NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
450180 2pxg 6797 cing 4-filtered-FRED STAR entry full 822


data_FRED_restraints_with_modified_coordinates_PDB_code_2pxg

# This FRED archive file contains, for PDB entry <2pxg>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, W Vranken, C Penkett, J Lin, CF Schulte, G Vuister, G Vriend,
# JL Markley, EL Ulrich. BioMagResBank database `NMR Restraints Grid` with
# curated sets of experimental NMR restraints for over 4,000 protein and nucleic
# acid PDB entries. (in preparation)




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.Sf_category          entry_information
    _Entry.ID                   1
    _Entry.Title                "Data for entry 1"
    _Entry.NMR_STAR_version     3.1.0.8
    _Entry.Experimental_method  NMR
    _Entry.Details              .

save_


save_assembly_2pxg
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2pxg
    _Assembly.Number_of_components  1
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "not present"
    _Assembly.Molecular_mass        13589.19

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $Outer_membrane_protein A . 1 1 
    stop_

save_


save_Outer_membrane_protein
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "Outer membrane protein"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  MAGSGIIYKQPIYQGNLIKQNAVEQLQVGQSKQQVSALLGTPSIPDPFHAQRWDYTSTQRVDRLARTEIKNFTVFFENEQVVRWEGDYFPSQDEQLAKAAPKQFGRNLARDKKKQRGR
    _Entity.Number_of_monomers           118

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

         1 MET . 1 1 
         2 ALA . 1 1 
         3 GLY . 1 1 
         4 SER . 1 1 
         5 GLY . 1 1 
         6 ILE . 1 1 
         7 ILE . 1 1 
         8 TYR . 1 1 
         9 LYS . 1 1 
        10 GLN . 1 1 
        11 PRO . 1 1 
        12 ILE . 1 1 
        13 TYR . 1 1 
        14 GLN . 1 1 
        15 GLY . 1 1 
        16 ASN . 1 1 
        17 LEU . 1 1 
        18 ILE . 1 1 
        19 LYS . 1 1 
        20 GLN . 1 1 
        21 ASN . 1 1 
        22 ALA . 1 1 
        23 VAL . 1 1 
        24 GLU . 1 1 
        25 GLN . 1 1 
        26 LEU . 1 1 
        27 GLN . 1 1 
        28 VAL . 1 1 
        29 GLY . 1 1 
        30 GLN . 1 1 
        31 SER . 1 1 
        32 LYS . 1 1 
        33 GLN . 1 1 
        34 GLN . 1 1 
        35 VAL . 1 1 
        36 SER . 1 1 
        37 ALA . 1 1 
        38 LEU . 1 1 
        39 LEU . 1 1 
        40 GLY . 1 1 
        41 THR . 1 1 
        42 PRO . 1 1 
        43 SER . 1 1 
        44 ILE . 1 1 
        45 PRO . 1 1 
        46 ASP . 1 1 
        47 PRO . 1 1 
        48 PHE . 1 1 
        49 HIS . 1 1 
        50 ALA . 1 1 
        51 GLN . 1 1 
        52 ARG . 1 1 
        53 TRP . 1 1 
        54 ASP . 1 1 
        55 TYR . 1 1 
        56 THR . 1 1 
        57 SER . 1 1 
        58 THR . 1 1 
        59 GLN . 1 1 
        60 ARG . 1 1 
        61 VAL . 1 1 
        62 ASP . 1 1 
        63 ARG . 1 1 
        64 LEU . 1 1 
        65 ALA . 1 1 
        66 ARG . 1 1 
        67 THR . 1 1 
        68 GLU . 1 1 
        69 ILE . 1 1 
        70 LYS . 1 1 
        71 ASN . 1 1 
        72 PHE . 1 1 
        73 THR . 1 1 
        74 VAL . 1 1 
        75 PHE . 1 1 
        76 PHE . 1 1 
        77 GLU . 1 1 
        78 ASN . 1 1 
        79 GLU . 1 1 
        80 GLN . 1 1 
        81 VAL . 1 1 
        82 VAL . 1 1 
        83 ARG . 1 1 
        84 TRP . 1 1 
        85 GLU . 1 1 
        86 GLY . 1 1 
        87 ASP . 1 1 
        88 TYR . 1 1 
        89 PHE . 1 1 
        90 PRO . 1 1 
        91 SER . 1 1 
        92 GLN . 1 1 
        93 ASP . 1 1 
        94 GLU . 1 1 
        95 GLN . 1 1 
        96 LEU . 1 1 
        97 ALA . 1 1 
        98 LYS . 1 1 
        99 ALA . 1 1 
       100 ALA . 1 1 
       101 PRO . 1 1 
       102 LYS . 1 1 
       103 GLN . 1 1 
       104 PHE . 1 1 
       105 GLY . 1 1 
       106 ARG . 1 1 
       107 ASN . 1 1 
       108 LEU . 1 1 
       109 ALA . 1 1 
       110 ARG . 1 1 
       111 ASP . 1 1 
       112 LYS . 1 1 
       113 LYS . 1 1 
       114 LYS . 1 1 
       115 GLN . 1 1 
       116 ARG . 1 1 
       117 GLY . 1 1 
       118 ARG . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       MET   1   1 1 1 
       ALA   2   2 1 1 
       GLY   3   3 1 1 
       SER   4   4 1 1 
       GLY   5   5 1 1 
       ILE   6   6 1 1 
       ILE   7   7 1 1 
       TYR   8   8 1 1 
       LYS   9   9 1 1 
       GLN  10  10 1 1 
       PRO  11  11 1 1 
       ILE  12  12 1 1 
       TYR  13  13 1 1 
       GLN  14  14 1 1 
       GLY  15  15 1 1 
       ASN  16  16 1 1 
       LEU  17  17 1 1 
       ILE  18  18 1 1 
       LYS  19  19 1 1 
       GLN  20  20 1 1 
       ASN  21  21 1 1 
       ALA  22  22 1 1 
       VAL  23  23 1 1 
       GLU  24  24 1 1 
       GLN  25  25 1 1 
       LEU  26  26 1 1 
       GLN  27  27 1 1 
       VAL  28  28 1 1 
       GLY  29  29 1 1 
       GLN  30  30 1 1 
       SER  31  31 1 1 
       LYS  32  32 1 1 
       GLN  33  33 1 1 
       GLN  34  34 1 1 
       VAL  35  35 1 1 
       SER  36  36 1 1 
       ALA  37  37 1 1 
       LEU  38  38 1 1 
       LEU  39  39 1 1 
       GLY  40  40 1 1 
       THR  41  41 1 1 
       PRO  42  42 1 1 
       SER  43  43 1 1 
       ILE  44  44 1 1 
       PRO  45  45 1 1 
       ASP  46  46 1 1 
       PRO  47  47 1 1 
       PHE  48  48 1 1 
       HIS  49  49 1 1 
       ALA  50  50 1 1 
       GLN  51  51 1 1 
       ARG  52  52 1 1 
       TRP  53  53 1 1 
       ASP  54  54 1 1 
       TYR  55  55 1 1 
       THR  56  56 1 1 
       SER  57  57 1 1 
       THR  58  58 1 1 
       GLN  59  59 1 1 
       ARG  60  60 1 1 
       VAL  61  61 1 1 
       ASP  62  62 1 1 
       ARG  63  63 1 1 
       LEU  64  64 1 1 
       ALA  65  65 1 1 
       ARG  66  66 1 1 
       THR  67  67 1 1 
       GLU  68  68 1 1 
       ILE  69  69 1 1 
       LYS  70  70 1 1 
       ASN  71  71 1 1 
       PHE  72  72 1 1 
       THR  73  73 1 1 
       VAL  74  74 1 1 
       PHE  75  75 1 1 
       PHE  76  76 1 1 
       GLU  77  77 1 1 
       ASN  78  78 1 1 
       GLU  79  79 1 1 
       GLN  80  80 1 1 
       VAL  81  81 1 1 
       VAL  82  82 1 1 
       ARG  83  83 1 1 
       TRP  84  84 1 1 
       GLU  85  85 1 1 
       GLY  86  86 1 1 
       ASP  87  87 1 1 
       TYR  88  88 1 1 
       PHE  89  89 1 1 
       PRO  90  90 1 1 
       SER  91  91 1 1 
       GLN  92  92 1 1 
       ASP  93  93 1 1 
       GLU  94  94 1 1 
       GLN  95  95 1 1 
       LEU  96  96 1 1 
       ALA  97  97 1 1 
       LYS  98  98 1 1 
       ALA  99  99 1 1 
       ALA 100 100 1 1 
       PRO 101 101 1 1 
       LYS 102 102 1 1 
       GLN 103 103 1 1 
       PHE 104 104 1 1 
       GLY 105 105 1 1 
       ARG 106 106 1 1 
       ASN 107 107 1 1 
       LEU 108 108 1 1 
       ALA 109 109 1 1 
       ARG 110 110 1 1 
       ASP 111 111 1 1 
       LYS 112 112 1 1 
       LYS 113 113 1 1 
       LYS 114 114 1 1 
       GLN 115 115 1 1 
       ARG 116 116 1 1 
       GLY 117 117 1 1 
       ARG 118 118 1 1 
    stop_

save_


save_Discover_distance_constraints_2_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

         1 1 . . . 1 1 
         2 1 . . . 1 1 
         3 1 . . . 1 1 
         4 1 . . . 1 1 
         5 1 . . . 1 1 
         6 1 . . . 1 1 
         7 1 . . . 1 1 
         8 1 . . . 1 1 
         9 1 . . . 1 1 
        10 1 . . . 1 1 
        11 1 . . . 1 1 
        12 1 . . . 1 1 
        13 1 . . . 1 1 
        14 1 . . . 1 1 
        15 1 . . . 1 1 
        16 1 . . . 1 1 
        17 1 . . . 1 1 
        18 1 . . . 1 1 
        19 1 . . . 1 1 
        20 1 . . . 1 1 
        21 1 . . . 1 1 
        22 1 . . . 1 1 
        23 1 . . . 1 1 
        24 1 . . . 1 1 
        25 1 . . . 1 1 
        26 1 . . . 1 1 
        27 1 . . . 1 1 
        28 1 . . . 1 1 
        29 1 . . . 1 1 
        30 1 . . . 1 1 
        31 1 . . . 1 1 
        32 1 . . . 1 1 
        33 1 . . . 1 1 
        34 1 . . . 1 1 
        35 1 . . . 1 1 
        36 1 . . . 1 1 
        37 1 . . . 1 1 
        38 1 . . . 1 1 
        39 1 . . . 1 1 
        40 1 . . . 1 1 
        41 1 . . . 1 1 
        42 1 . . . 1 1 
        43 1 . . . 1 1 
        44 1 . . . 1 1 
        45 1 . . . 1 1 
        46 1 . . . 1 1 
        47 1 . . . 1 1 
        48 1 . . . 1 1 
        49 1 . . . 1 1 
        50 1 . . . 1 1 
        51 1 . . . 1 1 
        52 1 . . . 1 1 
        53 1 . . . 1 1 
        54 1 . . . 1 1 
        55 1 . . . 1 1 
        56 1 . . . 1 1 
        57 1 . . . 1 1 
        58 1 . . . 1 1 
        59 1 . . . 1 1 
        60 1 . . . 1 1 
        61 1 . . . 1 1 
        62 1 . . . 1 1 
        63 1 . . . 1 1 
        64 1 . . . 1 1 
        65 1 . . . 1 1 
        66 1 . . . 1 1 
        67 1 . . . 1 1 
        68 1 . . . 1 1 
        69 1 . . . 1 1 
        70 1 . . . 1 1 
        71 1 . . . 1 1 
        72 1 . . . 1 1 
        73 1 . . . 1 1 
        74 1 . . . 1 1 
        75 1 . . . 1 1 
        76 1 . . . 1 1 
        77 1 . . . 1 1 
        78 1 . . . 1 1 
        79 1 . . . 1 1 
        80 1 . . . 1 1 
        81 1 . . . 1 1 
        82 1 . . . 1 1 
        83 1 . . . 1 1 
        84 1 . . . 1 1 
        85 1 . . . 1 1 
        86 1 . . . 1 1 
        87 1 . . . 1 1 
        88 1 . . . 1 1 
        89 1 . . . 1 1 
        90 1 . . . 1 1 
        91 1 . . . 1 1 
        92 1 . . . 1 1 
        93 1 . . . 1 1 
        94 1 . . . 1 1 
        95 1 . . . 1 1 
        96 1 . . . 1 1 
        97 1 . . . 1 1 
        98 1 . . . 1 1 
        99 1 . . . 1 1 
       100 1 . . . 1 1 
       101 1 . . . 1 1 
       102 1 . . . 1 1 
       103 1 . . . 1 1 
       104 1 . . . 1 1 
       105 1 . . . 1 1 
       106 1 . . . 1 1 
       107 1 . . . 1 1 
       108 1 . . . 1 1 
       109 1 . . . 1 1 
       110 1 . . . 1 1 
       111 1 . . . 1 1 
       112 1 . . . 1 1 
       113 1 . . . 1 1 
       114 1 . . . 1 1 
       115 1 . . . 1 1 
       116 1 . . . 1 1 
       117 1 . . . 1 1 
       118 1 . . . 1 1 
       119 1 . . . 1 1 
       120 1 . . . 1 1 
       121 1 . . . 1 1 
       122 1 . . . 1 1 
       123 1 . . . 1 1 
       124 1 . . . 1 1 
       125 1 . . . 1 1 
       126 1 . . . 1 1 
       127 1 . . . 1 1 
       128 1 . . . 1 1 
       129 1 . . . 1 1 
       130 1 . . . 1 1 
       131 1 . . . 1 1 
       132 1 . . . 1 1 
       133 1 . . . 1 1 
       134 1 . . . 1 1 
       135 1 . . . 1 1 
       136 1 . . . 1 1 
       137 1 . . . 1 1 
       138 1 . . . 1 1 
       139 1 . . . 1 1 
       140 1 . . . 1 1 
       141 1 . . . 1 1 
       142 1 . . . 1 1 
       143 1 . . . 1 1 
       144 1 . . . 1 1 
       145 1 . . . 1 1 
       146 1 . . . 1 1 
       147 1 . . . 1 1 
       148 1 . . . 1 1 
       149 1 . . . 1 1 
       150 1 . . . 1 1 
       151 1 . . . 1 1 
       152 1 . . . 1 1 
       153 1 . . . 1 1 
       154 1 . . . 1 1 
       155 1 . . . 1 1 
       156 1 . . . 1 1 
       157 1 . . . 1 1 
       158 1 . . . 1 1 
       159 1 . . . 1 1 
       160 1 . . . 1 1 
       161 1 . . . 1 1 
       162 1 . . . 1 1 
       163 1 . . . 1 1 
       164 1 . . . 1 1 
       165 1 . . . 1 1 
       166 1 . . . 1 1 
       167 1 . . . 1 1 
       168 1 . . . 1 1 
       169 1 . . . 1 1 
       170 1 . . . 1 1 
       171 1 . . . 1 1 
       172 1 . . . 1 1 
       173 1 . . . 1 1 
       174 1 . . . 1 1 
       175 1 . . . 1 1 
       176 1 . . . 1 1 
       177 1 . . . 1 1 
       178 1 . . . 1 1 
       179 1 . . . 1 1 
       180 1 . . . 1 1 
       181 1 . . . 1 1 
       182 1 . . . 1 1 
       183 1 . . . 1 1 
       184 1 . . . 1 1 
       185 1 . . . 1 1 
       186 1 . . . 1 1 
       187 1 . . . 1 1 
       188 1 . . . 1 1 
       189 1 . . . 1 1 
       190 1 . . . 1 1 
       191 1 . . . 1 1 
       192 1 . . . 1 1 
       193 1 . . . 1 1 
       194 1 . . . 1 1 
       195 1 . . . 1 1 
       196 1 . . . 1 1 
       197 1 . . . 1 1 
       198 1 . . . 1 1 
       199 1 . . . 1 1 
       200 1 . . . 1 1 
       201 1 . . . 1 1 
       202 1 . . . 1 1 
       203 1 . . . 1 1 
       204 1 . . . 1 1 
       205 1 . . . 1 1 
       206 1 . . . 1 1 
       207 1 . . . 1 1 
       208 1 . . . 1 1 
       209 1 . . . 1 1 
       210 1 . . . 1 1 
       211 1 . . . 1 1 
       212 1 . . . 1 1 
       213 1 . . . 1 1 
       214 1 . . . 1 1 
       215 1 . . . 1 1 
       216 1 . . . 1 1 
       217 1 . . . 1 1 
       218 1 . . . 1 1 
       219 1 . . . 1 1 
       220 1 . . . 1 1 
       221 1 . . . 1 1 
       222 1 . . . 1 1 
       223 1 . . . 1 1 
       224 1 . . . 1 1 
       225 1 . . . 1 1 
       226 1 . . . 1 1 
       227 1 . . . 1 1 
       228 1 . . . 1 1 
       229 1 . . . 1 1 
       230 1 . . . 1 1 
       231 1 . . . 1 1 
       232 1 . . . 1 1 
       233 1 . . . 1 1 
       234 1 . . . 1 1 
       235 1 . . . 1 1 
       236 1 . . . 1 1 
       237 1 . . . 1 1 
       238 1 . . . 1 1 
       239 1 . . . 1 1 
       240 1 . . . 1 1 
       241 1 . . . 1 1 
       242 1 . . . 1 1 
       243 1 . . . 1 1 
       244 1 . . . 1 1 
       245 1 . . . 1 1 
       246 1 . . . 1 1 
       247 1 . . . 1 1 
       248 1 . . . 1 1 
       249 1 . . . 1 1 
       250 1 . . . 1 1 
       251 1 . . . 1 1 
       252 1 . . . 1 1 
       253 1 . . . 1 1 
       254 1 . . . 1 1 
       255 1 . . . 1 1 
       256 1 . . . 1 1 
       257 1 . . . 1 1 
       258 1 . . . 1 1 
       259 1 . . . 1 1 
       260 1 . . . 1 1 
       261 1 . . . 1 1 
       262 1 . . . 1 1 
       263 1 . . . 1 1 
       264 1 . . . 1 1 
       265 1 . . . 1 1 
       266 1 . . . 1 1 
       267 1 . . . 1 1 
       268 1 . . . 1 1 
       269 1 . . . 1 1 
       270 1 . . . 1 1 
       271 1 . . . 1 1 
       272 1 . . . 1 1 
       273 1 . . . 1 1 
       274 1 . . . 1 1 
       275 1 . . . 1 1 
       276 1 . . . 1 1 
       277 1 . . . 1 1 
       278 1 . . . 1 1 
       279 1 . . . 1 1 
       280 1 . . . 1 1 
       281 1 . . . 1 1 
       282 1 . . . 1 1 
       283 1 . . . 1 1 
       284 1 . . . 1 1 
       285 1 . . . 1 1 
       286 1 . . . 1 1 
       287 1 . . . 1 1 
       288 1 . . . 1 1 
       289 1 . . . 1 1 
       290 1 . . . 1 1 
       291 1 . . . 1 1 
       292 1 . . . 1 1 
       293 1 . . . 1 1 
       294 1 . . . 1 1 
       295 1 . . . 1 1 
       296 1 . . . 1 1 
       297 1 . . . 1 1 
       298 1 . . . 1 1 
       299 1 . . . 1 1 
       300 1 . . . 1 1 
       301 1 . . . 1 1 
       302 1 . . . 1 1 
       303 1 . . . 1 1 
       304 1 . . . 1 1 
       305 1 . . . 1 1 
       306 1 . . . 1 1 
       307 1 . . . 1 1 
       308 1 . . . 1 1 
       309 1 . . . 1 1 
       310 1 . . . 1 1 
       311 1 . . . 1 1 
       312 1 . . . 1 1 
       313 1 . . . 1 1 
       314 1 . . . 1 1 
       315 1 . . . 1 1 
       316 1 . . . 1 1 
       317 1 . . . 1 1 
       318 1 . . . 1 1 
       319 1 . . . 1 1 
       320 1 . . . 1 1 
       321 1 . . . 1 1 
       322 1 . . . 1 1 
       323 1 . . . 1 1 
       324 1 . . . 1 1 
       325 1 . . . 1 1 
       326 1 . . . 1 1 
       327 1 . . . 1 1 
       328 1 . . . 1 1 
       329 1 . . . 1 1 
       330 1 . . . 1 1 
       331 1 . . . 1 1 
       332 1 . . . 1 1 
       333 1 . . . 1 1 
       334 1 . . . 1 1 
       335 1 . . . 1 1 
       336 1 . . . 1 1 
       337 1 . . . 1 1 
       338 1 . . . 1 1 
       339 1 . . . 1 1 
       340 1 . . . 1 1 
       341 1 . . . 1 1 
       342 1 . . . 1 1 
       343 1 . . . 1 1 
       344 1 . . . 1 1 
       345 1 . . . 1 1 
       346 1 . . . 1 1 
       347 1 . . . 1 1 
       348 1 . . . 1 1 
       349 1 . . . 1 1 
       350 1 . . . 1 1 
       351 1 . . . 1 1 
       352 1 . . . 1 1 
       353 1 . . . 1 1 
       354 1 . . . 1 1 
       355 1 . . . 1 1 
       356 1 . . . 1 1 
       357 1 . . . 1 1 
       358 1 . . . 1 1 
       359 1 . . . 1 1 
       360 1 . . . 1 1 
       361 1 . . . 1 1 
       362 1 . . . 1 1 
       363 1 . . . 1 1 
       364 1 . . . 1 1 
       365 1 . . . 1 1 
       366 1 . . . 1 1 
       367 1 . . . 1 1 
       368 1 . . . 1 1 
       369 1 . . . 1 1 
       370 1 . . . 1 1 
       371 1 . . . 1 1 
       372 1 . . . 1 1 
       373 1 . . . 1 1 
       374 1 . . . 1 1 
       375 1 . . . 1 1 
       376 1 . . . 1 1 
       377 1 . . . 1 1 
       378 1 . . . 1 1 
       379 1 . . . 1 1 
       380 1 . . . 1 1 
       381 1 . . . 1 1 
       382 1 . . . 1 1 
       383 1 . . . 1 1 
       384 1 . . . 1 1 
       385 1 . . . 1 1 
       386 1 . . . 1 1 
       387 1 . . . 1 1 
       388 1 . . . 1 1 
       389 1 . . . 1 1 
       390 1 . . . 1 1 
       391 1 . . . 1 1 
       392 1 . . . 1 1 
       393 1 . . . 1 1 
       394 1 . . . 1 1 
       395 1 . . . 1 1 
       396 1 . . . 1 1 
       397 1 . . . 1 1 
       398 1 . . . 1 1 
       399 1 . . . 1 1 
       400 1 . . . 1 1 
       401 1 . . . 1 1 
       402 1 . . . 1 1 
       403 1 . . . 1 1 
       404 1 . . . 1 1 
       405 1 . . . 1 1 
       406 1 . . . 1 1 
       407 1 . . . 1 1 
       408 1 . . . 1 1 
       409 1 . . . 1 1 
       410 1 . . . 1 1 
       411 1 . . . 1 1 
       412 1 . . . 1 1 
       413 1 . . . 1 1 
       414 1 . . . 1 1 
       415 1 . . . 1 1 
       416 1 . . . 1 1 
       417 1 . . . 1 1 
       418 1 . . . 1 1 
       419 1 . . . 1 1 
       420 1 . . . 1 1 
       421 1 . . . 1 1 
       422 1 . . . 1 1 
       423 1 . . . 1 1 
       424 1 . . . 1 1 
       425 1 . . . 1 1 
       426 1 . . . 1 1 
       427 1 . . . 1 1 
       428 1 . . . 1 1 
       429 1 . . . 1 1 
       430 1 . . . 1 1 
       431 1 . . . 1 1 
       432 1 . . . 1 1 
       433 1 . . . 1 1 
       434 1 . . . 1 1 
       435 1 . . . 1 1 
       436 1 . . . 1 1 
       437 1 . . . 1 1 
       438 1 . . . 1 1 
       439 1 . . . 1 1 
       440 1 . . . 1 1 
       441 1 . . . 1 1 
       442 1 . . . 1 1 
       443 1 . . . 1 1 
       444 1 . . . 1 1 
       445 1 . . . 1 1 
       446 1 . . . 1 1 
       447 1 . . . 1 1 
       448 1 . . . 1 1 
       449 1 . . . 1 1 
       450 1 . . . 1 1 
       451 1 . . . 1 1 
       452 1 . . . 1 1 
       453 1 . . . 1 1 
       454 1 . . . 1 1 
       455 1 . . . 1 1 
       456 1 . . . 1 1 
       457 1 . . . 1 1 
       458 1 . . . 1 1 
       459 1 . . . 1 1 
       460 1 . . . 1 1 
       461 1 . . . 1 1 
       462 1 . . . 1 1 
       463 1 . . . 1 1 
       464 1 . . . 1 1 
       465 1 . . . 1 1 
       466 1 . . . 1 1 
       467 1 . . . 1 1 
       468 1 . . . 1 1 
       469 1 . . . 1 1 
       470 1 . . . 1 1 
       471 1 . . . 1 1 
       472 1 . . . 1 1 
       473 1 . . . 1 1 
       474 1 . . . 1 1 
       475 1 . . . 1 1 
       476 1 . . . 1 1 
       477 1 . . . 1 1 
       478 1 . . . 1 1 
       479 1 . . . 1 1 
       480 1 . . . 1 1 
       481 1 . . . 1 1 
       482 1 . . . 1 1 
       483 1 . . . 1 1 
       484 1 . . . 1 1 
       485 1 . . . 1 1 
       486 1 . . . 1 1 
       487 1 . . . 1 1 
       488 1 . . . 1 1 
       489 1 . . . 1 1 
       490 1 . . . 1 1 
       491 1 . . . 1 1 
       492 1 . . . 1 1 
       493 1 . . . 1 1 
       494 1 . . . 1 1 
       495 1 . . . 1 1 
       496 1 . . . 1 1 
       497 1 . . . 1 1 
       498 1 . . . 1 1 
       499 1 . . . 1 1 
       500 1 . . . 1 1 
       501 1 . . . 1 1 
       502 1 . . . 1 1 
       503 1 . . . 1 1 
       504 1 . . . 1 1 
       505 1 . . . 1 1 
       506 1 . . . 1 1 
       507 1 . . . 1 1 
       508 1 . . . 1 1 
       509 1 . . . 1 1 
       510 1 . . . 1 1 
       511 1 . . . 1 1 
       512 1 . . . 1 1 
       513 1 . . . 1 1 
       514 1 . . . 1 1 
       515 1 . . . 1 1 
       516 1 . . . 1 1 
       517 1 . . . 1 1 
       518 1 . . . 1 1 
       519 1 . . . 1 1 
       520 1 . . . 1 1 
       521 1 . . . 1 1 
       522 1 . . . 1 1 
       523 1 . . . 1 1 
       524 1 . . . 1 1 
       525 1 . . . 1 1 
       526 1 . . . 1 1 
       527 1 . . . 1 1 
       528 1 . . . 1 1 
       529 1 . . . 1 1 
       530 1 . . . 1 1 
       531 1 . . . 1 1 
       532 1 . . . 1 1 
       533 1 . . . 1 1 
       534 1 . . . 1 1 
       535 1 . . . 1 1 
       536 1 . . . 1 1 
       537 1 . . . 1 1 
       538 1 . . . 1 1 
       539 1 . . . 1 1 
       540 1 . . . 1 1 
       541 1 . . . 1 1 
       542 1 . . . 1 1 
       543 1 . . . 1 1 
       544 1 . . . 1 1 
       545 1 . . . 1 1 
       546 1 . . . 1 1 
       547 1 . . . 1 1 
       548 1 . . . 1 1 
       549 1 . . . 1 1 
       550 1 . . . 1 1 
       551 1 . . . 1 1 
       552 1 . . . 1 1 
       553 1 . . . 1 1 
       554 1 . . . 1 1 
       555 1 . . . 1 1 
       556 1 . . . 1 1 
       557 1 . . . 1 1 
       558 1 . . . 1 1 
       559 1 . . . 1 1 
       560 1 . . . 1 1 
       561 1 . . . 1 1 
       562 1 . . . 1 1 
       563 1 . . . 1 1 
       564 1 . . . 1 1 
       565 1 . . . 1 1 
       566 1 . . . 1 1 
       567 1 . . . 1 1 
       568 1 . . . 1 1 
       569 1 . . . 1 1 
       570 1 . . . 1 1 
       571 1 . . . 1 1 
       572 1 . . . 1 1 
       573 1 . . . 1 1 
       574 1 . . . 1 1 
       575 1 . . . 1 1 
       576 1 . . . 1 1 
       577 1 . . . 1 1 
       578 1 . . . 1 1 
       579 1 . . . 1 1 
       580 1 . . . 1 1 
       581 1 . . . 1 1 
       582 1 . . . 1 1 
       583 1 . . . 1 1 
       584 1 . . . 1 1 
       585 1 . . . 1 1 
       586 1 . . . 1 1 
       587 1 . . . 1 1 
       588 1 . . . 1 1 
       589 1 . . . 1 1 
       590 1 . . . 1 1 
       591 1 . . . 1 1 
       592 1 . . . 1 1 
       593 1 . . . 1 1 
       594 1 . . . 1 1 
       595 1 . . . 1 1 
       596 1 . . . 1 1 
       597 1 . . . 1 1 
       598 1 . . . 1 1 
       599 1 . . . 1 1 
       600 1 . . . 1 1 
       601 1 . . . 1 1 
       602 1 . . . 1 1 
       603 1 . . . 1 1 
       604 1 . . . 1 1 
       605 1 . . . 1 1 
       606 1 . . . 1 1 
       607 1 . . . 1 1 
       608 1 . . . 1 1 
       609 1 . . . 1 1 
       610 1 . . . 1 1 
       611 1 . . . 1 1 
       612 1 . . . 1 1 
       613 1 . . . 1 1 
       614 1 . . . 1 1 
       615 1 . . . 1 1 
       616 1 . . . 1 1 
       617 1 . . . 1 1 
       618 1 . . . 1 1 
       619 1 . . . 1 1 
       620 1 . . . 1 1 
       621 1 . . . 1 1 
       622 1 . . . 1 1 
       623 1 . . . 1 1 
       624 1 . . . 1 1 
       625 1 . . . 1 1 
       626 1 . . . 1 1 
       627 1 . . . 1 1 
       628 1 . . . 1 1 
       629 1 . . . 1 1 
       630 1 . . . 1 1 
       631 1 . . . 1 1 
       632 1 . . . 1 1 
       633 1 . . . 1 1 
       634 1 . . . 1 1 
       635 1 . . . 1 1 
       636 1 . . . 1 1 
       637 1 . . . 1 1 
       638 1 . . . 1 1 
       639 1 . . . 1 1 
       640 1 . . . 1 1 
       641 1 . . . 1 1 
       642 1 . . . 1 1 
       643 1 . . . 1 1 
       644 1 . . . 1 1 
       645 1 . . . 1 1 
       646 1 . . . 1 1 
       647 1 . . . 1 1 
       648 1 . . . 1 1 
       649 1 . . . 1 1 
       650 1 . . . 1 1 
       651 1 . . . 1 1 
       652 1 . . . 1 1 
       653 1 . . . 1 1 
       654 1 . . . 1 1 
       655 1 . . . 1 1 
       656 1 . . . 1 1 
       657 1 . . . 1 1 
       658 1 . . . 1 1 
       659 1 . . . 1 1 
       660 1 . . . 1 1 
       661 1 . . . 1 1 
       662 1 . . . 1 1 
       663 1 . . . 1 1 
       664 1 . . . 1 1 
       665 1 . . . 1 1 
       666 1 . . . 1 1 
       667 1 . . . 1 1 
       668 1 . . . 1 1 
       669 1 . . . 1 1 
       670 1 . . . 1 1 
       671 1 . . . 1 1 
       672 1 . . . 1 1 
       673 1 . . . 1 1 
       674 1 . . . 1 1 
       675 1 . . . 1 1 
       676 1 . . . 1 1 
       677 1 . . . 1 1 
       678 1 . . . 1 1 
       679 1 . . . 1 1 
       680 1 . . . 1 1 
       681 1 . . . 1 1 
       682 1 . . . 1 1 
       683 1 . . . 1 1 
       684 1 . . . 1 1 
       685 1 . . . 1 1 
       686 1 . . . 1 1 
       687 1 . . . 1 1 
       688 1 . . . 1 1 
       689 1 . . . 1 1 
       690 1 . . . 1 1 
       691 1 . . . 1 1 
       692 1 . . . 1 1 
       693 1 . . . 1 1 
       694 1 . . . 1 1 
       695 1 . . . 1 1 
       696 1 . . . 1 1 
       697 1 . . . 1 1 
       698 1 . . . 1 1 
       699 1 . . . 1 1 
       700 1 . . . 1 1 
       701 1 . . . 1 1 
       702 1 . . . 1 1 
       703 1 . . . 1 1 
       704 1 . . . 1 1 
       705 1 . . . 1 1 
       706 1 . . . 1 1 
       707 1 . . . 1 1 
       708 1 . . . 1 1 
       709 1 . . . 1 1 
       710 1 . . . 1 1 
       711 1 . . . 1 1 
       712 1 . . . 1 1 
       713 1 . . . 1 1 
       714 1 . . . 1 1 
       715 1 . . . 1 1 
       716 1 . . . 1 1 
       717 1 . . . 1 1 
       718 1 . . . 1 1 
       719 1 . . . 1 1 
       720 1 . . . 1 1 
       721 1 . . . 1 1 
       722 1 . . . 1 1 
       723 1 . . . 1 1 
       724 1 . . . 1 1 
       725 1 . . . 1 1 
       726 1 . . . 1 1 
       727 1 . . . 1 1 
       728 1 . . . 1 1 
       729 1 . . . 1 1 
       730 1 . . . 1 1 
       731 1 . . . 1 1 
       732 1 . . . 1 1 
       733 1 . . . 1 1 
       734 1 . . . 1 1 
       735 1 . . . 1 1 
       736 1 . . . 1 1 
       737 1 . . . 1 1 
       738 1 . . . 1 1 
       739 1 . . . 1 1 
       740 1 . . . 1 1 
       741 1 . . . 1 1 
       742 1 . . . 1 1 
       743 1 . . . 1 1 
       744 1 . . . 1 1 
       745 1 . . . 1 1 
       746 1 . . . 1 1 
       747 1 . . . 1 1 
       748 1 . . . 1 1 
       749 1 . . . 1 1 
       750 1 . . . 1 1 
       751 1 . . . 1 1 
       752 1 . . . 1 1 
       753 1 . . . 1 1 
       754 1 . . . 1 1 
       755 1 . . . 1 1 
       756 1 . . . 1 1 
       757 1 . . . 1 1 
       758 1 . . . 1 1 
       759 1 . . . 1 1 
       760 1 . . . 1 1 
       761 1 . . . 1 1 
       762 1 . . . 1 1 
       763 1 . . . 1 1 
       764 1 . . . 1 1 
       765 1 . . . 1 1 
       766 1 . . . 1 1 
       767 1 . . . 1 1 
       768 1 . . . 1 1 
       769 1 . . . 1 1 
       770 1 . . . 1 1 
       771 1 . . . 1 1 
       772 1 . . . 1 1 
       773 1 . . . 1 1 
       774 1 . . . 1 1 
       775 1 . . . 1 1 
       776 1 . . . 1 1 
       777 1 . . . 1 1 
       778 1 . . . 1 1 
       779 1 . . . 1 1 
       780 1 . . . 1 1 
       781 1 . . . 1 1 
       782 1 . . . 1 1 
       783 1 . . . 1 1 
       784 1 . . . 1 1 
       785 1 . . . 1 1 
       786 1 . . . 1 1 
       787 1 . . . 1 1 
       788 1 . . . 1 1 
       789 1 . . . 1 1 
       790 1 . . . 1 1 
       791 1 . . . 1 1 
       792 1 . . . 1 1 
       793 1 . . . 1 1 
       794 1 . . . 1 1 
       795 1 . . . 1 1 
       796 1 . . . 1 1 
       797 1 . . . 1 1 
       798 1 . . . 1 1 
       799 1 . . . 1 1 
       800 1 . . . 1 1 
       801 1 . . . 1 1 
       802 1 . . . 1 1 
       803 1 . . . 1 1 
       804 1 . . . 1 1 
       805 1 . . . 1 1 
       806 1 . . . 1 1 
       807 1 . . . 1 1 
       808 1 . . . 1 1 
       809 1 . . . 1 1 
       810 1 . . . 1 1 
       811 1 . . . 1 1 
       812 1 . . . 1 1 
       813 1 . . . 1 1 
       814 1 . . . 1 1 
       815 1 . . . 1 1 
       816 1 . . . 1 1 
       817 1 . . . 1 1 
       818 1 . . . 1 1 
       819 1 . . . 1 1 
       820 1 . . . 1 1 
       821 1 . . . 1 1 
       822 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

