 . A A . 186 MET O    1 1 
        4  6878 1 1 108 MET SD   S   4.411 -11.250  -1.677 1.00 . A A . 186 MET SD   1 1 
        4  6879 1 1 109 TYR C    C  10.341 -11.570  -7.011 1.00 . A A . 187 TYR C    1 1 
        4  6880 1 1 109 TYR CA   C   9.850 -10.284  -6.354 1.00 . A A . 187 TYR CA   1 1 
        4  6881 1 1 109 TYR CB   C  11.030  -9.343  -6.103 1.00 . A A . 187 TYR CB   1 1 
        4  6882 1 1 109 TYR CD1  C   9.936  -7.736  -4.491 1.00 . A A . 187 TYR CD1  1 1 
        4  6883 1 1 109 TYR CD2  C  10.907  -6.850  -6.480 1.00 . A A . 187 TYR CD2  1 1 
        4  6884 1 1 109 TYR CE1  C   9.556  -6.465  -4.105 1.00 . A A . 187 TYR CE1  1 1 
        4  6885 1 1 109 TYR CE2  C  10.531  -5.576  -6.101 1.00 . A A . 187 TYR CE2  1 1 
        4  6886 1 1 109 TYR CG   C  10.616  -7.951  -5.684 1.00 . A A . 187 TYR CG   1 1 
        4  6887 1 1 109 TYR CZ   C   9.856  -5.389  -4.913 1.00 . A A . 187 TYR CZ   1 1 
        4  6888 1 1 109 TYR H    H   9.648 -10.485  -4.258 1.00 . A A . 187 TYR H    1 1 
        4  6889 1 1 109 TYR HA   H   9.149  -9.800  -7.016 1.00 . A A . 187 TYR HA   1 1 
        4  6890 1 1 109 TYR HB2  H  11.649  -9.755  -5.320 1.00 . A A . 187 TYR HB2  1 1 
        4  6891 1 1 109 TYR HB3  H  11.612  -9.259  -7.009 1.00 . A A . 187 TYR HB3  1 1 
        4  6892 1 1 109 TYR HD1  H   9.703  -8.580  -3.860 1.00 . A A . 187 TYR HD1  1 1 
        4  6893 1 1 109 TYR HD2  H  11.436  -7.000  -7.410 1.00 . A A . 187 TYR HD2  1 1 
        4  6894 1 1 109 TYR HE1  H   9.028  -6.319  -3.175 1.00 . A A . 187 TYR HE1  1 1 
        4  6895 1 1 109 TYR HE2  H  10.766  -4.733  -6.734 1.00 . A A . 187 TYR HE2  1 1 
        4  6896 1 1 109 TYR HH   H  10.263  -3.592  -4.365 1.00 . A A . 187 TYR HH   1 1 
        4  6897 1 1 109 TYR N    N   9.159 -10.571  -5.102 1.00 . A A . 187 TYR N    1 1 
        4  6898 1 1 109 TYR O    O  10.579 -11.553  -8.237 1.00 . A A . 187 TYR O    1 1 
        4  6899 1 1 109 TYR OXT  O  10.483 -12.583  -6.295 1.00 . A A . 187 TYR OXT  1 1 
        4  6900 1 1 109 TYR OH   O   9.480  -4.121  -4.533 1.00 . A A . 187 TYR OH   1 1 
        5  6901 1 1   1 GLY C    C  21.569  20.847  -5.169 1.00 . A A .  79 GLY C    1 1 
        5  6902 1 1   1 GLY CA   C  20.619  20.722  -3.993 1.00 . A A .  79 GLY CA   1 1 
        5  6903 1 1   1 GLY H1   H  21.251  18.732  -3.901 1.00 . A A .  79 GLY H1   1 1 
        5  6904 1 1   1 GLY H2   H  19.796  19.028  -3.090 1.00 . A A .  79 GLY H2   1 1 
        5  6905 1 1   1 GLY H3   H  21.260  19.525  -2.406 1.00 . A A .  79 GLY H3   1 1 
        5  6906 1 1   1 GLY HA2  H  19.606  20.836  -4.349 1.00 . A A .  79 GLY HA2  1 1 
        5  6907 1 1   1 GLY HA3  H  20.832  21.511  -3.287 1.00 . A A .  79 GLY HA3  1 1 
        5  6908 1 1   1 GLY N    N  20.740  19.410  -3.299 1.00 . A A .  79 GLY N    1 1 
        5  6909 1 1   1 GLY O    O  21.221  21.429  -6.197 1.00 . A A .  79 GLY O    1 1 
        5  6910 1 1   2 SER C    C  24.561  19.050  -6.145 1.00 . A A .  80 SER C    1 1 
        5  6911 1 1   2 SER CA   C  23.773  20.354  -6.075 1.00 . A A .  80 SER CA   1 1 
        5  6912 1 1   2 SER CB   C  24.726  21.527  -5.844 1.00 . A A .  80 SER CB   1 1 
        5  6913 1 1   2 SER H    H  22.988  19.851  -4.175 1.00 . A A .  80 SER H    1 1 
        5  6914 1 1   2 SER HA   H  23.258  20.500  -7.013 1.00 . A A .  80 SER HA   1 1 
        5  6915 1 1   2 SER HB2  H  25.076  21.508  -4.822 1.00 . A A .  80 SER HB2  1 1 
        5  6916 1 1   2 SER HB3  H  25.569  21.442  -6.514 1.00 . A A .  80 SER HB3  1 1 
        5  6917 1 1   2 SER HG   H  23.581  22.716  -6.899 1.00 . A A .  80 SER HG   1 1 
        5  6918 1 1   2 SER N    N  22.770  20.301  -5.018 1.00 . A A .  80 SER N    1 1 
        5  6919 1 1   2 SER O    O  24.739  18.478  -7.221 1.00 . A A .  80 SER O    1 1 
        5  6920 1 1   2 SER OG   O  24.079  22.766  -6.080 1.00 . A A .  80 SER OG   1 1 
        5  6921 1 1   3 HIS C    C  24.888  16.133  -5.044 1.00 . A A .  81 HIS C    1 1 
        5  6922 1 1   3 HIS CA   C  25.800  17.350  -4.922 1.00 . A A .  81 HIS CA   1 1 
        5  6923 1 1   3 HIS CB   C  26.582  17.286  -3.609 1.00 . A A .  81 HIS CB   1 1 
        5  6924 1 1   3 HIS CD2  C  27.930  15.231  -4.438 1.00 . A A .  81 HIS CD2  1 1 
        5  6925 1 1   3 HIS CE1  C  28.699  14.549  -2.501 1.00 . A A .  81 HIS CE1  1 1 
        5  6926 1 1   3 HIS CG   C  27.461  16.080  -3.493 1.00 . A A .  81 HIS CG   1 1 
        5  6927 1 1   3 HIS H    H  24.856  19.088  -4.169 1.00 . A A .  81 HIS H    1 1 
        5  6928 1 1   3 HIS HA   H  26.497  17.346  -5.746 1.00 . A A .  81 HIS HA   1 1 
        5  6929 1 1   3 HIS HB2  H  27.209  18.161  -3.528 1.00 . A A .  81 HIS HB2  1 1 
        5  6930 1 1   3 HIS HB3  H  25.885  17.271  -2.783 1.00 . A A .  81 HIS HB3  1 1 
        5  6931 1 1   3 HIS HD1  H  27.797  16.030  -1.413 1.00 . A A .  81 HIS HD1  1 1 
        5  6932 1 1   3 HIS HD2  H  27.738  15.284  -5.500 1.00 . A A .  81 HIS HD2  1 1 
        5  6933 1 1   3 HIS HE1  H  29.215  13.980  -1.743 1.00 . A A .  81 HIS HE1  1 1 
        5  6934 1 1   3 HIS HE2  H  29.237  13.600  -4.233 1.00 . A A .  81 HIS HE2  1 1 
        5  6935 1 1   3 HIS N    N  25.031  18.586  -4.992 1.00 . A A .  81 HIS N    1 1 
        5  6936 1 1   3 HIS ND1  N  27.960  15.625  -2.290 1.00 . A A .  81 HIS ND1  1 1 
        5  6937 1 1   3 HIS NE2  N  28.696  14.289  -3.795 1.00 . A A .  81 HIS NE2  1 1 
        5  6938 1 1   3 HIS O    O  24.507  15.528  -4.042 1.00 . A A .  81 HIS O    1 1 
        5  6939 1 1   4 MET C    C  23.655  14.285  -8.014 1.00 . A A .  82 MET C    1 1 
        5  6940 1 1   4 MET CA   C  23.674  14.636  -6.530 1.00 . A A .  82 MET CA   1 1 
        5  6941 1 1   4 MET CB   C  22.253  14.929  -6.045 1.00 . A A .  82 MET CB   1 1 
        5  6942 1 1   4 MET CE   C  22.674  12.587  -3.138 1.00 . A A .  82 MET CE   1 1 
        5  6943 1 1   4 MET CG   C  21.569  13.730  -5.408 1.00 . A A .  82 MET CG   1 1 
        5  6944 1 1   4 MET H    H  24.877  16.303  -7.036 1.00 . A A .  82 MET H    1 1 
        5  6945 1 1   4 MET HA   H  24.067  13.795  -5.978 1.00 . A A .  82 MET HA   1 1 
        5  6946 1 1   4 MET HB2  H  22.291  15.725  -5.315 1.00 . A A .  82 MET HB2  1 1 
        5  6947 1 1   4 MET HB3  H  21.657  15.252  -6.886 1.00 . A A .  82 MET HB3  1 1 
        5  6948 1 1   4 MET HE1  H  23.545  12.657  -3.771 1.00 . A A .  82 MET HE1  1 1 
        5  6949 1 1   4 MET HE2  H  22.225  11.611  -3.249 1.00 . A A .  82 MET HE2  1 1 
        5  6950 1 1   4 MET HE3  H  22.964  12.735  -2.108 1.00 . A A .  82 MET HE3  1 1 
        5  6951 1 1   4 MET HG2  H  20.562  13.661  -5.793 1.00 . A A .  82 MET HG2  1 1 
        5  6952 1 1   4 MET HG3  H  22.116  12.838  -5.674 1.00 . A A .  82 MET HG3  1 1 
        5  6953 1 1   4 MET N    N  24.541  15.781  -6.277 1.00 . A A .  82 MET N    1 1 
        5  6954 1 1   4 MET O    O  24.378  14.882  -8.812 1.00 . A A .  82 MET O    1 1 
        5  6955 1 1   4 MET SD   S  21.490  13.846  -3.610 1.00 . A A .  82 MET SD   1 1 
        5  6956 1 1   5 ASP C    C  21.430  13.418 -10.399 1.00 . A A .  83 ASP C    1 1 
        5  6957 1 1   5 ASP CA   C  22.713  12.882  -9.765 1.00 . A A .  83 ASP CA   1 1 
        5  6958 1 1   5 ASP CB   C  22.742  11.354  -9.851 1.00 . A A .  83 ASP CB   1 1 
        5  6959 1 1   5 ASP CG   C  23.661  10.854 -10.948 1.00 . A A .  83 ASP CG   1 1 
        5  6960 1 1   5 ASP H    H  22.275  12.875  -7.694 1.00 . A A .  83 ASP H    1 1 
        5  6961 1 1   5 ASP HA   H  23.560  13.280 -10.303 1.00 . A A .  83 ASP HA   1 1 
        5  6962 1 1   5 ASP HB2  H  23.086  10.954  -8.909 1.00 . A A .  83 ASP HB2  1 1 
        5  6963 1 1   5 ASP HB3  H  21.744  10.991 -10.049 1.00 . A A .  83 ASP HB3  1 1 
        5  6964 1 1   5 ASP N    N  22.825  13.313  -8.376 1.00 . A A .  83 ASP N    1 1 
        5  6965 1 1   5 ASP O    O  20.402  13.535  -9.733 1.00 . A A .  83 ASP O    1 1 
        5  6966 1 1   5 ASP OD1  O  24.798  11.361 -11.046 1.00 . A A .  83 ASP OD1  1 1 
        5  6967 1 1   5 ASP OD2  O  23.243   9.956 -11.709 1.00 . A A .  83 ASP OD2  1 1 
        5  6968 1 1   6 PRO C    C  19.288  13.194 -12.758 1.00 . A A .  84 PRO C    1 1 
        5  6969 1 1   6 PRO CA   C  20.312  14.277 -12.421 1.00 . A A .  84 PRO CA   1 1 
        5  6970 1 1   6 PRO CB   C  20.925  14.849 -13.698 1.00 . A A .  84 PRO CB   1 1 
        5  6971 1 1   6 PRO CD   C  22.662  13.645 -12.572 1.00 . A A .  84 PRO CD   1 1 
        5  6972 1 1   6 PRO CG   C  22.140  14.021 -13.934 1.00 . A A .  84 PRO CG   1 1 
        5  6973 1 1   6 PRO HA   H  19.828  15.067 -11.866 1.00 . A A .  84 PRO HA   1 1 
        5  6974 1 1   6 PRO HB2  H  20.220  14.759 -14.512 1.00 . A A .  84 PRO HB2  1 1 
        5  6975 1 1   6 PRO HB3  H  21.179  15.887 -13.546 1.00 . A A .  84 PRO HB3  1 1 
        5  6976 1 1   6 PRO HD2  H  23.043  12.634 -12.581 1.00 . A A .  84 PRO HD2  1 1 
        5  6977 1 1   6 PRO HD3  H  23.432  14.336 -12.260 1.00 . A A .  84 PRO HD3  1 1 
        5  6978 1 1   6 PRO HG2  H  21.878  13.135 -14.492 1.00 . A A .  84 PRO HG2  1 1 
        5  6979 1 1   6 PRO HG3  H  22.879  14.598 -14.471 1.00 . A A .  84 PRO HG3  1 1 
        5  6980 1 1   6 PRO N    N  21.475  13.752 -11.701 1.00 . A A .  84 PRO N    1 1 
        5  6981 1 1   6 PRO O    O  18.222  13.486 -13.302 1.00 . A A .  84 PRO O    1 1 
        5  6982 1 1   7 ALA C    C  18.125  10.270 -11.417 1.00 . A A .  85 ALA C    1 1 
        5  6983 1 1   7 ALA CA   C  18.717  10.828 -12.707 1.00 . A A .  85 ALA CA   1 1 
        5  6984 1 1   7 ALA CB   C  19.453   9.735 -13.468 1.00 . A A .  85 ALA CB   1 1 
        5  6985 1 1   7 ALA H    H  20.474  11.769 -12.003 1.00 . A A .  85 ALA H    1 1 
        5  6986 1 1   7 ALA HA   H  17.914  11.190 -13.332 1.00 . A A .  85 ALA HA   1 1 
        5  6987 1 1   7 ALA HB1  H  19.878  10.149 -14.370 1.00 . A A .  85 ALA HB1  1 1 
        5  6988 1 1   7 ALA HB2  H  18.761   8.946 -13.724 1.00 . A A .  85 ALA HB2  1 1 
        5  6989 1 1   7 ALA HB3  H  20.242   9.334 -12.848 1.00 . A A .  85 ALA HB3  1 1 
        5  6990 1 1   7 ALA N    N  19.613  11.945 -12.434 1.00 . A A .  85 ALA N    1 1 
        5  6991 1 1   7 ALA O    O  17.833   9.078 -11.321 1.00 . A A .  85 ALA O    1 1 
        5  6992 1 1   8 GLN C    C  15.908  10.406  -9.263 1.00 . A A .  86 GLN C    1 1 
        5  6993 1 1   8 GLN CA   C  17.395  10.733  -9.141 1.00 . A A .  86 GLN CA   1 1 
        5  6994 1 1   8 GLN CB   C  17.602  11.836  -8.101 1.00 . A A .  86 GLN CB   1 1 
        5  6995 1 1   8 GLN CD   C  19.434  11.107  -6.522 1.00 . A A .  86 GLN CD   1 1 
        5  6996 1 1   8 GLN CG   C  19.052  12.009  -7.680 1.00 . A A .  86 GLN CG   1 1 
        5  6997 1 1   8 GLN H    H  18.204  12.076 -10.563 1.00 . A A .  86 GLN H    1 1 
        5  6998 1 1   8 GLN HA   H  17.919   9.846  -8.819 1.00 . A A .  86 GLN HA   1 1 
        5  6999 1 1   8 GLN HB2  H  17.255  12.772  -8.513 1.00 . A A .  86 GLN HB2  1 1 
        5  7000 1 1   8 GLN HB3  H  17.020  11.601  -7.223 1.00 . A A .  86 GLN HB3  1 1 
        5  7001 1 1   8 GLN HE21 H  20.084   9.717  -7.786 1.00 . A A .  86 GLN HE21 1 1 
        5  7002 1 1   8 GLN HE22 H  20.224   9.330  -6.108 1.00 . A A .  86 GLN HE22 1 1 
        5  7003 1 1   8 GLN HG2  H  19.689  11.777  -8.521 1.00 . A A .  86 GLN HG2  1 1 
        5  7004 1 1   8 GLN HG3  H  19.208  13.036  -7.384 1.00 . A A .  86 GLN HG3  1 1 
        5  7005 1 1   8 GLN N    N  17.952  11.139 -10.426 1.00 . A A .  86 GLN N    1 1 
        5  7006 1 1   8 GLN NE2  N  19.968   9.933  -6.837 1.00 . A A .  86 GLN NE2  1 1 
        5  7007 1 1   8 GLN O    O  15.351   9.689  -8.432 1.00 . A A .  86 GLN O    1 1 
        5  7008 1 1   8 GLN OE1  O  19.252  11.463  -5.357 1.00 . A A .  86 GLN OE1  1 1 
        5  7009 1 1   9 LEU C    C  13.571   9.235 -10.852 1.00 . A A .  87 LEU C    1 1 
        5  7010 1 1   9 LEU CA   C  13.846  10.701 -10.525 1.00 . A A .  87 LEU CA   1 1 
        5  7011 1 1   9 LEU CB   C  13.331  11.593 -11.657 1.00 . A A .  87 LEU CB   1 1 
        5  7012 1 1   9 LEU CD1  C  12.787  11.483 -14.103 1.00 . A A .  87 LEU CD1  1 1 
        5  7013 1 1   9 LEU CD2  C  15.106  12.059 -13.364 1.00 . A A .  87 LEU CD2  1 1 
        5  7014 1 1   9 LEU CG   C  13.859  11.246 -13.050 1.00 . A A .  87 LEU CG   1 1 
        5  7015 1 1   9 LEU H    H  15.763  11.504 -10.930 1.00 . A A .  87 LEU H    1 1 
        5  7016 1 1   9 LEU HA   H  13.323  10.956  -9.615 1.00 . A A .  87 LEU HA   1 1 
        5  7017 1 1   9 LEU HB2  H  12.253  11.527 -11.676 1.00 . A A .  87 LEU HB2  1 1 
        5  7018 1 1   9 LEU HB3  H  13.608  12.614 -11.437 1.00 . A A .  87 LEU HB3  1 1 
        5  7019 1 1   9 LEU HD11 H  13.182  11.242 -15.079 1.00 . A A .  87 LEU HD11 1 1 
        5  7020 1 1   9 LEU HD12 H  12.486  12.520 -14.083 1.00 . A A .  87 LEU HD12 1 1 
        5  7021 1 1   9 LEU HD13 H  11.933  10.856 -13.895 1.00 . A A .  87 LEU HD13 1 1 
        5  7022 1 1   9 LEU HD21 H  15.183  12.201 -14.432 1.00 . A A .  87 LEU HD21 1 1 
        5  7023 1 1   9 LEU HD22 H  15.978  11.532 -13.007 1.00 . A A .  87 LEU HD22 1 1 