         1 1 1 1 1   1 MET HA   1   1 METN HA   1 1 
         1 1 2 1 1   2 ALA MB   1   2 ALA  HB3  1 1 
         2 1 1 1 1   2 ALA H    1   2 ALA  HN   1 1 
         2 1 2 1 1   3 GLY H    1   3 GLY  HN   1 1 
         3 1 1 1 1   2 ALA HA   1   2 ALA  HA   1 1 
         3 1 2 1 1   2 ALA MB   1   2 ALA  HB2  1 1 
         4 1 1 1 1   2 ALA HA   1   2 ALA  HA   1 1 
         4 1 2 1 1   3 GLY H    1   3 GLY  HN   1 1 
         5 1 1 1 1   3 GLY H    1   3 GLY  HN   1 1 
         5 1 2 1 1   3 GLY QA   1   3 GLY  HA*  1 1 
         6 1 1 1 1   3 GLY H    1   3 GLY  HN   1 1 
         6 1 2 1 1   4 SER H    1   4 SER  HN   1 1 
         7 1 1 1 1   3 GLY QA   1   3 GLY  HA*  1 1 
         7 1 2 1 1   4 SER H    1   4 SER  HN   1 1 
         8 1 1 1 1   4 SER H    1   4 SER  HN   1 1 
         8 1 2 1 1   5 GLY H    1   5 GLY  HN   1 1 
         9 1 1 1 1   4 SER HA   1   4 SER  HA   1 1 
         9 1 2 1 1   5 GLY H    1   5 GLY  HN   1 1 
        10 1 1 1 1   4 SER HA   1   4 SER  HA   1 1 
        10 1 2 1 1   5 GLY HA2  1   5 GLY  HA2  1 1 
        11 1 1 1 1   4 SER HA   1   4 SER  HA   1 1 
        11 1 2 1 1   5 GLY HA3  1   5 GLY  HA1  1 1 
        12 1 1 1 1   5 GLY H    1   5 GLY  HN   1 1 
        12 1 2 1 1   5 GLY QA   1   5 GLY  HA*  1 1 
        13 1 1 1 1   5 GLY H    1   5 GLY  HN   1 1 
        13 1 2 1 1   6 ILE H    1   6 ILE  HN   1 1 
        14 1 1 1 1   5 GLY QA   1   5 GLY  HA*  1 1 
        14 1 2 1 1   6 ILE H    1   6 ILE  HN   1 1 
        15 1 1 1 1   6 ILE H    1   6 ILE  HN   1 1 
        15 1 2 1 1   6 ILE HB   1   6 ILE  HB   1 1 
        16 1 1 1 1   6 ILE H    1   6 ILE  HN   1 1 
        16 1 2 1 1   6 ILE MG   1   6 ILE  HG22 1 1 
        17 1 1 1 1   6 ILE H    1   6 ILE  HN   1 1 
        17 1 2 1 1   7 ILE H    1   7 ILE  HN   1 1 
        18 1 1 1 1   6 ILE HA   1   6 ILE  HA   1 1 
        18 1 2 1 1   6 ILE HB   1   6 ILE  HB   1 1 
        19 1 1 1 1   6 ILE HA   1   6 ILE  HA   1 1 
        19 1 2 1 1   6 ILE MG   1   6 ILE  HG22 1 1 
        20 1 1 1 1   6 ILE HA   1   6 ILE  HA   1 1 
        20 1 2 1 1   7 ILE H    1   7 ILE  HN   1 1 
        21 1 1 1 1   6 ILE HA   1   6 ILE  HA   1 1 
        21 1 2 1 1   8 TYR H    1   8 TYR  HN   1 1 
        22 1 1 1 1   7 ILE H    1   7 ILE  HN   1 1 
        22 1 2 1 1   7 ILE HB   1   7 ILE  HB   1 1 
        23 1 1 1 1   7 ILE H    1   7 ILE  HN   1 1 
        23 1 2 1 1   7 ILE MG   1   7 ILE  HG22 1 1 
        24 1 1 1 1   7 ILE H    1   7 ILE  HN   1 1 
        24 1 2 1 1   8 TYR H    1   8 TYR  HN   1 1 
        25 1 1 1 1   7 ILE HA   1   7 ILE  HA   1 1 
        25 1 2 1 1   7 ILE HB   1   7 ILE  HB   1 1 
        26 1 1 1 1   7 ILE HA   1   7 ILE  HA   1 1 
        26 1 2 1 1   7 ILE MG   1   7 ILE  HG22 1 1 
        27 1 1 1 1   7 ILE HA   1   7 ILE  HA   1 1 
        27 1 2 1 1   8 TYR H    1   8 TYR  HN   1 1 
        28 1 1 1 1   7 ILE MD   1   7 ILE  HD11 1 1 
        28 1 2 1 1   8 TYR H    1   8 TYR  HN   1 1 
        29 1 1 1 1   8 TYR H    1   8 TYR  HN   1 1 
        29 1 2 1 1   8 TYR HA   1   8 TYR  HA   1 1 
        30 1 1 1 1   8 TYR H    1   8 TYR  HN   1 1 
        30 1 2 1 1   8 TYR QB   1   8 TYR  HB*  1 1 
        31 1 1 1 1   8 TYR H    1   8 TYR  HN   1 1 
        31 1 2 1 1   9 LYS H    1   9 LYS+ HN   1 1 
        32 1 1 1 1   8 TYR HA   1   8 TYR  HA   1 1 
        32 1 2 1 1   9 LYS H    1   9 LYS+ HN   1 1 
        33 1 1 1 1   9 LYS H    1   9 LYS+ HN   1 1 
        33 1 2 1 1  10 GLN HA   1  10 GLN  HA   1 1 
        34 1 1 1 1   9 LYS HA   1   9 LYS+ HA   1 1 
        34 1 2 1 1   9 LYS QD   1   9 LYS+ HD*  1 1 
        35 1 1 1 1   9 LYS HA   1   9 LYS+ HA   1 1 
        35 1 2 1 1   9 LYS QG   1   9 LYS+ HG*  1 1 
        36 1 1 1 1   9 LYS HA   1   9 LYS+ HA   1 1 
        36 1 2 1 1  10 GLN H    1  10 GLN  HN   1 1 
        37 1 1 1 1   9 LYS QB   1   9 LYS+ HB*  1 1 
        37 1 2 1 1  10 GLN H    1  10 GLN  HN   1 1 
        38 1 1 1 1  10 GLN H    1  10 GLN  HN   1 1 
        38 1 2 1 1  10 GLN QB   1  10 GLN  HB*  1 1 
        39 1 1 1 1  10 GLN H    1  10 GLN  HN   1 1 
        39 1 2 1 1  10 GLN QG   1  10 GLN  HG*  1 1 
        40 1 1 1 1  10 GLN HA   1  10 GLN  HA   1 1 
        40 1 2 1 1  10 GLN QB   1  10 GLN  HB*  1 1 
        41 1 1 1 1  10 GLN HA   1  10 GLN  HA   1 1 
        41 1 2 1 1  11 PRO HD2  1  11 PRO  HD2  1 1 
        42 1 1 1 1  10 GLN HA   1  10 GLN  HA   1 1 
        42 1 2 1 1  11 PRO QD   1  11 PRO  HD*  1 1 
        43 1 1 1 1  10 GLN HA   1  10 GLN  HA   1 1 
        43 1 2 1 1  11 PRO HD3  1  11 PRO  HD1  1 1 
        44 1 1 1 1  10 GLN QB   1  10 GLN  HB*  1 1 
        44 1 2 1 1  12 ILE H    1  12 ILE  HN   1 1 
        45 1 1 1 1  11 PRO HA   1  11 PRO  HA   1 1 
        45 1 2 1 1  12 ILE H    1  12 ILE  HN   1 1 
        46 1 1 1 1  12 ILE H    1  12 ILE  HN   1 1 
        46 1 2 1 1  12 ILE HA   1  12 ILE  HA   1 1 
        47 1 1 1 1  12 ILE H    1  12 ILE  HN   1 1 
        47 1 2 1 1  12 ILE QG   1  12 ILE  HG1* 1 1 
        48 1 1 1 1  12 ILE H    1  12 ILE  HN   1 1 
        48 1 2 1 1  13 TYR H    1  13 TYR  HN   1 1 
        49 1 1 1 1  12 ILE HA   1  12 ILE  HA   1 1 
        49 1 2 1 1  12 ILE HB   1  12 ILE  HB   1 1 
        50 1 1 1 1  12 ILE HA   1  12 ILE  HA   1 1 
        50 1 2 1 1  12 ILE MD   1  12 ILE  HD12 1 1 
        51 1 1 1 1  12 ILE HA   1  12 ILE  HA   1 1 
        51 1 2 1 1  12 ILE QG   1  12 ILE  HG1* 1 1 
        52 1 1 1 1  12 ILE HA   1  12 ILE  HA   1 1 
        52 1 2 1 1  13 TYR H    1  13 TYR  HN   1 1 
        53 1 1 1 1  12 ILE HB   1  12 ILE  HB   1 1 
        53 1 2 1 1  13 TYR H    1  13 TYR  HN   1 1 
        54 1 1 1 1  12 ILE QG   1  12 ILE  HG1* 1 1 
        54 1 2 1 1  13 TYR H    1  13 TYR  HN   1 1 
        55 1 1 1 1  12 ILE MG   1  12 ILE  HG23 1 1 
        55 1 2 1 1  13 TYR H    1  13 TYR  HN   1 1 
        56 1 1 1 1  13 TYR H    1  13 TYR  HN   1 1 
        56 1 2 1 1  13 TYR HA   1  13 TYR  HA   1 1 
        57 1 1 1 1  13 TYR H    1  13 TYR  HN   1 1 
        57 1 2 1 1  13 TYR HD1  1  13 TYR  HD1  1 1 
        58 1 1 1 1  13 TYR H    1  13 TYR  HN   1 1 
        58 1 2 1 1  14 GLN H    1  14 GLN  HN   1 1 
        59 1 1 1 1  13 TYR HA   1  13 TYR  HA   1 1 
        59 1 2 1 1  13 TYR HD1  1  13 TYR  HD1  1 1 
        60 1 1 1 1  13 TYR HA   1  13 TYR  HA   1 1 
        60 1 2 1 1  14 GLN H    1  14 GLN  HN   1 1 
        61 1 1 1 1  14 GLN H    1  14 GLN  HN   1 1 
        61 1 2 1 1  14 GLN HA   1  14 GLN  HA   1 1 
        62 1 1 1 1  14 GLN H    1  14 GLN  HN   1 1 
        62 1 2 1 1  14 GLN HB3  1  14 GLN  HB2  1 1 
        63 1 1 1 1  14 GLN H    1  14 GLN  HN   1 1 
        63 1 2 1 1  14 GLN QG   1  14 GLN  HG*  1 1 
        64 1 1 1 1  14 GLN H    1  14 GLN  HN   1 1 
        64 1 2 1 1  15 GLY H    1  15 GLY  HN   1 1 
        65 1 1 1 1  14 GLN HA   1  14 GLN  HA   1 1 
        65 1 2 1 1  14 GLN HB3  1  14 GLN  HB2  1 1 
        66 1 1 1 1  14 GLN HA   1  14 GLN  HA   1 1 
        66 1 2 1 1  14 GLN QG   1  14 GLN  HG*  1 1 
        67 1 1 1 1  14 GLN HA   1  14 GLN  HA   1 1 
        67 1 2 1 1  15 GLY H    1  15 GLY  HN   1 1 
        68 1 1 1 1  14 GLN HA   1  14 GLN  HA   1 1 
        68 1 2 1 1  16 ASN H    1  16 ASN  HN   1 1 
        69 1 1 1 1  14 GLN HB3  1  14 GLN  HB2  1 1 
        69 1 2 1 1  15 GLY H    1  15 GLY  HN   1 1 
        70 1 1 1 1  14 GLN QG   1  14 GLN  HG*  1 1 
        70 1 2 1 1  94 GLU H    1  94 GLU- HN   1 1 
        71 1 1 1 1  14 GLN HG2  1  14 GLN  HG2  1 1 
        71 1 2 1 1  94 GLU H    1  94 GLU- HN   1 1 
        72 1 1 1 1  14 GLN HG3  1  14 GLN  HG1  1 1 
        72 1 2 1 1  94 GLU H    1  94 GLU- HN   1 1 
        73 1 1 1 1  15 GLY H    1  15 GLY  HN   1 1 
        73 1 2 1 1  16 ASN H    1  16 ASN  HN   1 1 
        74 1 1 1 1  15 GLY QA   1  15 GLY  HA*  1 1 
        74 1 2 1 1  16 ASN H    1  16 ASN  HN   1 1 
        75 1 1 1 1  16 ASN H    1  16 ASN  HN   1 1 
        75 1 2 1 1  16 ASN HA   1  16 ASN  HA   1 1 
        76 1 1 1 1  16 ASN H    1  16 ASN  HN   1 1 
        76 1 2 1 1  16 ASN QB   1  16 ASN  HB*  1 1 
        77 1 1 1 1  16 ASN H    1  16 ASN  HN   1 1 
        77 1 2 1 1  17 LEU H    1  17 LEU  HN   1 1 
        78 1 1 1 1  16 ASN HA   1  16 ASN  HA   1 1 
        78 1 2 1 1  17 LEU H    1  17 LEU  HN   1 1 
        79 1 1 1 1  16 ASN HA   1  16 ASN  HA   1 1 
        79 1 2 1 1  18 ILE H    1  18 ILE  HN   1 1 
        80 1 1 1 1  16 ASN QB   1  16 ASN  HB*  1 1 
        80 1 2 1 1  17 LEU H    1  17 LEU  HN   1 1 
        81 1 1 1 1  17 LEU H    1  17 LEU  HN   1 1 
        81 1 2 1 1  17 LEU HB2  1  17 LEU  HB2  1 1 
        82 1 1 1 1  17 LEU H    1  17 LEU  HN   1 1 
        82 1 2 1 1  17 LEU QB   1  17 LEU  HB*  1 1 
        83 1 1 1 1  17 LEU H    1  17 LEU  HN   1 1 
        83 1 2 1 1  17 LEU HB3  1  17 LEU  HB1  1 1 
        84 1 1 1 1  17 LEU H    1  17 LEU  HN   1 1 
        84 1 2 1 1  17 LEU MD1  1  17 LEU  HD12 1 1 
        85 1 1 1 1  17 LEU H    1  17 LEU  HN   1 1 
        85 1 2 1 1  17 LEU MD2  1  17 LEU  HD22 1 1 
        86 1 1 1 1  17 LEU HA   1  17 LEU  HA   1 1 
        86 1 2 1 1  18 ILE H    1  18 ILE  HN   1 1 
        87 1 1 1 1  17 LEU QB   1  17 LEU  HB*  1 1 
        87 1 2 1 1  17 LEU MD2  1  17 LEU  HD22 1 1 
        88 1 1 1 1  18 ILE H    1  18 ILE  HN   1 1 
        88 1 2 1 1  18 ILE HB   1  18 ILE  HB   1 1 
        89 1 1 1 1  18 ILE H    1  18 ILE  HN   1 1 
        89 1 2 1 1  18 ILE MD   1  18 ILE  HD12 1 1 
        90 1 1 1 1  18 ILE H    1  18 ILE  HN   1 1 
        90 1 2 1 1  18 ILE HG12 1  18 ILE  HG12 1 1 
        91 1 1 1 1  18 ILE H    1  18 ILE  HN   1 1 
        91 1 2 1 1  18 ILE QG   1  18 ILE  HG1* 1 1 
        92 1 1 1 1  18 ILE H    1  18 ILE  HN   1 1 
        92 1 2 1 1  18 ILE HG13 1  18 ILE  HG11 1 1 
        93 1 1 1 1  18 ILE H    1  18 ILE  HN   1 1 
        93 1 2 1 1  18 ILE MG   1  18 ILE  HG22 1 1 
        94 1 1 1 1  18 ILE HA   1  18 ILE  HA   1 1 
        94 1 2 1 1  18 ILE MD   1  18 ILE  HD12 1 1 
        95 1 1 1 1  18 ILE HA   1  18 ILE  HA   1 1 
        95 1 2 1 1  18 ILE QG   1  18 ILE  HG1* 1 1 
        96 1 1 1 1  18 ILE HA   1  18 ILE  HA   1 1 
        96 1 2 1 1  18 ILE MG   1  18 ILE  HG22 1 1 
        97 1 1 1 1  18 ILE HA   1  18 ILE  HA   1 1 
        97 1 2 1 1  19 LYS H    1  19 LYS+ HN   1 1 
        98 1 1 1 1  18 ILE HA   1  18 ILE  HA   1 1 
        98 1 2 1 1  23 VAL QG   1  23 VAL  HG22 1 1 
        99 1 1 1 1  18 ILE HA   1  18 ILE  HA   1 1 
        99 1 2 1 1  39 LEU QD   1  39 LEU  HD23 1 1 
       100 1 1 1 1  18 ILE MD   1  18 ILE  HD12 1 1 
       100 1 2 1 1  18 ILE QG   1  18 ILE  HG1* 1 1 
       101 1 1 1 1  18 ILE MD   1  18 ILE  HD12 1 1 
       101 1 2 1 1  23 VAL QG   1  23 VAL  HG11 1 1 
       102 1 1 1 1  18 ILE MD   1  18 ILE  HD12 1 1 
       102 1 2 1 1  39 LEU QD   1  39 LEU  HD13 1 1 
       103 1 1 1 1  18 ILE MD   1  18 ILE  HD13 1 1 
       103 1 2 1 1  88 TYR QD   1  88 TYR  HD1  1 1 
       104 1 1 1 1  19 LYS H    1  19 LYS+ HN   1 1 
       104 1 2 1 1  20 GLN H    1  20 GLN  HN   1 1 
       105 1 1 1 1  19 LYS HA   1  19 LYS+ HA   1 1 
       105 1 2 1 1  19 LYS QB   1  19 LYS+ HB*  1 1 
       106 1 1 1 1  19 LYS HA   1  19 LYS+ HA   1 1 
       106 1 2 1 1  20 GLN H    1  20 GLN  HN   1 1 
       107 1 1 1 1  19 LYS HA   1  19 LYS+ HA   1 1 
       107 1 2 1 1  21 ASN H    1  21 ASN  HN   1 1 
       108 1 1 1 1  19 LYS HA   1  19 LYS+ HA   1 1 
       108 1 2 1 1  22 ALA H    1  22 ALA  HN   1 1 
       109 1 1 1 1  19 LYS QG   1  19 LYS+ HG*  1 1 
       109 1 2 1 1  39 LEU QD   1  39 LEU  HD22 1 1 
       110 1 1 1 1  20 GLN H    1  20 GLN  HN   1 1 
       110 1 2 1 1  20 GLN HA   1  20 GLN  HA   1 1 
       111 1 1 1 1  20 GLN H    1  20 GLN  HN   1 1 
       111 1 2 1 1  20 GLN HB2  1  20 GLN  HB2  1 1 
       112 1 1 1 1  20 GLN H    1  20 GLN  HN   1 1 
       112 1 2 1 1  20 GLN QB   1  20 GLN  HB*  1 1 
       113 1 1 1 1  20 GLN H    1  20 GLN  HN   1 1 
       113 1 2 1 1  20 GLN HB3  1  20 GLN  HB1  1 1 
       114 1 1 1 1  20 GLN H    1  20 GLN  HN   1 1 
       114 1 2 1 1  20 GLN QG   1  20 GLN  HG*  1 1 
       115 1 1 1 1  20 GLN H    1  20 GLN  HN   1 1 
       115 1 2 1 1  21 ASN H    1  21 ASN  HN   1 1 
       116 1 1 1 1  20 GLN HA   1  20 GLN  HA   1 1 
       116 1 2 1 1  20 GLN QG   1  20 GLN  HG*  1 1 
       117 1 1 1 1  20 GLN HA   1  20 GLN  HA   1 1 
       117 1 2 1 1  21 ASN H    1  21 ASN  HN   1 1 
       118 1 1 1 1  20 GLN QB   1  20 GLN  HB*  1 1 
       118 1 2 1 1  23 VAL H    1  23 VAL  HN   1 1 
       119 1 1 1 1  21 ASN H    1  21 ASN  HN   1 1 
       119 1 2 1 1  22 ALA H    1  22 ALA  HN   1 1 
       120 1 1 1 1  21 ASN H    1  21 ASN  HN   1 1 
       120 1 2 1 1  23 VAL H    1  23 VAL  HN   1 1 
       121 1 1 1 1  21 ASN H    1  21 ASN  HN   1 1 
       121 1 2 1 1  24 GLU H    1  24 GLU- HN   1 1 
       122 1 1 1 1  21 ASN HA   1  21 ASN  HA   1 1 
       122 1 2 1 1  24 GLU H    1  24 GLU- HN   1 1 
       123 1 1 1 1  21 ASN HA   1  21 ASN  HA   1 1 
       123 1 2 1 1  24 GLU HB2  1  24 GLU- HB2  1 1 
       124 1 1 1 1  21 ASN HA   1  21 ASN  HA   1 1 
       124 1 2 1 1  24 GLU QB   1  24 GLU- HB*  1 1 
       125 1 1 1 1  21 ASN HA   1  21 ASN  HA   1 1 
       125 1 2 1 1  24 GLU HB3  1  24 GLU- HB1  1 1 
       126 1 1 1 1  21 ASN HA   1  21 ASN  HA   1 1 
       126 1 2 1 1  25 GLN H    1  25 GLN  HN   1 1 
       127 1 1 1 1  22 ALA H    1  22 ALA  HN   1 1 
       127 1 2 1 1  23 VAL H    1  23 VAL  HN   1 1 
       128 1 1 1 1  22 ALA H    1  22 ALA  HN   1 1 
       128 1 2 1 1  24 GLU H    1  24 GLU- HN   1 1 
       129 1 1 1 1  22 ALA H    1  22 ALA  HN   1 1 
       129 1 2 1 1  25 GLN H    1  25 GLN  HN   1 1 
       130 1 1 1 1  22 ALA HA   1  22 ALA  HA   1 1 
       130 1 2 1 1  24 GLU H    1  24 GLU- HN   1 1 
       131 1 1 1 1  22 ALA HA   1  22 ALA  HA   1 1 
       131 1 2 1 1  25 GLN H    1  25 GLN  HN   1 1 
       132 1 1 1 1  22 ALA HA   1  22 ALA  HA   1 1 
       132 1 2 1 1  25 GLN HB2  1  25 GLN  HB2  1 1 
       133 1 1 1 1  22 ALA HA   1  22 ALA  HA   1 1 
       133 1 2 1 1  25 GLN QB   1  25 GLN  HB*  1 1 
       134 1 1 1 1  22 ALA HA   1  22 ALA  HA   1 1 
       134 1 2 1 1  25 GLN HB3  1  25 GLN  HB1  1 1 
       135 1 1 1 1  22 ALA HA   1  22 ALA  HA   1 1 
       135 1 2 1 1  26 LEU H    1  26 LEU  HN   1 1 
       136 1 1 1 1  23 VAL H    1  23 VAL  HN   1 1 
       136 1 2 1 1  23 VAL HA   1  23 VAL  HA   1 1 
       137 1 1 1 1  23 VAL H    1  23 VAL  HN   1 1 
       137 1 2 1 1  23 VAL HB   1  23 VAL  HB   1 1 
       138 1 1 1 1  23 VAL H    1  23 VAL  HN   1 1 
       138 1 2 1 1  23 VAL QG   1  23 VAL  HG13 1 1 
       139 1 1 1 1  23 VAL H    1  23 VAL  HN   1 1 
       139 1 2 1 1  24 GLU H    1  24 GLU- HN   1 1 
       140 1 1 1 1  23 VAL H    1  23 VAL  HN   1 1 
       140 1 2 1 1  25 GLN H    1  25 GLN  HN   1 1 
       141 1 1 1 1  23 VAL H    1  23 VAL  HN   1 1 
       141 1 2 1 1  26 LEU H    1  26 LEU  HN   1 1 
       142 1 1 1 1  23 VAL HA   1  23 VAL  HA   1 1 
       142 1 2 1 1  23 VAL QG   1  23 VAL  HG13 1 1 
       143 1 1 1 1  23 VAL HA   1  23 VAL  HA   1 1 
       143 1 2 1 1  24 GLU H    1  24 GLU- HN   1 1 
       144 1 1 1 1  23 VAL HA   1  23 VAL  HA   1 1 
       144 1 2 1 1  26 LEU H    1  26 LEU  HN   1 1 
       145 1 1 1 1  23 VAL HA   1  23 VAL  HA   1 1 
       145 1 2 1 1  26 LEU MD1  1  26 LEU  HD12 1 1 
       146 1 1 1 1  23 VAL HA   1  23 VAL  HA   1 1 
       146 1 2 1 1  26 LEU MD2  1  26 LEU  HD22 1 1 
       147 1 1 1 1  23 VAL HB   1  23 VAL  HB   1 1 
       147 1 2 1 1  23 VAL QG   1  23 VAL  HG12 1 1 
       148 1 1 1 1  23 VAL HB   1  23 VAL  HB   1 1 
       148 1 2 1 1  24 GLU H    1  24 GLU- HN   1 1 
       149 1 1 1 1  23 VAL QG   1  23 VAL  HG12 1 1 
       149 1 2 1 1  24 GLU H    1  24 GLU- HN   1 1 
       150 1 1 1 1  23 VAL QG   1  23 VAL  HG12 1 1 
       150 1 2 1 1  24 GLU HA   1  24 GLU- HA   1 1 
       151 1 1 1 1  23 VAL QG   1  23 VAL  HG11 1 1 
       151 1 2 1 1  26 LEU MD1  1  26 LEU  HD12 1 1 
       152 1 1 1 1  23 VAL QG   1  23 VAL  HG11 1 1 
       152 1 2 1 1  26 LEU MD2  1  26 LEU  HD22 1 1 
       153 1 1 1 1  23 VAL QG   1  23 VAL  HG11 1 1 
       153 1 2 1 1  72 PHE HD1  1  72 PHE  HD2  1 1 
       154 1 1 1 1  23 VAL QG   1  23 VAL  HG23 1 1 
       154 1 2 1 1  72 PHE HE1  1  72 PHE  HE2  1 1 
       155 1 1 1 1  23 VAL QG   1  23 VAL  HG11 1 1 
       155 1 2 1 1  84 TRP HD1  1  84 TRP  HD1  1 1 
       156 1 1 1 1  23 VAL QG   1  23 VAL  HG23 1 1 
       156 1 2 1 1  88 TYR QE   1  88 TYR  HE1  1 1 
       157 1 1 1 1  24 GLU H    1  24 GLU- HN   1 1 
       157 1 2 1 1  24 GLU HB2  1  24 GLU- HB2  1 1 
       158 1 1 1 1  24 GLU H    1  24 GLU- HN   1 1 
       158 1 2 1 1  24 GLU HB3  1  24 GLU- HB1  1 1 
       159 1 1 1 1  24 GLU H    1  24 GLU- HN   1 1 
       159 1 2 1 1  25 GLN H    1  25 GLN  HN   1 1 
       160 1 1 1 1  24 GLU H    1  24 GLU- HN   1 1 
       160 1 2 1 1  26 LEU H    1  26 LEU  HN   1 1 
       161 1 1 1 1  24 GLU HA   1  24 GLU- HA   1 1 
       161 1 2 1 1  24 GLU QG   1  24 GLU- HG*  1 1 
       162 1 1 1 1  24 GLU HA   1  24 GLU- HA   1 1 
       162 1 2 1 1  25 GLN H    1  25 GLN  HN   1 1 
       163 1 1 1 1  24 GLU HA   1  24 GLU- HA   1 1 
       163 1 2 1 1  26 LEU H    1  26 LEU  HN   1 1 
       164 1 1 1 1  25 GLN H    1  25 GLN  HN   1 1 
       164 1 2 1 1  26 LEU H    1  26 LEU  HN   1 1 
       165 1 1 1 1  25 GLN HA   1  25 GLN  HA   1 1 
       165 1 2 1 1  25 GLN QB   1  25 GLN  HB*  1 1 
       166 1 1 1 1  25 GLN HA   1  25 GLN  HA   1 1 
       166 1 2 1 1  25 GLN QG   1  25 GLN  HG*  1 1 
       167 1 1 1 1  25 GLN HA   1  25 GLN  HA   1 1 
       167 1 2 1 1  26 LEU H    1  26 LEU  HN   1 1 
       168 1 1 1 1  25 GLN HA   1  25 GLN  HA   1 1 
       168 1 2 1 1  27 GLN H    1  27 GLN  HN   1 1 
       169 1 1 1 1  26 LEU H    1  26 LEU  HN   1 1 
       169 1 2 1 1  26 LEU HA   1  26 LEU  HA   1 1 
       170 1 1 1 1  26 LEU H    1  26 LEU  HN   1 1 
       170 1 2 1 1  26 LEU HB2  1  26 LEU  HB1  1 1 
       171 1 1 1 1  26 LEU H    1  26 LEU  HN   1 1 
       171 1 2 1 1  26 LEU HB3  1  26 LEU  HB2  1 1 
       172 1 1 1 1  26 LEU H    1  26 LEU  HN   1 1 
       172 1 2 1 1  26 LEU MD1  1  26 LEU  HD12 1 1 
       173 1 1 1 1  26 LEU H    1  26 LEU  HN   1 1 
       173 1 2 1 1  26 LEU MD2  1  26 LEU  HD22 1 1 
       174 1 1 1 1  26 LEU H    1  26 LEU  HN   1 1 
       174 1 2 1 1  26 LEU HG   1  26 LEU  HG   1 1 
       175 1 1 1 1  26 LEU H    1  26 LEU  HN   1 1 
       175 1 2 1 1  27 GLN H    1  27 GLN  HN   1 1 
       176 1 1 1 1  26 LEU HA   1  26 LEU  HA   1 1 
       176 1 2 1 1  26 LEU HB3  1  26 LEU  HB2  1 1 
       177 1 1 1 1  26 LEU HA   1  26 LEU  HA   1 1 
       177 1 2 1 1  26 LEU MD1  1  26 LEU  HD11 1 1 
       178 1 1 1 1  26 LEU HA   1  26 LEU  HA   1 1 
       178 1 2 1 1  26 LEU MD2  1  26 LEU  HD23 1 1 
       179 1 1 1 1  26 LEU HA   1  26 LEU  HA   1 1 
       179 1 2 1 1  26 LEU HG   1  26 LEU  HG   1 1 
       180 1 1 1 1  26 LEU HA   1  26 LEU  HA   1 1 
       180 1 2 1 1  27 GLN H    1  27 GLN  HN   1 1 
       181 1 1 1 1  26 LEU HA   1  26 LEU  HA   1 1 
       181 1 2 1 1  28 VAL H    1  28 VAL  HN   1 1 
       182 1 1 1 1  26 LEU HB3  1  26 LEU  HB2  1 1 
       182 1 2 1 1  26 LEU MD1  1  26 LEU  HD11 1 1 
       183 1 1 1 1  26 LEU HB3  1  26 LEU  HB2  1 1 
       183 1 2 1 1  26 LEU MD2  1  26 LEU  HD22 1 1 
       184 1 1 1 1  26 LEU HB3  1  26 LEU  HB2  1 1 
       184 1 2 1 1  26 LEU HG   1  26 LEU  HG   1 1 
       185 1 1 1 1  26 LEU HB3  1  26 LEU  HB2  1 1 
       185 1 2 1 1  27 GLN H    1  27 GLN  HN   1 1 
       186 1 1 1 1  26 LEU HB3  1  26 LEU  HB2  1 1 
       186 1 2 1 1  84 TRP HZ2  1  84 TRP  HZ2  1 1 
       187 1 1 1 1  26 LEU QD   1  26 LEU  HD*  1 1 
       187 1 2 1 1  72 PHE HE2  1  72 PHE  HE1  1 1 
       188 1 1 1 1  26 LEU MD1  1  26 LEU  HD12 1 1 
       188 1 2 1 1  84 TRP HD1  1  84 TRP  HD1  1 1 
       189 1 1 1 1  26 LEU MD1  1  26 LEU  HD12 1 1 
       189 1 2 1 1  84 TRP HE3  1  84 TRP  HE3  1 1 
       190 1 1 1 1  26 LEU MD2  1  26 LEU  HD22 1 1 
       190 1 2 1 1  28 VAL MG2  1  28 VAL  HG22 1 1 
       191 1 1 1 1  26 LEU HG   1  26 LEU  HG   1 1 
       191 1 2 1 1  27 GLN H    1  27 GLN  HN   1 1 
       192 1 1 1 1  27 GLN H    1  27 GLN  HN   1 1 
       192 1 2 1 1  27 GLN HA   1  27 GLN  HA   1 1 
       193 1 1 1 1  27 GLN H    1  27 GLN  HN   1 1 
       193 1 2 1 1  27 GLN HB2  1  27 GLN  HB1  1 1 
       194 1 1 1 1  27 GLN H    1  27 GLN  HN   1 1 
       194 1 2 1 1  27 GLN HB3  1  27 GLN  HB2  1 1 
       195 1 1 1 1  27 GLN H    1  27 GLN  HN   1 1 
       195 1 2 1 1  27 GLN QE   1  27 GLN  HE2* 1 1 
       196 1 1 1 1  27 GLN H    1  27 GLN  HN   1 1 
       196 1 2 1 1  27 GLN QG   1  27 GLN  HG*  1 1 
       197 1 1 1 1  27 GLN H    1  27 GLN  HN   1 1 
       197 1 2 1 1  28 VAL H    1  28 VAL  HN   1 1 
       198 1 1 1 1  27 GLN HA   1  27 GLN  HA   1 1 
       198 1 2 1 1  27 GLN QG   1  27 GLN  HG*  1 1 
       199 1 1 1 1  27 GLN HA   1  27 GLN  HA   1 1 
       199 1 2 1 1  28 VAL H    1  28 VAL  HN   1 1 
       200 1 1 1 1  27 GLN HB3  1  27 GLN  HB2  1 1 
       200 1 2 1 1  27 GLN QG   1  27 GLN  HG*  1 1 
       201 1 1 1 1  27 GLN HB3  1  27 GLN  HB2  1 1 
       201 1 2 1 1  28 VAL H    1  28 VAL  HN   1 1 
       202 1 1 1 1  28 VAL H    1  28 VAL  HN   1 1 
       202 1 2 1 1  28 VAL HB   1  28 VAL  HB   1 1 
       203 1 1 1 1  28 VAL H    1  28 VAL  HN   1 1 
       203 1 2 1 1  84 TRP HH2  1  84 TRP  HH2  1 1 
       204 1 1 1 1  28 VAL H    1  28 VAL  HN   1 1 
       204 1 2 1 1  84 TRP HZ3  1  84 TRP  HZ3  1 1 
       205 1 1 1 1  28 VAL HA   1  28 VAL  HA   1 1 
       205 1 2 1 1  29 GLY H    1  29 GLY  HN   1 1 
       206 1 1 1 1  28 VAL HA   1  28 VAL  HA   1 1 
       206 1 2 1 1  30 GLN H    1  30 GLN  HN   1 1 
       207 1 1 1 1  28 VAL HA   1  28 VAL  HA   1 1 
       207 1 2 1 1  84 TRP HH2  1  84 TRP  HH2  1 1 
       208 1 1 1 1  28 VAL HB   1  28 VAL  HB   1 1 
       208 1 2 1 1  28 VAL MG1  1  28 VAL  HG13 1 1 
       209 1 1 1 1  28 VAL HB   1  28 VAL  HB   1 1 
       209 1 2 1 1  28 VAL MG2  1  28 VAL  HG22 1 1 
       210 1 1 1 1  28 VAL MG1  1  28 VAL  HG11 1 1 
       210 1 2 1 1  29 GLY H    1  29 GLY  HN   1 1 
       211 1 1 1 1  29 GLY H    1  29 GLY  HN   1 1 
       211 1 2 1 1  30 GLN H    1  30 GLN  HN   1 1 
       212 1 1 1 1  29 GLY H    1  29 GLY  HN   1 1 
       212 1 2 1 1  81 VAL H    1  81 VAL  HN   1 1 
       213 1 1 1 1  29 GLY QA   1  29 GLY  HA*  1 1 
       213 1 2 1 1  30 GLN H    1  30 GLN  HN   1 1 
       214 1 1 1 1  29 GLY QA   1  29 GLY  HA*  1 1 
       214 1 2 1 1  80 GLN HB2  1  80 GLN  HB1  1 1 
       215 1 1 1 1  30 GLN H    1  30 GLN  HN   1 1 
       215 1 2 1 1  30 GLN HB2  1  30 GLN  HB2  1 1 
       216 1 1 1 1  30 GLN H    1  30 GLN  HN   1 1 
       216 1 2 1 1  30 GLN HB3  1  30 GLN  HB1  1 1 
       217 1 1 1 1  30 GLN H    1  30 GLN  HN   1 1 
       217 1 2 1 1  31 SER H    1  31 SER  HN   1 1 
       218 1 1 1 1  30 GLN H    1  30 GLN  HN   1 1 
       218 1 2 1 1  81 VAL H    1  81 VAL  HN   1 1 
       219 1 1 1 1  30 GLN HA   1  30 GLN  HA   1 1 
       219 1 2 1 1  30 GLN QG   1  30 GLN  HG*  1 1 
       220 1 1 1 1  30 GLN HA   1  30 GLN  HA   1 1 
       220 1 2 1 1  31 SER H    1  31 SER  HN   1 1 
       221 1 1 1 1  30 GLN QG   1  30 GLN  HG*  1 1 
       221 1 2 1 1  80 GLN HA   1  80 GLN  HA   1 1 
       222 1 1 1 1  31 SER H    1  31 SER  HN   1 1 
       222 1 2 1 1  32 LYS H    1  32 LYS+ HN   1 1 
       223 1 1 1 1  31 SER H    1  31 SER  HN   1 1 
       223 1 2 1 1  81 VAL H    1  81 VAL  HN   1 1 
       224 1 1 1 1  31 SER HA   1  31 SER  HA   1 1 
       224 1 2 1 1  31 SER QB   1  31 SER  HB*  1 1 
       225 1 1 1 1  31 SER HA   1  31 SER  HA   1 1 
       225 1 2 1 1  32 LYS H    1  32 LYS+ HN   1 1 
       226 1 1 1 1  31 SER HA   1  31 SER  HA   1 1 
       226 1 2 1 1  33 GLN H    1  33 GLN  HN   1 1 
       227 1 1 1 1  31 SER HA   1  31 SER  HA   1 1 
       227 1 2 1 1  34 GLN H    1  34 GLN  HN   1 1 
       228 1 1 1 1  31 SER HA   1  31 SER  HA   1 1 
       228 1 2 1 1  80 GLN HA   1  80 GLN  HA   1 1 
       229 1 1 1 1  31 SER QB   1  31 SER  HB*  1 1 
       229 1 2 1 1  33 GLN H    1  33 GLN  HN   1 1 
       230 1 1 1 1  31 SER QB   1  31 SER  HB*  1 1 
       230 1 2 1 1  80 GLN HA   1  80 GLN  HA   1 1 
       231 1 1 1 1  32 LYS H    1  32 LYS+ HN   1 1 
       231 1 2 1 1  32 LYS HA   1  32 LYS+ HA   1 1 
       232 1 1 1 1  32 LYS H    1  32 LYS+ HN   1 1 
       232 1 2 1 1  33 GLN H    1  33 GLN  HN   1 1 
       233 1 1 1 1  32 LYS H    1  32 LYS+ HN   1 1 
       233 1 2 1 1  34 GLN H    1  34 GLN  HN   1 1 
       234 1 1 1 1  32 LYS HA   1  32 LYS+ HA   1 1 
       234 1 2 1 1  32 LYS QB   1  32 LYS+ HB*  1 1 
       235 1 1 1 1  32 LYS HA   1  32 LYS+ HA   1 1 
       235 1 2 1 1  35 VAL H    1  35 VAL  HN   1 1 
       236 1 1 1 1  32 LYS HA   1  32 LYS+ HA   1 1 
       236 1 2 1 1  76 PHE HE1  1  76 PHE  HE1  1 1 
       237 1 1 1 1  32 LYS QG   1  32 LYS+ HG*  1 1 
       237 1 2 1 1  33 GLN H    1  33 GLN  HN   1 1 
       238 1 1 1 1  32 LYS HG2  1  32 LYS+ HG2  1 1 
       238 1 2 1 1  33 GLN H    1  33 GLN  HN   1 1 
       239 1 1 1 1  32 LYS HG3  1  32 LYS+ HG1  1 1 
       239 1 2 1 1  33 GLN H    1  33 GLN  HN   1 1 
       240 1 1 1 1  33 GLN H    1  33 GLN  HN   1 1 
       240 1 2 1 1  33 GLN HB2  1  33 GLN  HB2  1 1 
       241 1 1 1 1  33 GLN H    1  33 GLN  HN   1 1 
       241 1 2 1 1  33 GLN QB   1  33 GLN  HB*  1 1 
       242 1 1 1 1  33 GLN H    1  33 GLN  HN   1 1 
       242 1 2 1 1  33 GLN HB3  1  33 GLN  HB1  1 1 
       243 1 1 1 1  33 GLN H    1  33 GLN  HN   1 1 
       243 1 2 1 1  34 GLN H    1  34 GLN  HN   1 1 
       244 1 1 1 1  33 GLN H    1  33 GLN  HN   1 1 
       244 1 2 1 1  35 VAL H    1  35 VAL  HN   1 1 
       245 1 1 1 1  33 GLN HA   1  33 GLN  HA   1 1 
       245 1 2 1 1  33 GLN QB   1  33 GLN  HB*  1 1 
       246 1 1 1 1  33 GLN HA   1  33 GLN  HA   1 1 
       246 1 2 1 1  34 GLN H    1  34 GLN  HN   1 1 
       247 1 1 1 1  33 GLN HA   1  33 GLN  HA   1 1 
       247 1 2 1 1  35 VAL H    1  35 VAL  HN   1 1 
       248 1 1 1 1  33 GLN HA   1  33 GLN  HA   1 1 
       248 1 2 1 1  36 SER H    1  36 SER  HN   1 1 
       249 1 1 1 1  33 GLN HA   1  33 GLN  HA   1 1 
       249 1 2 1 1  37 ALA H    1  37 ALA  HN   1 1 
       250 1 1 1 1  33 GLN QB   1  33 GLN  HB*  1 1 
       250 1 2 1 1  34 GLN HA   1  34 GLN  HA   1 1 
       251 1 1 1 1  33 GLN QB   1  33 GLN  HB*  1 1 
       251 1 2 1 1  36 SER QB   1  36 SER  HB*  1 1 
       252 1 1 1 1  33 GLN QG   1  33 GLN  HG*  1 1 
       252 1 2 1 1  34 GLN H    1  34 GLN  HN   1 1 
       253 1 1 1 1  34 GLN H    1  34 GLN  HN   1 1 
       253 1 2 1 1  34 GLN HB2  1  34 GLN  HB1  1 1 
       254 1 1 1 1  34 GLN H    1  34 GLN  HN   1 1 
       254 1 2 1 1  34 GLN HB3  1  34 GLN  HB2  1 1 
       255 1 1 1 1  34 GLN H    1  34 GLN  HN   1 1 
       255 1 2 1 1  34 GLN HG2  1  34 GLN  HG2  1 1 
       256 1 1 1 1  34 GLN H    1  34 GLN  HN   1 1 
       256 1 2 1 1  34 GLN QG   1  34 GLN  HG*  1 1 
       257 1 1 1 1  34 GLN H    1  34 GLN  HN   1 1 
       257 1 2 1 1  34 GLN HG3  1  34 GLN  HG1  1 1 
       258 1 1 1 1  34 GLN H    1  34 GLN  HN   1 1 
       258 1 2 1 1  35 VAL H    1  35 VAL  HN   1 1 
       259 1 1 1 1  34 GLN H    1  34 GLN  HN   1 1 
       259 1 2 1 1  36 SER H    1  36 SER  HN   1 1 
       260 1 1 1 1  34 GLN H    1  34 GLN  HN   1 1 
       260 1 2 1 1  37 ALA H    1  37 ALA  HN   1 1 
       261 1 1 1 1  34 GLN HA   1  34 GLN  HA   1 1 
       261 1 2 1 1  34 GLN HB3  1  34 GLN  HB2  1 1 
       262 1 1 1 1  34 GLN HA   1  34 GLN  HA   1 1 
       262 1 2 1 1  34 GLN QG   1  34 GLN  HG*  1 1 
       263 1 1 1 1  34 GLN HA   1  34 GLN  HA   1 1 
       263 1 2 1 1  35 VAL H    1  35 VAL  HN   1 1 
       264 1 1 1 1  34 GLN HA   1  34 GLN  HA   1 1 
       264 1 2 1 1  36 SER H    1  36 SER  HN   1 1 
       265 1 1 1 1  34 GLN HA   1  34 GLN  HA   1 1 
       265 1 2 1 1  37 ALA H    1  37 ALA  HN   1 1 
       266 1 1 1 1  34 GLN HA   1  34 GLN  HA   1 1 
       266 1 2 1 1  37 ALA MB   1  37 ALA  HB2  1 1 
       267 1 1 1 1  34 GLN HB3  1  34 GLN  HB2  1 1 
       267 1 2 1 1  35 VAL H    1  35 VAL  HN   1 1 
       268 1 1 1 1  34 GLN HB3  1  34 GLN  HB2  1 1 
       268 1 2 1 1  37 ALA MB   1  37 ALA  HB2  1 1 
       269 1 1 1 1  35 VAL H    1  35 VAL  HN   1 1 
       269 1 2 1 1  35 VAL HB   1  35 VAL  HB   1 1 
       270 1 1 1 1  35 VAL H    1  35 VAL  HN   1 1 
       270 1 2 1 1  35 VAL MG1  1  35 VAL  HG12 1 1 
       271 1 1 1 1  35 VAL H    1  35 VAL  HN   1 1 
       271 1 2 1 1  35 VAL MG2  1  35 VAL  HG22 1 1 
       272 1 1 1 1  35 VAL H    1  35 VAL  HN   1 1 
       272 1 2 1 1  36 SER H    1  36 SER  HN   1 1 
       273 1 1 1 1  35 VAL HA   1  35 VAL  HA   1 1 
       273 1 2 1 1  35 VAL MG2  1  35 VAL  HG22 1 1 
       274 1 1 1 1  35 VAL HA   1  35 VAL  HA   1 1 
       274 1 2 1 1  36 SER H    1  36 SER  HN   1 1 
       275 1 1 1 1  35 VAL HA   1  35 VAL  HA   1 1 
       275 1 2 1 1  37 ALA H    1  37 ALA  HN   1 1 
       276 1 1 1 1  35 VAL HA   1  35 VAL  HA   1 1 
       276 1 2 1 1  38 LEU H    1  38 LEU  HN   1 1 
       277 1 1 1 1  35 VAL HA   1  35 VAL  HA   1 1 
       277 1 2 1 1  38 LEU HB2  1  38 LEU  HB1  1 1 
       278 1 1 1 1  35 VAL HA   1  35 VAL  HA   1 1 
       278 1 2 1 1  38 LEU HB3  1  38 LEU  HB2  1 1 
       279 1 1 1 1  35 VAL HA   1  35 VAL  HA   1 1 
       279 1 2 1 1  38 LEU MD1  1  38 LEU  HD12 1 1 
       280 1 1 1 1  35 VAL HA   1  35 VAL  HA   1 1 
       280 1 2 1 1  38 LEU MD2  1  38 LEU  HD21 1 1 
       281 1 1 1 1  35 VAL HA   1  35 VAL  HA   1 1 
       281 1 2 1 1  39 LEU H    1  39 LEU  HN   1 1 
       282 1 1 1 1  35 VAL HA   1  35 VAL  HA   1 1 
       282 1 2 1 1  39 LEU QD   1  39 LEU  HD11 1 1 
       283 1 1 1 1  35 VAL HB   1  35 VAL  HB   1 1 
       283 1 2 1 1  76 PHE HE1  1  76 PHE  HE1  1 1 
       284 1 1 1 1  35 VAL MG1  1  35 VAL  HG11 1 1 
       284 1 2 1 1  39 LEU QD   1  39 LEU  HD11 1 1 
       285 1 1 1 1  35 VAL MG1  1  35 VAL  HG13 1 1 
       285 1 2 1 1  84 TRP HE3  1  84 TRP  HE3  1 1 
       286 1 1 1 1  35 VAL MG1  1  35 VAL  HG13 1 1 
       286 1 2 1 1  84 TRP HZ3  1  84 TRP  HZ3  1 1 
       287 1 1 1 1  35 VAL MG2  1  35 VAL  HG22 1 1 
       287 1 2 1 1  36 SER HA   1  36 SER  HA   1 1 
       288 1 1 1 1  35 VAL MG2  1  35 VAL  HG23 1 1 
       288 1 2 1 1  39 LEU QD   1  39 LEU  HD11 1 1 
       289 1 1 1 1  35 VAL MG2  1  35 VAL  HG22 1 1 
       289 1 2 1 1  53 TRP HZ3  1  53 TRP  HZ3  1 1 
       290 1 1 1 1  35 VAL MG2  1  35 VAL  HG21 1 1 
       290 1 2 1 1  76 PHE HE1  1  76 PHE  HE1  1 1 
       291 1 1 1 1  35 VAL MG2  1  35 VAL  HG23 1 1 
       291 1 2 1 1  81 VAL MG2  1  81 VAL  HG23 1 1 
       292 1 1 1 1  36 SER H    1  36 SER  HN   1 1 
       292 1 2 1 1  37 ALA H    1  37 ALA  HN   1 1 
       293 1 1 1 1  36 SER HA   1  36 SER  HA   1 1 
       293 1 2 1 1  37 ALA H    1  37 ALA  HN   1 1 
       294 1 1 1 1  36 SER HA   1  36 SER  HA   1 1 
       294 1 2 1 1  38 LEU H    1  38 LEU  HN   1 1 
       295 1 1 1 1  36 SER HA   1  36 SER  HA   1 1 
       295 1 2 1 1  39 LEU H    1  39 LEU  HN   1 1 
       296 1 1 1 1  36 SER HA   1  36 SER  HA   1 1 
       296 1 2 1 1  39 LEU HB2  1  39 LEU  HB1  1 1 
       297 1 1 1 1  36 SER HA   1  36 SER  HA   1 1 
       297 1 2 1 1  39 LEU HB3  1  39 LEU  HB2  1 1 
       298 1 1 1 1  36 SER HA   1  36 SER  HA   1 1 
       298 1 2 1 1  40 GLY H    1  40 GLY  HN   1 1 
       299 1 1 1 1  36 SER HA   1  36 SER  HA   1 1 
       299 1 2 1 1  53 TRP HZ2  1  53 TRP  HZ2  1 1 
       300 1 1 1 1  36 SER QB   1  36 SER  HB*  1 1 
       300 1 2 1 1  37 ALA H    1  37 ALA  HN   1 1 
       301 1 1 1 1  36 SER QB   1  36 SER  HB*  1 1 
       301 1 2 1 1  53 TRP HH2  1  53 TRP  HH2  1 1 
       302 1 1 1 1  37 ALA H    1  37 ALA  HN   1 1 
       302 1 2 1 1  37 ALA MB   1  37 ALA  HB2  1 1 
       303 1 1 1 1  37 ALA H    1  37 ALA  HN   1 1 
       303 1 2 1 1  38 LEU H    1  38 LEU  HN   1 1 
       304 1 1 1 1  37 ALA H    1  37 ALA  HN   1 1 
       304 1 2 1 1  39 LEU H    1  39 LEU  HN   1 1 
       305 1 1 1 1  37 ALA HA   1  37 ALA  HA   1 1 
       305 1 2 1 1  38 LEU H    1  38 LEU  HN   1 1 
       306 1 1 1 1  37 ALA HA   1  37 ALA  HA   1 1 
       306 1 2 1 1  39 LEU H    1  39 LEU  HN   1 1 
       307 1 1 1 1  37 ALA HA   1  37 ALA  HA   1 1 
       307 1 2 1 1  40 GLY H    1  40 GLY  HN   1 1 
       308 1 1 1 1  37 ALA HA   1  37 ALA  HA   1 1 
       308 1 2 1 1  41 THR H    1  41 THR  HN   1 1 
       309 1 1 1 1  37 ALA MB   1  37 ALA  HB2  1 1 
       309 1 2 1 1  38 LEU H    1  38 LEU  HN   1 1 
       310 1 1 1 1  38 LEU H    1  38 LEU  HN   1 1 
       310 1 2 1 1  38 LEU HB2  1  38 LEU  HB1  1 1 
       311 1 1 1 1  38 LEU H    1  38 LEU  HN   1 1 
       311 1 2 1 1  38 LEU HB3  1  38 LEU  HB2  1 1 
       312 1 1 1 1  38 LEU H    1  38 LEU  HN   1 1 
       312 1 2 1 1  38 LEU MD1  1  38 LEU  HD11 1 1 
       313 1 1 1 1  38 LEU H    1  38 LEU  HN   1 1 
       313 1 2 1 1  38 LEU MD2  1  38 LEU  HD21 1 1 
       314 1 1 1 1  38 LEU H    1  38 LEU  HN   1 1 
       314 1 2 1 1  39 LEU H    1  39 LEU  HN   1 1 
       315 1 1 1 1  38 LEU H    1  38 LEU  HN   1 1 
       315 1 2 1 1  40 GLY H    1  40 GLY  HN   1 1 
       316 1 1 1 1  38 LEU HA   1  38 LEU  HA   1 1 
       316 1 2 1 1  38 LEU HB3  1  38 LEU  HB2  1 1 
       317 1 1 1 1  38 LEU HA   1  38 LEU  HA   1 1 
       317 1 2 1 1  38 LEU HG   1  38 LEU  HG   1 1 
       318 1 1 1 1  38 LEU HA   1  38 LEU  HA   1 1 
       318 1 2 1 1  39 LEU H    1  39 LEU  HN   1 1 
       319 1 1 1 1  38 LEU HA   1  38 LEU  HA   1 1 
       319 1 2 1 1  40 GLY H    1  40 GLY  HN   1 1 
       320 1 1 1 1  38 LEU HB3  1  38 LEU  HB2  1 1 
       320 1 2 1 1  38 LEU HG   1  38 LEU  HG   1 1 
       321 1 1 1 1  38 LEU HB3  1  38 LEU  HB2  1 1 
       321 1 2 1 1  39 LEU H    1  39 LEU  HN   1 1 
       322 1 1 1 1  39 LEU H    1  39 LEU  HN   1 1 
       322 1 2 1 1  39 LEU HB2  1  39 LEU  HB1  1 1 
       323 1 1 1 1  39 LEU H    1  39 LEU  HN   1 1 
       323 1 2 1 1  39 LEU HB3  1  39 LEU  HB2  1 1 
       324 1 1 1 1  39 LEU H    1  39 LEU  HN   1 1 
       324 1 2 1 1  39 LEU HG   1  39 LEU  HG   1 1 
       325 1 1 1 1  39 LEU H    1  39 LEU  HN   1 1 
       325 1 2 1 1  40 GLY H    1  40 GLY  HN   1 1 
       326 1 1 1 1  39 LEU HA   1  39 LEU  HA   1 1 
       326 1 2 1 1  39 LEU HB3  1  39 LEU  HB2  1 1 
       327 1 1 1 1  39 LEU HA   1  39 LEU  HA   1 1 
       327 1 2 1 1  39 LEU QD   1  39 LEU  HD11 1 1 
       328 1 1 1 1  39 LEU HA   1  39 LEU  HA   1 1 
       328 1 2 1 1  40 GLY H    1  40 GLY  HN   1 1 
       329 1 1 1 1  39 LEU HB2  1  39 LEU  HB1  1 1 
       329 1 2 1 1  39 LEU QD   1  39 LEU  HD13 1 1 
       330 1 1 1 1  39 LEU HB2  1  39 LEU  HB1  1 1 
       330 1 2 1 1  40 GLY H    1  40 GLY  HN   1 1 
       331 1 1 1 1  39 LEU HB3  1  39 LEU  HB2  1 1 
       331 1 2 1 1  40 GLY H    1  40 GLY  HN   1 1 
       332 1 1 1 1  39 LEU QD   1  39 LEU  HD12 1 1 
       332 1 2 1 1  53 TRP HH2  1  53 TRP  HH2  1 1 
       333 1 1 1 1  39 LEU QD   1  39 LEU  HD12 1 1 
       333 1 2 1 1  88 TYR QE   1  88 TYR  HE1  1 1 
       334 1 1 1 1  39 LEU QD   1  39 LEU  HD23 1 1 
       334 1 2 1 1  89 PHE QD   1  89 PHE  HD1  1 1 
       335 1 1 1 1  40 GLY H    1  40 GLY  HN   1 1 
       335 1 2 1 1  40 GLY QA   1  40 GLY  HA*  1 1 
       336 1 1 1 1  40 GLY H    1  40 GLY  HN   1 1 
       336 1 2 1 1  41 THR H    1  41 THR  HN   1 1 
       337 1 1 1 1  41 THR H    1  41 THR  HN   1 1 
       337 1 2 1 1  41 THR HB   1  41 THR  HB   1 1 
       338 1 1 1 1  41 THR H    1  41 THR  HN   1 1 
       338 1 2 1 1  41 THR HG1  1  41 THR  HG1  1 1 
       339 1 1 1 1  41 THR H    1  41 THR  HN   1 1 
       339 1 2 1 1  41 THR MG   1  41 THR  HG22 1 1 
       340 1 1 1 1  41 THR H    1  41 THR  HN   1 1 
       340 1 2 1 1  42 PRO HD2  1  42 PRO  HD2  1 1 
       341 1 1 1 1  41 THR H    1  41 THR  HN   1 1 
       341 1 2 1 1  42 PRO QD   1  42 PRO  HD*  1 1 
       342 1 1 1 1  41 THR H    1  41 THR  HN   1 1 
       342 1 2 1 1  42 PRO HD3  1  42 PRO  HD1  1 1 
       343 1 1 1 1  41 THR HA   1  41 THR  HA   1 1 
       343 1 2 1 1  41 THR HG1  1  41 THR  HG1  1 1 
       344 1 1 1 1  41 THR HA   1  41 THR  HA   1 1 
       344 1 2 1 1  42 PRO HD2  1  42 PRO  HD2  1 1 
       345 1 1 1 1  41 THR HA   1  41 THR  HA   1 1 
       345 1 2 1 1  42 PRO QD   1  42 PRO  HD*  1 1 
       346 1 1 1 1  41 THR HA   1  41 THR  HA   1 1 
       346 1 2 1 1  42 PRO HD3  1  42 PRO  HD1  1 1 
       347 1 1 1 1  41 THR HB   1  41 THR  HB   1 1 
       347 1 2 1 1  41 THR HG1  1  41 THR  HG1  1 1 
       348 1 1 1 1  41 THR HB   1  41 THR  HB   1 1 
       348 1 2 1 1  41 THR MG   1  41 THR  HG21 1 1 
       349 1 1 1 1  41 THR HB   1  41 THR  HB   1 1 
       349 1 2 1 1  42 PRO QD   1  42 PRO  HD*  1 1 
       350 1 1 1 1  41 THR MG   1  41 THR  HG23 1 1 
       350 1 2 1 1  53 TRP HD1  1  53 TRP  HD1  1 1 
       351 1 1 1 1  41 THR MG   1  41 THR  HG21 1 1 
       351 1 2 1 1  53 TRP HH2  1  53 TRP  HH2  1 1 
       352 1 1 1 1  42 PRO HA   1  42 PRO  HA   1 1 
       352 1 2 1 1  43 SER H    1  43 SER  HN   1 1 
       353 1 1 1 1  42 PRO HG2  1  42 PRO  HG1  1 1 
       353 1 2 1 1  43 SER H    1  43 SER  HN   1 1 
       354 1 1 1 1  43 SER H    1  43 SER  HN   1 1 
       354 1 2 1 1  43 SER HA   1  43 SER  HA   1 1 
       355 1 1 1 1  43 SER H    1  43 SER  HN   1 1 
       355 1 2 1 1  43 SER HB2  1  43 SER  HB2  1 1 
       356 1 1 1 1  43 SER H    1  43 SER  HN   1 1 
       356 1 2 1 1  43 SER QB   1  43 SER  HB*  1 1 
       357 1 1 1 1  43 SER H    1  43 SER  HN   1 1 
       357 1 2 1 1  43 SER HB3  1  43 SER  HB1  1 1 
       358 1 1 1 1  43 SER H    1  43 SER  HN   1 1 
       358 1 2 1 1  44 ILE H    1  44 ILE  HN   1 1 
       359 1 1 1 1  43 SER HA   1  43 SER  HA   1 1 
       359 1 2 1 1  43 SER QB   1  43 SER  HB*  1 1 
       360 1 1 1 1  43 SER HA   1  43 SER  HA   1 1 
       360 1 2 1 1  44 ILE H    1  44 ILE  HN   1 1 
       361 1 1 1 1  43 SER QB   1  43 SER  HB*  1 1 
       361 1 2 1 1  44 ILE H    1  44 ILE  HN   1 1 
       362 1 1 1 1  44 ILE H    1  44 ILE  HN   1 1 
       362 1 2 1 1  44 ILE QG   1  44 ILE  HG1* 1 1 
       363 1 1 1 1  44 ILE H    1  44 ILE  HN   1 1 
       363 1 2 1 1  44 ILE MG   1  44 ILE  HG22 1 1 
       364 1 1 1 1  44 ILE H    1  44 ILE  HN   1 1 
       364 1 2 1 1  45 PRO HD2  1  45 PRO  HD2  1 1 
       365 1 1 1 1  44 ILE H    1  44 ILE  HN   1 1 
       365 1 2 1 1  45 PRO QD   1  45 PRO  HD*  1 1 
       366 1 1 1 1  44 ILE H    1  44 ILE  HN   1 1 
       366 1 2 1 1  45 PRO HD3  1  45 PRO  HD1  1 1 
       367 1 1 1 1  44 ILE HA   1  44 ILE  HA   1 1 
       367 1 2 1 1  44 ILE MD   1  44 ILE  HD12 1 1 
       368 1 1 1 1  44 ILE HA   1  44 ILE  HA   1 1 
       368 1 2 1 1  44 ILE QG   1  44 ILE  HG1* 1 1 
       369 1 1 1 1  44 ILE HA   1  44 ILE  HA   1 1 
       369 1 2 1 1  44 ILE MG   1  44 ILE  HG22 1 1 
       370 1 1 1 1  44 ILE HA   1  44 ILE  HA   1 1 
       370 1 2 1 1  45 PRO HD2  1  45 PRO  HD2  1 1 
       371 1 1 1 1  44 ILE HA   1  44 ILE  HA   1 1 
       371 1 2 1 1  45 PRO QD   1  45 PRO  HD*  1 1 
       372 1 1 1 1  44 ILE HA   1  44 ILE  HA   1 1 
       372 1 2 1 1  45 PRO HD3  1  45 PRO  HD1  1 1 
       373 1 1 1 1  44 ILE HA   1  44 ILE  HA   1 1 
       373 1 2 1 1  46 ASP H    1  46 ASP- HN   1 1 
       374 1 1 1 1  44 ILE HB   1  44 ILE  HB   1 1 
       374 1 2 1 1  44 ILE MD   1  44 ILE  HD12 1 1 
       375 1 1 1 1  44 ILE HB   1  44 ILE  HB   1 1 
       375 1 2 1 1  44 ILE QG   1  44 ILE  HG1* 1 1 
       376 1 1 1 1  44 ILE MD   1  44 ILE  HD1* 1 1 
       376 1 2 1 1  44 ILE MG   1  44 ILE  HG2* 1 1 
       377 1 1 1 1  44 ILE MD   1  44 ILE  HD12 1 1 
       377 1 2 1 1  53 TRP HA   1  53 TRP  HA   1 1 
       378 1 1 1 1  44 ILE QG   1  44 ILE  HG1* 1 1 
       378 1 2 1 1  44 ILE MG   1  44 ILE  HG2* 1 1 
       379 1 1 1 1  45 PRO HA   1  45 PRO  HA   1 1 
       379 1 2 1 1  46 ASP H    1  46 ASP- HN   1 1 
       380 1 1 1 1  46 ASP H    1  46 ASP- HN   1 1 
       380 1 2 1 1  46 ASP QB   1  46 ASP- HB*  1 1 
       381 1 1 1 1  46 ASP H    1  46 ASP- HN   1 1 
       381 1 2 1 1  47 PRO HD2  1  47 PRO  HD2  1 1 
       382 1 1 1 1  46 ASP H    1  46 ASP- HN   1 1 
       382 1 2 1 1  47 PRO QD   1  47 PRO  HD*  1 1 
       383 1 1 1 1  46 ASP H    1  46 ASP- HN   1 1 
       383 1 2 1 1  47 PRO HD3  1  47 PRO  HD1  1 1 
       384 1 1 1 1  46 ASP HA   1  46 ASP- HA   1 1 
       384 1 2 1 1  47 PRO HD2  1  47 PRO  HD2  1 1 
       385 1 1 1 1  46 ASP HA   1  46 ASP- HA   1 1 
       385 1 2 1 1  47 PRO QD   1  47 PRO  HD*  1 1 
       386 1 1 1 1  46 ASP HA   1  46 ASP- HA   1 1 
       386 1 2 1 1  47 PRO HD3  1  47 PRO  HD1  1 1 
       387 1 1 1 1  46 ASP HA   1  46 ASP- HA   1 1 
       387 1 2 1 1  48 PHE H    1  48 PHE  HN   1 1 
       388 1 1 1 1  47 PRO HA   1  47 PRO  HA   1 1 
       388 1 2 1 1  50 ALA H    1  50 ALA  HN   1 1 
       389 1 1 1 1  47 PRO HG2  1  47 PRO  HG1  1 1 
       389 1 2 1 1  48 PHE H    1  48 PHE  HN   1 1 
       390 1 1 1 1  47 PRO HG3  1  47 PRO  HG2  1 1 
       390 1 2 1 1  48 PHE H    1  48 PHE  HN   1 1 
       391 1 1 1 1  48 PHE H    1  48 PHE  HN   1 1 
       391 1 2 1 1  48 PHE HB2  1  48 PHE  HB1  1 1 
       392 1 1 1 1  48 PHE H    1  48 PHE  HN   1 1 
       392 1 2 1 1  48 PHE HB3  1  48 PHE  HB2  1 1 
       393 1 1 1 1  48 PHE H    1  48 PHE  HN   1 1 
       393 1 2 1 1  49 HIS H    1  49 HISD HN   1 1 
       394 1 1 1 1  48 PHE HA   1  48 PHE  HA   1 1 
       394 1 2 1 1  48 PHE HD1  1  48 PHE  HD1  1 1 
       395 1 1 1 1  48 PHE HA   1  48 PHE  HA   1 1 
       395 1 2 1 1  48 PHE HD2  1  48 PHE  HD2  1 1 
       396 1 1 1 1  48 PHE HA   1  48 PHE  HA   1 1 
       396 1 2 1 1  49 HIS H    1  49 HISD HN   1 1 
       397 1 1 1 1  48 PHE HB3  1  48 PHE  HB2  1 1 
       397 1 2 1 1  49 HIS H    1  49 HISD HN   1 1 
       398 1 1 1 1  49 HIS H    1  49 HISD HN   1 1 
       398 1 2 1 1  49 HIS HB2  1  49 HISD HB2  1 1 
       399 1 1 1 1  49 HIS H    1  49 HISD HN   1 1 
       399 1 2 1 1  49 HIS QB   1  49 HISD HB*  1 1 
       400 1 1 1 1  49 HIS H    1  49 HISD HN   1 1 
       400 1 2 1 1  49 HIS HB3  1  49 HISD HB1  1 1 
       401 1 1 1 1  49 HIS H    1  49 HISD HN   1 1 
       401 1 2 1 1  50 ALA H    1  50 ALA  HN   1 1 
       402 1 1 1 1  49 HIS HA   1  49 HISD HA   1 1 
       402 1 2 1 1  49 HIS HD2  1  49 HISD HD2  1 1 
       403 1 1 1 1  49 HIS HA   1  49 HISD HA   1 1 
       403 1 2 1 1  50 ALA H    1  50 ALA  HN   1 1 
       404 1 1 1 1  49 HIS QB   1  49 HISD HB*  1 1 
       404 1 2 1 1  50 ALA H    1  50 ALA  HN   1 1 
       405 1 1 1 1  49 HIS HD2  1  49 HISD HD2  1 1 
       405 1 2 1 1  51 GLN QE   1  51 GLN  HE2* 1 1 
       406 1 1 1 1  50 ALA H    1  50 ALA  HN   1 1 
       406 1 2 1 1  50 ALA MB   1  50 ALA  HB2  1 1 
       407 1 1 1 1  50 ALA H    1  50 ALA  HN   1 1 
       407 1 2 1 1  51 GLN H    1  51 GLN  HN   1 1 
       408 1 1 1 1  50 ALA HA   1  50 ALA  HA   1 1 
       408 1 2 1 1  50 ALA MB   1  50 ALA  HB2  1 1 
       409 1 1 1 1  50 ALA HA   1  50 ALA  HA   1 1 
       409 1 2 1 1  51 GLN H    1  51 GLN  HN   1 1 
       410 1 1 1 1  50 ALA MB   1  50 ALA  HB2  1 1 
       410 1 2 1 1  51 GLN H    1  51 GLN  HN   1 1 
       411 1 1 1 1  51 GLN H    1  51 GLN  HN   1 1 
       411 1 2 1 1  51 GLN HB2  1  51 GLN  HB1  1 1 
       412 1 1 1 1  51 GLN H    1  51 GLN  HN   1 1 
       412 1 2 1 1  51 GLN HB3  1  51 GLN  HB2  1 1 
       413 1 1 1 1  51 GLN H    1  51 GLN  HN   1 1 
       413 1 2 1 1  51 GLN QG   1  51 GLN  HG*  1 1 
       414 1 1 1 1  51 GLN HA   1  51 GLN  HA   1 1 
       414 1 2 1 1  51 GLN HB3  1  51 GLN  HB2  1 1 
       415 1 1 1 1  51 GLN HA   1  51 GLN  HA   1 1 
       415 1 2 1 1  52 ARG H    1  52 ARG+ HN   1 1 
       416 1 1 1 1  51 GLN HB2  1  51 GLN  HB1  1 1 
       416 1 2 1 1  52 ARG H    1  52 ARG+ HN   1 1 
       417 1 1 1 1  51 GLN QG   1  51 GLN  HG*  1 1 
       417 1 2 1 1  52 ARG H    1  52 ARG+ HN   1 1 
       418 1 1 1 1  51 GLN HG2  1  51 GLN  HG2  1 1 
       418 1 2 1 1  52 ARG H    1  52 ARG+ HN   1 1 
       419 1 1 1 1  51 GLN HG3  1  51 GLN  HG1  1 1 
       419 1 2 1 1  52 ARG H    1  52 ARG+ HN   1 1 
       420 1 1 1 1  52 ARG H    1  52 ARG+ HN   1 1 
       420 1 2 1 1  52 ARG HA   1  52 ARG+ HA   1 1 
       421 1 1 1 1  52 ARG H    1  52 ARG+ HN   1 1 
       421 1 2 1 1  52 ARG QB   1  52 ARG+ HB1  1 1 
       422 1 1 1 1  52 ARG H    1  52 ARG+ HN   1 1 
       422 1 2 1 1  52 ARG HG2  1  52 ARG+ HG2  1 1 
       423 1 1 1 1  52 ARG H    1  52 ARG+ HN   1 1 
       423 1 2 1 1  52 ARG QG   1  52 ARG+ HG*  1 1 
       424 1 1 1 1  52 ARG H    1  52 ARG+ HN   1 1 
       424 1 2 1 1  52 ARG HG3  1  52 ARG+ HG1  1 1 
       425 1 1 1 1  52 ARG H    1  52 ARG+ HN   1 1 
       425 1 2 1 1  53 TRP H    1  53 TRP  HN   1 1 
       426 1 1 1 1  52 ARG H    1  52 ARG+ HN   1 1 
       426 1 2 1 1  75 PHE QD   1  75 PHE  HD2  1 1 
       427 1 1 1 1  52 ARG HA   1  52 ARG+ HA   1 1 
       427 1 2 1 1  52 ARG QB   1  52 ARG+ HB2  1 1 
       428 1 1 1 1  52 ARG HA   1  52 ARG+ HA   1 1 
       428 1 2 1 1  53 TRP H    1  53 TRP  HN   1 1 
       429 1 1 1 1  52 ARG HA   1  52 ARG+ HA   1 1 
       429 1 2 1 1  74 VAL H    1  74 VAL  HN   1 1 
       430 1 1 1 1  52 ARG HA   1  52 ARG+ HA   1 1 
       430 1 2 1 1  75 PHE HA   1  75 PHE  HA   1 1 
       431 1 1 1 1  52 ARG HA   1  52 ARG+ HA   1 1 
       431 1 2 1 1  76 PHE H    1  76 PHE  HN   1 1 
       432 1 1 1 1  52 ARG HA   1  52 ARG+ HA   1 1 
       432 1 2 1 1  76 PHE HA   1  76 PHE  HA   1 1 
       433 1 1 1 1  52 ARG QB   1  52 ARG+ HB2  1 1 
       433 1 2 1 1  52 ARG QG   1  52 ARG+ HG*  1 1 
       434 1 1 1 1  52 ARG QB   1  52 ARG+ HB2  1 1 
       434 1 2 1 1  53 TRP H    1  53 TRP  HN   1 1 
       435 1 1 1 1  52 ARG QB   1  52 ARG+ HB1  1 1 
       435 1 2 1 1  73 THR MG   1  73 THR  HG21 1 1 
       436 1 1 1 1  52 ARG QB   1  52 ARG+ HB1  1 1 
       436 1 2 1 1  75 PHE HA   1  75 PHE  HA   1 1 
       437 1 1 1 1  52 ARG QB   1  52 ARG+ HB2  1 1 
       437 1 2 1 1  75 PHE QD   1  75 PHE  HD2  1 1 
       438 1 1 1 1  52 ARG QB   1  52 ARG+ HB1  1 1 
       438 1 2 1 1  75 PHE QE   1  75 PHE  HE1  1 1 
       439 1 1 1 1  52 ARG HE   1  52 ARG+ HE   1 1 
       439 1 2 1 1  52 ARG QG   1  52 ARG+ HG*  1 1 
       440 1 1 1 1  52 ARG QG   1  52 ARG+ HG*  1 1 
       440 1 2 1 1  53 TRP H    1  53 TRP  HN   1 1 
       441 1 1 1 1  52 ARG HG2  1  52 ARG+ HG2  1 1 
       441 1 2 1 1  53 TRP H    1  53 TRP  HN   1 1 
       442 1 1 1 1  52 ARG HG2  1  52 ARG+ HG2  1 1 
       442 1 2 1 1  73 THR MG   1  73 THR  HG22 1 1 
       443 1 1 1 1  52 ARG HG3  1  52 ARG+ HG1  1 1 
       443 1 2 1 1  53 TRP H    1  53 TRP  HN   1 1 
       444 1 1 1 1  52 ARG HG3  1  52 ARG+ HG1  1 1 
       444 1 2 1 1  73 THR MG   1  73 THR  HG22 1 1 
       445 1 1 1 1  53 TRP H    1  53 TRP  HN   1 1 
       445 1 2 1 1  53 TRP HB2  1  53 TRP  HB2  1 1 
       446 1 1 1 1  53 TRP H    1  53 TRP  HN   1 1 
       446 1 2 1 1  53 TRP QB   1  53 TRP  HB*  1 1 
       447 1 1 1 1  53 TRP H    1  53 TRP  HN   1 1 
       447 1 2 1 1  53 TRP HB3  1  53 TRP  HB1  1 1 
       448 1 1 1 1  53 TRP H    1  53 TRP  HN   1 1 
       448 1 2 1 1  73 THR HA   1  73 THR  HA   1 1 
       449 1 1 1 1  53 TRP H    1  53 TRP  HN   1 1 
       449 1 2 1 1  74 VAL H    1  74 VAL  HN   1 1 
       450 1 1 1 1  53 TRP H    1  53 TRP  HN   1 1 
       450 1 2 1 1  74 VAL HB   1  74 VAL  HB   1 1 
       451 1 1 1 1  53 TRP H    1  53 TRP  HN   1 1 
       451 1 2 1 1  75 PHE HA   1  75 PHE  HA   1 1 
       452 1 1 1 1  53 TRP H    1  53 TRP  HN   1 1 
       452 1 2 1 1  75 PHE QD   1  75 PHE  HD2  1 1 
       453 1 1 1 1  53 TRP HA   1  53 TRP  HA   1 1 
       453 1 2 1 1  54 ASP H    1  54 ASP- HN   1 1 
       454 1 1 1 1  53 TRP QB   1  53 TRP  HB*  1 1 
       454 1 2 1 1  74 VAL H    1  74 VAL  HN   1 1 
       455 1 1 1 1  53 TRP HE3  1  53 TRP  HE3  1 1 
       455 1 2 1 1  74 VAL MG2  1  74 VAL  HG22 1 1 
       456 1 1 1 1  53 TRP HH2  1  53 TRP  HH2  1 1 
       456 1 2 1 1  72 PHE HE2  1  72 PHE  HE1  1 1 
       457 1 1 1 1  54 ASP H    1  54 ASP- HN   1 1 
       457 1 2 1 1  54 ASP HB2  1  54 ASP- HB2  1 1 
       458 1 1 1 1  54 ASP H    1  54 ASP- HN   1 1 
       458 1 2 1 1  54 ASP QB   1  54 ASP- HB*  1 1 
       459 1 1 1 1  54 ASP H    1  54 ASP- HN   1 1 
       459 1 2 1 1  54 ASP HB3  1  54 ASP- HB1  1 1 
       460 1 1 1 1  54 ASP H    1  54 ASP- HN   1 1 
       460 1 2 1 1  55 TYR H    1  55 TYR  HN   1 1 
       461 1 1 1 1  54 ASP HA   1  54 ASP- HA   1 1 
       461 1 2 1 1  55 TYR H    1  55 TYR  HN   1 1 
       462 1 1 1 1  54 ASP HA   1  54 ASP- HA   1 1 
       462 1 2 1 1  73 THR HA   1  73 THR  HA   1 1 
       463 1 1 1 1  54 ASP HA   1  54 ASP- HA   1 1 
       463 1 2 1 1  73 THR HG1  1  73 THR  HG1  1 1 
       464 1 1 1 1  54 ASP HA   1  54 ASP- HA   1 1 
       464 1 2 1 1  73 THR MG   1  73 THR  HG21 1 1 
       465 1 1 1 1  54 ASP HA   1  54 ASP- HA   1 1 
       465 1 2 1 1  74 VAL H    1  74 VAL  HN   1 1 
       466 1 1 1 1  55 TYR H    1  55 TYR  HN   1 1 
       466 1 2 1 1  55 TYR HB2  1  55 TYR  HB2  1 1 
       467 1 1 1 1  55 TYR H    1  55 TYR  HN   1 1 
       467 1 2 1 1  55 TYR QB   1  55 TYR  HB*  1 1 
       468 1 1 1 1  55 TYR H    1  55 TYR  HN   1 1 
       468 1 2 1 1  55 TYR HB3  1  55 TYR  HB1  1 1 
       469 1 1 1 1  55 TYR H    1  55 TYR  HN   1 1 
       469 1 2 1 1  55 TYR QE   1  55 TYR  HE1  1 1 
       470 1 1 1 1  55 TYR H    1  55 TYR  HN   1 1 
       470 1 2 1 1  56 THR H    1  56 THR  HN   1 1 
       471 1 1 1 1  55 TYR H    1  55 TYR  HN   1 1 
       471 1 2 1 1  73 THR HA   1  73 THR  HA   1 1 
       472 1 1 1 1  55 TYR HA   1  55 TYR  HA   1 1 
       472 1 2 1 1  56 THR H    1  56 THR  HN   1 1 
       473 1 1 1 1  56 THR H    1  56 THR  HN   1 1 
       473 1 2 1 1  56 THR HB   1  56 THR  HB   1 1 
       474 1 1 1 1  56 THR H    1  56 THR  HN   1 1 
       474 1 2 1 1  57 SER H    1  57 SER  HN   1 1 
       475 1 1 1 1  56 THR HA   1  56 THR  HA   1 1 
       475 1 2 1 1  56 THR HG1  1  56 THR  HG1  1 1 
       476 1 1 1 1  56 THR HA   1  56 THR  HA   1 1 
       476 1 2 1 1  56 THR MG   1  56 THR  HG21 1 1 
       477 1 1 1 1  56 THR HA   1  56 THR  HA   1 1 
       477 1 2 1 1  57 SER H    1  57 SER  HN   1 1 
       478 1 1 1 1  56 THR HA   1  56 THR  HA   1 1 
       478 1 2 1 1  71 ASN HA   1  71 ASN  HA   1 1 
       479 1 1 1 1  56 THR HG1  1  56 THR  HG1  1 1 
       479 1 2 1 1  71 ASN HA   1  71 ASN  HA   1 1 
       480 1 1 1 1  56 THR MG   1  56 THR  HG22 1 1 
       480 1 2 1 1  69 ILE MG   1  69 ILE  HG23 1 1 
       481 1 1 1 1  56 THR MG   1  56 THR  HG21 1 1 
       481 1 2 1 1  71 ASN HA   1  71 ASN  HA   1 1 
       482 1 1 1 1  57 SER H    1  57 SER  HN   1 1 
       482 1 2 1 1  57 SER HB2  1  57 SER  HB2  1 1 
       483 1 1 1 1  57 SER H    1  57 SER  HN   1 1 
       483 1 2 1 1  57 SER QB   1  57 SER  HB*  1 1 
       484 1 1 1 1  57 SER H    1  57 SER  HN   1 1 
       484 1 2 1 1  57 SER HB3  1  57 SER  HB1  1 1 
       485 1 1 1 1  57 SER H    1  57 SER  HN   1 1 
       485 1 2 1 1  58 THR H    1  58 THR  HN   1 1 
       486 1 1 1 1  57 SER H    1  57 SER  HN   1 1 
       486 1 2 1 1  71 ASN H    1  71 ASN  HN   1 1 
       487 1 1 1 1  57 SER H    1  57 SER  HN   1 1 
       487 1 2 1 1  71 ASN HA   1  71 ASN  HA   1 1 
       488 1 1 1 1  57 SER HA   1  57 SER  HA   1 1 
       488 1 2 1 1  57 SER QB   1  57 SER  HB*  1 1 
       489 1 1 1 1  57 SER HA   1  57 SER  HA   1 1 
       489 1 2 1 1  58 THR H    1  58 THR  HN   1 1 
       490 1 1 1 1  57 SER HA   1  57 SER  HA   1 1 
       490 1 2 1 1  58 THR HB   1  58 THR  HB   1 1 
       491 1 1 1 1  57 SER QB   1  57 SER  HB*  1 1 
       491 1 2 1 1  58 THR H    1  58 THR  HN   1 1 
       492 1 1 1 1  57 SER HB2  1  57 SER  HB2  1 1 
       492 1 2 1 1  58 THR H    1  58 THR  HN   1 1 
       493 1 1 1 1  57 SER HB3  1  57 SER  HB1  1 1 
       493 1 2 1 1  58 THR H    1  58 THR  HN   1 1 
       494 1 1 1 1  58 THR H    1  58 THR  HN   1 1 
       494 1 2 1 1  58 THR MG   1  58 THR  HG23 1 1 
       495 1 1 1 1  58 THR H    1  58 THR  HN   1 1 
       495 1 2 1 1  59 GLN H    1  59 GLN  HN   1 1 
       496 1 1 1 1  58 THR HA   1  58 THR  HA   1 1 
       496 1 2 1 1  58 THR HB   1  58 THR  HB   1 1 
       497 1 1 1 1  58 THR HA   1  58 THR  HA   1 1 
       497 1 2 1 1  58 THR MG   1  58 THR  HG22 1 1 
       498 1 1 1 1  58 THR HA   1  58 THR  HA   1 1 
       498 1 2 1 1  59 GLN H    1  59 GLN  HN   1 1 
       499 1 1 1 1  58 THR HB   1  58 THR  HB   1 1 
       499 1 2 1 1  59 GLN H    1  59 GLN  HN   1 1 
       500 1 1 1 1  58 THR HB   1  58 THR  HB   1 1 
       500 1 2 1 1  69 ILE QG   1  69 ILE  HG11 1 1 
       501 1 1 1 1  58 THR HB   1  58 THR  HB   1 1 
       501 1 2 1 1  69 ILE MG   1  69 ILE  HG22 1 1 
       502 1 1 1 1  58 THR HG1  1  58 THR  HG1  1 1 
       502 1 2 1 1  59 GLN H    1  59 GLN  HN   1 1 
       503 1 1 1 1  58 THR MG   1  58 THR  HG22 1 1 
       503 1 2 1 1  59 GLN H    1  59 GLN  HN   1 1 
       504 1 1 1 1  59 GLN H    1  59 GLN  HN   1 1 
       504 1 2 1 1  60 ARG H    1  60 ARG+ HN   1 1 
       505 1 1 1 1  59 GLN H    1  59 GLN  HN   1 1 
       505 1 2 1 1  68 GLU H    1  68 GLU- HN   1 1 
       506 1 1 1 1  59 GLN HA   1  59 GLN  HA   1 1 
       506 1 2 1 1  59 GLN QB   1  59 GLN  HB*  1 1 
       507 1 1 1 1  59 GLN HA   1  59 GLN  HA   1 1 
       507 1 2 1 1  60 ARG H    1  60 ARG+ HN   1 1 
       508 1 1 1 1  59 GLN HA   1  59 GLN  HA   1 1 
       508 1 2 1 1  60 ARG QB   1  60 ARG+ HB*  1 1 
       509 1 1 1 1  60 ARG H    1  60 ARG+ HN   1 1 
       509 1 2 1 1  60 ARG HB2  1  60 ARG+ HB2  1 1 
       510 1 1 1 1  60 ARG H    1  60 ARG+ HN   1 1 
       510 1 2 1 1  60 ARG QB   1  60 ARG+ HB*  1 1 
       511 1 1 1 1  60 ARG H    1  60 ARG+ HN   1 1 
       511 1 2 1 1  60 ARG HB3  1  60 ARG+ HB1  1 1 
       512 1 1 1 1  60 ARG H    1  60 ARG+ HN   1 1 
       512 1 2 1 1  61 VAL H    1  61 VAL  HN   1 1 
       513 1 1 1 1  60 ARG HA   1  60 ARG+ HA   1 1 
       513 1 2 1 1  60 ARG QB   1  60 ARG+ HB*  1 1 
       514 1 1 1 1  60 ARG HA   1  60 ARG+ HA   1 1 
       514 1 2 1 1  61 VAL H    1  61 VAL  HN   1 1 
       515 1 1 1 1  60 ARG HA   1  60 ARG+ HA   1 1 
       515 1 2 1 1  62 ASP H    1  62 ASP- HN   1 1 
       516 1 1 1 1  60 ARG HA   1  60 ARG+ HA   1 1 
       516 1 2 1 1  67 THR MG   1  67 THR  HG22 1 1 
       517 1 1 1 1  60 ARG QG   1  60 ARG+ HG*  1 1 
       517 1 2 1 1  61 VAL H    1  61 VAL  HN   1 1 
       518 1 1 1 1  61 VAL H    1  61 VAL  HN   1 1 
       518 1 2 1 1  61 VAL HA   1  61 VAL  HA   1 1 
       519 1 1 1 1  61 VAL H    1  61 VAL  HN   1 1 
       519 1 2 1 1  61 VAL HB   1  61 VAL  HB   1 1 
       520 1 1 1 1  61 VAL H    1  61 VAL  HN   1 1 
       520 1 2 1 1  61 VAL MG1  1  61 VAL  HG13 1 1 
       521 1 1 1 1  61 VAL H    1  61 VAL  HN   1 1 
       521 1 2 1 1  61 VAL MG2  1  61 VAL  HG22 1 1 
       522 1 1 1 1  61 VAL H    1  61 VAL  HN   1 1 
       522 1 2 1 1  62 ASP H    1  62 ASP- HN   1 1 
       523 1 1 1 1  61 VAL H    1  61 VAL  HN   1 1 
       523 1 2 1 1  67 THR HA   1  67 THR  HA   1 1 
       524 1 1 1 1  61 VAL HA   1  61 VAL  HA   1 1 
       524 1 2 1 1  61 VAL HB   1  61 VAL  HB   1 1 
       525 1 1 1 1  61 VAL HA   1  61 VAL  HA   1 1 
       525 1 2 1 1  61 VAL MG2  1  61 VAL  HG22 1 1 
       526 1 1 1 1  61 VAL HA   1  61 VAL  HA   1 1 
       526 1 2 1 1  62 ASP H    1  62 ASP- HN   1 1 
       527 1 1 1 1  61 VAL HB   1  61 VAL  HB   1 1 
       527 1 2 1 1  61 VAL MG1  1  61 VAL  HG13 1 1 
       528 1 1 1 1  61 VAL HB   1  61 VAL  HB   1 1 
       528 1 2 1 1  61 VAL MG2  1  61 VAL  HG22 1 1 
       529 1 1 1 1  62 ASP H    1  62 ASP- HN   1 1 
       529 1 2 1 1  62 ASP HB2  1  62 ASP- HB2  1 1 
       530 1 1 1 1  62 ASP H    1  62 ASP- HN   1 1 
       530 1 2 1 1  62 ASP QB   1  62 ASP- HB*  1 1 
       531 1 1 1 1  62 ASP H    1  62 ASP- HN   1 1 
       531 1 2 1 1  62 ASP HB3  1  62 ASP- HB1  1 1 
       532 1 1 1 1  62 ASP H    1  62 ASP- HN   1 1 
       532 1 2 1 1  63 ARG H    1  63 ARG+ HN   1 1 
       533 1 1 1 1  62 ASP HA   1  62 ASP- HA   1 1 
       533 1 2 1 1  63 ARG H    1  63 ARG+ HN   1 1 
       534 1 1 1 1  62 ASP QB   1  62 ASP- HB*  1 1 
       534 1 2 1 1  63 ARG H    1  63 ARG+ HN   1 1 
       535 1 1 1 1  62 ASP HB2  1  62 ASP- HB2  1 1 
       535 1 2 1 1  63 ARG H    1  63 ARG+ HN   1 1 
       536 1 1 1 1  62 ASP HB3  1  62 ASP- HB1  1 1 
       536 1 2 1 1  63 ARG H    1  63 ARG+ HN   1 1 
       537 1 1 1 1  63 ARG H    1  63 ARG+ HN   1 1 
       537 1 2 1 1  64 LEU H    1  64 LEU  HN   1 1 
       538 1 1 1 1  63 ARG HA   1  63 ARG+ HA   1 1 
       538 1 2 1 1  63 ARG QB   1  63 ARG+ HB*  1 1 
       539 1 1 1 1  63 ARG HA   1  63 ARG+ HA   1 1 
       539 1 2 1 1  63 ARG QG   1  63 ARG+ HG*  1 1 
       540 1 1 1 1  63 ARG HA   1  63 ARG+ HA   1 1 
       540 1 2 1 1  64 LEU H    1  64 LEU  HN   1 1 
       541 1 1 1 1  64 LEU H    1  64 LEU  HN   1 1 
       541 1 2 1 1  64 LEU HA   1  64 LEU  HA   1 1 
       542 1 1 1 1  64 LEU H    1  64 LEU  HN   1 1 
       542 1 2 1 1  64 LEU MD1  1  64 LEU  HD12 1 1 
       543 1 1 1 1  64 LEU H    1  64 LEU  HN   1 1 
       543 1 2 1 1  64 LEU MD2  1  64 LEU  HD22 1 1 
       544 1 1 1 1  64 LEU H    1  64 LEU  HN   1 1 
       544 1 2 1 1  64 LEU HG   1  64 LEU  HG   1 1 
       545 1 1 1 1  64 LEU H    1  64 LEU  HN   1 1 
       545 1 2 1 1  65 ALA H    1  65 ALA  HN   1 1 
       546 1 1 1 1  64 LEU HA   1  64 LEU  HA   1 1 
       546 1 2 1 1  65 ALA H    1  65 ALA  HN   1 1 
       547 1 1 1 1  64 LEU QB   1  64 LEU  HB*  1 1 
       547 1 2 1 1  64 LEU MD1  1  64 LEU  HD11 1 1 
       548 1 1 1 1  64 LEU QB   1  64 LEU  HB*  1 1 
       548 1 2 1 1  65 ALA H    1  65 ALA  HN   1 1 
       549 1 1 1 1  64 LEU MD1  1  64 LEU  HD13 1 1 
       549 1 2 1 1  65 ALA H    1  65 ALA  HN   1 1 
       550 1 1 1 1  65 ALA H    1  65 ALA  HN   1 1 
       550 1 2 1 1  65 ALA MB   1  65 ALA  HB2  1 1 
       551 1 1 1 1  65 ALA HA   1  65 ALA  HA   1 1 
       551 1 2 1 1  65 ALA MB   1  65 ALA  HB2  1 1 
       552 1 1 1 1  65 ALA HA   1  65 ALA  HA   1 1 
       552 1 2 1 1  66 ARG H    1  66 ARG+ HN   1 1 
       553 1 1 1 1  65 ALA MB   1  65 ALA  HB2  1 1 
       553 1 2 1 1  66 ARG H    1  66 ARG+ HN   1 1 
       554 1 1 1 1  66 ARG H    1  66 ARG+ HN   1 1 
       554 1 2 1 1  67 THR H    1  67 THR  HN   1 1 
       555 1 1 1 1  66 ARG HA   1  66 ARG+ HA   1 1 
       555 1 2 1 1  66 ARG QG   1  66 ARG+ HG*  1 1 
       556 1 1 1 1  66 ARG HA   1  66 ARG+ HA   1 1 
       556 1 2 1 1  67 THR H    1  67 THR  HN   1 1 
       557 1 1 1 1  67 THR H    1  67 THR  HN   1 1 
       557 1 2 1 1  67 THR HB   1  67 THR  HB   1 1 
       558 1 1 1 1  67 THR H    1  67 THR  HN   1 1 
       558 1 2 1 1  68 GLU H    1  68 GLU- HN   1 1 
       559 1 1 1 1  67 THR HA   1  67 THR  HA   1 1 
       559 1 2 1 1  67 THR MG   1  67 THR  HG23 1 1 
       560 1 1 1 1  67 THR HA   1  67 THR  HA   1 1 
       560 1 2 1 1  68 GLU H    1  68 GLU- HN   1 1 
       561 1 1 1 1  67 THR HB   1  67 THR  HB   1 1 
       561 1 2 1 1  68 GLU H    1  68 GLU- HN   1 1 
       562 1 1 1 1  68 GLU H    1  68 GLU- HN   1 1 
       562 1 2 1 1  68 GLU HB2  1  68 GLU- HB2  1 1 
       563 1 1 1 1  68 GLU H    1  68 GLU- HN   1 1 
       563 1 2 1 1  68 GLU QB   1  68 GLU- HB*  1 1 
       564 1 1 1 1  68 GLU H    1  68 GLU- HN   1 1 
       564 1 2 1 1  68 GLU HB3  1  68 GLU- HB1  1 1 
       565 1 1 1 1  68 GLU H    1  68 GLU- HN   1 1 
       565 1 2 1 1  69 ILE H    1  69 ILE  HN   1 1 
       566 1 1 1 1  68 GLU HA   1  68 GLU- HA   1 1 
       566 1 2 1 1  68 GLU QG   1  68 GLU- HG*  1 1 
       567 1 1 1 1  68 GLU HA   1  68 GLU- HA   1 1 
       567 1 2 1 1  69 ILE H    1  69 ILE  HN   1 1 
       568 1 1 1 1  69 ILE H    1  69 ILE  HN   1 1 
       568 1 2 1 1  69 ILE HB   1  69 ILE  HB   1 1 
       569 1 1 1 1  69 ILE H    1  69 ILE  HN   1 1 
       569 1 2 1 1  69 ILE MD   1  69 ILE  HD12 1 1 
       570 1 1 1 1  69 ILE H    1  69 ILE  HN   1 1 
       570 1 2 1 1  69 ILE QG   1  69 ILE  HG12 1 1 
       571 1 1 1 1  69 ILE H    1  69 ILE  HN   1 1 
       571 1 2 1 1  69 ILE MG   1  69 ILE  HG23 1 1 
       572 1 1 1 1  69 ILE HA   1  69 ILE  HA   1 1 
       572 1 2 1 1  69 ILE QG   1  69 ILE  HG11 1 1 
       573 1 1 1 1  69 ILE HA   1  69 ILE  HA   1 1 
       573 1 2 1 1  69 ILE MG   1  69 ILE  HG22 1 1 
       574 1 1 1 1  69 ILE HA   1  69 ILE  HA   1 1 
       574 1 2 1 1  70 LYS H    1  70 LYS+ HN   1 1 
       575 1 1 1 1  69 ILE HB   1  69 ILE  HB   1 1 
       575 1 2 1 1  69 ILE MD   1  69 ILE  HD12 1 1 
       576 1 1 1 1  69 ILE HB   1  69 ILE  HB   1 1 
       576 1 2 1 1  69 ILE MG   1  69 ILE  HG22 1 1 
       577 1 1 1 1  69 ILE QG   1  69 ILE  HG11 1 1 
       577 1 2 1 1  69 ILE MG   1  69 ILE  HG2* 1 1 
       578 1 1 1 1  69 ILE QG   1  69 ILE  HG11 1 1 
       578 1 2 1 1  89 PHE QD   1  89 PHE  HD2  1 1 
       579 1 1 1 1  69 ILE MG   1  69 ILE  HG22 1 1 
       579 1 2 1 1  70 LYS H    1  70 LYS+ HN   1 1 
       580 1 1 1 1  70 LYS H    1  70 LYS+ HN   1 1 
       580 1 2 1 1  70 LYS QG   1  70 LYS+ HG*  1 1 
       581 1 1 1 1  70 LYS H    1  70 LYS+ HN   1 1 
       581 1 2 1 1  71 ASN H    1  71 ASN  HN   1 1 
       582 1 1 1 1  70 LYS HA   1  70 LYS+ HA   1 1 
       582 1 2 1 1  70 LYS QB   1  70 LYS+ HB*  1 1 
       583 1 1 1 1  70 LYS HA   1  70 LYS+ HA   1 1 
       583 1 2 1 1  70 LYS QG   1  70 LYS+ HG*  1 1 
       584 1 1 1 1  70 LYS HA   1  70 LYS+ HA   1 1 
       584 1 2 1 1  71 ASN H    1  71 ASN  HN   1 1 
       585 1 1 1 1  70 LYS HA   1  70 LYS+ HA   1 1 
       585 1 2 1 1  88 TYR HA   1  88 TYR  HA   1 1 
       586 1 1 1 1  70 LYS HA   1  70 LYS+ HA   1 1 
       586 1 2 1 1  89 PHE H    1  89 PHE  HN   1 1 
       587 1 1 1 1  71 ASN H    1  71 ASN  HN   1 1 
       587 1 2 1 1  71 ASN HB2  1  71 ASN  HB2  1 1 
       588 1 1 1 1  71 ASN H    1  71 ASN  HN   1 1 
       588 1 2 1 1  71 ASN QB   1  71 ASN  HB*  1 1 
       589 1 1 1 1  71 ASN H    1  71 ASN  HN   1 1 
       589 1 2 1 1  71 ASN HB3  1  71 ASN  HB1  1 1 
       590 1 1 1 1  71 ASN H    1  71 ASN  HN   1 1 
       590 1 2 1 1  72 PHE H    1  72 PHE  HN   1 1 
       591 1 1 1 1  71 ASN H    1  71 ASN  HN   1 1 
       591 1 2 1 1  88 TYR HA   1  88 TYR  HA   1 1 
       592 1 1 1 1  71 ASN H    1  71 ASN  HN   1 1 
       592 1 2 1 1  88 TYR QB   1  88 TYR  HB1  1 1 
       593 1 1 1 1  71 ASN HA   1  71 ASN  HA   1 1 
       593 1 2 1 1  72 PHE H    1  72 PHE  HN   1 1 
       594 1 1 1 1  72 PHE H    1  72 PHE  HN   1 1 
       594 1 2 1 1  73 THR H    1  73 THR  HN   1 1 
       595 1 1 1 1  72 PHE HA   1  72 PHE  HA   1 1 
       595 1 2 1 1  73 THR H    1  73 THR  HN   1 1 
       596 1 1 1 1  72 PHE HA   1  72 PHE  HA   1 1 
       596 1 2 1 1  87 ASP H    1  87 ASP- HN   1 1 
       597 1 1 1 1  72 PHE HE2  1  72 PHE  HE1  1 1 
       597 1 2 1 1  74 VAL MG2  1  74 VAL  HG21 1 1 
       598 1 1 1 1  73 THR H    1  73 THR  HN   1 1 
       598 1 2 1 1  73 THR HB   1  73 THR  HB   1 1 
       599 1 1 1 1  73 THR H    1  73 THR  HN   1 1 
       599 1 2 1 1  74 VAL H    1  74 VAL  HN   1 1 
       600 1 1 1 1  73 THR H    1  73 THR  HN   1 1 
       600 1 2 1 1  86 GLY QA   1  86 GLY  HA*  1 1 
       601 1 1 1 1  73 THR HA   1  73 THR  HA   1 1 
       601 1 2 1 1  73 THR HG1  1  73 THR  HG1  1 1 
       602 1 1 1 1  73 THR HA   1  73 THR  HA   1 1 
       602 1 2 1 1  73 THR MG   1  73 THR  HG21 1 1 
       603 1 1 1 1  73 THR HA   1  73 THR  HA   1 1 
       603 1 2 1 1  74 VAL H    1  74 VAL  HN   1 1 
       604 1 1 1 1  73 THR HB   1  73 THR  HB   1 1 
       604 1 2 1 1  85 GLU H    1  85 GLU- HN   1 1 
       605 1 1 1 1  73 THR HG1  1  73 THR  HG1  1 1 
       605 1 2 1 1  74 VAL H    1  74 VAL  HN   1 1 
       606 1 1 1 1  73 THR MG   1  73 THR  HG21 1 1 
       606 1 2 1 1  74 VAL H    1  74 VAL  HN   1 1 
       607 1 1 1 1  73 THR MG   1  73 THR  HG21 1 1 
       607 1 2 1 1  75 PHE QD   1  75 PHE  HD1  1 1 
       608 1 1 1 1  73 THR MG   1  73 THR  HG22 1 1 
       608 1 2 1 1  75 PHE QE   1  75 PHE  HE1  1 1 
       609 1 1 1 1  74 VAL H    1  74 VAL  HN   1 1 
       609 1 2 1 1  74 VAL HB   1  74 VAL  HB   1 1 
       610 1 1 1 1  74 VAL H    1  74 VAL  HN   1 1 
       610 1 2 1 1  74 VAL MG1  1  74 VAL  HG13 1 1 
       611 1 1 1 1  74 VAL H    1  74 VAL  HN   1 1 
       611 1 2 1 1  74 VAL MG2  1  74 VAL  HG22 1 1 
       612 1 1 1 1  74 VAL H    1  74 VAL  HN   1 1 
       612 1 2 1 1  75 PHE H    1  75 PHE  HN   1 1 
       613 1 1 1 1  74 VAL HA   1  74 VAL  HA   1 1 
       613 1 2 1 1  74 VAL MG1  1  74 VAL  HG13 1 1 
       614 1 1 1 1  74 VAL HA   1  74 VAL  HA   1 1 
       614 1 2 1 1  74 VAL MG2  1  74 VAL  HG22 1 1 
       615 1 1 1 1  74 VAL HA   1  74 VAL  HA   1 1 
       615 1 2 1 1  75 PHE H    1  75 PHE  HN   1 1 
       616 1 1 1 1  74 VAL HA   1  74 VAL  HA   1 1 
       616 1 2 1 1  84 TRP HA   1  84 TRP  HA   1 1 
       617 1 1 1 1  74 VAL HA   1  74 VAL  HA   1 1 
       617 1 2 1 1  85 GLU H    1  85 GLU- HN   1 1 
       618 1 1 1 1  74 VAL HB   1  74 VAL  HB   1 1 
       618 1 2 1 1  85 GLU H    1  85 GLU- HN   1 1 
       619 1 1 1 1  74 VAL MG1  1  74 VAL  HG13 1 1 
       619 1 2 1 1  75 PHE H    1  75 PHE  HN   1 1 
       620 1 1 1 1  74 VAL MG1  1  74 VAL  HG11 1 1 
       620 1 2 1 1  84 TRP HE3  1  84 TRP  HE3  1 1 
       621 1 1 1 1  74 VAL MG2  1  74 VAL  HG22 1 1 
       621 1 2 1 1  75 PHE H    1  75 PHE  HN   1 1 
       622 1 1 1 1  74 VAL MG2  1  74 VAL  HG22 1 1 
       622 1 2 1 1  81 VAL HA   1  81 VAL  HA   1 1 
       623 1 1 1 1  74 VAL MG2  1  74 VAL  HG21 1 1 
       623 1 2 1 1  84 TRP HZ3  1  84 TRP  HZ3  1 1 
       624 1 1 1 1  75 PHE H    1  75 PHE  HN   1 1 
       624 1 2 1 1  75 PHE HB2  1  75 PHE  HB1  1 1 
       625 1 1 1 1  75 PHE H    1  75 PHE  HN   1 1 
       625 1 2 1 1  75 PHE HB3  1  75 PHE  HB2  1 1 
       626 1 1 1 1  75 PHE H    1  75 PHE  HN   1 1 
       626 1 2 1 1  76 PHE H    1  76 PHE  HN   1 1 
       627 1 1 1 1  75 PHE H    1  75 PHE  HN   1 1 
       627 1 2 1 1  84 TRP HA   1  84 TRP  HA   1 1 
       628 1 1 1 1  75 PHE H    1  75 PHE  HN   1 1 
       628 1 2 1 1  84 TRP QB   1  84 TRP  HB*  1 1 
       629 1 1 1 1  75 PHE HA   1  75 PHE  HA   1 1 
       629 1 2 1 1  75 PHE QD   1  75 PHE  HD1  1 1 
       630 1 1 1 1  75 PHE HA   1  75 PHE  HA   1 1 
       630 1 2 1 1  76 PHE H    1  76 PHE  HN   1 1 
       631 1 1 1 1  75 PHE HB2  1  75 PHE  HB1  1 1 
       631 1 2 1 1  83 ARG H    1  83 ARG+ HN   1 1 
       632 1 1 1 1  75 PHE HB3  1  75 PHE  HB2  1 1 
       632 1 2 1 1  76 PHE H    1  76 PHE  HN   1 1 
       633 1 1 1 1  75 PHE HB3  1  75 PHE  HB2  1 1 
       633 1 2 1 1  83 ARG H    1  83 ARG+ HN   1 1 
       634 1 1 1 1  75 PHE QD   1  75 PHE  HD1  1 1 
       634 1 2 1 1  83 ARG QG   1  83 ARG+ HG*  1 1 
       635 1 1 1 1  75 PHE QD   1  75 PHE  HD1  1 1 
       635 1 2 1 1  84 TRP HA   1  84 TRP  HA   1 1 
       636 1 1 1 1  76 PHE H    1  76 PHE  HN   1 1 
       636 1 2 1 1  76 PHE HB2  1  76 PHE  HB2  1 1 
       637 1 1 1 1  76 PHE H    1  76 PHE  HN   1 1 
       637 1 2 1 1  76 PHE QB   1  76 PHE  HB*  1 1 
       638 1 1 1 1  76 PHE H    1  76 PHE  HN   1 1 
       638 1 2 1 1  76 PHE HB3  1  76 PHE  HB1  1 1 
       639 1 1 1 1  76 PHE H    1  76 PHE  HN   1 1 
       639 1 2 1 1  77 GLU H    1  77 GLU- HN   1 1 
       640 1 1 1 1  76 PHE HA   1  76 PHE  HA   1 1 
       640 1 2 1 1  76 PHE HD1  1  76 PHE  HD1  1 1 
       641 1 1 1 1  76 PHE HA   1  76 PHE  HA   1 1 
       641 1 2 1 1  76 PHE HD2  1  76 PHE  HD2  1 1 
       642 1 1 1 1  76 PHE HA   1  76 PHE  HA   1 1 
       642 1 2 1 1  77 GLU H    1  77 GLU- HN   1 1 
       643 1 1 1 1  76 PHE HA   1  76 PHE  HA   1 1 
       643 1 2 1 1  78 ASN H    1  78 ASN  HN   1 1 
       644 1 1 1 1  76 PHE HA   1  76 PHE  HA   1 1 
       644 1 2 1 1  80 GLN HA   1  80 GLN  HA   1 1 
       645 1 1 1 1  76 PHE HA   1  76 PHE  HA   1 1 
       645 1 2 1 1  81 VAL HA   1  81 VAL  HA   1 1 
       646 1 1 1 1  76 PHE HA   1  76 PHE  HA   1 1 
       646 1 2 1 1  82 VAL H    1  82 VAL  HN   1 1 
       647 1 1 1 1  76 PHE HA   1  76 PHE  HA   1 1 
       647 1 2 1 1  82 VAL MG2  1  82 VAL  HG23 1 1 
       648 1 1 1 1  76 PHE HD1  1  76 PHE  HD1  1 1 
       648 1 2 1 1  77 GLU H    1  77 GLU- HN   1 1 
       649 1 1 1 1  76 PHE HD1  1  76 PHE  HD1  1 1 
       649 1 2 1 1  80 GLN H    1  80 GLN  HN   1 1 
       650 1 1 1 1  76 PHE HD1  1  76 PHE  HD1  1 1 
       650 1 2 1 1  81 VAL HA   1  81 VAL  HA   1 1 
       651 1 1 1 1  76 PHE HD1  1  76 PHE  HD1  1 1 
       651 1 2 1 1  81 VAL MG1  1  81 VAL  HG11 1 1 
       652 1 1 1 1  76 PHE HE1  1  76 PHE  HE1  1 1 
       652 1 2 1 1  81 VAL HA   1  81 VAL  HA   1 1 
       653 1 1 1 1  76 PHE HE1  1  76 PHE  HE1  1 1 
       653 1 2 1 1  81 VAL HB   1  81 VAL  HB   1 1 
       654 1 1 1 1  76 PHE HE1  1  76 PHE  HE1  1 1 
       654 1 2 1 1  81 VAL MG1  1  81 VAL  HG12 1 1 
       655 1 1 1 1  76 PHE HE1  1  76 PHE  HE1  1 1 
       655 1 2 1 1  81 VAL MG2  1  81 VAL  HG22 1 1 
       656 1 1 1 1  77 GLU H    1  77 GLU- HN   1 1 
       656 1 2 1 1  78 ASN H    1  78 ASN  HN   1 1 
       657 1 1 1 1  77 GLU H    1  77 GLU- HN   1 1 
       657 1 2 1 1  80 GLN H    1  80 GLN  HN   1 1 
       658 1 1 1 1  77 GLU H    1  77 GLU- HN   1 1 
       658 1 2 1 1  81 VAL HA   1  81 VAL  HA   1 1 
       659 1 1 1 1  77 GLU H    1  77 GLU- HN   1 1 
       659 1 2 1 1  82 VAL MG2  1  82 VAL  HG22 1 1 
       660 1 1 1 1  77 GLU HA   1  77 GLU- HA   1 1 
       660 1 2 1 1  77 GLU QB   1  77 GLU- HB*  1 1 
       661 1 1 1 1  77 GLU HA   1  77 GLU- HA   1 1 
       661 1 2 1 1  78 ASN H    1  78 ASN  HN   1 1 
       662 1 1 1 1  77 GLU QG   1  77 GLU- HG*  1 1 
       662 1 2 1 1  82 VAL MG2  1  82 VAL  HG23 1 1 
       663 1 1 1 1  78 ASN H    1  78 ASN  HN   1 1 
       663 1 2 1 1  78 ASN QB   1  78 ASN  HB*  1 1 
       664 1 1 1 1  78 ASN HA   1  78 ASN  HA   1 1 
       664 1 2 1 1  79 GLU H    1  79 GLU- HN   1 1 
       665 1 1 1 1  79 GLU H    1  79 GLU- HN   1 1 
       665 1 2 1 1  80 GLN H    1  80 GLN  HN   1 1 
       666 1 1 1 1  79 GLU HA   1  79 GLU- HA   1 1 
       666 1 2 1 1  79 GLU QG   1  79 GLU- HG*  1 1 
       667 1 1 1 1  80 GLN H    1  80 GLN  HN   1 1 
       667 1 2 1 1  80 GLN HB3  1  80 GLN  HB2  1 1 
       668 1 1 1 1  80 GLN H    1  80 GLN  HN   1 1 
       668 1 2 1 1  81 VAL H    1  81 VAL  HN   1 1 
       669 1 1 1 1  80 GLN HA   1  80 GLN  HA   1 1 
       669 1 2 1 1  80 GLN HB3  1  80 GLN  HB2  1 1 
       670 1 1 1 1  80 GLN HA   1  80 GLN  HA   1 1 
       670 1 2 1 1  80 GLN QG   1  80 GLN  HG*  1 1 
       671 1 1 1 1  80 GLN HA   1  80 GLN  HA   1 1 
       671 1 2 1 1  81 VAL H    1  81 VAL  HN   1 1 
       672 1 1 1 1  80 GLN HB2  1  80 GLN  HB1  1 1 
       672 1 2 1 1  81 VAL H    1  81 VAL  HN   1 1 
       673 1 1 1 1  81 VAL H    1  81 VAL  HN   1 1 
       673 1 2 1 1  81 VAL HB   1  81 VAL  HB   1 1 
       674 1 1 1 1  81 VAL H    1  81 VAL  HN   1 1 
       674 1 2 1 1  81 VAL MG1  1  81 VAL  HG12 1 1 
       675 1 1 1 1  81 VAL H    1  81 VAL  HN   1 1 
       675 1 2 1 1  81 VAL MG2  1  81 VAL  HG22 1 1 
       676 1 1 1 1  81 VAL H    1  81 VAL  HN   1 1 
       676 1 2 1 1  82 VAL H    1  82 VAL  HN   1 1 
       677 1 1 1 1  81 VAL HA   1  81 VAL  HA   1 1 
       677 1 2 1 1  81 VAL MG1  1  81 VAL  HG13 1 1 
       678 1 1 1 1  81 VAL HA   1  81 VAL  HA   1 1 
       678 1 2 1 1  81 VAL MG2  1  81 VAL  HG22 1 1 
       679 1 1 1 1  81 VAL HA   1  81 VAL  HA   1 1 
       679 1 2 1 1  82 VAL H    1  82 VAL  HN   1 1 
       680 1 1 1 1  81 VAL HB   1  81 VAL  HB   1 1 
       680 1 2 1 1  81 VAL MG1  1  81 VAL  HG13 1 1 
       681 1 1 1 1  81 VAL HB   1  81 VAL  HB   1 1 
       681 1 2 1 1  81 VAL MG2  1  81 VAL  HG22 1 1 
       682 1 1 1 1  81 VAL MG1  1  81 VAL  HG11 1 1 
       682 1 2 1 1  82 VAL HA   1  82 VAL  HA   1 1 
       683 1 1 1 1  82 VAL H    1  82 VAL  HN   1 1 
       683 1 2 1 1  83 ARG H    1  83 ARG+ HN   1 1 
       684 1 1 1 1  82 VAL HA   1  82 VAL  HA   1 1 
       684 1 2 1 1  82 VAL MG1  1  82 VAL  HG13 1 1 
       685 1 1 1 1  82 VAL HA   1  82 VAL  HA   1 1 
       685 1 2 1 1  82 VAL MG2  1  82 VAL  HG22 1 1 
       686 1 1 1 1  82 VAL HA   1  82 VAL  HA   1 1 
       686 1 2 1 1  83 ARG H    1  83 ARG+ HN   1 1 
       687 1 1 1 1  82 VAL HB   1  82 VAL  HB   1 1 
       687 1 2 1 1  82 VAL MG1  1  82 VAL  HG13 1 1 
       688 1 1 1 1  82 VAL HB   1  82 VAL  HB   1 1 
       688 1 2 1 1  83 ARG H    1  83 ARG+ HN   1 1 
       689 1 1 1 1  83 ARG H    1  83 ARG+ HN   1 1 
       689 1 2 1 1  83 ARG HE   1  83 ARG+ HE   1 1 
       690 1 1 1 1  83 ARG H    1  83 ARG+ HN   1 1 
       690 1 2 1 1  83 ARG QG   1  83 ARG+ HG*  1 1 
       691 1 1 1 1  83 ARG HA   1  83 ARG+ HA   1 1 
       691 1 2 1 1  83 ARG HB3  1  83 ARG+ HB2  1 1 
       692 1 1 1 1  83 ARG HA   1  83 ARG+ HA   1 1 
       692 1 2 1 1  83 ARG QG   1  83 ARG+ HG*  1 1 
       693 1 1 1 1  83 ARG HA   1  83 ARG+ HA   1 1 
       693 1 2 1 1  84 TRP H    1  84 TRP  HN   1 1 
       694 1 1 1 1  83 ARG HB2  1  83 ARG+ HB1  1 1 
       694 1 2 1 1  84 TRP H    1  84 TRP  HN   1 1 
       695 1 1 1 1  83 ARG HE   1  83 ARG+ HE   1 1 
       695 1 2 1 1  84 TRP H    1  84 TRP  HN   1 1 
       696 1 1 1 1  84 TRP H    1  84 TRP  HN   1 1 
       696 1 2 1 1  84 TRP HB2  1  84 TRP  HB2  1 1 
       697 1 1 1 1  84 TRP H    1  84 TRP  HN   1 1 
       697 1 2 1 1  84 TRP QB   1  84 TRP  HB*  1 1 
       698 1 1 1 1  84 TRP H    1  84 TRP  HN   1 1 
       698 1 2 1 1  84 TRP HB3  1  84 TRP  HB1  1 1 
       699 1 1 1 1  84 TRP H    1  84 TRP  HN   1 1 
       699 1 2 1 1  85 GLU H    1  85 GLU- HN   1 1 
       700 1 1 1 1  84 TRP HA   1  84 TRP  HA   1 1 
       700 1 2 1 1  85 GLU H    1  85 GLU- HN   1 1 
       701 1 1 1 1  84 TRP QB   1  84 TRP  HB*  1 1 
       701 1 2 1 1  85 GLU H    1  85 GLU- HN   1 1 
       702 1 1 1 1  85 GLU H    1  85 GLU- HN   1 1 
       702 1 2 1 1  86 GLY H    1  86 GLY  HN   1 1 
       703 1 1 1 1  85 GLU HA   1  85 GLU- HA   1 1 
       703 1 2 1 1  85 GLU QB   1  85 GLU- HB*  1 1 
       704 1 1 1 1  85 GLU HA   1  85 GLU- HA   1 1 
       704 1 2 1 1  85 GLU QG   1  85 GLU- HG*  1 1 
       705 1 1 1 1  85 GLU HA   1  85 GLU- HA   1 1 
       705 1 2 1 1  86 GLY H    1  86 GLY  HN   1 1 
       706 1 1 1 1  86 GLY H    1  86 GLY  HN   1 1 
       706 1 2 1 1  86 GLY QA   1  86 GLY  HA*  1 1 
       707 1 1 1 1  86 GLY H    1  86 GLY  HN   1 1 
       707 1 2 1 1  87 ASP H    1  87 ASP- HN   1 1 
       708 1 1 1 1  86 GLY QA   1  86 GLY  HA*  1 1 
       708 1 2 1 1  87 ASP H    1  87 ASP- HN   1 1 
       709 1 1 1 1  86 GLY HA2  1  86 GLY  HA2  1 1 
       709 1 2 1 1  87 ASP H    1  87 ASP- HN   1 1 
       710 1 1 1 1  86 GLY HA3  1  86 GLY  HA1  1 1 
       710 1 2 1 1  87 ASP H    1  87 ASP- HN   1 1 
       711 1 1 1 1  87 ASP H    1  87 ASP- HN   1 1 
       711 1 2 1 1  88 TYR QB   1  88 TYR  HB*  1 1 
       712 1 1 1 1  88 TYR H    1  88 TYR  HN   1 1 
       712 1 2 1 1  88 TYR QB   1  88 TYR  HB1  1 1 
       713 1 1 1 1  88 TYR H    1  88 TYR  HN   1 1 
       713 1 2 1 1  89 PHE H    1  89 PHE  HN   1 1 
       714 1 1 1 1  88 TYR HA   1  88 TYR  HA   1 1 
       714 1 2 1 1  88 TYR QD   1  88 TYR  HD1  1 1 
       715 1 1 1 1  88 TYR HA   1  88 TYR  HA   1 1 
       715 1 2 1 1  89 PHE H    1  89 PHE  HN   1 1 
       716 1 1 1 1  89 PHE HA   1  89 PHE  HA   1 1 
       716 1 2 1 1  89 PHE QB   1  89 PHE  HB*  1 1 
       717 1 1 1 1  89 PHE HA   1  89 PHE  HA   1 1 
       717 1 2 1 1  90 PRO HD2  1  90 PRO  HD1  1 1 
       718 1 1 1 1  89 PHE HA   1  89 PHE  HA   1 1 
       718 1 2 1 1  90 PRO HD3  1  90 PRO  HD2  1 1 
       719 1 1 1 1  90 PRO HA   1  90 PRO  HA   1 1 
       719 1 2 1 1  91 SER H    1  91 SER  HN   1 1 
       720 1 1 1 1  90 PRO HD2  1  90 PRO  HD1  1 1 
       720 1 2 1 1  91 SER H    1  91 SER  HN   1 1 
       721 1 1 1 1  90 PRO HD3  1  90 PRO  HD2  1 1 
       721 1 2 1 1  91 SER H    1  91 SER  HN   1 1 
       722 1 1 1 1  91 SER H    1  91 SER  HN   1 1 
       722 1 2 1 1  92 GLN H    1  92 GLN  HN   1 1 
       723 1 1 1 1  91 SER HA   1  91 SER  HA   1 1 
       723 1 2 1 1  91 SER QB   1  91 SER  HB*  1 1 
       724 1 1 1 1  91 SER HA   1  91 SER  HA   1 1 
       724 1 2 1 1  92 GLN H    1  92 GLN  HN   1 1 
       725 1 1 1 1  92 GLN H    1  92 GLN  HN   1 1 
       725 1 2 1 1  93 ASP H    1  93 ASP- HN   1 1 
       726 1 1 1 1  92 GLN HA   1  92 GLN  HA   1 1 
       726 1 2 1 1  92 GLN QB   1  92 GLN  HB*  1 1 
       727 1 1 1 1  92 GLN HA   1  92 GLN  HA   1 1 
       727 1 2 1 1  92 GLN QG   1  92 GLN  HG*  1 1 
       728 1 1 1 1  92 GLN HA   1  92 GLN  HA   1 1 
       728 1 2 1 1  93 ASP H    1  93 ASP- HN   1 1 
       729 1 1 1 1  93 ASP H    1  93 ASP- HN   1 1 
       729 1 2 1 1  93 ASP HA   1  93 ASP- HA   1 1 
       730 1 1 1 1  93 ASP H    1  93 ASP- HN   1 1 
       730 1 2 1 1  94 GLU H    1  94 GLU- HN   1 1 
       731 1 1 1 1  93 ASP HA   1  93 ASP- HA   1 1 
       731 1 2 1 1  93 ASP QB   1  93 ASP- HB*  1 1 
       732 1 1 1 1  93 ASP HA   1  93 ASP- HA   1 1 
       732 1 2 1 1  94 GLU H    1  94 GLU- HN   1 1 
       733 1 1 1 1  93 ASP HA   1  93 ASP- HA   1 1 
       733 1 2 1 1  95 GLN H    1  95 GLN  HN   1 1 
       734 1 1 1 1  94 GLU H    1  94 GLU- HN   1 1 
       734 1 2 1 1  94 GLU HA   1  94 GLU- HA   1 1 
       735 1 1 1 1  94 GLU H    1  94 GLU- HN   1 1 
       735 1 2 1 1  94 GLU QG   1  94 GLU- HG*  1 1 
       736 1 1 1 1  94 GLU H    1  94 GLU- HN   1 1 
       736 1 2 1 1  95 GLN H    1  95 GLN  HN   1 1 
       737 1 1 1 1  94 GLU HA   1  94 GLU- HA   1 1 
       737 1 2 1 1  95 GLN H    1  95 GLN  HN   1 1 
       738 1 1 1 1  95 GLN H    1  95 GLN  HN   1 1 
       738 1 2 1 1  95 GLN QB   1  95 GLN  HB*  1 1 
       739 1 1 1 1  95 GLN H    1  95 GLN  HN   1 1 
       739 1 2 1 1  95 GLN QG   1  95 GLN  HG*  1 1 
       740 1 1 1 1  95 GLN H    1  95 GLN  HN   1 1 
       740 1 2 1 1  96 LEU H    1  96 LEU  HN   1 1 
       741 1 1 1 1  95 GLN HA   1  95 GLN  HA   1 1 
       741 1 2 1 1  96 LEU H    1  96 LEU  HN   1 1 
       742 1 1 1 1  96 LEU H    1  96 LEU  HN   1 1 
       742 1 2 1 1  96 LEU HA   1  96 LEU  HA   1 1 
       743 1 1 1 1  96 LEU H    1  96 LEU  HN   1 1 
       743 1 2 1 1  96 LEU QB   1  96 LEU  HB*  1 1 
       744 1 1 1 1  96 LEU HA   1  96 LEU  HA   1 1 
       744 1 2 1 1  97 ALA H    1  97 ALA  HN   1 1 
       745 1 1 1 1  96 LEU QB   1  96 LEU  HB*  1 1 
       745 1 2 1 1  97 ALA H    1  97 ALA  HN   1 1 
       746 1 1 1 1  97 ALA H    1  97 ALA  HN   1 1 
       746 1 2 1 1  97 ALA HA   1  97 ALA  HA   1 1 
       747 1 1 1 1  97 ALA H    1  97 ALA  HN   1 1 
       747 1 2 1 1  97 ALA MB   1  97 ALA  HB3  1 1 
       748 1 1 1 1  97 ALA HA   1  97 ALA  HA   1 1 
       748 1 2 1 1  97 ALA MB   1  97 ALA  HB2  1 1 
       749 1 1 1 1  97 ALA HA   1  97 ALA  HA   1 1 
       749 1 2 1 1  98 LYS H    1  98 LYS+ HN   1 1 
       750 1 1 1 1  98 LYS HA   1  98 LYS+ HA   1 1 
       750 1 2 1 1  99 ALA H    1  99 ALA  HN   1 1 
       751 1 1 1 1  98 LYS QB   1  98 LYS+ HB*  1 1 
       751 1 2 1 1  99 ALA H    1  99 ALA  HN   1 1 
       752 1 1 1 1  99 ALA H    1  99 ALA  HN   1 1 
       752 1 2 1 1  99 ALA HA   1  99 ALA  HA   1 1 
       753 1 1 1 1  99 ALA H    1  99 ALA  HN   1 1 
       753 1 2 1 1  99 ALA MB   1  99 ALA  HB2  1 1 
       754 1 1 1 1  99 ALA H    1  99 ALA  HN   1 1 
       754 1 2 1 1 100 ALA H    1 100 ALA  HN   1 1 
       755 1 1 1 1  99 ALA HA   1  99 ALA  HA   1 1 
       755 1 2 1 1  99 ALA MB   1  99 ALA  HB2  1 1 
       756 1 1 1 1  99 ALA MB   1  99 ALA  HB3  1 1 
       756 1 2 1 1 100 ALA H    1 100 ALA  HN   1 1 
       757 1 1 1 1 100 ALA H    1 100 ALA  HN   1 1 
       757 1 2 1 1 100 ALA MB   1 100 ALA  HB2  1 1 
       758 1 1 1 1 100 ALA H    1 100 ALA  HN   1 1 
       758 1 2 1 1 102 LYS H    1 102 LYS+ HN   1 1 
       759 1 1 1 1 100 ALA HA   1 100 ALA  HA   1 1 
       759 1 2 1 1 101 PRO HD2  1 101 PRO  HD2  1 1 
       760 1 1 1 1 100 ALA HA   1 100 ALA  HA   1 1 
       760 1 2 1 1 101 PRO QD   1 101 PRO  HD*  1 1 
       761 1 1 1 1 100 ALA HA   1 100 ALA  HA   1 1 
       761 1 2 1 1 101 PRO HD3  1 101 PRO  HD1  1 1 
       762 1 1 1 1 101 PRO HA   1 101 PRO  HA   1 1 
       762 1 2 1 1 102 LYS H    1 102 LYS+ HN   1 1 
       763 1 1 1 1 102 LYS HA   1 102 LYS+ HA   1 1 
       763 1 2 1 1 102 LYS QB   1 102 LYS+ HB*  1 1 
       764 1 1 1 1 102 LYS HA   1 102 LYS+ HA   1 1 
       764 1 2 1 1 103 GLN H    1 103 GLN  HN   1 1 
       765 1 1 1 1 103 GLN H    1 103 GLN  HN   1 1 
       765 1 2 1 1 104 PHE H    1 104 PHE  HN   1 1 
       766 1 1 1 1 103 GLN HA   1 103 GLN  HA   1 1 
       766 1 2 1 1 104 PHE H    1 104 PHE  HN   1 1 
       767 1 1 1 1 104 PHE H    1 104 PHE  HN   1 1 
       767 1 2 1 1 105 GLY H    1 105 GLY  HN   1 1 
       768 1 1 1 1 104 PHE HA   1 104 PHE  HA   1 1 
       768 1 2 1 1 104 PHE QB   1 104 PHE  HB*  1 1 
       769 1 1 1 1 104 PHE HA   1 104 PHE  HA   1 1 
       769 1 2 1 1 105 GLY H    1 105 GLY  HN   1 1 
       770 1 1 1 1 105 GLY H    1 105 GLY  HN   1 1 
       770 1 2 1 1 105 GLY QA   1 105 GLY  HA*  1 1 
       771 1 1 1 1 105 GLY H    1 105 GLY  HN   1 1 
       771 1 2 1 1 106 ARG H    1 106 ARG+ HN   1 1 
       772 1 1 1 1 105 GLY QA   1 105 GLY  HA*  1 1 
       772 1 2 1 1 106 ARG H    1 106 ARG+ HN   1 1 
       773 1 1 1 1 105 GLY HA2  1 105 GLY  HA2  1 1 
       773 1 2 1 1 106 ARG H    1 106 ARG+ HN   1 1 
       774 1 1 1 1 105 GLY HA3  1 105 GLY  HA1  1 1 
       774 1 2 1 1 106 ARG H    1 106 ARG+ HN   1 1 
       775 1 1 1 1 106 ARG H    1 106 ARG+ HN   1 1 
       775 1 2 1 1 106 ARG QB   1 106 ARG+ HB*  1 1 
       776 1 1 1 1 106 ARG H    1 106 ARG+ HN   1 1 
       776 1 2 1 1 107 ASN H    1 107 ASN  HN   1 1 
       777 1 1 1 1 106 ARG HA   1 106 ARG+ HA   1 1 
       777 1 2 1 1 107 ASN H    1 107 ASN  HN   1 1 
       778 1 1 1 1 107 ASN H    1 107 ASN  HN   1 1 
       778 1 2 1 1 107 ASN QB   1 107 ASN  HB*  1 1 
       779 1 1 1 1 107 ASN H    1 107 ASN  HN   1 1 
       779 1 2 1 1 107 ASN QD   1 107 ASN  HD2* 1 1 
       780 1 1 1 1 107 ASN H    1 107 ASN  HN   1 1 
       780 1 2 1 1 108 LEU H    1 108 LEU  HN   1 1 
       781 1 1 1 1 107 ASN HA   1 107 ASN  HA   1 1 
       781 1 2 1 1 108 LEU H    1 108 LEU  HN   1 1 
       782 1 1 1 1 108 LEU H    1 108 LEU  HN   1 1 
       782 1 2 1 1 108 LEU HA   1 108 LEU  HA   1 1 
       783 1 1 1 1 108 LEU H    1 108 LEU  HN   1 1 
       783 1 2 1 1 108 LEU QB   1 108 LEU  HB*  1 1 
       784 1 1 1 1 108 LEU H    1 108 LEU  HN   1 1 
       784 1 2 1 1 109 ALA H    1 109 ALA  HN   1 1 
       785 1 1 1 1 108 LEU HA   1 108 LEU  HA   1 1 
       785 1 2 1 1 109 ALA H    1 109 ALA  HN   1 1 
       786 1 1 1 1 109 ALA H    1 109 ALA  HN   1 1 
       786 1 2 1 1 109 ALA MB   1 109 ALA  HB2  1 1 
       787 1 1 1 1 109 ALA H    1 109 ALA  HN   1 1 
       787 1 2 1 1 110 ARG H    1 110 ARG+ HN   1 1 
       788 1 1 1 1 109 ALA HA   1 109 ALA  HA   1 1 
       788 1 2 1 1 110 ARG H    1 110 ARG+ HN   1 1 
       789 1 1 1 1 109 ALA MB   1 109 ALA  HB3  1 1 
       789 1 2 1 1 110 ARG H    1 110 ARG+ HN   1 1 
       790 1 1 1 1 110 ARG H    1 110 ARG+ HN   1 1 
       790 1 2 1 1 110 ARG QB   1 110 ARG+ HB*  1 1 
       791 1 1 1 1 110 ARG H    1 110 ARG+ HN   1 1 
       791 1 2 1 1 111 ASP H    1 111 ASP- HN   1 1 
       792 1 1 1 1 110 ARG HA   1 110 ARG+ HA   1 1 
       792 1 2 1 1 110 ARG QB   1 110 ARG+ HB*  1 1 
       793 1 1 1 1 110 ARG HA   1 110 ARG+ HA   1 1 
       793 1 2 1 1 111 ASP H    1 111 ASP- HN   1 1 
       794 1 1 1 1 111 ASP H    1 111 ASP- HN   1 1 
       794 1 2 1 1 111 ASP HA   1 111 ASP- HA   1 1 
       795 1 1 1 1 111 ASP H    1 111 ASP- HN   1 1 
       795 1 2 1 1 111 ASP QB   1 111 ASP- HB*  1 1 
       796 1 1 1 1 111 ASP H    1 111 ASP- HN   1 1 
       796 1 2 1 1 112 LYS H    1 112 LYS+ HN   1 1 
       797 1 1 1 1 111 ASP HA   1 111 ASP- HA   1 1 
       797 1 2 1 1 111 ASP QB   1 111 ASP- HB*  1 1 
       798 1 1 1 1 111 ASP HA   1 111 ASP- HA   1 1 
       798 1 2 1 1 112 LYS H    1 112 LYS+ HN   1 1 
       799 1 1 1 1 111 ASP QB   1 111 ASP- HB*  1 1 
       799 1 2 1 1 112 LYS H    1 112 LYS+ HN   1 1 
       800 1 1 1 1 112 LYS H    1 112 LYS+ HN   1 1 
       800 1 2 1 1 112 LYS HA   1 112 LYS+ HA   1 1 
       801 1 1 1 1 112 LYS H    1 112 LYS+ HN   1 1 
       801 1 2 1 1 112 LYS QB   1 112 LYS+ HB*  1 1 
       802 1 1 1 1 112 LYS H    1 112 LYS+ HN   1 1 
       802 1 2 1 1 113 LYS H    1 113 LYS+ HN   1 1 
       803 1 1 1 1 112 LYS HA   1 112 LYS+ HA   1 1 
       803 1 2 1 1 113 LYS H    1 113 LYS+ HN   1 1 
       804 1 1 1 1 113 LYS H    1 113 LYS+ HN   1 1 
       804 1 2 1 1 114 LYS H    1 114 LYS+ HN   1 1 
       805 1 1 1 1 113 LYS HA   1 113 LYS+ HA   1 1 
       805 1 2 1 1 114 LYS H    1 114 LYS+ HN   1 1 
       806 1 1 1 1 114 LYS H    1 114 LYS+ HN   1 1 
       806 1 2 1 1 115 GLN H    1 115 GLN  HN   1 1 
       807 1 1 1 1 114 LYS HA   1 114 LYS+ HA   1 1 
       807 1 2 1 1 115 GLN H    1 115 GLN  HN   1 1 
       808 1 1 1 1 115 GLN H    1 115 GLN  HN   1 1 
       808 1 2 1 1 115 GLN HA   1 115 GLN  HA   1 1 
       809 1 1 1 1 115 GLN H    1 115 GLN  HN   1 1 
       809 1 2 1 1 115 GLN QB   1 115 GLN  HB*  1 1 
       810 1 1 1 1 115 GLN H    1 115 GLN  HN   1 1 
       810 1 2 1 1 116 ARG H    1 116 ARG+ HN   1 1 
       811 1 1 1 1 115 GLN HA   1 115 GLN  HA   1 1 
       811 1 2 1 1 116 ARG H    1 116 ARG+ HN   1 1 
       812 1 1 1 1 116 ARG H    1 116 ARG+ HN   1 1 
       812 1 2 1 1 116 ARG QB   1 116 ARG+ HB*  1 1 
       813 1 1 1 1 116 ARG H    1 116 ARG+ HN   1 1 
       813 1 2 1 1 117 GLY H    1 117 GLY  HN   1 1 
       814 1 1 1 1 116 ARG HA   1 116 ARG+ HA   1 1 
       814 1 2 1 1 117 GLY H    1 117 GLY  HN   1 1 
       815 1 1 1 1 116 ARG QG   1 116 ARG+ HG*  1 1 
       815 1 2 1 1 117 GLY H    1 117 GLY  HN   1 1 
       816 1 1 1 1 117 GLY H    1 117 GLY  HN   1 1 
       816 1 2 1 1 117 GLY HA2  1 117 GLY  HA2  1 1 
       817 1 1 1 1 117 GLY H    1 117 GLY  HN   1 1 
       817 1 2 1 1 117 GLY QA   1 117 GLY  HA*  1 1 
       818 1 1 1 1 117 GLY H    1 117 GLY  HN   1 1 
       818 1 2 1 1 117 GLY HA3  1 117 GLY  HA1  1 1 
       819 1 1 1 1 117 GLY H    1 117 GLY  HN   1 1 
       819 1 2 1 1 118 ARG H    1 118 AR+C HN   1 1 
       820 1 1 1 1 117 GLY QA   1 117 GLY  HA*  1 1 
       820 1 2 1 1 118 ARG H    1 118 AR+C HN   1 1 
       821 1 1 1 1 117 GLY HA2  1 117 GLY  HA2  1 1 
       821 1 2 1 1 118 ARG H    1 118 AR+C HN   1 1 
       822 1 1 1 1 117 GLY HA3  1 117 GLY  HA1  1 1 
       822 1 2 1 1 118 ARG H    1 118 AR+C HN   1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