        5  7024 1 1   9 LEU HD23 H  15.041  13.020 -12.877 1.00 . A A .  87 LEU HD23 1 1 
        5  7025 1 1   9 LEU HG   H  14.126  10.199 -13.076 1.00 . A A .  87 LEU HG   1 1 
        5  7026 1 1   9 LEU N    N  15.269  10.938 -10.301 1.00 . A A .  87 LEU N    1 1 
        5  7027 1 1   9 LEU O    O  12.435   8.771 -10.748 1.00 . A A .  87 LEU O    1 1 
        5  7028 1 1  10 THR C    C  13.896   6.300 -10.427 1.00 . A A .  88 THR C    1 1 
        5  7029 1 1  10 THR CA   C  14.472   7.096 -11.594 1.00 . A A .  88 THR CA   1 1 
        5  7030 1 1  10 THR CB   C  15.825   6.513 -12.004 1.00 . A A .  88 THR CB   1 1 
        5  7031 1 1  10 THR CG2  C  15.708   5.217 -12.778 1.00 . A A .  88 THR CG2  1 1 
        5  7032 1 1  10 THR H    H  15.495   8.927 -11.318 1.00 . A A .  88 THR H    1 1 
        5  7033 1 1  10 THR HA   H  13.793   7.026 -12.430 1.00 . A A .  88 THR HA   1 1 
        5  7034 1 1  10 THR HB   H  16.405   6.315 -11.114 1.00 . A A .  88 THR HB   1 1 
        5  7035 1 1  10 THR HG1  H  17.235   7.843 -12.286 1.00 . A A .  88 THR HG1  1 1 
        5  7036 1 1  10 THR HG21 H  16.279   4.448 -12.280 1.00 . A A .  88 THR HG21 1 1 
        5  7037 1 1  10 THR HG22 H  16.091   5.360 -13.778 1.00 . A A .  88 THR HG22 1 1 
        5  7038 1 1  10 THR HG23 H  14.671   4.920 -12.829 1.00 . A A .  88 THR HG23 1 1 
        5  7039 1 1  10 THR N    N  14.612   8.507 -11.250 1.00 . A A .  88 THR N    1 1 
        5  7040 1 1  10 THR O    O  12.924   5.561 -10.587 1.00 . A A .  88 THR O    1 1 
        5  7041 1 1  10 THR OG1  O  16.543   7.431 -12.809 1.00 . A A .  88 THR OG1  1 1 
        5  7042 1 1  11 GLU C    C  12.583   6.056  -7.762 1.00 . A A .  89 GLU C    1 1 
        5  7043 1 1  11 GLU CA   C  14.047   5.743  -8.060 1.00 . A A .  89 GLU CA   1 1 
        5  7044 1 1  11 GLU CB   C  14.917   6.115  -6.860 1.00 . A A .  89 GLU CB   1 1 
        5  7045 1 1  11 GLU CD   C  14.919   6.110  -4.334 1.00 . A A .  89 GLU CD   1 1 
        5  7046 1 1  11 GLU CG   C  14.569   5.346  -5.596 1.00 . A A .  89 GLU CG   1 1 
        5  7047 1 1  11 GLU H    H  15.272   7.053  -9.187 1.00 . A A .  89 GLU H    1 1 
        5  7048 1 1  11 GLU HA   H  14.145   4.685  -8.249 1.00 . A A .  89 GLU HA   1 1 
        5  7049 1 1  11 GLU HB2  H  15.949   5.915  -7.105 1.00 . A A .  89 GLU HB2  1 1 
        5  7050 1 1  11 GLU HB3  H  14.801   7.169  -6.659 1.00 . A A .  89 GLU HB3  1 1 
        5  7051 1 1  11 GLU HG2  H  13.508   5.144  -5.593 1.00 . A A .  89 GLU HG2  1 1 
        5  7052 1 1  11 GLU HG3  H  15.113   4.413  -5.597 1.00 . A A .  89 GLU HG3  1 1 
        5  7053 1 1  11 GLU N    N  14.501   6.452  -9.253 1.00 . A A .  89 GLU N    1 1 
        5  7054 1 1  11 GLU O    O  11.840   5.199  -7.281 1.00 . A A .  89 GLU O    1 1 
        5  7055 1 1  11 GLU OE1  O  14.633   7.325  -4.277 1.00 . A A .  89 GLU OE1  1 1 
        5  7056 1 1  11 GLU OE2  O  15.479   5.494  -3.403 1.00 . A A .  89 GLU OE2  1 1 
        5  7057 1 1  12 ASP C    C   9.862   7.023  -8.815 1.00 . A A .  90 ASP C    1 1 
        5  7058 1 1  12 ASP CA   C  10.796   7.696  -7.815 1.00 . A A .  90 ASP CA   1 1 
        5  7059 1 1  12 ASP CB   C  10.667   9.217  -7.918 1.00 . A A .  90 ASP CB   1 1 
        5  7060 1 1  12 ASP CG   C   9.629   9.775  -6.965 1.00 . A A .  90 ASP CG   1 1 
        5  7061 1 1  12 ASP H    H  12.819   7.917  -8.435 1.00 . A A .  90 ASP H    1 1 
        5  7062 1 1  12 ASP HA   H  10.523   7.385  -6.817 1.00 . A A .  90 ASP HA   1 1 
        5  7063 1 1  12 ASP HB2  H  11.620   9.670  -7.689 1.00 . A A .  90 ASP HB2  1 1 
        5  7064 1 1  12 ASP HB3  H  10.382   9.480  -8.927 1.00 . A A .  90 ASP HB3  1 1 
        5  7065 1 1  12 ASP N    N  12.175   7.285  -8.053 1.00 . A A .  90 ASP N    1 1 
        5  7066 1 1  12 ASP O    O   8.833   6.459  -8.440 1.00 . A A .  90 ASP O    1 1 
        5  7067 1 1  12 ASP OD1  O   9.780   9.577  -5.741 1.00 . A A .  90 ASP OD1  1 1 
        5  7068 1 1  12 ASP OD2  O   8.665  10.411  -7.441 1.00 . A A .  90 ASP OD2  1 1 
        5  7069 1 1  13 ILE C    C   9.424   4.963 -11.046 1.00 . A A .  91 ILE C    1 1 
        5  7070 1 1  13 ILE CA   C   9.425   6.486 -11.148 1.00 . A A .  91 ILE CA   1 1 
        5  7071 1 1  13 ILE CB   C   9.927   6.904 -12.546 1.00 . A A .  91 ILE CB   1 1 
        5  7072 1 1  13 ILE CD1  C  10.053   8.905 -14.124 1.00 . A A .  91 ILE CD1  1 1 
        5  7073 1 1  13 ILE CG1  C   9.833   8.425 -12.706 1.00 . A A .  91 ILE CG1  1 1 
        5  7074 1 1  13 ILE CG2  C   9.129   6.195 -13.634 1.00 . A A .  91 ILE CG2  1 1 
        5  7075 1 1  13 ILE H    H  11.051   7.564 -10.328 1.00 . A A .  91 ILE H    1 1 
        5  7076 1 1  13 ILE HA   H   8.411   6.842 -11.034 1.00 . A A .  91 ILE HA   1 1 
        5  7077 1 1  13 ILE HB   H  10.960   6.603 -12.637 1.00 . A A .  91 ILE HB   1 1 
        5  7078 1 1  13 ILE HD11 H  10.150   9.981 -14.129 1.00 . A A .  91 ILE HD11 1 1 
        5  7079 1 1  13 ILE HD12 H   9.211   8.617 -14.736 1.00 . A A .  91 ILE HD12 1 1 
        5  7080 1 1  13 ILE HD13 H  10.955   8.461 -14.519 1.00 . A A .  91 ILE HD13 1 1 
        5  7081 1 1  13 ILE HG12 H   8.852   8.752 -12.396 1.00 . A A .  91 ILE HG12 1 1 
        5  7082 1 1  13 ILE HG13 H  10.577   8.892 -12.077 1.00 . A A .  91 ILE HG13 1 1 
        5  7083 1 1  13 ILE HG21 H   9.254   5.127 -13.533 1.00 . A A .  91 ILE HG21 1 1 
        5  7084 1 1  13 ILE HG22 H   9.486   6.509 -14.604 1.00 . A A .  91 ILE HG22 1 1 
        5  7085 1 1  13 ILE HG23 H   8.084   6.447 -13.536 1.00 . A A .  91 ILE HG23 1 1 
        5  7086 1 1  13 ILE N    N  10.229   7.086 -10.091 1.00 . A A .  91 ILE N    1 1 
        5  7087 1 1  13 ILE O    O   8.373   4.330 -11.141 1.00 . A A .  91 ILE O    1 1 
        5  7088 1 1  14 THR C    C   9.812   2.403  -9.626 1.00 . A A .  92 THR C    1 1 
        5  7089 1 1  14 THR CA   C  10.714   2.927 -10.744 1.00 . A A .  92 THR CA   1 1 
        5  7090 1 1  14 THR CB   C  12.170   2.503 -10.511 1.00 . A A .  92 THR CB   1 1 
        5  7091 1 1  14 THR CG2  C  12.697   2.862  -9.140 1.00 . A A .  92 THR CG2  1 1 
        5  7092 1 1  14 THR H    H  11.409   4.930 -10.786 1.00 . A A .  92 THR H    1 1 
        5  7093 1 1  14 THR HA   H  10.375   2.506 -11.679 1.00 . A A .  92 THR HA   1 1 
        5  7094 1 1  14 THR HB   H  12.800   2.991 -11.245 1.00 . A A .  92 THR HB   1 1 
        5  7095 1 1  14 THR HG1  H  11.686   0.651 -10.098 1.00 . A A .  92 THR HG1  1 1 
        5  7096 1 1  14 THR HG21 H  12.222   2.238  -8.397 1.00 . A A .  92 THR HG21 1 1 
        5  7097 1 1  14 THR HG22 H  12.478   3.898  -8.934 1.00 . A A .  92 THR HG22 1 1 
        5  7098 1 1  14 THR HG23 H  13.765   2.707  -9.112 1.00 . A A .  92 THR HG23 1 1 
        5  7099 1 1  14 THR N    N  10.603   4.377 -10.854 1.00 . A A .  92 THR N    1 1 
        5  7100 1 1  14 THR O    O   9.009   1.496  -9.845 1.00 . A A .  92 THR O    1 1 
        5  7101 1 1  14 THR OG1  O  12.312   1.103 -10.668 1.00 . A A .  92 THR OG1  1 1 
        5  7102 1 1  15 ARG C    C   7.656   2.630  -7.616 1.00 . A A .  93 ARG C    1 1 
        5  7103 1 1  15 ARG CA   C   9.143   2.556  -7.288 1.00 . A A .  93 ARG CA   1 1 
        5  7104 1 1  15 ARG CB   C   9.460   3.433  -6.077 1.00 . A A .  93 ARG CB   1 1 
        5  7105 1 1  15 ARG CD   C   7.431   3.889  -4.668 1.00 . A A .  93 ARG CD   1 1 
        5  7106 1 1  15 ARG CG   C   8.688   3.048  -4.826 1.00 . A A .  93 ARG CG   1 1 
        5  7107 1 1  15 ARG CZ   C   5.313   3.832  -3.411 1.00 . A A .  93 ARG CZ   1 1 
        5  7108 1 1  15 ARG H    H  10.608   3.685  -8.305 1.00 . A A .  93 ARG H    1 1 
        5  7109 1 1  15 ARG HA   H   9.400   1.533  -7.059 1.00 . A A .  93 ARG HA   1 1 
        5  7110 1 1  15 ARG HB2  H  10.516   3.357  -5.862 1.00 . A A .  93 ARG HB2  1 1 
        5  7111 1 1  15 ARG HB3  H   9.225   4.459  -6.320 1.00 . A A .  93 ARG HB3  1 1 
        5  7112 1 1  15 ARG HD2  H   7.711   4.866  -4.301 1.00 . A A .  93 ARG HD2  1 1 
        5  7113 1 1  15 ARG HD3  H   6.957   3.990  -5.633 1.00 . A A .  93 ARG HD3  1 1 
        5  7114 1 1  15 ARG HE   H   6.732   2.432  -3.325 1.00 . A A .  93 ARG HE   1 1 
        5  7115 1 1  15 ARG HG2  H   8.406   2.008  -4.894 1.00 . A A .  93 ARG HG2  1 1 
        5  7116 1 1  15 ARG HG3  H   9.321   3.197  -3.964 1.00 . A A .  93 ARG HG3  1 1 
        5  7117 1 1  15 ARG HH11 H   5.543   5.458  -4.592 1.00 . A A .  93 ARG HH11 1 1 
        5  7118 1 1  15 ARG HH12 H   4.062   5.394  -3.698 1.00 . A A .  93 ARG HH12 1 1 
        5  7119 1 1  15 ARG HH21 H   4.783   2.347  -2.148 1.00 . A A .  93 ARG HH21 1 1 
        5  7120 1 1  15 ARG HH22 H   3.630   3.629  -2.310 1.00 . A A .  93 ARG HH22 1 1 
        5  7121 1 1  15 ARG N    N   9.946   2.975  -8.429 1.00 . A A .  93 ARG N    1 1 
        5  7122 1 1  15 ARG NE   N   6.483   3.287  -3.733 1.00 . A A .  93 ARG NE   1 1 
        5  7123 1 1  15 ARG NH1  N   4.943   4.990  -3.944 1.00 . A A .  93 ARG NH1  1 1 
        5  7124 1 1  15 ARG NH2  N   4.509   3.219  -2.553 1.00 . A A .  93 ARG NH2  1 1 
        5  7125 1 1  15 ARG O    O   6.905   1.695  -7.341 1.00 . A A .  93 ARG O    1 1 
        5  7126 1 1  16 TYR C    C   5.350   2.750  -9.431 1.00 . A A .  94 TYR C    1 1 
        5  7127 1 1  16 TYR CA   C   5.838   3.925  -8.589 1.00 . A A .  94 TYR CA   1 1 
        5  7128 1 1  16 TYR CB   C   5.669   5.232  -9.366 1.00 . A A .  94 TYR CB   1 1 
        5  7129 1 1  16 TYR CD1  C   3.174   5.168  -8.992 1.00 . A A .  94 TYR CD1  1 1 
        5  7130 1 1  16 TYR CD2  C   3.981   6.075 -11.044 1.00 . A A .  94 TYR CD2  1 1 
        5  7131 1 1  16 TYR CE1  C   1.874   5.407  -9.392 1.00 . A A .  94 TYR CE1  1 1 
        5  7132 1 1  16 TYR CE2  C   2.682   6.317 -11.452 1.00 . A A .  94 TYR CE2  1 1 
        5  7133 1 1  16 TYR CG   C   4.248   5.497  -9.809 1.00 . A A .  94 TYR CG   1 1 
        5  7134 1 1  16 TYR CZ   C   1.633   5.981 -10.622 1.00 . A A .  94 TYR CZ   1 1 
        5  7135 1 1  16 TYR H    H   7.881   4.454  -8.416 1.00 . A A .  94 TYR H    1 1 
        5  7136 1 1  16 TYR HA   H   5.252   3.975  -7.683 1.00 . A A .  94 TYR HA   1 1 
        5  7137 1 1  16 TYR HB2  H   5.979   6.057  -8.742 1.00 . A A .  94 TYR HB2  1 1 
        5  7138 1 1  16 TYR HB3  H   6.292   5.201 -10.248 1.00 . A A .  94 TYR HB3  1 1 
        5  7139 1 1  16 TYR HD1  H   3.365   4.718  -8.029 1.00 . A A .  94 TYR HD1  1 1 
        5  7140 1 1  16 TYR HD2  H   4.806   6.336 -11.692 1.00 . A A .  94 TYR HD2  1 1 
        5  7141 1 1  16 TYR HE1  H   1.054   5.144  -8.742 1.00 . A A .  94 TYR HE1  1 1 
        5  7142 1 1  16 TYR HE2  H   2.494   6.767 -12.415 1.00 . A A .  94 TYR HE2  1 1 
        5  7143 1 1  16 TYR HH   H   0.282   7.096 -11.416 1.00 . A A .  94 TYR HH   1 1 
        5  7144 1 1  16 TYR N    N   7.237   3.742  -8.214 1.00 . A A .  94 TYR N    1 1 
        5  7145 1 1  16 TYR O    O   4.375   2.082  -9.083 1.00 . A A .  94 TYR O    1 1 
        5  7146 1 1  16 TYR OH   O   0.339   6.221 -11.024 1.00 . A A .  94 TYR OH   1 1 
        5  7147 1 1  17 TYR C    C   5.850   0.061 -10.727 1.00 . A A .  95 TYR C    1 1 
        5  7148 1 1  17 TYR CA   C   5.690   1.405 -11.430 1.00 . A A .  95 TYR CA   1 1 
        5  7149 1 1  17 TYR CB   C   6.559   1.444 -12.689 1.00 . A A .  95 TYR CB   1 1 
        5  7150 1 1  17 TYR CD1  C   4.845   2.791 -13.963 1.00 . A A .  95 TYR CD1  1 1 
        5  7151 1 1  17 TYR CD2  C   7.148   3.333 -14.258 1.00 . A A .  95 TYR CD2  1 1 
        5  7152 1 1  17 TYR CE1  C   4.492   3.795 -14.845 1.00 . A A .  95 TYR CE1  1 1 
        5  7153 1 1  17 TYR CE2  C   6.802   4.338 -15.141 1.00 . A A .  95 TYR CE2  1 1 
        5  7154 1 1  17 TYR CG   C   6.177   2.543 -13.655 1.00 . A A .  95 TYR CG   1 1 
        5  7155 1 1  17 TYR CZ   C   5.474   4.565 -15.432 1.00 . A A .  95 TYR CZ   1 1 
        5  7156 1 1  17 TYR H    H   6.812   3.066 -10.756 1.00 . A A .  95 TYR H    1 1 
        5  7157 1 1  17 TYR HA   H   4.656   1.528 -11.714 1.00 . A A .  95 TYR HA   1 1 
        5  7158 1 1  17 TYR HB2  H   7.589   1.598 -12.402 1.00 . A A .  95 TYR HB2  1 1 
        5  7159 1 1  17 TYR HB3  H   6.472   0.500 -13.207 1.00 . A A .  95 TYR HB3  1 1 
        5  7160 1 1  17 TYR HD1  H   4.078   2.187 -13.502 1.00 . A A .  95 TYR HD1  1 1 
        5  7161 1 1  17 TYR HD2  H   8.188   3.153 -14.029 1.00 . A A .  95 TYR HD2  1 1 
        5  7162 1 1  17 TYR HE1  H   3.451   3.972 -15.072 1.00 . A A .  95 TYR HE1  1 1 
        5  7163 1 1  17 TYR HE2  H   7.572   4.941 -15.601 1.00 . A A .  95 TYR HE2  1 1 
        5  7164 1 1  17 TYR HH   H   5.168   5.230 -17.210 1.00 . A A .  95 TYR HH   1 1 
        5  7165 1 1  17 TYR N    N   6.042   2.501 -10.538 1.00 . A A .  95 TYR N    1 1 
        5  7166 1 1  17 TYR O    O   5.157  -0.904 -11.049 1.00 . A A .  95 TYR O    1 1 
        5  7167 1 1  17 TYR OH   O   5.126   5.565 -16.311 1.00 . A A .  95 TYR OH   1 1 
        5  7168 1 1  18 LEU C    C   5.784  -1.581  -8.168 1.00 . A A .  96 LEU C    1 1 