         1 1 . . . . . 4.54 1.9 4.54 1 1 
         2 1 . . . . . 4.35 1.9 4.35 1 1 
         3 1 . . . . . 2.49 1.9 2.49 1 1 
         4 1 . . . . . 2.27 1.9 2.27 1 1 
         5 1 . . . . . 2.56 1.9 2.56 1 1 
         6 1 . . . . . 3.93 1.9 3.93 1 1 
         7 1 . . . . . 2.97 1.9 2.97 1 1 
         8 1 . . . . . 4.12 1.9 4.12 1 1 
         9 1 . . . . . 2.25 1.9 2.25 1 1 
        10 1 . . . . . 4.63 1.9 4.63 1 1 
        11 1 . . . . . 4.63 1.9 4.63 1 1 
        12 1 . . . . . 2.55 1.9 2.55 1 1 
        13 1 . . . . . 3.84 1.9 3.84 1 1 
        14 1 . . . . . 2.99 1.9 2.99 1 1 
        15 1 . . . . . 3.76 1.9 3.76 1 1 
        16 1 . . . . . 2.68 1.9 2.68 1 1 
        17 1 . . . . .  3.9 1.9  3.9 1 1 
        18 1 . . . . . 2.48 1.9 2.48 1 1 
        19 1 . . . . . 3.39 1.9 3.39 1 1 
        20 1 . . . . . 2.32 1.9 2.32 1 1 
        21 1 . . . . .  4.6 1.9  4.6 1 1 
        22 1 . . . . . 2.65 1.9 2.65 1 1 
        23 1 . . . . . 3.47 1.9 3.47 1 1 
        24 1 . . . . . 3.94 1.9 3.94 1 1 
        25 1 . . . . .  2.4 1.9  2.4 1 1 
        26 1 . . . . . 3.95 1.9 3.95 1 1 
        27 1 . . . . . 2.28 1.9 2.28 1 1 
        28 1 . . . . . 3.81 1.9 3.81 1 1 
        29 1 . . . . . 2.92 1.9 2.92 1 1 
        30 1 . . . . . 3.35 1.9 3.35 1 1 
        31 1 . . . . . 4.39 1.9 4.39 1 1 
        32 1 . . . . . 2.24 1.9 2.24 1 1 
        33 1 . . . . . 4.52 1.9 4.52 1 1 
        34 1 . . . . . 6.08 1.9 6.08 1 1 
        35 1 . . . . . 3.98 1.9 3.98 1 1 
        36 1 . . . . . 2.19 1.9 2.19 1 1 
        37 1 . . . . .  5.4 1.9  5.4 1 1 
        38 1 . . . . . 3.86 1.9 3.86 1 1 
        39 1 . . . . . 4.75 1.9 4.75 1 1 
        40 1 . . . . .  2.6 1.9  2.6 1 1 
        41 1 . . . . . 2.46 1.9 2.46 1 1 
        42 1 . . . . . 2.22 1.9 2.22 1 1 
        43 1 . . . . . 2.46 1.9 2.46 1 1 
        44 1 . . . . . 5.36 1.9 5.36 1 1 
        45 1 . . . . . 2.38 1.9 2.38 1 1 
        46 1 . . . . . 2.93 1.9 2.93 1 1 
        47 1 . . . . . 5.55 1.9 5.55 1 1 
        48 1 . . . . . 3.83 1.9 3.83 1 1 
        49 1 . . . . . 2.41 1.9 2.41 1 1 
        50 1 . . . . . 3.81 1.9 3.81 1 1 
        51 1 . . . . . 3.64 1.9 3.64 1 1 
        52 1 . . . . . 2.25 1.9 2.25 1 1 
        53 1 . . . . . 4.47 1.9 4.47 1 1 
        54 1 . . . . . 5.35 1.9 5.35 1 1 
        55 1 . . . . . 4.98 1.9 4.98 1 1 
        56 1 . . . . . 2.93 1.9 2.93 1 1 
        57 1 . . . . . 5.19 1.9 5.19 1 1 
        58 1 . . . . . 4.01 1.9 4.01 1 1 
        59 1 . . . . . 4.34 1.9 4.34 1 1 
        60 1 . . . . .  2.2 1.9  2.2 1 1 
        61 1 . . . . .  2.8 1.9  2.8 1 1 
        62 1 . . . . . 2.46 1.9 2.46 1 1 
        63 1 . . . . . 4.71 1.9 4.71 1 1 
        64 1 . . . . . 3.13 1.9 3.13 1 1 
        65 1 . . . . . 2.41 1.9 2.41 1 1 
        66 1 . . . . .  4.0 1.9  4.0 1 1 
        67 1 . . . . . 3.44 1.9 3.44 1 1 
        68 1 . . . . . 4.77 1.9 4.77 1 1 
        69 1 . . . . . 4.15 1.9 4.15 1 1 
        70 1 . . . . . 4.45 1.9 4.45 1 1 
        71 1 . . . . . 4.83 1.9 4.83 1 1 
        72 1 . . . . . 4.83 1.9 4.83 1 1 
        73 1 . . . . . 3.61 1.9 3.61 1 1 
        74 1 . . . . . 2.98 1.9 2.98 1 1 
        75 1 . . . . . 2.78 1.9 2.78 1 1 
        76 1 . . . . . 3.36 1.9 3.36 1 1 
        77 1 . . . . . 3.23 1.9 3.23 1 1 
        78 1 . . . . . 3.58 1.9 3.58 1 1 
        79 1 . . . . .  4.8 1.9  4.8 1 1 
        80 1 . . . . . 4.01 1.9 4.01 1 1 
        81 1 . . . . . 3.76 1.9 3.76 1 1 
        82 1 . . . . . 3.27 1.9 3.27 1 1 
        83 1 . . . . . 3.76 1.9 3.76 1 1 
        84 1 . . . . . 4.34 1.9 4.34 1 1 
        85 1 . . . . . 3.69 1.9 3.69 1 1 
        86 1 . . . . .  3.6 1.9  3.6 1 1 
        87 1 . . . . . 3.98 1.9 3.98 1 1 
        88 1 . . . . . 2.36 1.9 2.36 1 1 
        89 1 . . . . . 4.97 1.9 4.97 1 1 
        90 1 . . . . . 3.86 1.9 3.86 1 1 
        91 1 . . . . . 3.18 1.9 3.18 1 1 
        92 1 . . . . . 3.86 1.9 3.86 1 1 
        93 1 . . . . .    . 1.9 4.39 1 1 
        94 1 . . . . . 3.01 1.9 3.01 1 1 
        95 1 . . . . . 3.91 1.9 3.91 1 1 
        96 1 . . . . . 2.89 1.9 2.89 1 1 
        97 1 . . . . . 3.58 1.9 3.58 1 1 
        98 1 . . . . .    . 1.9 3.31 1 1 
        99 1 . . . . .    . 1.9 2.58 1 1 
       100 1 . . . . . 2.69 1.9 2.69 1 1 
       101 1 . . . . . 4.06 1.9 4.06 1 1 
       102 1 . . . . . 4.87 1.9 4.87 1 1 
       103 1 . . . . . 4.55 1.9 4.55 1 1 
       104 1 . . . . .  3.6 1.9  3.6 1 1 
       105 1 . . . . . 2.53 1.9 2.53 1 1 
       106 1 . . . . . 3.45 1.9 3.45 1 1 
       107 1 . . . . .  4.2 1.9  4.2 1 1 
       108 1 . . . . . 4.82 1.9 4.82 1 1 
       109 1 . . . . . 8.04 1.9 8.04 1 1 
       110 1 . . . . . 2.84 1.9 2.84 1 1 
       111 1 . . . . . 2.93 1.9 2.93 1 1 
       112 1 . . . . . 2.42 1.9 2.42 1 1 
       113 1 . . . . . 2.93 1.9 2.93 1 1 
       114 1 . . . . . 5.34 1.9 5.34 1 1 
       115 1 . . . . . 3.48 1.9 3.48 1 1 
       116 1 . . . . . 3.91 1.9 3.91 1 1 
       117 1 . . . . . 3.53 1.9 3.53 1 1 
       118 1 . . . . . 7.58 1.9 7.58 1 1 
       119 1 . . . . . 2.74 1.9 2.74 1 1 
       120 1 . . . . . 4.13 1.9 4.13 1 1 
       121 1 . . . . . 4.92 1.9 4.92 1 1 
       122 1 . . . . . 3.59 1.9 3.59 1 1 
       123 1 . . . . . 4.12 1.9 4.12 1 1 
       124 1 . . . . . 3.54 1.9 3.54 1 1 
       125 1 . . . . . 4.12 1.9 4.12 1 1 
       126 1 . . . . . 4.05 1.9 4.05 1 1 
       127 1 . . . . . 2.78 1.9 2.78 1 1 
       128 1 . . . . . 4.52 1.9 4.52 1 1 
       129 1 . . . . .  4.9 1.9  4.9 1 1 
       130 1 . . . . . 4.81 1.9 4.81 1 1 
       131 1 . . . . . 3.63 1.9 3.63 1 1 
       132 1 . . . . . 4.45 1.9 4.45 1 1 
       133 1 . . . . . 3.62 1.9 3.62 1 1 
       134 1 . . . . . 4.45 1.9 4.45 1 1 
       135 1 . . . . . 3.85 1.9 3.85 1 1 
       136 1 . . . . . 2.94 1.9 2.94 1 1 
       137 1 . . . . . 2.71 1.9 2.71 1 1 
       138 1 . . . . .    . 1.9 2.32 1 1 
       139 1 . . . . . 2.92 1.9 2.92 1 1 
       140 1 . . . . . 4.24 1.9 4.24 1 1 
       141 1 . . . . . 4.74 1.9 4.74 1 1 
       142 1 . . . . . 2.59 1.9 2.59 1 1 
       143 1 . . . . . 3.53 1.9 3.53 1 1 
       144 1 . . . . . 3.63 1.9 3.63 1 1 
       145 1 . . . . . 4.04 1.9 4.04 1 1 
       146 1 . . . . .    . 1.9  2.3 1 1 
       147 1 . . . . . 2.53 1.9 2.53 1 1 
       148 1 . . . . . 2.99 1.9 2.99 1 1 
       149 1 . . . . . 3.99 1.9 3.99 1 1 
       150 1 . . . . . 4.15 1.9 4.15 1 1 
       151 1 . . . . . 5.55 1.9 5.55 1 1 
       152 1 . . . . . 4.38 1.9 4.38 1 1 
       153 1 . . . . . 4.57 1.9 4.57 1 1 
       154 1 . . . . .  5.1 1.9  5.1 1 1 
       155 1 . . . . . 4.38 1.9 4.38 1 1 
       156 1 . . . . . 4.53 1.9 4.53 1 1 
       157 1 . . . . . 2.63 1.9 2.63 1 1 
       158 1 . . . . . 2.63 1.9 2.63 1 1 
       159 1 . . . . . 2.78 1.9 2.78 1 1 
       160 1 . . . . .  4.4 1.9  4.4 1 1 
       161 1 . . . . . 3.34 1.9 3.34 1 1 
       162 1 . . . . .  3.5 1.9  3.5 1 1 
       163 1 . . . . . 4.68 1.9 4.68 1 1 
       164 1 . . . . . 2.78 1.9 2.78 1 1 
       165 1 . . . . . 2.67 1.9 2.67 1 1 
       166 1 . . . . . 3.97 1.9 3.97 1 1 
       167 1 . . . . . 3.54 1.9 3.54 1 1 
       168 1 . . . . . 4.25 1.9 4.25 1 1 
       169 1 . . . . . 2.74 1.9 2.74 1 1 
       170 1 . . . . . 3.69 1.9 3.69 1 1 
       171 1 . . . . . 2.52 1.9 2.52 1 1 
       172 1 . . . . . 4.88 1.9 4.88 1 1 
       173 1 . . . . . 4.72 1.9 4.72 1 1 
       174 1 . . . . . 2.51 1.9 2.51 1 1 
       175 1 . . . . . 3.26 1.9 3.26 1 1 
       176 1 . . . . .  2.3 1.9  2.3 1 1 
       177 1 . . . . . 4.58 1.9 4.58 1 1 
       178 1 . . . . . 4.82 1.9 4.82 1 1 
       179 1 . . . . . 3.83 1.9 3.83 1 1 
       180 1 . . . . . 3.44 1.9 3.44 1 1 
       181 1 . . . . . 4.94 1.9 4.94 1 1 
       182 1 . . . . . 3.79 1.9 3.79 1 1 
       183 1 . . . . . 3.62 1.9 3.62 1 1 
       184 1 . . . . . 2.59 1.9 2.59 1 1 
       185 1 . . . . . 4.36 1.9 4.36 1 1 
       186 1 . . . . . 5.44 1.9 5.44 1 1 
       187 1 . . . . . 7.34 1.9 7.34 1 1 
       188 1 . . . . . 6.39 1.9 6.39 1 1 
       189 1 . . . . . 5.25 1.9 5.25 1 1 
       190 1 . . . . .    . 1.9 4.13 1 1 
       191 1 . . . . . 3.43 1.9 3.43 1 1 
       192 1 . . . . . 2.38 1.9 2.38 1 1 
       193 1 . . . . . 2.65 1.9 2.65 1 1 
       194 1 . . . . . 3.46 1.9 3.46 1 1 
       195 1 . . . . . 5.88 1.9 5.88 1 1 
       196 1 . . . . . 5.82 1.9 5.82 1 1 
       197 1 . . . . . 3.25 1.9 3.25 1 1 
       198 1 . . . . . 3.67 1.9 3.67 1 1 
       199 1 . . . . . 2.62 1.9 2.62 1 1 
       200 1 . . . . . 2.66 1.9 2.66 1 1 
       201 1 . . . . . 4.39 1.9 4.39 1 1 
       202 1 . . . . . 2.49 1.9 2.49 1 1 
       203 1 . . . . . 2.23 1.9 2.23 1 1 
       204 1 . . . . . 3.86 1.9 3.86 1 1 
       205 1 . . . . . 2.23 1.9 2.23 1 1 
       206 1 . . . . . 4.47 1.9 4.47 1 1 
       207 1 . . . . . 4.85 1.9 4.85 1 1 
       208 1 . . . . . 2.81 1.9 2.81 1 1 
       209 1 . . . . . 2.51 1.9 2.51 1 1 
       210 1 . . . . .    . 1.9  3.1 1 1 
       211 1 . . . . . 3.13 1.9 3.13 1 1 
       212 1 . . . . . 4.88 1.9 4.88 1 1 
       213 1 . . . . . 3.01 1.9 3.01 1 1 
       214 1 . . . . . 4.75 1.9 4.75 1 1 
       215 1 . . . . . 2.95 1.9 2.95 1 1 
       216 1 . . . . . 2.95 1.9 2.95 1 1 
       217 1 . . . . . 2.37 1.9 2.37 1 1 
       218 1 . . . . . 3.04 1.9 3.04 1 1 
       219 1 . . . . . 3.87 1.9 3.87 1 1 
       220 1 . . . . . 3.62 1.9 3.62 1 1 
       221 1 . . . . .  6.4 1.9  6.4 1 1 
       222 1 . . . . . 4.49 1.9 4.49 1 1 
       223 1 . . . . . 3.79 1.9 3.79 1 1 
       224 1 . . . . . 2.69 1.9 2.69 1 1 
       225 1 . . . . .  2.3 1.9  2.3 1 1 
       226 1 . . . . . 4.27 1.9 4.27 1 1 
       227 1 . . . . . 4.72 1.9 4.72 1 1 
       228 1 . . . . . 3.56 1.9 3.56 1 1 
       229 1 . . . . . 5.39 1.9 5.39 1 1 
       230 1 . . . . . 6.05 1.9 6.05 1 1 
       231 1 . . . . . 2.91 1.9 2.91 1 1 
       232 1 . . . . . 2.93 1.9 2.93 1 1 
       233 1 . . . . . 4.34 1.9 4.34 1 1 
       234 1 . . . . . 2.61 1.9 2.61 1 1 
       235 1 . . . . . 3.83 1.9 3.83 1 1 
       236 1 . . . . . 2.79 1.9 2.79 1 1 
       237 1 . . . . . 2.88 1.9 2.88 1 1 
       238 1 . . . . . 3.62 1.9 3.62 1 1 
       239 1 . . . . . 3.62 1.9 3.62 1 1 
       240 1 . . . . . 3.77 1.9 3.77 1 1 
       241 1 . . . . . 3.26 1.9 3.26 1 1 
       242 1 . . . . . 3.77 1.9 3.77 1 1 
       243 1 . . . . .  2.7 1.9  2.7 1 1 
       244 1 . . . . . 4.56 1.9 4.56 1 1 
       245 1 . . . . . 2.56 1.9 2.56 1 1 
       246 1 . . . . . 3.49 1.9 3.49 1 1 
       247 1 . . . . . 4.68 1.9 4.68 1 1 
       248 1 . . . . . 3.53 1.9 3.53 1 1 
       249 1 . . . . .  3.5 1.9  3.5 1 1 
       250 1 . . . . . 5.72 1.9 5.72 1 1 
       251 1 . . . . . 6.55 1.9 6.55 1 1 
       252 1 . . . . . 3.93 1.9 3.93 1 1 
       253 1 . . . . . 2.57 1.9 2.57 1 1 
       254 1 . . . . . 3.75 1.9 3.75 1 1 
       255 1 . . . . . 3.87 1.9 3.87 1 1 
       256 1 . . . . . 3.22 1.9 3.22 1 1 
       257 1 . . . . . 3.87 1.9 3.87 1 1 
       258 1 . . . . . 2.68 1.9 2.68 1 1 
       259 1 . . . . . 4.01 1.9 4.01 1 1 
       260 1 . . . . . 4.66 1.9 4.66 1 1 
       261 1 . . . . . 2.55 1.9 2.55 1 1 
       262 1 . . . . . 3.61 1.9 3.61 1 1 
       263 1 . . . . .  3.6 1.9  3.6 1 1 
       264 1 . . . . . 4.67 1.9 4.67 1 1 
       265 1 . . . . . 3.77 1.9 3.77 1 1 
       266 1 . . . . .  3.0 1.9  3.0 1 1 
       267 1 . . . . . 3.49 1.9 3.49 1 1 
       268 1 . . . . .  5.2 1.9  5.2 1 1 
       269 1 . . . . . 2.59 1.9 2.59 1 1 
       270 1 . . . . . 3.62 1.9 3.62 1 1 
       271 1 . . . . .    . 1.9 4.55 1 1 
       272 1 . . . . .  2.7 1.9  2.7 1 1 
       273 1 . . . . .    . 1.9 2.41 1 1 
       274 1 . . . . . 3.51 1.9 3.51 1 1 
       275 1 . . . . . 4.49 1.9 4.49 1 1 
       276 1 . . . . . 3.55 1.9 3.55 1 1 
       277 1 . . . . . 2.78 1.9 2.78 1 1 
       278 1 . . . . . 4.24 1.9 4.24 1 1 
       279 1 . . . . . 4.25 1.9 4.25 1 1 
       280 1 . . . . .  3.9 1.9  3.9 1 1 
       281 1 . . . . . 3.87 1.9 3.87 1 1 
       282 1 . . . . . 4.49 1.9 4.49 1 1 
       283 1 . . . . . 4.83 1.9 4.83 1 1 
       284 1 . . . . . 5.09 1.9 5.09 1 1 
       285 1 . . . . . 5.69 1.9 5.69 1 1 
       286 1 . . . . . 5.52 1.9 5.52 1 1 
       287 1 . . . . . 4.42 1.9 4.42 1 1 
       288 1 . . . . . 3.99 1.9 3.99 1 1 
       289 1 . . . . . 3.65 1.9 3.65 1 1 
       290 1 . . . . . 4.95 1.9 4.95 1 1 
       291 1 . . . . . 5.47 1.9 5.47 1 1 
       292 1 . . . . . 2.77 1.9 2.77 1 1 
       293 1 . . . . . 3.51 1.9 3.51 1 1 
       294 1 . . . . . 4.48 1.9 4.48 1 1 
       295 1 . . . . . 3.52 1.9 3.52 1 1 
       296 1 . . . . . 2.53 1.9 2.53 1 1 
       297 1 . . . . . 4.07 1.9 4.07 1 1 
       298 1 . . . . . 3.67 1.9 3.67 1 1 
       299 1 . . . . . 4.54 1.9 4.54 1 1 
       300 1 . . . . . 3.85 1.9 3.85 1 1 
       301 1 . . . . . 5.91 1.9 5.91 1 1 
       302 1 . . . . . 2.53 1.9 2.53 1 1 
       303 1 . . . . . 2.72 1.9 2.72 1 1 
       304 1 . . . . . 4.42 1.9 4.42 1 1 
       305 1 . . . . . 3.53 1.9 3.53 1 1 
       306 1 . . . . . 4.89 1.9 4.89 1 1 
       307 1 . . . . . 3.68 1.9 3.68 1 1 
       308 1 . . . . . 3.14 1.9 3.14 1 1 
       309 1 . . . . .  2.7 1.9  2.7 1 1 
       310 1 . . . . . 2.34 1.9 2.34 1 1 
       311 1 . . . . . 3.63 1.9 3.63 1 1 
       312 1 . . . . . 2.95 1.9 2.95 1 1 
       313 1 . . . . . 4.45 1.9 4.45 1 1 
       314 1 . . . . . 2.86 1.9 2.86 1 1 
       315 1 . . . . . 4.04 1.9 4.04 1 1 
       316 1 . . . . . 2.74 1.9 2.74 1 1 
       317 1 . . . . . 3.96 1.9 3.96 1 1 
       318 1 . . . . . 3.54 1.9 3.54 1 1 
       319 1 . . . . . 4.28 1.9 4.28 1 1 
       320 1 . . . . . 2.44 1.9 2.44 1 1 
       321 1 . . . . . 3.31 1.9 3.31 1 1 
       322 1 . . . . . 2.35 1.9 2.35 1 1 
       323 1 . . . . . 3.59 1.9 3.59 1 1 
       324 1 . . . . . 2.52 1.9 2.52 1 1 
       325 1 . . . . . 2.69 1.9 2.69 1 1 
       326 1 . . . . . 2.63 1.9 2.63 1 1 
       327 1 . . . . .    . 1.9 3.83 1 1 
       328 1 . . . . . 3.52 1.9 3.52 1 1 
       329 1 . . . . .    . 1.9 2.45 1 1 
       330 1 . . . . . 2.67 1.9 2.67 1 1 
       331 1 . . . . . 3.51 1.9 3.51 1 1 
       332 1 . . . . . 2.39 1.9 2.39 1 1 
       333 1 . . . . . 4.72 1.9 4.72 1 1 
       334 1 . . . . . 6.35 1.9 6.35 1 1 
       335 1 . . . . .  2.6 1.9  2.6 1 1 
       336 1 . . . . . 2.58 1.9 2.58 1 1 
       337 1 . . . . . 2.98 1.9 2.98 1 1 
       338 1 . . . . . 3.19 1.9 3.19 1 1 
       339 1 . . . . . 4.77 1.9 4.77 1 1 
       340 1 . . . . . 4.95 1.9 4.95 1 1 
       341 1 . . . . . 4.69 1.9 4.69 1 1 
       342 1 . . . . . 4.95 1.9 4.95 1 1 
       343 1 . . . . . 2.34 1.9 2.34 1 1 
       344 1 . . . . . 2.56 1.9 2.56 1 1 
       345 1 . . . . . 2.22 1.9 2.22 1 1 
       346 1 . . . . . 2.56 1.9 2.56 1 1 
       347 1 . . . . . 2.59 1.9 2.59 1 1 
       348 1 . . . . . 2.52 1.9 2.52 1 1 
       349 1 . . . . .  5.4 1.9  5.4 1 1 
       350 1 . . . . . 5.86 1.9 5.86 1 1 
       351 1 . . . . .  4.7 1.9  4.7 1 1 
       352 1 . . . . . 2.36 1.9 2.36 1 1 
       353 1 . . . . . 4.81 1.9 4.81 1 1 
       354 1 . . . . .  2.9 1.9  2.9 1 1 
       355 1 . . . . .  3.7 1.9  3.7 1 1 
       356 1 . . . . . 3.08 1.9 3.08 1 1 
       357 1 . . . . .  3.7 1.9  3.7 1 1 
       358 1 . . . . . 4.05 1.9 4.05 1 1 
       359 1 . . . . . 2.65 1.9 2.65 1 1 
       360 1 . . . . .  3.5 1.9  3.5 1 1 
       361 1 . . . . . 3.38 1.9 3.38 1 1 
       362 1 . . . . .  4.0 1.9  4.0 1 1 
       363 1 . . . . . 4.98 1.9 4.98 1 1 
       364 1 . . . . . 4.53 1.9 4.53 1 1 
       365 1 . . . . . 3.92 1.9 3.92 1 1 
       366 1 . . . . . 4.53 1.9 4.53 1 1 
       367 1 . . . . . 4.88 1.9 4.88 1 1 
       368 1 . . . . . 3.69 1.9 3.69 1 1 
       369 1 . . . . . 2.53 1.9 2.53 1 1 
       370 1 . . . . . 2.62 1.9 2.62 1 1 
       371 1 . . . . . 2.34 1.9 2.34 1 1 
       372 1 . . . . . 2.62 1.9 2.62 1 1 
       373 1 . . . . . 4.68 1.9 4.68 1 1 
       374 1 . . . . . 2.52 1.9 2.52 1 1 
       375 1 . . . . . 2.67 1.9 2.67 1 1 
       376 1 . . . . . 3.51 1.9 3.51 1 1 
       377 1 . . . . .    . 1.9  3.4 1 1 
       378 1 . . . . . 3.39 1.9 3.39 1 1 
       379 1 . . . . .  2.4 1.9  2.4 1 1 
       380 1 . . . . .  3.7 1.9  3.7 1 1 
       381 1 . . . . . 4.93 1.9 4.93 1 1 
       382 1 . . . . . 4.61 1.9 4.61 1 1 
       383 1 . . . . . 4.93 1.9 4.93 1 1 
       384 1 . . . . . 2.58 1.9 2.58 1 1 
       385 1 . . . . . 2.23 1.9 2.23 1 1 
       386 1 . . . . . 2.58 1.9 2.58 1 1 
       387 1 . . . . .  3.6 1.9  3.6 1 1 
       388 1 . . . . . 4.86 1.9 4.86 1 1 
       389 1 . . . . . 3.14 1.9 3.14 1 1 
       390 1 . . . . . 4.53 1.9 4.53 1 1 
       391 1 . . . . . 2.63 1.9 2.63 1 1 
       392 1 . . . . . 2.55 1.9 2.55 1 1 
       393 1 . . . . . 2.89 1.9 2.89 1 1 
       394 1 . . . . . 2.88 1.9 2.88 1 1 
       395 1 . . . . . 4.22 1.9 4.22 1 1 
       396 1 . . . . . 3.63 1.9 3.63 1 1 
       397 1 . . . . . 2.42 1.9 2.42 1 1 
       398 1 . . . . . 3.52 1.9 3.52 1 1 
       399 1 . . . . . 3.25 1.9 3.25 1 1 
       400 1 . . . . . 3.52 1.9 3.52 1 1 
       401 1 . . . . . 3.72 1.9 3.72 1 1 
       402 1 . . . . .  4.4 1.9  4.4 1 1 
       403 1 . . . . . 2.28 1.9 2.28 1 1 
       404 1 . . . . . 5.38 1.9 5.38 1 1 
       405 1 . . . . . 4.41 1.9 4.41 1 1 
       406 1 . . . . . 3.38 1.9 3.38 1 1 
       407 1 . . . . . 4.32 1.9 4.32 1 1 
       408 1 . . . . .  2.4 1.9  2.4 1 1 
       409 1 . . . . . 2.26 1.9 2.26 1 1 
       410 1 . . . . .  4.1 1.9  4.1 1 1 
       411 1 . . . . .  2.4 1.9  2.4 1 1 
       412 1 . . . . . 3.63 1.9 3.63 1 1 
       413 1 . . . . . 4.63 1.9 4.63 1 1 
       414 1 . . . . . 2.59 1.9 2.59 1 1 
       415 1 . . . . . 2.68 1.9 2.68 1 1 
       416 1 . . . . .  3.1 1.9  3.1 1 1 
       417 1 . . . . . 4.18 1.9 4.18 1 1 
       418 1 . . . . . 4.63 1.9 4.63 1 1 
       419 1 . . . . . 4.63 1.9 4.63 1 1 
       420 1 . . . . . 2.78 1.9 2.78 1 1 
       421 1 . . . . .    . 1.9 2.33 1 1 
       422 1 . . . . . 4.06 1.9 4.06 1 1 
       423 1 . . . . . 3.91 1.9 3.91 1 1 
       424 1 . . . . . 4.06 1.9 4.06 1 1 
       425 1 . . . . . 4.68 1.9 4.68 1 1 
       426 1 . . . . . 4.69 1.9 4.69 1 1 
       427 1 . . . . . 2.52 1.9 2.52 1 1 
       428 1 . . . . . 2.31 1.9 2.31 1 1 
       429 1 . . . . . 5.08 1.9 5.08 1 1 
       430 1 . . . . . 2.67 1.9 2.67 1 1 
       431 1 . . . . . 2.59 1.9 2.59 1 1 
       432 1 . . . . . 4.85 1.9 4.85 1 1 
       433 1 . . . . . 2.65 1.9 2.65 1 1 
       434 1 . . . . . 3.95 1.9 3.95 1 1 
       435 1 . . . . . 4.56 1.9 4.56 1 1 
       436 1 . . . . . 2.25 1.9 2.25 1 1 
       437 1 . . . . . 2.71 1.9 2.71 1 1 
       438 1 . . . . .    . 1.9 4.24 1 1 
       439 1 . . . . . 3.59 1.9 3.59 1 1 
       440 1 . . . . . 4.06 1.9 4.06 1 1 
       441 1 . . . . . 4.61 1.9 4.61 1 1 
       442 1 . . . . .  4.5 1.9  4.5 1 1 
       443 1 . . . . . 4.61 1.9 4.61 1 1 
       444 1 . . . . .  4.5 1.9  4.5 1 1 
       445 1 . . . . .  3.3 1.9  3.3 1 1 
       446 1 . . . . . 2.68 1.9 2.68 1 1 
       447 1 . . . . .  3.3 1.9  3.3 1 1 
       448 1 . . . . . 4.69 1.9 4.69 1 1 
       449 1 . . . . . 3.23 1.9 3.23 1 1 
       450 1 . . . . . 5.36 1.9 5.36 1 1 
       451 1 . . . . . 3.73 1.9 3.73 1 1 
       452 1 . . . . .  6.0 1.9  6.0 1 1 
       453 1 . . . . . 2.29 1.9 2.29 1 1 
       454 1 . . . . . 5.69 1.9 5.69 1 1 
       455 1 . . . . . 4.55 1.9 4.55 1 1 
       456 1 . . . . . 4.27 1.9 4.27 1 1 
       457 1 . . . . . 3.69 1.9 3.69 1 1 
       458 1 . . . . . 3.04 1.9 3.04 1 1 
       459 1 . . . . . 3.69 1.9 3.69 1 1 
       460 1 . . . . .  3.5 1.9  3.5 1 1 
       461 1 . . . . . 2.77 1.9 2.77 1 1 
       462 1 . . . . . 2.76 1.9 2.76 1 1 
       463 1 . . . . . 3.78 1.9 3.78 1 1 
       464 1 . . . . .    . 1.9 2.51 1 1 
       465 1 . . . . . 4.14 1.9 4.14 1 1 
       466 1 . . . . . 3.78 1.9 3.78 1 1 
       467 1 . . . . . 3.13 1.9 3.13 1 1 
       468 1 . . . . . 3.78 1.9 3.78 1 1 
       469 1 . . . . . 5.01 1.9 5.01 1 1 
       470 1 . . . . .  4.5 1.9  4.5 1 1 
       471 1 . . . . . 3.81 1.9 3.81 1 1 
       472 1 . . . . . 2.26 1.9 2.26 1 1 
       473 1 . . . . . 2.62 1.9 2.62 1 1 
       474 1 . . . . . 4.25 1.9 4.25 1 1 
       475 1 . . . . . 2.71 1.9 2.71 1 1 
       476 1 . . . . . 3.16 1.9 3.16 1 1 
       477 1 . . . . . 2.31 1.9 2.31 1 1 
       478 1 . . . . . 2.28 1.9 2.28 1 1 
       479 1 . . . . . 4.41 1.9 4.41 1 1 
       480 1 . . . . . 6.39 1.9 6.39 1 1 
       481 1 . . . . .    . 1.9 4.07 1 1 
       482 1 . . . . .  3.7 1.9  3.7 1 1 
       483 1 . . . . . 3.02 1.9 3.02 1 1 
       484 1 . . . . .  3.7 1.9  3.7 1 1 
       485 1 . . . . . 4.61 1.9 4.61 1 1 
       486 1 . . . . . 4.47 1.9 4.47 1 1 
       487 1 . . . . . 2.75 1.9 2.75 1 1 
       488 1 . . . . . 2.68 1.9 2.68 1 1 
       489 1 . . . . . 2.29 1.9 2.29 1 1 
       490 1 . . . . . 4.68 1.9 4.68 1 1 
       491 1 . . . . .  3.5 1.9  3.5 1 1 
       492 1 . . . . . 4.12 1.9 4.12 1 1 
       493 1 . . . . . 4.12 1.9 4.12 1 1 
       494 1 . . . . . 3.73 1.9 3.73 1 1 
       495 1 . . . . . 4.27 1.9 4.27 1 1 
       496 1 . . . . . 2.42 1.9 2.42 1 1 
       497 1 . . . . .    . 1.9 3.91 1 1 
       498 1 . . . . . 2.23 1.9 2.23 1 1 
       499 1 . . . . . 3.99 1.9 3.99 1 1 
       500 1 . . . . .    . 1.9 3.87 1 1 
       501 1 . . . . .    . 1.9 2.82 1 1 
       502 1 . . . . . 2.31 1.9 2.31 1 1 
       503 1 . . . . . 4.95 1.9 4.95 1 1 
       504 1 . . . . . 4.48 1.9 4.48 1 1 
       505 1 . . . . . 3.06 1.9 3.06 1 1 
       506 1 . . . . . 2.62 1.9 2.62 1 1 
       507 1 . . . . . 2.48 1.9 2.48 1 1 
       508 1 . . . . . 5.51 1.9 5.51 1 1 
       509 1 . . . . . 3.92 1.9 3.92 1 1 
       510 1 . . . . . 3.31 1.9 3.31 1 1 
       511 1 . . . . . 3.92 1.9 3.92 1 1 
       512 1 . . . . . 4.49 1.9 4.49 1 1 
       513 1 . . . . . 2.68 1.9 2.68 1 1 
       514 1 . . . . . 2.45 1.9 2.45 1 1 
       515 1 . . . . . 4.47 1.9 4.47 1 1 
       516 1 . . . . . 4.88 1.9 4.88 1 1 
       517 1 . . . . . 5.65 1.9 5.65 1 1 
       518 1 . . . . . 2.83 1.9 2.83 1 1 
       519 1 . . . . . 2.55 1.9 2.55 1 1 
       520 1 . . . . . 2.52 1.9 2.52 1 1 
       521 1 . . . . . 4.39 1.9 4.39 1 1 
       522 1 . . . . . 2.98 1.9 2.98 1 1 
       523 1 . . . . . 5.25 1.9 5.25 1 1 
       524 1 . . . . .  2.5 1.9  2.5 1 1 
       525 1 . . . . .  2.5 1.9  2.5 1 1 
       526 1 . . . . . 3.49 1.9 3.49 1 1 
       527 1 . . . . . 2.54 1.9 2.54 1 1 
       528 1 . . . . . 2.47 1.9 2.47 1 1 
       529 1 . . . . . 2.93 1.9 2.93 1 1 
       530 1 . . . . . 2.65 1.9 2.65 1 1 
       531 1 . . . . . 2.93 1.9 2.93 1 1 
       532 1 . . . . .  4.5 1.9  4.5 1 1 
       533 1 . . . . . 2.61 1.9 2.61 1 1 
       534 1 . . . . . 4.39 1.9 4.39 1 1 
       535 1 . . . . . 4.64 1.9 4.64 1 1 
       536 1 . . . . . 4.64 1.9 4.64 1 1 
       537 1 . . . . . 4.07 1.9 4.07 1 1 
       538 1 . . . . . 2.61 1.9 2.61 1 1 
       539 1 . . . . . 3.96 1.9 3.96 1 1 
       540 1 . . . . . 3.58 1.9 3.58 1 1 
       541 1 . . . . . 2.93 1.9 2.93 1 1 
       542 1 . . . . . 5.18 1.9 5.18 1 1 
       543 1 . . . . . 3.89 1.9 3.89 1 1 
       544 1 . . . . . 4.26 1.9 4.26 1 1 
       545 1 . . . . . 4.47 1.9 4.47 1 1 
       546 1 . . . . . 3.58 1.9 3.58 1 1 
       547 1 . . . . . 3.76 1.9 3.76 1 1 
       548 1 . . . . . 4.71 1.9 4.71 1 1 
       549 1 . . . . . 5.04 1.9 5.04 1 1 
       550 1 . . . . .    . 1.9 3.19 1 1 
       551 1 . . . . . 2.45 1.9 2.45 1 1 
       552 1 . . . . . 3.52 1.9 3.52 1 1 
       553 1 . . . . . 4.35 1.9 4.35 1 1 
       554 1 . . . . . 3.01 1.9 3.01 1 1 
       555 1 . . . . .  3.4 1.9  3.4 1 1 
       556 1 . . . . . 3.53 1.9 3.53 1 1 
       557 1 . . . . . 3.67 1.9 3.67 1 1 
       558 1 . . . . . 4.58 1.9 4.58 1 1 
       559 1 . . . . .  3.8 1.9  3.8 1 1 
       560 1 . . . . . 2.23 1.9 2.23 1 1 
       561 1 . . . . . 4.47 1.9 4.47 1 1 
       562 1 . . . . . 3.37 1.9 3.37 1 1 
       563 1 . . . . . 3.12 1.9 3.12 1 1 
       564 1 . . . . . 3.37 1.9 3.37 1 1 
       565 1 . . . . .  4.3 1.9  4.3 1 1 
       566 1 . . . . . 3.48 1.9 3.48 1 1 
       567 1 . . . . . 2.27 1.9 2.27 1 1 
       568 1 . . . . . 2.92 1.9 2.92 1 1 
       569 1 . . . . . 4.11 1.9 4.11 1 1 
       570 1 . . . . . 4.06 1.9 4.06 1 1 
       571 1 . . . . . 4.69 1.9 4.69 1 1 
       572 1 . . . . .    . 1.9 2.81 1 1 
       573 1 . . . . . 3.71 1.9 3.71 1 1 
       574 1 . . . . . 2.25 1.9 2.25 1 1 
       575 1 . . . . . 3.68 1.9 3.68 1 1 
       576 1 . . . . . 2.49 1.9 2.49 1 1 
       577 1 . . . . . 2.83 1.9 2.83 1 1 
       578 1 . . . . .  5.8 1.9  5.8 1 1 
       579 1 . . . . . 4.72 1.9 4.72 1 1 
       580 1 . . . . . 4.45 1.9 4.45 1 1 
       581 1 . . . . .  3.4 1.9  3.4 1 1 
       582 1 . . . . . 2.64 1.9 2.64 1 1 
       583 1 . . . . . 3.72 1.9 3.72 1 1 
       584 1 . . . . . 2.36 1.9 2.36 1 1 
       585 1 . . . . . 3.91 1.9 3.91 1 1 
       586 1 . . . . . 4.87 1.9 4.87 1 1 
       587 1 . . . . . 3.87 1.9 3.87 1 1 
       588 1 . . . . . 3.27 1.9 3.27 1 1 
       589 1 . . . . . 3.87 1.9 3.87 1 1 
       590 1 . . . . . 3.92 1.9 3.92 1 1 
       591 1 . . . . . 2.59 1.9 2.59 1 1 
       592 1 . . . . .    . 1.9 3.04 1 1 
       593 1 . . . . . 2.35 1.9 2.35 1 1 
       594 1 . . . . . 4.53 1.9 4.53 1 1 
       595 1 . . . . . 2.29 1.9 2.29 1 1 
       596 1 . . . . . 3.62 1.9 3.62 1 1 
       597 1 . . . . . 3.04 1.9 3.04 1 1 
       598 1 . . . . . 2.65 1.9 2.65 1 1 
       599 1 . . . . . 4.38 1.9 4.38 1 1 
       600 1 . . . . . 4.51 1.9 4.51 1 1 
       601 1 . . . . . 2.56 1.9 2.56 1 1 
       602 1 . . . . . 3.17 1.9 3.17 1 1 
       603 1 . . . . . 2.24 1.9 2.24 1 1 
       604 1 . . . . . 3.94 1.9 3.94 1 1 
       605 1 . . . . . 4.57 1.9 4.57 1 1 
       606 1 . . . . . 4.06 1.9 4.06 1 1 
       607 1 . . . . . 4.43 1.9 4.43 1 1 
       608 1 . . . . . 4.68 1.9 4.68 1 1 
       609 1 . . . . . 3.45 1.9 3.45 1 1 
       610 1 . . . . . 3.17 1.9 3.17 1 1 
       611 1 . . . . . 4.66 1.9 4.66 1 1 
       612 1 . . . . . 4.48 1.9 4.48 1 1 
       613 1 . . . . . 3.87 1.9 3.87 1 1 
       614 1 . . . . . 3.31 1.9 3.31 1 1 
       615 1 . . . . . 2.23 1.9 2.23 1 1 
       616 1 . . . . . 2.15 1.9 2.15 1 1 
       617 1 . . . . . 3.11 1.9 3.11 1 1 
       618 1 . . . . . 3.92 1.9 3.92 1 1 
       619 1 . . . . . 4.55 1.9 4.55 1 1 
       620 1 . . . . . 5.39 1.9 5.39 1 1 
       621 1 . . . . . 3.18 1.9 3.18 1 1 
       622 1 . . . . . 4.45 1.9 4.45 1 1 
       623 1 . . . . . 4.73 1.9 4.73 1 1 
       624 1 . . . . . 2.45 1.9 2.45 1 1 
       625 1 . . . . . 3.67 1.9 3.67 1 1 
       626 1 . . . . . 4.52 1.9 4.52 1 1 
       627 1 . . . . . 3.39 1.9 3.39 1 1 
       628 1 . . . . .  5.6 1.9  5.6 1 1 
       629 1 . . . . .    . 1.9 2.97 1 1 
       630 1 . . . . . 2.21 1.9 2.21 1 1 
       631 1 . . . . . 2.59 1.9 2.59 1 1 
       632 1 . . . . . 3.52 1.9 3.52 1 1 
       633 1 . . . . . 3.82 1.9 3.82 1 1 
       634 1 . . . . . 4.62 1.9 4.62 1 1 
       635 1 . . . . . 3.97 1.9 3.97 1 1 
       636 1 . . . . . 3.87 1.9 3.87 1 1 
       637 1 . . . . . 3.27 1.9 3.27 1 1 
       638 1 . . . . . 3.87 1.9 3.87 1 1 
       639 1 . . . . .  4.5 1.9  4.5 1 1 
       640 1 . . . . . 2.89 1.9 2.89 1 1 
       641 1 . . . . . 4.47 1.9 4.47 1 1 
       642 1 . . . . . 2.23 1.9 2.23 1 1 
       643 1 . . . . . 4.75 1.9 4.75 1 1 
       644 1 . . . . . 5.51 1.9 5.51 1 1 
       645 1 . . . . . 2.68 1.9 2.68 1 1 
       646 1 . . . . . 2.95 1.9 2.95 1 1 
       647 1 . . . . . 3.29 1.9 3.29 1 1 
       648 1 . . . . . 4.32 1.9 4.32 1 1 
       649 1 . . . . . 5.29 1.9 5.29 1 1 
       650 1 . . . . . 2.32 1.9 2.32 1 1 
       651 1 . . . . .    . 1.9 3.16 1 1 
       652 1 . . . . . 3.65 1.9 3.65 1 1 
       653 1 . . . . . 4.42 1.9 4.42 1 1 
       654 1 . . . . . 2.63 1.9 2.63 1 1 
       655 1 . . . . . 3.68 1.9 3.68 1 1 
       656 1 . . . . . 2.76 1.9 2.76 1 1 
       657 1 . . . . .  3.3 1.9  3.3 1 1 
       658 1 . . . . . 4.22 1.9 4.22 1 1 
       659 1 . . . . .    . 1.9 3.33 1 1 
       660 1 . . . . . 2.72 1.9 2.72 1 1 
       661 1 . . . . .  3.5 1.9  3.5 1 1 
       662 1 . . . . . 7.23 1.9 7.23 1 1 
       663 1 . . . . . 3.45 1.9 3.45 1 1 
       664 1 . . . . . 3.55 1.9 3.55 1 1 
       665 1 . . . . . 2.36 1.9 2.36 1 1 
       666 1 . . . . . 3.91 1.9 3.91 1 1 
       667 1 . . . . . 2.96 1.9 2.96 1 1 
       668 1 . . . . . 4.66 1.9 4.66 1 1 
       669 1 . . . . . 2.55 1.9 2.55 1 1 
       670 1 . . . . . 3.94 1.9 3.94 1 1 
       671 1 . . . . . 2.23 1.9 2.23 1 1 
       672 1 . . . . . 2.78 1.9 2.78 1 1 
       673 1 . . . . . 3.05 1.9 3.05 1 1 
       674 1 . . . . . 4.51 1.9 4.51 1 1 
       675 1 . . . . . 2.37 1.9 2.37 1 1 
       676 1 . . . . . 4.57 1.9 4.57 1 1 
       677 1 . . . . . 3.66 1.9 3.66 1 1 
       678 1 . . . . . 3.79 1.9 3.79 1 1 
       679 1 . . . . . 2.28 1.9 2.28 1 1 
       680 1 . . . . . 2.53 1.9 2.53 1 1 
       681 1 . . . . . 2.35 1.9 2.35 1 1 
       682 1 . . . . . 4.52 1.9 4.52 1 1 
       683 1 . . . . . 2.66 1.9 2.66 1 1 
       684 1 . . . . . 3.83 1.9 3.83 1 1 
       685 1 . . . . . 2.63 1.9 2.63 1 1 
       686 1 . . . . . 3.63 1.9 3.63 1 1 
       687 1 . . . . . 2.51 1.9 2.51 1 1 
       688 1 . . . . . 2.43 1.9 2.43 1 1 
       689 1 . . . . . 5.75 1.9 5.75 1 1 
       690 1 . . . . . 4.43 1.9 4.43 1 1 
       691 1 . . . . . 2.51 1.9 2.51 1 1 
       692 1 . . . . . 3.95 1.9 3.95 1 1 
       693 1 . . . . . 2.26 1.9 2.26 1 1 
       694 1 . . . . . 2.66 1.9 2.66 1 1 
       695 1 . . . . . 3.36 1.9 3.36 1 1 
       696 1 . . . . . 3.82 1.9 3.82 1 1 
       697 1 . . . . . 3.48 1.9 3.48 1 1 
       698 1 . . . . . 3.82 1.9 3.82 1 1 
       699 1 . . . . . 4.53 1.9 4.53 1 1 
       700 1 . . . . . 2.28 1.9 2.28 1 1 
       701 1 . . . . . 4.08 1.9 4.08 1 1 
       702 1 . . . . . 4.17 1.9 4.17 1 1 
       703 1 . . . . .  2.7 1.9  2.7 1 1 
       704 1 . . . . . 3.58 1.9 3.58 1 1 
       705 1 . . . . .  2.3 1.9  2.3 1 1 
       706 1 . . . . . 2.57 1.9 2.57 1 1 
       707 1 . . . . . 4.53 1.9 4.53 1 1 
       708 1 . . . . . 2.78 1.9 2.78 1 1 
       709 1 . . . . . 3.45 1.9 3.45 1 1 
       710 1 . . . . . 3.45 1.9 3.45 1 1 
       711 1 . . . . . 5.35 1.9 5.35 1 1 
       712 1 . . . . .    . 1.9  3.3 1 1 
       713 1 . . . . . 4.67 1.9 4.67 1 1 
       714 1 . . . . .    . 1.9 4.33 1 1 
       715 1 . . . . . 3.43 1.9 3.43 1 1 
       716 1 . . . . . 2.74 1.9 2.74 1 1 
       717 1 . . . . .  2.2 1.9  2.2 1 1 
       718 1 . . . . . 2.74 1.9 2.74 1 1 
       719 1 . . . . . 2.43 1.9 2.43 1 1 
       720 1 . . . . . 4.59 1.9 4.59 1 1 
       721 1 . . . . . 4.91 1.9 4.91 1 1 
       722 1 . . . . . 3.28 1.9 3.28 1 1 
       723 1 . . . . . 2.68 1.9 2.68 1 1 
       724 1 . . . . . 2.49 1.9 2.49 1 1 
       725 1 . . . . . 3.99 1.9 3.99 1 1 
       726 1 . . . . . 2.59 1.9 2.59 1 1 
       727 1 . . . . .  4.0 1.9  4.0 1 1 
       728 1 . . . . . 2.25 1.9 2.25 1 1 
       729 1 . . . . . 2.34 1.9 2.34 1 1 
       730 1 . . . . . 3.32 1.9 3.32 1 1 
       731 1 . . . . . 2.65 1.9 2.65 1 1 
       732 1 . . . . . 2.52 1.9 2.52 1 1 
       733 1 . . . . . 4.51 1.9 4.51 1 1 
       734 1 . . . . .  2.9 1.9  2.9 1 1 
       735 1 . . . . . 5.43 1.9 5.43 1 1 
       736 1 . . . . .  3.6 1.9  3.6 1 1 
       737 1 . . . . .  2.6 1.9  2.6 1 1 
       738 1 . . . . . 3.56 1.9 3.56 1 1 
       739 1 . . . . .  5.6 1.9  5.6 1 1 
       740 1 . . . . . 3.38 1.9 3.38 1 1 
       741 1 . . . . . 2.25 1.9 2.25 1 1 
       742 1 . . . . . 2.89 1.9 2.89 1 1 
       743 1 . . . . . 3.07 1.9 3.07 1 1 
       744 1 . . . . . 2.39 1.9 2.39 1 1 
       745 1 . . . . . 5.52 1.9 5.52 1 1 
       746 1 . . . . .  2.9 1.9  2.9 1 1 
       747 1 . . . . . 2.82 1.9 2.82 1 1 
       748 1 . . . . .  2.5 1.9  2.5 1 1 
       749 1 . . . . . 2.48 1.9 2.48 1 1 
       750 1 . . . . . 2.26 1.9 2.26 1 1 
       751 1 . . . . . 5.28 1.9 5.28 1 1 
       752 1 . . . . . 2.94 1.9 2.94 1 1 
       753 1 . . . . . 3.64 1.9 3.64 1 1 
       754 1 . . . . . 4.32 1.9 4.32 1 1 
       755 1 . . . . . 2.49 1.9 2.49 1 1 
       756 1 . . . . . 4.52 1.9 4.52 1 1 
       757 1 . . . . . 2.56 1.9 2.56 1 1 
       758 1 . . . . . 5.47 1.9 5.47 1 1 
       759 1 . . . . . 2.53 1.9 2.53 1 1 
       760 1 . . . . . 2.27 1.9 2.27 1 1 
       761 1 . . . . . 2.53 1.9 2.53 1 1 
       762 1 . . . . . 2.46 1.9 2.46 1 1 
       763 1 . . . . . 2.57 1.9 2.57 1 1 
       764 1 . . . . . 2.23 1.9 2.23 1 1 
       765 1 . . . . . 3.87 1.9 3.87 1 1 
       766 1 . . . . .  2.5 1.9  2.5 1 1 
       767 1 . . . . . 2.92 1.9 2.92 1 1 
       768 1 . . . . . 2.59 1.9 2.59 1 1 
       769 1 . . . . . 3.14 1.9 3.14 1 1 
       770 1 . . . . . 2.61 1.9 2.61 1 1 
       771 1 . . . . . 4.14 1.9 4.14 1 1 
       772 1 . . . . . 2.95 1.9 2.95 1 1 
       773 1 . . . . .  3.5 1.9  3.5 1 1 
       774 1 . . . . .  3.5 1.9  3.5 1 1 
       775 1 . . . . . 3.74 1.9 3.74 1 1 
       776 1 . . . . . 4.34 1.9 4.34 1 1 
       777 1 . . . . . 2.25 1.9 2.25 1 1 
       778 1 . . . . . 3.38 1.9 3.38 1 1 
       779 1 . . . . . 5.55 1.9 5.55 1 1 
       780 1 . . . . . 4.16 1.9 4.16 1 1 
       781 1 . . . . . 2.26 1.9 2.26 1 1 
       782 1 . . . . . 2.91 1.9 2.91 1 1 
       783 1 . . . . . 3.68 1.9 3.68 1 1 
       784 1 . . . . . 3.94 1.9 3.94 1 1 
       785 1 . . . . . 2.38 1.9 2.38 1 1 
       786 1 . . . . . 2.56 1.9 2.56 1 1 
       787 1 . . . . . 3.97 1.9 3.97 1 1 
       788 1 . . . . .  3.6 1.9  3.6 1 1 
       789 1 . . . . .    . 1.9 3.77 1 1 
       790 1 . . . . . 3.91 1.9 3.91 1 1 
       791 1 . . . . . 4.34 1.9 4.34 1 1 
       792 1 . . . . . 2.68 1.9 2.68 1 1 
       793 1 . . . . . 2.23 1.9 2.23 1 1 
       794 1 . . . . . 2.83 1.9 2.83 1 1 
       795 1 . . . . . 3.26 1.9 3.26 1 1 
       796 1 . . . . . 4.52 1.9 4.52 1 1 
       797 1 . . . . . 2.63 1.9 2.63 1 1 
       798 1 . . . . .  2.4 1.9  2.4 1 1 
       799 1 . . . . . 2.99 1.9 2.99 1 1 
       800 1 . . . . . 2.92 1.9 2.92 1 1 
       801 1 . . . . . 3.67 1.9 3.67 1 1 
       802 1 . . . . . 2.94 1.9 2.94 1 1 
       803 1 . . . . .  2.3 1.9  2.3 1 1 
       804 1 . . . . . 4.58 1.9 4.58 1 1 
       805 1 . . . . . 2.25 1.9 2.25 1 1 
       806 1 . . . . . 3.69 1.9 3.69 1 1 
       807 1 . . . . . 3.55 1.9 3.55 1 1 
       808 1 . . . . . 2.84 1.9 2.84 1 1 
       809 1 . . . . . 3.36 1.9 3.36 1 1 
       810 1 . . . . . 3.75 1.9 3.75 1 1 
       811 1 . . . . . 3.26 1.9 3.26 1 1 
       812 1 . . . . . 3.65 1.9 3.65 1 1 
       813 1 . . . . . 3.49 1.9 3.49 1 1 
       814 1 . . . . . 2.31 1.9 2.31 1 1 
       815 1 . . . . . 5.34 1.9 5.34 1 1 
       816 1 . . . . . 2.82 1.9 2.82 1 1 
       817 1 . . . . . 2.45 1.9 2.45 1 1 
       818 1 . . . . . 2.82 1.9 2.82 1 1 
       819 1 . . . . . 4.05 1.9 4.05 1 1 
       820 1 . . . . .  2.8 1.9  2.8 1 1 
       821 1 . . . . . 3.47 1.9 3.47 1 1 
       822 1 . . . . . 3.47 1.9 3.47 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1   1 MET C    C  23.953 -11.054 -16.658 1.00 . A A .   1 MET C    1 1 
        1     2 1 1   1 MET CA   C  24.704  -9.777 -17.154 1.00 . A A .   1 MET CA   1 1 
        1     3 1 1   1 MET CB   C  24.257  -8.550 -16.321 1.00 . A A .   1 MET CB   1 1 
        1     4 1 1   1 MET CE   C  25.650  -4.688 -15.758 1.00 . A A .   1 MET CE   1 1 
        1     5 1 1   1 MET CG   C  25.114  -7.289 -16.506 1.00 . A A .   1 MET CG   1 1 
        1     6 1 1   1 MET H1   H  24.816  -8.650 -18.935 1.00 . A A .   1 MET H1   1 1 
        1     7 1 1   1 MET H2   H  24.816 -10.283 -19.212 1.00 . A A .   1 MET H2   1 1 
        1     8 1 1   1 MET H3   H  23.425  -9.520 -18.790 1.00 . A A .   1 MET H3   1 1 
        1     9 1 1   1 MET HA   H  25.795  -9.928 -16.993 1.00 . A A .   1 MET HA   1 1 
        1    10 1 1   1 MET HB2  H  23.191  -8.308 -16.507 1.00 . A A .   1 MET HB2  1 1 
        1    11 1 1   1 MET HB3  H  24.291  -8.808 -15.241 1.00 . A A .   1 MET HB3  1 1 
        1    12 1 1   1 MET HE1  H  25.580  -4.389 -16.819 1.00 . A A .   1 MET HE1  1 1 
        1    13 1 1   1 MET HE2  H  25.429  -3.797 -15.143 1.00 . A A .   1 MET HE2  1 1 
        1    14 1 1   1 MET HE3  H  26.694  -4.986 -15.553 1.00 . A A .   1 MET HE3  1 1 
        1    15 1 1   1 MET HG2  H  26.180  -7.478 -16.277 1.00 . A A .   1 MET HG2  1 1 
        1    16 1 1   1 MET HG3  H  25.071  -6.888 -17.535 1.00 . A A .   1 MET HG3  1 1 
        1    17 1 1   1 MET N    N  24.437  -9.545 -18.605 1.00 . A A .   1 MET N    1 1 
        1    18 1 1   1 MET O    O  22.781 -11.247 -16.993 1.00 . A A .   1 MET O    1 1 
        1    19 1 1   1 MET SD   S  24.502  -6.021 -15.375 1.00 . A A .   1 MET SD   1 1 
        1    20 1 1   2 ALA C    C  23.243 -12.828 -13.960 1.00 . A A .   2 ALA C    1 1 
        1    21 1 1   2 ALA CA   C  23.992 -13.121 -15.294 1.00 . A A .   2 ALA CA   1 1 
        1    22 1 1   2 ALA CB   C  25.114 -14.158 -15.123 1.00 . A A .   2 ALA CB   1 1 
        1    23 1 1   2 ALA H    H  25.569 -11.625 -15.584 1.00 . A A .   2 ALA H    1 1 
        1    24 1 1   2 ALA HA   H  23.280 -13.554 -16.029 1.00 . A A .   2 ALA HA   1 1 
        1    25 1 1   2 ALA HB1  H  25.612 -14.383 -16.085 1.00 . A A .   2 ALA HB1  1 1 
        1    26 1 1   2 ALA HB2  H  25.896 -13.831 -14.413 1.00 . A A .   2 ALA HB2  1 1 
        1    27 1 1   2 ALA HB3  H  24.723 -15.119 -14.740 1.00 . A A .   2 ALA HB3  1 1 
        1    28 1 1   2 ALA N    N  24.620 -11.898 -15.859 1.00 . A A .   2 ALA N    1 1 
        1    29 1 1   2 ALA O    O  23.856 -12.737 -12.892 1.00 . A A .   2 ALA O    1 1 
        1    30 1 1   3 GLY C    C  19.588 -12.403 -13.144 1.00 . A A .   3 GLY C    1 1 
        1    31 1 1   3 GLY CA   C  21.092 -12.329 -12.865 1.00 . A A .   3 GLY CA   1 1 
        1    32 1 1   3 GLY H    H  21.551 -12.596 -14.996 1.00 . A A .   3 GLY H    1 1 
        1    33 1 1   3 GLY HA2  H  21.357 -12.978 -12.008 1.00 . A A .   3 GLY HA2  1 1 
        1    34 1 1   3 GLY HA3  H  21.332 -11.298 -12.545 1.00 . A A .   3 GLY HA3  1 1 
        1    35 1 1   3 GLY N    N  21.916 -12.665 -14.043 1.00 . A A .   3 GLY N    1 1 
        1    36 1 1   3 GLY O    O  18.980 -11.397 -13.515 1.00 . A A .   3 GLY O    1 1 
        1    37 1 1   4 SER C    C  16.647 -13.394 -11.971 1.00 . A A .   4 SER C    1 1 
        1    38 1 1   4 SER CA   C  17.534 -13.792 -13.185 1.00 . A A .   4 SER CA   1 1 
        1    39 1 1   4 SER CB   C  17.329 -15.261 -13.649 1.00 . A A .   4 SER CB   1 1 
        1    40 1 1   4 SER H    H  19.594 -14.352 -12.653 1.00 . A A .   4 SER H    1 1 
        1    41 1 1   4 SER HA   H  17.216 -13.175 -14.053 1.00 . A A .   4 SER HA   1 1 
        1    42 1 1   4 SER HB2  H  16.255 -15.433 -13.861 1.00 . A A .   4 SER HB2  1 1 
        1    43 1 1   4 SER HB3  H  17.855 -15.413 -14.612 1.00 . A A .   4 SER HB3  1 1 
        1    44 1 1   4 SER HG   H  17.466 -17.084 -12.978 1.00 . A A .   4 SER HG   1 1 
        1    45 1 1   4 SER N    N  18.985 -13.580 -12.944 1.00 . A A .   4 SER N    1 1 
        1    46 1 1   4 SER O    O  16.238 -14.225 -11.153 1.00 . A A .   4 SER O    1 1 
        1    47 1 1   4 SER OG   O  17.790 -16.223 -12.698 1.00 . A A .   4 SER OG   1 1 
        1    48 1 1   5 GLY C    C  14.006 -11.714 -10.875 1.00 . A A .   5 GLY C    1 1 
        1    49 1 1   5 GLY CA   C  15.528 -11.543 -10.757 1.00 . A A .   5 GLY CA   1 1 
        1    50 1 1   5 GLY H    H  16.840 -11.503 -12.550 1.00 . A A .   5 GLY H    1 1 
        1    51 1 1   5 GLY HA2  H  15.875 -11.960  -9.791 1.00 . A A .   5 GLY HA2  1 1 
        1    52 1 1   5 GLY HA3  H  15.740 -10.461 -10.675 1.00 . A A .   5 GLY HA3  1 1 
        1    53 1 1   5 GLY N    N  16.325 -12.091 -11.882 1.00 . A A .   5 GLY N    1 1 
        1    54 1 1   5 GLY O    O  13.281 -10.742 -11.094 1.00 . A A .   5 GLY O    1 1 
        1    55 1 1   6 ILE C    C  11.284 -13.009  -9.515 1.00 . A A .   6 ILE C    1 1 
        1    56 1 1   6 ILE CA   C  12.087 -13.303 -10.815 1.00 . A A .   6 ILE CA   1 1 
        1    57 1 1   6 ILE CB   C  11.920 -14.734 -11.444 1.00 . A A .   6 ILE CB   1 1 
        1    58 1 1   6 ILE CD1  C  10.257 -16.168 -12.821 1.00 . A A .   6 ILE CD1  1 1 
        1    59 1 1   6 ILE CG1  C  10.443 -15.013 -11.835 1.00 . A A .   6 ILE CG1  1 1 
        1    60 1 1   6 ILE CG2  C  12.505 -15.867 -10.590 1.00 . A A .   6 ILE CG2  1 1 
        1    61 1 1   6 ILE H    H  14.279 -13.658 -10.635 1.00 . A A .   6 ILE H    1 1 
        1    62 1 1   6 ILE HA   H  11.677 -12.652 -11.607 1.00 . A A .   6 ILE HA   1 1 
        1    63 1 1   6 ILE HB   H  12.505 -14.701 -12.391 1.00 . A A .   6 ILE HB   1 1 
        1    64 1 1   6 ILE HD11 H  10.579 -17.139 -12.404 1.00 . A A .   6 ILE HD11 1 1 
        1    65 1 1   6 ILE HD12 H   9.192 -16.280 -13.099 1.00 . A A .   6 ILE HD12 1 1 
        1    66 1 1   6 ILE HD13 H  10.819 -16.010 -13.760 1.00 . A A .   6 ILE HD13 1 1 
        1    67 1 1   6 ILE HG12 H   9.834 -15.198 -10.928 1.00 . A A .   6 ILE HG12 1 1 
        1    68 1 1   6 ILE HG13 H  10.000 -14.107 -12.296 1.00 . A A .   6 ILE HG13 1 1 
        1    69 1 1   6 ILE HG21 H  12.563 -16.817 -11.149 1.00 . A A .   6 ILE HG21 1 1 
        1    70 1 1   6 ILE HG22 H  13.531 -15.612 -10.280 1.00 . A A .   6 ILE HG22 1 1 
        1    71 1 1   6 ILE HG23 H  11.925 -16.059  -9.669 1.00 . A A .   6 ILE HG23 1 1 
        1    72 1 1   6 ILE N    N  13.532 -12.952 -10.682 1.00 . A A .   6 ILE N    1 1 
        1    73 1 1   6 ILE O    O  10.975 -13.899  -8.718 1.00 . A A .   6 ILE O    1 1 
        1    74 1 1   7 ILE C    C   8.605 -11.558  -8.295 1.00 . A A .   7 ILE C    1 1 
        1    75 1 1   7 ILE CA   C  10.130 -11.274  -8.142 1.00 . A A .   7 ILE CA   1 1 
        1    76 1 1   7 ILE CB   C  10.541  -9.812  -7.769 1.00 . A A .   7 ILE CB   1 1 
        1    77 1 1   7 ILE CD1  C  10.369 -10.083  -5.185 1.00 . A A .   7 ILE CD1  1 1 
        1    78 1 1   7 ILE CG1  C   9.941  -9.304  -6.427 1.00 . A A .   7 ILE CG1  1 1 
        1    79 1 1   7 ILE CG2  C  10.249  -8.744  -8.851 1.00 . A A .   7 ILE CG2  1 1 
        1    80 1 1   7 ILE H    H  11.388 -11.076  -9.965 1.00 . A A .   7 ILE H    1 1 
        1    81 1 1   7 ILE HA   H  10.482 -11.877  -7.277 1.00 . A A .   7 ILE HA   1 1 
        1    82 1 1   7 ILE HB   H  11.646  -9.823  -7.637 1.00 . A A .   7 ILE HB   1 1 
        1    83 1 1   7 ILE HD11 H   9.991  -9.594  -4.268 1.00 . A A .   7 ILE HD11 1 1 
        1    84 1 1   7 ILE HD12 H   9.979 -11.117  -5.171 1.00 . A A .   7 ILE HD12 1 1 
        1    85 1 1   7 ILE HD13 H  11.468 -10.143  -5.085 1.00 . A A .   7 ILE HD13 1 1 
        1    86 1 1   7 ILE HG12 H  10.245  -8.247  -6.279 1.00 . A A .   7 ILE HG12 1 1 
        1    87 1 1   7 ILE HG13 H   8.835  -9.274  -6.486 1.00 . A A .   7 ILE HG13 1 1 
        1    88 1 1   7 ILE HG21 H  10.672  -7.763  -8.566 1.00 . A A .   7 ILE HG21 1 1 
        1    89 1 1   7 ILE HG22 H  10.696  -9.000  -9.828 1.00 . A A .   7 ILE HG22 1 1 
        1    90 1 1   7 ILE HG23 H   9.168  -8.593  -9.022 1.00 . A A .   7 ILE HG23 1 1 
        1    91 1 1   7 ILE N    N  10.911 -11.732  -9.331 1.00 . A A .   7 ILE N    1 1 
        1    92 1 1   7 ILE O    O   7.802 -10.681  -8.627 1.00 . A A .   7 ILE O    1 1 
        1    93 1 1   8 TYR C    C   5.995 -13.019  -6.873 1.00 . A A .   8 TYR C    1 1 
        1    94 1 1   8 TYR CA   C   6.807 -13.266  -8.177 1.00 . A A .   8 TYR CA   1 1 
        1    95 1 1   8 TYR CB   C   6.849 -14.751  -8.625 1.00 . A A .   8 TYR CB   1 1 
        1    96 1 1   8 TYR CD1  C   4.888 -15.094 -10.240 1.00 . A A .   8 TYR CD1  1 1 
        1    97 1 1   8 TYR CD2  C   4.757 -16.097  -8.049 1.00 . A A .   8 TYR CD2  1 1 
        1    98 1 1   8 TYR CE1  C   3.619 -15.595 -10.543 1.00 . A A .   8 TYR CE1  1 1 
        1    99 1 1   8 TYR CE2  C   3.488 -16.595  -8.352 1.00 . A A .   8 TYR CE2  1 1 
        1   100 1 1   8 TYR CG   C   5.470 -15.335  -8.986 1.00 . A A .   8 TYR CG   1 1 
        1   101 1 1   8 TYR CZ   C   2.919 -16.344  -9.598 1.00 . A A .   8 TYR CZ   1 1 
        1   102 1 1   8 TYR H    H   8.999 -13.473  -7.951 1.00 . A A .   8 TYR H    1 1 
        1   103 1 1   8 TYR HA   H   6.338 -12.704  -9.013 1.00 . A A .   8 TYR HA   1 1 
        1   104 1 1   8 TYR HB2  H   7.511 -14.849  -9.510 1.00 . A A .   8 TYR HB2  1 1 
        1   105 1 1   8 TYR HB3  H   7.331 -15.376  -7.847 1.00 . A A .   8 TYR HB3  1 1 
        1   106 1 1   8 TYR HD1  H   5.412 -14.503 -10.982 1.00 . A A .   8 TYR HD1  1 1 
        1   107 1 1   8 TYR HD2  H   5.178 -16.288  -7.068 1.00 . A A .   8 TYR HD2  1 1 
        1   108 1 1   8 TYR HE1  H   3.191 -15.389 -11.515 1.00 . A A .   8 TYR HE1  1 1 
        1   109 1 1   8 TYR HE2  H   2.958 -17.170  -7.604 1.00 . A A .   8 TYR HE2  1 1 
        1   110 1 1   8 TYR HH   H   1.382 -17.331  -9.112 1.00 . A A .   8 TYR HH   1 1 
        1   111 1 1   8 TYR N    N   8.213 -12.815  -8.029 1.00 . A A .   8 TYR N    1 1 
        1   112 1 1   8 TYR O    O   6.022 -13.823  -5.936 1.00 . A A .   8 TYR O    1 1 
        1   113 1 1   8 TYR OH   O   1.670 -16.812  -9.871 1.00 . A A .   8 TYR OH   1 1 
        1   114 1 1   9 LYS C    C   3.127 -10.758  -6.407 1.00 . A A .   9 LYS C    1 1 
        1   115 1 1   9 LYS CA   C   4.244 -11.645  -5.783 1.00 . A A .   9 LYS CA   1 1 
        1   116 1 1   9 LYS CB   C   4.908 -10.962  -4.554 1.00 . A A .   9 LYS CB   1 1 
        1   117 1 1   9 LYS CD   C   4.607 -10.130  -2.143 1.00 . A A .   9 LYS CD   1 1 
        1   118 1 1   9 LYS CE   C   3.577  -9.915  -1.018 1.00 . A A .   9 LYS CE   1 1 
        1   119 1 1   9 LYS CG   C   3.939 -10.791  -3.364 1.00 . A A .   9 LYS CG   1 1 