        5  7169 1 1  18 LEU CA   C   7.003  -1.219  -9.007 1.00 . A A .  96 LEU CA   1 1 
        5  7170 1 1  18 LEU CB   C   8.228  -1.055  -8.104 1.00 . A A .  96 LEU CB   1 1 
        5  7171 1 1  18 LEU CD1  C   9.623  -2.686  -9.398 1.00 . A A .  96 LEU CD1  1 1 
        5  7172 1 1  18 LEU CD2  C  10.313  -2.003  -7.093 1.00 . A A .  96 LEU CD2  1 1 
        5  7173 1 1  18 LEU CG   C   9.136  -2.281  -8.015 1.00 . A A .  96 LEU CG   1 1 
        5  7174 1 1  18 LEU H    H   7.280   0.807  -9.537 1.00 . A A .  96 LEU H    1 1 
        5  7175 1 1  18 LEU HA   H   7.189  -2.013  -9.715 1.00 . A A .  96 LEU HA   1 1 
        5  7176 1 1  18 LEU HB2  H   8.812  -0.226  -8.474 1.00 . A A .  96 LEU HB2  1 1 
        5  7177 1 1  18 LEU HB3  H   7.886  -0.816  -7.108 1.00 . A A .  96 LEU HB3  1 1 
        5  7178 1 1  18 LEU HD11 H   8.812  -3.144  -9.945 1.00 . A A .  96 LEU HD11 1 1 
        5  7179 1 1  18 LEU HD12 H  10.436  -3.391  -9.301 1.00 . A A .  96 LEU HD12 1 1 
        5  7180 1 1  18 LEU HD13 H   9.966  -1.811  -9.929 1.00 . A A .  96 LEU HD13 1 1 
        5  7181 1 1  18 LEU HD21 H   9.969  -1.967  -6.070 1.00 . A A .  96 LEU HD21 1 1 
        5  7182 1 1  18 LEU HD22 H  10.760  -1.055  -7.356 1.00 . A A .  96 LEU HD22 1 1 
        5  7183 1 1  18 LEU HD23 H  11.047  -2.788  -7.199 1.00 . A A .  96 LEU HD23 1 1 
        5  7184 1 1  18 LEU HG   H   8.575  -3.107  -7.603 1.00 . A A .  96 LEU HG   1 1 
        5  7185 1 1  18 LEU N    N   6.761   0.006  -9.759 1.00 . A A .  96 LEU N    1 1 
        5  7186 1 1  18 LEU O    O   5.247  -2.684  -8.275 1.00 . A A .  96 LEU O    1 1 
        5  7187 1 1  19 CYS C    C   2.972  -1.248  -7.308 1.00 . A A .  97 CYS C    1 1 
        5  7188 1 1  19 CYS CA   C   4.188  -0.855  -6.477 1.00 . A A .  97 CYS CA   1 1 
        5  7189 1 1  19 CYS CB   C   3.884   0.408  -5.670 1.00 . A A .  97 CYS CB   1 1 
        5  7190 1 1  19 CYS H    H   5.818   0.218  -7.297 1.00 . A A .  97 CYS H    1 1 
        5  7191 1 1  19 CYS HA   H   4.422  -1.660  -5.797 1.00 . A A .  97 CYS HA   1 1 
        5  7192 1 1  19 CYS HB2  H   4.796   0.969  -5.534 1.00 . A A .  97 CYS HB2  1 1 
        5  7193 1 1  19 CYS HB3  H   3.173   1.013  -6.215 1.00 . A A .  97 CYS HB3  1 1 
        5  7194 1 1  19 CYS HG   H   2.391   0.610  -3.940 1.00 . A A .  97 CYS HG   1 1 
        5  7195 1 1  19 CYS N    N   5.349  -0.641  -7.334 1.00 . A A .  97 CYS N    1 1 
        5  7196 1 1  19 CYS O    O   2.198  -2.123  -6.919 1.00 . A A .  97 CYS O    1 1 
        5  7197 1 1  19 CYS SG   S   3.190   0.087  -4.031 1.00 . A A .  97 CYS SG   1 1 
        5  7198 1 1  20 LEU C    C   1.717  -2.347  -9.788 1.00 . A A .  98 LEU C    1 1 
        5  7199 1 1  20 LEU CA   C   1.695  -0.887  -9.348 1.00 . A A .  98 LEU CA   1 1 
        5  7200 1 1  20 LEU CB   C   1.742   0.028 -10.573 1.00 . A A .  98 LEU CB   1 1 
        5  7201 1 1  20 LEU CD1  C   1.576   2.328 -11.556 1.00 . A A .  98 LEU CD1  1 1 
        5  7202 1 1  20 LEU CD2  C  -0.089   1.579  -9.848 1.00 . A A .  98 LEU CD2  1 1 
        5  7203 1 1  20 LEU CG   C   1.358   1.485 -10.310 1.00 . A A .  98 LEU CG   1 1 
        5  7204 1 1  20 LEU H    H   3.467   0.086  -8.715 1.00 . A A .  98 LEU H    1 1 
        5  7205 1 1  20 LEU HA   H   0.781  -0.700  -8.804 1.00 . A A .  98 LEU HA   1 1 
        5  7206 1 1  20 LEU HB2  H   2.746   0.009 -10.971 1.00 . A A .  98 LEU HB2  1 1 
        5  7207 1 1  20 LEU HB3  H   1.070  -0.368 -11.319 1.00 . A A .  98 LEU HB3  1 1 
        5  7208 1 1  20 LEU HD11 H   2.583   2.182 -11.918 1.00 . A A .  98 LEU HD11 1 1 
        5  7209 1 1  20 LEU HD12 H   1.428   3.371 -11.317 1.00 . A A .  98 LEU HD12 1 1 
        5  7210 1 1  20 LEU HD13 H   0.873   2.031 -12.320 1.00 . A A .  98 LEU HD13 1 1 
        5  7211 1 1  20 LEU HD21 H  -0.426   2.602  -9.925 1.00 . A A .  98 LEU HD21 1 1 
        5  7212 1 1  20 LEU HD22 H  -0.160   1.253  -8.820 1.00 . A A .  98 LEU HD22 1 1 
        5  7213 1 1  20 LEU HD23 H  -0.707   0.948 -10.469 1.00 . A A .  98 LEU HD23 1 1 
        5  7214 1 1  20 LEU HG   H   1.987   1.881  -9.525 1.00 . A A .  98 LEU HG   1 1 
        5  7215 1 1  20 LEU N    N   2.814  -0.599  -8.458 1.00 . A A .  98 LEU N    1 1 
        5  7216 1 1  20 LEU O    O   0.684  -3.017  -9.806 1.00 . A A .  98 LEU O    1 1 
        5  7217 1 1  21 GLN C    C   2.805  -5.185  -9.425 1.00 . A A .  99 GLN C    1 1 
        5  7218 1 1  21 GLN CA   C   3.062  -4.218 -10.576 1.00 . A A .  99 GLN CA   1 1 
        5  7219 1 1  21 GLN CB   C   4.468  -4.439 -11.138 1.00 . A A .  99 GLN CB   1 1 
        5  7220 1 1  21 GLN CD   C   4.757  -4.214 -13.638 1.00 . A A .  99 GLN CD   1 1 
        5  7221 1 1  21 GLN CG   C   4.813  -3.514 -12.294 1.00 . A A .  99 GLN CG   1 1 
        5  7222 1 1  21 GLN H    H   3.690  -2.253 -10.101 1.00 . A A .  99 GLN H    1 1 
        5  7223 1 1  21 GLN HA   H   2.339  -4.404 -11.356 1.00 . A A .  99 GLN HA   1 1 
        5  7224 1 1  21 GLN HB2  H   5.188  -4.278 -10.349 1.00 . A A .  99 GLN HB2  1 1 
        5  7225 1 1  21 GLN HB3  H   4.548  -5.459 -11.485 1.00 . A A .  99 GLN HB3  1 1 
        5  7226 1 1  21 GLN HE21 H   4.585  -2.466 -14.569 1.00 . A A .  99 GLN HE21 1 1 
        5  7227 1 1  21 GLN HE22 H   4.594  -3.861 -15.588 1.00 . A A .  99 GLN HE22 1 1 
        5  7228 1 1  21 GLN HG2  H   4.111  -2.694 -12.304 1.00 . A A .  99 GLN HG2  1 1 
        5  7229 1 1  21 GLN HG3  H   5.812  -3.130 -12.145 1.00 . A A .  99 GLN HG3  1 1 
        5  7230 1 1  21 GLN N    N   2.903  -2.836 -10.139 1.00 . A A .  99 GLN N    1 1 
        5  7231 1 1  21 GLN NE2  N   4.633  -3.435 -14.706 1.00 . A A .  99 GLN NE2  1 1 
        5  7232 1 1  21 GLN O    O   2.070  -6.161  -9.573 1.00 . A A .  99 GLN O    1 1 
        5  7233 1 1  21 GLN OE1  O   4.825  -5.441 -13.715 1.00 . A A .  99 GLN OE1  1 1 
        5  7234 1 1  22 LEU C    C   1.782  -5.807  -6.678 1.00 . A A . 100 LEU C    1 1 
        5  7235 1 1  22 LEU CA   C   3.248  -5.748  -7.098 1.00 . A A . 100 LEU CA   1 1 
        5  7236 1 1  22 LEU CB   C   4.103  -5.218  -5.943 1.00 . A A . 100 LEU CB   1 1 
        5  7237 1 1  22 LEU CD1  C   6.376  -5.119  -4.889 1.00 . A A . 100 LEU CD1  1 1 
        5  7238 1 1  22 LEU CD2  C   5.155  -7.298  -5.018 1.00 . A A . 100 LEU CD2  1 1 
        5  7239 1 1  22 LEU CG   C   5.416  -5.968  -5.709 1.00 . A A . 100 LEU CG   1 1 
        5  7240 1 1  22 LEU H    H   3.985  -4.111  -8.220 1.00 . A A . 100 LEU H    1 1 
        5  7241 1 1  22 LEU HA   H   3.578  -6.744  -7.353 1.00 . A A . 100 LEU HA   1 1 
        5  7242 1 1  22 LEU HB2  H   4.334  -4.182  -6.141 1.00 . A A . 100 LEU HB2  1 1 
        5  7243 1 1  22 LEU HB3  H   3.520  -5.272  -5.036 1.00 . A A . 100 LEU HB3  1 1 
        5  7244 1 1  22 LEU HD11 H   7.387  -5.463  -5.050 1.00 . A A . 100 LEU HD11 1 1 
        5  7245 1 1  22 LEU HD12 H   6.128  -5.207  -3.841 1.00 . A A . 100 LEU HD12 1 1 
        5  7246 1 1  22 LEU HD13 H   6.294  -4.087  -5.193 1.00 . A A . 100 LEU HD13 1 1 
        5  7247 1 1  22 LEU HD21 H   5.312  -7.188  -3.956 1.00 . A A . 100 LEU HD21 1 1 
        5  7248 1 1  22 LEU HD22 H   5.830  -8.045  -5.408 1.00 . A A . 100 LEU HD22 1 1 
        5  7249 1 1  22 LEU HD23 H   4.135  -7.604  -5.201 1.00 . A A . 100 LEU HD23 1 1 
        5  7250 1 1  22 LEU HG   H   5.883  -6.171  -6.661 1.00 . A A . 100 LEU HG   1 1 
        5  7251 1 1  22 LEU N    N   3.413  -4.905  -8.276 1.00 . A A . 100 LEU N    1 1 
        5  7252 1 1  22 LEU O    O   1.250  -6.879  -6.390 1.00 . A A . 100 LEU O    1 1 
        5  7253 1 1  23 ARG C    C  -1.161  -5.251  -7.285 1.00 . A A . 101 ARG C    1 1 
        5  7254 1 1  23 ARG CA   C  -0.267  -4.557  -6.262 1.00 . A A . 101 ARG CA   1 1 
        5  7255 1 1  23 ARG CB   C  -0.684  -3.093  -6.114 1.00 . A A . 101 ARG CB   1 1 
        5  7256 1 1  23 ARG CD   C  -2.422  -1.444  -5.354 1.00 . A A . 101 ARG CD   1 1 
        5  7257 1 1  23 ARG CG   C  -2.024  -2.910  -5.420 1.00 . A A . 101 ARG CG   1 1 
        5  7258 1 1  23 ARG CZ   C  -2.655   0.477  -6.880 1.00 . A A . 101 ARG CZ   1 1 
        5  7259 1 1  23 ARG H    H   1.618  -3.827  -6.887 1.00 . A A . 101 ARG H    1 1 
        5  7260 1 1  23 ARG HA   H  -0.381  -5.052  -5.309 1.00 . A A . 101 ARG HA   1 1 
        5  7261 1 1  23 ARG HB2  H   0.069  -2.572  -5.540 1.00 . A A . 101 ARG HB2  1 1 
        5  7262 1 1  23 ARG HB3  H  -0.748  -2.648  -7.096 1.00 . A A . 101 ARG HB3  1 1 
        5  7263 1 1  23 ARG HD2  H  -3.412  -1.373  -4.927 1.00 . A A . 101 ARG HD2  1 1 
        5  7264 1 1  23 ARG HD3  H  -1.720  -0.921  -4.723 1.00 . A A . 101 ARG HD3  1 1 
        5  7265 1 1  23 ARG HE   H  -2.263  -1.395  -7.450 1.00 . A A . 101 ARG HE   1 1 
        5  7266 1 1  23 ARG HG2  H  -2.779  -3.454  -5.967 1.00 . A A . 101 ARG HG2  1 1 
        5  7267 1 1  23 ARG HG3  H  -1.953  -3.300  -4.415 1.00 . A A . 101 ARG HG3  1 1 
        5  7268 1 1  23 ARG HH11 H  -2.885   0.929  -4.921 1.00 . A A . 101 ARG HH11 1 1 
        5  7269 1 1  23 ARG HH12 H  -3.050   2.261  -6.014 1.00 . A A . 101 ARG HH12 1 1 
        5  7270 1 1  23 ARG HH21 H  -2.479   0.357  -8.889 1.00 . A A . 101 ARG HH21 1 1 
        5  7271 1 1  23 ARG HH22 H  -2.820   1.937  -8.267 1.00 . A A . 101 ARG HH22 1 1 
        5  7272 1 1  23 ARG N    N   1.137  -4.646  -6.646 1.00 . A A . 101 ARG N    1 1 
        5  7273 1 1  23 ARG NE   N  -2.431  -0.819  -6.675 1.00 . A A . 101 ARG NE   1 1 
        5  7274 1 1  23 ARG NH1  N  -2.882   1.289  -5.854 1.00 . A A . 101 ARG NH1  1 1 
        5  7275 1 1  23 ARG NH2  N  -2.651   0.964  -8.113 1.00 . A A . 101 ARG NH2  1 1 
        5  7276 1 1  23 ARG O    O  -2.235  -5.749  -6.947 1.00 . A A . 101 ARG O    1 1 
        5  7277 1 1  24 GLN C    C  -1.466  -7.433  -9.457 1.00 . A A . 102 GLN C    1 1 
        5  7278 1 1  24 GLN CA   C  -1.475  -5.915  -9.606 1.00 . A A . 102 GLN CA   1 1 
        5  7279 1 1  24 GLN CB   C  -0.903  -5.522 -10.970 1.00 . A A . 102 GLN CB   1 1 
        5  7280 1 1  24 GLN CD   C  -1.088  -4.004 -12.980 1.00 . A A . 102 GLN CD   1 1 
        5  7281 1 1  24 GLN CG   C  -1.529  -4.266 -11.553 1.00 . A A . 102 GLN CG   1 1 
        5  7282 1 1  24 GLN H    H   0.153  -4.872  -8.745 1.00 . A A . 102 GLN H    1 1 
        5  7283 1 1  24 GLN HA   H  -2.494  -5.565  -9.540 1.00 . A A . 102 GLN HA   1 1 
        5  7284 1 1  24 GLN HB2  H   0.159  -5.355 -10.867 1.00 . A A . 102 GLN HB2  1 1 
        5  7285 1 1  24 GLN HB3  H  -1.065  -6.334 -11.663 1.00 . A A . 102 GLN HB3  1 1 
        5  7286 1 1  24 GLN HE21 H   0.778  -3.684 -12.371 1.00 . A A . 102 GLN HE21 1 1 
        5  7287 1 1  24 GLN HE22 H   0.508  -3.538 -14.071 1.00 . A A . 102 GLN HE22 1 1 
        5  7288 1 1  24 GLN HG2  H  -2.603  -4.375 -11.539 1.00 . A A . 102 GLN HG2  1 1 
        5  7289 1 1  24 GLN HG3  H  -1.246  -3.421 -10.943 1.00 . A A . 102 GLN HG3  1 1 
        5  7290 1 1  24 GLN N    N  -0.713  -5.280  -8.537 1.00 . A A . 102 GLN N    1 1 
        5  7291 1 1  24 GLN NE2  N   0.195  -3.712 -13.159 1.00 . A A . 102 GLN NE2  1 1 
        5  7292 1 1  24 GLN O    O  -2.483  -8.094  -9.670 1.00 . A A . 102 GLN O    1 1 
        5  7293 1 1  24 GLN OE1  O  -1.891  -4.062 -13.911 1.00 . A A . 102 GLN OE1  1 1 
        5  7294 1 1  25 ASP C    C  -0.908  -9.901  -7.678 1.00 . A A . 103 ASP C    1 1 
        5  7295 1 1  25 ASP CA   C  -0.166  -9.421  -8.921 1.00 . A A . 103 ASP CA   1 1 
        5  7296 1 1  25 ASP CB   C   1.313  -9.798  -8.822 1.00 . A A . 103 ASP CB   1 1 
        5  7297 1 1  25 ASP CG   C   2.007  -9.777 -10.170 1.00 . A A . 103 ASP CG   1 1 
        5  7298 1 1  25 ASP H    H   0.465  -7.400  -8.943 1.00 . A A . 103 ASP H    1 1 
        5  7299 1 1  25 ASP HA   H  -0.593  -9.903  -9.788 1.00 . A A . 103 ASP HA   1 1 
        5  7300 1 1  25 ASP HB2  H   1.814  -9.097  -8.170 1.00 . A A . 103 ASP HB2  1 1 
        5  7301 1 1  25 ASP HB3  H   1.398 -10.792  -8.409 1.00 . A A . 103 ASP HB3  1 1 
        5  7302 1 1  25 ASP N    N  -0.310  -7.980  -9.095 1.00 . A A . 103 ASP N    1 1 
        5  7303 1 1  25 ASP O    O  -1.568 -10.940  -7.699 1.00 . A A . 103 ASP O    1 1 
        5  7304 1 1  25 ASP OD1  O   1.884  -8.761 -10.886 1.00 . A A . 103 ASP OD1  1 1 
        5  7305 1 1  25 ASP OD2  O   2.674 -10.777 -10.510 1.00 . A A . 103 ASP OD2  1 1 
        5  7306 1 1  26 ILE C    C  -2.967  -9.509  -5.496 1.00 . A A . 104 ILE C    1 1 
        5  7307 1 1  26 ILE CA   C  -1.449  -9.491  -5.341 1.00 . A A . 104 ILE CA   1 1 
        5  7308 1 1  26 ILE CB   C  -1.068  -8.512  -4.212 1.00 . A A . 104 ILE CB   1 1 
        5  7309 1 1  26 ILE CD1  C   0.936  -7.048  -3.645 1.00 . A A . 104 ILE CD1  1 1 
        5  7310 1 1  26 ILE CG1  C   0.454  -8.412  -4.086 1.00 . A A . 104 ILE CG1  1 1 
        5  7311 1 1  26 ILE CG2  C  -1.685  -8.952  -2.892 1.00 . A A . 104 ILE CG2  1 1 
        5  7312 1 1  26 ILE H    H  -0.250  -8.325  -6.638 1.00 . A A . 104 ILE H    1 1 
        5  7313 1 1  26 ILE HA   H  -1.116 -10.479  -5.057 1.00 . A A . 104 ILE HA   1 1 
        5  7314 1 1  26 ILE HB   H  -1.465  -7.539  -4.460 1.00 . A A . 104 ILE HB   1 1 