        1   120 1 1   9 LYS H    H   5.330 -11.293  -7.657 1.00 . A A .   9 LYS H    1 1 
        1   121 1 1   9 LYS HA   H   3.805 -12.612  -5.456 1.00 . A A .   9 LYS HA   1 1 
        1   122 1 1   9 LYS HB2  H   5.776 -11.576  -4.237 1.00 . A A .   9 LYS HB2  1 1 
        1   123 1 1   9 LYS HB3  H   5.335  -9.985  -4.856 1.00 . A A .   9 LYS HB3  1 1 
        1   124 1 1   9 LYS HD2  H   5.448 -10.763  -1.795 1.00 . A A .   9 LYS HD2  1 1 
        1   125 1 1   9 LYS HD3  H   5.057  -9.163  -2.448 1.00 . A A .   9 LYS HD3  1 1 
        1   126 1 1   9 LYS HE2  H   2.743  -9.277  -1.390 1.00 . A A .   9 LYS HE2  1 1 
        1   127 1 1   9 LYS HE3  H   3.097 -10.883  -0.750 1.00 . A A .   9 LYS HE3  1 1 
        1   128 1 1   9 LYS HG2  H   3.066 -10.183  -3.681 1.00 . A A .   9 LYS HG2  1 1 
        1   129 1 1   9 LYS HG3  H   3.528 -11.781  -3.080 1.00 . A A .   9 LYS HG3  1 1 
        1   130 1 1   9 LYS HZ1  H   4.729  -8.436  -0.042 1.00 . A A .   9 LYS HZ1  1 1 
        1   131 1 1   9 LYS HZ2  H   3.510  -9.036   0.903 1.00 . A A .   9 LYS HZ2  1 1 
        1   132 1 1   9 LYS HZ3  H   4.888  -9.919   0.641 1.00 . A A .   9 LYS HZ3  1 1 
        1   133 1 1   9 LYS N    N   5.247 -11.910  -6.840 1.00 . A A .   9 LYS N    1 1 
        1   134 1 1   9 LYS NZ   N   4.214  -9.298   0.176 1.00 . A A .   9 LYS NZ   1 1 
        1   135 1 1   9 LYS O    O   3.408  -9.685  -6.951 1.00 . A A .   9 LYS O    1 1 
        1   136 1 1  10 GLN C    C   0.128  -9.714  -5.286 1.00 . A A .  10 GLN C    1 1 
        1   137 1 1  10 GLN CA   C   0.700 -10.345  -6.608 1.00 . A A .  10 GLN CA   1 1 
        1   138 1 1  10 GLN CB   C  -0.390 -11.186  -7.315 1.00 . A A .  10 GLN CB   1 1 
        1   139 1 1  10 GLN CD   C   0.883 -12.748  -9.010 1.00 . A A .  10 GLN CD   1 1 
        1   140 1 1  10 GLN CG   C  -0.106 -11.622  -8.762 1.00 . A A .  10 GLN CG   1 1 
        1   141 1 1  10 GLN H    H   1.764 -12.110  -5.833 1.00 . A A .  10 GLN H    1 1 
        1   142 1 1  10 GLN HA   H   0.997  -9.536  -7.305 1.00 . A A .  10 GLN HA   1 1 
        1   143 1 1  10 GLN HB2  H  -0.678 -12.052  -6.690 1.00 . A A .  10 GLN HB2  1 1 
        1   144 1 1  10 GLN HB3  H  -1.315 -10.572  -7.357 1.00 . A A .  10 GLN HB3  1 1 
        1   145 1 1  10 GLN HE21 H  -0.144 -13.983  -7.839 1.00 . A A .  10 GLN HE21 1 1 
        1   146 1 1  10 GLN HE22 H   1.409 -14.594  -8.622 1.00 . A A .  10 GLN HE22 1 1 
        1   147 1 1  10 GLN HG2  H  -1.072 -11.916  -9.209 1.00 . A A .  10 GLN HG2  1 1 
        1   148 1 1  10 GLN HG3  H   0.207 -10.744  -9.361 1.00 . A A .  10 GLN HG3  1 1 
        1   149 1 1  10 GLN N    N   1.869 -11.185  -6.259 1.00 . A A .  10 GLN N    1 1 
        1   150 1 1  10 GLN NE2  N   0.640 -13.930  -8.494 1.00 . A A .  10 GLN NE2  1 1 
        1   151 1 1  10 GLN O    O  -0.524 -10.447  -4.530 1.00 . A A .  10 GLN O    1 1 
        1   152 1 1  10 GLN OE1  O   1.874 -12.606  -9.716 1.00 . A A .  10 GLN OE1  1 1 
        1   153 1 1  11 PRO C    C  -1.655  -7.403  -3.624 1.00 . A A .  11 PRO C    1 1 
        1   154 1 1  11 PRO CA   C  -0.163  -7.836  -3.644 1.00 . A A .  11 PRO CA   1 1 
        1   155 1 1  11 PRO CB   C   0.860  -6.692  -3.427 1.00 . A A .  11 PRO CB   1 1 
        1   156 1 1  11 PRO CD   C   1.192  -7.481  -5.698 1.00 . A A .  11 PRO CD   1 1 
        1   157 1 1  11 PRO CG   C   1.192  -6.198  -4.853 1.00 . A A .  11 PRO CG   1 1 
        1   158 1 1  11 PRO HA   H  -0.032  -8.583  -2.837 1.00 . A A .  11 PRO HA   1 1 
        1   159 1 1  11 PRO HB2  H   0.497  -5.880  -2.771 1.00 . A A .  11 PRO HB2  1 1 
        1   160 1 1  11 PRO HB3  H   1.771  -7.107  -2.954 1.00 . A A .  11 PRO HB3  1 1 
        1   161 1 1  11 PRO HD2  H   0.804  -7.307  -6.719 1.00 . A A .  11 PRO HD2  1 1 
        1   162 1 1  11 PRO HD3  H   2.213  -7.892  -5.792 1.00 . A A .  11 PRO HD3  1 1 
        1   163 1 1  11 PRO HG2  H   0.398  -5.514  -5.205 1.00 . A A .  11 PRO HG2  1 1 
        1   164 1 1  11 PRO HG3  H   2.148  -5.647  -4.908 1.00 . A A .  11 PRO HG3  1 1 
        1   165 1 1  11 PRO N    N   0.327  -8.411  -4.946 1.00 . A A .  11 PRO N    1 1 
        1   166 1 1  11 PRO O    O  -2.009  -6.260  -3.327 1.00 . A A .  11 PRO O    1 1 
        1   167 1 1  12 ILE C    C  -4.538  -8.571  -2.382 1.00 . A A .  12 ILE C    1 1 
        1   168 1 1  12 ILE CA   C  -4.010  -8.219  -3.800 1.00 . A A .  12 ILE CA   1 1 
        1   169 1 1  12 ILE CB   C  -4.642  -8.970  -5.015 1.00 . A A .  12 ILE CB   1 1 
        1   170 1 1  12 ILE CD1  C  -6.462  -7.286  -5.764 1.00 . A A .  12 ILE CD1  1 1 
        1   171 1 1  12 ILE CG1  C  -6.155  -8.681  -5.221 1.00 . A A .  12 ILE CG1  1 1 
        1   172 1 1  12 ILE CG2  C  -4.435 -10.504  -5.039 1.00 . A A .  12 ILE CG2  1 1 
        1   173 1 1  12 ILE H    H  -2.070  -9.274  -4.092 1.00 . A A .  12 ILE H    1 1 
        1   174 1 1  12 ILE HA   H  -4.237  -7.149  -3.973 1.00 . A A .  12 ILE HA   1 1 
        1   175 1 1  12 ILE HB   H  -4.122  -8.583  -5.918 1.00 . A A .  12 ILE HB   1 1 
        1   176 1 1  12 ILE HD11 H  -5.982  -7.117  -6.747 1.00 . A A .  12 ILE HD11 1 1 
        1   177 1 1  12 ILE HD12 H  -7.547  -7.152  -5.921 1.00 . A A .  12 ILE HD12 1 1 
        1   178 1 1  12 ILE HD13 H  -6.134  -6.470  -5.101 1.00 . A A .  12 ILE HD13 1 1 
        1   179 1 1  12 ILE HG12 H  -6.565  -9.402  -5.959 1.00 . A A .  12 ILE HG12 1 1 
        1   180 1 1  12 ILE HG13 H  -6.724  -8.870  -4.291 1.00 . A A .  12 ILE HG13 1 1 
        1   181 1 1  12 ILE HG21 H  -4.789 -10.930  -5.997 1.00 . A A .  12 ILE HG21 1 1 
        1   182 1 1  12 ILE HG22 H  -3.371 -10.787  -4.955 1.00 . A A .  12 ILE HG22 1 1 
        1   183 1 1  12 ILE HG23 H  -4.977 -11.021  -4.227 1.00 . A A .  12 ILE HG23 1 1 
        1   184 1 1  12 ILE N    N  -2.530  -8.385  -3.855 1.00 . A A .  12 ILE N    1 1 
        1   185 1 1  12 ILE O    O  -5.119  -9.633  -2.143 1.00 . A A .  12 ILE O    1 1 
        1   186 1 1  13 TYR C    C  -4.691  -6.600   0.800 1.00 . A A .  13 TYR C    1 1 
        1   187 1 1  13 TYR CA   C  -4.540  -7.942   0.019 1.00 . A A .  13 TYR CA   1 1 
        1   188 1 1  13 TYR CB   C  -3.413  -8.826   0.629 1.00 . A A .  13 TYR CB   1 1 
        1   189 1 1  13 TYR CD1  C  -4.529 -10.890   1.614 1.00 . A A .  13 TYR CD1  1 1 
        1   190 1 1  13 TYR CD2  C  -3.695  -9.233   3.157 1.00 . A A .  13 TYR CD2  1 1 
        1   191 1 1  13 TYR CE1  C  -4.963 -11.669   2.687 1.00 . A A .  13 TYR CE1  1 1 
        1   192 1 1  13 TYR CE2  C  -4.131 -10.014   4.232 1.00 . A A .  13 TYR CE2  1 1 
        1   193 1 1  13 TYR CG   C  -3.887  -9.663   1.833 1.00 . A A .  13 TYR CG   1 1 
        1   194 1 1  13 TYR CZ   C  -4.762 -11.235   3.994 1.00 . A A .  13 TYR CZ   1 1 
        1   195 1 1  13 TYR H    H  -3.805  -6.828  -1.738 1.00 . A A .  13 TYR H    1 1 
        1   196 1 1  13 TYR HA   H  -5.499  -8.502   0.071 1.00 . A A .  13 TYR HA   1 1 
        1   197 1 1  13 TYR HB2  H  -3.025  -9.530  -0.136 1.00 . A A .  13 TYR HB2  1 1 
        1   198 1 1  13 TYR HB3  H  -2.533  -8.211   0.894 1.00 . A A .  13 TYR HB3  1 1 
        1   199 1 1  13 TYR HD1  H  -4.703 -11.241   0.603 1.00 . A A .  13 TYR HD1  1 1 
        1   200 1 1  13 TYR HD2  H  -3.212  -8.287   3.357 1.00 . A A .  13 TYR HD2  1 1 
        1   201 1 1  13 TYR HE1  H  -5.462 -12.612   2.501 1.00 . A A .  13 TYR HE1  1 1 
        1   202 1 1  13 TYR HE2  H  -3.982  -9.663   5.247 1.00 . A A .  13 TYR HE2  1 1 
        1   203 1 1  13 TYR HH   H  -5.055 -11.572   5.907 1.00 . A A .  13 TYR HH   1 1 
        1   204 1 1  13 TYR N    N  -4.279  -7.675  -1.413 1.00 . A A .  13 TYR N    1 1 
        1   205 1 1  13 TYR O    O  -3.879  -5.676   0.703 1.00 . A A .  13 TYR O    1 1 
        1   206 1 1  13 TYR OH   O  -5.189 -12.022   5.021 1.00 . A A .  13 TYR OH   1 1 
        1   207 1 1  14 GLN C    C  -5.174  -4.832   3.522 1.00 . A A .  14 GLN C    1 1 
        1   208 1 1  14 GLN CA   C  -6.138  -5.410   2.447 1.00 . A A .  14 GLN CA   1 1 
        1   209 1 1  14 GLN CB   C  -7.554  -5.722   3.000 1.00 . A A .  14 GLN CB   1 1 
        1   210 1 1  14 GLN CD   C  -7.656  -8.305   3.533 1.00 . A A .  14 GLN CD   1 1 
        1   211 1 1  14 GLN CG   C  -7.727  -6.865   4.026 1.00 . A A .  14 GLN CG   1 1 
        1   212 1 1  14 GLN H    H  -6.325  -7.410   1.573 1.00 . A A .  14 GLN H    1 1 
        1   213 1 1  14 GLN HA   H  -6.260  -4.580   1.733 1.00 . A A .  14 GLN HA   1 1 
        1   214 1 1  14 GLN HB2  H  -7.957  -4.799   3.464 1.00 . A A .  14 GLN HB2  1 1 
        1   215 1 1  14 GLN HB3  H  -8.236  -5.898   2.143 1.00 . A A .  14 GLN HB3  1 1 
        1   216 1 1  14 GLN HE21 H  -7.940  -8.973   5.399 1.00 . A A .  14 GLN HE21 1 1 
        1   217 1 1  14 GLN HE22 H  -7.688 -10.195   4.045 1.00 . A A .  14 GLN HE22 1 1 
        1   218 1 1  14 GLN HG2  H  -7.023  -6.731   4.868 1.00 . A A .  14 GLN HG2  1 1 
        1   219 1 1  14 GLN HG3  H  -8.730  -6.744   4.474 1.00 . A A .  14 GLN HG3  1 1 
        1   220 1 1  14 GLN N    N  -5.732  -6.568   1.621 1.00 . A A .  14 GLN N    1 1 
        1   221 1 1  14 GLN NE2  N  -7.756  -9.250   4.430 1.00 . A A .  14 GLN NE2  1 1 
        1   222 1 1  14 GLN O    O  -5.201  -3.617   3.765 1.00 . A A .  14 GLN O    1 1 
        1   223 1 1  14 GLN OE1  O  -7.515  -8.625   2.355 1.00 . A A .  14 GLN OE1  1 1 
        1   224 1 1  15 GLY C    C  -2.004  -6.157   4.918 1.00 . A A .  15 GLY C    1 1 
        1   225 1 1  15 GLY CA   C  -3.221  -5.226   4.978 1.00 . A A .  15 GLY CA   1 1 
        1   226 1 1  15 GLY H    H  -4.470  -6.648   3.819 1.00 . A A .  15 GLY H    1 1 
        1   227 1 1  15 GLY HA2  H  -2.902  -4.198   4.717 1.00 . A A .  15 GLY HA2  1 1 
        1   228 1 1  15 GLY HA3  H  -3.557  -5.157   6.030 1.00 . A A .  15 GLY HA3  1 1 
        1   229 1 1  15 GLY N    N  -4.342  -5.680   4.135 1.00 . A A .  15 GLY N    1 1 
        1   230 1 1  15 GLY O    O  -1.799  -6.941   5.845 1.00 . A A .  15 GLY O    1 1 
        1   231 1 1  16 ASN C    C   1.273  -5.744   3.645 1.00 . A A .  16 ASN C    1 1 
        1   232 1 1  16 ASN CA   C   0.111  -6.775   3.751 1.00 . A A .  16 ASN CA   1 1 
        1   233 1 1  16 ASN CB   C  -0.011  -7.864   2.665 1.00 . A A .  16 ASN CB   1 1 
        1   234 1 1  16 ASN CG   C   1.151  -8.846   2.608 1.00 . A A .  16 ASN CG   1 1 
        1   235 1 1  16 ASN H    H  -1.590  -5.525   3.070 1.00 . A A .  16 ASN H    1 1 
        1   236 1 1  16 ASN HA   H   0.291  -7.290   4.712 1.00 . A A .  16 ASN HA   1 1 
        1   237 1 1  16 ASN HB2  H  -0.945  -8.435   2.829 1.00 . A A .  16 ASN HB2  1 1 
        1   238 1 1  16 ASN HB3  H  -0.144  -7.416   1.664 1.00 . A A .  16 ASN HB3  1 1 
        1   239 1 1  16 ASN HD21 H   0.288 -10.006   3.984 1.00 . A A .  16 ASN HD21 1 1 
        1   240 1 1  16 ASN HD22 H   1.923 -10.522   3.324 1.00 . A A .  16 ASN HD22 1 1 
        1   241 1 1  16 ASN N    N  -1.190  -6.052   3.851 1.00 . A A .  16 ASN N    1 1 
        1   242 1 1  16 ASN ND2  N   1.106  -9.908   3.376 1.00 . A A .  16 ASN ND2  1 1 
        1   243 1 1  16 ASN O    O   1.675  -5.199   4.673 1.00 . A A .  16 ASN O    1 1 
        1   244 1 1  16 ASN OD1  O   2.116  -8.670   1.870 1.00 . A A .  16 ASN OD1  1 1 
        1   245 1 1  17 LEU C    C   2.117  -2.885   2.365 1.00 . A A .  17 LEU C    1 1 
        1   246 1 1  17 LEU CA   C   2.764  -4.301   2.273 1.00 . A A .  17 LEU CA   1 1 
        1   247 1 1  17 LEU CB   C   3.678  -4.560   1.052 1.00 . A A .  17 LEU CB   1 1 
        1   248 1 1  17 LEU CD1  C   3.227  -3.066  -0.973 1.00 . A A .  17 LEU CD1  1 1 
        1   249 1 1  17 LEU CD2  C   3.825  -5.453  -1.313 1.00 . A A .  17 LEU CD2  1 1 
        1   250 1 1  17 LEU CG   C   3.091  -4.475  -0.373 1.00 . A A .  17 LEU CG   1 1 
        1   251 1 1  17 LEU H    H   1.400  -5.939   1.653 1.00 . A A .  17 LEU H    1 1 
        1   252 1 1  17 LEU HA   H   3.468  -4.345   3.134 1.00 . A A .  17 LEU HA   1 1 
        1   253 1 1  17 LEU HB2  H   4.557  -3.889   1.131 1.00 . A A .  17 LEU HB2  1 1 
        1   254 1 1  17 LEU HB3  H   4.124  -5.562   1.218 1.00 . A A .  17 LEU HB3  1 1 
        1   255 1 1  17 LEU HD11 H   2.761  -3.004  -1.974 1.00 . A A .  17 LEU HD11 1 1 
        1   256 1 1  17 LEU HD12 H   2.741  -2.289  -0.360 1.00 . A A .  17 LEU HD12 1 1 
        1   257 1 1  17 LEU HD13 H   4.282  -2.756  -1.091 1.00 . A A .  17 LEU HD13 1 1 
        1   258 1 1  17 LEU HD21 H   3.449  -5.376  -2.350 1.00 . A A .  17 LEU HD21 1 1 
        1   259 1 1  17 LEU HD22 H   4.914  -5.260  -1.352 1.00 . A A .  17 LEU HD22 1 1 
        1   260 1 1  17 LEU HD23 H   3.683  -6.502  -1.004 1.00 . A A .  17 LEU HD23 1 1 
        1   261 1 1  17 LEU HG   H   2.019  -4.759  -0.375 1.00 . A A .  17 LEU HG   1 1 
        1   262 1 1  17 LEU N    N   1.799  -5.434   2.448 1.00 . A A .  17 LEU N    1 1 
        1   263 1 1  17 LEU O    O   2.622  -2.028   3.089 1.00 . A A .  17 LEU O    1 1 
        1   264 1 1  18 ILE C    C  -0.256  -0.927   3.103 1.00 . A A .  18 ILE C    1 1 
        1   265 1 1  18 ILE CA   C   0.139  -1.467   1.700 1.00 . A A .  18 ILE CA   1 1 
        1   266 1 1  18 ILE CB   C  -1.026  -1.763   0.681 1.00 . A A .  18 ILE CB   1 1 
        1   267 1 1  18 ILE CD1  C  -0.357  -0.036  -1.183 1.00 . A A .  18 ILE CD1  1 1 
        1   268 1 1  18 ILE CG1  C  -0.562  -1.497  -0.784 1.00 . A A .  18 ILE CG1  1 1 
        1   269 1 1  18 ILE CG2  C  -2.372  -1.075   0.921 1.00 . A A .  18 ILE CG2  1 1 
        1   270 1 1  18 ILE H    H   0.740  -3.504   1.098 1.00 . A A .  18 ILE H    1 1 
        1   271 1 1  18 ILE HA   H   0.752  -0.644   1.268 1.00 . A A .  18 ILE HA   1 1 
        1   272 1 1  18 ILE HB   H  -1.279  -2.848   0.714 1.00 . A A .  18 ILE HB   1 1 
        1   273 1 1  18 ILE HD11 H   0.213   0.026  -2.128 1.00 . A A .  18 ILE HD11 1 1 
        1   274 1 1  18 ILE HD12 H  -1.326   0.460  -1.373 1.00 . A A .  18 ILE HD12 1 1 
        1   275 1 1  18 ILE HD13 H   0.173   0.567  -0.418 1.00 . A A .  18 ILE HD13 1 1 
        1   276 1 1  18 ILE HG12 H   0.369  -2.058  -0.987 1.00 . A A .  18 ILE HG12 1 1 
        1   277 1 1  18 ILE HG13 H  -1.301  -1.944  -1.477 1.00 . A A .  18 ILE HG13 1 1 
        1   278 1 1  18 ILE HG21 H  -2.863  -1.424   1.843 1.00 . A A .  18 ILE HG21 1 1 
        1   279 1 1  18 ILE HG22 H  -2.243   0.013   0.997 1.00 . A A .  18 ILE HG22 1 1 
        1   280 1 1  18 ILE HG23 H  -3.083  -1.266   0.094 1.00 . A A .  18 ILE HG23 1 1 
        1   281 1 1  18 ILE N    N   0.979  -2.700   1.685 1.00 . A A .  18 ILE N    1 1 
        1   282 1 1  18 ILE O    O  -0.028   0.259   3.360 1.00 . A A .  18 ILE O    1 1 
        1   283 1 1  19 LYS C    C  -1.147  -2.526   6.401 1.00 . A A .  19 LYS C    1 1 
        1   284 1 1  19 LYS CA   C  -1.045  -1.323   5.416 1.00 . A A .  19 LYS CA   1 1 
        1   285 1 1  19 LYS CB   C  -2.192  -0.280   5.580 1.00 . A A .  19 LYS CB   1 1 
        1   286 1 1  19 LYS CD   C  -4.627   0.415   5.247 1.00 . A A .  19 LYS CD   1 1 
        1   287 1 1  19 LYS CE   C  -6.096   0.036   4.951 1.00 . A A .  19 LYS CE   1 1 
        1   288 1 1  19 LYS CG   C  -3.550  -0.642   4.966 1.00 . A A .  19 LYS CG   1 1 
        1   289 1 1  19 LYS H    H  -0.899  -2.717   3.690 1.00 . A A .  19 LYS H    1 1 
        1   290 1 1  19 LYS HA   H  -0.138  -0.769   5.747 1.00 . A A .  19 LYS HA   1 1 
        1   291 1 1  19 LYS HB2  H  -2.309  -0.074   6.660 1.00 . A A .  19 LYS HB2  1 1 
        1   292 1 1  19 LYS HB3  H  -1.836   0.678   5.157 1.00 . A A .  19 LYS HB3  1 1 
        1   293 1 1  19 LYS HD2  H  -4.585   0.741   6.307 1.00 . A A .  19 LYS HD2  1 1 
        1   294 1 1  19 LYS HD3  H  -4.393   1.341   4.694 1.00 . A A .  19 LYS HD3  1 1 
        1   295 1 1  19 LYS HE2  H  -6.557  -0.361   5.878 1.00 . A A .  19 LYS HE2  1 1 
        1   296 1 1  19 LYS HE3  H  -6.661   0.981   4.772 1.00 . A A .  19 LYS HE3  1 1 
        1   297 1 1  19 LYS HG2  H  -3.427  -0.750   3.870 1.00 . A A .  19 LYS HG2  1 1 
        1   298 1 1  19 LYS HG3  H  -3.866  -1.637   5.327 1.00 . A A .  19 LYS HG3  1 1 
        1   299 1 1  19 LYS HZ1  H  -6.008  -0.538   2.894 1.00 . A A .  19 LYS HZ1  1 1 
        1   300 1 1  19 LYS HZ2  H  -5.801  -1.819   3.914 1.00 . A A .  19 LYS HZ2  1 1 
        1   301 1 1  19 LYS HZ3  H  -7.298  -1.156   3.640 1.00 . A A .  19 LYS HZ3  1 1 
        1   302 1 1  19 LYS N    N  -0.815  -1.747   4.008 1.00 . A A .  19 LYS N    1 1 
        1   303 1 1  19 LYS NZ   N  -6.299  -0.915   3.822 1.00 . A A .  19 LYS NZ   1 1 
        1   304 1 1  19 LYS O    O  -2.224  -2.845   6.909 1.00 . A A .  19 LYS O    1 1 
        1   305 1 1  20 GLN C    C   0.893  -3.050   9.030 1.00 . A A .  20 GLN C    1 1 
        1   306 1 1  20 GLN CA   C   0.170  -3.932   7.976 1.00 . A A .  20 GLN CA   1 1 
        1   307 1 1  20 GLN CB   C   0.810  -5.286   7.616 1.00 . A A .  20 GLN CB   1 1 
        1   308 1 1  20 GLN CD   C   1.867  -6.267   9.782 1.00 . A A .  20 GLN CD   1 1 
        1   309 1 1  20 GLN CG   C   0.797  -6.370   8.709 1.00 . A A .  20 GLN CG   1 1 
        1   310 1 1  20 GLN H    H   0.741  -3.099   6.021 1.00 . A A .  20 GLN H    1 1 
        1   311 1 1  20 GLN HA   H  -0.827  -4.159   8.390 1.00 . A A .  20 GLN HA   1 1 
        1   312 1 1  20 GLN HB2  H   0.233  -5.701   6.766 1.00 . A A .  20 GLN HB2  1 1 
        1   313 1 1  20 GLN HB3  H   1.831  -5.150   7.209 1.00 . A A .  20 GLN HB3  1 1 
        1   314 1 1  20 GLN HE21 H   3.235  -7.087   8.578 1.00 . A A .  20 GLN HE21 1 1 
        1   315 1 1  20 GLN HE22 H   3.738  -6.617  10.286 1.00 . A A .  20 GLN HE22 1 1 
        1   316 1 1  20 GLN HG2  H  -0.193  -6.402   9.201 1.00 . A A .  20 GLN HG2  1 1 
        1   317 1 1  20 GLN HG3  H   0.877  -7.359   8.218 1.00 . A A .  20 GLN HG3  1 1 
        1   318 1 1  20 GLN N    N   0.001  -3.142   6.725 1.00 . A A .  20 GLN N    1 1 
        1   319 1 1  20 GLN NE2  N   3.076  -6.699   9.510 1.00 . A A .  20 GLN NE2  1 1 
        1   320 1 1  20 GLN O    O   0.223  -2.482   9.885 1.00 . A A .  20 GLN O    1 1 
        1   321 1 1  20 GLN OE1  O   1.634  -5.801  10.891 1.00 . A A .  20 GLN OE1  1 1 
        1   322 1 1  21 ASN C    C   4.344  -1.672   8.960 1.00 . A A .  21 ASN C    1 1 
        1   323 1 1  21 ASN CA   C   3.004  -1.929   9.769 1.00 . A A .  21 ASN CA   1 1 
        1   324 1 1  21 ASN CB   C   3.320  -2.465  11.188 1.00 . A A .  21 ASN CB   1 1 
        1   325 1 1  21 ASN CG   C   2.211  -2.390  12.225 1.00 . A A .  21 ASN CG   1 1 
        1   326 1 1  21 ASN H    H   2.582  -3.187   8.027 1.00 . A A .  21 ASN H    1 1 
        1   327 1 1  21 ASN HA   H   2.482  -0.943   9.817 1.00 . A A .  21 ASN HA   1 1 
        1   328 1 1  21 ASN HB2  H   3.729  -3.492  11.123 1.00 . A A .  21 ASN HB2  1 1 
        1   329 1 1  21 ASN HB3  H   4.154  -1.874  11.613 1.00 . A A .  21 ASN HB3  1 1 
        1   330 1 1  21 ASN HD21 H   1.721  -4.313  11.969 1.00 . A A .  21 ASN HD21 1 1 
        1   331 1 1  21 ASN HD22 H   0.857  -3.348  13.276 1.00 . A A .  21 ASN HD22 1 1 
        1   332 1 1  21 ASN N    N   2.222  -2.896   8.942 1.00 . A A .  21 ASN N    1 1 
        1   333 1 1  21 ASN ND2  N   1.591  -3.489  12.580 1.00 . A A .  21 ASN ND2  1 1 
        1   334 1 1  21 ASN O    O   5.434  -2.109   9.335 1.00 . A A .  21 ASN O    1 1 
        1   335 1 1  21 ASN OD1  O   1.904  -1.339  12.776 1.00 . A A .  21 ASN OD1  1 1 
        1   336 1 1  22 ALA C    C   5.202   0.508   6.105 1.00 . A A .  22 ALA C    1 1 
        1   337 1 1  22 ALA CA   C   5.279  -0.878   6.794 1.00 . A A .  22 ALA CA   1 1 
        1   338 1 1  22 ALA CB   C   5.199  -2.063   5.820 1.00 . A A .  22 ALA CB   1 1 
        1   339 1 1  22 ALA H    H   3.226  -0.777   7.600 1.00 . A A .  22 ALA H    1 1 
        1   340 1 1  22 ALA HA   H   6.270  -0.921   7.292 1.00 . A A .  22 ALA HA   1 1 
        1   341 1 1  22 ALA HB1  H   5.342  -3.023   6.350 1.00 . A A .  22 ALA HB1  1 1 
        1   342 1 1  22 ALA HB2  H   4.231  -2.127   5.288 1.00 . A A .  22 ALA HB2  1 1 
        1   343 1 1  22 ALA HB3  H   5.988  -2.009   5.048 1.00 . A A .  22 ALA HB3  1 1 
        1   344 1 1  22 ALA N    N   4.204  -0.997   7.813 1.00 . A A .  22 ALA N    1 1 
        1   345 1 1  22 ALA O    O   6.118   1.313   6.274 1.00 . A A .  22 ALA O    1 1 
        1   346 1 1  23 VAL C    C   3.509   3.224   6.103 1.00 . A A .  23 VAL C    1 1 
        1   347 1 1  23 VAL CA   C   3.802   2.212   4.942 1.00 . A A .  23 VAL CA   1 1 
        1   348 1 1  23 VAL CB   C   2.698   2.235   3.844 1.00 . A A .  23 VAL CB   1 1 
        1   349 1 1  23 VAL CG1  C   2.469   3.647   3.241 1.00 . A A .  23 VAL CG1  1 1 
        1   350 1 1  23 VAL CG2  C   3.016   1.321   2.638 1.00 . A A .  23 VAL CG2  1 1 
        1   351 1 1  23 VAL H    H   3.449   0.034   5.267 1.00 . A A .  23 VAL H    1 1 
        1   352 1 1  23 VAL HA   H   4.725   2.585   4.463 1.00 . A A .  23 VAL HA   1 1 
        1   353 1 1  23 VAL HB   H   1.746   1.891   4.298 1.00 . A A .  23 VAL HB   1 1 
        1   354 1 1  23 VAL HG11 H   1.763   3.620   2.387 1.00 . A A .  23 VAL HG11 1 1 
        1   355 1 1  23 VAL HG12 H   2.047   4.353   3.982 1.00 . A A .  23 VAL HG12 1 1 
        1   356 1 1  23 VAL HG13 H   3.406   4.098   2.865 1.00 . A A .  23 VAL HG13 1 1 
        1   357 1 1  23 VAL HG21 H   2.136   1.235   1.977 1.00 . A A .  23 VAL HG21 1 1 
        1   358 1 1  23 VAL HG22 H   3.865   1.691   2.034 1.00 . A A .  23 VAL HG22 1 1 
        1   359 1 1  23 VAL HG23 H   3.267   0.293   2.939 1.00 . A A .  23 VAL HG23 1 1 
        1   360 1 1  23 VAL N    N   4.090   0.822   5.415 1.00 . A A .  23 VAL N    1 1 
        1   361 1 1  23 VAL O    O   3.909   4.380   5.975 1.00 . A A .  23 VAL O    1 1 
        1   362 1 1  24 GLU C    C   4.316   3.728   9.154 1.00 . A A .  24 GLU C    1 1 
        1   363 1 1  24 GLU CA   C   2.906   3.663   8.468 1.00 . A A .  24 GLU CA   1 1 
        1   364 1 1  24 GLU CB   C   1.796   3.129   9.393 1.00 . A A .  24 GLU CB   1 1 
        1   365 1 1  24 GLU CD   C   1.870   4.129  11.803 1.00 . A A .  24 GLU CD   1 1 
        1   366 1 1  24 GLU CG   C   1.222   4.108  10.434 1.00 . A A .  24 GLU CG   1 1 
        1   367 1 1  24 GLU H    H   2.634   1.829   7.251 1.00 . A A .  24 GLU H    1 1 
        1   368 1 1  24 GLU HA   H   2.639   4.695   8.170 1.00 . A A .  24 GLU HA   1 1 
        1   369 1 1  24 GLU HB2  H   0.928   2.808   8.779 1.00 . A A .  24 GLU HB2  1 1 
        1   370 1 1  24 GLU HB3  H   2.134   2.190   9.874 1.00 . A A .  24 GLU HB3  1 1 
        1   371 1 1  24 GLU HG2  H   1.156   5.139  10.053 1.00 . A A .  24 GLU HG2  1 1 
        1   372 1 1  24 GLU HG3  H   0.166   3.842  10.624 1.00 . A A .  24 GLU HG3  1 1 
        1   373 1 1  24 GLU N    N   2.884   2.826   7.225 1.00 . A A .  24 GLU N    1 1 
        1   374 1 1  24 GLU O    O   4.805   4.822   9.454 1.00 . A A .  24 GLU O    1 1 
        1   375 1 1  24 GLU OE1  O   1.575   3.225  12.616 1.00 . A A .  24 GLU OE1  1 1 
        1   376 1 1  24 GLU OE2  O   2.633   5.077  12.099 1.00 . A A .  24 GLU OE2  1 1 
        1   377 1 1  25 GLN C    C   7.505   3.185   9.210 1.00 . A A .  25 GLN C    1 1 
        1   378 1 1  25 GLN CA   C   6.328   2.483   9.952 1.00 . A A .  25 GLN CA   1 1 
        1   379 1 1  25 GLN CB   C   6.591   0.979  10.213 1.00 . A A .  25 GLN CB   1 1 
        1   380 1 1  25 GLN CD   C   7.953   1.100  12.424 1.00 . A A .  25 GLN CD   1 1 
        1   381 1 1  25 GLN CG   C   7.866   0.599  10.992 1.00 . A A .  25 GLN CG   1 1 
        1   382 1 1  25 GLN H    H   4.525   1.775   8.887 1.00 . A A .  25 GLN H    1 1 
        1   383 1 1  25 GLN HA   H   6.255   2.978  10.941 1.00 . A A .  25 GLN HA   1 1 
        1   384 1 1  25 GLN HB2  H   5.724   0.542  10.753 1.00 . A A .  25 GLN HB2  1 1 
        1   385 1 1  25 GLN HB3  H   6.624   0.437   9.248 1.00 . A A .  25 GLN HB3  1 1 
        1   386 1 1  25 GLN HE21 H   8.809   2.795  11.817 1.00 . A A .  25 GLN HE21 1 1 
        1   387 1 1  25 GLN HE22 H   8.539   2.541  13.628 1.00 . A A .  25 GLN HE22 1 1 
        1   388 1 1  25 GLN HG2  H   7.914  -0.506  11.027 1.00 . A A .  25 GLN HG2  1 1 
        1   389 1 1  25 GLN HG3  H   8.772   0.888  10.426 1.00 . A A .  25 GLN HG3  1 1 
        1   390 1 1  25 GLN N    N   4.977   2.572   9.340 1.00 . A A .  25 GLN N    1 1 
        1   391 1 1  25 GLN NE2  N   8.552   2.247  12.648 1.00 . A A .  25 GLN NE2  1 1 
        1   392 1 1  25 GLN O    O   8.412   3.653   9.904 1.00 . A A .  25 GLN O    1 1 
        1   393 1 1  25 GLN OE1  O   7.492   0.466  13.365 1.00 . A A .  25 GLN OE1  1 1 
        1   394 1 1  26 LEU C    C   8.872   5.496   7.549 1.00 . A A .  26 LEU C    1 1 
        1   395 1 1  26 LEU CA   C   8.551   4.040   7.109 1.00 . A A .  26 LEU CA   1 1 
        1   396 1 1  26 LEU CB   C   8.378   3.857   5.576 1.00 . A A .  26 LEU CB   1 1 
        1   397 1 1  26 LEU CD1  C   7.124   5.902   4.568 1.00 . A A .  26 LEU CD1  1 1 
        1   398 1 1  26 LEU CD2  C   6.997   3.695   3.478 1.00 . A A .  26 LEU CD2  1 1 
        1   399 1 1  26 LEU CG   C   7.130   4.397   4.851 1.00 . A A .  26 LEU CG   1 1 
        1   400 1 1  26 LEU H    H   6.788   2.722   7.389 1.00 . A A .  26 LEU H    1 1 
        1   401 1 1  26 LEU HA   H   9.490   3.485   7.318 1.00 . A A .  26 LEU HA   1 1 
        1   402 1 1  26 LEU HB2  H   9.293   4.229   5.075 1.00 . A A .  26 LEU HB2  1 1 
        1   403 1 1  26 LEU HB3  H   8.419   2.759   5.411 1.00 . A A .  26 LEU HB3  1 1 
        1   404 1 1  26 LEU HD11 H   7.967   6.216   3.927 1.00 . A A .  26 LEU HD11 1 1 
        1   405 1 1  26 LEU HD12 H   6.186   6.226   4.069 1.00 . A A .  26 LEU HD12 1 1 
        1   406 1 1  26 LEU HD13 H   7.172   6.504   5.481 1.00 . A A .  26 LEU HD13 1 1 
        1   407 1 1  26 LEU HD21 H   7.880   3.878   2.837 1.00 . A A .  26 LEU HD21 1 1 
        1   408 1 1  26 LEU HD22 H   6.874   2.601   3.579 1.00 . A A .  26 LEU HD22 1 1 
        1   409 1 1  26 LEU HD23 H   6.109   4.050   2.923 1.00 . A A .  26 LEU HD23 1 1 
        1   410 1 1  26 LEU HG   H   6.235   4.144   5.445 1.00 . A A .  26 LEU HG   1 1 
        1   411 1 1  26 LEU N    N   7.501   3.295   7.866 1.00 . A A .  26 LEU N    1 1 
        1   412 1 1  26 LEU O    O  10.046   5.870   7.547 1.00 . A A .  26 LEU O    1 1 
        1   413 1 1  27 GLN C    C   8.974   8.646   7.839 1.00 . A A .  27 GLN C    1 1 
        1   414 1 1  27 GLN CA   C   8.019   7.637   8.557 1.00 . A A .  27 GLN CA   1 1 
        1   415 1 1  27 GLN CB   C   8.253   7.403  10.068 1.00 . A A .  27 GLN CB   1 1 
        1   416 1 1  27 GLN CD   C   7.671   8.167  12.418 1.00 . A A .  27 GLN CD   1 1 
        1   417 1 1  27 GLN CG   C   7.917   8.600  10.978 1.00 . A A .  27 GLN CG   1 1 
        1   418 1 1  27 GLN H    H   7.007   5.726   8.119 1.00 . A A .  27 GLN H    1 1 
        1   419 1 1  27 GLN HA   H   7.016   8.099   8.472 1.00 . A A .  27 GLN HA   1 1 
        1   420 1 1  27 GLN HB2  H   7.634   6.537  10.392 1.00 . A A .  27 GLN HB2  1 1 
        1   421 1 1  27 GLN HB3  H   9.296   7.072  10.242 1.00 . A A .  27 GLN HB3  1 1 
        1   422 1 1  27 GLN HE21 H   9.617   8.063  12.742 1.00 . A A .  27 GLN HE21 1 1 
        1   423 1 1  27 GLN HE22 H   8.477   7.562  14.094 1.00 . A A .  27 GLN HE22 1 1 
        1   424 1 1  27 GLN HG2  H   8.713   9.368  10.929 1.00 . A A .  27 GLN HG2  1 1 
        1   425 1 1  27 GLN HG3  H   7.005   9.117  10.629 1.00 . A A .  27 GLN HG3  1 1 
        1   426 1 1  27 GLN N    N   7.850   6.283   7.945 1.00 . A A .  27 GLN N    1 1 
        1   427 1 1  27 GLN NE2  N   8.705   8.015  13.206 1.00 . A A .  27 GLN NE2  1 1 
        1   428 1 1  27 GLN O    O   9.801   9.312   8.464 1.00 . A A .  27 GLN O    1 1 
        1   429 1 1  27 GLN OE1  O   6.542   7.904  12.826 1.00 . A A .  27 GLN OE1  1 1 
        1   430 1 1  28 VAL C    C   9.022  10.924   5.334 1.00 . A A .  28 VAL C    1 1 
        1   431 1 1  28 VAL CA   C   9.711   9.555   5.639 1.00 . A A .  28 VAL CA   1 1 
        1   432 1 1  28 VAL CB   C  10.015   8.757   4.317 1.00 . A A .  28 VAL CB   1 1 
        1   433 1 1  28 VAL CG1  C  10.917   9.552   3.346 1.00 . A A .  28 VAL CG1  1 1 
        1   434 1 1  28 VAL CG2  C  10.722   7.404   4.560 1.00 . A A .  28 VAL CG2  1 1 
        1   435 1 1  28 VAL H    H   8.188   8.047   6.125 1.00 . A A .  28 VAL H    1 1 
        1   436 1 1  28 VAL HA   H  10.682   9.726   6.151 1.00 . A A .  28 VAL HA   1 1 
        1   437 1 1  28 VAL HB   H   9.056   8.548   3.796 1.00 . A A .  28 VAL HB   1 1 
        1   438 1 1  28 VAL HG11 H  10.401  10.443   2.948 1.00 . A A .  28 VAL HG11 1 1 
        1   439 1 1  28 VAL HG12 H  11.846   9.902   3.835 1.00 . A A .  28 VAL HG12 1 1 
        1   440 1 1  28 VAL HG13 H  11.208   8.953   2.463 1.00 . A A .  28 VAL HG13 1 1 
        1   441 1 1  28 VAL HG21 H  10.989   6.903   3.611 1.00 . A A .  28 VAL HG21 1 1 
        1   442 1 1  28 VAL HG22 H  11.651   7.510   5.150 1.00 . A A .  28 VAL HG22 1 1 
        1   443 1 1  28 VAL HG23 H  10.077   6.688   5.100 1.00 . A A .  28 VAL HG23 1 1 
        1   444 1 1  28 VAL N    N   8.811   8.761   6.513 1.00 . A A .  28 VAL N    1 1 
        1   445 1 1  28 VAL O    O   7.947  10.961   4.729 1.00 . A A .  28 VAL O    1 1 
        1   446 1 1  29 GLY C    C  10.219  14.059   4.296 1.00 . A A .  29 GLY C    1 1 
        1   447 1 1  29 GLY CA   C   9.261  13.391   5.294 1.00 . A A .  29 GLY CA   1 1 
        1   448 1 1  29 GLY H    H  10.629  11.846   6.053 1.00 . A A .  29 GLY H    1 1 
        1   449 1 1  29 GLY HA2  H   8.234  13.414   4.891 1.00 . A A .  29 GLY HA2  1 1 
        1   450 1 1  29 GLY HA3  H   9.205  14.026   6.198 1.00 . A A .  29 GLY HA3  1 1 
        1   451 1 1  29 GLY N    N   9.686  12.029   5.700 1.00 . A A .  29 GLY N    1 1 
        1   452 1 1  29 GLY O    O  10.798  15.098   4.611 1.00 . A A .  29 GLY O    1 1 
        1   453 1 1  30 GLN C    C  11.101  14.044   0.739 1.00 . A A .  30 GLN C    1 1 
        1   454 1 1  30 GLN CA   C  11.525  13.767   2.204 1.00 . A A .  30 GLN CA   1 1 
        1   455 1 1  30 GLN CB   C  12.577  12.637   2.353 1.00 . A A .  30 GLN CB   1 1 
        1   456 1 1  30 GLN CD   C  14.187  12.733   0.315 1.00 . A A .  30 GLN CD   1 1 
        1   457 1 1  30 GLN CG   C  13.991  12.928   1.811 1.00 . A A .  30 GLN CG   1 1 
        1   458 1 1  30 GLN H    H   9.886  12.558   3.060 1.00 . A A .  30 GLN H    1 1 
        1   459 1 1  30 GLN HA   H  12.012  14.704   2.548 1.00 . A A .  30 GLN HA   1 1 
        1   460 1 1  30 GLN HB2  H  12.708  12.427   3.436 1.00 . A A .  30 GLN HB2  1 1 
        1   461 1 1  30 GLN HB3  H  12.201  11.687   1.927 1.00 . A A .  30 GLN HB3  1 1 
        1   462 1 1  30 GLN HE21 H  14.572  14.672   0.050 1.00 . A A .  30 GLN HE21 1 1 
        1   463 1 1  30 GLN HE22 H  14.638  13.557  -1.409 1.00 . A A .  30 GLN HE22 1 1 
        1   464 1 1  30 GLN HG2  H  14.336  13.926   2.145 1.00 . A A .  30 GLN HG2  1 1 
        1   465 1 1  30 GLN HG3  H  14.687  12.224   2.305 1.00 . A A .  30 GLN HG3  1 1 
        1   466 1 1  30 GLN N    N  10.381  13.455   3.108 1.00 . A A .  30 GLN N    1 1 
        1   467 1 1  30 GLN NE2  N  14.579  13.756  -0.406 1.00 . A A .  30 GLN NE2  1 1 
        1   468 1 1  30 GLN O    O  11.504  15.088   0.226 1.00 . A A .  30 GLN O    1 1 
        1   469 1 1  30 GLN OE1  O  14.003  11.649  -0.230 1.00 . A A .  30 GLN OE1  1 1 
        1   470 1 1  31 SER C    C   8.753  12.695  -1.891 1.00 . A A .  31 SER C    1 1 
        1   471 1 1  31 SER CA   C  10.122  13.266  -1.409 1.00 . A A .  31 SER CA   1 1 
        1   472 1 1  31 SER CB   C  11.309  12.625  -2.167 1.00 . A A .  31 SER CB   1 1 
        1   473 1 1  31 SER H    H  10.032  12.346   0.610 1.00 . A A .  31 SER H    1 1 
        1   474 1 1  31 SER HA   H  10.138  14.343  -1.667 1.00 . A A .  31 SER HA   1 1 
        1   475 1 1  31 SER HB2  H  12.242  13.153  -1.895 1.00 . A A .  31 SER HB2  1 1 
        1   476 1 1  31 SER HB3  H  11.460  11.579  -1.860 1.00 . A A .  31 SER HB3  1 1 
        1   477 1 1  31 SER HG   H  10.925  13.687  -3.795 1.00 . A A .  31 SER HG   1 1 
        1   478 1 1  31 SER N    N  10.368  13.138   0.055 1.00 . A A .  31 SER N    1 1 
        1   479 1 1  31 SER O    O   8.316  11.613  -1.483 1.00 . A A .  31 SER O    1 1 
        1   480 1 1  31 SER OG   O  11.147  12.708  -3.584 1.00 . A A .  31 SER OG   1 1 
        1   481 1 1  32 LYS C    C   6.922  11.824  -4.477 1.00 . A A .  32 LYS C    1 1 
        1   482 1 1  32 LYS CA   C   6.851  13.019  -3.485 1.00 . A A .  32 LYS CA   1 1 
        1   483 1 1  32 LYS CB   C   6.138  14.261  -4.083 1.00 . A A .  32 LYS CB   1 1 
        1   484 1 1  32 LYS CD   C   7.899  15.398  -5.617 1.00 . A A .  32 LYS CD   1 1 
        1   485 1 1  32 LYS CE   C   8.135  16.328  -6.817 1.00 . A A .  32 LYS CE   1 1 
        1   486 1 1  32 LYS CG   C   6.511  14.787  -5.486 1.00 . A A .  32 LYS CG   1 1 
        1   487 1 1  32 LYS H    H   8.655  14.263  -3.111 1.00 . A A .  32 LYS H    1 1 
        1   488 1 1  32 LYS HA   H   6.199  12.662  -2.670 1.00 . A A .  32 LYS HA   1 1 
        1   489 1 1  32 LYS HB2  H   5.058  14.016  -4.127 1.00 . A A .  32 LYS HB2  1 1 
        1   490 1 1  32 LYS HB3  H   6.175  15.095  -3.351 1.00 . A A .  32 LYS HB3  1 1 
        1   491 1 1  32 LYS HD2  H   8.169  15.939  -4.698 1.00 . A A .  32 LYS HD2  1 1 
        1   492 1 1  32 LYS HD3  H   8.653  14.591  -5.667 1.00 . A A .  32 LYS HD3  1 1 
        1   493 1 1  32 LYS HE2  H   9.235  16.468  -6.931 1.00 . A A .  32 LYS HE2  1 1 
        1   494 1 1  32 LYS HE3  H   7.805  15.855  -7.767 1.00 . A A .  32 LYS HE3  1 1 
        1   495 1 1  32 LYS HG2  H   6.387  13.996  -6.249 1.00 . A A .  32 LYS HG2  1 1 
        1   496 1 1  32 LYS HG3  H   5.743  15.531  -5.744 1.00 . A A .  32 LYS HG3  1 1 
        1   497 1 1  32 LYS HZ1  H   6.545  17.690  -7.049 1.00 . A A .  32 LYS HZ1  1 1 
        1   498 1 1  32 LYS HZ2  H   7.283  17.789  -5.573 1.00 . A A .  32 LYS HZ2  1 1 
        1   499 1 1  32 LYS HZ3  H   8.003  18.472  -6.868 1.00 . A A .  32 LYS HZ3  1 1 
        1   500 1 1  32 LYS N    N   8.125  13.426  -2.831 1.00 . A A .  32 LYS N    1 1 
        1   501 1 1  32 LYS NZ   N   7.468  17.636  -6.584 1.00 . A A .  32 LYS NZ   1 1 
        1   502 1 1  32 LYS O    O   6.078  10.923  -4.467 1.00 . A A .  32 LYS O    1 1 
        1   503 1 1  33 GLN C    C   8.901   9.524  -5.624 1.00 . A A .  33 GLN C    1 1 
        1   504 1 1  33 GLN CA   C   8.310  10.802  -6.274 1.00 . A A .  33 GLN CA   1 1 
        1   505 1 1  33 GLN CB   C   9.205  11.412  -7.385 1.00 . A A .  33 GLN CB   1 1 
        1   506 1 1  33 GLN CD   C  11.271  12.766  -8.069 1.00 . A A .  33 GLN CD   1 1 
        1   507 1 1  33 GLN CG   C  10.553  12.033  -6.941 1.00 . A A .  33 GLN CG   1 1 
        1   508 1 1  33 GLN H    H   8.392  12.793  -5.287 1.00 . A A .  33 GLN H    1 1 
        1   509 1 1  33 GLN HA   H   7.390  10.441  -6.779 1.00 . A A .  33 GLN HA   1 1 
        1   510 1 1  33 GLN HB2  H   9.403  10.636  -8.152 1.00 . A A .  33 GLN HB2  1 1 
        1   511 1 1  33 GLN HB3  H   8.605  12.176  -7.921 1.00 . A A .  33 GLN HB3  1 1 
        1   512 1 1  33 GLN HE21 H  11.401  14.508  -7.023 1.00 . A A .  33 GLN HE21 1 1 
        1   513 1 1  33 GLN HE22 H  12.105  14.409  -8.716 1.00 . A A .  33 GLN HE22 1 1 
        1   514 1 1  33 GLN HG2  H  10.413  12.714  -6.081 1.00 . A A .  33 GLN HG2  1 1 
        1   515 1 1  33 GLN HG3  H  11.228  11.242  -6.568 1.00 . A A .  33 GLN HG3  1 1 
        1   516 1 1  33 GLN N    N   7.911  11.891  -5.362 1.00 . A A .  33 GLN N    1 1 
        1   517 1 1  33 GLN NE2  N  11.553  14.042  -7.938 1.00 . A A .  33 GLN NE2  1 1 
        1   518 1 1  33 GLN O    O   8.648   8.442  -6.150 1.00 . A A .  33 GLN O    1 1 
        1   519 1 1  33 GLN OE1  O  11.603  12.194  -9.101 1.00 . A A .  33 GLN OE1  1 1 
        1   520 1 1  34 GLN C    C   8.906   7.592  -3.098 1.00 . A A .  34 GLN C    1 1 
        1   521 1 1  34 GLN CA   C  10.065   8.419  -3.733 1.00 . A A .  34 GLN CA   1 1 
        1   522 1 1  34 GLN CB   C  11.114   8.795  -2.659 1.00 . A A .  34 GLN CB   1 1 
        1   523 1 1  34 GLN CD   C  13.329   8.291  -3.898 1.00 . A A .  34 GLN CD   1 1 
        1   524 1 1  34 GLN CG   C  12.464   9.322  -3.190 1.00 . A A .  34 GLN CG   1 1 
        1   525 1 1  34 GLN H    H   9.630  10.566  -4.091 1.00 . A A .  34 GLN H    1 1 
        1   526 1 1  34 GLN HA   H  10.557   7.733  -4.453 1.00 . A A .  34 GLN HA   1 1 
        1   527 1 1  34 GLN HB2  H  10.678   9.543  -1.970 1.00 . A A .  34 GLN HB2  1 1 
        1   528 1 1  34 GLN HB3  H  11.308   7.916  -2.013 1.00 . A A .  34 GLN HB3  1 1 
        1   529 1 1  34 GLN HE21 H  14.406   7.979  -2.245 1.00 . A A .  34 GLN HE21 1 1 
        1   530 1 1  34 GLN HE22 H  14.834   7.034  -3.769 1.00 . A A .  34 GLN HE22 1 1 
        1   531 1 1  34 GLN HG2  H  12.299  10.167  -3.884 1.00 . A A .  34 GLN HG2  1 1 
        1   532 1 1  34 GLN HG3  H  13.021   9.777  -2.348 1.00 . A A .  34 GLN HG3  1 1 
        1   533 1 1  34 GLN N    N   9.606   9.617  -4.483 1.00 . A A .  34 GLN N    1 1 
        1   534 1 1  34 GLN NE2  N  14.274   7.690  -3.218 1.00 . A A .  34 GLN NE2  1 1 
        1   535 1 1  34 GLN O    O   8.840   6.389  -3.355 1.00 . A A .  34 GLN O    1 1 
        1   536 1 1  34 GLN OE1  O  13.167   8.010  -5.080 1.00 . A A .  34 GLN OE1  1 1 
        1   537 1 1  35 VAL C    C   5.822   6.886  -2.844 1.00 . A A .  35 VAL C    1 1 
        1   538 1 1  35 VAL CA   C   6.805   7.460  -1.777 1.00 . A A .  35 VAL CA   1 1 
        1   539 1 1  35 VAL CB   C   6.146   8.279  -0.628 1.00 . A A .  35 VAL CB   1 1 
        1   540 1 1  35 VAL CG1  C   5.287   9.466  -1.082 1.00 . A A .  35 VAL CG1  1 1 
        1   541 1 1  35 VAL CG2  C   5.294   7.386   0.300 1.00 . A A .  35 VAL CG2  1 1 
        1   542 1 1  35 VAL H    H   8.040   9.232  -2.298 1.00 . A A .  35 VAL H    1 1 
        1   543 1 1  35 VAL HA   H   7.237   6.560  -1.294 1.00 . A A .  35 VAL HA   1 1 
        1   544 1 1  35 VAL HB   H   6.966   8.683   0.005 1.00 . A A .  35 VAL HB   1 1 
        1   545 1 1  35 VAL HG11 H   5.826  10.124  -1.781 1.00 . A A .  35 VAL HG11 1 1 
        1   546 1 1  35 VAL HG12 H   4.373   9.148  -1.611 1.00 . A A .  35 VAL HG12 1 1 
        1   547 1 1  35 VAL HG13 H   4.975  10.086  -0.223 1.00 . A A .  35 VAL HG13 1 1 
        1   548 1 1  35 VAL HG21 H   5.885   6.551   0.719 1.00 . A A .  35 VAL HG21 1 1 
        1   549 1 1  35 VAL HG22 H   4.895   7.956   1.160 1.00 . A A .  35 VAL HG22 1 1 
        1   550 1 1  35 VAL HG23 H   4.431   6.941  -0.228 1.00 . A A .  35 VAL HG23 1 1 
        1   551 1 1  35 VAL N    N   7.983   8.204  -2.327 1.00 . A A .  35 VAL N    1 1 
        1   552 1 1  35 VAL O    O   5.390   5.740  -2.695 1.00 . A A .  35 VAL O    1 1 
        1   553 1 1  36 SER C    C   5.441   6.010  -5.923 1.00 . A A .  36 SER C    1 1 
        1   554 1 1  36 SER CA   C   4.727   7.089  -5.057 1.00 . A A .  36 SER CA   1 1 
        1   555 1 1  36 SER CB   C   4.189   8.256  -5.911 1.00 . A A .  36 SER CB   1 1 
        1   556 1 1  36 SER H    H   6.045   8.518  -3.987 1.00 . A A .  36 SER H    1 1 
        1   557 1 1  36 SER HA   H   3.849   6.566  -4.619 1.00 . A A .  36 SER HA   1 1 
        1   558 1 1  36 SER HB2  H   4.031   9.170  -5.307 1.00 . A A .  36 SER HB2  1 1 
        1   559 1 1  36 SER HB3  H   4.913   8.527  -6.702 1.00 . A A .  36 SER HB3  1 1 
        1   560 1 1  36 SER HG   H   2.768   8.475  -7.262 1.00 . A A .  36 SER HG   1 1 
        1   561 1 1  36 SER N    N   5.520   7.633  -3.924 1.00 . A A .  36 SER N    1 1 
        1   562 1 1  36 SER O    O   4.793   5.024  -6.271 1.00 . A A .  36 SER O    1 1 
        1   563 1 1  36 SER OG   O   2.941   7.893  -6.492 1.00 . A A .  36 SER OG   1 1 
        1   564 1 1  37 ALA C    C   7.675   3.726  -5.948 1.00 . A A .  37 ALA C    1 1 
        1   565 1 1  37 ALA CA   C   7.535   5.018  -6.815 1.00 . A A .  37 ALA CA   1 1 
        1   566 1 1  37 ALA CB   C   8.912   5.570  -7.208 1.00 . A A .  37 ALA CB   1 1 
        1   567 1 1  37 ALA H    H   7.206   6.977  -5.847 1.00 . A A .  37 ALA H    1 1 
        1   568 1 1  37 ALA HA   H   7.028   4.712  -7.752 1.00 . A A .  37 ALA HA   1 1 
        1   569 1 1  37 ALA HB1  H   9.532   4.810  -7.718 1.00 . A A .  37 ALA HB1  1 1 
        1   570 1 1  37 ALA HB2  H   8.826   6.425  -7.904 1.00 . A A .  37 ALA HB2  1 1 
        1   571 1 1  37 ALA HB3  H   9.486   5.923  -6.330 1.00 . A A .  37 ALA HB3  1 1 
        1   572 1 1  37 ALA N    N   6.749   6.130  -6.217 1.00 . A A .  37 ALA N    1 1 
        1   573 1 1  37 ALA O    O   7.518   2.631  -6.491 1.00 . A A .  37 ALA O    1 1 
        1   574 1 1  38 LEU C    C   6.530   1.984  -3.510 1.00 . A A .  38 LEU C    1 1 
        1   575 1 1  38 LEU CA   C   7.917   2.690  -3.695 1.00 . A A .  38 LEU CA   1 1 
        1   576 1 1  38 LEU CB   C   8.527   3.109  -2.330 1.00 . A A .  38 LEU CB   1 1 
        1   577 1 1  38 LEU CD1  C  10.909   3.761  -3.119 1.00 . A A .  38 LEU CD1  1 1 
        1   578 1 1  38 LEU CD2  C  10.456   3.238  -0.724 1.00 . A A .  38 LEU CD2  1 1 
        1   579 1 1  38 LEU CG   C  10.054   2.911  -2.177 1.00 . A A .  38 LEU CG   1 1 
        1   580 1 1  38 LEU H    H   8.032   4.824  -4.314 1.00 . A A .  38 LEU H    1 1 
        1   581 1 1  38 LEU HA   H   8.552   1.905  -4.144 1.00 . A A .  38 LEU HA   1 1 
        1   582 1 1  38 LEU HB2  H   8.240   4.148  -2.075 1.00 . A A .  38 LEU HB2  1 1 
        1   583 1 1  38 LEU HB3  H   8.061   2.501  -1.526 1.00 . A A .  38 LEU HB3  1 1 
        1   584 1 1  38 LEU HD11 H  10.693   3.559  -4.183 1.00 . A A .  38 LEU HD11 1 1 
        1   585 1 1  38 LEU HD12 H  10.764   4.844  -2.962 1.00 . A A .  38 LEU HD12 1 1 
        1   586 1 1  38 LEU HD13 H  11.987   3.557  -2.978 1.00 . A A .  38 LEU HD13 1 1 
        1   587 1 1  38 LEU HD21 H  11.535   3.068  -0.551 1.00 . A A .  38 LEU HD21 1 1 
        1   588 1 1  38 LEU HD22 H  10.246   4.292  -0.464 1.00 . A A .  38 LEU HD22 1 1 
        1   589 1 1  38 LEU HD23 H   9.918   2.606   0.006 1.00 . A A .  38 LEU HD23 1 1 
        1   590 1 1  38 LEU HG   H  10.287   1.840  -2.357 1.00 . A A .  38 LEU HG   1 1 
        1   591 1 1  38 LEU N    N   7.922   3.849  -4.632 1.00 . A A .  38 LEU N    1 1 
        1   592 1 1  38 LEU O    O   6.485   0.753  -3.516 1.00 . A A .  38 LEU O    1 1 
        1   593 1 1  39 LEU C    C   3.703   1.604  -4.962 1.00 . A A .  39 LEU C    1 1 
        1   594 1 1  39 LEU CA   C   4.056   2.170  -3.541 1.00 . A A .  39 LEU CA   1 1 
        1   595 1 1  39 LEU CB   C   3.049   3.276  -3.109 1.00 . A A .  39 LEU CB   1 1 
        1   596 1 1  39 LEU CD1  C   2.339   4.851  -1.251 1.00 . A A .  39 LEU CD1  1 1 
        1   597 1 1  39 LEU CD2  C   2.162   2.384  -0.898 1.00 . A A .  39 LEU CD2  1 1 
        1   598 1 1  39 LEU CG   C   2.975   3.495  -1.577 1.00 . A A .  39 LEU CG   1 1 
        1   599 1 1  39 LEU H    H   5.582   3.746  -3.295 1.00 . A A .  39 LEU H    1 1 
        1   600 1 1  39 LEU HA   H   3.958   1.307  -2.855 1.00 . A A .  39 LEU HA   1 1 
        1   601 1 1  39 LEU HB2  H   3.320   4.223  -3.622 1.00 . A A .  39 LEU HB2  1 1 
        1   602 1 1  39 LEU HB3  H   2.036   3.051  -3.486 1.00 . A A .  39 LEU HB3  1 1 
        1   603 1 1  39 LEU HD11 H   2.908   5.701  -1.684 1.00 . A A .  39 LEU HD11 1 1 
        1   604 1 1  39 LEU HD12 H   1.297   4.931  -1.613 1.00 . A A .  39 LEU HD12 1 1 
        1   605 1 1  39 LEU HD13 H   2.304   5.013  -0.159 1.00 . A A .  39 LEU HD13 1 1 
        1   606 1 1  39 LEU HD21 H   2.568   1.380  -1.107 1.00 . A A .  39 LEU HD21 1 1 
        1   607 1 1  39 LEU HD22 H   2.135   2.476   0.200 1.00 . A A .  39 LEU HD22 1 1 
        1   608 1 1  39 LEU HD23 H   1.105   2.378  -1.218 1.00 . A A .  39 LEU HD23 1 1 
        1   609 1 1  39 LEU HG   H   4.008   3.508  -1.167 1.00 . A A .  39 LEU HG   1 1 
        1   610 1 1  39 LEU N    N   5.425   2.732  -3.392 1.00 . A A .  39 LEU N    1 1 
        1   611 1 1  39 LEU O    O   3.073   0.549  -5.046 1.00 . A A .  39 LEU O    1 1 
        1   612 1 1  40 GLY C    C   2.718   2.769  -8.127 1.00 . A A .  40 GLY C    1 1 
        1   613 1 1  40 GLY CA   C   3.789   1.911  -7.432 1.00 . A A .  40 GLY CA   1 1 
        1   614 1 1  40 GLY H    H   4.636   3.145  -5.792 1.00 . A A .  40 GLY H    1 1 
        1   615 1 1  40 GLY HA2  H   4.730   1.968  -8.010 1.00 . A A .  40 GLY HA2  1 1 
        1   616 1 1  40 GLY HA3  H   3.493   0.848  -7.491 1.00 . A A .  40 GLY HA3  1 1 
        1   617 1 1  40 GLY N    N   4.068   2.315  -6.035 1.00 . A A .  40 GLY N    1 1 
        1   618 1 1  40 GLY O    O   1.590   2.319  -8.339 1.00 . A A .  40 GLY O    1 1 
        1   619 1 1  41 THR C    C   2.963   6.323  -9.377 1.00 . A A .  41 THR C    1 1 
        1   620 1 1  41 THR CA   C   2.108   5.079  -8.914 1.00 . A A .  41 THR CA   1 1 
        1   621 1 1  41 THR CB   C   1.091   5.439  -7.789 1.00 . A A .  41 THR CB   1 1 
        1   622 1 1  41 THR CG2  C   0.136   6.600  -8.001 1.00 . A A .  41 THR CG2  1 1 