        5  7315 1 1  26 ILE HD11 H   1.132  -7.061  -2.583 1.00 . A A . 104 ILE HD11 1 1 
        5  7316 1 1  26 ILE HD12 H   0.176  -6.311  -3.861 1.00 . A A . 104 ILE HD12 1 1 
        5  7317 1 1  26 ILE HD13 H   1.842  -6.797  -4.175 1.00 . A A . 104 ILE HD13 1 1 
        5  7318 1 1  26 ILE HG12 H   0.796  -9.134  -3.359 1.00 . A A . 104 ILE HG12 1 1 
        5  7319 1 1  26 ILE HG13 H   0.903  -8.631  -5.043 1.00 . A A . 104 ILE HG13 1 1 
        5  7320 1 1  26 ILE HG21 H  -1.580 -10.021  -2.785 1.00 . A A . 104 ILE HG21 1 1 
        5  7321 1 1  26 ILE HG22 H  -2.732  -8.690  -2.880 1.00 . A A . 104 ILE HG22 1 1 
        5  7322 1 1  26 ILE HG23 H  -1.180  -8.457  -2.076 1.00 . A A . 104 ILE HG23 1 1 
        5  7323 1 1  26 ILE N    N  -0.792  -9.140  -6.594 1.00 . A A . 104 ILE N    1 1 
        5  7324 1 1  26 ILE O    O  -3.622 -10.496  -5.162 1.00 . A A . 104 ILE O    1 1 
        5  7325 1 1  27 VAL C    C  -5.484  -9.386  -7.131 1.00 . A A . 105 VAL C    1 1 
        5  7326 1 1  27 VAL CA   C  -4.964  -8.302  -6.193 1.00 . A A . 105 VAL CA   1 1 
        5  7327 1 1  27 VAL CB   C  -5.352  -6.923  -6.757 1.00 . A A . 105 VAL CB   1 1 
        5  7328 1 1  27 VAL CG1  C  -5.031  -5.826  -5.754 1.00 . A A . 105 VAL CG1  1 1 
        5  7329 1 1  27 VAL CG2  C  -4.646  -6.670  -8.081 1.00 . A A . 105 VAL CG2  1 1 
        5  7330 1 1  27 VAL H    H  -2.954  -7.652  -6.247 1.00 . A A . 105 VAL H    1 1 
        5  7331 1 1  27 VAL HA   H  -5.437  -8.418  -5.229 1.00 . A A . 105 VAL HA   1 1 
        5  7332 1 1  27 VAL HB   H  -6.417  -6.916  -6.935 1.00 . A A . 105 VAL HB   1 1 
        5  7333 1 1  27 VAL HG11 H  -5.738  -5.866  -4.939 1.00 . A A . 105 VAL HG11 1 1 
        5  7334 1 1  27 VAL HG12 H  -5.095  -4.864  -6.240 1.00 . A A . 105 VAL HG12 1 1 
        5  7335 1 1  27 VAL HG13 H  -4.031  -5.970  -5.371 1.00 . A A . 105 VAL HG13 1 1 
        5  7336 1 1  27 VAL HG21 H  -4.576  -5.606  -8.253 1.00 . A A . 105 VAL HG21 1 1 
        5  7337 1 1  27 VAL HG22 H  -5.207  -7.129  -8.881 1.00 . A A . 105 VAL HG22 1 1 
        5  7338 1 1  27 VAL HG23 H  -3.654  -7.095  -8.046 1.00 . A A . 105 VAL HG23 1 1 
        5  7339 1 1  27 VAL N    N  -3.522  -8.411  -6.000 1.00 . A A . 105 VAL N    1 1 
        5  7340 1 1  27 VAL O    O  -6.613  -9.854  -6.987 1.00 . A A . 105 VAL O    1 1 
        5  7341 1 1  28 ALA C    C  -4.895 -12.212  -8.461 1.00 . A A . 106 ALA C    1 1 
        5  7342 1 1  28 ALA CA   C  -5.040 -10.810  -9.053 1.00 . A A . 106 ALA CA   1 1 
        5  7343 1 1  28 ALA CB   C  -4.207 -10.684 -10.319 1.00 . A A . 106 ALA CB   1 1 
        5  7344 1 1  28 ALA H    H  -3.768  -9.375  -8.159 1.00 . A A . 106 ALA H    1 1 
        5  7345 1 1  28 ALA HA   H  -6.075 -10.649  -9.316 1.00 . A A . 106 ALA HA   1 1 
        5  7346 1 1  28 ALA HB1  H  -4.724 -10.055 -11.029 1.00 . A A . 106 ALA HB1  1 1 
        5  7347 1 1  28 ALA HB2  H  -4.055 -11.663 -10.749 1.00 . A A . 106 ALA HB2  1 1 
        5  7348 1 1  28 ALA HB3  H  -3.251 -10.244 -10.078 1.00 . A A . 106 ALA HB3  1 1 
        5  7349 1 1  28 ALA N    N  -4.657  -9.781  -8.093 1.00 . A A . 106 ALA N    1 1 
        5  7350 1 1  28 ALA O    O  -5.218 -13.204  -9.115 1.00 . A A . 106 ALA O    1 1 
        5  7351 1 1  29 GLY C    C  -3.140 -14.405  -7.231 1.00 . A A . 107 GLY C    1 1 
        5  7352 1 1  29 GLY CA   C  -4.233 -13.579  -6.581 1.00 . A A . 107 GLY CA   1 1 
        5  7353 1 1  29 GLY H    H  -4.165 -11.471  -6.747 1.00 . A A . 107 GLY H    1 1 
        5  7354 1 1  29 GLY HA2  H  -3.979 -13.420  -5.543 1.00 . A A . 107 GLY HA2  1 1 
        5  7355 1 1  29 GLY HA3  H  -5.162 -14.126  -6.635 1.00 . A A . 107 GLY HA3  1 1 
        5  7356 1 1  29 GLY N    N  -4.408 -12.291  -7.225 1.00 . A A . 107 GLY N    1 1 
        5  7357 1 1  29 GLY O    O  -3.240 -15.629  -7.309 1.00 . A A . 107 GLY O    1 1 
        5  7358 1 1  30 ARG C    C   0.107 -14.787  -7.341 1.00 . A A . 108 ARG C    1 1 
        5  7359 1 1  30 ARG CA   C  -0.979 -14.409  -8.350 1.00 . A A . 108 ARG CA   1 1 
        5  7360 1 1  30 ARG CB   C  -0.387 -13.520  -9.447 1.00 . A A . 108 ARG CB   1 1 
        5  7361 1 1  30 ARG CD   C  -1.708 -14.480 -11.358 1.00 . A A . 108 ARG CD   1 1 
        5  7362 1 1  30 ARG CG   C  -0.319 -14.197 -10.806 1.00 . A A . 108 ARG CG   1 1 
        5  7363 1 1  30 ARG CZ   C  -2.781 -16.196 -12.763 1.00 . A A . 108 ARG CZ   1 1 
        5  7364 1 1  30 ARG H    H  -2.076 -12.756  -7.609 1.00 . A A . 108 ARG H    1 1 
        5  7365 1 1  30 ARG HA   H  -1.360 -15.312  -8.802 1.00 . A A . 108 ARG HA   1 1 
        5  7366 1 1  30 ARG HB2  H  -0.995 -12.632  -9.541 1.00 . A A . 108 ARG HB2  1 1 
        5  7367 1 1  30 ARG HB3  H   0.614 -13.231  -9.163 1.00 . A A . 108 ARG HB3  1 1 
        5  7368 1 1  30 ARG HD2  H  -2.424 -14.403 -10.554 1.00 . A A . 108 ARG HD2  1 1 
        5  7369 1 1  30 ARG HD3  H  -1.937 -13.744 -12.115 1.00 . A A . 108 ARG HD3  1 1 
        5  7370 1 1  30 ARG HE   H  -1.095 -16.456 -11.728 1.00 . A A . 108 ARG HE   1 1 
        5  7371 1 1  30 ARG HG2  H   0.205 -13.550 -11.494 1.00 . A A . 108 ARG HG2  1 1 
        5  7372 1 1  30 ARG HG3  H   0.216 -15.130 -10.707 1.00 . A A . 108 ARG HG3  1 1 
        5  7373 1 1  30 ARG HH11 H  -3.754 -14.423 -12.716 1.00 . A A . 108 ARG HH11 1 1 
        5  7374 1 1  30 ARG HH12 H  -4.489 -15.647 -13.697 1.00 . A A . 108 ARG HH12 1 1 
        5  7375 1 1  30 ARG HH21 H  -2.059 -18.067 -13.018 1.00 . A A . 108 ARG HH21 1 1 
        5  7376 1 1  30 ARG HH22 H  -3.527 -17.716 -13.868 1.00 . A A . 108 ARG HH22 1 1 
        5  7377 1 1  30 ARG N    N  -2.095 -13.731  -7.701 1.00 . A A . 108 ARG N    1 1 
        5  7378 1 1  30 ARG NE   N  -1.800 -15.813 -11.949 1.00 . A A . 108 ARG NE   1 1 
        5  7379 1 1  30 ARG NH1  N  -3.754 -15.353 -13.085 1.00 . A A . 108 ARG NH1  1 1 
        5  7380 1 1  30 ARG NH2  N  -2.790 -17.427 -13.257 1.00 . A A . 108 ARG NH2  1 1 
        5  7381 1 1  30 ARG O    O   1.159 -15.304  -7.718 1.00 . A A . 108 ARG O    1 1 
        5  7382 1 1  31 LEU C    C   0.106 -14.974  -3.658 1.00 . A A . 109 LEU C    1 1 
        5  7383 1 1  31 LEU CA   C   0.808 -14.850  -5.010 1.00 . A A . 109 LEU CA   1 1 
        5  7384 1 1  31 LEU CB   C   1.892 -13.773  -4.936 1.00 . A A . 109 LEU CB   1 1 
        5  7385 1 1  31 LEU CD1  C   4.368 -13.560  -5.277 1.00 . A A . 109 LEU CD1  1 1 
        5  7386 1 1  31 LEU CD2  C   3.460 -14.073  -3.003 1.00 . A A . 109 LEU CD2  1 1 
        5  7387 1 1  31 LEU CG   C   3.271 -14.272  -4.500 1.00 . A A . 109 LEU CG   1 1 
        5  7388 1 1  31 LEU H    H  -1.004 -14.120  -5.812 1.00 . A A . 109 LEU H    1 1 
        5  7389 1 1  31 LEU HA   H   1.268 -15.794  -5.257 1.00 . A A . 109 LEU HA   1 1 
        5  7390 1 1  31 LEU HB2  H   1.987 -13.321  -5.913 1.00 . A A . 109 LEU HB2  1 1 
        5  7391 1 1  31 LEU HB3  H   1.570 -13.016  -4.238 1.00 . A A . 109 LEU HB3  1 1 
        5  7392 1 1  31 LEU HD11 H   4.481 -14.023  -6.246 1.00 . A A . 109 LEU HD11 1 1 
        5  7393 1 1  31 LEU HD12 H   5.298 -13.631  -4.733 1.00 . A A . 109 LEU HD12 1 1 
        5  7394 1 1  31 LEU HD13 H   4.103 -12.521  -5.403 1.00 . A A . 109 LEU HD13 1 1 
        5  7395 1 1  31 LEU HD21 H   3.786 -13.061  -2.813 1.00 . A A . 109 LEU HD21 1 1 
        5  7396 1 1  31 LEU HD22 H   4.205 -14.765  -2.639 1.00 . A A . 109 LEU HD22 1 1 
        5  7397 1 1  31 LEU HD23 H   2.524 -14.251  -2.495 1.00 . A A . 109 LEU HD23 1 1 
        5  7398 1 1  31 LEU HG   H   3.347 -15.329  -4.709 1.00 . A A . 109 LEU HG   1 1 
        5  7399 1 1  31 LEU N    N  -0.151 -14.531  -6.060 1.00 . A A . 109 LEU N    1 1 
        5  7400 1 1  31 LEU O    O  -0.442 -13.998  -3.147 1.00 . A A . 109 LEU O    1 1 
        5  7401 1 1  32 PRO C    C  -0.120 -15.392  -0.708 1.00 . A A . 110 PRO C    1 1 
        5  7402 1 1  32 PRO CA   C  -0.536 -16.414  -1.762 1.00 . A A . 110 PRO CA   1 1 
        5  7403 1 1  32 PRO CB   C  -0.051 -17.811  -1.372 1.00 . A A . 110 PRO CB   1 1 
        5  7404 1 1  32 PRO CD   C   0.736 -17.403  -3.593 1.00 . A A . 110 PRO CD   1 1 
        5  7405 1 1  32 PRO CG   C   0.243 -18.483  -2.668 1.00 . A A . 110 PRO CG   1 1 
        5  7406 1 1  32 PRO HA   H  -1.613 -16.416  -1.851 1.00 . A A . 110 PRO HA   1 1 
        5  7407 1 1  32 PRO HB2  H   0.834 -17.729  -0.758 1.00 . A A . 110 PRO HB2  1 1 
        5  7408 1 1  32 PRO HB3  H  -0.828 -18.326  -0.828 1.00 . A A . 110 PRO HB3  1 1 
        5  7409 1 1  32 PRO HD2  H   1.813 -17.334  -3.552 1.00 . A A . 110 PRO HD2  1 1 
        5  7410 1 1  32 PRO HD3  H   0.407 -17.594  -4.603 1.00 . A A . 110 PRO HD3  1 1 
        5  7411 1 1  32 PRO HG2  H   1.007 -19.233  -2.527 1.00 . A A . 110 PRO HG2  1 1 
        5  7412 1 1  32 PRO HG3  H  -0.657 -18.931  -3.061 1.00 . A A . 110 PRO HG3  1 1 
        5  7413 1 1  32 PRO N    N   0.109 -16.179  -3.058 1.00 . A A . 110 PRO N    1 1 
        5  7414 1 1  32 PRO O    O   1.068 -15.201  -0.449 1.00 . A A . 110 PRO O    1 1 
        5  7415 1 1  33 CYS C    C  -1.859 -13.862   2.064 1.00 . A A . 111 CYS C    1 1 
        5  7416 1 1  33 CYS CA   C  -0.848 -13.741   0.928 1.00 . A A . 111 CYS CA   1 1 
        5  7417 1 1  33 CYS CB   C  -0.895 -12.333   0.328 1.00 . A A . 111 CYS CB   1 1 
        5  7418 1 1  33 CYS H    H  -2.034 -14.940  -0.350 1.00 . A A . 111 CYS H    1 1 
        5  7419 1 1  33 CYS HA   H   0.141 -13.922   1.322 1.00 . A A . 111 CYS HA   1 1 
        5  7420 1 1  33 CYS HB2  H  -1.295 -12.390  -0.673 1.00 . A A . 111 CYS HB2  1 1 
        5  7421 1 1  33 CYS HB3  H  -1.540 -11.712   0.933 1.00 . A A . 111 CYS HB3  1 1 
        5  7422 1 1  33 CYS HG   H   1.387 -12.202   0.144 1.00 . A A . 111 CYS HG   1 1 
        5  7423 1 1  33 CYS N    N  -1.107 -14.741  -0.102 1.00 . A A . 111 CYS N    1 1 
        5  7424 1 1  33 CYS O    O  -3.054 -14.040   1.828 1.00 . A A . 111 CYS O    1 1 
        5  7425 1 1  33 CYS SG   S   0.717 -11.520   0.228 1.00 . A A . 111 CYS SG   1 1 
        5  7426 1 1  34 SER C    C  -3.125 -12.641   4.603 1.00 . A A . 112 SER C    1 1 
        5  7427 1 1  34 SER CA   C  -2.233 -13.871   4.469 1.00 . A A . 112 SER CA   1 1 
        5  7428 1 1  34 SER CB   C  -1.389 -14.043   5.733 1.00 . A A . 112 SER CB   1 1 
        5  7429 1 1  34 SER H    H  -0.409 -13.629   3.420 1.00 . A A . 112 SER H    1 1 
        5  7430 1 1  34 SER HA   H  -2.858 -14.742   4.344 1.00 . A A . 112 SER HA   1 1 
        5  7431 1 1  34 SER HB2  H  -0.405 -14.397   5.461 1.00 . A A . 112 SER HB2  1 1 
        5  7432 1 1  34 SER HB3  H  -1.302 -13.092   6.238 1.00 . A A . 112 SER HB3  1 1 
        5  7433 1 1  34 SER HG   H  -2.131 -14.562   7.470 1.00 . A A . 112 SER HG   1 1 
        5  7434 1 1  34 SER N    N  -1.371 -13.768   3.296 1.00 . A A . 112 SER N    1 1 
        5  7435 1 1  34 SER O    O  -2.836 -11.586   4.037 1.00 . A A . 112 SER O    1 1 
        5  7436 1 1  34 SER OG   O  -1.980 -14.978   6.618 1.00 . A A . 112 SER OG   1 1 
        5  7437 1 1  35 PHE C    C  -4.439 -10.478   6.173 1.00 . A A . 113 PHE C    1 1 
        5  7438 1 1  35 PHE CA   C  -5.147 -11.688   5.573 1.00 . A A . 113 PHE CA   1 1 
        5  7439 1 1  35 PHE CB   C  -6.286 -12.142   6.492 1.00 . A A . 113 PHE CB   1 1 
        5  7440 1 1  35 PHE CD1  C  -8.318 -10.723   6.088 1.00 . A A . 113 PHE CD1  1 1 
        5  7441 1 1  35 PHE CD2  C  -7.023 -10.317   8.049 1.00 . A A . 113 PHE CD2  1 1 
        5  7442 1 1  35 PHE CE1  C  -9.186  -9.709   6.447 1.00 . A A . 113 PHE CE1  1 1 
        5  7443 1 1  35 PHE CE2  C  -7.887  -9.302   8.413 1.00 . A A . 113 PHE CE2  1 1 
        5  7444 1 1  35 PHE CG   C  -7.228 -11.038   6.884 1.00 . A A . 113 PHE CG   1 1 
        5  7445 1 1  35 PHE CZ   C  -8.970  -8.998   7.612 1.00 . A A . 113 PHE CZ   1 1 
        5  7446 1 1  35 PHE H    H  -4.383 -13.651   5.783 1.00 . A A . 113 PHE H    1 1 
        5  7447 1 1  35 PHE HA   H  -5.559 -11.410   4.615 1.00 . A A . 113 PHE HA   1 1 
        5  7448 1 1  35 PHE HB2  H  -6.862 -12.904   5.989 1.00 . A A . 113 PHE HB2  1 1 
        5  7449 1 1  35 PHE HB3  H  -5.864 -12.556   7.396 1.00 . A A . 113 PHE HB3  1 1 
        5  7450 1 1  35 PHE HD1  H  -8.488 -11.279   5.178 1.00 . A A . 113 PHE HD1  1 1 
        5  7451 1 1  35 PHE HD2  H  -6.177 -10.554   8.676 1.00 . A A . 113 PHE HD2  1 1 
        5  7452 1 1  35 PHE HE1  H -10.032  -9.473   5.819 1.00 . A A . 113 PHE HE1  1 1 
        5  7453 1 1  35 PHE HE2  H  -7.716  -8.747   9.324 1.00 . A A . 113 PHE HE2  1 1 
        5  7454 1 1  35 PHE HZ   H  -9.646  -8.205   7.895 1.00 . A A . 113 PHE HZ   1 1 
        5  7455 1 1  35 PHE N    N  -4.209 -12.785   5.358 1.00 . A A . 113 PHE N    1 1 
        5  7456 1 1  35 PHE O    O  -4.614  -9.351   5.710 1.00 . A A . 113 PHE O    1 1 
        5  7457 1 1  36 ALA C    C  -2.052  -8.863   6.923 1.00 . A A . 114 ALA C    1 1 
        5  7458 1 1  36 ALA CA   C  -2.935  -9.641   7.891 1.00 . A A . 114 ALA CA   1 1 
        5  7459 1 1  36 ALA CB   C  -2.097 -10.197   9.030 1.00 . A A . 114 ALA CB   1 1 
        5  7460 1 1  36 ALA H    H  -3.570 -11.631   7.558 1.00 . A A . 114 ALA H    1 1 
        5  7461 1 1  36 ALA HA   H  -3.667  -8.967   8.313 1.00 . A A . 114 ALA HA   1 1 
        5  7462 1 1  36 ALA HB1  H  -1.270  -9.530   9.224 1.00 . A A . 114 ALA HB1  1 1 
        5  7463 1 1  36 ALA HB2  H  -1.719 -11.170   8.757 1.00 . A A . 114 ALA HB2  1 1 
        5  7464 1 1  36 ALA HB3  H  -2.707 -10.282   9.917 1.00 . A A . 114 ALA HB3  1 1 
        5  7465 1 1  36 ALA N    N  -3.652 -10.716   7.218 1.00 . A A . 114 ALA N    1 1 
        5  7466 1 1  36 ALA O    O  -1.979  -7.637   6.994 1.00 . A A . 114 ALA O    1 1 
        5  7467 1 1  37 THR C    C  -1.348  -8.164   4.012 1.00 . A A . 115 THR C    1 1 
        5  7468 1 1  37 THR CA   C  -0.517  -8.919   5.041 1.00 . A A . 115 THR CA   1 1 
        5  7469 1 1  37 THR CB   C   0.367  -9.958   4.345 1.00 . A A . 115 THR CB   1 1 
        5  7470 1 1  37 THR CG2  C   1.229  -9.377   3.244 1.00 . A A . 115 THR CG2  1 1 
        5  7471 1 1  37 THR H    H  -1.468 -10.544   5.984 1.00 . A A . 115 THR H    1 1 
        5  7472 1 1  37 THR HA   H   0.110  -8.217   5.569 1.00 . A A . 115 THR HA   1 1 
        5  7473 1 1  37 THR HB   H  -0.265 -10.715   3.904 1.00 . A A . 115 THR HB   1 1 
        5  7474 1 1  37 THR HG1  H   0.706 -11.027   5.950 1.00 . A A . 115 THR HG1  1 1 
        5  7475 1 1  37 THR HG21 H   2.254  -9.687   3.387 1.00 . A A . 115 THR HG21 1 1 
        5  7476 1 1  37 THR HG22 H   1.172  -8.298   3.273 1.00 . A A . 115 THR HG22 1 1 
        5  7477 1 1  37 THR HG23 H   0.876  -9.730   2.286 1.00 . A A . 115 THR HG23 1 1 
        5  7478 1 1  37 THR N    N  -1.384  -9.569   6.015 1.00 . A A . 115 THR N    1 1 
        5  7479 1 1  37 THR O    O  -0.989  -7.062   3.597 1.00 . A A . 115 THR O    1 1 
        5  7480 1 1  37 THR OG1  O   1.229 -10.586   5.277 1.00 . A A . 115 THR OG1  1 1 
        5  7481 1 1  38 LEU C    C  -3.848  -6.796   3.161 1.00 . A A . 116 LEU C    1 1 
        5  7482 1 1  38 LEU CA   C  -3.351  -8.137   2.636 1.00 . A A . 116 LEU CA   1 1 
        5  7483 1 1  38 LEU CB   C  -4.539  -9.052   2.329 1.00 . A A . 116 LEU CB   1 1 
        5  7484 1 1  38 LEU CD1  C  -5.503 -10.983   1.053 1.00 . A A . 116 LEU CD1  1 1 
        5  7485 1 1  38 LEU CD2  C  -3.470  -9.811   0.189 1.00 . A A . 116 LEU CD2  1 1 
        5  7486 1 1  38 LEU CG   C  -4.224 -10.253   1.435 1.00 . A A . 116 LEU CG   1 1 
        5  7487 1 1  38 LEU H    H  -2.701  -9.636   3.980 1.00 . A A . 116 LEU H    1 1 
        5  7488 1 1  38 LEU HA   H  -2.788  -7.971   1.730 1.00 . A A . 116 LEU HA   1 1 
        5  7489 1 1  38 LEU HB2  H  -4.934  -9.420   3.265 1.00 . A A . 116 LEU HB2  1 1 
        5  7490 1 1  38 LEU HB3  H  -5.303  -8.462   1.844 1.00 . A A . 116 LEU HB3  1 1 
        5  7491 1 1  38 LEU HD11 H  -6.314 -10.274   0.980 1.00 . A A . 116 LEU HD11 1 1 
        5  7492 1 1  38 LEU HD12 H  -5.735 -11.720   1.808 1.00 . A A . 116 LEU HD12 1 1 
        5  7493 1 1  38 LEU HD13 H  -5.367 -11.474   0.101 1.00 . A A . 116 LEU HD13 1 1 
        5  7494 1 1  38 LEU HD21 H  -2.462  -9.533   0.458 1.00 . A A . 116 LEU HD21 1 1 
        5  7495 1 1  38 LEU HD22 H  -3.972  -8.963  -0.253 1.00 . A A . 116 LEU HD22 1 1 
        5  7496 1 1  38 LEU HD23 H  -3.442 -10.623  -0.522 1.00 . A A . 116 LEU HD23 1 1 
        5  7497 1 1  38 LEU HG   H  -3.596 -10.944   1.980 1.00 . A A . 116 LEU HG   1 1 
        5  7498 1 1  38 LEU N    N  -2.465  -8.760   3.609 1.00 . A A . 116 LEU N    1 1 
        5  7499 1 1  38 LEU O    O  -3.836  -5.794   2.446 1.00 . A A . 116 LEU O    1 1 
        5  7500 1 1  39 ALA C    C  -3.662  -4.594   5.347 1.00 . A A . 117 ALA C    1 1 
        5  7501 1 1  39 ALA CA   C  -4.791  -5.576   5.045 1.00 . A A . 117 ALA CA   1 1 
        5  7502 1 1  39 ALA CB   C  -5.538  -5.935   6.321 1.00 . A A . 117 ALA CB   1 1 
        5  7503 1 1  39 ALA H    H  -4.278  -7.616   4.938 1.00 . A A . 117 ALA H    1 1 
        5  7504 1 1  39 ALA HA   H  -5.490  -5.112   4.366 1.00 . A A . 117 ALA HA   1 1 
        5  7505 1 1  39 ALA HB1  H  -6.601  -5.910   6.135 1.00 . A A . 117 ALA HB1  1 1 
        5  7506 1 1  39 ALA HB2  H  -5.291  -5.224   7.097 1.00 . A A . 117 ALA HB2  1 1 
        5  7507 1 1  39 ALA HB3  H  -5.250  -6.928   6.638 1.00 . A A . 117 ALA HB3  1 1 
        5  7508 1 1  39 ALA N    N  -4.287  -6.788   4.416 1.00 . A A . 117 ALA N    1 1 
        5  7509 1 1  39 ALA O    O  -3.844  -3.380   5.252 1.00 . A A . 117 ALA O    1 1 
        5  7510 1 1  40 LEU C    C  -0.845  -3.564   4.766 1.00 . A A . 118 LEU C    1 1 
        5  7511 1 1  40 LEU CA   C  -1.343  -4.281   6.018 1.00 . A A . 118 LEU CA   1 1 
        5  7512 1 1  40 LEU CB   C  -0.218  -5.125   6.621 1.00 . A A . 118 LEU CB   1 1 
        5  7513 1 1  40 LEU CD1  C   1.762  -4.909   8.146 1.00 . A A . 118 LEU CD1  1 1 
        5  7514 1 1  40 LEU CD2  C   2.017  -4.468   5.697 1.00 . A A . 118 LEU CD2  1 1 
        5  7515 1 1  40 LEU CG   C   1.085  -4.370   6.895 1.00 . A A . 118 LEU CG   1 1 
        5  7516 1 1  40 LEU H    H  -2.404  -6.098   5.763 1.00 . A A . 118 LEU H    1 1 
        5  7517 1 1  40 LEU HA   H  -1.656  -3.544   6.741 1.00 . A A . 118 LEU HA   1 1 
        5  7518 1 1  40 LEU HB2  H  -0.570  -5.544   7.552 1.00 . A A . 118 LEU HB2  1 1 
        5  7519 1 1  40 LEU HB3  H   0.000  -5.936   5.941 1.00 . A A . 118 LEU HB3  1 1 
        5  7520 1 1  40 LEU HD11 H   2.372  -5.761   7.886 1.00 . A A . 118 LEU HD11 1 1 
        5  7521 1 1  40 LEU HD12 H   1.011  -5.208   8.861 1.00 . A A . 118 LEU HD12 1 1 
        5  7522 1 1  40 LEU HD13 H   2.384  -4.139   8.578 1.00 . A A . 118 LEU HD13 1 1 
        5  7523 1 1  40 LEU HD21 H   3.006  -4.142   5.983 1.00 . A A . 118 LEU HD21 1 1 
        5  7524 1 1  40 LEU HD22 H   1.648  -3.839   4.900 1.00 . A A . 118 LEU HD22 1 1 
        5  7525 1 1  40 LEU HD23 H   2.060  -5.492   5.357 1.00 . A A . 118 LEU HD23 1 1 
        5  7526 1 1  40 LEU HG   H   0.860  -3.326   7.061 1.00 . A A . 118 LEU HG   1 1 
        5  7527 1 1  40 LEU N    N  -2.495  -5.122   5.708 1.00 . A A . 118 LEU N    1 1 
        5  7528 1 1  40 LEU O    O  -0.682  -2.343   4.759 1.00 . A A . 118 LEU O    1 1 
        5  7529 1 1  41 LEU C    C  -1.180  -2.814   1.871 1.00 . A A . 119 LEU C    1 1 
        5  7530 1 1  41 LEU CA   C  -0.143  -3.772   2.446 1.00 . A A . 119 LEU CA   1 1 
        5  7531 1 1  41 LEU CB   C   0.148  -4.890   1.443 1.00 . A A . 119 LEU CB   1 1 
        5  7532 1 1  41 LEU CD1  C   1.244  -7.089   0.945 1.00 . A A . 119 LEU CD1  1 1 
        5  7533 1 1  41 LEU CD2  C   2.581  -5.224   1.937 1.00 . A A . 119 LEU CD2  1 1 
        5  7534 1 1  41 LEU CG   C   1.216  -5.892   1.883 1.00 . A A . 119 LEU CG   1 1 
        5  7535 1 1  41 LEU H    H  -0.771  -5.296   3.776 1.00 . A A . 119 LEU H    1 1 
        5  7536 1 1  41 LEU HA   H   0.768  -3.226   2.642 1.00 . A A . 119 LEU HA   1 1 
        5  7537 1 1  41 LEU HB2  H  -0.771  -5.430   1.262 1.00 . A A . 119 LEU HB2  1 1 
        5  7538 1 1  41 LEU HB3  H   0.469  -4.440   0.516 1.00 . A A . 119 LEU HB3  1 1 
        5  7539 1 1  41 LEU HD11 H   2.092  -7.713   1.182 1.00 . A A . 119 LEU HD11 1 1 
        5  7540 1 1  41 LEU HD12 H   1.324  -6.745  -0.076 1.00 . A A . 119 LEU HD12 1 1 
        5  7541 1 1  41 LEU HD13 H   0.334  -7.659   1.062 1.00 . A A . 119 LEU HD13 1 1 
        5  7542 1 1  41 LEU HD21 H   3.008  -5.196   0.945 1.00 . A A . 119 LEU HD21 1 1 
        5  7543 1 1  41 LEU HD22 H   3.230  -5.785   2.593 1.00 . A A . 119 LEU HD22 1 1 
        5  7544 1 1  41 LEU HD23 H   2.475  -4.217   2.311 1.00 . A A . 119 LEU HD23 1 1 
        5  7545 1 1  41 LEU HG   H   0.978  -6.251   2.874 1.00 . A A . 119 LEU HG   1 1 
        5  7546 1 1  41 LEU N    N  -0.614  -4.332   3.707 1.00 . A A . 119 LEU N    1 1 
        5  7547 1 1  41 LEU O    O  -0.838  -1.803   1.255 1.00 . A A . 119 LEU O    1 1 
        5  7548 1 1  42 GLY C    C  -3.619  -0.994   2.375 1.00 . A A . 120 GLY C    1 1 
        5  7549 1 1  42 GLY CA   C  -3.522  -2.295   1.605 1.00 . A A . 120 GLY CA   1 1 
        5  7550 1 1  42 GLY H    H  -2.654  -3.947   2.604 1.00 . A A . 120 GLY H    1 1 
        5  7551 1 1  42 GLY HA2  H  -3.348  -2.073   0.562 1.00 . A A . 120 GLY HA2  1 1 
        5  7552 1 1  42 GLY HA3  H  -4.457  -2.828   1.699 1.00 . A A . 120 GLY HA3  1 1 
        5  7553 1 1  42 GLY N    N  -2.449  -3.137   2.092 1.00 . A A . 120 GLY N    1 1 
        5  7554 1 1  42 GLY O    O  -3.627   0.086   1.787 1.00 . A A . 120 GLY O    1 1 
        5  7555 1 1  43 SER C    C  -2.658   1.057   4.284 1.00 . A A . 121 SER C    1 1 
        5  7556 1 1  43 SER CA   C  -3.789   0.072   4.561 1.00 . A A . 121 SER CA   1 1 
        5  7557 1 1  43 SER CB   C  -3.763  -0.349   6.032 1.00 . A A . 121 SER CB   1 1 
        5  7558 1 1  43 SER H    H  -3.679  -1.992   4.107 1.00 . A A . 121 SER H    1 1 
        5  7559 1 1  43 SER HA   H  -4.731   0.557   4.353 1.00 . A A . 121 SER HA   1 1 
        5  7560 1 1  43 SER HB2  H  -4.571  -1.040   6.220 1.00 . A A . 121 SER HB2  1 1 
        5  7561 1 1  43 SER HB3  H  -2.821  -0.830   6.250 1.00 . A A . 121 SER HB3  1 1 
        5  7562 1 1  43 SER HG   H  -4.655   1.304   6.590 1.00 . A A . 121 SER HG   1 1 
        5  7563 1 1  43 SER N    N  -3.691  -1.101   3.699 1.00 . A A . 121 SER N    1 1 
        5  7564 1 1  43 SER O    O  -2.846   2.272   4.373 1.00 . A A . 121 SER O    1 1 
        5  7565 1 1  43 SER OG   O  -3.913   0.772   6.886 1.00 . A A . 121 SER OG   1 1 
        5  7566 1 1  44 TYR C    C  -0.522   2.096   2.316 1.00 . A A . 122 TYR C    1 1 
        5  7567 1 1  44 TYR CA   C  -0.335   1.378   3.647 1.00 . A A . 122 TYR CA   1 1 
        5  7568 1 1  44 TYR CB   C   0.946   0.541   3.616 1.00 . A A . 122 TYR CB   1 1 
        5  7569 1 1  44 TYR CD1  C   1.677   1.249   5.927 1.00 . A A . 122 TYR CD1  1 1 
        5  7570 1 1  44 TYR CD2  C   1.855  -1.057   5.347 1.00 . A A . 122 TYR CD2  1 1 
        5  7571 1 1  44 TYR CE1  C   2.186   0.976   7.183 1.00 . A A . 122 TYR CE1  1 1 
        5  7572 1 1  44 TYR CE2  C   2.364  -1.337   6.601 1.00 . A A . 122 TYR CE2  1 1 
        5  7573 1 1  44 TYR CG   C   1.504   0.239   4.989 1.00 . A A . 122 TYR CG   1 1 
        5  7574 1 1  44 TYR CZ   C   2.528  -0.317   7.515 1.00 . A A . 122 TYR CZ   1 1 
        5  7575 1 1  44 TYR H    H  -1.388  -0.441   3.873 1.00 . A A . 122 TYR H    1 1 
        5  7576 1 1  44 TYR HA   H  -0.255   2.114   4.432 1.00 . A A . 122 TYR HA   1 1 
        5  7577 1 1  44 TYR HB2  H   0.742  -0.399   3.127 1.00 . A A . 122 TYR HB2  1 1 
        5  7578 1 1  44 TYR HB3  H   1.703   1.074   3.060 1.00 . A A . 122 TYR HB3  1 1 
        5  7579 1 1  44 TYR HD1  H   1.408   2.261   5.664 1.00 . A A . 122 TYR HD1  1 1 
        5  7580 1 1  44 TYR HD2  H   1.727  -1.853   4.629 1.00 . A A . 122 TYR HD2  1 1 
        5  7581 1 1  44 TYR HE1  H   2.313   1.775   7.898 1.00 . A A . 122 TYR HE1  1 1 
        5  7582 1 1  44 TYR HE2  H   2.632  -2.350   6.861 1.00 . A A . 122 TYR HE2  1 1 
        5  7583 1 1  44 TYR HH   H   3.686  -1.293   8.701 1.00 . A A . 122 TYR HH   1 1 
        5  7584 1 1  44 TYR N    N  -1.485   0.533   3.940 1.00 . A A . 122 TYR N    1 1 
        5  7585 1 1  44 TYR O    O  -0.301   3.303   2.215 1.00 . A A . 122 TYR O    1 1 
        5  7586 1 1  44 TYR OH   O   3.033  -0.592   8.765 1.00 . A A . 122 TYR OH   1 1 
        5  7587 1 1  45 THR C    C  -2.218   3.015   0.035 1.00 . A A . 123 THR C    1 1 
        5  7588 1 1  45 THR CA   C  -1.159   1.920  -0.025 1.00 . A A . 123 THR CA   1 1 
        5  7589 1 1  45 THR CB   C  -1.583   0.833  -1.013 1.00 . A A . 123 THR CB   1 1 
        5  7590 1 1  45 THR CG2  C  -1.559   1.291  -2.455 1.00 . A A . 123 THR CG2  1 1 
        5  7591 1 1  45 THR H    H  -1.099   0.391   1.439 1.00 . A A . 123 THR H    1 1 
        5  7592 1 1  45 THR HA   H  -0.228   2.357  -0.358 1.00 . A A . 123 THR HA   1 1 
        5  7593 1 1  45 THR HB   H  -2.592   0.523  -0.781 1.00 . A A . 123 THR HB   1 1 
        5  7594 1 1  45 THR HG1  H   0.180  -0.022  -0.999 1.00 . A A . 123 THR HG1  1 1 
        5  7595 1 1  45 THR HG21 H  -2.330   0.777  -3.009 1.00 . A A . 123 THR HG21 1 1 
        5  7596 1 1  45 THR HG22 H  -0.595   1.069  -2.888 1.00 . A A . 123 THR HG22 1 1 
        5  7597 1 1  45 THR HG23 H  -1.736   2.356  -2.497 1.00 . A A . 123 THR HG23 1 1 
        5  7598 1 1  45 THR N    N  -0.936   1.348   1.297 1.00 . A A . 123 THR N    1 1 
        5  7599 1 1  45 THR O    O  -2.107   4.037  -0.641 1.00 . A A . 123 THR O    1 1 
        5  7600 1 1  45 THR OG1  O  -0.735  -0.298  -0.908 1.00 . A A . 123 THR OG1  1 1 
        5  7601 1 1  46 ILE C    C  -3.767   5.074   1.595 1.00 . A A . 124 ILE C    1 1 
        5  7602 1 1  46 ILE CA   C  -4.313   3.774   1.013 1.00 . A A . 124 ILE CA   1 1 
        5  7603 1 1  46 ILE CB   C  -5.440   3.231   1.920 1.00 . A A . 124 ILE CB   1 1 
        5  7604 1 1  46 ILE CD1  C  -6.844   2.229   0.043 1.00 . A A . 124 ILE CD1  1 1 
        5  7605 1 1  46 ILE CG1  C  -6.051   1.968   1.306 1.00 . A A . 124 ILE CG1  1 1 
        5  7606 1 1  46 ILE CG2  C  -6.518   4.285   2.144 1.00 . A A . 124 ILE CG2  1 1 