        1   623 1 1  41 THR H    H   3.930   4.329  -7.973 1.00 . A A .  41 THR H    1 1 
        1   624 1 1  41 THR HA   H   1.571   4.681  -9.797 1.00 . A A .  41 THR HA   1 1 
        1   625 1 1  41 THR HB   H   1.657   5.634  -6.853 1.00 . A A .  41 THR HB   1 1 
        1   626 1 1  41 THR HG1  H   0.751   3.547  -7.883 1.00 . A A .  41 THR HG1  1 1 
        1   627 1 1  41 THR HG21 H  -0.585   6.449  -8.821 1.00 . A A .  41 THR HG21 1 1 
        1   628 1 1  41 THR HG22 H  -0.472   6.748  -7.094 1.00 . A A .  41 THR HG22 1 1 
        1   629 1 1  41 THR HG23 H   0.641   7.561  -8.184 1.00 . A A .  41 THR HG23 1 1 
        1   630 1 1  41 THR N    N   3.059   4.025  -8.428 1.00 . A A .  41 THR N    1 1 
        1   631 1 1  41 THR O    O   4.007   6.599  -8.773 1.00 . A A .  41 THR O    1 1 
        1   632 1 1  41 THR OG1  O   0.236   4.321  -7.577 1.00 . A A .  41 THR OG1  1 1 
        1   633 1 1  42 PRO C    C   3.029   9.523  -9.510 1.00 . A A .  42 PRO C    1 1 
        1   634 1 1  42 PRO CA   C   3.212   8.475 -10.646 1.00 . A A .  42 PRO CA   1 1 
        1   635 1 1  42 PRO CB   C   2.567   8.876 -12.000 1.00 . A A .  42 PRO CB   1 1 
        1   636 1 1  42 PRO CD   C   1.445   6.843 -11.303 1.00 . A A .  42 PRO CD   1 1 
        1   637 1 1  42 PRO CG   C   1.185   8.186 -12.002 1.00 . A A .  42 PRO CG   1 1 
        1   638 1 1  42 PRO HA   H   4.299   8.324 -10.796 1.00 . A A .  42 PRO HA   1 1 
        1   639 1 1  42 PRO HB2  H   2.494   9.967 -12.161 1.00 . A A .  42 PRO HB2  1 1 
        1   640 1 1  42 PRO HB3  H   3.184   8.473 -12.827 1.00 . A A .  42 PRO HB3  1 1 
        1   641 1 1  42 PRO HD2  H   0.545   6.478 -10.778 1.00 . A A .  42 PRO HD2  1 1 
        1   642 1 1  42 PRO HD3  H   1.756   6.055 -12.016 1.00 . A A .  42 PRO HD3  1 1 
        1   643 1 1  42 PRO HG2  H   0.465   8.784 -11.410 1.00 . A A .  42 PRO HG2  1 1 
        1   644 1 1  42 PRO HG3  H   0.766   8.070 -13.017 1.00 . A A .  42 PRO HG3  1 1 
        1   645 1 1  42 PRO N    N   2.563   7.140 -10.387 1.00 . A A .  42 PRO N    1 1 
        1   646 1 1  42 PRO O    O   2.318   9.303  -8.524 1.00 . A A .  42 PRO O    1 1 
        1   647 1 1  43 SER C    C   3.417  13.137  -9.325 1.00 . A A .  43 SER C    1 1 
        1   648 1 1  43 SER CA   C   3.629  11.760  -8.626 1.00 . A A .  43 SER CA   1 1 
        1   649 1 1  43 SER CB   C   4.835  11.637  -7.667 1.00 . A A .  43 SER CB   1 1 
        1   650 1 1  43 SER H    H   4.247  10.773 -10.491 1.00 . A A .  43 SER H    1 1 
        1   651 1 1  43 SER HA   H   2.716  11.616  -8.020 1.00 . A A .  43 SER HA   1 1 
        1   652 1 1  43 SER HB2  H   5.050  10.573  -7.462 1.00 . A A .  43 SER HB2  1 1 
        1   653 1 1  43 SER HB3  H   5.758  12.050  -8.116 1.00 . A A .  43 SER HB3  1 1 
        1   654 1 1  43 SER HG   H   4.996  11.755  -5.732 1.00 . A A .  43 SER HG   1 1 
        1   655 1 1  43 SER N    N   3.736  10.654  -9.616 1.00 . A A .  43 SER N    1 1 
        1   656 1 1  43 SER O    O   2.898  13.211 -10.444 1.00 . A A .  43 SER O    1 1 
        1   657 1 1  43 SER OG   O   4.553  12.275  -6.423 1.00 . A A .  43 SER OG   1 1 
        1   658 1 1  44 ILE C    C   4.737  16.412  -9.277 1.00 . A A .  44 ILE C    1 1 
        1   659 1 1  44 ILE CA   C   3.400  15.617  -9.066 1.00 . A A .  44 ILE CA   1 1 
        1   660 1 1  44 ILE CB   C   2.387  16.285  -8.063 1.00 . A A .  44 ILE CB   1 1 
        1   661 1 1  44 ILE CD1  C   0.146  15.865  -6.828 1.00 . A A .  44 ILE CD1  1 1 
        1   662 1 1  44 ILE CG1  C   1.037  15.499  -8.011 1.00 . A A .  44 ILE CG1  1 1 
        1   663 1 1  44 ILE CG2  C   2.066  17.746  -8.470 1.00 . A A .  44 ILE CG2  1 1 
        1   664 1 1  44 ILE H    H   4.207  13.999  -7.748 1.00 . A A .  44 ILE H    1 1 
        1   665 1 1  44 ILE HA   H   2.877  15.598 -10.043 1.00 . A A .  44 ILE HA   1 1 
        1   666 1 1  44 ILE HB   H   2.832  16.287  -7.048 1.00 . A A .  44 ILE HB   1 1 
        1   667 1 1  44 ILE HD11 H  -0.180  16.920  -6.836 1.00 . A A .  44 ILE HD11 1 1 
        1   668 1 1  44 ILE HD12 H  -0.770  15.249  -6.817 1.00 . A A .  44 ILE HD12 1 1 
        1   669 1 1  44 ILE HD13 H   0.662  15.696  -5.866 1.00 . A A .  44 ILE HD13 1 1 
        1   670 1 1  44 ILE HG12 H   0.484  15.621  -8.962 1.00 . A A .  44 ILE HG12 1 1 
        1   671 1 1  44 ILE HG13 H   1.227  14.412  -7.933 1.00 . A A .  44 ILE HG13 1 1 
        1   672 1 1  44 ILE HG21 H   2.962  18.388  -8.502 1.00 . A A .  44 ILE HG21 1 1 
        1   673 1 1  44 ILE HG22 H   1.592  17.795  -9.468 1.00 . A A .  44 ILE HG22 1 1 
        1   674 1 1  44 ILE HG23 H   1.379  18.230  -7.752 1.00 . A A .  44 ILE HG23 1 1 
        1   675 1 1  44 ILE N    N   3.751  14.233  -8.633 1.00 . A A .  44 ILE N    1 1 
        1   676 1 1  44 ILE O    O   5.230  17.021  -8.318 1.00 . A A .  44 ILE O    1 1 
        1   677 1 1  45 PRO C    C   6.338  18.743 -11.177 1.00 . A A .  45 PRO C    1 1 
        1   678 1 1  45 PRO CA   C   6.582  17.265 -10.756 1.00 . A A .  45 PRO CA   1 1 
        1   679 1 1  45 PRO CB   C   7.270  16.385 -11.837 1.00 . A A .  45 PRO CB   1 1 
        1   680 1 1  45 PRO CD   C   5.012  15.543 -11.612 1.00 . A A .  45 PRO CD   1 1 
        1   681 1 1  45 PRO CG   C   6.093  15.820 -12.668 1.00 . A A .  45 PRO CG   1 1 
        1   682 1 1  45 PRO HA   H   7.226  17.280  -9.857 1.00 . A A .  45 PRO HA   1 1 
        1   683 1 1  45 PRO HB2  H   8.006  16.931 -12.455 1.00 . A A .  45 PRO HB2  1 1 
        1   684 1 1  45 PRO HB3  H   7.816  15.558 -11.342 1.00 . A A .  45 PRO HB3  1 1 
        1   685 1 1  45 PRO HD2  H   3.991  15.713 -11.999 1.00 . A A .  45 PRO HD2  1 1 
        1   686 1 1  45 PRO HD3  H   5.060  14.495 -11.260 1.00 . A A .  45 PRO HD3  1 1 
        1   687 1 1  45 PRO HG2  H   5.740  16.586 -13.386 1.00 . A A .  45 PRO HG2  1 1 
        1   688 1 1  45 PRO HG3  H   6.369  14.921 -13.247 1.00 . A A .  45 PRO HG3  1 1 
        1   689 1 1  45 PRO N    N   5.340  16.463 -10.498 1.00 . A A .  45 PRO N    1 1 
        1   690 1 1  45 PRO O    O   6.748  19.186 -12.253 1.00 . A A .  45 PRO O    1 1 
        1   691 1 1  46 ASP C    C   6.960  21.584  -9.597 1.00 . A A .  46 ASP C    1 1 
        1   692 1 1  46 ASP CA   C   5.718  20.998 -10.348 1.00 . A A .  46 ASP CA   1 1 
        1   693 1 1  46 ASP CB   C   4.365  21.526  -9.812 1.00 . A A .  46 ASP CB   1 1 
        1   694 1 1  46 ASP CG   C   4.255  23.051  -9.715 1.00 . A A .  46 ASP CG   1 1 
        1   695 1 1  46 ASP H    H   5.496  19.016  -9.408 1.00 . A A .  46 ASP H    1 1 
        1   696 1 1  46 ASP HA   H   5.734  21.296 -11.413 1.00 . A A .  46 ASP HA   1 1 
        1   697 1 1  46 ASP HB2  H   3.551  21.177 -10.473 1.00 . A A .  46 ASP HB2  1 1 
        1   698 1 1  46 ASP HB3  H   4.127  21.113  -8.820 1.00 . A A .  46 ASP HB3  1 1 
        1   699 1 1  46 ASP N    N   5.742  19.519 -10.262 1.00 . A A .  46 ASP N    1 1 
        1   700 1 1  46 ASP O    O   7.072  21.361  -8.385 1.00 . A A .  46 ASP O    1 1 
        1   701 1 1  46 ASP OD1  O   4.793  23.763 -10.591 1.00 . A A .  46 ASP OD1  1 1 
        1   702 1 1  46 ASP OD2  O   3.685  23.551  -8.722 1.00 . A A .  46 ASP OD2  1 1 
        1   703 1 1  47 PRO C    C   8.372  24.449  -8.713 1.00 . A A .  47 PRO C    1 1 
        1   704 1 1  47 PRO CA   C   8.874  23.183  -9.469 1.00 . A A .  47 PRO CA   1 1 
        1   705 1 1  47 PRO CB   C   9.889  23.517 -10.594 1.00 . A A .  47 PRO CB   1 1 
        1   706 1 1  47 PRO CD   C   7.917  22.598 -11.684 1.00 . A A .  47 PRO CD   1 1 
        1   707 1 1  47 PRO CG   C   9.018  23.659 -11.865 1.00 . A A .  47 PRO CG   1 1 
        1   708 1 1  47 PRO HA   H   9.364  22.538  -8.712 1.00 . A A .  47 PRO HA   1 1 
        1   709 1 1  47 PRO HB2  H  10.502  24.414 -10.391 1.00 . A A .  47 PRO HB2  1 1 
        1   710 1 1  47 PRO HB3  H  10.592  22.669 -10.714 1.00 . A A .  47 PRO HB3  1 1 
        1   711 1 1  47 PRO HD2  H   6.945  22.958 -12.073 1.00 . A A .  47 PRO HD2  1 1 
        1   712 1 1  47 PRO HD3  H   8.167  21.651 -12.202 1.00 . A A .  47 PRO HD3  1 1 
        1   713 1 1  47 PRO HG2  H   8.561  24.668 -11.896 1.00 . A A .  47 PRO HG2  1 1 
        1   714 1 1  47 PRO HG3  H   9.592  23.525 -12.797 1.00 . A A .  47 PRO HG3  1 1 
        1   715 1 1  47 PRO N    N   7.870  22.372 -10.223 1.00 . A A .  47 PRO N    1 1 
        1   716 1 1  47 PRO O    O   9.152  24.989  -7.926 1.00 . A A .  47 PRO O    1 1 
        1   717 1 1  48 PHE C    C   6.084  25.497  -6.663 1.00 . A A .  48 PHE C    1 1 
        1   718 1 1  48 PHE CA   C   6.532  25.994  -8.067 1.00 . A A .  48 PHE CA   1 1 
        1   719 1 1  48 PHE CB   C   5.448  26.686  -8.929 1.00 . A A .  48 PHE CB   1 1 
        1   720 1 1  48 PHE CD1  C   5.524  29.187  -8.395 1.00 . A A .  48 PHE CD1  1 1 
        1   721 1 1  48 PHE CD2  C   3.623  27.907  -7.632 1.00 . A A .  48 PHE CD2  1 1 
        1   722 1 1  48 PHE CE1  C   4.985  30.334  -7.809 1.00 . A A .  48 PHE CE1  1 1 
        1   723 1 1  48 PHE CE2  C   3.086  29.053  -7.044 1.00 . A A .  48 PHE CE2  1 1 
        1   724 1 1  48 PHE CG   C   4.851  27.958  -8.310 1.00 . A A .  48 PHE CG   1 1 
        1   725 1 1  48 PHE CZ   C   3.768  30.265  -7.134 1.00 . A A .  48 PHE CZ   1 1 
        1   726 1 1  48 PHE H    H   6.531  24.354  -9.546 1.00 . A A .  48 PHE H    1 1 
        1   727 1 1  48 PHE HA   H   7.323  26.752  -7.890 1.00 . A A .  48 PHE HA   1 1 
        1   728 1 1  48 PHE HB2  H   5.885  26.939  -9.916 1.00 . A A .  48 PHE HB2  1 1 
        1   729 1 1  48 PHE HB3  H   4.637  25.973  -9.179 1.00 . A A .  48 PHE HB3  1 1 
        1   730 1 1  48 PHE HD1  H   6.475  29.253  -8.912 1.00 . A A .  48 PHE HD1  1 1 
        1   731 1 1  48 PHE HD2  H   3.091  26.966  -7.550 1.00 . A A .  48 PHE HD2  1 1 
        1   732 1 1  48 PHE HE1  H   5.516  31.276  -7.879 1.00 . A A .  48 PHE HE1  1 1 
        1   733 1 1  48 PHE HE2  H   2.140  28.998  -6.519 1.00 . A A .  48 PHE HE2  1 1 
        1   734 1 1  48 PHE HZ   H   3.352  31.155  -6.678 1.00 . A A .  48 PHE HZ   1 1 
        1   735 1 1  48 PHE N    N   7.114  24.900  -8.887 1.00 . A A .  48 PHE N    1 1 
        1   736 1 1  48 PHE O    O   6.776  25.792  -5.685 1.00 . A A .  48 PHE O    1 1 
        1   737 1 1  49 HIS C    C   3.645  23.001  -5.364 1.00 . A A .  49 HIS C    1 1 
        1   738 1 1  49 HIS CA   C   4.444  24.326  -5.207 1.00 . A A .  49 HIS CA   1 1 
        1   739 1 1  49 HIS CB   C   3.640  25.486  -4.581 1.00 . A A .  49 HIS CB   1 1 
        1   740 1 1  49 HIS CD2  C   2.857  26.529  -2.360 1.00 . A A .  49 HIS CD2  1 1 
        1   741 1 1  49 HIS CE1  C   3.197  24.956  -1.024 1.00 . A A .  49 HIS CE1  1 1 
        1   742 1 1  49 HIS CG   C   3.381  25.444  -3.074 1.00 . A A .  49 HIS CG   1 1 
        1   743 1 1  49 HIS H    H   4.530  24.446  -7.430 1.00 . A A .  49 HIS H    1 1 
        1   744 1 1  49 HIS HA   H   5.299  24.119  -4.533 1.00 . A A .  49 HIS HA   1 1 
        1   745 1 1  49 HIS HB2  H   4.187  26.435  -4.765 1.00 . A A .  49 HIS HB2  1 1 
        1   746 1 1  49 HIS HB3  H   2.678  25.613  -5.113 1.00 . A A .  49 HIS HB3  1 1 
        1   747 1 1  49 HIS HD1  H   4.013  23.453  -2.343 1.00 . A A .  49 HIS HD1  1 1 
        1   748 1 1  49 HIS HD2  H   2.625  27.481  -2.807 1.00 . A A .  49 HIS HD2  1 1 
        1   749 1 1  49 HIS HE1  H   3.237  24.391  -0.104 1.00 . A A .  49 HIS HE1  1 1 
        1   750 1 1  49 HIS N    N   4.959  24.769  -6.535 1.00 . A A .  49 HIS N    1 1 
        1   751 1 1  49 HIS ND1  N   3.618  24.399  -2.198 1.00 . A A .  49 HIS ND1  1 1 
        1   752 1 1  49 HIS NE2  N   2.711  26.237  -1.017 1.00 . A A .  49 HIS NE2  1 1 
        1   753 1 1  49 HIS O    O   2.408  22.983  -5.323 1.00 . A A .  49 HIS O    1 1 
        1   754 1 1  50 ALA C    C   3.115  19.910  -4.510 1.00 . A A .  50 ALA C    1 1 
        1   755 1 1  50 ALA CA   C   3.762  20.557  -5.764 1.00 . A A .  50 ALA CA   1 1 
        1   756 1 1  50 ALA CB   C   4.841  19.647  -6.346 1.00 . A A .  50 ALA CB   1 1 
        1   757 1 1  50 ALA H    H   5.358  22.084  -5.756 1.00 . A A .  50 ALA H    1 1 
        1   758 1 1  50 ALA HA   H   3.001  20.667  -6.568 1.00 . A A .  50 ALA HA   1 1 
        1   759 1 1  50 ALA HB1  H   5.702  19.533  -5.669 1.00 . A A .  50 ALA HB1  1 1 
        1   760 1 1  50 ALA HB2  H   4.444  18.637  -6.550 1.00 . A A .  50 ALA HB2  1 1 
        1   761 1 1  50 ALA HB3  H   5.213  20.050  -7.296 1.00 . A A .  50 ALA HB3  1 1 
        1   762 1 1  50 ALA N    N   4.378  21.883  -5.517 1.00 . A A .  50 ALA N    1 1 
        1   763 1 1  50 ALA O    O   3.757  19.245  -3.691 1.00 . A A .  50 ALA O    1 1 
        1   764 1 1  51 GLN C    C   0.393  18.327  -3.358 1.00 . A A .  51 GLN C    1 1 
        1   765 1 1  51 GLN CA   C   1.007  19.755  -3.222 1.00 . A A .  51 GLN CA   1 1 
        1   766 1 1  51 GLN CB   C   0.042  20.943  -2.953 1.00 . A A .  51 GLN CB   1 1 
        1   767 1 1  51 GLN CD   C  -0.030  23.442  -2.345 1.00 . A A .  51 GLN CD   1 1 
        1   768 1 1  51 GLN CG   C   0.777  22.158  -2.327 1.00 . A A .  51 GLN CG   1 1 
        1   769 1 1  51 GLN H    H   1.533  20.869  -5.075 1.00 . A A .  51 GLN H    1 1 
        1   770 1 1  51 GLN HA   H   1.670  19.671  -2.341 1.00 . A A .  51 GLN HA   1 1 
        1   771 1 1  51 GLN HB2  H  -0.484  21.232  -3.885 1.00 . A A .  51 GLN HB2  1 1 
        1   772 1 1  51 GLN HB3  H  -0.762  20.664  -2.249 1.00 . A A .  51 GLN HB3  1 1 
        1   773 1 1  51 GLN HE21 H   0.740  23.903  -4.115 1.00 . A A .  51 GLN HE21 1 1 
        1   774 1 1  51 GLN HE22 H  -0.408  25.109  -3.332 1.00 . A A .  51 GLN HE22 1 1 
        1   775 1 1  51 GLN HG2  H   1.050  21.924  -1.280 1.00 . A A .  51 GLN HG2  1 1 
        1   776 1 1  51 GLN HG3  H   1.752  22.334  -2.819 1.00 . A A .  51 GLN HG3  1 1 
        1   777 1 1  51 GLN N    N   1.806  20.132  -4.415 1.00 . A A .  51 GLN N    1 1 
        1   778 1 1  51 GLN NE2  N   0.040  24.194  -3.419 1.00 . A A .  51 GLN NE2  1 1 
        1   779 1 1  51 GLN O    O   0.941  17.464  -4.046 1.00 . A A .  51 GLN O    1 1 
        1   780 1 1  51 GLN OE1  O  -0.728  23.788  -1.395 1.00 . A A .  51 GLN OE1  1 1 
        1   781 1 1  52 ARG C    C  -1.417  15.661  -3.430 1.00 . A A .  52 ARG C    1 1 
        1   782 1 1  52 ARG CA   C  -1.096  16.655  -2.270 1.00 . A A .  52 ARG CA   1 1 
        1   783 1 1  52 ARG CB   C  -2.255  16.788  -1.241 1.00 . A A .  52 ARG CB   1 1 
        1   784 1 1  52 ARG CD   C  -4.080  18.340  -2.366 1.00 . A A .  52 ARG CD   1 1 
        1   785 1 1  52 ARG CG   C  -3.699  17.011  -1.710 1.00 . A A .  52 ARG CG   1 1 
        1   786 1 1  52 ARG CZ   C  -4.479  17.874  -4.802 1.00 . A A .  52 ARG CZ   1 1 
        1   787 1 1  52 ARG H    H  -0.971  18.829  -2.028 1.00 . A A .  52 ARG H    1 1 
        1   788 1 1  52 ARG HA   H  -0.240  16.231  -1.693 1.00 . A A .  52 ARG HA   1 1 
        1   789 1 1  52 ARG HB2  H  -2.284  15.850  -0.647 1.00 . A A .  52 ARG HB2  1 1 
        1   790 1 1  52 ARG HB3  H  -1.987  17.541  -0.477 1.00 . A A .  52 ARG HB3  1 1 
        1   791 1 1  52 ARG HD2  H  -5.160  18.535  -2.209 1.00 . A A .  52 ARG HD2  1 1 
        1   792 1 1  52 ARG HD3  H  -3.584  19.186  -1.851 1.00 . A A .  52 ARG HD3  1 1 
        1   793 1 1  52 ARG HE   H  -2.764  18.519  -4.100 1.00 . A A .  52 ARG HE   1 1 
        1   794 1 1  52 ARG HG2  H  -3.995  16.172  -2.366 1.00 . A A .  52 ARG HG2  1 1 
        1   795 1 1  52 ARG HG3  H  -4.335  16.882  -0.809 1.00 . A A .  52 ARG HG3  1 1 
        1   796 1 1  52 ARG HH11 H  -6.061  17.455  -3.700 1.00 . A A .  52 ARG HH11 1 1 
        1   797 1 1  52 ARG HH12 H  -6.165  17.025  -5.473 1.00 . A A .  52 ARG HH12 1 1 
        1   798 1 1  52 ARG HH21 H  -2.961  18.070  -6.058 1.00 . A A .  52 ARG HH21 1 1 
        1   799 1 1  52 ARG HH22 H  -4.499  17.349  -6.725 1.00 . A A .  52 ARG HH22 1 1 
        1   800 1 1  52 ARG N    N  -0.677  18.041  -2.610 1.00 . A A .  52 ARG N    1 1 
        1   801 1 1  52 ARG NE   N  -3.735  18.367  -3.811 1.00 . A A .  52 ARG NE   1 1 
        1   802 1 1  52 ARG NH1  N  -5.703  17.434  -4.658 1.00 . A A .  52 ARG NH1  1 1 
        1   803 1 1  52 ARG NH2  N  -3.945  17.810  -5.985 1.00 . A A .  52 ARG NH2  1 1 
        1   804 1 1  52 ARG O    O  -1.930  16.043  -4.484 1.00 . A A .  52 ARG O    1 1 
        1   805 1 1  53 TRP C    C  -3.085  12.845  -3.210 1.00 . A A .  53 TRP C    1 1 
        1   806 1 1  53 TRP CA   C  -1.803  13.259  -3.976 1.00 . A A .  53 TRP CA   1 1 
        1   807 1 1  53 TRP CB   C  -0.709  12.187  -4.132 1.00 . A A .  53 TRP CB   1 1 
        1   808 1 1  53 TRP CD1  C  -2.223  10.114  -5.045 1.00 . A A .  53 TRP CD1  1 1 
        1   809 1 1  53 TRP CD2  C  -0.196   9.602  -4.272 1.00 . A A .  53 TRP CD2  1 1 
        1   810 1 1  53 TRP CE2  C  -0.902   8.412  -4.609 1.00 . A A .  53 TRP CE2  1 1 
        1   811 1 1  53 TRP CE3  C   1.123   9.513  -3.715 1.00 . A A .  53 TRP CE3  1 1 
        1   812 1 1  53 TRP CG   C  -1.031  10.701  -4.513 1.00 . A A .  53 TRP CG   1 1 
        1   813 1 1  53 TRP CH2  C   0.981   7.086  -3.829 1.00 . A A .  53 TRP CH2  1 1 
        1   814 1 1  53 TRP CZ2  C  -0.298   7.139  -4.373 1.00 . A A .  53 TRP CZ2  1 1 
        1   815 1 1  53 TRP CZ3  C   1.676   8.259  -3.490 1.00 . A A .  53 TRP CZ3  1 1 
        1   816 1 1  53 TRP H    H  -0.908  14.177  -2.199 1.00 . A A .  53 TRP H    1 1 
        1   817 1 1  53 TRP HA   H  -2.075  13.611  -4.992 1.00 . A A .  53 TRP HA   1 1 
        1   818 1 1  53 TRP HB2  H   0.036  12.564  -4.861 1.00 . A A .  53 TRP HB2  1 1 
        1   819 1 1  53 TRP HB3  H  -0.159  12.105  -3.177 1.00 . A A .  53 TRP HB3  1 1 
        1   820 1 1  53 TRP HD1  H  -3.118  10.648  -5.310 1.00 . A A .  53 TRP HD1  1 1 
        1   821 1 1  53 TRP HE1  H  -2.954   8.067  -5.195 1.00 . A A .  53 TRP HE1  1 1 
        1   822 1 1  53 TRP HE3  H   1.665  10.408  -3.433 1.00 . A A .  53 TRP HE3  1 1 
        1   823 1 1  53 TRP HH2  H   1.461   6.130  -3.663 1.00 . A A .  53 TRP HH2  1 1 
        1   824 1 1  53 TRP HZ2  H  -0.810   6.222  -4.631 1.00 . A A .  53 TRP HZ2  1 1 
        1   825 1 1  53 TRP HZ3  H   2.664   8.171  -3.056 1.00 . A A .  53 TRP HZ3  1 1 
        1   826 1 1  53 TRP N    N  -1.180  14.367  -3.182 1.00 . A A .  53 TRP N    1 1 
        1   827 1 1  53 TRP NE1  N  -2.156   8.708  -5.104 1.00 . A A .  53 TRP NE1  1 1 
        1   828 1 1  53 TRP O    O  -3.020  12.011  -2.310 1.00 . A A .  53 TRP O    1 1 
        1   829 1 1  54 ASP C    C  -6.435  12.462  -4.133 1.00 . A A .  54 ASP C    1 1 
        1   830 1 1  54 ASP CA   C  -5.560  13.082  -3.003 1.00 . A A .  54 ASP CA   1 1 
        1   831 1 1  54 ASP CB   C  -6.145  14.356  -2.364 1.00 . A A .  54 ASP CB   1 1 
        1   832 1 1  54 ASP CG   C  -7.454  14.184  -1.608 1.00 . A A .  54 ASP CG   1 1 
        1   833 1 1  54 ASP H    H  -4.127  14.172  -4.284 1.00 . A A .  54 ASP H    1 1 
        1   834 1 1  54 ASP HA   H  -5.457  12.343  -2.179 1.00 . A A .  54 ASP HA   1 1 
        1   835 1 1  54 ASP HB2  H  -5.432  14.748  -1.621 1.00 . A A .  54 ASP HB2  1 1 
        1   836 1 1  54 ASP HB3  H  -6.283  15.151  -3.116 1.00 . A A .  54 ASP HB3  1 1 
        1   837 1 1  54 ASP N    N  -4.226  13.457  -3.558 1.00 . A A .  54 ASP N    1 1 
        1   838 1 1  54 ASP O    O  -7.328  13.113  -4.685 1.00 . A A .  54 ASP O    1 1 
        1   839 1 1  54 ASP OD1  O  -7.706  13.084  -1.065 1.00 . A A .  54 ASP OD1  1 1 
        1   840 1 1  54 ASP OD2  O  -8.208  15.174  -1.508 1.00 . A A .  54 ASP OD2  1 1 
        1   841 1 1  55 TYR C    C  -6.864   9.053  -5.550 1.00 . A A .  55 TYR C    1 1 
        1   842 1 1  55 TYR CA   C  -6.691  10.595  -5.741 1.00 . A A .  55 TYR CA   1 1 
        1   843 1 1  55 TYR CB   C  -5.773  10.839  -6.984 1.00 . A A .  55 TYR CB   1 1 
        1   844 1 1  55 TYR CD1  C  -6.659  13.000  -8.031 1.00 . A A .  55 TYR CD1  1 1 
        1   845 1 1  55 TYR CD2  C  -4.468  13.025  -7.025 1.00 . A A .  55 TYR CD2  1 1 
        1   846 1 1  55 TYR CE1  C  -6.574  14.379  -8.246 1.00 . A A .  55 TYR CE1  1 1 
        1   847 1 1  55 TYR CE2  C  -4.391  14.405  -7.220 1.00 . A A .  55 TYR CE2  1 1 
        1   848 1 1  55 TYR CG   C  -5.615  12.311  -7.397 1.00 . A A .  55 TYR CG   1 1 
        1   849 1 1  55 TYR CZ   C  -5.445  15.083  -7.828 1.00 . A A .  55 TYR CZ   1 1 
        1   850 1 1  55 TYR H    H  -5.219  10.894  -4.148 1.00 . A A .  55 TYR H    1 1 
        1   851 1 1  55 TYR HA   H  -7.693  11.028  -5.945 1.00 . A A .  55 TYR HA   1 1 
        1   852 1 1  55 TYR HB2  H  -4.783  10.376  -6.811 1.00 . A A .  55 TYR HB2  1 1 
        1   853 1 1  55 TYR HB3  H  -6.183  10.279  -7.844 1.00 . A A .  55 TYR HB3  1 1 
        1   854 1 1  55 TYR HD1  H  -7.567  12.479  -8.312 1.00 . A A .  55 TYR HD1  1 1 
        1   855 1 1  55 TYR HD2  H  -3.651  12.524  -6.524 1.00 . A A .  55 TYR HD2  1 1 
        1   856 1 1  55 TYR HE1  H  -7.408  14.892  -8.708 1.00 . A A .  55 TYR HE1  1 1 
        1   857 1 1  55 TYR HE2  H  -3.514  14.928  -6.867 1.00 . A A .  55 TYR HE2  1 1 
        1   858 1 1  55 TYR HH   H  -6.044  16.670  -8.667 1.00 . A A .  55 TYR HH   1 1 
        1   859 1 1  55 TYR N    N  -6.113  11.217  -4.525 1.00 . A A .  55 TYR N    1 1 
        1   860 1 1  55 TYR O    O  -6.028   8.378  -4.935 1.00 . A A .  55 TYR O    1 1 
        1   861 1 1  55 TYR OH   O  -5.392  16.435  -7.998 1.00 . A A .  55 TYR OH   1 1 
        1   862 1 1  56 THR C    C  -7.095   6.548  -7.522 1.00 . A A .  56 THR C    1 1 
        1   863 1 1  56 THR CA   C  -8.038   7.021  -6.364 1.00 . A A .  56 THR CA   1 1 
        1   864 1 1  56 THR CB   C  -9.528   6.648  -6.646 1.00 . A A .  56 THR CB   1 1 
        1   865 1 1  56 THR CG2  C  -9.773   5.139  -6.704 1.00 . A A .  56 THR CG2  1 1 
        1   866 1 1  56 THR H    H  -8.588   9.148  -6.581 1.00 . A A .  56 THR H    1 1 
        1   867 1 1  56 THR HA   H  -7.749   6.512  -5.418 1.00 . A A .  56 THR HA   1 1 
        1   868 1 1  56 THR HB   H  -9.840   7.098  -7.612 1.00 . A A .  56 THR HB   1 1 
        1   869 1 1  56 THR HG1  H -10.212   6.619  -4.824 1.00 . A A .  56 THR HG1  1 1 
        1   870 1 1  56 THR HG21 H -10.837   4.919  -6.904 1.00 . A A .  56 THR HG21 1 1 
        1   871 1 1  56 THR HG22 H  -9.186   4.651  -7.501 1.00 . A A .  56 THR HG22 1 1 
        1   872 1 1  56 THR HG23 H  -9.504   4.626  -5.765 1.00 . A A .  56 THR HG23 1 1 
        1   873 1 1  56 THR N    N  -7.907   8.494  -6.183 1.00 . A A .  56 THR N    1 1 
        1   874 1 1  56 THR O    O  -7.462   6.557  -8.701 1.00 . A A .  56 THR O    1 1 
        1   875 1 1  56 THR OG1  O -10.392   7.149  -5.630 1.00 . A A .  56 THR OG1  1 1 
        1   876 1 1  57 SER C    C  -5.125   3.966  -8.180 1.00 . A A .  57 SER C    1 1 
        1   877 1 1  57 SER CA   C  -4.921   5.509  -8.093 1.00 . A A .  57 SER CA   1 1 
        1   878 1 1  57 SER CB   C  -3.496   5.900  -7.628 1.00 . A A .  57 SER CB   1 1 
        1   879 1 1  57 SER H    H  -5.707   6.165  -6.136 1.00 . A A .  57 SER H    1 1 
        1   880 1 1  57 SER HA   H  -5.060   5.933  -9.110 1.00 . A A .  57 SER HA   1 1 
        1   881 1 1  57 SER HB2  H  -3.351   5.685  -6.552 1.00 . A A .  57 SER HB2  1 1 
        1   882 1 1  57 SER HB3  H  -2.732   5.303  -8.163 1.00 . A A .  57 SER HB3  1 1 
        1   883 1 1  57 SER HG   H  -2.439   7.531  -7.415 1.00 . A A .  57 SER HG   1 1 
        1   884 1 1  57 SER N    N  -5.883   6.132  -7.152 1.00 . A A .  57 SER N    1 1 
        1   885 1 1  57 SER O    O  -5.732   3.336  -7.309 1.00 . A A .  57 SER O    1 1 
        1   886 1 1  57 SER OG   O  -3.248   7.285  -7.878 1.00 . A A .  57 SER OG   1 1 
        1   887 1 1  58 THR C    C  -3.499   1.337 -10.248 1.00 . A A .  58 THR C    1 1 
        1   888 1 1  58 THR CA   C  -4.715   1.869  -9.437 1.00 . A A .  58 THR CA   1 1 
        1   889 1 1  58 THR CB   C  -6.086   1.414 -10.012 1.00 . A A .  58 THR CB   1 1 
        1   890 1 1  58 THR CG2  C  -6.408   1.832 -11.440 1.00 . A A .  58 THR CG2  1 1 
        1   891 1 1  58 THR H    H  -4.160   3.953  -9.935 1.00 . A A .  58 THR H    1 1 
        1   892 1 1  58 THR HA   H  -4.659   1.410  -8.425 1.00 . A A .  58 THR HA   1 1 
        1   893 1 1  58 THR HB   H  -6.879   1.810  -9.342 1.00 . A A .  58 THR HB   1 1 
        1   894 1 1  58 THR HG1  H  -5.370  -0.308 -10.431 1.00 . A A .  58 THR HG1  1 1 
        1   895 1 1  58 THR HG21 H  -5.701   1.415 -12.179 1.00 . A A .  58 THR HG21 1 1 
        1   896 1 1  58 THR HG22 H  -7.420   1.495 -11.729 1.00 . A A .  58 THR HG22 1 1 
        1   897 1 1  58 THR HG23 H  -6.386   2.929 -11.562 1.00 . A A .  58 THR HG23 1 1 
        1   898 1 1  58 THR N    N  -4.631   3.347  -9.256 1.00 . A A .  58 THR N    1 1 
        1   899 1 1  58 THR O    O  -3.051   1.949 -11.222 1.00 . A A .  58 THR O    1 1 
        1   900 1 1  58 THR OG1  O  -6.163  -0.010  -9.971 1.00 . A A .  58 THR OG1  1 1 
        1   901 1 1  59 GLN C    C  -2.215  -1.963 -10.852 1.00 . A A .  59 GLN C    1 1 
        1   902 1 1  59 GLN CA   C  -1.844  -0.500 -10.496 1.00 . A A .  59 GLN CA   1 1 
        1   903 1 1  59 GLN CB   C  -0.674  -0.435  -9.480 1.00 . A A .  59 GLN CB   1 1 
        1   904 1 1  59 GLN CD   C   1.781  -1.043  -8.973 1.00 . A A .  59 GLN CD   1 1 
        1   905 1 1  59 GLN CG   C   0.688  -0.906 -10.031 1.00 . A A .  59 GLN CG   1 1 
        1   906 1 1  59 GLN H    H  -3.441  -0.203  -8.984 1.00 . A A .  59 GLN H    1 1 
        1   907 1 1  59 GLN HA   H  -1.539   0.046 -11.412 1.00 . A A .  59 GLN HA   1 1 
        1   908 1 1  59 GLN HB2  H  -0.557   0.612  -9.129 1.00 . A A .  59 GLN HB2  1 1 
        1   909 1 1  59 GLN HB3  H  -0.947  -1.025  -8.582 1.00 . A A .  59 GLN HB3  1 1 
        1   910 1 1  59 GLN HE21 H   3.125  -1.450 -10.397 1.00 . A A .  59 GLN HE21 1 1 
        1   911 1 1  59 GLN HE22 H   3.671  -1.472  -8.639 1.00 . A A .  59 GLN HE22 1 1 
        1   912 1 1  59 GLN HG2  H   0.585  -1.886 -10.534 1.00 . A A .  59 GLN HG2  1 1 
        1   913 1 1  59 GLN HG3  H   1.028  -0.201 -10.814 1.00 . A A .  59 GLN HG3  1 1 
        1   914 1 1  59 GLN N    N  -3.011   0.159  -9.850 1.00 . A A .  59 GLN N    1 1 
        1   915 1 1  59 GLN NE2  N   2.986  -1.341  -9.389 1.00 . A A .  59 GLN NE2  1 1 
        1   916 1 1  59 GLN O    O  -2.579  -2.739  -9.961 1.00 . A A .  59 GLN O    1 1 
        1   917 1 1  59 GLN OE1  O   1.583  -0.911  -7.768 1.00 . A A .  59 GLN OE1  1 1 
        1   918 1 1  60 ARG C    C  -1.140  -4.832 -12.215 1.00 . A A .  60 ARG C    1 1 
        1   919 1 1  60 ARG CA   C  -2.299  -3.813 -12.508 1.00 . A A .  60 ARG CA   1 1 
        1   920 1 1  60 ARG CB   C  -2.921  -3.865 -13.924 1.00 . A A .  60 ARG CB   1 1 
        1   921 1 1  60 ARG CD   C  -2.205  -5.004 -16.141 1.00 . A A .  60 ARG CD   1 1 
        1   922 1 1  60 ARG CG   C  -1.974  -3.845 -15.143 1.00 . A A .  60 ARG CG   1 1 
        1   923 1 1  60 ARG CZ   C  -2.353  -7.491 -15.895 1.00 . A A .  60 ARG CZ   1 1 
        1   924 1 1  60 ARG H    H  -1.758  -1.676 -12.799 1.00 . A A .  60 ARG H    1 1 
        1   925 1 1  60 ARG HA   H  -3.112  -4.188 -11.852 1.00 . A A .  60 ARG HA   1 1 
        1   926 1 1  60 ARG HB2  H  -3.561  -4.772 -13.950 1.00 . A A .  60 ARG HB2  1 1 
        1   927 1 1  60 ARG HB3  H  -3.667  -3.052 -14.032 1.00 . A A .  60 ARG HB3  1 1 
        1   928 1 1  60 ARG HD2  H  -3.242  -4.952 -16.535 1.00 . A A .  60 ARG HD2  1 1 
        1   929 1 1  60 ARG HD3  H  -1.526  -4.875 -17.008 1.00 . A A .  60 ARG HD3  1 1 
        1   930 1 1  60 ARG HE   H  -1.567  -6.305 -14.504 1.00 . A A .  60 ARG HE   1 1 
        1   931 1 1  60 ARG HG2  H  -2.103  -2.885 -15.681 1.00 . A A .  60 ARG HG2  1 1 
        1   932 1 1  60 ARG HG3  H  -0.908  -3.837 -14.841 1.00 . A A .  60 ARG HG3  1 1 
        1   933 1 1  60 ARG HH11 H  -2.752  -6.889 -17.716 1.00 . A A .  60 ARG HH11 1 1 
        1   934 1 1  60 ARG HH12 H  -3.079  -8.655 -17.365 1.00 . A A .  60 ARG HH12 1 1 
        1   935 1 1  60 ARG HH21 H  -2.123  -8.271 -14.068 1.00 . A A .  60 ARG HH21 1 1 
        1   936 1 1  60 ARG HH22 H  -2.674  -9.382 -15.402 1.00 . A A .  60 ARG HH22 1 1 
        1   937 1 1  60 ARG N    N  -2.055  -2.385 -12.122 1.00 . A A .  60 ARG N    1 1 
        1   938 1 1  60 ARG NE   N  -1.940  -6.307 -15.474 1.00 . A A .  60 ARG NE   1 1 
        1   939 1 1  60 ARG NH1  N  -2.783  -7.711 -17.112 1.00 . A A .  60 ARG NH1  1 1 
        1   940 1 1  60 ARG NH2  N  -2.326  -8.487 -15.061 1.00 . A A .  60 ARG NH2  1 1 
        1   941 1 1  60 ARG O    O  -0.871  -5.757 -12.985 1.00 . A A .  60 ARG O    1 1 
        1   942 1 1  61 VAL C    C  -0.246  -7.084 -10.018 1.00 . A A .  61 VAL C    1 1 
        1   943 1 1  61 VAL CA   C   0.389  -5.718 -10.446 1.00 . A A .  61 VAL CA   1 1 
        1   944 1 1  61 VAL CB   C   1.219  -4.989  -9.339 1.00 . A A .  61 VAL CB   1 1 
        1   945 1 1  61 VAL CG1  C   0.431  -4.564  -8.093 1.00 . A A .  61 VAL CG1  1 1 
        1   946 1 1  61 VAL CG2  C   2.475  -5.778  -8.936 1.00 . A A .  61 VAL CG2  1 1 
        1   947 1 1  61 VAL H    H  -0.906  -3.938 -10.469 1.00 . A A .  61 VAL H    1 1 
        1   948 1 1  61 VAL HA   H   1.111  -5.967 -11.247 1.00 . A A .  61 VAL HA   1 1 
        1   949 1 1  61 VAL HB   H   1.609  -4.055  -9.801 1.00 . A A .  61 VAL HB   1 1 
        1   950 1 1  61 VAL HG11 H  -0.071  -5.407  -7.589 1.00 . A A .  61 VAL HG11 1 1 
        1   951 1 1  61 VAL HG12 H   1.080  -4.068  -7.347 1.00 . A A .  61 VAL HG12 1 1 
        1   952 1 1  61 VAL HG13 H  -0.360  -3.834  -8.341 1.00 . A A .  61 VAL HG13 1 1 
        1   953 1 1  61 VAL HG21 H   3.101  -5.212  -8.221 1.00 . A A .  61 VAL HG21 1 1 
        1   954 1 1  61 VAL HG22 H   2.250  -6.755  -8.474 1.00 . A A .  61 VAL HG22 1 1 
        1   955 1 1  61 VAL HG23 H   3.103  -5.979  -9.821 1.00 . A A .  61 VAL HG23 1 1 
        1   956 1 1  61 VAL N    N  -0.539  -4.710 -11.030 1.00 . A A .  61 VAL N    1 1 
        1   957 1 1  61 VAL O    O   0.468  -8.088  -9.977 1.00 . A A .  61 VAL O    1 1 
        1   958 1 1  62 ASP C    C  -2.455  -9.086 -11.160 1.00 . A A .  62 ASP C    1 1 
        1   959 1 1  62 ASP CA   C  -2.321  -8.415  -9.742 1.00 . A A .  62 ASP CA   1 1 
        1   960 1 1  62 ASP CB   C  -3.693  -8.102  -9.093 1.00 . A A .  62 ASP CB   1 1 
        1   961 1 1  62 ASP CG   C  -4.582  -9.308  -8.785 1.00 . A A .  62 ASP CG   1 1 
        1   962 1 1  62 ASP H    H  -2.042  -6.242  -9.876 1.00 . A A .  62 ASP H    1 1 
        1   963 1 1  62 ASP HA   H  -1.779  -9.104  -9.064 1.00 . A A .  62 ASP HA   1 1 
        1   964 1 1  62 ASP HB2  H  -3.546  -7.571  -8.135 1.00 . A A .  62 ASP HB2  1 1 
        1   965 1 1  62 ASP HB3  H  -4.271  -7.406  -9.730 1.00 . A A .  62 ASP HB3  1 1 
        1   966 1 1  62 ASP N    N  -1.566  -7.141  -9.767 1.00 . A A .  62 ASP N    1 1 
        1   967 1 1  62 ASP O    O  -2.456  -8.444 -12.219 1.00 . A A .  62 ASP O    1 1 
        1   968 1 1  62 ASP OD1  O  -4.064 -10.440  -8.637 1.00 . A A .  62 ASP OD1  1 1 
        1   969 1 1  62 ASP OD2  O  -5.818  -9.137  -8.725 1.00 . A A .  62 ASP OD2  1 1 
        1   970 1 1  63 ARG C    C  -4.296 -12.202 -11.920 1.00 . A A .  63 ARG C    1 1 
        1   971 1 1  63 ARG CA   C  -3.104 -11.226 -12.248 1.00 . A A .  63 ARG CA   1 1 
        1   972 1 1  63 ARG CB   C  -1.909 -11.925 -12.959 1.00 . A A .  63 ARG CB   1 1 
        1   973 1 1  63 ARG CD   C  -0.006 -13.628 -12.881 1.00 . A A .  63 ARG CD   1 1 
        1   974 1 1  63 ARG CG   C  -1.337 -13.176 -12.268 1.00 . A A .  63 ARG CG   1 1 
        1   975 1 1  63 ARG CZ   C   0.103 -16.132 -12.958 1.00 . A A .  63 ARG CZ   1 1 
        1   976 1 1  63 ARG H    H  -2.796 -10.676 -10.134 1.00 . A A .  63 ARG H    1 1 
        1   977 1 1  63 ARG HA   H  -3.544 -10.541 -13.002 1.00 . A A .  63 ARG HA   1 1 
        1   978 1 1  63 ARG HB2  H  -2.236 -12.203 -13.981 1.00 . A A .  63 ARG HB2  1 1 
        1   979 1 1  63 ARG HB3  H  -1.112 -11.170 -13.118 1.00 . A A .  63 ARG HB3  1 1 
        1   980 1 1  63 ARG HD2  H  -0.020 -13.596 -13.989 1.00 . A A .  63 ARG HD2  1 1 
        1   981 1 1  63 ARG HD3  H   0.786 -12.902 -12.599 1.00 . A A .  63 ARG HD3  1 1 
        1   982 1 1  63 ARG HE   H   0.899 -15.070 -11.488 1.00 . A A .  63 ARG HE   1 1 
        1   983 1 1  63 ARG HG2  H  -1.186 -12.989 -11.190 1.00 . A A .  63 ARG HG2  1 1 
        1   984 1 1  63 ARG HG3  H  -2.090 -13.989 -12.315 1.00 . A A .  63 ARG HG3  1 1 
        1   985 1 1  63 ARG HH11 H  -0.957 -15.356 -14.413 1.00 . A A .  63 ARG HH11 1 1 
        1   986 1 1  63 ARG HH12 H  -0.768 -17.175 -14.440 1.00 . A A .  63 ARG HH12 1 1 
        1   987 1 1  63 ARG HH21 H   1.079 -17.105 -11.531 1.00 . A A .  63 ARG HH21 1 1 
        1   988 1 1  63 ARG HH22 H   0.344 -18.107 -12.874 1.00 . A A .  63 ARG HH22 1 1 
        1   989 1 1  63 ARG N    N  -2.589 -10.414 -11.111 1.00 . A A .  63 ARG N    1 1 
        1   990 1 1  63 ARG NE   N   0.372 -14.970 -12.364 1.00 . A A .  63 ARG NE   1 1 
        1   991 1 1  63 ARG NH1  N  -0.599 -16.244 -14.058 1.00 . A A .  63 ARG NH1  1 1 
        1   992 1 1  63 ARG NH2  N   0.553 -17.220 -12.412 1.00 . A A .  63 ARG NH2  1 1 
        1   993 1 1  63 ARG O    O  -4.724 -12.920 -12.826 1.00 . A A .  63 ARG O    1 1 
        1   994 1 1  64 LEU C    C  -7.315 -12.463 -10.365 1.00 . A A .  64 LEU C    1 1 
        1   995 1 1  64 LEU CA   C  -5.909 -13.145 -10.270 1.00 . A A .  64 LEU CA   1 1 
        1   996 1 1  64 LEU CB   C  -5.655 -13.651  -8.819 1.00 . A A .  64 LEU CB   1 1 
        1   997 1 1  64 LEU CD1  C  -4.645 -15.895  -9.466 1.00 . A A .  64 LEU CD1  1 1 
        1   998 1 1  64 LEU CD2  C  -3.126 -14.091  -8.573 1.00 . A A .  64 LEU CD2  1 1 
        1   999 1 1  64 LEU CG   C  -4.537 -14.676  -8.550 1.00 . A A .  64 LEU CG   1 1 
        1  1000 1 1  64 LEU H    H  -4.440 -11.567  -9.993 1.00 . A A .  64 LEU H    1 1 
        1  1001 1 1  64 LEU HA   H  -5.953 -14.018 -10.947 1.00 . A A .  64 LEU HA   1 1 
        1  1002 1 1  64 LEU HB2  H  -5.517 -12.786  -8.138 1.00 . A A .  64 LEU HB2  1 1 
        1  1003 1 1  64 LEU HB3  H  -6.590 -14.123  -8.453 1.00 . A A .  64 LEU HB3  1 1 
        1  1004 1 1  64 LEU HD11 H  -4.319 -15.680 -10.500 1.00 . A A .  64 LEU HD11 1 1 
        1  1005 1 1  64 LEU HD12 H  -4.033 -16.735  -9.097 1.00 . A A .  64 LEU HD12 1 1 
        1  1006 1 1  64 LEU HD13 H  -5.695 -16.234  -9.525 1.00 . A A .  64 LEU HD13 1 1 
        1  1007 1 1  64 LEU HD21 H  -3.042 -13.199  -7.925 1.00 . A A .  64 LEU HD21 1 1 
        1  1008 1 1  64 LEU HD22 H  -2.385 -14.827  -8.212 1.00 . A A .  64 LEU HD22 1 1 
        1  1009 1 1  64 LEU HD23 H  -2.810 -13.785  -9.585 1.00 . A A .  64 LEU HD23 1 1 
        1  1010 1 1  64 LEU HG   H  -4.715 -15.029  -7.510 1.00 . A A .  64 LEU HG   1 1 
        1  1011 1 1  64 LEU N    N  -4.816 -12.241 -10.683 1.00 . A A .  64 LEU N    1 1 
        1  1012 1 1  64 LEU O    O  -8.179 -12.963 -11.088 1.00 . A A .  64 LEU O    1 1 
        1  1013 1 1  65 ALA C    C  -8.894  -9.435 -10.523 1.00 . A A .  65 ALA C    1 1 
        1  1014 1 1  65 ALA CA   C  -8.826 -10.659  -9.573 1.00 . A A .  65 ALA CA   1 1 
        1  1015 1 1  65 ALA CB   C  -9.118 -10.326  -8.100 1.00 . A A .  65 ALA CB   1 1 
        1  1016 1 1  65 ALA H    H  -6.687 -11.023  -9.141 1.00 . A A .  65 ALA H    1 1 
        1  1017 1 1  65 ALA HA   H  -9.638 -11.341  -9.894 1.00 . A A .  65 ALA HA   1 1 
        1  1018 1 1  65 ALA HB1  H  -9.142 -11.241  -7.480 1.00 . A A .  65 ALA HB1  1 1 
        1  1019 1 1  65 ALA HB2  H  -8.361  -9.651  -7.657 1.00 . A A .  65 ALA HB2  1 1 
        1  1020 1 1  65 ALA HB3  H -10.101  -9.836  -7.982 1.00 . A A .  65 ALA HB3  1 1 
        1  1021 1 1  65 ALA N    N  -7.534 -11.372  -9.616 1.00 . A A .  65 ALA N    1 1 
        1  1022 1 1  65 ALA O    O  -9.689  -9.465 -11.467 1.00 . A A .  65 ALA O    1 1 
        1  1023 1 1  66 ARG C    C  -6.908  -6.264 -10.922 1.00 . A A .  66 ARG C    1 1 
        1  1024 1 1  66 ARG CA   C  -8.216  -7.100 -11.069 1.00 . A A .  66 ARG CA   1 1 
        1  1025 1 1  66 ARG CB   C  -9.547  -6.360 -10.726 1.00 . A A .  66 ARG CB   1 1 
        1  1026 1 1  66 ARG CD   C -11.184  -4.469 -11.168 1.00 . A A .  66 ARG CD   1 1 
        1  1027 1 1  66 ARG CG   C  -9.817  -5.075 -11.531 1.00 . A A .  66 ARG CG   1 1 
        1  1028 1 1  66 ARG CZ   C -12.448  -2.422 -11.844 1.00 . A A .  66 ARG CZ   1 1 
        1  1029 1 1  66 ARG H    H  -7.356  -8.552  -9.599 1.00 . A A .  66 ARG H    1 1 
        1  1030 1 1  66 ARG HA   H  -8.259  -7.386 -12.140 1.00 . A A .  66 ARG HA   1 1 
        1  1031 1 1  66 ARG HB2  H -10.383  -7.067 -10.899 1.00 . A A .  66 ARG HB2  1 1 
        1  1032 1 1  66 ARG HB3  H  -9.582  -6.143  -9.640 1.00 . A A .  66 ARG HB3  1 1 
        1  1033 1 1  66 ARG HD2  H -11.990  -5.199 -11.392 1.00 . A A .  66 ARG HD2  1 1 
        1  1034 1 1  66 ARG HD3  H -11.221  -4.267 -10.076 1.00 . A A .  66 ARG HD3  1 1 
        1  1035 1 1  66 ARG HE   H -10.672  -2.885 -12.592 1.00 . A A .  66 ARG HE   1 1 
        1  1036 1 1  66 ARG HG2  H  -9.020  -4.332 -11.328 1.00 . A A .  66 ARG HG2  1 1 
        1  1037 1 1  66 ARG HG3  H  -9.769  -5.295 -12.617 1.00 . A A .  66 ARG HG3  1 1 
        1  1038 1 1  66 ARG HH11 H -13.384  -3.523 -10.515 1.00 . A A .  66 ARG HH11 1 1 
        1  1039 1 1  66 ARG HH12 H -14.248  -2.003 -11.051 1.00 . A A .  66 ARG HH12 1 1 
        1  1040 1 1  66 ARG HH21 H -11.677  -1.174 -13.184 1.00 . A A .  66 ARG HH21 1 1 
        1  1041 1 1  66 ARG HH22 H -13.304  -0.750 -12.494 1.00 . A A .  66 ARG HH22 1 1 
        1  1042 1 1  66 ARG N    N  -8.128  -8.354 -10.267 1.00 . A A .  66 ARG N    1 1 
        1  1043 1 1  66 ARG NE   N -11.384  -3.215 -11.935 1.00 . A A .  66 ARG NE   1 1 
        1  1044 1 1  66 ARG NH1  N -13.469  -2.663 -11.060 1.00 . A A .  66 ARG NH1  1 1 
        1  1045 1 1  66 ARG NH2  N -12.479  -1.347 -12.575 1.00 . A A .  66 ARG NH2  1 1 
        1  1046 1 1  66 ARG O    O  -6.048  -6.312 -11.806 1.00 . A A .  66 ARG O    1 1 
        1  1047 1 1  67 THR C    C  -5.469  -4.212  -8.151 1.00 . A A .  67 THR C    1 1 
        1  1048 1 1  67 THR CA   C  -5.732  -4.454  -9.684 1.00 . A A .  67 THR CA   1 1 
        1  1049 1 1  67 THR CB   C  -6.083  -3.073 -10.337 1.00 . A A .  67 THR CB   1 1 
        1  1050 1 1  67 THR CG2  C  -6.180  -3.049 -11.854 1.00 . A A .  67 THR CG2  1 1 
        1  1051 1 1  67 THR H    H  -7.574  -5.498  -9.198 1.00 . A A .  67 THR H    1 1 
        1  1052 1 1  67 THR HA   H  -4.782  -4.822 -10.122 1.00 . A A .  67 THR HA   1 1 
        1  1053 1 1  67 THR HB   H  -5.247  -2.410 -10.058 1.00 . A A .  67 THR HB   1 1 
        1  1054 1 1  67 THR HG1  H  -7.155  -1.537  -9.855 1.00 . A A .  67 THR HG1  1 1 
        1  1055 1 1  67 THR HG21 H  -6.285  -2.016 -12.231 1.00 . A A .  67 THR HG21 1 1 
        1  1056 1 1  67 THR HG22 H  -5.291  -3.483 -12.338 1.00 . A A .  67 THR HG22 1 1 
        1  1057 1 1  67 THR HG23 H  -7.046  -3.617 -12.232 1.00 . A A .  67 THR HG23 1 1 
        1  1058 1 1  67 THR N    N  -6.794  -5.466  -9.855 1.00 . A A .  67 THR N    1 1 
        1  1059 1 1  67 THR O    O  -6.342  -4.418  -7.302 1.00 . A A .  67 THR O    1 1 
        1  1060 1 1  67 THR OG1  O  -7.283  -2.496  -9.818 1.00 . A A .  67 THR OG1  1 1 
        1  1061 1 1  68 GLU C    C  -4.444  -1.671  -6.377 1.00 . A A .  68 GLU C    1 1 
        1  1062 1 1  68 GLU CA   C  -3.982  -3.160  -6.468 1.00 . A A .  68 GLU CA   1 1 
        1  1063 1 1  68 GLU CB   C  -2.486  -3.419  -6.205 1.00 . A A .  68 GLU CB   1 1 
        1  1064 1 1  68 GLU CD   C  -1.644  -1.992  -4.226 1.00 . A A .  68 GLU CD   1 1 
        1  1065 1 1  68 GLU CG   C  -2.050  -3.351  -4.733 1.00 . A A .  68 GLU CG   1 1 
        1  1066 1 1  68 GLU H    H  -3.662  -3.488  -8.628 1.00 . A A .  68 GLU H    1 1 
        1  1067 1 1  68 GLU HA   H  -4.537  -3.773  -5.728 1.00 . A A .  68 GLU HA   1 1 
        1  1068 1 1  68 GLU HB2  H  -2.250  -4.454  -6.535 1.00 . A A .  68 GLU HB2  1 1 
        1  1069 1 1  68 GLU HB3  H  -1.849  -2.770  -6.836 1.00 . A A .  68 GLU HB3  1 1 
        1  1070 1 1  68 GLU HG2  H  -2.807  -3.775  -4.055 1.00 . A A .  68 GLU HG2  1 1 
        1  1071 1 1  68 GLU HG3  H  -1.176  -4.009  -4.589 1.00 . A A .  68 GLU HG3  1 1 
        1  1072 1 1  68 GLU N    N  -4.276  -3.698  -7.827 1.00 . A A .  68 GLU N    1 1 
        1  1073 1 1  68 GLU O    O  -3.918  -0.786  -7.068 1.00 . A A .  68 GLU O    1 1 
        1  1074 1 1  68 GLU OE1  O  -2.508  -1.188  -3.832 1.00 . A A .  68 GLU OE1  1 1 
        1  1075 1 1  68 GLU OE2  O  -0.429  -1.698  -4.250 1.00 . A A .  68 GLU OE2  1 1 
        1  1076 1 1  69 ILE C    C  -5.725   0.795  -4.488 1.00 . A A .  69 ILE C    1 1 
        1  1077 1 1  69 ILE CA   C  -6.284  -0.179  -5.581 1.00 . A A .  69 ILE CA   1 1 
        1  1078 1 1  69 ILE CB   C  -7.816  -0.458  -5.316 1.00 . A A .  69 ILE CB   1 1 
        1  1079 1 1  69 ILE CD1  C  -8.524  -2.936  -5.495 1.00 . A A .  69 ILE CD1  1 1 
        1  1080 1 1  69 ILE CG1  C  -8.452  -1.576  -6.197 1.00 . A A .  69 ILE CG1  1 1 
        1  1081 1 1  69 ILE CG2  C  -8.650   0.835  -5.541 1.00 . A A .  69 ILE CG2  1 1 
        1  1082 1 1  69 ILE H    H  -5.875  -2.279  -5.125 1.00 . A A .  69 ILE H    1 1 
        1  1083 1 1  69 ILE HA   H  -6.203   0.294  -6.583 1.00 . A A .  69 ILE HA   1 1 
        1  1084 1 1  69 ILE HB   H  -7.945  -0.733  -4.246 1.00 . A A .  69 ILE HB   1 1 
        1  1085 1 1  69 ILE HD11 H  -9.138  -2.898  -4.576 1.00 . A A .  69 ILE HD11 1 1 
        1  1086 1 1  69 ILE HD12 H  -8.977  -3.697  -6.157 1.00 . A A .  69 ILE HD12 1 1 
        1  1087 1 1  69 ILE HD13 H  -7.535  -3.329  -5.206 1.00 . A A .  69 ILE HD13 1 1 
        1  1088 1 1  69 ILE HG12 H  -9.489  -1.318  -6.492 1.00 . A A .  69 ILE HG12 1 1 
        1  1089 1 1  69 ILE HG13 H  -7.908  -1.679  -7.156 1.00 . A A .  69 ILE HG13 1 1 
        1  1090 1 1  69 ILE HG21 H  -8.328   1.668  -4.890 1.00 . A A .  69 ILE HG21 1 1 
        1  1091 1 1  69 ILE HG22 H  -8.598   1.194  -6.586 1.00 . A A .  69 ILE HG22 1 1 
        1  1092 1 1  69 ILE HG23 H  -9.712   0.654  -5.301 1.00 . A A .  69 ILE HG23 1 1 
        1  1093 1 1  69 ILE N    N  -5.501  -1.443  -5.581 1.00 . A A .  69 ILE N    1 1 
        1  1094 1 1  69 ILE O    O  -5.659   0.452  -3.305 1.00 . A A .  69 ILE O    1 1 
        1  1095 1 1  70 LYS C    C  -5.509   4.323  -3.881 1.00 . A A .  70 LYS C    1 1 
        1  1096 1 1  70 LYS CA   C  -4.683   3.003  -4.041 1.00 . A A .  70 LYS CA   1 1 
        1  1097 1 1  70 LYS CB   C  -3.286   3.290  -4.647 1.00 . A A .  70 LYS CB   1 1 
        1  1098 1 1  70 LYS CD   C  -1.016   2.509  -5.361 1.00 . A A .  70 LYS CD   1 1 
        1  1099 1 1  70 LYS CE   C   0.144   1.516  -5.282 1.00 . A A .  70 LYS CE   1 1 
        1  1100 1 1  70 LYS CG   C  -2.265   2.140  -4.545 1.00 . A A .  70 LYS CG   1 1 
        1  1101 1 1  70 LYS H    H  -5.618   2.257  -5.874 1.00 . A A .  70 LYS H    1 1 
        1  1102 1 1  70 LYS HA   H  -4.518   2.600  -3.027 1.00 . A A .  70 LYS HA   1 1 
        1  1103 1 1  70 LYS HB2  H  -3.415   3.584  -5.707 1.00 . A A .  70 LYS HB2  1 1 
        1  1104 1 1  70 LYS HB3  H  -2.850   4.181  -4.151 1.00 . A A .  70 LYS HB3  1 1 
        1  1105 1 1  70 LYS HD2  H  -1.300   2.669  -6.420 1.00 . A A .  70 LYS HD2  1 1 
        1  1106 1 1  70 LYS HD3  H  -0.638   3.496  -5.023 1.00 . A A .  70 LYS HD3  1 1 
        1  1107 1 1  70 LYS HE2  H   1.030   1.984  -5.759 1.00 . A A .  70 LYS HE2  1 1 
        1  1108 1 1  70 LYS HE3  H   0.447   1.339  -4.227 1.00 . A A .  70 LYS HE3  1 1 
        1  1109 1 1  70 LYS HG2  H  -2.010   1.940  -3.486 1.00 . A A .  70 LYS HG2  1 1 
        1  1110 1 1  70 LYS HG3  H  -2.704   1.192  -4.919 1.00 . A A .  70 LYS HG3  1 1 
        1  1111 1 1  70 LYS HZ1  H  -0.290  -0.563  -5.224 1.00 . A A .  70 LYS HZ1  1 1 
        1  1112 1 1  70 LYS HZ2  H  -1.058   0.229  -6.449 1.00 . A A .  70 LYS HZ2  1 1 
        1  1113 1 1  70 LYS HZ3  H   0.573  -0.132  -6.584 1.00 . A A .  70 LYS HZ3  1 1 
        1  1114 1 1  70 LYS N    N  -5.380   2.019  -4.898 1.00 . A A .  70 LYS N    1 1 
        1  1115 1 1  70 LYS NZ   N  -0.167   0.229  -5.945 1.00 . A A .  70 LYS NZ   1 1 
        1  1116 1 1  70 LYS O    O  -5.173   5.376  -4.432 1.00 . A A .  70 LYS O    1 1 
        1  1117 1 1  71 ASN C    C  -6.113   5.985  -1.207 1.00 . A A .  71 ASN C    1 1 
        1  1118 1 1  71 ASN CA   C  -7.077   5.511  -2.372 1.00 . A A .  71 ASN CA   1 1 
        1  1119 1 1  71 ASN CB   C  -8.482   5.248  -1.772 1.00 . A A .  71 ASN CB   1 1 
        1  1120 1 1  71 ASN CG   C  -9.602   4.976  -2.747 1.00 . A A .  71 ASN CG   1 1 
        1  1121 1 1  71 ASN H    H  -6.773   3.331  -2.726 1.00 . A A .  71 ASN H    1 1 
        1  1122 1 1  71 ASN HA   H  -7.162   6.321  -3.133 1.00 . A A .  71 ASN HA   1 1 
        1  1123 1 1  71 ASN HB2  H  -8.413   4.450  -1.012 1.00 . A A .  71 ASN HB2  1 1 
        1  1124 1 1  71 ASN HB3  H  -8.788   6.139  -1.191 1.00 . A A .  71 ASN HB3  1 1 
        1  1125 1 1  71 ASN HD21 H -10.074   3.300  -1.805 1.00 . A A .  71 ASN HD21 1 1 