        5  7607 1 1  46 ILE H    H  -3.271   1.969   1.378 1.00 . A A . 124 ILE H    1 1 
        5  7608 1 1  46 ILE HA   H  -4.727   3.974   0.035 1.00 . A A . 124 ILE HA   1 1 
        5  7609 1 1  46 ILE HB   H  -5.011   2.982   2.879 1.00 . A A . 124 ILE HB   1 1 
        5  7610 1 1  46 ILE HD11 H  -7.652   2.912   0.259 1.00 . A A . 124 ILE HD11 1 1 
        5  7611 1 1  46 ILE HD12 H  -7.248   1.298  -0.327 1.00 . A A . 124 ILE HD12 1 1 
        5  7612 1 1  46 ILE HD13 H  -6.197   2.662  -0.706 1.00 . A A . 124 ILE HD13 1 1 
        5  7613 1 1  46 ILE HG12 H  -5.260   1.277   1.061 1.00 . A A . 124 ILE HG12 1 1 
        5  7614 1 1  46 ILE HG13 H  -6.713   1.510   2.026 1.00 . A A . 124 ILE HG13 1 1 
        5  7615 1 1  46 ILE HG21 H  -6.056   5.228   2.396 1.00 . A A . 124 ILE HG21 1 1 
        5  7616 1 1  46 ILE HG22 H  -7.162   3.974   2.953 1.00 . A A . 124 ILE HG22 1 1 
        5  7617 1 1  46 ILE HG23 H  -7.102   4.398   1.244 1.00 . A A . 124 ILE HG23 1 1 
        5  7618 1 1  46 ILE N    N  -3.241   2.799   0.857 1.00 . A A . 124 ILE N    1 1 
        5  7619 1 1  46 ILE O    O  -4.021   6.156   1.069 1.00 . A A . 124 ILE O    1 1 
        5  7620 1 1  47 GLN C    C  -1.557   6.911   2.355 1.00 . A A . 125 GLN C    1 1 
        5  7621 1 1  47 GLN CA   C  -2.422   6.123   3.335 1.00 . A A . 125 GLN CA   1 1 
        5  7622 1 1  47 GLN CB   C  -1.584   5.685   4.539 1.00 . A A . 125 GLN CB   1 1 
        5  7623 1 1  47 GLN CD   C  -1.568   7.189   6.570 1.00 . A A . 125 GLN CD   1 1 
        5  7624 1 1  47 GLN CG   C  -0.895   6.835   5.258 1.00 . A A . 125 GLN CG   1 1 
        5  7625 1 1  47 GLN H    H  -2.843   4.068   3.056 1.00 . A A . 125 GLN H    1 1 
        5  7626 1 1  47 GLN HA   H  -3.227   6.755   3.677 1.00 . A A . 125 GLN HA   1 1 
        5  7627 1 1  47 GLN HB2  H  -2.226   5.181   5.246 1.00 . A A . 125 GLN HB2  1 1 
        5  7628 1 1  47 GLN HB3  H  -0.825   4.995   4.202 1.00 . A A . 125 GLN HB3  1 1 
        5  7629 1 1  47 GLN HE21 H  -1.414   9.127   6.155 1.00 . A A . 125 GLN HE21 1 1 
        5  7630 1 1  47 GLN HE22 H  -2.162   8.740   7.663 1.00 . A A . 125 GLN HE22 1 1 
        5  7631 1 1  47 GLN HG2  H   0.128   6.555   5.461 1.00 . A A . 125 GLN HG2  1 1 
        5  7632 1 1  47 GLN HG3  H  -0.909   7.704   4.618 1.00 . A A . 125 GLN HG3  1 1 
        5  7633 1 1  47 GLN N    N  -3.010   4.958   2.683 1.00 . A A . 125 GLN N    1 1 
        5  7634 1 1  47 GLN NE2  N  -1.731   8.482   6.821 1.00 . A A . 125 GLN NE2  1 1 
        5  7635 1 1  47 GLN O    O  -1.540   8.141   2.377 1.00 . A A . 125 GLN O    1 1 
        5  7636 1 1  47 GLN OE1  O  -1.936   6.309   7.349 1.00 . A A . 125 GLN OE1  1 1 
        5  7637 1 1  48 SER C    C  -0.775   7.339  -0.683 1.00 . A A . 126 SER C    1 1 
        5  7638 1 1  48 SER CA   C   0.028   6.822   0.509 1.00 . A A . 126 SER CA   1 1 
        5  7639 1 1  48 SER CB   C   1.089   5.829   0.030 1.00 . A A . 126 SER CB   1 1 
        5  7640 1 1  48 SER H    H  -0.897   5.215   1.534 1.00 . A A . 126 SER H    1 1 
        5  7641 1 1  48 SER HA   H   0.520   7.656   0.985 1.00 . A A . 126 SER HA   1 1 
        5  7642 1 1  48 SER HB2  H   1.715   5.545   0.863 1.00 . A A . 126 SER HB2  1 1 
        5  7643 1 1  48 SER HB3  H   0.603   4.952  -0.371 1.00 . A A . 126 SER HB3  1 1 
        5  7644 1 1  48 SER HG   H   1.440   6.379  -1.817 1.00 . A A . 126 SER HG   1 1 
        5  7645 1 1  48 SER N    N  -0.840   6.193   1.499 1.00 . A A . 126 SER N    1 1 
        5  7646 1 1  48 SER O    O  -0.330   8.236  -1.400 1.00 . A A . 126 SER O    1 1 
        5  7647 1 1  48 SER OG   O   1.905   6.401  -0.978 1.00 . A A . 126 SER OG   1 1 
        5  7648 1 1  49 GLU C    C  -3.606   8.395  -1.683 1.00 . A A . 127 GLU C    1 1 
        5  7649 1 1  49 GLU CA   C  -2.801   7.150  -2.017 1.00 . A A . 127 GLU CA   1 1 
        5  7650 1 1  49 GLU CB   C  -3.754   6.010  -2.387 1.00 . A A . 127 GLU CB   1 1 
        5  7651 1 1  49 GLU CD   C  -3.940   3.938  -3.819 1.00 . A A . 127 GLU CD   1 1 
        5  7652 1 1  49 GLU CG   C  -3.441   5.367  -3.728 1.00 . A A . 127 GLU CG   1 1 
        5  7653 1 1  49 GLU H    H  -2.242   6.038  -0.301 1.00 . A A . 127 GLU H    1 1 
        5  7654 1 1  49 GLU HA   H  -2.164   7.363  -2.862 1.00 . A A . 127 GLU HA   1 1 
        5  7655 1 1  49 GLU HB2  H  -3.697   5.248  -1.625 1.00 . A A . 127 GLU HB2  1 1 
        5  7656 1 1  49 GLU HB3  H  -4.766   6.395  -2.424 1.00 . A A . 127 GLU HB3  1 1 
        5  7657 1 1  49 GLU HG2  H  -3.911   5.946  -4.509 1.00 . A A . 127 GLU HG2  1 1 
        5  7658 1 1  49 GLU HG3  H  -2.371   5.369  -3.873 1.00 . A A . 127 GLU HG3  1 1 
        5  7659 1 1  49 GLU N    N  -1.951   6.757  -0.900 1.00 . A A . 127 GLU N    1 1 
        5  7660 1 1  49 GLU O    O  -3.761   9.291  -2.513 1.00 . A A . 127 GLU O    1 1 
        5  7661 1 1  49 GLU OE1  O  -4.149   3.313  -2.758 1.00 . A A . 127 GLU OE1  1 1 
        5  7662 1 1  49 GLU OE2  O  -4.123   3.444  -4.952 1.00 . A A . 127 GLU OE2  1 1 
        5  7663 1 1  50 LEU C    C  -4.297  10.361   1.062 1.00 . A A . 128 LEU C    1 1 
        5  7664 1 1  50 LEU CA   C  -4.971   9.536  -0.034 1.00 . A A . 128 LEU CA   1 1 
        5  7665 1 1  50 LEU CB   C  -6.291   8.975   0.474 1.00 . A A . 128 LEU CB   1 1 
        5  7666 1 1  50 LEU CD1  C  -6.954   6.586   0.099 1.00 . A A . 128 LEU CD1  1 1 
        5  7667 1 1  50 LEU CD2  C  -8.393   8.421  -0.785 1.00 . A A . 128 LEU CD2  1 1 
        5  7668 1 1  50 LEU CG   C  -6.970   7.989  -0.481 1.00 . A A . 128 LEU CG   1 1 
        5  7669 1 1  50 LEU H    H  -4.014   7.672   0.134 1.00 . A A . 128 LEU H    1 1 
        5  7670 1 1  50 LEU HA   H  -5.165  10.171  -0.884 1.00 . A A . 128 LEU HA   1 1 
        5  7671 1 1  50 LEU HB2  H  -6.093   8.462   1.406 1.00 . A A . 128 LEU HB2  1 1 
        5  7672 1 1  50 LEU HB3  H  -6.966   9.795   0.662 1.00 . A A . 128 LEU HB3  1 1 
        5  7673 1 1  50 LEU HD11 H  -7.144   6.636   1.160 1.00 . A A . 128 LEU HD11 1 1 
        5  7674 1 1  50 LEU HD12 H  -5.987   6.136  -0.074 1.00 . A A . 128 LEU HD12 1 1 
        5  7675 1 1  50 LEU HD13 H  -7.719   5.992  -0.378 1.00 . A A . 128 LEU HD13 1 1 
        5  7676 1 1  50 LEU HD21 H  -8.485   9.487  -0.644 1.00 . A A . 128 LEU HD21 1 1 
        5  7677 1 1  50 LEU HD22 H  -9.074   7.908  -0.121 1.00 . A A . 128 LEU HD22 1 1 
        5  7678 1 1  50 LEU HD23 H  -8.631   8.171  -1.809 1.00 . A A . 128 LEU HD23 1 1 
        5  7679 1 1  50 LEU HG   H  -6.421   7.968  -1.411 1.00 . A A . 128 LEU HG   1 1 
        5  7680 1 1  50 LEU N    N  -4.145   8.427  -0.475 1.00 . A A . 128 LEU N    1 1 
        5  7681 1 1  50 LEU O    O  -4.872  11.331   1.556 1.00 . A A . 128 LEU O    1 1 
        5  7682 1 1  51 GLY C    C  -2.825  10.345   3.868 1.00 . A A . 129 GLY C    1 1 
        5  7683 1 1  51 GLY CA   C  -2.368  10.716   2.471 1.00 . A A . 129 GLY CA   1 1 
        5  7684 1 1  51 GLY H    H  -2.657   9.207   1.014 1.00 . A A . 129 GLY H    1 1 
        5  7685 1 1  51 GLY HA2  H  -1.312  10.507   2.382 1.00 . A A . 129 GLY HA2  1 1 
        5  7686 1 1  51 GLY HA3  H  -2.528  11.773   2.320 1.00 . A A . 129 GLY HA3  1 1 
        5  7687 1 1  51 GLY N    N  -3.079   9.982   1.439 1.00 . A A . 129 GLY N    1 1 
        5  7688 1 1  51 GLY O    O  -2.439   9.303   4.397 1.00 . A A . 129 GLY O    1 1 
        5  7689 1 1  52 ASP C    C  -5.681  10.951   5.826 1.00 . A A . 130 ASP C    1 1 
        5  7690 1 1  52 ASP CA   C  -4.156  10.954   5.813 1.00 . A A . 130 ASP CA   1 1 
        5  7691 1 1  52 ASP CB   C  -3.630  12.016   6.780 1.00 . A A . 130 ASP CB   1 1 
        5  7692 1 1  52 ASP CG   C  -2.205  11.742   7.221 1.00 . A A . 130 ASP CG   1 1 
        5  7693 1 1  52 ASP H    H  -3.922  12.013   3.996 1.00 . A A . 130 ASP H    1 1 
        5  7694 1 1  52 ASP HA   H  -3.803   9.984   6.130 1.00 . A A . 130 ASP HA   1 1 
        5  7695 1 1  52 ASP HB2  H  -3.657  12.981   6.296 1.00 . A A . 130 ASP HB2  1 1 
        5  7696 1 1  52 ASP HB3  H  -4.260  12.039   7.657 1.00 . A A . 130 ASP HB3  1 1 
        5  7697 1 1  52 ASP N    N  -3.648  11.199   4.468 1.00 . A A . 130 ASP N    1 1 
        5  7698 1 1  52 ASP O    O  -6.321  11.358   4.856 1.00 . A A . 130 ASP O    1 1 
        5  7699 1 1  52 ASP OD1  O  -1.418  11.226   6.400 1.00 . A A . 130 ASP OD1  1 1 
        5  7700 1 1  52 ASP OD2  O  -1.877  12.042   8.388 1.00 . A A . 130 ASP OD2  1 1 
        5  7701 1 1  53 TYR C    C  -8.315  11.831   7.010 1.00 . A A . 131 TYR C    1 1 
        5  7702 1 1  53 TYR CA   C  -7.707  10.434   7.073 1.00 . A A . 131 TYR CA   1 1 
        5  7703 1 1  53 TYR CB   C  -8.085   9.759   8.392 1.00 . A A . 131 TYR CB   1 1 
        5  7704 1 1  53 TYR CD1  C -10.010   8.190   7.937 1.00 . A A . 131 TYR CD1  1 1 
        5  7705 1 1  53 TYR CD2  C -10.461  10.212   9.115 1.00 . A A . 131 TYR CD2  1 1 
        5  7706 1 1  53 TYR CE1  C -11.344   7.840   8.018 1.00 . A A . 131 TYR CE1  1 1 
        5  7707 1 1  53 TYR CE2  C -11.797   9.869   9.201 1.00 . A A . 131 TYR CE2  1 1 
        5  7708 1 1  53 TYR CG   C  -9.546   9.380   8.483 1.00 . A A . 131 TYR CG   1 1 
        5  7709 1 1  53 TYR CZ   C -12.233   8.682   8.650 1.00 . A A . 131 TYR CZ   1 1 
        5  7710 1 1  53 TYR H    H  -5.692  10.180   7.671 1.00 . A A . 131 TYR H    1 1 
        5  7711 1 1  53 TYR HA   H  -8.096   9.847   6.254 1.00 . A A . 131 TYR HA   1 1 
        5  7712 1 1  53 TYR HB2  H  -7.502   8.857   8.507 1.00 . A A . 131 TYR HB2  1 1 
        5  7713 1 1  53 TYR HB3  H  -7.864  10.431   9.208 1.00 . A A . 131 TYR HB3  1 1 
        5  7714 1 1  53 TYR HD1  H  -9.311   7.531   7.442 1.00 . A A . 131 TYR HD1  1 1 
        5  7715 1 1  53 TYR HD2  H -10.116  11.141   9.545 1.00 . A A . 131 TYR HD2  1 1 
        5  7716 1 1  53 TYR HE1  H -11.686   6.910   7.587 1.00 . A A . 131 TYR HE1  1 1 
        5  7717 1 1  53 TYR HE2  H -12.493  10.529   9.696 1.00 . A A . 131 TYR HE2  1 1 
        5  7718 1 1  53 TYR HH   H -13.786   8.137   9.645 1.00 . A A . 131 TYR HH   1 1 
        5  7719 1 1  53 TYR N    N  -6.257  10.490   6.932 1.00 . A A . 131 TYR N    1 1 
        5  7720 1 1  53 TYR O    O  -7.750  12.789   7.539 1.00 . A A . 131 TYR O    1 1 
        5  7721 1 1  53 TYR OH   O -13.563   8.337   8.733 1.00 . A A . 131 TYR OH   1 1 
        5  7722 1 1  54 ASP C    C -11.637  13.084   6.574 1.00 . A A . 132 ASP C    1 1 
        5  7723 1 1  54 ASP CA   C -10.155  13.221   6.230 1.00 . A A . 132 ASP CA   1 1 
        5  7724 1 1  54 ASP CB   C  -9.998  13.763   4.809 1.00 . A A . 132 ASP CB   1 1 
        5  7725 1 1  54 ASP CG   C  -8.778  14.651   4.660 1.00 . A A . 132 ASP CG   1 1 
        5  7726 1 1  54 ASP H    H  -9.871  11.140   5.961 1.00 . A A . 132 ASP H    1 1 
        5  7727 1 1  54 ASP HA   H  -9.699  13.913   6.922 1.00 . A A . 132 ASP HA   1 1 
        5  7728 1 1  54 ASP HB2  H  -9.903  12.935   4.123 1.00 . A A . 132 ASP HB2  1 1 
        5  7729 1 1  54 ASP HB3  H -10.875  14.340   4.551 1.00 . A A . 132 ASP HB3  1 1 
        5  7730 1 1  54 ASP N    N  -9.470  11.940   6.361 1.00 . A A . 132 ASP N    1 1 
        5  7731 1 1  54 ASP O    O -12.460  12.799   5.704 1.00 . A A . 132 ASP O    1 1 
        5  7732 1 1  54 ASP OD1  O  -7.718  14.303   5.221 1.00 . A A . 132 ASP OD1  1 1 
        5  7733 1 1  54 ASP OD2  O  -8.883  15.694   3.981 1.00 . A A . 132 ASP OD2  1 1 
        5  7734 1 1  55 PRO C    C -14.305  14.171   7.598 1.00 . A A . 133 PRO C    1 1 
        5  7735 1 1  55 PRO CA   C -13.389  13.181   8.309 1.00 . A A . 133 PRO CA   1 1 
        5  7736 1 1  55 PRO CB   C -13.309  13.509   9.805 1.00 . A A . 133 PRO CB   1 1 
        5  7737 1 1  55 PRO CD   C -11.082  13.625   8.955 1.00 . A A . 133 PRO CD   1 1 
        5  7738 1 1  55 PRO CG   C -11.884  13.281  10.177 1.00 . A A . 133 PRO CG   1 1 
        5  7739 1 1  55 PRO HA   H -13.773  12.180   8.178 1.00 . A A . 133 PRO HA   1 1 
        5  7740 1 1  55 PRO HB2  H -13.599  14.537   9.965 1.00 . A A . 133 PRO HB2  1 1 
        5  7741 1 1  55 PRO HB3  H -13.969  12.855  10.355 1.00 . A A . 133 PRO HB3  1 1 
        5  7742 1 1  55 PRO HD2  H -10.839  14.677   8.946 1.00 . A A . 133 PRO HD2  1 1 
        5  7743 1 1  55 PRO HD3  H -10.185  13.027   8.910 1.00 . A A . 133 PRO HD3  1 1 
        5  7744 1 1  55 PRO HG2  H -11.611  13.925  10.999 1.00 . A A . 133 PRO HG2  1 1 
        5  7745 1 1  55 PRO HG3  H -11.735  12.245  10.444 1.00 . A A . 133 PRO HG3  1 1 
        5  7746 1 1  55 PRO N    N -11.997  13.284   7.853 1.00 . A A . 133 PRO N    1 1 
        5  7747 1 1  55 PRO O    O -15.498  13.918   7.431 1.00 . A A . 133 PRO O    1 1 
        5  7748 1 1  56 GLU C    C -15.065  15.798   5.174 1.00 . A A . 134 GLU C    1 1 
        5  7749 1 1  56 GLU CA   C -14.505  16.328   6.489 1.00 . A A . 134 GLU CA   1 1 
        5  7750 1 1  56 GLU CB   C -13.629  17.554   6.226 1.00 . A A . 134 GLU CB   1 1 
        5  7751 1 1  56 GLU CD   C -11.114  17.785   6.315 1.00 . A A . 134 GLU CD   1 1 
        5  7752 1 1  56 GLU CG   C -12.303  17.223   5.561 1.00 . A A . 134 GLU CG   1 1 
        5  7753 1 1  56 GLU H    H -12.784  15.443   7.345 1.00 . A A . 134 GLU H    1 1 
        5  7754 1 1  56 GLU HA   H -15.328  16.615   7.127 1.00 . A A . 134 GLU HA   1 1 
        5  7755 1 1  56 GLU HB2  H -14.168  18.236   5.585 1.00 . A A . 134 GLU HB2  1 1 
        5  7756 1 1  56 GLU HB3  H -13.424  18.044   7.167 1.00 . A A . 134 GLU HB3  1 1 
        5  7757 1 1  56 GLU HG2  H -12.200  16.149   5.508 1.00 . A A . 134 GLU HG2  1 1 
        5  7758 1 1  56 GLU HG3  H -12.304  17.633   4.562 1.00 . A A . 134 GLU HG3  1 1 
        5  7759 1 1  56 GLU N    N -13.739  15.299   7.182 1.00 . A A . 134 GLU N    1 1 
        5  7760 1 1  56 GLU O    O -16.136  16.213   4.731 1.00 . A A . 134 GLU O    1 1 
        5  7761 1 1  56 GLU OE1  O -10.935  19.021   6.306 1.00 . A A . 134 GLU OE1  1 1 
        5  7762 1 1  56 GLU OE2  O -10.360  16.989   6.915 1.00 . A A . 134 GLU OE2  1 1 
        5  7763 1 1  57 LEU C    C -15.699  13.114   3.523 1.00 . A A . 135 LEU C    1 1 
        5  7764 1 1  57 LEU CA   C -14.758  14.291   3.288 1.00 . A A . 135 LEU CA   1 1 
        5  7765 1 1  57 LEU CB   C -13.541  13.833   2.481 1.00 . A A . 135 LEU CB   1 1 
        5  7766 1 1  57 LEU CD1  C -11.333  14.353   1.415 1.00 . A A . 135 LEU CD1  1 1 
        5  7767 1 1  57 LEU CD2  C -13.086  16.129   1.587 1.00 . A A . 135 LEU CD2  1 1 
        5  7768 1 1  57 LEU CG   C -12.475  14.905   2.253 1.00 . A A . 135 LEU CG   1 1 
        5  7769 1 1  57 LEU H    H -13.489  14.587   4.956 1.00 . A A . 135 LEU H    1 1 
        5  7770 1 1  57 LEU HA   H -15.283  15.051   2.730 1.00 . A A . 135 LEU HA   1 1 
        5  7771 1 1  57 LEU HB2  H -13.083  13.003   3.000 1.00 . A A . 135 LEU HB2  1 1 
        5  7772 1 1  57 LEU HB3  H -13.884  13.488   1.518 1.00 . A A . 135 LEU HB3  1 1 
        5  7773 1 1  57 LEU HD11 H -11.702  13.556   0.786 1.00 . A A . 135 LEU HD11 1 1 
        5  7774 1 1  57 LEU HD12 H -10.561  13.970   2.065 1.00 . A A . 135 LEU HD12 1 1 
        5  7775 1 1  57 LEU HD13 H -10.927  15.140   0.797 1.00 . A A . 135 LEU HD13 1 1 
        5  7776 1 1  57 LEU HD21 H -13.687  15.818   0.745 1.00 . A A . 135 LEU HD21 1 1 
        5  7777 1 1  57 LEU HD22 H -12.298  16.783   1.244 1.00 . A A . 135 LEU HD22 1 1 
        5  7778 1 1  57 LEU HD23 H -13.706  16.655   2.298 1.00 . A A . 135 LEU HD23 1 1 
        5  7779 1 1  57 LEU HG   H -12.071  15.210   3.208 1.00 . A A . 135 LEU HG   1 1 
        5  7780 1 1  57 LEU N    N -14.334  14.878   4.554 1.00 . A A . 135 LEU N    1 1 
        5  7781 1 1  57 LEU O    O -16.702  12.960   2.825 1.00 . A A . 135 LEU O    1 1 
        5  7782 1 1  58 HIS C    C -16.282  10.176   3.642 1.00 . A A . 136 HIS C    1 1 
        5  7783 1 1  58 HIS CA   C -16.186  11.123   4.834 1.00 . A A . 136 HIS CA   1 1 
        5  7784 1 1  58 HIS CB   C -17.586  11.561   5.267 1.00 . A A . 136 HIS CB   1 1 
        5  7785 1 1  58 HIS CD2  C -17.013  11.633   7.797 1.00 . A A . 136 HIS CD2  1 1 
        5  7786 1 1  58 HIS CE1  C -18.286  13.326   8.365 1.00 . A A . 136 HIS CE1  1 1 
        5  7787 1 1  58 HIS CG   C -17.648  12.058   6.678 1.00 . A A . 136 HIS CG   1 1 
        5  7788 1 1  58 HIS H    H -14.558  12.461   5.029 1.00 . A A . 136 HIS H    1 1 
        5  7789 1 1  58 HIS HA   H -15.712  10.604   5.654 1.00 . A A . 136 HIS HA   1 1 
        5  7790 1 1  58 HIS HB2  H -17.923  12.358   4.621 1.00 . A A . 136 HIS HB2  1 1 
        5  7791 1 1  58 HIS HB3  H -18.262  10.723   5.179 1.00 . A A . 136 HIS HB3  1 1 
        5  7792 1 1  58 HIS HD1  H -19.024  13.643   6.483 1.00 . A A . 136 HIS HD1  1 1 
        5  7793 1 1  58 HIS HD2  H -16.311  10.814   7.863 1.00 . A A . 136 HIS HD2  1 1 
        5  7794 1 1  58 HIS HE1  H -18.781  14.090   8.946 1.00 . A A . 136 HIS HE1  1 1 
        5  7795 1 1  58 HIS HE2  H -17.191  12.320   9.774 1.00 . A A . 136 HIS HE2  1 1 
        5  7796 1 1  58 HIS N    N -15.370  12.286   4.508 1.00 . A A . 136 HIS N    1 1 
        5  7797 1 1  58 HIS ND1  N -18.439  13.119   7.069 1.00 . A A . 136 HIS ND1  1 1 
        5  7798 1 1  58 HIS NE2  N -17.427  12.437   8.830 1.00 . A A . 136 HIS NE2  1 1 
        5  7799 1 1  58 HIS O    O -15.776  10.473   2.560 1.00 . A A . 136 HIS O    1 1 
        5  7800 1 1  59 GLY C    C -17.380   6.677   3.296 1.00 . A A . 137 GLY C    1 1 
        5  7801 1 1  59 GLY CA   C -17.084   8.066   2.780 1.00 . A A . 137 GLY CA   1 1 
        5  7802 1 1  59 GLY H    H -17.318   8.855   4.731 1.00 . A A . 137 GLY H    1 1 
        5  7803 1 1  59 GLY HA2  H -17.890   8.377   2.133 1.00 . A A . 137 GLY HA2  1 1 
        5  7804 1 1  59 GLY HA3  H -16.171   8.033   2.209 1.00 . A A . 137 GLY HA3  1 1 
        5  7805 1 1  59 GLY N    N -16.935   9.037   3.848 1.00 . A A . 137 GLY N    1 1 
        5  7806 1 1  59 GLY O    O -18.261   5.992   2.777 1.00 . A A . 137 GLY O    1 1 
        5  7807 1 1  60 VAL C    C -16.380   3.844   3.933 1.00 . A A . 138 VAL C    1 1 
        5  7808 1 1  60 VAL CA   C -16.814   4.940   4.905 1.00 . A A . 138 VAL CA   1 1 
        5  7809 1 1  60 VAL CB   C -18.281   4.708   5.331 1.00 . A A . 138 VAL CB   1 1 
        5  7810 1 1  60 VAL CG1  C -18.533   3.242   5.635 1.00 . A A . 138 VAL CG1  1 1 
        5  7811 1 1  60 VAL CG2  C -18.629   5.574   6.532 1.00 . A A . 138 VAL CG2  1 1 
        5  7812 1 1  60 VAL H    H -15.947   6.855   4.678 1.00 . A A . 138 VAL H    1 1 
        5  7813 1 1  60 VAL HA   H -16.193   4.886   5.788 1.00 . A A . 138 VAL HA   1 1 
        5  7814 1 1  60 VAL HB   H -18.923   4.995   4.513 1.00 . A A . 138 VAL HB   1 1 
        5  7815 1 1  60 VAL HG11 H -19.263   3.157   6.425 1.00 . A A . 138 VAL HG11 1 1 
        5  7816 1 1  60 VAL HG12 H -17.609   2.777   5.944 1.00 . A A . 138 VAL HG12 1 1 
        5  7817 1 1  60 VAL HG13 H -18.903   2.752   4.747 1.00 . A A . 138 VAL HG13 1 1 
        5  7818 1 1  60 VAL HG21 H -17.824   5.531   7.251 1.00 . A A . 138 VAL HG21 1 1 
        5  7819 1 1  60 VAL HG22 H -19.538   5.209   6.987 1.00 . A A . 138 VAL HG22 1 1 
        5  7820 1 1  60 VAL HG23 H -18.771   6.595   6.211 1.00 . A A . 138 VAL HG23 1 1 
        5  7821 1 1  60 VAL N    N -16.636   6.260   4.316 1.00 . A A . 138 VAL N    1 1 
        5  7822 1 1  60 VAL O    O -15.410   3.128   4.183 1.00 . A A . 138 VAL O    1 1 
        5  7823 1 1  61 ASP C    C -15.897   3.279   0.725 1.00 . A A . 139 ASP C    1 1 
        5  7824 1 1  61 ASP CA   C -16.793   2.707   1.821 1.00 . A A . 139 ASP CA   1 1 
        5  7825 1 1  61 ASP CB   C -18.082   2.158   1.206 1.00 . A A . 139 ASP CB   1 1 
        5  7826 1 1  61 ASP CG   C -18.819   1.224   2.145 1.00 . A A . 139 ASP CG   1 1 
        5  7827 1 1  61 ASP H    H -17.867   4.316   2.682 1.00 . A A . 139 ASP H    1 1 
        5  7828 1 1  61 ASP HA   H -16.269   1.902   2.313 1.00 . A A . 139 ASP HA   1 1 
        5  7829 1 1  61 ASP HB2  H -18.736   2.982   0.961 1.00 . A A . 139 ASP HB2  1 1 
        5  7830 1 1  61 ASP HB3  H -17.840   1.615   0.304 1.00 . A A . 139 ASP HB3  1 1 
        5  7831 1 1  61 ASP N    N -17.104   3.717   2.826 1.00 . A A . 139 ASP N    1 1 
        5  7832 1 1  61 ASP O    O -16.085   2.991  -0.457 1.00 . A A . 139 ASP O    1 1 
        5  7833 1 1  61 ASP OD1  O -18.317   0.106   2.387 1.00 . A A . 139 ASP OD1  1 1 
        5  7834 1 1  61 ASP OD2  O -19.899   1.611   2.640 1.00 . A A . 139 ASP OD2  1 1 
        5  7835 1 1  62 TYR C    C -12.977   3.671  -0.318 1.00 . A A . 140 TYR C    1 1 
        5  7836 1 1  62 TYR CA   C -13.997   4.694   0.171 1.00 . A A . 140 TYR CA   1 1 
        5  7837 1 1  62 TYR CB   C -13.281   5.888   0.805 1.00 . A A . 140 TYR CB   1 1 
        5  7838 1 1  62 TYR CD1  C -11.356   5.039   2.198 1.00 . A A . 140 TYR CD1  1 1 
        5  7839 1 1  62 TYR CD2  C -13.305   5.816   3.329 1.00 . A A . 140 TYR CD2  1 1 
        5  7840 1 1  62 TYR CE1  C -10.762   4.751   3.412 1.00 . A A . 140 TYR CE1  1 1 
        5  7841 1 1  62 TYR CE2  C -12.718   5.531   4.547 1.00 . A A . 140 TYR CE2  1 1 
        5  7842 1 1  62 TYR CG   C -12.635   5.575   2.136 1.00 . A A . 140 TYR CG   1 1 
        5  7843 1 1  62 TYR CZ   C -11.446   4.999   4.583 1.00 . A A . 140 TYR CZ   1 1 
        5  7844 1 1  62 TYR H    H -14.817   4.281   2.078 1.00 . A A . 140 TYR H    1 1 
        5  7845 1 1  62 TYR HA   H -14.574   5.039  -0.674 1.00 . A A . 140 TYR HA   1 1 
        5  7846 1 1  62 TYR HB2  H -12.507   6.232   0.135 1.00 . A A . 140 TYR HB2  1 1 
        5  7847 1 1  62 TYR HB3  H -13.994   6.684   0.961 1.00 . A A . 140 TYR HB3  1 1 
        5  7848 1 1  62 TYR HD1  H -10.822   4.846   1.280 1.00 . A A . 140 TYR HD1  1 1 
        5  7849 1 1  62 TYR HD2  H -14.302   6.232   3.297 1.00 . A A . 140 TYR HD2  1 1 
        5  7850 1 1  62 TYR HE1  H  -9.766   4.336   3.440 1.00 . A A . 140 TYR HE1  1 1 
        5  7851 1 1  62 TYR HE2  H -13.255   5.725   5.463 1.00 . A A . 140 TYR HE2  1 1 
        5  7852 1 1  62 TYR HH   H -11.073   5.405   6.425 1.00 . A A . 140 TYR HH   1 1 
        5  7853 1 1  62 TYR N    N -14.920   4.089   1.123 1.00 . A A . 140 TYR N    1 1 
        5  7854 1 1  62 TYR O    O -12.518   3.732  -1.458 1.00 . A A . 140 TYR O    1 1 
        5  7855 1 1  62 TYR OH   O -10.858   4.714   5.794 1.00 . A A . 140 TYR OH   1 1 
        5  7856 1 1  63 VAL C    C -12.195   0.814  -0.938 1.00 . A A . 141 VAL C    1 1 
        5  7857 1 1  63 VAL CA   C -11.673   1.682   0.206 1.00 . A A . 141 VAL CA   1 1 
        5  7858 1 1  63 VAL CB   C -11.359   0.782   1.416 1.00 . A A . 141 VAL CB   1 1 
        5  7859 1 1  63 VAL CG1  C -10.162  -0.108   1.123 1.00 . A A . 141 VAL CG1  1 1 
        5  7860 1 1  63 VAL CG2  C -11.113   1.623   2.660 1.00 . A A . 141 VAL CG2  1 1 
        5  7861 1 1  63 VAL H    H -13.036   2.726   1.444 1.00 . A A . 141 VAL H    1 1 
        5  7862 1 1  63 VAL HA   H -10.757   2.161  -0.108 1.00 . A A . 141 VAL HA   1 1 
        5  7863 1 1  63 VAL HB   H -12.214   0.148   1.600 1.00 . A A . 141 VAL HB   1 1 
        5  7864 1 1  63 VAL HG11 H  -9.275   0.500   1.030 1.00 . A A . 141 VAL HG11 1 1 
        5  7865 1 1  63 VAL HG12 H -10.330  -0.645   0.201 1.00 . A A . 141 VAL HG12 1 1 
        5  7866 1 1  63 VAL HG13 H -10.032  -0.813   1.931 1.00 . A A . 141 VAL HG13 1 1 
        5  7867 1 1  63 VAL HG21 H -10.633   1.018   3.415 1.00 . A A . 141 VAL HG21 1 1 
        5  7868 1 1  63 VAL HG22 H -12.055   1.990   3.039 1.00 . A A . 141 VAL HG22 1 1 
        5  7869 1 1  63 VAL HG23 H -10.476   2.459   2.409 1.00 . A A . 141 VAL HG23 1 1 
        5  7870 1 1  63 VAL N    N -12.632   2.725   0.551 1.00 . A A . 141 VAL N    1 1 
        5  7871 1 1  63 VAL O    O -11.429   0.112  -1.598 1.00 . A A . 141 VAL O    1 1 
        5  7872 1 1  64 SER C    C -13.623   0.508  -3.612 1.00 . A A . 142 SER C    1 1 
        5  7873 1 1  64 SER CA   C -14.144   0.105  -2.232 1.00 . A A . 142 SER CA   1 1 
        5  7874 1 1  64 SER CB   C -15.661   0.289  -2.176 1.00 . A A . 142 SER CB   1 1 
        5  7875 1 1  64 SER H    H -14.063   1.453  -0.612 1.00 . A A . 142 SER H    1 1 
        5  7876 1 1  64 SER HA   H -13.914  -0.937  -2.067 1.00 . A A . 142 SER HA   1 1 
        5  7877 1 1  64 SER HB2  H -16.140  -0.526  -2.697 1.00 . A A . 142 SER HB2  1 1 
        5  7878 1 1  64 SER HB3  H -15.982   0.296  -1.145 1.00 . A A . 142 SER HB3  1 1 
        5  7879 1 1  64 SER HG   H -15.524   2.228  -2.425 1.00 . A A . 142 SER HG   1 1 
        5  7880 1 1  64 SER N    N -13.504   0.874  -1.169 1.00 . A A . 142 SER N    1 1 
        5  7881 1 1  64 SER O    O -13.845  -0.200  -4.595 1.00 . A A . 142 SER O    1 1 
        5  7882 1 1  64 SER OG   O -16.050   1.509  -2.783 1.00 . A A . 142 SER OG   1 1 
        5  7883 1 1  65 ASP C    C -10.967   1.577  -5.170 1.00 . A A . 143 ASP C    1 1 
        5  7884 1 1  65 ASP CA   C -12.379   2.117  -4.949 1.00 . A A . 143 ASP CA   1 1 
        5  7885 1 1  65 ASP CB   C -12.365   3.648  -4.978 1.00 . A A . 143 ASP CB   1 1 
        5  7886 1 1  65 ASP CG   C -13.459   4.218  -5.860 1.00 . A A . 143 ASP CG   1 1 
        5  7887 1 1  65 ASP H    H -12.759   2.156  -2.870 1.00 . A A . 143 ASP H    1 1 
        5  7888 1 1  65 ASP HA   H -13.016   1.757  -5.743 1.00 . A A . 143 ASP HA   1 1 
        5  7889 1 1  65 ASP HB2  H -12.507   4.022  -3.975 1.00 . A A . 143 ASP HB2  1 1 
        5  7890 1 1  65 ASP HB3  H -11.411   3.988  -5.353 1.00 . A A . 143 ASP HB3  1 1 
        5  7891 1 1  65 ASP N    N -12.927   1.640  -3.685 1.00 . A A . 143 ASP N    1 1 
        5  7892 1 1  65 ASP O    O -10.518   1.435  -6.307 1.00 . A A . 143 ASP O    1 1 
        5  7893 1 1  65 ASP OD1  O -14.525   3.577  -5.973 1.00 . A A . 143 ASP OD1  1 1 
        5  7894 1 1  65 ASP OD2  O -13.249   5.305  -6.438 1.00 . A A . 143 ASP OD2  1 1 
        5  7895 1 1  66 PHE C    C  -8.907  -0.768  -4.116 1.00 . A A . 144 PHE C    1 1 
        5  7896 1 1  66 PHE CA   C  -8.911   0.757  -4.153 1.00 . A A . 144 PHE CA   1 1 
        5  7897 1 1  66 PHE CB   C  -8.066   1.310  -3.004 1.00 . A A . 144 PHE CB   1 1 
        5  7898 1 1  66 PHE CD1  C  -8.947   3.562  -2.337 1.00 . A A . 144 PHE CD1  1 1 