        1  1126 1 1  71 ASN HD22 H -11.075   3.795  -3.262 1.00 . A A .  71 ASN HD22 1 1 
        1  1127 1 1  71 ASN N    N  -6.527   4.282  -3.012 1.00 . A A .  71 ASN N    1 1 
        1  1128 1 1  71 ASN ND2  N -10.247   3.836  -2.661 1.00 . A A .  71 ASN ND2  1 1 
        1  1129 1 1  71 ASN O    O  -6.278   5.612  -0.042 1.00 . A A .  71 ASN O    1 1 
        1  1130 1 1  71 ASN OD1  O  -9.948   5.808  -3.577 1.00 . A A .  71 ASN OD1  1 1 
        1  1131 1 1  72 PHE C    C  -3.935   8.735  -0.649 1.00 . A A .  72 PHE C    1 1 
        1  1132 1 1  72 PHE CA   C  -4.034   7.195  -0.603 1.00 . A A .  72 PHE CA   1 1 
        1  1133 1 1  72 PHE CB   C  -2.721   6.472  -0.986 1.00 . A A .  72 PHE CB   1 1 
        1  1134 1 1  72 PHE CD1  C  -1.566   6.038   1.262 1.00 . A A .  72 PHE CD1  1 1 
        1  1135 1 1  72 PHE CD2  C  -0.404   7.358  -0.385 1.00 . A A .  72 PHE CD2  1 1 
        1  1136 1 1  72 PHE CE1  C  -0.445   6.087   2.094 1.00 . A A .  72 PHE CE1  1 1 
        1  1137 1 1  72 PHE CE2  C   0.714   7.417   0.452 1.00 . A A .  72 PHE CE2  1 1 
        1  1138 1 1  72 PHE CG   C  -1.552   6.653   0.000 1.00 . A A .  72 PHE CG   1 1 
        1  1139 1 1  72 PHE CZ   C   0.693   6.775   1.686 1.00 . A A .  72 PHE CZ   1 1 
        1  1140 1 1  72 PHE H    H  -5.017   6.920  -2.577 1.00 . A A .  72 PHE H    1 1 
        1  1141 1 1  72 PHE HA   H  -4.299   6.885   0.431 1.00 . A A .  72 PHE HA   1 1 
        1  1142 1 1  72 PHE HB2  H  -2.921   5.386  -1.071 1.00 . A A .  72 PHE HB2  1 1 
        1  1143 1 1  72 PHE HB3  H  -2.410   6.770  -2.007 1.00 . A A .  72 PHE HB3  1 1 
        1  1144 1 1  72 PHE HD1  H  -2.421   5.457   1.580 1.00 . A A .  72 PHE HD1  1 1 
        1  1145 1 1  72 PHE HD2  H  -0.369   7.851  -1.348 1.00 . A A .  72 PHE HD2  1 1 
        1  1146 1 1  72 PHE HE1  H  -0.454   5.552   3.036 1.00 . A A .  72 PHE HE1  1 1 
        1  1147 1 1  72 PHE HE2  H   1.603   7.945   0.130 1.00 . A A .  72 PHE HE2  1 1 
        1  1148 1 1  72 PHE HZ   H   1.566   6.803   2.326 1.00 . A A .  72 PHE HZ   1 1 
        1  1149 1 1  72 PHE N    N  -5.083   6.754  -1.565 1.00 . A A .  72 PHE N    1 1 
        1  1150 1 1  72 PHE O    O  -3.324   9.293  -1.566 1.00 . A A .  72 PHE O    1 1 
        1  1151 1 1  73 THR C    C  -3.199  11.315   1.214 1.00 . A A .  73 THR C    1 1 
        1  1152 1 1  73 THR CA   C  -4.474  10.893   0.443 1.00 . A A .  73 THR CA   1 1 
        1  1153 1 1  73 THR CB   C  -5.795  11.437   1.045 1.00 . A A .  73 THR CB   1 1 
        1  1154 1 1  73 THR CG2  C  -5.783  12.951   1.222 1.00 . A A .  73 THR CG2  1 1 
        1  1155 1 1  73 THR H    H  -4.979   8.838   1.075 1.00 . A A .  73 THR H    1 1 
        1  1156 1 1  73 THR HA   H  -4.448  11.328  -0.571 1.00 . A A .  73 THR HA   1 1 
        1  1157 1 1  73 THR HB   H  -6.004  10.952   2.018 1.00 . A A .  73 THR HB   1 1 
        1  1158 1 1  73 THR HG1  H  -7.096  12.003  -0.333 1.00 . A A .  73 THR HG1  1 1 
        1  1159 1 1  73 THR HG21 H  -6.764  13.332   1.561 1.00 . A A .  73 THR HG21 1 1 
        1  1160 1 1  73 THR HG22 H  -5.025  13.273   1.949 1.00 . A A .  73 THR HG22 1 1 
        1  1161 1 1  73 THR HG23 H  -5.538  13.458   0.272 1.00 . A A .  73 THR HG23 1 1 
        1  1162 1 1  73 THR N    N  -4.526   9.410   0.347 1.00 . A A .  73 THR N    1 1 
        1  1163 1 1  73 THR O    O  -3.165  11.278   2.445 1.00 . A A .  73 THR O    1 1 
        1  1164 1 1  73 THR OG1  O  -6.868  11.158   0.154 1.00 . A A .  73 THR OG1  1 1 
        1  1165 1 1  74 VAL C    C  -0.493  13.568   0.692 1.00 . A A .  74 VAL C    1 1 
        1  1166 1 1  74 VAL CA   C  -0.845  12.103   1.060 1.00 . A A .  74 VAL CA   1 1 
        1  1167 1 1  74 VAL CB   C   0.258  11.055   0.740 1.00 . A A .  74 VAL CB   1 1 
        1  1168 1 1  74 VAL CG1  C   0.494  10.782  -0.744 1.00 . A A .  74 VAL CG1  1 1 
        1  1169 1 1  74 VAL CG2  C   1.630  11.421   1.349 1.00 . A A .  74 VAL CG2  1 1 
        1  1170 1 1  74 VAL H    H  -2.359  11.744  -0.540 1.00 . A A .  74 VAL H    1 1 
        1  1171 1 1  74 VAL HA   H  -0.946  12.046   2.162 1.00 . A A .  74 VAL HA   1 1 
        1  1172 1 1  74 VAL HB   H  -0.075  10.105   1.208 1.00 . A A .  74 VAL HB   1 1 
        1  1173 1 1  74 VAL HG11 H   1.310  10.052  -0.886 1.00 . A A .  74 VAL HG11 1 1 
        1  1174 1 1  74 VAL HG12 H  -0.403  10.371  -1.244 1.00 . A A .  74 VAL HG12 1 1 
        1  1175 1 1  74 VAL HG13 H   0.772  11.701  -1.283 1.00 . A A .  74 VAL HG13 1 1 
        1  1176 1 1  74 VAL HG21 H   1.567  11.749   2.399 1.00 . A A .  74 VAL HG21 1 1 
        1  1177 1 1  74 VAL HG22 H   2.337  10.570   1.321 1.00 . A A .  74 VAL HG22 1 1 
        1  1178 1 1  74 VAL HG23 H   2.095  12.258   0.797 1.00 . A A .  74 VAL HG23 1 1 
        1  1179 1 1  74 VAL N    N  -2.161  11.719   0.475 1.00 . A A .  74 VAL N    1 1 
        1  1180 1 1  74 VAL O    O  -0.529  13.977  -0.472 1.00 . A A .  74 VAL O    1 1 
        1  1181 1 1  75 PHE C    C   1.597  16.143   1.471 1.00 . A A .  75 PHE C    1 1 
        1  1182 1 1  75 PHE CA   C   0.085  15.801   1.607 1.00 . A A .  75 PHE CA   1 1 
        1  1183 1 1  75 PHE CB   C  -0.541  16.478   2.848 1.00 . A A .  75 PHE CB   1 1 
        1  1184 1 1  75 PHE CD1  C  -2.936  15.586   3.225 1.00 . A A .  75 PHE CD1  1 1 
        1  1185 1 1  75 PHE CD2  C  -2.647  17.758   2.219 1.00 . A A .  75 PHE CD2  1 1 
        1  1186 1 1  75 PHE CE1  C  -4.322  15.739   3.158 1.00 . A A .  75 PHE CE1  1 1 
        1  1187 1 1  75 PHE CE2  C  -4.032  17.899   2.123 1.00 . A A .  75 PHE CE2  1 1 
        1  1188 1 1  75 PHE CG   C  -2.079  16.605   2.774 1.00 . A A .  75 PHE CG   1 1 
        1  1189 1 1  75 PHE CZ   C  -4.868  16.892   2.600 1.00 . A A .  75 PHE CZ   1 1 
        1  1190 1 1  75 PHE H    H  -0.051  13.836   2.614 1.00 . A A .  75 PHE H    1 1 
        1  1191 1 1  75 PHE HA   H  -0.451  16.192   0.719 1.00 . A A .  75 PHE HA   1 1 
        1  1192 1 1  75 PHE HB2  H  -0.241  15.952   3.770 1.00 . A A .  75 PHE HB2  1 1 
        1  1193 1 1  75 PHE HB3  H  -0.114  17.491   2.992 1.00 . A A .  75 PHE HB3  1 1 
        1  1194 1 1  75 PHE HD1  H  -2.539  14.652   3.602 1.00 . A A .  75 PHE HD1  1 1 
        1  1195 1 1  75 PHE HD2  H  -2.001  18.535   1.833 1.00 . A A .  75 PHE HD2  1 1 
        1  1196 1 1  75 PHE HE1  H  -4.967  14.950   3.523 1.00 . A A .  75 PHE HE1  1 1 
        1  1197 1 1  75 PHE HE2  H  -4.454  18.779   1.658 1.00 . A A .  75 PHE HE2  1 1 
        1  1198 1 1  75 PHE HZ   H  -5.943  16.996   2.521 1.00 . A A .  75 PHE HZ   1 1 
        1  1199 1 1  75 PHE N    N  -0.136  14.343   1.718 1.00 . A A .  75 PHE N    1 1 
        1  1200 1 1  75 PHE O    O   2.447  15.639   2.213 1.00 . A A .  75 PHE O    1 1 
        1  1201 1 1  76 PHE C    C   3.445  18.969   0.218 1.00 . A A .  76 PHE C    1 1 
        1  1202 1 1  76 PHE CA   C   3.288  17.414   0.162 1.00 . A A .  76 PHE CA   1 1 
        1  1203 1 1  76 PHE CB   C   3.650  16.922  -1.271 1.00 . A A .  76 PHE CB   1 1 
        1  1204 1 1  76 PHE CD1  C   4.374  14.511  -0.776 1.00 . A A .  76 PHE CD1  1 1 
        1  1205 1 1  76 PHE CD2  C   2.680  14.888  -2.452 1.00 . A A .  76 PHE CD2  1 1 
        1  1206 1 1  76 PHE CE1  C   4.253  13.135  -0.970 1.00 . A A .  76 PHE CE1  1 1 
        1  1207 1 1  76 PHE CE2  C   2.588  13.514  -2.672 1.00 . A A .  76 PHE CE2  1 1 
        1  1208 1 1  76 PHE CG   C   3.574  15.406  -1.504 1.00 . A A .  76 PHE CG   1 1 
        1  1209 1 1  76 PHE CZ   C   3.372  12.639  -1.928 1.00 . A A .  76 PHE CZ   1 1 
        1  1210 1 1  76 PHE H    H   1.100  17.412   0.009 1.00 . A A .  76 PHE H    1 1 
        1  1211 1 1  76 PHE HA   H   4.004  16.963   0.872 1.00 . A A .  76 PHE HA   1 1 
        1  1212 1 1  76 PHE HB2  H   3.018  17.451  -2.011 1.00 . A A .  76 PHE HB2  1 1 
        1  1213 1 1  76 PHE HB3  H   4.679  17.251  -1.518 1.00 . A A .  76 PHE HB3  1 1 
        1  1214 1 1  76 PHE HD1  H   5.092  14.889  -0.059 1.00 . A A .  76 PHE HD1  1 1 
        1  1215 1 1  76 PHE HD2  H   2.053  15.556  -3.022 1.00 . A A .  76 PHE HD2  1 1 
        1  1216 1 1  76 PHE HE1  H   4.863  12.450  -0.397 1.00 . A A .  76 PHE HE1  1 1 
        1  1217 1 1  76 PHE HE2  H   1.913  13.139  -3.427 1.00 . A A .  76 PHE HE2  1 1 
        1  1218 1 1  76 PHE HZ   H   3.303  11.572  -2.092 1.00 . A A .  76 PHE HZ   1 1 
        1  1219 1 1  76 PHE N    N   1.900  17.018   0.508 1.00 . A A .  76 PHE N    1 1 
        1  1220 1 1  76 PHE O    O   2.486  19.708  -0.040 1.00 . A A .  76 PHE O    1 1 
        1  1221 1 1  77 GLU C    C   5.417  21.181  -1.194 1.00 . A A .  77 GLU C    1 1 
        1  1222 1 1  77 GLU CA   C   4.988  20.908   0.287 1.00 . A A .  77 GLU CA   1 1 
        1  1223 1 1  77 GLU CB   C   6.009  21.345   1.364 1.00 . A A .  77 GLU CB   1 1 
        1  1224 1 1  77 GLU CD   C   5.045  23.476   2.427 1.00 . A A .  77 GLU CD   1 1 
        1  1225 1 1  77 GLU CG   C   6.127  22.872   1.551 1.00 . A A .  77 GLU CG   1 1 
        1  1226 1 1  77 GLU H    H   5.382  18.763   0.745 1.00 . A A .  77 GLU H    1 1 
        1  1227 1 1  77 GLU HA   H   4.066  21.501   0.457 1.00 . A A .  77 GLU HA   1 1 
        1  1228 1 1  77 GLU HB2  H   5.747  20.889   2.342 1.00 . A A .  77 GLU HB2  1 1 
        1  1229 1 1  77 GLU HB3  H   7.010  20.938   1.133 1.00 . A A .  77 GLU HB3  1 1 
        1  1230 1 1  77 GLU HG2  H   7.097  23.107   2.027 1.00 . A A .  77 GLU HG2  1 1 
        1  1231 1 1  77 GLU HG3  H   6.138  23.413   0.589 1.00 . A A .  77 GLU HG3  1 1 
        1  1232 1 1  77 GLU N    N   4.665  19.461   0.490 1.00 . A A .  77 GLU N    1 1 
        1  1233 1 1  77 GLU O    O   4.653  21.761  -1.968 1.00 . A A .  77 GLU O    1 1 
        1  1234 1 1  77 GLU OE1  O   3.854  23.450   2.054 1.00 . A A .  77 GLU OE1  1 1 
        1  1235 1 1  77 GLU OE2  O   5.358  23.919   3.550 1.00 . A A .  77 GLU OE2  1 1 
        1  1236 1 1  78 ASN C    C   7.543  18.970  -3.104 1.00 . A A .  78 ASN C    1 1 
        1  1237 1 1  78 ASN CA   C   6.942  20.412  -3.003 1.00 . A A .  78 ASN CA   1 1 
        1  1238 1 1  78 ASN CB   C   7.824  21.534  -3.599 1.00 . A A .  78 ASN CB   1 1 
        1  1239 1 1  78 ASN CG   C   7.987  21.441  -5.115 1.00 . A A .  78 ASN CG   1 1 
        1  1240 1 1  78 ASN H    H   7.066  20.206  -0.814 1.00 . A A .  78 ASN H    1 1 
        1  1241 1 1  78 ASN HA   H   5.999  20.380  -3.581 1.00 . A A .  78 ASN HA   1 1 
        1  1242 1 1  78 ASN HB2  H   7.377  22.511  -3.326 1.00 . A A .  78 ASN HB2  1 1 
        1  1243 1 1  78 ASN HB3  H   8.828  21.541  -3.138 1.00 . A A .  78 ASN HB3  1 1 
        1  1244 1 1  78 ASN HD21 H   7.658  23.416  -5.364 1.00 . A A .  78 ASN HD21 1 1 
        1  1245 1 1  78 ASN HD22 H   7.752  22.320  -6.846 1.00 . A A .  78 ASN HD22 1 1 
        1  1246 1 1  78 ASN N    N   6.608  20.703  -1.582 1.00 . A A .  78 ASN N    1 1 
        1  1247 1 1  78 ASN ND2  N   7.792  22.515  -5.834 1.00 . A A .  78 ASN ND2  1 1 
        1  1248 1 1  78 ASN O    O   6.964  18.113  -3.779 1.00 . A A .  78 ASN O    1 1 
        1  1249 1 1  78 ASN OD1  O   8.262  20.389  -5.688 1.00 . A A .  78 ASN OD1  1 1 
        1  1250 1 1  79 GLU C    C   8.724  16.815  -0.757 1.00 . A A .  79 GLU C    1 1 
        1  1251 1 1  79 GLU CA   C   9.177  17.360  -2.150 1.00 . A A .  79 GLU CA   1 1 
        1  1252 1 1  79 GLU CB   C  10.715  17.302  -2.334 1.00 . A A .  79 GLU CB   1 1 
        1  1253 1 1  79 GLU CD   C  11.016  15.940  -4.567 1.00 . A A .  79 GLU CD   1 1 
        1  1254 1 1  79 GLU CG   C  11.213  17.238  -3.793 1.00 . A A .  79 GLU CG   1 1 
        1  1255 1 1  79 GLU H    H   9.110  19.557  -2.021 1.00 . A A .  79 GLU H    1 1 
        1  1256 1 1  79 GLU HA   H   8.742  16.646  -2.866 1.00 . A A .  79 GLU HA   1 1 
        1  1257 1 1  79 GLU HB2  H  11.195  18.165  -1.831 1.00 . A A .  79 GLU HB2  1 1 
        1  1258 1 1  79 GLU HB3  H  11.130  16.424  -1.805 1.00 . A A .  79 GLU HB3  1 1 
        1  1259 1 1  79 GLU HG2  H  10.781  18.056  -4.396 1.00 . A A .  79 GLU HG2  1 1 
        1  1260 1 1  79 GLU HG3  H  12.301  17.430  -3.803 1.00 . A A .  79 GLU HG3  1 1 
        1  1261 1 1  79 GLU N    N   8.680  18.725  -2.435 1.00 . A A .  79 GLU N    1 1 
        1  1262 1 1  79 GLU O    O   8.253  15.678  -0.698 1.00 . A A .  79 GLU O    1 1 
        1  1263 1 1  79 GLU OE1  O  10.536  14.928  -4.016 1.00 . A A .  79 GLU OE1  1 1 
        1  1264 1 1  79 GLU OE2  O  11.317  15.927  -5.777 1.00 . A A .  79 GLU OE2  1 1 
        1  1265 1 1  80 GLN C    C   7.319  16.513   2.109 1.00 . A A .  80 GLN C    1 1 
        1  1266 1 1  80 GLN CA   C   8.745  16.983   1.714 1.00 . A A .  80 GLN CA   1 1 
        1  1267 1 1  80 GLN CB   C   9.391  17.895   2.784 1.00 . A A .  80 GLN CB   1 1 
        1  1268 1 1  80 GLN CD   C   9.369  20.042   4.174 1.00 . A A .  80 GLN CD   1 1 
        1  1269 1 1  80 GLN CG   C   8.726  19.257   3.040 1.00 . A A .  80 GLN CG   1 1 
        1  1270 1 1  80 GLN H    H   8.898  18.574   0.182 1.00 . A A .  80 GLN H    1 1 
        1  1271 1 1  80 GLN HA   H   9.403  16.088   1.707 1.00 . A A .  80 GLN HA   1 1 
        1  1272 1 1  80 GLN HB2  H   9.427  17.304   3.723 1.00 . A A .  80 GLN HB2  1 1 
        1  1273 1 1  80 GLN HB3  H  10.457  18.045   2.515 1.00 . A A .  80 GLN HB3  1 1 
        1  1274 1 1  80 GLN HE21 H   8.234  19.113   5.526 1.00 . A A .  80 GLN HE21 1 1 
        1  1275 1 1  80 GLN HE22 H   9.442  20.382   6.106 1.00 . A A .  80 GLN HE22 1 1 
        1  1276 1 1  80 GLN HG2  H   8.793  19.880   2.131 1.00 . A A .  80 GLN HG2  1 1 
        1  1277 1 1  80 GLN HG3  H   7.641  19.148   3.228 1.00 . A A .  80 GLN HG3  1 1 
        1  1278 1 1  80 GLN N    N   8.859  17.567   0.352 1.00 . A A .  80 GLN N    1 1 
        1  1279 1 1  80 GLN NE2  N   8.932  19.849   5.396 1.00 . A A .  80 GLN NE2  1 1 
        1  1280 1 1  80 GLN O    O   6.325  17.208   1.869 1.00 . A A .  80 GLN O    1 1 
        1  1281 1 1  80 GLN OE1  O  10.270  20.848   3.976 1.00 . A A .  80 GLN OE1  1 1 
        1  1282 1 1  81 VAL C    C   5.443  15.024   4.405 1.00 . A A .  81 VAL C    1 1 
        1  1283 1 1  81 VAL CA   C   5.955  14.635   2.979 1.00 . A A .  81 VAL CA   1 1 
        1  1284 1 1  81 VAL CB   C   6.045  13.077   2.827 1.00 . A A .  81 VAL CB   1 1 
        1  1285 1 1  81 VAL CG1  C   4.625  12.481   2.736 1.00 . A A .  81 VAL CG1  1 1 
        1  1286 1 1  81 VAL CG2  C   6.857  12.572   1.621 1.00 . A A .  81 VAL CG2  1 1 
        1  1287 1 1  81 VAL H    H   8.146  14.843   2.840 1.00 . A A .  81 VAL H    1 1 
        1  1288 1 1  81 VAL HA   H   5.218  14.982   2.222 1.00 . A A .  81 VAL HA   1 1 
        1  1289 1 1  81 VAL HB   H   6.518  12.646   3.728 1.00 . A A .  81 VAL HB   1 1 
        1  1290 1 1  81 VAL HG11 H   4.034  12.691   3.648 1.00 . A A .  81 VAL HG11 1 1 
        1  1291 1 1  81 VAL HG12 H   4.065  12.908   1.887 1.00 . A A .  81 VAL HG12 1 1 
        1  1292 1 1  81 VAL HG13 H   4.641  11.383   2.610 1.00 . A A .  81 VAL HG13 1 1 
        1  1293 1 1  81 VAL HG21 H   6.725  11.488   1.446 1.00 . A A .  81 VAL HG21 1 1 
        1  1294 1 1  81 VAL HG22 H   6.623  13.100   0.682 1.00 . A A .  81 VAL HG22 1 1 
        1  1295 1 1  81 VAL HG23 H   7.935  12.724   1.778 1.00 . A A .  81 VAL HG23 1 1 
        1  1296 1 1  81 VAL N    N   7.245  15.318   2.710 1.00 . A A .  81 VAL N    1 1 
        1  1297 1 1  81 VAL O    O   6.143  14.856   5.408 1.00 . A A .  81 VAL O    1 1 
        1  1298 1 1  82 VAL C    C   2.789  14.937   6.483 1.00 . A A .  82 VAL C    1 1 
        1  1299 1 1  82 VAL CA   C   3.601  16.047   5.722 1.00 . A A .  82 VAL CA   1 1 
        1  1300 1 1  82 VAL CB   C   2.747  17.322   5.399 1.00 . A A .  82 VAL CB   1 1 
        1  1301 1 1  82 VAL CG1  C   2.084  17.938   6.648 1.00 . A A .  82 VAL CG1  1 1 
        1  1302 1 1  82 VAL CG2  C   3.558  18.458   4.727 1.00 . A A .  82 VAL CG2  1 1 
        1  1303 1 1  82 VAL H    H   3.735  15.629   3.551 1.00 . A A .  82 VAL H    1 1 
        1  1304 1 1  82 VAL HA   H   4.410  16.363   6.410 1.00 . A A .  82 VAL HA   1 1 
        1  1305 1 1  82 VAL HB   H   1.929  17.044   4.700 1.00 . A A .  82 VAL HB   1 1 
        1  1306 1 1  82 VAL HG11 H   2.821  18.314   7.377 1.00 . A A .  82 VAL HG11 1 1 
        1  1307 1 1  82 VAL HG12 H   1.433  18.784   6.362 1.00 . A A .  82 VAL HG12 1 1 
        1  1308 1 1  82 VAL HG13 H   1.427  17.227   7.178 1.00 . A A .  82 VAL HG13 1 1 
        1  1309 1 1  82 VAL HG21 H   4.003  18.149   3.762 1.00 . A A .  82 VAL HG21 1 1 
        1  1310 1 1  82 VAL HG22 H   2.910  19.323   4.493 1.00 . A A .  82 VAL HG22 1 1 
        1  1311 1 1  82 VAL HG23 H   4.386  18.818   5.364 1.00 . A A .  82 VAL HG23 1 1 
        1  1312 1 1  82 VAL N    N   4.211  15.529   4.464 1.00 . A A .  82 VAL N    1 1 
        1  1313 1 1  82 VAL O    O   3.041  14.691   7.664 1.00 . A A .  82 VAL O    1 1 
        1  1314 1 1  83 ARG C    C   0.175  12.513   5.350 1.00 . A A .  83 ARG C    1 1 
        1  1315 1 1  83 ARG CA   C   0.777  13.451   6.446 1.00 . A A .  83 ARG CA   1 1 
        1  1316 1 1  83 ARG CB   C  -0.319  14.261   7.205 1.00 . A A .  83 ARG CB   1 1 
        1  1317 1 1  83 ARG CD   C  -2.249  16.005   7.006 1.00 . A A .  83 ARG CD   1 1 
        1  1318 1 1  83 ARG CG   C  -1.060  15.302   6.359 1.00 . A A .  83 ARG CG   1 1 
        1  1319 1 1  83 ARG CZ   C  -4.704  15.518   7.025 1.00 . A A .  83 ARG CZ   1 1 
        1  1320 1 1  83 ARG H    H   1.725  14.626   4.836 1.00 . A A .  83 ARG H    1 1 
        1  1321 1 1  83 ARG HA   H   1.276  12.790   7.186 1.00 . A A .  83 ARG HA   1 1 
        1  1322 1 1  83 ARG HB2  H  -1.041  13.541   7.636 1.00 . A A .  83 ARG HB2  1 1 
        1  1323 1 1  83 ARG HB3  H   0.155  14.747   8.079 1.00 . A A .  83 ARG HB3  1 1 
        1  1324 1 1  83 ARG HD2  H  -1.982  16.398   8.006 1.00 . A A .  83 ARG HD2  1 1 
        1  1325 1 1  83 ARG HD3  H  -2.450  16.902   6.379 1.00 . A A .  83 ARG HD3  1 1 
        1  1326 1 1  83 ARG HE   H  -3.304  14.050   7.043 1.00 . A A .  83 ARG HE   1 1 
        1  1327 1 1  83 ARG HG2  H  -0.347  16.089   6.042 1.00 . A A .  83 ARG HG2  1 1 
        1  1328 1 1  83 ARG HG3  H  -1.391  14.835   5.416 1.00 . A A .  83 ARG HG3  1 1 
        1  1329 1 1  83 ARG HH11 H  -4.315  17.427   6.589 1.00 . A A .  83 ARG HH11 1 1 
        1  1330 1 1  83 ARG HH12 H  -6.069  16.927   6.669 1.00 . A A .  83 ARG HH12 1 1 
        1  1331 1 1  83 ARG HH21 H  -5.367  13.658   7.397 1.00 . A A .  83 ARG HH21 1 1 
        1  1332 1 1  83 ARG HH22 H  -6.625  14.969   7.142 1.00 . A A .  83 ARG HH22 1 1 
        1  1333 1 1  83 ARG N    N   1.788  14.349   5.823 1.00 . A A .  83 ARG N    1 1 
        1  1334 1 1  83 ARG NE   N  -3.432  15.106   7.077 1.00 . A A .  83 ARG NE   1 1 
        1  1335 1 1  83 ARG NH1  N  -5.071  16.756   6.803 1.00 . A A .  83 ARG NH1  1 1 
        1  1336 1 1  83 ARG NH2  N  -5.657  14.659   7.216 1.00 . A A .  83 ARG NH2  1 1 
        1  1337 1 1  83 ARG O    O   0.134  12.872   4.168 1.00 . A A .  83 ARG O    1 1 
        1  1338 1 1  84 TRP C    C  -2.063   9.544   5.415 1.00 . A A .  84 TRP C    1 1 
        1  1339 1 1  84 TRP CA   C  -0.873  10.337   4.816 1.00 . A A .  84 TRP CA   1 1 
        1  1340 1 1  84 TRP CB   C   0.157   9.423   4.149 1.00 . A A .  84 TRP CB   1 1 
        1  1341 1 1  84 TRP CD1  C   0.805   7.186   5.439 1.00 . A A .  84 TRP CD1  1 1 
        1  1342 1 1  84 TRP CD2  C   2.421   8.713   5.264 1.00 . A A .  84 TRP CD2  1 1 
        1  1343 1 1  84 TRP CE2  C   2.909   7.572   5.951 1.00 . A A .  84 TRP CE2  1 1 
        1  1344 1 1  84 TRP CE3  C   3.312   9.782   4.931 1.00 . A A .  84 TRP CE3  1 1 
        1  1345 1 1  84 TRP CG   C   1.077   8.500   4.967 1.00 . A A .  84 TRP CG   1 1 
        1  1346 1 1  84 TRP CH2  C   5.109   8.589   6.052 1.00 . A A .  84 TRP CH2  1 1 
        1  1347 1 1  84 TRP CZ2  C   4.274   7.519   6.359 1.00 . A A .  84 TRP CZ2  1 1 
        1  1348 1 1  84 TRP CZ3  C   4.638   9.702   5.335 1.00 . A A .  84 TRP CZ3  1 1 
        1  1349 1 1  84 TRP H    H  -0.618  11.338   6.719 1.00 . A A .  84 TRP H    1 1 
        1  1350 1 1  84 TRP HA   H  -1.285  10.923   3.970 1.00 . A A .  84 TRP HA   1 1 
        1  1351 1 1  84 TRP HB2  H  -0.408   8.811   3.434 1.00 . A A .  84 TRP HB2  1 1 
        1  1352 1 1  84 TRP HB3  H   0.798  10.071   3.535 1.00 . A A .  84 TRP HB3  1 1 
        1  1353 1 1  84 TRP HD1  H  -0.102   6.627   5.247 1.00 . A A .  84 TRP HD1  1 1 
        1  1354 1 1  84 TRP HE1  H   2.086   5.633   6.320 1.00 . A A .  84 TRP HE1  1 1 
        1  1355 1 1  84 TRP HE3  H   2.973  10.607   4.323 1.00 . A A .  84 TRP HE3  1 1 
        1  1356 1 1  84 TRP HH2  H   6.148   8.569   6.335 1.00 . A A .  84 TRP HH2  1 1 
        1  1357 1 1  84 TRP HZ2  H   4.657   6.651   6.882 1.00 . A A .  84 TRP HZ2  1 1 
        1  1358 1 1  84 TRP HZ3  H   5.334  10.489   5.071 1.00 . A A .  84 TRP HZ3  1 1 
        1  1359 1 1  84 TRP N    N  -0.283  11.319   5.752 1.00 . A A .  84 TRP N    1 1 
        1  1360 1 1  84 TRP NE1  N   1.921   6.619   6.077 1.00 . A A .  84 TRP NE1  1 1 
        1  1361 1 1  84 TRP O    O  -1.999   9.005   6.524 1.00 . A A .  84 TRP O    1 1 
        1  1362 1 1  85 GLU C    C  -4.872   7.820   4.119 1.00 . A A .  85 GLU C    1 1 
        1  1363 1 1  85 GLU CA   C  -4.456   8.994   5.070 1.00 . A A .  85 GLU CA   1 1 
        1  1364 1 1  85 GLU CB   C  -5.522  10.119   5.096 1.00 . A A .  85 GLU CB   1 1 
        1  1365 1 1  85 GLU CD   C  -4.428  11.934   6.672 1.00 . A A .  85 GLU CD   1 1 
        1  1366 1 1  85 GLU CG   C  -5.100  11.571   5.368 1.00 . A A .  85 GLU CG   1 1 
        1  1367 1 1  85 GLU H    H  -3.055  10.088   3.785 1.00 . A A .  85 GLU H    1 1 
        1  1368 1 1  85 GLU HA   H  -4.392   8.625   6.113 1.00 . A A .  85 GLU HA   1 1 
        1  1369 1 1  85 GLU HB2  H  -6.063  10.150   4.130 1.00 . A A .  85 GLU HB2  1 1 
        1  1370 1 1  85 GLU HB3  H  -6.306   9.824   5.822 1.00 . A A .  85 GLU HB3  1 1 
        1  1371 1 1  85 GLU HG2  H  -4.446  11.921   4.551 1.00 . A A .  85 GLU HG2  1 1 
        1  1372 1 1  85 GLU HG3  H  -6.006  12.193   5.283 1.00 . A A .  85 GLU HG3  1 1 
        1  1373 1 1  85 GLU N    N  -3.132   9.469   4.614 1.00 . A A .  85 GLU N    1 1 
        1  1374 1 1  85 GLU O    O  -5.252   8.038   2.960 1.00 . A A .  85 GLU O    1 1 
        1  1375 1 1  85 GLU OE1  O  -5.143  12.046   7.689 1.00 . A A .  85 GLU OE1  1 1 
        1  1376 1 1  85 GLU OE2  O  -3.259  12.378   6.664 1.00 . A A .  85 GLU OE2  1 1 
        1  1377 1 1  86 GLY C    C  -6.064   4.540   3.832 1.00 . A A .  86 GLY C    1 1 
        1  1378 1 1  86 GLY CA   C  -4.798   5.389   3.713 1.00 . A A .  86 GLY CA   1 1 
        1  1379 1 1  86 GLY H    H  -4.357   6.536   5.550 1.00 . A A .  86 GLY H    1 1 
        1  1380 1 1  86 GLY HA2  H  -4.635   5.654   2.649 1.00 . A A .  86 GLY HA2  1 1 
        1  1381 1 1  86 GLY HA3  H  -3.939   4.736   3.946 1.00 . A A .  86 GLY HA3  1 1 
        1  1382 1 1  86 GLY N    N  -4.718   6.575   4.592 1.00 . A A .  86 GLY N    1 1 
        1  1383 1 1  86 GLY O    O  -6.023   3.459   4.425 1.00 . A A .  86 GLY O    1 1 
        1  1384 1 1  87 ASP C    C  -8.217   3.231   1.534 1.00 . A A .  87 ASP C    1 1 
        1  1385 1 1  87 ASP CA   C  -8.318   4.082   2.867 1.00 . A A .  87 ASP CA   1 1 
        1  1386 1 1  87 ASP CB   C  -9.591   4.958   2.914 1.00 . A A .  87 ASP CB   1 1 
        1  1387 1 1  87 ASP CG   C -10.053   5.263   4.337 1.00 . A A .  87 ASP CG   1 1 
        1  1388 1 1  87 ASP H    H  -6.986   5.861   2.669 1.00 . A A .  87 ASP H    1 1 
        1  1389 1 1  87 ASP HA   H  -8.408   3.318   3.669 1.00 . A A .  87 ASP HA   1 1 
        1  1390 1 1  87 ASP HB2  H  -9.463   5.901   2.352 1.00 . A A .  87 ASP HB2  1 1 
        1  1391 1 1  87 ASP HB3  H -10.441   4.451   2.427 1.00 . A A .  87 ASP HB3  1 1 
        1  1392 1 1  87 ASP N    N  -7.128   4.958   3.137 1.00 . A A .  87 ASP N    1 1 
        1  1393 1 1  87 ASP O    O  -9.196   2.956   0.833 1.00 . A A .  87 ASP O    1 1 
        1  1394 1 1  87 ASP OD1  O -10.524   4.327   5.021 1.00 . A A .  87 ASP OD1  1 1 
        1  1395 1 1  87 ASP OD2  O  -9.949   6.428   4.774 1.00 . A A .  87 ASP OD2  1 1 
        1  1396 1 1  88 TYR C    C  -6.883   0.402   0.444 1.00 . A A .  88 TYR C    1 1 
        1  1397 1 1  88 TYR CA   C  -6.662   1.893   0.114 1.00 . A A .  88 TYR CA   1 1 
        1  1398 1 1  88 TYR CB   C  -5.251   2.233  -0.399 1.00 . A A .  88 TYR CB   1 1 
        1  1399 1 1  88 TYR CD1  C  -3.931   2.123   1.861 1.00 . A A .  88 TYR CD1  1 1 
        1  1400 1 1  88 TYR CD2  C  -2.809   2.673  -0.204 1.00 . A A .  88 TYR CD2  1 1 
        1  1401 1 1  88 TYR CE1  C  -2.727   2.263   2.547 1.00 . A A .  88 TYR CE1  1 1 
        1  1402 1 1  88 TYR CE2  C  -1.604   2.797   0.486 1.00 . A A .  88 TYR CE2  1 1 
        1  1403 1 1  88 TYR CG   C  -3.989   2.326   0.464 1.00 . A A .  88 TYR CG   1 1 
        1  1404 1 1  88 TYR CZ   C  -1.565   2.581   1.858 1.00 . A A .  88 TYR CZ   1 1 
        1  1405 1 1  88 TYR H    H  -6.291   3.188   1.852 1.00 . A A .  88 TYR H    1 1 
        1  1406 1 1  88 TYR HA   H  -7.319   2.173  -0.739 1.00 . A A .  88 TYR HA   1 1 
        1  1407 1 1  88 TYR HB2  H  -5.028   1.524  -1.217 1.00 . A A .  88 TYR HB2  1 1 
        1  1408 1 1  88 TYR HB3  H  -5.342   3.219  -0.891 1.00 . A A .  88 TYR HB3  1 1 
        1  1409 1 1  88 TYR HD1  H  -4.809   1.842   2.423 1.00 . A A .  88 TYR HD1  1 1 
        1  1410 1 1  88 TYR HD2  H  -2.811   2.848  -1.272 1.00 . A A .  88 TYR HD2  1 1 
        1  1411 1 1  88 TYR HE1  H  -2.677   2.118   3.614 1.00 . A A .  88 TYR HE1  1 1 
        1  1412 1 1  88 TYR HE2  H  -0.702   3.069  -0.043 1.00 . A A .  88 TYR HE2  1 1 
        1  1413 1 1  88 TYR HH   H  -0.250   1.724   2.932 1.00 . A A .  88 TYR HH   1 1 
        1  1414 1 1  88 TYR N    N  -7.004   2.749   1.261 1.00 . A A .  88 TYR N    1 1 
        1  1415 1 1  88 TYR O    O  -6.139  -0.182   1.236 1.00 . A A .  88 TYR O    1 1 
        1  1416 1 1  88 TYR OH   O  -0.386   2.603   2.524 1.00 . A A .  88 TYR OH   1 1 
        1  1417 1 1  89 PHE C    C  -9.329  -1.111   1.804 1.00 . A A .  89 PHE C    1 1 
        1  1418 1 1  89 PHE CA   C  -8.630  -1.401   0.402 1.00 . A A .  89 PHE CA   1 1 
        1  1419 1 1  89 PHE CB   C  -7.748  -2.671   0.475 1.00 . A A .  89 PHE CB   1 1 
        1  1420 1 1  89 PHE CD1  C  -5.947  -2.594  -1.333 1.00 . A A .  89 PHE CD1  1 1 
        1  1421 1 1  89 PHE CD2  C  -7.552  -4.393  -1.395 1.00 . A A .  89 PHE CD2  1 1 
        1  1422 1 1  89 PHE CE1  C  -5.268  -3.159  -2.412 1.00 . A A .  89 PHE CE1  1 1 
        1  1423 1 1  89 PHE CE2  C  -6.865  -4.966  -2.469 1.00 . A A .  89 PHE CE2  1 1 
        1  1424 1 1  89 PHE CG   C  -7.099  -3.201  -0.808 1.00 . A A .  89 PHE CG   1 1 
        1  1425 1 1  89 PHE CZ   C  -5.721  -4.349  -2.971 1.00 . A A .  89 PHE CZ   1 1 
        1  1426 1 1  89 PHE H    H  -8.396   0.424  -0.831 1.00 . A A .  89 PHE H    1 1 
        1  1427 1 1  89 PHE HA   H  -9.461  -1.632  -0.295 1.00 . A A .  89 PHE HA   1 1 
        1  1428 1 1  89 PHE HB2  H  -6.945  -2.518   1.219 1.00 . A A .  89 PHE HB2  1 1 
        1  1429 1 1  89 PHE HB3  H  -8.362  -3.476   0.926 1.00 . A A .  89 PHE HB3  1 1 
        1  1430 1 1  89 PHE HD1  H  -5.547  -1.685  -0.902 1.00 . A A .  89 PHE HD1  1 1 
        1  1431 1 1  89 PHE HD2  H  -8.419  -4.908  -0.998 1.00 . A A .  89 PHE HD2  1 1 
        1  1432 1 1  89 PHE HE1  H  -4.384  -2.662  -2.794 1.00 . A A .  89 PHE HE1  1 1 
        1  1433 1 1  89 PHE HE2  H  -7.214  -5.898  -2.895 1.00 . A A .  89 PHE HE2  1 1 
        1  1434 1 1  89 PHE HZ   H  -5.177  -4.801  -3.788 1.00 . A A .  89 PHE HZ   1 1 
        1  1435 1 1  89 PHE N    N  -7.963  -0.172  -0.119 1.00 . A A .  89 PHE N    1 1 
        1  1436 1 1  89 PHE O    O  -8.749  -1.482   2.833 1.00 . A A .  89 PHE O    1 1 
        1  1437 1 1  90 PRO C    C -11.697  -0.839   4.238 1.00 . A A .  90 PRO C    1 1 
        1  1438 1 1  90 PRO CA   C -10.991   0.120   3.233 1.00 . A A .  90 PRO CA   1 1 
        1  1439 1 1  90 PRO CB   C -11.869   1.306   2.747 1.00 . A A .  90 PRO CB   1 1 
        1  1440 1 1  90 PRO CD   C -11.260   0.092   0.759 1.00 . A A .  90 PRO CD   1 1 
        1  1441 1 1  90 PRO CG   C -12.452   0.820   1.400 1.00 . A A .  90 PRO CG   1 1 
        1  1442 1 1  90 PRO HA   H -10.123   0.547   3.774 1.00 . A A .  90 PRO HA   1 1 
        1  1443 1 1  90 PRO HB2  H -12.645   1.622   3.467 1.00 . A A .  90 PRO HB2  1 1 
        1  1444 1 1  90 PRO HB3  H -11.221   2.191   2.581 1.00 . A A .  90 PRO HB3  1 1 
        1  1445 1 1  90 PRO HD2  H -11.570  -0.706   0.059 1.00 . A A .  90 PRO HD2  1 1 
        1  1446 1 1  90 PRO HD3  H -10.632   0.812   0.200 1.00 . A A .  90 PRO HD3  1 1 
        1  1447 1 1  90 PRO HG2  H -13.289   0.118   1.581 1.00 . A A .  90 PRO HG2  1 1 
        1  1448 1 1  90 PRO HG3  H -12.833   1.649   0.778 1.00 . A A .  90 PRO HG3  1 1 
        1  1449 1 1  90 PRO N    N -10.514  -0.452   1.915 1.00 . A A .  90 PRO N    1 1 
        1  1450 1 1  90 PRO O    O -12.746  -0.529   4.804 1.00 . A A .  90 PRO O    1 1 
        1  1451 1 1  91 SER C    C -10.088  -3.769   5.863 1.00 . A A .  91 SER C    1 1 
        1  1452 1 1  91 SER CA   C -11.326  -2.839   5.687 1.00 . A A .  91 SER CA   1 1 
        1  1453 1 1  91 SER CB   C -12.637  -3.641   5.526 1.00 . A A .  91 SER CB   1 1 
        1  1454 1 1  91 SER H    H -10.148  -2.006   3.996 1.00 . A A .  91 SER H    1 1 
        1  1455 1 1  91 SER HA   H -11.438  -2.204   6.589 1.00 . A A .  91 SER HA   1 1 
        1  1456 1 1  91 SER HB2  H -13.416  -3.014   5.053 1.00 . A A .  91 SER HB2  1 1 
        1  1457 1 1  91 SER HB3  H -12.514  -4.511   4.854 1.00 . A A .  91 SER HB3  1 1 
        1  1458 1 1  91 SER HG   H -12.451  -4.618   7.303 1.00 . A A .  91 SER HG   1 1 
        1  1459 1 1  91 SER N    N -11.031  -1.962   4.524 1.00 . A A .  91 SER N    1 1 
        1  1460 1 1  91 SER O    O  -9.972  -4.798   5.192 1.00 . A A .  91 SER O    1 1 
        1  1461 1 1  91 SER OG   O -13.146  -4.061   6.792 1.00 . A A .  91 SER OG   1 1 
        1  1462 1 1  92 GLN C    C  -7.982  -5.290   7.973 1.00 . A A .  92 GLN C    1 1 
        1  1463 1 1  92 GLN CA   C  -7.866  -4.146   6.926 1.00 . A A .  92 GLN CA   1 1 
        1  1464 1 1  92 GLN CB   C  -6.697  -3.156   7.157 1.00 . A A .  92 GLN CB   1 1 
        1  1465 1 1  92 GLN CD   C  -5.789  -1.098   8.467 1.00 . A A .  92 GLN CD   1 1 
        1  1466 1 1  92 GLN CG   C  -6.780  -2.246   8.397 1.00 . A A .  92 GLN CG   1 1 
        1  1467 1 1  92 GLN H    H  -9.355  -2.520   7.230 1.00 . A A .  92 GLN H    1 1 
        1  1468 1 1  92 GLN HA   H  -7.604  -4.645   5.969 1.00 . A A .  92 GLN HA   1 1 
        1  1469 1 1  92 GLN HB2  H  -5.751  -3.734   7.186 1.00 . A A .  92 GLN HB2  1 1 
        1  1470 1 1  92 GLN HB3  H  -6.607  -2.552   6.237 1.00 . A A .  92 GLN HB3  1 1 
        1  1471 1 1  92 GLN HE21 H  -4.203  -2.327   8.359 1.00 . A A .  92 GLN HE21 1 1 
        1  1472 1 1  92 GLN HE22 H  -3.912  -0.529   8.526 1.00 . A A .  92 GLN HE22 1 1 
        1  1473 1 1  92 GLN HG2  H  -7.789  -1.804   8.485 1.00 . A A .  92 GLN HG2  1 1 
        1  1474 1 1  92 GLN HG3  H  -6.670  -2.841   9.316 1.00 . A A .  92 GLN HG3  1 1 
        1  1475 1 1  92 GLN N    N  -9.130  -3.376   6.717 1.00 . A A .  92 GLN N    1 1 
        1  1476 1 1  92 GLN NE2  N  -4.509  -1.347   8.383 1.00 . A A .  92 GLN NE2  1 1 
        1  1477 1 1  92 GLN O    O  -7.416  -5.232   9.070 1.00 . A A .  92 GLN O    1 1 
        1  1478 1 1  92 GLN OE1  O  -6.156   0.063   8.625 1.00 . A A .  92 GLN OE1  1 1 
        1  1479 1 1  93 ASP C    C  -9.708  -8.616   7.815 1.00 . A A .  93 ASP C    1 1 
        1  1480 1 1  93 ASP CA   C  -9.251  -7.333   8.565 1.00 . A A .  93 ASP CA   1 1 
        1  1481 1 1  93 ASP CB   C -10.337  -6.746   9.498 1.00 . A A .  93 ASP CB   1 1 
        1  1482 1 1  93 ASP CG   C -11.641  -6.255   8.891 1.00 . A A .  93 ASP CG   1 1 
        1  1483 1 1  93 ASP H    H  -9.181  -6.227   6.698 1.00 . A A .  93 ASP H    1 1 
        1  1484 1 1  93 ASP HA   H  -8.427  -7.618   9.252 1.00 . A A .  93 ASP HA   1 1 
        1  1485 1 1  93 ASP HB2  H -10.579  -7.503  10.265 1.00 . A A .  93 ASP HB2  1 1 
        1  1486 1 1  93 ASP HB3  H  -9.902  -5.903  10.063 1.00 . A A .  93 ASP HB3  1 1 
        1  1487 1 1  93 ASP N    N  -8.715  -6.348   7.602 1.00 . A A .  93 ASP N    1 1 
        1  1488 1 1  93 ASP O    O -10.815  -8.711   7.279 1.00 . A A .  93 ASP O    1 1 
        1  1489 1 1  93 ASP OD1  O -11.627  -5.291   8.095 1.00 . A A .  93 ASP OD1  1 1 
        1  1490 1 1  93 ASP OD2  O -12.699  -6.830   9.220 1.00 . A A .  93 ASP OD2  1 1 
        1  1491 1 1  94 GLU C    C -10.110 -11.672   8.669 1.00 . A A .  94 GLU C    1 1 
        1  1492 1 1  94 GLU CA   C  -9.278 -11.030   7.512 1.00 . A A .  94 GLU CA   1 1 
        1  1493 1 1  94 GLU CB   C  -8.109 -11.902   7.012 1.00 . A A .  94 GLU CB   1 1 
        1  1494 1 1  94 GLU CD   C  -5.832 -11.113   7.923 1.00 . A A .  94 GLU CD   1 1 
        1  1495 1 1  94 GLU CG   C  -6.911 -12.169   7.927 1.00 . A A .  94 GLU CG   1 1 
        1  1496 1 1  94 GLU H    H  -7.894  -9.406   8.067 1.00 . A A .  94 GLU H    1 1 
        1  1497 1 1  94 GLU HA   H  -9.935 -10.977   6.616 1.00 . A A .  94 GLU HA   1 1 
        1  1498 1 1  94 GLU HB2  H  -8.537 -12.884   6.730 1.00 . A A .  94 GLU HB2  1 1 
        1  1499 1 1  94 GLU HB3  H  -7.756 -11.499   6.044 1.00 . A A .  94 GLU HB3  1 1 
        1  1500 1 1  94 GLU HG2  H  -7.216 -12.360   8.966 1.00 . A A .  94 GLU HG2  1 1 
        1  1501 1 1  94 GLU HG3  H  -6.454 -13.111   7.592 1.00 . A A .  94 GLU HG3  1 1 
        1  1502 1 1  94 GLU N    N  -8.861  -9.648   7.837 1.00 . A A .  94 GLU N    1 1 
        1  1503 1 1  94 GLU O    O  -9.621 -12.399   9.542 1.00 . A A .  94 GLU O    1 1 
        1  1504 1 1  94 GLU OE1  O  -6.023 -10.041   8.530 1.00 . A A .  94 GLU OE1  1 1 
        1  1505 1 1  94 GLU OE2  O  -4.775 -11.361   7.297 1.00 . A A .  94 GLU OE2  1 1 
        1  1506 1 1  95 GLN C    C -12.855 -13.443   8.626 1.00 . A A .  95 GLN C    1 1 
        1  1507 1 1  95 GLN CA   C -12.446 -12.134   9.400 1.00 . A A .  95 GLN CA   1 1 
        1  1508 1 1  95 GLN CB   C -13.654 -11.207   9.681 1.00 . A A .  95 GLN CB   1 1 
        1  1509 1 1  95 GLN CD   C -14.595  -9.244  11.028 1.00 . A A .  95 GLN CD   1 1 
        1  1510 1 1  95 GLN CG   C -13.348 -10.031  10.638 1.00 . A A .  95 GLN CG   1 1 
        1  1511 1 1  95 GLN H    H -11.600 -10.593   8.005 1.00 . A A .  95 GLN H    1 1 
        1  1512 1 1  95 GLN HA   H -12.032 -12.452  10.379 1.00 . A A .  95 GLN HA   1 1 
        1  1513 1 1  95 GLN HB2  H -14.070 -10.820   8.729 1.00 . A A .  95 GLN HB2  1 1 
        1  1514 1 1  95 GLN HB3  H -14.471 -11.817  10.119 1.00 . A A .  95 GLN HB3  1 1 
        1  1515 1 1  95 GLN HE21 H -13.987  -7.622   9.987 1.00 . A A .  95 GLN HE21 1 1 
        1  1516 1 1  95 GLN HE22 H -15.609  -7.566  10.881 1.00 . A A .  95 GLN HE22 1 1 
        1  1517 1 1  95 GLN HG2  H -12.894 -10.410  11.571 1.00 . A A .  95 GLN HG2  1 1 
        1  1518 1 1  95 GLN HG3  H -12.589  -9.358  10.193 1.00 . A A .  95 GLN HG3  1 1 
        1  1519 1 1  95 GLN N    N -11.415 -11.393   8.623 1.00 . A A .  95 GLN N    1 1 
        1  1520 1 1  95 GLN NE2  N -14.769  -8.040  10.544 1.00 . A A .  95 GLN NE2  1 1 
        1  1521 1 1  95 GLN O    O -13.925 -13.561   8.025 1.00 . A A .  95 GLN O    1 1 
        1  1522 1 1  95 GLN OE1  O -15.428  -9.705  11.801 1.00 . A A .  95 GLN OE1  1 1 
        1  1523 1 1  96 LEU C    C -11.068 -16.701   8.200 1.00 . A A .  96 LEU C    1 1 
        1  1524 1 1  96 LEU CA   C -11.836 -15.483   7.604 1.00 . A A .  96 LEU CA   1 1 
        1  1525 1 1  96 LEU CB   C -11.172 -14.882   6.328 1.00 . A A .  96 LEU CB   1 1 
        1  1526 1 1  96 LEU CD1  C -11.310 -14.911   3.796 1.00 . A A .  96 LEU CD1  1 1 
        1  1527 1 1  96 LEU CD2  C  -9.780 -16.510   4.930 1.00 . A A .  96 LEU CD2  1 1 
        1  1528 1 1  96 LEU CG   C -11.120 -15.769   5.065 1.00 . A A .  96 LEU CG   1 1 
        1  1529 1 1  96 LEU H    H -11.037 -14.000   9.012 1.00 . A A .  96 LEU H    1 1 
        1  1530 1 1  96 LEU HA   H -12.871 -15.795   7.368 1.00 . A A .  96 LEU HA   1 1 
        1  1531 1 1  96 LEU HB2  H -11.744 -13.961   6.083 1.00 . A A .  96 LEU HB2  1 1 
        1  1532 1 1  96 LEU HB3  H -10.161 -14.504   6.573 1.00 . A A .  96 LEU HB3  1 1 
        1  1533 1 1  96 LEU HD11 H -10.528 -14.137   3.689 1.00 . A A .  96 LEU HD11 1 1 
        1  1534 1 1  96 LEU HD12 H -11.286 -15.529   2.880 1.00 . A A .  96 LEU HD12 1 1 
        1  1535 1 1  96 LEU HD13 H -12.285 -14.390   3.796 1.00 . A A .  96 LEU HD13 1 1 
        1  1536 1 1  96 LEU HD21 H  -8.925 -15.816   4.829 1.00 . A A .  96 LEU HD21 1 1 
        1  1537 1 1  96 LEU HD22 H  -9.560 -17.157   5.795 1.00 . A A .  96 LEU HD22 1 1 
        1  1538 1 1  96 LEU HD23 H  -9.769 -17.169   4.043 1.00 . A A .  96 LEU HD23 1 1 
        1  1539 1 1  96 LEU HG   H -11.944 -16.512   5.079 1.00 . A A .  96 LEU HG   1 1 
        1  1540 1 1  96 LEU N    N -11.900 -14.384   8.610 1.00 . A A .  96 LEU N    1 1 
        1  1541 1 1  96 LEU O    O -10.170 -16.548   9.037 1.00 . A A .  96 LEU O    1 1 
        1  1542 1 1  97 ALA C    C  -9.232 -19.286   7.798 1.00 . A A .  97 ALA C    1 1 
        1  1543 1 1  97 ALA CA   C -10.742 -19.169   8.195 1.00 . A A .  97 ALA CA   1 1 
        1  1544 1 1  97 ALA CB   C -11.576 -20.334   7.636 1.00 . A A .  97 ALA CB   1 1 
        1  1545 1 1  97 ALA H    H -12.140 -17.930   7.028 1.00 . A A .  97 ALA H    1 1 
        1  1546 1 1  97 ALA HA   H -10.836 -19.226   9.301 1.00 . A A .  97 ALA HA   1 1 
        1  1547 1 1  97 ALA HB1  H -12.629 -20.282   7.971 1.00 . A A .  97 ALA HB1  1 1 
        1  1548 1 1  97 ALA HB2  H -11.580 -20.360   6.530 1.00 . A A .  97 ALA HB2  1 1 
        1  1549 1 1  97 ALA HB3  H -11.188 -21.312   7.975 1.00 . A A .  97 ALA HB3  1 1 
        1  1550 1 1  97 ALA N    N -11.404 -17.919   7.740 1.00 . A A .  97 ALA N    1 1 
        1  1551 1 1  97 ALA O    O  -8.876 -19.658   6.677 1.00 . A A .  97 ALA O    1 1 
        1  1552 1 1  98 LYS C    C  -6.169 -19.296   9.829 1.00 . A A .  98 LYS C    1 1 
        1  1553 1 1  98 LYS CA   C  -6.897 -18.808   8.541 1.00 . A A .  98 LYS CA   1 1 
        1  1554 1 1  98 LYS CB   C  -6.600 -17.315   8.226 1.00 . A A .  98 LYS CB   1 1 
        1  1555 1 1  98 LYS CD   C  -4.979 -15.488   7.536 1.00 . A A .  98 LYS CD   1 1 
        1  1556 1 1  98 LYS CE   C  -3.523 -15.085   7.258 1.00 . A A .  98 LYS CE   1 1 
        1  1557 1 1  98 LYS CG   C  -5.130 -16.983   7.888 1.00 . A A .  98 LYS CG   1 1 
        1  1558 1 1  98 LYS H    H  -8.823 -18.466   9.550 1.00 . A A .  98 LYS H    1 1 
        1  1559 1 1  98 LYS HA   H  -6.588 -19.437   7.681 1.00 . A A .  98 LYS HA   1 1 
        1  1560 1 1  98 LYS HB2  H  -7.241 -17.010   7.371 1.00 . A A .  98 LYS HB2  1 1 
        1  1561 1 1  98 LYS HB3  H  -6.941 -16.687   9.075 1.00 . A A .  98 LYS HB3  1 1 
        1  1562 1 1  98 LYS HD2  H  -5.625 -15.260   6.663 1.00 . A A .  98 LYS HD2  1 1 
        1  1563 1 1  98 LYS HD3  H  -5.374 -14.883   8.378 1.00 . A A .  98 LYS HD3  1 1 
        1  1564 1 1  98 LYS HE2  H  -2.924 -15.183   8.192 1.00 . A A .  98 LYS HE2  1 1 
        1  1565 1 1  98 LYS HE3  H  -3.058 -15.797   6.540 1.00 . A A .  98 LYS HE3  1 1 
        1  1566 1 1  98 LYS HG2  H  -4.477 -17.240   8.746 1.00 . A A .  98 LYS HG2  1 1 
        1  1567 1 1  98 LYS HG3  H  -4.788 -17.613   7.042 1.00 . A A .  98 LYS HG3  1 1 
        1  1568 1 1  98 LYS HZ1  H  -2.507 -13.331   6.587 1.00 . A A .  98 LYS HZ1  1 1 
        1  1569 1 1  98 LYS HZ2  H  -3.927 -13.590   5.807 1.00 . A A .  98 LYS HZ2  1 1 
        1  1570 1 1  98 LYS HZ3  H  -3.944 -12.958   7.284 1.00 . A A .  98 LYS HZ3  1 1 
        1  1571 1 1  98 LYS N    N  -8.367 -18.920   8.749 1.00 . A A .  98 LYS N    1 1 
        1  1572 1 1  98 LYS NZ   N  -3.458 -13.694   6.720 1.00 . A A .  98 LYS NZ   1 1 
        1  1573 1 1  98 LYS O    O  -6.570 -18.951  10.947 1.00 . A A .  98 LYS O    1 1 
        1  1574 1 1  99 ALA C    C  -3.379 -19.476  11.544 1.00 . A A .  99 ALA C    1 1 
        1  1575 1 1  99 ALA CA   C  -4.276 -20.552  10.840 1.00 . A A .  99 ALA CA   1 1 
        1  1576 1 1  99 ALA CB   C  -3.480 -21.759  10.321 1.00 . A A .  99 ALA CB   1 1 
        1  1577 1 1  99 ALA H    H  -4.840 -20.323   8.718 1.00 . A A .  99 ALA H    1 1 
        1  1578 1 1  99 ALA HA   H  -4.980 -20.948  11.602 1.00 . A A .  99 ALA HA   1 1 
        1  1579 1 1  99 ALA HB1  H  -2.747 -21.482   9.539 1.00 . A A .  99 ALA HB1  1 1 
        1  1580 1 1  99 ALA HB2  H  -2.906 -22.246  11.131 1.00 . A A .  99 ALA HB2  1 1 
        1  1581 1 1  99 ALA HB3  H  -4.143 -22.536   9.897 1.00 . A A .  99 ALA HB3  1 1 
        1  1582 1 1  99 ALA N    N  -5.061 -20.043   9.678 1.00 . A A .  99 ALA N    1 1 
        1  1583 1 1  99 ALA O    O  -2.148 -19.486  11.468 1.00 . A A .  99 ALA O    1 1 
        1  1584 1 1 100 ALA C    C  -4.426 -16.827  13.973 1.00 . A A . 100 ALA C    1 1 
        1  1585 1 1 100 ALA CA   C  -3.424 -17.388  12.903 1.00 . A A . 100 ALA CA   1 1 
        1  1586 1 1 100 ALA CB   C  -3.137 -16.314  11.836 1.00 . A A . 100 ALA CB   1 1 
        1  1587 1 1 100 ALA H    H  -5.052 -18.526  11.983 1.00 . A A . 100 ALA H    1 1 
        1  1588 1 1 100 ALA HA   H  -2.474 -17.695  13.378 1.00 . A A . 100 ALA HA   1 1 
        1  1589 1 1 100 ALA HB1  H  -2.750 -15.380  12.281 1.00 . A A . 100 ALA HB1  1 1 
        1  1590 1 1 100 ALA HB2  H  -2.383 -16.664  11.107 1.00 . A A . 100 ALA HB2  1 1 
        1  1591 1 1 100 ALA HB3  H  -4.056 -16.069  11.270 1.00 . A A . 100 ALA HB3  1 1 
        1  1592 1 1 100 ALA N    N  -4.051 -18.548  12.236 1.00 . A A . 100 ALA N    1 1 
        1  1593 1 1 100 ALA O    O  -5.545 -16.471  13.575 1.00 . A A . 100 ALA O    1 1 
        1  1594 1 1 101 PRO C    C  -5.365 -14.695  16.322 1.00 . A A . 101 PRO C    1 1 
        1  1595 1 1 101 PRO CA   C  -5.122 -16.230  16.314 1.00 . A A . 101 PRO CA   1 1 
        1  1596 1 1 101 PRO CB   C  -4.515 -16.803  17.623 1.00 . A A . 101 PRO CB   1 1 
        1  1597 1 1 101 PRO CD   C  -2.847 -17.158  15.901 1.00 . A A . 101 PRO CD   1 1 
        1  1598 1 1 101 PRO CG   C  -2.988 -16.775  17.385 1.00 . A A . 101 PRO CG   1 1 
        1  1599 1 1 101 PRO HA   H  -6.091 -16.740  16.138 1.00 . A A . 101 PRO HA   1 1 
        1  1600 1 1 101 PRO HB2  H  -4.818 -16.255  18.533 1.00 . A A . 101 PRO HB2  1 1 
        1  1601 1 1 101 PRO HB3  H  -4.856 -17.850  17.752 1.00 . A A . 101 PRO HB3  1 1 
        1  1602 1 1 101 PRO HD2  H  -1.963 -16.679  15.440 1.00 . A A . 101 PRO HD2  1 1 
        1  1603 1 1 101 PRO HD3  H  -2.746 -18.256  15.789 1.00 . A A . 101 PRO HD3  1 1 
        1  1604 1 1 101 PRO HG2  H  -2.603 -15.749  17.552 1.00 . A A . 101 PRO HG2  1 1 
        1  1605 1 1 101 PRO HG3  H  -2.436 -17.453  18.058 1.00 . A A . 101 PRO HG3  1 1 
        1  1606 1 1 101 PRO N    N  -4.113 -16.695  15.293 1.00 . A A . 101 PRO N    1 1 
        1  1607 1 1 101 PRO O    O  -4.970 -13.965  17.236 1.00 . A A . 101 PRO O    1 1 
        1  1608 1 1 102 LYS C    C  -7.490 -12.152  15.516 1.00 . A A . 102 LYS C    1 1 
        1  1609 1 1 102 LYS CA   C  -6.159 -12.762  14.987 1.00 . A A . 102 LYS CA   1 1 
        1  1610 1 1 102 LYS CB   C  -5.961 -12.595  13.462 1.00 . A A . 102 LYS CB   1 1 
        1  1611 1 1 102 LYS CD   C  -6.183 -10.840  11.600 1.00 . A A . 102 LYS CD   1 1 
        1  1612 1 1 102 LYS CE   C  -7.549 -10.134  11.503 1.00 . A A . 102 LYS CE   1 1 
        1  1613 1 1 102 LYS CG   C  -5.695 -11.143  13.020 1.00 . A A . 102 LYS CG   1 1 
        1  1614 1 1 102 LYS H    H  -6.162 -14.936  14.541 1.00 . A A . 102 LYS H    1 1 
        1  1615 1 1 102 LYS HA   H  -5.323 -12.224  15.478 1.00 . A A . 102 LYS HA   1 1 
        1  1616 1 1 102 LYS HB2  H  -5.095 -13.205  13.130 1.00 . A A . 102 LYS HB2  1 1 
        1  1617 1 1 102 LYS HB3  H  -6.830 -13.033  12.935 1.00 . A A . 102 LYS HB3  1 1 
        1  1618 1 1 102 LYS HD2  H  -5.440 -10.164  11.129 1.00 . A A . 102 LYS HD2  1 1 
        1  1619 1 1 102 LYS HD3  H  -6.146 -11.736  10.952 1.00 . A A . 102 LYS HD3  1 1 
        1  1620 1 1 102 LYS HE2  H  -7.514  -9.194  12.096 1.00 . A A . 102 LYS HE2  1 1 
        1  1621 1 1 102 LYS HE3  H  -7.681  -9.795  10.452 1.00 . A A . 102 LYS HE3  1 1 
        1  1622 1 1 102 LYS HG2  H  -6.105 -10.399  13.733 1.00 . A A . 102 LYS HG2  1 1 
        1  1623 1 1 102 LYS HG3  H  -4.601 -10.966  13.064 1.00 . A A . 102 LYS HG3  1 1 
        1  1624 1 1 102 LYS HZ1  H  -9.576 -10.483  11.991 1.00 . A A . 102 LYS HZ1  1 1 
        1  1625 1 1 102 LYS HZ2  H  -8.881 -11.753  11.227 1.00 . A A . 102 LYS HZ2  1 1 
        1  1626 1 1 102 LYS HZ3  H  -8.541 -11.444  12.837 1.00 . A A . 102 LYS HZ3  1 1 
        1  1627 1 1 102 LYS N    N  -6.047 -14.215  15.271 1.00 . A A . 102 LYS N    1 1 
        1  1628 1 1 102 LYS NZ   N  -8.692 -10.998  11.913 1.00 . A A . 102 LYS NZ   1 1 