        5  7899 1 1  66 PHE CD2  C  -6.944   3.466  -3.627 1.00 . A A . 144 PHE CD2  1 1 
        5  7900 1 1  66 PHE CE1  C  -8.875   4.942  -2.321 1.00 . A A . 144 PHE CE1  1 1 
        5  7901 1 1  66 PHE CE2  C  -6.866   4.846  -3.615 1.00 . A A . 144 PHE CE2  1 1 
        5  7902 1 1  66 PHE CG   C  -7.984   2.810  -2.989 1.00 . A A . 144 PHE CG   1 1 
        5  7903 1 1  66 PHE CZ   C  -7.833   5.585  -2.961 1.00 . A A . 144 PHE CZ   1 1 
        5  7904 1 1  66 PHE H    H -10.681   1.415  -3.196 1.00 . A A . 144 PHE H    1 1 
        5  7905 1 1  66 PHE HA   H  -8.485   1.083  -5.090 1.00 . A A . 144 PHE HA   1 1 
        5  7906 1 1  66 PHE HB2  H  -8.494   0.991  -2.066 1.00 . A A . 144 PHE HB2  1 1 
        5  7907 1 1  66 PHE HB3  H  -7.062   0.922  -3.087 1.00 . A A . 144 PHE HB3  1 1 
        5  7908 1 1  66 PHE HD1  H  -9.762   3.061  -1.835 1.00 . A A . 144 PHE HD1  1 1 
        5  7909 1 1  66 PHE HD2  H  -6.188   2.889  -4.138 1.00 . A A . 144 PHE HD2  1 1 
        5  7910 1 1  66 PHE HE1  H  -9.632   5.518  -1.810 1.00 . A A . 144 PHE HE1  1 1 
        5  7911 1 1  66 PHE HE2  H  -6.050   5.345  -4.116 1.00 . A A . 144 PHE HE2  1 1 
        5  7912 1 1  66 PHE HZ   H  -7.774   6.663  -2.951 1.00 . A A . 144 PHE HZ   1 1 
        5  7913 1 1  66 PHE N    N -10.272   1.279  -4.076 1.00 . A A . 144 PHE N    1 1 
        5  7914 1 1  66 PHE O    O  -9.431  -1.378  -3.184 1.00 . A A . 144 PHE O    1 1 
        5  7915 1 1  67 LYS C    C  -7.144  -3.382  -4.319 1.00 . A A . 145 LYS C    1 1 
        5  7916 1 1  67 LYS CA   C  -8.240  -2.831  -5.227 1.00 . A A . 145 LYS CA   1 1 
        5  7917 1 1  67 LYS CB   C  -7.983  -3.260  -6.673 1.00 . A A . 145 LYS CB   1 1 
        5  7918 1 1  67 LYS CD   C  -7.106  -1.643  -8.389 1.00 . A A . 145 LYS CD   1 1 
        5  7919 1 1  67 LYS CE   C  -5.907  -0.808  -8.809 1.00 . A A . 145 LYS CE   1 1 
        5  7920 1 1  67 LYS CG   C  -6.744  -2.624  -7.285 1.00 . A A . 145 LYS CG   1 1 
        5  7921 1 1  67 LYS H    H  -7.916  -0.833  -5.850 1.00 . A A . 145 LYS H    1 1 
        5  7922 1 1  67 LYS HA   H  -9.191  -3.230  -4.907 1.00 . A A . 145 LYS HA   1 1 
        5  7923 1 1  67 LYS HB2  H  -7.861  -4.333  -6.700 1.00 . A A . 145 LYS HB2  1 1 
        5  7924 1 1  67 LYS HB3  H  -8.837  -2.989  -7.274 1.00 . A A . 145 LYS HB3  1 1 
        5  7925 1 1  67 LYS HD2  H  -7.464  -2.195  -9.245 1.00 . A A . 145 LYS HD2  1 1 
        5  7926 1 1  67 LYS HD3  H  -7.885  -0.985  -8.031 1.00 . A A . 145 LYS HD3  1 1 
        5  7927 1 1  67 LYS HE2  H  -5.007  -1.287  -8.452 1.00 . A A . 145 LYS HE2  1 1 
        5  7928 1 1  67 LYS HE3  H  -5.882  -0.754  -9.888 1.00 . A A . 145 LYS HE3  1 1 
        5  7929 1 1  67 LYS HG2  H  -6.203  -2.097  -6.513 1.00 . A A . 145 LYS HG2  1 1 
        5  7930 1 1  67 LYS HG3  H  -6.119  -3.402  -7.698 1.00 . A A . 145 LYS HG3  1 1 
        5  7931 1 1  67 LYS HZ1  H  -5.020   0.993  -8.231 1.00 . A A . 145 LYS HZ1  1 1 
        5  7932 1 1  67 LYS HZ2  H  -6.356   0.555  -7.291 1.00 . A A . 145 LYS HZ2  1 1 
        5  7933 1 1  67 LYS HZ3  H  -6.584   1.168  -8.851 1.00 . A A . 145 LYS HZ3  1 1 
        5  7934 1 1  67 LYS N    N  -8.313  -1.376  -5.138 1.00 . A A . 145 LYS N    1 1 
        5  7935 1 1  67 LYS NZ   N  -5.971   0.573  -8.257 1.00 . A A . 145 LYS NZ   1 1 
        5  7936 1 1  67 LYS O    O  -5.983  -3.474  -4.718 1.00 . A A . 145 LYS O    1 1 
        5  7937 1 1  68 LEU C    C  -6.418  -5.798  -2.300 1.00 . A A . 146 LEU C    1 1 
        5  7938 1 1  68 LEU CA   C  -6.569  -4.289  -2.134 1.00 . A A . 146 LEU CA   1 1 
        5  7939 1 1  68 LEU CB   C  -7.016  -3.969  -0.707 1.00 . A A . 146 LEU CB   1 1 
        5  7940 1 1  68 LEU CD1  C  -8.394  -2.476   0.758 1.00 . A A . 146 LEU CD1  1 1 
        5  7941 1 1  68 LEU CD2  C  -6.360  -1.571  -0.388 1.00 . A A . 146 LEU CD2  1 1 
        5  7942 1 1  68 LEU CG   C  -7.526  -2.544  -0.489 1.00 . A A . 146 LEU CG   1 1 
        5  7943 1 1  68 LEU H    H  -8.461  -3.647  -2.838 1.00 . A A . 146 LEU H    1 1 
        5  7944 1 1  68 LEU HA   H  -5.613  -3.822  -2.314 1.00 . A A . 146 LEU HA   1 1 
        5  7945 1 1  68 LEU HB2  H  -7.805  -4.657  -0.437 1.00 . A A . 146 LEU HB2  1 1 
        5  7946 1 1  68 LEU HB3  H  -6.178  -4.132  -0.045 1.00 . A A . 146 LEU HB3  1 1 
        5  7947 1 1  68 LEU HD11 H  -9.435  -2.451   0.471 1.00 . A A . 146 LEU HD11 1 1 
        5  7948 1 1  68 LEU HD12 H  -8.154  -1.583   1.316 1.00 . A A . 146 LEU HD12 1 1 
        5  7949 1 1  68 LEU HD13 H  -8.211  -3.345   1.373 1.00 . A A . 146 LEU HD13 1 1 
        5  7950 1 1  68 LEU HD21 H  -6.582  -0.820   0.356 1.00 . A A . 146 LEU HD21 1 1 
        5  7951 1 1  68 LEU HD22 H  -6.205  -1.095  -1.345 1.00 . A A . 146 LEU HD22 1 1 
        5  7952 1 1  68 LEU HD23 H  -5.467  -2.108  -0.104 1.00 . A A . 146 LEU HD23 1 1 
        5  7953 1 1  68 LEU HG   H  -8.133  -2.254  -1.335 1.00 . A A . 146 LEU HG   1 1 
        5  7954 1 1  68 LEU N    N  -7.521  -3.746  -3.097 1.00 . A A . 146 LEU N    1 1 
        5  7955 1 1  68 LEU O    O  -5.396  -6.373  -1.926 1.00 . A A . 146 LEU O    1 1 
        5  7956 1 1  69 ALA C    C  -8.572  -8.325  -3.963 1.00 . A A . 147 ALA C    1 1 
        5  7957 1 1  69 ALA CA   C  -7.414  -7.878  -3.074 1.00 . A A . 147 ALA CA   1 1 
        5  7958 1 1  69 ALA CB   C  -7.458  -8.609  -1.740 1.00 . A A . 147 ALA CB   1 1 
        5  7959 1 1  69 ALA H    H  -8.229  -5.926  -3.141 1.00 . A A . 147 ALA H    1 1 
        5  7960 1 1  69 ALA HA   H  -6.483  -8.126  -3.562 1.00 . A A . 147 ALA HA   1 1 
        5  7961 1 1  69 ALA HB1  H  -6.732  -9.409  -1.744 1.00 . A A . 147 ALA HB1  1 1 
        5  7962 1 1  69 ALA HB2  H  -8.445  -9.018  -1.584 1.00 . A A . 147 ALA HB2  1 1 
        5  7963 1 1  69 ALA HB3  H  -7.225  -7.917  -0.943 1.00 . A A . 147 ALA HB3  1 1 
        5  7964 1 1  69 ALA N    N  -7.440  -6.436  -2.862 1.00 . A A . 147 ALA N    1 1 
        5  7965 1 1  69 ALA O    O  -9.521  -7.573  -4.185 1.00 . A A . 147 ALA O    1 1 
        5  7966 1 1  70 PRO C    C -10.829 -10.439  -4.589 1.00 . A A . 148 PRO C    1 1 
        5  7967 1 1  70 PRO CA   C  -9.554 -10.106  -5.356 1.00 . A A . 148 PRO CA   1 1 
        5  7968 1 1  70 PRO CB   C  -8.921 -11.379  -5.917 1.00 . A A . 148 PRO CB   1 1 
        5  7969 1 1  70 PRO CD   C  -7.409 -10.523  -4.273 1.00 . A A . 148 PRO CD   1 1 
        5  7970 1 1  70 PRO CG   C  -7.933 -11.795  -4.883 1.00 . A A . 148 PRO CG   1 1 
        5  7971 1 1  70 PRO HA   H  -9.789  -9.429  -6.165 1.00 . A A . 148 PRO HA   1 1 
        5  7972 1 1  70 PRO HB2  H  -9.683 -12.130  -6.062 1.00 . A A . 148 PRO HB2  1 1 
        5  7973 1 1  70 PRO HB3  H  -8.438 -11.161  -6.858 1.00 . A A . 148 PRO HB3  1 1 
        5  7974 1 1  70 PRO HD2  H  -7.218 -10.662  -3.219 1.00 . A A . 148 PRO HD2  1 1 
        5  7975 1 1  70 PRO HD3  H  -6.512 -10.202  -4.781 1.00 . A A . 148 PRO HD3  1 1 
        5  7976 1 1  70 PRO HG2  H  -8.420 -12.398  -4.132 1.00 . A A . 148 PRO HG2  1 1 
        5  7977 1 1  70 PRO HG3  H  -7.128 -12.347  -5.345 1.00 . A A . 148 PRO HG3  1 1 
        5  7978 1 1  70 PRO N    N  -8.507  -9.561  -4.487 1.00 . A A . 148 PRO N    1 1 
        5  7979 1 1  70 PRO O    O -11.930 -10.365  -5.133 1.00 . A A . 148 PRO O    1 1 
        5  7980 1 1  71 ASN C    C -11.865 -10.262  -1.242 1.00 . A A . 149 ASN C    1 1 
        5  7981 1 1  71 ASN CA   C -11.812 -11.153  -2.480 1.00 . A A . 149 ASN CA   1 1 
        5  7982 1 1  71 ASN CB   C -11.739 -12.624  -2.065 1.00 . A A . 149 ASN CB   1 1 
        5  7983 1 1  71 ASN CG   C -13.101 -13.201  -1.735 1.00 . A A . 149 ASN CG   1 1 
        5  7984 1 1  71 ASN H    H  -9.768 -10.848  -2.943 1.00 . A A . 149 ASN H    1 1 
        5  7985 1 1  71 ASN HA   H -12.710 -10.996  -3.059 1.00 . A A . 149 ASN HA   1 1 
        5  7986 1 1  71 ASN HB2  H -11.312 -13.199  -2.874 1.00 . A A . 149 ASN HB2  1 1 
        5  7987 1 1  71 ASN HB3  H -11.108 -12.715  -1.193 1.00 . A A . 149 ASN HB3  1 1 
        5  7988 1 1  71 ASN HD21 H -13.806 -12.609  -3.498 1.00 . A A . 149 ASN HD21 1 1 
        5  7989 1 1  71 ASN HD22 H -14.932 -13.430  -2.476 1.00 . A A . 149 ASN HD22 1 1 
        5  7990 1 1  71 ASN N    N -10.672 -10.807  -3.321 1.00 . A A . 149 ASN N    1 1 
        5  7991 1 1  71 ASN ND2  N -14.042 -13.066  -2.663 1.00 . A A . 149 ASN ND2  1 1 
        5  7992 1 1  71 ASN O    O -11.731 -10.739  -0.114 1.00 . A A . 149 ASN O    1 1 
        5  7993 1 1  71 ASN OD1  O -13.307 -13.761  -0.658 1.00 . A A . 149 ASN OD1  1 1 
        5  7994 1 1  72 GLN C    C -13.403  -8.209   0.453 1.00 . A A . 150 GLN C    1 1 
        5  7995 1 1  72 GLN CA   C -12.130  -8.010  -0.362 1.00 . A A . 150 GLN CA   1 1 
        5  7996 1 1  72 GLN CB   C -12.074  -6.578  -0.897 1.00 . A A . 150 GLN CB   1 1 
        5  7997 1 1  72 GLN CD   C -11.343  -4.206  -0.431 1.00 . A A . 150 GLN CD   1 1 
        5  7998 1 1  72 GLN CG   C -11.724  -5.547   0.164 1.00 . A A . 150 GLN CG   1 1 
        5  7999 1 1  72 GLN H    H -12.159  -8.645  -2.381 1.00 . A A . 150 GLN H    1 1 
        5  8000 1 1  72 GLN HA   H -11.277  -8.178   0.279 1.00 . A A . 150 GLN HA   1 1 
        5  8001 1 1  72 GLN HB2  H -11.330  -6.526  -1.678 1.00 . A A . 150 GLN HB2  1 1 
        5  8002 1 1  72 GLN HB3  H -13.038  -6.323  -1.311 1.00 . A A . 150 GLN HB3  1 1 
        5  8003 1 1  72 GLN HE21 H  -9.685  -4.990  -1.197 1.00 . A A . 150 GLN HE21 1 1 
        5  8004 1 1  72 GLN HE22 H  -9.935  -3.310  -1.511 1.00 . A A . 150 GLN HE22 1 1 
        5  8005 1 1  72 GLN HG2  H -12.578  -5.408   0.809 1.00 . A A . 150 GLN HG2  1 1 
        5  8006 1 1  72 GLN HG3  H -10.892  -5.917   0.746 1.00 . A A . 150 GLN HG3  1 1 
        5  8007 1 1  72 GLN N    N -12.060  -8.966  -1.460 1.00 . A A . 150 GLN N    1 1 
        5  8008 1 1  72 GLN NE2  N -10.206  -4.164  -1.115 1.00 . A A . 150 GLN NE2  1 1 
        5  8009 1 1  72 GLN O    O -14.512  -8.060  -0.061 1.00 . A A . 150 GLN O    1 1 
        5  8010 1 1  72 GLN OE1  O -12.062  -3.219  -0.277 1.00 . A A . 150 GLN OE1  1 1 
        5  8011 1 1  73 THR C    C -14.423  -7.699   3.704 1.00 . A A . 151 THR C    1 1 
        5  8012 1 1  73 THR CA   C -14.370  -8.766   2.616 1.00 . A A . 151 THR CA   1 1 
        5  8013 1 1  73 THR CB   C -14.288 -10.155   3.250 1.00 . A A . 151 THR CB   1 1 
        5  8014 1 1  73 THR CG2  C -13.011 -10.383   4.028 1.00 . A A . 151 THR CG2  1 1 
        5  8015 1 1  73 THR H    H -12.325  -8.649   2.077 1.00 . A A . 151 THR H    1 1 
        5  8016 1 1  73 THR HA   H -15.271  -8.704   2.025 1.00 . A A . 151 THR HA   1 1 
        5  8017 1 1  73 THR HB   H -14.336 -10.900   2.468 1.00 . A A . 151 THR HB   1 1 
        5  8018 1 1  73 THR HG1  H -16.198 -10.326   3.644 1.00 . A A . 151 THR HG1  1 1 
        5  8019 1 1  73 THR HG21 H -12.543 -11.297   3.693 1.00 . A A . 151 THR HG21 1 1 
        5  8020 1 1  73 THR HG22 H -13.240 -10.460   5.080 1.00 . A A . 151 THR HG22 1 1 
        5  8021 1 1  73 THR HG23 H -12.338  -9.554   3.865 1.00 . A A . 151 THR HG23 1 1 
        5  8022 1 1  73 THR N    N -13.235  -8.546   1.727 1.00 . A A . 151 THR N    1 1 
        5  8023 1 1  73 THR O    O -13.443  -6.992   3.939 1.00 . A A . 151 THR O    1 1 
        5  8024 1 1  73 THR OG1  O -15.374 -10.368   4.134 1.00 . A A . 151 THR OG1  1 1 
        5  8025 1 1  74 LYS C    C -14.569  -6.578   6.378 1.00 . A A . 152 LYS C    1 1 
        5  8026 1 1  74 LYS CA   C -15.761  -6.598   5.425 1.00 . A A . 152 LYS CA   1 1 
        5  8027 1 1  74 LYS CB   C -17.047  -6.894   6.201 1.00 . A A . 152 LYS CB   1 1 
        5  8028 1 1  74 LYS CD   C -19.255  -5.774   5.740 1.00 . A A . 152 LYS CD   1 1 
        5  8029 1 1  74 LYS CE   C -20.376  -6.059   6.726 1.00 . A A . 152 LYS CE   1 1 
        5  8030 1 1  74 LYS CG   C -17.908  -5.663   6.440 1.00 . A A . 152 LYS CG   1 1 
        5  8031 1 1  74 LYS H    H -16.322  -8.172   4.124 1.00 . A A . 152 LYS H    1 1 
        5  8032 1 1  74 LYS HA   H -15.849  -5.627   4.961 1.00 . A A . 152 LYS HA   1 1 
        5  8033 1 1  74 LYS HB2  H -17.630  -7.615   5.647 1.00 . A A . 152 LYS HB2  1 1 
        5  8034 1 1  74 LYS HB3  H -16.787  -7.316   7.160 1.00 . A A . 152 LYS HB3  1 1 
        5  8035 1 1  74 LYS HD2  H -19.464  -4.844   5.233 1.00 . A A . 152 LYS HD2  1 1 
        5  8036 1 1  74 LYS HD3  H -19.210  -6.576   5.018 1.00 . A A . 152 LYS HD3  1 1 
        5  8037 1 1  74 LYS HE2  H -20.472  -7.128   6.843 1.00 . A A . 152 LYS HE2  1 1 
        5  8038 1 1  74 LYS HE3  H -20.121  -5.615   7.678 1.00 . A A . 152 LYS HE3  1 1 
        5  8039 1 1  74 LYS HG2  H -18.074  -5.553   7.501 1.00 . A A . 152 LYS HG2  1 1 
        5  8040 1 1  74 LYS HG3  H -17.388  -4.794   6.064 1.00 . A A . 152 LYS HG3  1 1 
        5  8041 1 1  74 LYS HZ1  H -21.558  -4.513   5.966 1.00 . A A . 152 LYS HZ1  1 1 
        5  8042 1 1  74 LYS HZ2  H -22.375  -5.539   7.034 1.00 . A A . 152 LYS HZ2  1 1 
        5  8043 1 1  74 LYS HZ3  H -22.037  -6.056   5.460 1.00 . A A . 152 LYS HZ3  1 1 
        5  8044 1 1  74 LYS N    N -15.575  -7.584   4.362 1.00 . A A . 152 LYS