        1  1629 1 1 102 LYS O    O  -8.397 -11.798  14.750 1.00 . A A . 102 LYS O    1 1 
        1  1630 1 1 103 GLN C    C  -8.513  -9.742  17.600 1.00 . A A . 103 GLN C    1 1 
        1  1631 1 1 103 GLN CA   C  -8.673 -11.295  17.534 1.00 . A A . 103 GLN CA   1 1 
        1  1632 1 1 103 GLN CB   C  -8.926 -11.988  18.898 1.00 . A A . 103 GLN CB   1 1 
        1  1633 1 1 103 GLN CD   C  -8.153 -12.679  21.234 1.00 . A A . 103 GLN CD   1 1 
        1  1634 1 1 103 GLN CG   C  -7.775 -11.994  19.926 1.00 . A A . 103 GLN CG   1 1 
        1  1635 1 1 103 GLN H    H  -6.735 -12.376  17.332 1.00 . A A . 103 GLN H    1 1 
        1  1636 1 1 103 GLN HA   H  -9.607 -11.485  16.961 1.00 . A A . 103 GLN HA   1 1 
        1  1637 1 1 103 GLN HB2  H  -9.826 -11.527  19.354 1.00 . A A . 103 GLN HB2  1 1 
        1  1638 1 1 103 GLN HB3  H  -9.230 -13.036  18.691 1.00 . A A . 103 GLN HB3  1 1 
        1  1639 1 1 103 GLN HE21 H  -8.721 -10.941  22.038 1.00 . A A . 103 GLN HE21 1 1 
        1  1640 1 1 103 GLN HE22 H  -8.851 -12.470  23.061 1.00 . A A . 103 GLN HE22 1 1 
        1  1641 1 1 103 GLN HG2  H  -6.899 -12.529  19.517 1.00 . A A . 103 GLN HG2  1 1 
        1  1642 1 1 103 GLN HG3  H  -7.408 -10.970  20.126 1.00 . A A . 103 GLN HG3  1 1 
        1  1643 1 1 103 GLN N    N  -7.542 -11.969  16.841 1.00 . A A . 103 GLN N    1 1 
        1  1644 1 1 103 GLN NE2  N  -8.615 -11.943  22.216 1.00 . A A . 103 GLN NE2  1 1 
        1  1645 1 1 103 GLN O    O  -8.342  -9.144  18.665 1.00 . A A . 103 GLN O    1 1 
        1  1646 1 1 103 GLN OE1  O  -8.030 -13.888  21.391 1.00 . A A . 103 GLN OE1  1 1 
        1  1647 1 1 104 PHE C    C  -8.653  -7.293  14.786 1.00 . A A . 104 PHE C    1 1 
        1  1648 1 1 104 PHE CA   C  -8.268  -7.662  16.247 1.00 . A A . 104 PHE CA   1 1 
        1  1649 1 1 104 PHE CB   C  -6.840  -7.205  16.649 1.00 . A A . 104 PHE CB   1 1 
        1  1650 1 1 104 PHE CD1  C  -5.069  -9.040  16.538 1.00 . A A . 104 PHE CD1  1 1 
        1  1651 1 1 104 PHE CD2  C  -4.994  -7.287  14.878 1.00 . A A . 104 PHE CD2  1 1 
        1  1652 1 1 104 PHE CE1  C  -3.928  -9.619  15.978 1.00 . A A . 104 PHE CE1  1 1 
        1  1653 1 1 104 PHE CE2  C  -3.859  -7.870  14.314 1.00 . A A . 104 PHE CE2  1 1 
        1  1654 1 1 104 PHE CG   C  -5.621  -7.869  15.994 1.00 . A A . 104 PHE CG   1 1 
        1  1655 1 1 104 PHE CZ   C  -3.325  -9.032  14.868 1.00 . A A . 104 PHE CZ   1 1 
        1  1656 1 1 104 PHE H    H  -8.808  -9.697  15.627 1.00 . A A . 104 PHE H    1 1 
        1  1657 1 1 104 PHE HA   H  -8.944  -7.101  16.929 1.00 . A A . 104 PHE HA   1 1 
        1  1658 1 1 104 PHE HB2  H  -6.782  -6.108  16.501 1.00 . A A . 104 PHE HB2  1 1 
        1  1659 1 1 104 PHE HB3  H  -6.748  -7.309  17.748 1.00 . A A . 104 PHE HB3  1 1 
        1  1660 1 1 104 PHE HD1  H  -5.519  -9.500  17.410 1.00 . A A . 104 PHE HD1  1 1 
        1  1661 1 1 104 PHE HD2  H  -5.392  -6.379  14.440 1.00 . A A . 104 PHE HD2  1 1 
        1  1662 1 1 104 PHE HE1  H  -3.512 -10.519  16.414 1.00 . A A . 104 PHE HE1  1 1 
        1  1663 1 1 104 PHE HE2  H  -3.390  -7.417  13.449 1.00 . A A . 104 PHE HE2  1 1 
        1  1664 1 1 104 PHE HZ   H  -2.441  -9.479  14.432 1.00 . A A . 104 PHE HZ   1 1 
        1  1665 1 1 104 PHE N    N  -8.559  -9.102  16.423 1.00 . A A . 104 PHE N    1 1 
        1  1666 1 1 104 PHE O    O  -7.875  -7.483  13.846 1.00 . A A . 104 PHE O    1 1 
        1  1667 1 1 105 GLY C    C  -9.755  -4.941  12.727 1.00 . A A . 105 GLY C    1 1 
        1  1668 1 1 105 GLY CA   C -10.317  -6.282  13.257 1.00 . A A . 105 GLY CA   1 1 
        1  1669 1 1 105 GLY H    H -10.502  -6.961  15.374 1.00 . A A . 105 GLY H    1 1 
        1  1670 1 1 105 GLY HA2  H -10.115  -7.055  12.493 1.00 . A A . 105 GLY HA2  1 1 
        1  1671 1 1 105 GLY HA3  H -11.419  -6.194  13.270 1.00 . A A . 105 GLY HA3  1 1 
        1  1672 1 1 105 GLY N    N  -9.867  -6.761  14.594 1.00 . A A . 105 GLY N    1 1 
        1  1673 1 1 105 GLY O    O -10.511  -4.139  12.182 1.00 . A A . 105 GLY O    1 1 
        1  1674 1 1 106 ARG C    C  -6.178  -3.961  12.306 1.00 . A A . 106 ARG C    1 1 
        1  1675 1 1 106 ARG CA   C  -7.697  -3.612  12.227 1.00 . A A . 106 ARG CA   1 1 
        1  1676 1 1 106 ARG CB   C  -8.045  -2.267  12.921 1.00 . A A . 106 ARG CB   1 1 
        1  1677 1 1 106 ARG CD   C  -6.249  -0.470  12.389 1.00 . A A . 106 ARG CD   1 1 
        1  1678 1 1 106 ARG CG   C  -7.670  -0.990  12.142 1.00 . A A . 106 ARG CG   1 1 
        1  1679 1 1 106 ARG CZ   C  -5.191   1.735  11.840 1.00 . A A . 106 ARG CZ   1 1 
        1  1680 1 1 106 ARG H    H  -7.972  -5.561  13.268 1.00 . A A . 106 ARG H    1 1 
        1  1681 1 1 106 ARG HA   H  -8.003  -3.551  11.162 1.00 . A A . 106 ARG HA   1 1 
        1  1682 1 1 106 ARG HB2  H  -9.145  -2.222  13.060 1.00 . A A . 106 ARG HB2  1 1 
        1  1683 1 1 106 ARG HB3  H  -7.650  -2.242  13.955 1.00 . A A . 106 ARG HB3  1 1 
        1  1684 1 1 106 ARG HD2  H  -6.112  -0.274  13.473 1.00 . A A . 106 ARG HD2  1 1 
        1  1685 1 1 106 ARG HD3  H  -5.490  -1.229  12.115 1.00 . A A . 106 ARG HD3  1 1 
        1  1686 1 1 106 ARG HE   H  -6.512   0.858  10.660 1.00 . A A . 106 ARG HE   1 1 
        1  1687 1 1 106 ARG HG2  H  -7.867  -1.134  11.062 1.00 . A A . 106 ARG HG2  1 1 
        1  1688 1 1 106 ARG HG3  H  -8.386  -0.198  12.450 1.00 . A A . 106 ARG HG3  1 1 
        1  1689 1 1 106 ARG HH11 H  -4.362   0.877  13.421 1.00 . A A . 106 ARG HH11 1 1 
        1  1690 1 1 106 ARG HH12 H  -3.707   2.506  12.928 1.00 . A A . 106 ARG HH12 1 1 
        1  1691 1 1 106 ARG HH21 H  -5.743   2.726  10.207 1.00 . A A . 106 ARG HH21 1 1 
        1  1692 1 1 106 ARG HH22 H  -4.384   3.430  11.210 1.00 . A A . 106 ARG HH22 1 1 
        1  1693 1 1 106 ARG N    N  -8.434  -4.746  12.841 1.00 . A A . 106 ARG N    1 1 
        1  1694 1 1 106 ARG NE   N  -6.048   0.755  11.571 1.00 . A A . 106 ARG NE   1 1 
        1  1695 1 1 106 ARG NH1  N  -4.392   1.748  12.872 1.00 . A A . 106 ARG NH1  1 1 
        1  1696 1 1 106 ARG NH2  N  -5.120   2.739  11.017 1.00 . A A . 106 ARG NH2  1 1 
        1  1697 1 1 106 ARG O    O  -5.542  -3.770  13.349 1.00 . A A . 106 ARG O    1 1 
        1  1698 1 1 107 ASN C    C  -3.204  -3.621  10.929 1.00 . A A . 107 ASN C    1 1 
        1  1699 1 1 107 ASN CA   C  -4.155  -4.853  11.174 1.00 . A A . 107 ASN CA   1 1 
        1  1700 1 1 107 ASN CB   C  -3.931  -5.915  10.066 1.00 . A A . 107 ASN CB   1 1 
        1  1701 1 1 107 ASN CG   C  -4.518  -7.293  10.283 1.00 . A A . 107 ASN CG   1 1 
        1  1702 1 1 107 ASN H    H  -6.251  -4.719  10.454 1.00 . A A . 107 ASN H    1 1 
        1  1703 1 1 107 ASN HA   H  -3.859  -5.295  12.149 1.00 . A A . 107 ASN HA   1 1 
        1  1704 1 1 107 ASN HB2  H  -4.239  -5.509   9.082 1.00 . A A . 107 ASN HB2  1 1 
        1  1705 1 1 107 ASN HB3  H  -2.842  -6.074   9.945 1.00 . A A . 107 ASN HB3  1 1 
        1  1706 1 1 107 ASN HD21 H  -6.111  -6.785   9.220 1.00 . A A . 107 ASN HD21 1 1 
        1  1707 1 1 107 ASN HD22 H  -5.733  -8.573   9.405 1.00 . A A . 107 ASN HD22 1 1 
        1  1708 1 1 107 ASN N    N  -5.593  -4.462  11.207 1.00 . A A . 107 ASN N    1 1 
        1  1709 1 1 107 ASN ND2  N  -5.654  -7.574   9.692 1.00 . A A . 107 ASN ND2  1 1 
        1  1710 1 1 107 ASN O    O  -2.675  -3.452   9.830 1.00 . A A . 107 ASN O    1 1 
        1  1711 1 1 107 ASN OD1  O  -3.922  -8.155  10.919 1.00 . A A . 107 ASN OD1  1 1 
        1  1712 1 1 108 LEU C    C  -2.170  -0.900  13.342 1.00 . A A . 108 LEU C    1 1 
        1  1713 1 1 108 LEU CA   C  -2.098  -1.608  11.950 1.00 . A A . 108 LEU CA   1 1 
        1  1714 1 1 108 LEU CB   C  -2.385  -0.625  10.777 1.00 . A A . 108 LEU CB   1 1 
        1  1715 1 1 108 LEU CD1  C  -0.101   0.536  10.661 1.00 . A A . 108 LEU CD1  1 1 
        1  1716 1 1 108 LEU CD2  C  -2.056   1.513   9.478 1.00 . A A . 108 LEU CD2  1 1 
        1  1717 1 1 108 LEU CG   C  -1.616   0.705  10.714 1.00 . A A . 108 LEU CG   1 1 
        1  1718 1 1 108 LEU H    H  -3.557  -3.043  12.798 1.00 . A A . 108 LEU H    1 1 
        1  1719 1 1 108 LEU HA   H  -1.076  -2.015  11.833 1.00 . A A . 108 LEU HA   1 1 
        1  1720 1 1 108 LEU HB2  H  -2.180  -1.157   9.829 1.00 . A A . 108 LEU HB2  1 1 
        1  1721 1 1 108 LEU HB3  H  -3.468  -0.405  10.767 1.00 . A A . 108 LEU HB3  1 1 
        1  1722 1 1 108 LEU HD11 H   0.276   0.253   9.662 1.00 . A A . 108 LEU HD11 1 1 
        1  1723 1 1 108 LEU HD12 H   0.395   1.468  10.972 1.00 . A A . 108 LEU HD12 1 1 
        1  1724 1 1 108 LEU HD13 H   0.277  -0.226  11.354 1.00 . A A . 108 LEU HD13 1 1 
        1  1725 1 1 108 LEU HD21 H  -1.623   2.531   9.493 1.00 . A A . 108 LEU HD21 1 1 
        1  1726 1 1 108 LEU HD22 H  -1.731   1.043   8.534 1.00 . A A . 108 LEU HD22 1 1 
        1  1727 1 1 108 LEU HD23 H  -3.150   1.637   9.420 1.00 . A A . 108 LEU HD23 1 1 
        1  1728 1 1 108 LEU HG   H  -1.859   1.309  11.610 1.00 . A A . 108 LEU HG   1 1 
        1  1729 1 1 108 LEU N    N  -3.015  -2.787  11.963 1.00 . A A . 108 LEU N    1 1 
        1  1730 1 1 108 LEU O    O  -3.252  -0.687  13.902 1.00 . A A . 108 LEU O    1 1 
        1  1731 1 1 109 ALA C    C  -1.594   1.801  14.933 1.00 . A A . 109 ALA C    1 1 
        1  1732 1 1 109 ALA CA   C  -0.890   0.413  15.024 1.00 . A A . 109 ALA CA   1 1 
        1  1733 1 1 109 ALA CB   C   0.608   0.515  15.356 1.00 . A A . 109 ALA CB   1 1 
        1  1734 1 1 109 ALA H    H  -0.180  -0.746  13.289 1.00 . A A . 109 ALA H    1 1 
        1  1735 1 1 109 ALA HA   H  -1.365  -0.121  15.871 1.00 . A A . 109 ALA HA   1 1 
        1  1736 1 1 109 ALA HB1  H   1.192   1.004  14.552 1.00 . A A . 109 ALA HB1  1 1 
        1  1737 1 1 109 ALA HB2  H   0.786   1.095  16.280 1.00 . A A . 109 ALA HB2  1 1 
        1  1738 1 1 109 ALA HB3  H   1.058  -0.482  15.519 1.00 . A A . 109 ALA HB3  1 1 
        1  1739 1 1 109 ALA N    N  -1.004  -0.457  13.830 1.00 . A A . 109 ALA N    1 1 
        1  1740 1 1 109 ALA O    O  -2.554   2.008  15.679 1.00 . A A . 109 ALA O    1 1 
        1  1741 1 1 110 ARG C    C  -2.311   4.605  12.727 1.00 . A A . 110 ARG C    1 1 
        1  1742 1 1 110 ARG CA   C  -1.660   4.132  14.079 1.00 . A A . 110 ARG CA   1 1 
        1  1743 1 1 110 ARG CB   C  -0.477   5.050  14.529 1.00 . A A . 110 ARG CB   1 1 
        1  1744 1 1 110 ARG CD   C   0.084   7.168  15.886 1.00 . A A . 110 ARG CD   1 1 
        1  1745 1 1 110 ARG CG   C  -0.805   5.916  15.768 1.00 . A A . 110 ARG CG   1 1 
        1  1746 1 1 110 ARG CZ   C   0.094   9.414  14.777 1.00 . A A . 110 ARG CZ   1 1 
        1  1747 1 1 110 ARG H    H  -0.293   2.507  13.557 1.00 . A A . 110 ARG H    1 1 
        1  1748 1 1 110 ARG HA   H  -2.473   4.229  14.824 1.00 . A A . 110 ARG HA   1 1 
        1  1749 1 1 110 ARG HB2  H   0.438   4.466  14.755 1.00 . A A . 110 ARG HB2  1 1 
        1  1750 1 1 110 ARG HB3  H  -0.153   5.688  13.685 1.00 . A A . 110 ARG HB3  1 1 
        1  1751 1 1 110 ARG HD2  H   0.134   7.472  16.952 1.00 . A A . 110 ARG HD2  1 1 
        1  1752 1 1 110 ARG HD3  H   1.123   6.933  15.575 1.00 . A A . 110 ARG HD3  1 1 
        1  1753 1 1 110 ARG HE   H  -1.515   8.261  14.785 1.00 . A A . 110 ARG HE   1 1 
        1  1754 1 1 110 ARG HG2  H  -1.874   6.210  15.801 1.00 . A A . 110 ARG HG2  1 1 
        1  1755 1 1 110 ARG HG3  H  -0.671   5.286  16.670 1.00 . A A . 110 ARG HG3  1 1 
        1  1756 1 1 110 ARG HH11 H   1.809   8.968  15.616 1.00 . A A . 110 ARG HH11 1 1 
        1  1757 1 1 110 ARG HH12 H   1.687  10.616  14.814 1.00 . A A . 110 ARG HH12 1 1 
        1  1758 1 1 110 ARG HH21 H  -1.560  10.018  13.820 1.00 . A A . 110 ARG HH21 1 1 
        1  1759 1 1 110 ARG HH22 H  -0.148  11.178  13.826 1.00 . A A . 110 ARG HH22 1 1 
        1  1760 1 1 110 ARG N    N  -1.170   2.729  14.051 1.00 . A A . 110 ARG N    1 1 
        1  1761 1 1 110 ARG NE   N  -0.505   8.275  15.090 1.00 . A A . 110 ARG NE   1 1 
        1  1762 1 1 110 ARG NH1  N   1.330   9.702  15.092 1.00 . A A . 110 ARG NH1  1 1 
        1  1763 1 1 110 ARG NH2  N  -0.590  10.295  14.122 1.00 . A A . 110 ARG NH2  1 1 
        1  1764 1 1 110 ARG O    O  -2.393   3.904  11.716 1.00 . A A . 110 ARG O    1 1 
        1  1765 1 1 111 ASP C    C  -1.606   7.294  11.063 1.00 . A A . 111 ASP C    1 1 
        1  1766 1 1 111 ASP CA   C  -2.972   6.741  11.616 1.00 . A A . 111 ASP CA   1 1 
        1  1767 1 1 111 ASP CB   C  -3.926   7.868  12.132 1.00 . A A . 111 ASP CB   1 1 
        1  1768 1 1 111 ASP CG   C  -3.323   8.786  13.197 1.00 . A A . 111 ASP CG   1 1 
        1  1769 1 1 111 ASP H    H  -2.756   6.248  13.708 1.00 . A A . 111 ASP H    1 1 
        1  1770 1 1 111 ASP HA   H  -3.484   6.223  10.789 1.00 . A A . 111 ASP HA   1 1 
        1  1771 1 1 111 ASP HB2  H  -4.261   8.494  11.285 1.00 . A A . 111 ASP HB2  1 1 
        1  1772 1 1 111 ASP HB3  H  -4.859   7.427  12.530 1.00 . A A . 111 ASP HB3  1 1 
        1  1773 1 1 111 ASP N    N  -2.837   5.822  12.780 1.00 . A A . 111 ASP N    1 1 
        1  1774 1 1 111 ASP O    O  -0.529   6.909  11.527 1.00 . A A . 111 ASP O    1 1 
        1  1775 1 1 111 ASP OD1  O  -3.095   8.336  14.340 1.00 . A A . 111 ASP OD1  1 1 
        1  1776 1 1 111 ASP OD2  O  -2.935   9.922  12.866 1.00 . A A . 111 ASP OD2  1 1 
        1  1777 1 1 112 LYS C    C  -0.870  10.695   9.768 1.00 . A A . 112 LYS C    1 1 
        1  1778 1 1 112 LYS CA   C  -0.487   9.186   9.938 1.00 . A A . 112 LYS CA   1 1 
        1  1779 1 1 112 LYS CB   C   0.481   8.668   8.843 1.00 . A A . 112 LYS CB   1 1 
        1  1780 1 1 112 LYS CD   C   2.547   7.749  10.006 1.00 . A A . 112 LYS CD   1 1 
        1  1781 1 1 112 LYS CE   C   3.920   8.036  10.610 1.00 . A A . 112 LYS CE   1 1 
        1  1782 1 1 112 LYS CG   C   1.969   8.922   9.195 1.00 . A A . 112 LYS CG   1 1 
        1  1783 1 1 112 LYS H    H  -2.592   8.473   9.802 1.00 . A A . 112 LYS H    1 1 
        1  1784 1 1 112 LYS HA   H   0.070   9.195  10.899 1.00 . A A . 112 LYS HA   1 1 
        1  1785 1 1 112 LYS HB2  H   0.325   7.588   8.645 1.00 . A A . 112 LYS HB2  1 1 
        1  1786 1 1 112 LYS HB3  H   0.244   9.134   7.868 1.00 . A A . 112 LYS HB3  1 1 
        1  1787 1 1 112 LYS HD2  H   1.842   7.465  10.815 1.00 . A A . 112 LYS HD2  1 1 
        1  1788 1 1 112 LYS HD3  H   2.595   6.864   9.339 1.00 . A A . 112 LYS HD3  1 1 
        1  1789 1 1 112 LYS HE2  H   4.632   8.379   9.830 1.00 . A A . 112 LYS HE2  1 1 
        1  1790 1 1 112 LYS HE3  H   3.850   8.869  11.343 1.00 . A A . 112 LYS HE3  1 1 
        1  1791 1 1 112 LYS HG2  H   2.545   9.046   8.258 1.00 . A A . 112 LYS HG2  1 1 
        1  1792 1 1 112 LYS HG3  H   2.082   9.891   9.719 1.00 . A A . 112 LYS HG3  1 1 
        1  1793 1 1 112 LYS HZ1  H   5.164   6.927  11.959 1.00 . A A . 112 LYS HZ1  1 1 
        1  1794 1 1 112 LYS HZ2  H   3.638   6.217  11.730 1.00 . A A . 112 LYS HZ2  1 1 
        1  1795 1 1 112 LYS HZ3  H   4.727   6.077  10.574 1.00 . A A . 112 LYS HZ3  1 1 
        1  1796 1 1 112 LYS N    N  -1.643   8.258  10.123 1.00 . A A . 112 LYS N    1 1 
        1  1797 1 1 112 LYS NZ   N   4.408   6.794  11.264 1.00 . A A . 112 LYS NZ   1 1 
        1  1798 1 1 112 LYS O    O  -0.546  11.343   8.769 1.00 . A A . 112 LYS O    1 1 
        1  1799 1 1 113 LYS C    C  -0.430  13.311  11.881 1.00 . A A . 113 LYS C    1 1 
        1  1800 1 1 113 LYS CA   C  -1.589  12.738  11.003 1.00 . A A . 113 LYS CA   1 1 
        1  1801 1 1 113 LYS CB   C  -2.989  12.944  11.632 1.00 . A A . 113 LYS CB   1 1 
        1  1802 1 1 113 LYS CD   C  -3.581  15.323  10.789 1.00 . A A . 113 LYS CD   1 1 
        1  1803 1 1 113 LYS CE   C  -4.140  16.682  11.243 1.00 . A A . 113 LYS CE   1 1 
        1  1804 1 1 113 LYS CG   C  -3.434  14.371  11.986 1.00 . A A . 113 LYS CG   1 1 
        1  1805 1 1 113 LYS H    H  -1.839  10.599  11.515 1.00 . A A . 113 LYS H    1 1 
        1  1806 1 1 113 LYS HA   H  -1.585  13.228  10.008 1.00 . A A . 113 LYS HA   1 1 
        1  1807 1 1 113 LYS HB2  H  -3.749  12.487  10.963 1.00 . A A . 113 LYS HB2  1 1 
        1  1808 1 1 113 LYS HB3  H  -3.063  12.352  12.568 1.00 . A A . 113 LYS HB3  1 1 
        1  1809 1 1 113 LYS HD2  H  -2.599  15.453  10.295 1.00 . A A . 113 LYS HD2  1 1 
        1  1810 1 1 113 LYS HD3  H  -4.244  14.860  10.030 1.00 . A A . 113 LYS HD3  1 1 
        1  1811 1 1 113 LYS HE2  H  -5.156  16.540  11.678 1.00 . A A . 113 LYS HE2  1 1 
        1  1812 1 1 113 LYS HE3  H  -3.522  17.093  12.074 1.00 . A A . 113 LYS HE3  1 1 
        1  1813 1 1 113 LYS HG2  H  -4.407  14.277  12.513 1.00 . A A . 113 LYS HG2  1 1 
        1  1814 1 1 113 LYS HG3  H  -2.746  14.801  12.742 1.00 . A A . 113 LYS HG3  1 1 
        1  1815 1 1 113 LYS HZ1  H  -3.239  18.017   9.854 1.00 . A A . 113 LYS HZ1  1 1 
        1  1816 1 1 113 LYS HZ2  H  -4.521  17.191   9.234 1.00 . A A . 113 LYS HZ2  1 1 
        1  1817 1 1 113 LYS HZ3  H  -4.769  18.451  10.266 1.00 . A A . 113 LYS HZ3  1 1 
        1  1818 1 1 113 LYS N    N  -1.444  11.268  10.831 1.00 . A A . 113 LYS N    1 1 
        1  1819 1 1 113 LYS NZ   N  -4.177  17.629  10.097 1.00 . A A . 113 LYS NZ   1 1 
        1  1820 1 1 113 LYS O    O   0.001  12.705  12.870 1.00 . A A . 113 LYS O    1 1 
        1  1821 1 1 114 LYS C    C   0.154  16.677  12.791 1.00 . A A . 114 LYS C    1 1 
        1  1822 1 1 114 LYS CA   C   0.887  15.338  12.429 1.00 . A A . 114 LYS CA   1 1 
        1  1823 1 1 114 LYS CB   C   2.298  15.493  11.787 1.00 . A A . 114 LYS CB   1 1 
        1  1824 1 1 114 LYS CD   C   3.858  16.672  10.105 1.00 . A A . 114 LYS CD   1 1 
        1  1825 1 1 114 LYS CE   C   4.788  17.468  11.039 1.00 . A A . 114 LYS CE   1 1 
        1  1826 1 1 114 LYS CG   C   2.415  16.429  10.571 1.00 . A A . 114 LYS CG   1 1 
        1  1827 1 1 114 LYS H    H  -0.487  15.008  10.820 1.00 . A A . 114 LYS H    1 1 
        1  1828 1 1 114 LYS HA   H   1.043  14.812  13.396 1.00 . A A . 114 LYS HA   1 1 
        1  1829 1 1 114 LYS HB2  H   2.989  15.819  12.587 1.00 . A A . 114 LYS HB2  1 1 
        1  1830 1 1 114 LYS HB3  H   2.671  14.483  11.516 1.00 . A A . 114 LYS HB3  1 1 
        1  1831 1 1 114 LYS HD2  H   4.330  15.691   9.888 1.00 . A A . 114 LYS HD2  1 1 
        1  1832 1 1 114 LYS HD3  H   3.827  17.160   9.111 1.00 . A A . 114 LYS HD3  1 1 
        1  1833 1 1 114 LYS HE2  H   4.911  16.932  12.005 1.00 . A A . 114 LYS HE2  1 1 
        1  1834 1 1 114 LYS HE3  H   5.808  17.453  10.592 1.00 . A A . 114 LYS HE3  1 1 
        1  1835 1 1 114 LYS HG2  H   1.859  15.981   9.720 1.00 . A A . 114 LYS HG2  1 1 
        1  1836 1 1 114 LYS HG3  H   1.908  17.395  10.751 1.00 . A A . 114 LYS HG3  1 1 
        1  1837 1 1 114 LYS HZ1  H   4.993  19.408  11.861 1.00 . A A . 114 LYS HZ1  1 1 
        1  1838 1 1 114 LYS HZ2  H   4.233  19.416  10.400 1.00 . A A . 114 LYS HZ2  1 1 
        1  1839 1 1 114 LYS HZ3  H   3.438  18.949  11.758 1.00 . A A . 114 LYS HZ3  1 1 
        1  1840 1 1 114 LYS N    N   0.041  14.515  11.536 1.00 . A A . 114 LYS N    1 1 
        1  1841 1 1 114 LYS NZ   N   4.344  18.877  11.266 1.00 . A A . 114 LYS NZ   1 1 
        1  1842 1 1 114 LYS O    O  -0.971  16.973  12.371 1.00 . A A . 114 LYS O    1 1 
        1  1843 1 1 115 GLN C    C   0.798  19.809  12.524 1.00 . A A . 115 GLN C    1 1 
        1  1844 1 1 115 GLN CA   C   0.516  18.926  13.782 1.00 . A A . 115 GLN CA   1 1 
        1  1845 1 1 115 GLN CB   C   1.132  19.432  15.108 1.00 . A A . 115 GLN CB   1 1 
        1  1846 1 1 115 GLN CD   C   3.508  18.369  15.195 1.00 . A A . 115 GLN CD   1 1 
        1  1847 1 1 115 GLN CG   C   2.650  19.620  15.265 1.00 . A A . 115 GLN CG   1 1 
        1  1848 1 1 115 GLN H    H   1.826  17.169  13.621 1.00 . A A . 115 GLN H    1 1 
        1  1849 1 1 115 GLN HA   H  -0.573  18.953  13.991 1.00 . A A . 115 GLN HA   1 1 
        1  1850 1 1 115 GLN HB2  H   0.664  20.413  15.331 1.00 . A A . 115 GLN HB2  1 1 
        1  1851 1 1 115 GLN HB3  H   0.762  18.780  15.926 1.00 . A A . 115 GLN HB3  1 1 
        1  1852 1 1 115 GLN HE21 H   3.629  18.261  17.186 1.00 . A A . 115 GLN HE21 1 1 
        1  1853 1 1 115 GLN HE22 H   4.504  16.986  16.190 1.00 . A A . 115 GLN HE22 1 1 
        1  1854 1 1 115 GLN HG2  H   3.030  20.340  14.519 1.00 . A A . 115 GLN HG2  1 1 
        1  1855 1 1 115 GLN HG3  H   2.820  20.142  16.228 1.00 . A A . 115 GLN HG3  1 1 
        1  1856 1 1 115 GLN N    N   0.869  17.506  13.549 1.00 . A A . 115 GLN N    1 1 
        1  1857 1 1 115 GLN NE2  N   3.911  17.812  16.310 1.00 . A A . 115 GLN NE2  1 1 
        1  1858 1 1 115 GLN O    O   1.897  20.332  12.327 1.00 . A A . 115 GLN O    1 1 
        1  1859 1 1 115 GLN OE1  O   3.821  17.865  14.120 1.00 . A A . 115 GLN OE1  1 1 
        1  1860 1 1 116 ARG C    C  -1.596  20.207   9.677 1.00 . A A . 116 ARG C    1 1 
        1  1861 1 1 116 ARG CA   C  -0.262  20.640  10.393 1.00 . A A . 116 ARG CA   1 1 
        1  1862 1 1 116 ARG CB   C   0.977  20.493   9.466 1.00 . A A . 116 ARG CB   1 1 
        1  1863 1 1 116 ARG CD   C   2.168  21.493   7.408 1.00 . A A . 116 ARG CD   1 1 
        1  1864 1 1 116 ARG CG   C   0.830  21.192   8.098 1.00 . A A . 116 ARG CG   1 1 
        1  1865 1 1 116 ARG CZ   C   2.671  22.314   5.096 1.00 . A A . 116 ARG CZ   1 1 
        1  1866 1 1 116 ARG H    H  -0.972  19.211  11.892 1.00 . A A . 116 ARG H    1 1 
        1  1867 1 1 116 ARG HA   H  -0.339  21.710  10.679 1.00 . A A . 116 ARG HA   1 1 
        1  1868 1 1 116 ARG HB2  H   1.851  20.917   9.994 1.00 . A A . 116 ARG HB2  1 1 
        1  1869 1 1 116 ARG HB3  H   1.212  19.423   9.304 1.00 . A A . 116 ARG HB3  1 1 
        1  1870 1 1 116 ARG HD2  H   2.633  22.383   7.879 1.00 . A A . 116 ARG HD2  1 1 
        1  1871 1 1 116 ARG HD3  H   2.885  20.658   7.525 1.00 . A A . 116 ARG HD3  1 1 
        1  1872 1 1 116 ARG HE   H   1.111  21.198   5.465 1.00 . A A . 116 ARG HE   1 1 
        1  1873 1 1 116 ARG HG2  H   0.186  20.551   7.458 1.00 . A A . 116 ARG HG2  1 1 
        1  1874 1 1 116 ARG HG3  H   0.273  22.146   8.193 1.00 . A A . 116 ARG HG3  1 1 
        1  1875 1 1 116 ARG HH11 H   3.985  22.992   6.403 1.00 . A A . 116 ARG HH11 1 1 
        1  1876 1 1 116 ARG HH12 H   4.336  23.376   4.622 1.00 . A A . 116 ARG HH12 1 1 
        1  1877 1 1 116 ARG HH21 H   1.477  21.668   3.671 1.00 . A A . 116 ARG HH21 1 1 
        1  1878 1 1 116 ARG HH22 H   2.931  22.726   3.137 1.00 . A A . 116 ARG HH22 1 1 
        1  1879 1 1 116 ARG N    N  -0.218  19.864  11.654 1.00 . A A . 116 ARG N    1 1 
        1  1880 1 1 116 ARG NE   N   1.891  21.701   5.970 1.00 . A A . 116 ARG NE   1 1 
        1  1881 1 1 116 ARG NH1  N   3.754  22.971   5.413 1.00 . A A . 116 ARG NH1  1 1 
        1  1882 1 1 116 ARG NH2  N   2.317  22.241   3.850 1.00 . A A . 116 ARG NH2  1 1 
        1  1883 1 1 116 ARG O    O  -1.863  19.018   9.456 1.00 . A A . 116 ARG O    1 1 
        1  1884 1 1 117 GLY C    C  -3.311  20.377   7.028 1.00 . A A . 117 GLY C    1 1 
        1  1885 1 1 117 GLY CA   C  -3.562  21.037   8.399 1.00 . A A . 117 GLY CA   1 1 
        1  1886 1 1 117 GLY H    H  -2.158  22.090   9.757 1.00 . A A . 117 GLY H    1 1 
        1  1887 1 1 117 GLY HA2  H  -4.343  20.466   8.925 1.00 . A A . 117 GLY HA2  1 1 
        1  1888 1 1 117 GLY HA3  H  -4.025  22.028   8.228 1.00 . A A . 117 GLY HA3  1 1 
        1  1889 1 1 117 GLY N    N  -2.390  21.210   9.289 1.00 . A A . 117 GLY N    1 1 
        1  1890 1 1 117 GLY O    O  -3.688  19.218   6.838 1.00 . A A . 117 GLY O    1 1 
        1  1891 1 1 118 ARG C    C  -0.936  19.915   4.791 1.00 . A A . 118 ARG C    1 1 
        1  1892 1 1 118 ARG CA   C  -2.320  20.634   4.761 1.00 . A A . 118 ARG CA   1 1 
        1  1893 1 1 118 ARG CB   C  -2.388  21.860   3.809 1.00 . A A . 118 ARG CB   1 1 
        1  1894 1 1 118 ARG CD   C  -2.216  22.714   1.362 1.00 . A A . 118 ARG CD   1 1 
        1  1895 1 1 118 ARG CG   C  -2.264  21.506   2.313 1.00 . A A . 118 ARG CG   1 1 
        1  1896 1 1 118 ARG CZ   C  -3.768  24.530   0.625 1.00 . A A . 118 ARG CZ   1 1 
        1  1897 1 1 118 ARG H    H  -2.412  22.051   6.461 1.00 . A A . 118 ARG H    1 1 
        1  1898 1 1 118 ARG HA   H  -3.078  19.898   4.424 1.00 . A A . 118 ARG HA   1 1 
        1  1899 1 1 118 ARG HB2  H  -3.351  22.385   3.970 1.00 . A A . 118 ARG HB2  1 1 
        1  1900 1 1 118 ARG HB3  H  -1.602  22.591   4.086 1.00 . A A . 118 ARG HB3  1 1 
        1  1901 1 1 118 ARG HD2  H  -1.384  23.391   1.649 1.00 . A A . 118 ARG HD2  1 1 
        1  1902 1 1 118 ARG HD3  H  -1.968  22.342   0.346 1.00 . A A . 118 ARG HD3  1 1 
        1  1903 1 1 118 ARG HE   H  -4.255  23.174   1.988 1.00 . A A . 118 ARG HE   1 1 
        1  1904 1 1 118 ARG HG2  H  -1.333  20.923   2.158 1.00 . A A . 118 ARG HG2  1 1 
        1  1905 1 1 118 ARG HG3  H  -3.080  20.821   2.016 1.00 . A A . 118 ARG HG3  1 1 
        1  1906 1 1 118 ARG HH11 H  -2.086  24.503  -0.446 1.00 . A A . 118 ARG HH11 1 1 
        1  1907 1 1 118 ARG HH12 H  -3.241  25.883  -0.760 1.00 . A A . 118 ARG HH12 1 1 
        1  1908 1 1 118 ARG HH21 H  -5.537  24.721   1.508 1.00 . A A . 118 ARG HH21 1 1 
        1  1909 1 1 118 ARG HH22 H  -5.091  25.967   0.261 1.00 . A A . 118 ARG HH22 1 1 
        1  1910 1 1 118 ARG N    N  -2.688  21.129   6.116 1.00 . A A . 118 ARG N    1 1 
        1  1911 1 1 118 ARG NE   N  -3.510  23.438   1.337 1.00 . A A . 118 ARG NE   1 1 
        1  1912 1 1 118 ARG NH1  N  -2.951  25.041  -0.262 1.00 . A A . 118 ARG NH1  1 1 
        1  1913 1 1 118 ARG NH2  N  -4.907  25.128   0.814 1.00 . A A . 118 ARG NH2  1 1 
        1  1914 1 1 118 ARG O    O  -0.877  18.742   5.221 1.00 . A A . 118 ARG O    1 1 
        1  1915 1 1 118 ARG OXT  O   0.098  20.515   4.409 1.00 . A A . 118 ARG OXT  1 1 
        2  1916 1 1   1 MET C    C  33.516 -18.394  10.457 1.00 . A A .   1 MET C    1 1 
        2  1917 1 1   1 MET CA   C  34.301 -18.176  11.785 1.00 . A A .   1 MET CA   1 1 
        2  1918 1 1   1 MET CB   C  33.507 -17.427  12.880 1.00 . A A .   1 MET CB   1 1 
        2  1919 1 1   1 MET CE   C  33.860 -16.991  16.987 1.00 . A A .   1 MET CE   1 1 
        2  1920 1 1   1 MET CG   C  34.095 -17.545  14.295 1.00 . A A .   1 MET CG   1 1 
        2  1921 1 1   1 MET H1   H  36.178 -17.420  12.375 1.00 . A A .   1 MET H1   1 1 
        2  1922 1 1   1 MET H2   H  36.197 -18.069  10.858 1.00 . A A .   1 MET H2   1 1 
        2  1923 1 1   1 MET H3   H  35.530 -16.589  11.114 1.00 . A A .   1 MET H3   1 1 
        2  1924 1 1   1 MET HA   H  34.480 -19.207  12.166 1.00 . A A .   1 MET HA   1 1 
        2  1925 1 1   1 MET HB2  H  33.373 -16.357  12.629 1.00 . A A .   1 MET HB2  1 1 
        2  1926 1 1   1 MET HB3  H  32.473 -17.833  12.922 1.00 . A A .   1 MET HB3  1 1 
        2  1927 1 1   1 MET HE1  H  33.966 -18.072  17.195 1.00 . A A .   1 MET HE1  1 1 
        2  1928 1 1   1 MET HE2  H  34.871 -16.545  16.964 1.00 . A A .   1 MET HE2  1 1 
        2  1929 1 1   1 MET HE3  H  33.314 -16.539  17.834 1.00 . A A .   1 MET HE3  1 1 
        2  1930 1 1   1 MET HG2  H  34.197 -18.600  14.613 1.00 . A A .   1 MET HG2  1 1 
        2  1931 1 1   1 MET HG3  H  35.097 -17.085  14.381 1.00 . A A .   1 MET HG3  1 1 
        2  1932 1 1   1 MET N    N  35.623 -17.529  11.518 1.00 . A A .   1 MET N    1 1 
        2  1933 1 1   1 MET O    O  33.536 -19.518   9.953 1.00 . A A .   1 MET O    1 1 
        2  1934 1 1   1 MET SD   S  32.982 -16.705  15.442 1.00 . A A .   1 MET SD   1 1 
        2  1935 1 1   2 ALA C    C  33.152 -17.299   7.367 1.00 . A A .   2 ALA C    1 1 
        2  1936 1 1   2 ALA CA   C  32.183 -17.491   8.571 1.00 . A A .   2 ALA CA   1 1 
        2  1937 1 1   2 ALA CB   C  31.054 -16.447   8.565 1.00 . A A .   2 ALA CB   1 1 
        2  1938 1 1   2 ALA H    H  32.880 -16.473  10.381 1.00 . A A .   2 ALA H    1 1 
        2  1939 1 1   2 ALA HA   H  31.690 -18.485   8.510 1.00 . A A .   2 ALA HA   1 1 
        2  1940 1 1   2 ALA HB1  H  30.349 -16.601   9.404 1.00 . A A .   2 ALA HB1  1 1 
        2  1941 1 1   2 ALA HB2  H  31.429 -15.409   8.633 1.00 . A A .   2 ALA HB2  1 1 
        2  1942 1 1   2 ALA HB3  H  30.454 -16.506   7.638 1.00 . A A .   2 ALA HB3  1 1 
        2  1943 1 1   2 ALA N    N  32.885 -17.361   9.872 1.00 . A A .   2 ALA N    1 1 
        2  1944 1 1   2 ALA O    O  33.673 -16.203   7.144 1.00 . A A .   2 ALA O    1 1 
        2  1945 1 1   3 GLY C    C  33.593 -17.877   4.127 1.00 . A A .   3 GLY C    1 1 
        2  1946 1 1   3 GLY CA   C  34.273 -18.344   5.422 1.00 . A A .   3 GLY CA   1 1 
        2  1947 1 1   3 GLY H    H  32.986 -19.248   6.985 1.00 . A A .   3 GLY H    1 1 
        2  1948 1 1   3 GLY HA2  H  35.149 -17.693   5.611 1.00 . A A .   3 GLY HA2  1 1 
        2  1949 1 1   3 GLY HA3  H  34.712 -19.347   5.260 1.00 . A A .   3 GLY HA3  1 1 
        2  1950 1 1   3 GLY N    N  33.390 -18.382   6.612 1.00 . A A .   3 GLY N    1 1 
        2  1951 1 1   3 GLY O    O  33.824 -16.750   3.683 1.00 . A A .   3 GLY O    1 1 
        2  1952 1 1   4 SER C    C  30.668 -17.667   2.638 1.00 . A A .   4 SER C    1 1 
        2  1953 1 1   4 SER CA   C  32.007 -18.380   2.293 1.00 . A A .   4 SER CA   1 1 
        2  1954 1 1   4 SER CB   C  31.796 -19.671   1.467 1.00 . A A .   4 SER CB   1 1 
        2  1955 1 1   4 SER H    H  32.597 -19.608   4.034 1.00 . A A .   4 SER H    1 1 
        2  1956 1 1   4 SER HA   H  32.626 -17.709   1.659 1.00 . A A .   4 SER HA   1 1 
        2  1957 1 1   4 SER HB2  H  32.762 -20.191   1.309 1.00 . A A .   4 SER HB2  1 1 
        2  1958 1 1   4 SER HB3  H  31.151 -20.389   2.012 1.00 . A A .   4 SER HB3  1 1 
        2  1959 1 1   4 SER HG   H  31.881 -18.979  -0.352 1.00 . A A .   4 SER HG   1 1 
        2  1960 1 1   4 SER N    N  32.766 -18.739   3.518 1.00 . A A .   4 SER N    1 1 
        2  1961 1 1   4 SER O    O  29.656 -18.310   2.939 1.00 . A A .   4 SER O    1 1 
        2  1962 1 1   4 SER OG   O  31.205 -19.385   0.200 1.00 . A A .   4 SER OG   1 1 
        2  1963 1 1   5 GLY C    C  28.458 -15.388   1.726 1.00 . A A .   5 GLY C    1 1 
        2  1964 1 1   5 GLY CA   C  29.463 -15.516   2.882 1.00 . A A .   5 GLY CA   1 1 
        2  1965 1 1   5 GLY H    H  31.608 -15.915   2.478 1.00 . A A .   5 GLY H    1 1 
        2  1966 1 1   5 GLY HA2  H  28.946 -15.898   3.784 1.00 . A A .   5 GLY HA2  1 1 
        2  1967 1 1   5 GLY HA3  H  29.785 -14.497   3.165 1.00 . A A .   5 GLY HA3  1 1 
        2  1968 1 1   5 GLY N    N  30.672 -16.324   2.585 1.00 . A A .   5 GLY N    1 1 
        2  1969 1 1   5 GLY O    O  28.320 -14.316   1.132 1.00 . A A .   5 GLY O    1 1 
        2  1970 1 1   6 ILE C    C  25.401 -15.966   0.601 1.00 . A A .   6 ILE C    1 1 
        2  1971 1 1   6 ILE CA   C  26.802 -16.560   0.279 1.00 . A A .   6 ILE CA   1 1 
        2  1972 1 1   6 ILE CB   C  26.838 -17.996  -0.358 1.00 . A A .   6 ILE CB   1 1 
        2  1973 1 1   6 ILE CD1  C  26.430 -19.237  -2.598 1.00 . A A .   6 ILE CD1  1 1 
        2  1974 1 1   6 ILE CG1  C  26.089 -18.032  -1.719 1.00 . A A .   6 ILE CG1  1 1 
        2  1975 1 1   6 ILE CG2  C  26.359 -19.112   0.582 1.00 . A A .   6 ILE CG2  1 1 
        2  1976 1 1   6 ILE H    H  28.072 -17.316   1.941 1.00 . A A .   6 ILE H    1 1 
        2  1977 1 1   6 ILE HA   H  27.245 -15.941  -0.521 1.00 . A A .   6 ILE HA   1 1 
        2  1978 1 1   6 ILE HB   H  27.913 -18.190  -0.574 1.00 . A A .   6 ILE HB   1 1 
        2  1979 1 1   6 ILE HD11 H  27.512 -19.302  -2.817 1.00 . A A .   6 ILE HD11 1 1 
        2  1980 1 1   6 ILE HD12 H  26.131 -20.196  -2.138 1.00 . A A .   6 ILE HD12 1 1 
        2  1981 1 1   6 ILE HD13 H  25.907 -19.176  -3.570 1.00 . A A .   6 ILE HD13 1 1 
        2  1982 1 1   6 ILE HG12 H  24.995 -17.991  -1.556 1.00 . A A .   6 ILE HG12 1 1 
        2  1983 1 1   6 ILE HG13 H  26.326 -17.119  -2.301 1.00 . A A .   6 ILE HG13 1 1 
        2  1984 1 1   6 ILE HG21 H  26.597 -20.115   0.185 1.00 . A A .   6 ILE HG21 1 1 
        2  1985 1 1   6 ILE HG22 H  26.863 -19.022   1.557 1.00 . A A .   6 ILE HG22 1 1 
        2  1986 1 1   6 ILE HG23 H  25.271 -19.081   0.773 1.00 . A A .   6 ILE HG23 1 1 
        2  1987 1 1   6 ILE N    N  27.739 -16.481   1.440 1.00 . A A .   6 ILE N    1 1 
        2  1988 1 1   6 ILE O    O  24.426 -16.679   0.853 1.00 . A A .   6 ILE O    1 1 
        2  1989 1 1   7 ILE C    C  23.096 -13.867  -0.440 1.00 . A A .   7 ILE C    1 1 
        2  1990 1 1   7 ILE CA   C  24.031 -13.888   0.808 1.00 . A A .   7 ILE CA   1 1 
        2  1991 1 1   7 ILE CB   C  24.357 -12.513   1.477 1.00 . A A .   7 ILE CB   1 1 
        2  1992 1 1   7 ILE CD1  C  22.288 -12.443   3.056 1.00 . A A .   7 ILE CD1  1 1 
        2  1993 1 1   7 ILE CG1  C  23.112 -11.733   1.983 1.00 . A A .   7 ILE CG1  1 1 
        2  1994 1 1   7 ILE CG2  C  25.209 -11.544   0.622 1.00 . A A .   7 ILE CG2  1 1 
        2  1995 1 1   7 ILE H    H  26.221 -14.161   0.515 1.00 . A A .   7 ILE H    1 1 
        2  1996 1 1   7 ILE HA   H  23.492 -14.451   1.601 1.00 . A A .   7 ILE HA   1 1 
        2  1997 1 1   7 ILE HB   H  24.968 -12.745   2.378 1.00 . A A .   7 ILE HB   1 1 
        2  1998 1 1   7 ILE HD11 H  21.490 -11.780   3.439 1.00 . A A .   7 ILE HD11 1 1 
        2  1999 1 1   7 ILE HD12 H  21.784 -13.352   2.681 1.00 . A A .   7 ILE HD12 1 1 
        2  2000 1 1   7 ILE HD13 H  22.899 -12.741   3.927 1.00 . A A .   7 ILE HD13 1 1 
        2  2001 1 1   7 ILE HG12 H  23.447 -10.766   2.409 1.00 . A A .   7 ILE HG12 1 1 
        2  2002 1 1   7 ILE HG13 H  22.456 -11.460   1.136 1.00 . A A .   7 ILE HG13 1 1 
        2  2003 1 1   7 ILE HG21 H  25.477 -10.637   1.194 1.00 . A A .   7 ILE HG21 1 1 
        2  2004 1 1   7 ILE HG22 H  26.166 -11.998   0.306 1.00 . A A .   7 ILE HG22 1 1 
        2  2005 1 1   7 ILE HG23 H  24.695 -11.214  -0.297 1.00 . A A .   7 ILE HG23 1 1 
        2  2006 1 1   7 ILE N    N  25.304 -14.628   0.543 1.00 . A A .   7 ILE N    1 1 
        2  2007 1 1   7 ILE O    O  22.986 -12.872  -1.166 1.00 . A A .   7 ILE O    1 1 
        2  2008 1 1   8 TYR C    C  20.153 -14.628  -1.715 1.00 . A A .   8 TYR C    1 1 
        2  2009 1 1   8 TYR CA   C  21.586 -15.211  -1.889 1.00 . A A .   8 TYR CA   1 1 
        2  2010 1 1   8 TYR CB   C  21.605 -16.730  -2.208 1.00 . A A .   8 TYR CB   1 1 
        2  2011 1 1   8 TYR CD1  C  21.842 -16.921  -4.749 1.00 . A A .   8 TYR CD1  1 1 
        2  2012 1 1   8 TYR CD2  C  19.727 -17.528  -3.754 1.00 . A A .   8 TYR CD2  1 1 
        2  2013 1 1   8 TYR CE1  C  21.322 -17.194  -6.016 1.00 . A A .   8 TYR CE1  1 1 
        2  2014 1 1   8 TYR CE2  C  19.212 -17.806  -5.023 1.00 . A A .   8 TYR CE2  1 1 
        2  2015 1 1   8 TYR CG   C  21.047 -17.075  -3.602 1.00 . A A .   8 TYR CG   1 1 
        2  2016 1 1   8 TYR CZ   C  20.006 -17.628  -6.155 1.00 . A A .   8 TYR CZ   1 1 
        2  2017 1 1   8 TYR H    H  22.719 -15.782  -0.078 1.00 . A A .   8 TYR H    1 1 
        2  2018 1 1   8 TYR HA   H  22.095 -14.709  -2.741 1.00 . A A .   8 TYR HA   1 1 
        2  2019 1 1   8 TYR HB2  H  22.646 -17.110  -2.154 1.00 . A A .   8 TYR HB2  1 1 
        2  2020 1 1   8 TYR HB3  H  21.063 -17.298  -1.427 1.00 . A A .   8 TYR HB3  1 1 
        2  2021 1 1   8 TYR HD1  H  22.865 -16.575  -4.663 1.00 . A A .   8 TYR HD1  1 1 
        2  2022 1 1   8 TYR HD2  H  19.089 -17.653  -2.887 1.00 . A A .   8 TYR HD2  1 1 
        2  2023 1 1   8 TYR HE1  H  21.938 -17.057  -6.896 1.00 . A A .   8 TYR HE1  1 1 
        2  2024 1 1   8 TYR HE2  H  18.192 -18.156  -5.119 1.00 . A A .   8 TYR HE2  1 1 
        2  2025 1 1   8 TYR HH   H  18.533 -17.718  -7.408 1.00 . A A .   8 TYR HH   1 1 
        2  2026 1 1   8 TYR N    N  22.409 -15.001  -0.672 1.00 . A A .   8 TYR N    1 1 
        2  2027 1 1   8 TYR O    O  19.294 -15.210  -1.048 1.00 . A A .   8 TYR O    1 1 
        2  2028 1 1   8 TYR OH   O  19.500 -17.846  -7.404 1.00 . A A .   8 TYR OH   1 1 
        2  2029 1 1   9 LYS C    C  18.263 -12.249  -3.688 1.00 . A A .   9 LYS C    1 1 
        2  2030 1 1   9 LYS CA   C  18.647 -12.723  -2.255 1.00 . A A .   9 LYS CA   1 1 
        2  2031 1 1   9 LYS CB   C  18.646 -11.594  -1.192 1.00 . A A .   9 LYS CB   1 1 
        2  2032 1 1   9 LYS CD   C  20.562 -10.011  -1.952 1.00 . A A .   9 LYS CD   1 1 
        2  2033 1 1   9 LYS CE   C  21.863  -9.333  -1.496 1.00 . A A .   9 LYS CE   1 1 
        2  2034 1 1   9 LYS CG   C  19.936 -10.842  -0.826 1.00 . A A .   9 LYS CG   1 1 
        2  2035 1 1   9 LYS H    H  20.757 -13.071  -2.788 1.00 . A A .   9 LYS H    1 1 
        2  2036 1 1   9 LYS HA   H  17.844 -13.417  -1.918 1.00 . A A .   9 LYS HA   1 1 
        2  2037 1 1   9 LYS HB2  H  17.839 -10.870  -1.422 1.00 . A A .   9 LYS HB2  1 1 
        2  2038 1 1   9 LYS HB3  H  18.298 -12.067  -0.249 1.00 . A A .   9 LYS HB3  1 1 
        2  2039 1 1   9 LYS HD2  H  20.772 -10.670  -2.817 1.00 . A A .   9 LYS HD2  1 1 
        2  2040 1 1   9 LYS HD3  H  19.823  -9.267  -2.315 1.00 . A A .   9 LYS HD3  1 1 
        2  2041 1 1   9 LYS HE2  H  21.672  -8.680  -0.615 1.00 . A A .   9 LYS HE2  1 1 
        2  2042 1 1   9 LYS HE3  H  22.581 -10.108  -1.140 1.00 . A A .   9 LYS HE3  1 1 
        2  2043 1 1   9 LYS HG2  H  19.698 -10.190   0.040 1.00 . A A .   9 LYS HG2  1 1 
        2  2044 1 1   9 LYS HG3  H  20.672 -11.574  -0.434 1.00 . A A .   9 LYS HG3  1 1 
        2  2045 1 1   9 LYS HZ1  H  21.791  -7.834  -2.974 1.00 . A A .   9 LYS HZ1  1 1 
        2  2046 1 1   9 LYS HZ2  H  23.317  -8.075  -2.405 1.00 . A A .   9 LYS HZ2  1 1 
        2  2047 1 1   9 LYS HZ3  H  22.636  -9.154  -3.444 1.00 . A A .   9 LYS HZ3  1 1 
        2  2048 1 1   9 LYS N    N  19.928 -13.468  -2.336 1.00 . A A .   9 LYS N    1 1 
        2  2049 1 1   9 LYS NZ   N  22.436  -8.557  -2.631 1.00 . A A .   9 LYS NZ   1 1 
        2  2050 1 1   9 LYS O    O  18.856 -11.318  -4.241 1.00 . A A .   9 LYS O    1 1 
        2  2051 1 1  10 GLN C    C  16.095 -11.441  -5.990 1.00 . A A .  10 GLN C    1 1 
        2  2052 1 1  10 GLN CA   C  16.948 -12.736  -5.738 1.00 . A A .  10 GLN CA   1 1 
        2  2053 1 1  10 GLN CB   C  16.178 -13.978  -6.274 1.00 . A A .  10 GLN CB   1 1 
        2  2054 1 1  10 GLN CD   C  16.353 -16.528  -6.838 1.00 . A A .  10 GLN CD   1 1 
        2  2055 1 1  10 GLN CG   C  16.970 -15.298  -6.188 1.00 . A A .  10 GLN CG   1 1 
        2  2056 1 1  10 GLN H    H  16.880 -13.693  -3.751 1.00 . A A .  10 GLN H    1 1 
        2  2057 1 1  10 GLN HA   H  17.895 -12.665  -6.307 1.00 . A A .  10 GLN HA   1 1 
        2  2058 1 1  10 GLN HB2  H  15.211 -14.070  -5.742 1.00 . A A .  10 GLN HB2  1 1 
        2  2059 1 1  10 GLN HB3  H  15.911 -13.789  -7.334 1.00 . A A .  10 GLN HB3  1 1 
        2  2060 1 1  10 GLN HE21 H  14.624 -16.300  -5.862 1.00 . A A .  10 GLN HE21 1 1 
        2  2061 1 1  10 GLN HE22 H  14.814 -17.746  -6.987 1.00 . A A .  10 GLN HE22 1 1 
        2  2062 1 1  10 GLN HG2  H  17.971 -15.154  -6.640 1.00 . A A .  10 GLN HG2  1 1 
        2  2063 1 1  10 GLN HG3  H  17.185 -15.554  -5.134 1.00 . A A .  10 GLN HG3  1 1 
        2  2064 1 1  10 GLN N    N  17.283 -12.928  -4.300 1.00 . A A .  10 GLN N    1 1 
        2  2065 1 1  10 GLN NE2  N  15.137 -16.898  -6.515 1.00 . A A .  10 GLN NE2  1 1 
        2  2066 1 1  10 GLN O    O  15.226 -11.160  -5.157 1.00 . A A .  10 GLN O    1 1 
        2  2067 1 1  10 GLN OE1  O  17.008 -17.235  -7.598 1.00 . A A .  10 GLN OE1  1 1 
        2  2068 1 1  11 PRO C    C  14.083  -9.456  -7.758 1.00 . A A .  11 PRO C    1 1 
        2  2069 1 1  11 PRO CA   C  15.547  -9.338  -7.249 1.00 . A A .  11 PRO CA   1 1 
        2  2070 1 1  11 PRO CB   C  16.506  -8.578  -8.208 1.00 . A A .  11 PRO CB   1 1 
        2  2071 1 1  11 PRO CD   C  17.349 -10.838  -8.080 1.00 . A A .  11 PRO CD   1 1 
        2  2072 1 1  11 PRO CG   C  17.134  -9.690  -9.079 1.00 . A A .  11 PRO CG   1 1 
        2  2073 1 1  11 PRO HA   H  15.537  -8.790  -6.286 1.00 . A A .  11 PRO HA   1 1 
        2  2074 1 1  11 PRO HB2  H  16.008  -7.794  -8.807 1.00 . A A .  11 PRO HB2  1 1 
        2  2075 1 1  11 PRO HB3  H  17.293  -8.075  -7.612 1.00 . A A .  11 PRO HB3  1 1 
        2  2076 1 1  11 PRO HD2  H  17.290 -11.831  -8.565 1.00 . A A .  11 PRO HD2  1 1 
        2  2077 1 1  11 PRO HD3  H  18.342 -10.749  -7.596 1.00 . A A .  11 PRO HD3  1 1 
        2  2078 1 1  11 PRO HG2  H  16.419  -9.997  -9.869 1.00 . A A .  11 PRO HG2  1 1 
        2  2079 1 1  11 PRO HG3  H  18.066  -9.372  -9.577 1.00 . A A .  11 PRO HG3  1 1 
        2  2080 1 1  11 PRO N    N  16.275 -10.644  -7.079 1.00 . A A .  11 PRO N    1 1 
        2  2081 1 1  11 PRO O    O  13.764  -9.160  -8.913 1.00 . A A .  11 PRO O    1 1 
        2  2082 1 1  12 ILE C    C  10.959  -9.791  -5.784 1.00 . A A .  12 ILE C    1 1 
        2  2083 1 1  12 ILE CA   C  11.727  -9.982  -7.123 1.00 . A A .  12 ILE CA   1 1 
        2  2084 1 1  12 ILE CB   C  11.371 -11.273  -7.937 1.00 . A A .  12 ILE CB   1 1 
        2  2085 1 1  12 ILE CD1  C   9.625 -12.081  -9.652 1.00 . A A .  12 ILE CD1  1 1 
        2  2086 1 1  12 ILE CG1  C   9.885 -11.253  -8.394 1.00 . A A .  12 ILE CG1  1 1 
        2  2087 1 1  12 ILE CG2  C  11.719 -12.600  -7.241 1.00 . A A .  12 ILE CG2  1 1 
        2  2088 1 1  12 ILE H    H  13.621 -10.213  -5.986 1.00 . A A .  12 ILE H    1 1 
        2  2089 1 1  12 ILE HA   H  11.451  -9.144  -7.797 1.00 . A A .  12 ILE HA   1 1 
        2  2090 1 1  12 ILE HB   H  11.998 -11.211  -8.854 1.00 . A A .  12 ILE HB   1 1 
        2  2091 1 1  12 ILE HD11 H   9.848 -13.154  -9.515 1.00 . A A .  12 ILE HD11 1 1 
        2  2092 1 1  12 ILE HD12 H   8.567 -12.007  -9.966 1.00 . A A .  12 ILE HD12 1 1 
        2  2093 1 1  12 ILE HD13 H  10.238 -11.718 -10.497 1.00 . A A .  12 ILE HD13 1 1 
        2  2094 1 1  12 ILE HG12 H   9.218 -11.580  -7.571 1.00 . A A .  12 ILE HG12 1 1 
        2  2095 1 1  12 ILE HG13 H   9.565 -10.215  -8.616 1.00 . A A .  12 ILE HG13 1 1 
        2  2096 1 1  12 ILE HG21 H  11.037 -12.834  -6.403 1.00 . A A .  12 ILE HG21 1 1 
        2  2097 1 1  12 ILE HG22 H  11.675 -13.450  -7.946 1.00 . A A .  12 ILE HG22 1 1 
        2  2098 1 1  12 ILE HG23 H  12.740 -12.574  -6.822 1.00 . A A .  12 ILE HG23 1 1 
        2  2099 1 1  12 ILE N    N  13.188  -9.857  -6.848 1.00 . A A .  12 ILE N    1 1 
        2  2100 1 1  12 ILE O    O  10.802 -10.730  -4.999 1.00 . A A .  12 ILE O    1 1 
        2  2101 1 1  13 TYR C    C   8.528  -7.445  -4.485 1.00 . A A .  13 TYR C    1 1 
        2  2102 1 1  13 TYR CA   C   9.866  -8.198  -4.223 1.00 . A A .  13 TYR CA   1 1 
        2  2103 1 1  13 TYR CB   C  10.821  -7.395  -3.291 1.00 . A A .  13 TYR CB   1 1 
        2  2104 1 1  13 TYR CD1  C  12.080  -9.243  -2.034 1.00 . A A .  13 TYR CD1  1 1 
        2  2105 1 1  13 TYR CD2  C  13.313  -7.832  -3.559 1.00 . A A .  13 TYR CD2  1 1 
        2  2106 1 1  13 TYR CE1  C  13.211 -10.046  -1.866 1.00 . A A .  13 TYR CE1  1 1 
        2  2107 1 1  13 TYR CE2  C  14.441  -8.633  -3.385 1.00 . A A .  13 TYR CE2  1 1 
        2  2108 1 1  13 TYR CG   C  12.110  -8.144  -2.910 1.00 . A A .  13 TYR CG   1 1 
        2  2109 1 1  13 TYR CZ   C  14.384  -9.751  -2.556 1.00 . A A .  13 TYR CZ   1 1 
        2  2110 1 1  13 TYR H    H  10.834  -7.849  -6.183 1.00 . A A .  13 TYR H    1 1 
        2  2111 1 1  13 TYR HA   H   9.586  -9.123  -3.681 1.00 . A A .  13 TYR HA   1 1 
        2  2112 1 1  13 TYR HB2  H  11.065  -6.417  -3.750 1.00 . A A .  13 TYR HB2  1 1 
        2  2113 1 1  13 TYR HB3  H  10.281  -7.133  -2.361 1.00 . A A .  13 TYR HB3  1 1 
        2  2114 1 1  13 TYR HD1  H  11.155  -9.527  -1.547 1.00 . A A .  13 TYR HD1  1 1 
        2  2115 1 1  13 TYR HD2  H  13.355  -7.009  -4.262 1.00 . A A .  13 TYR HD2  1 1 
        2  2116 1 1  13 TYR HE1  H  13.153 -10.939  -1.257 1.00 . A A .  13 TYR HE1  1 1 
        2  2117 1 1  13 TYR HE2  H  15.344  -8.422  -3.943 1.00 . A A .  13 TYR HE2  1 1 
        2  2118 1 1  13 TYR HH   H  15.511 -10.894  -3.527 1.00 . A A .  13 TYR HH   1 1 
        2  2119 1 1  13 TYR N    N  10.516  -8.553  -5.516 1.00 . A A .  13 TYR N    1 1 
        2  2120 1 1  13 TYR O    O   8.440  -6.218  -4.391 1.00 . A A .  13 TYR O    1 1 
        2  2121 1 1  13 TYR OH   O  15.403 -10.651  -2.591 1.00 . A A .  13 TYR OH   1 1 
        2  2122 1 1  14 GLN C    C   5.268  -7.314  -3.870 1.00 . A A .  14 GLN C    1 1 
        2  2123 1 1  14 GLN CA   C   6.132  -7.689  -5.101 1.00 . A A .  14 GLN CA   1 1 
        2  2124 1 1  14 GLN CB   C   5.452  -8.598  -6.146 1.00 . A A .  14 GLN CB   1 1 
        2  2125 1 1  14 GLN CD   C   6.015 -11.077  -5.493 1.00 . A A .  14 GLN CD   1 1 
        2  2126 1 1  14 GLN CG   C   4.973  -9.999  -5.743 1.00 . A A .  14 GLN CG   1 1 
        2  2127 1 1  14 GLN H    H   7.731  -9.184  -5.059 1.00 . A A .  14 GLN H    1 1 
        2  2128 1 1  14 GLN HA   H   6.280  -6.738  -5.644 1.00 . A A .  14 GLN HA   1 1 
        2  2129 1 1  14 GLN HB2  H   4.571  -8.056  -6.545 1.00 . A A .  14 GLN HB2  1 1 
        2  2130 1 1  14 GLN HB3  H   6.132  -8.683  -7.018 1.00 . A A .  14 GLN HB3  1 1 
        2  2131 1 1  14 GLN HE21 H   4.656 -12.146  -4.492 1.00 . A A .  14 GLN HE21 1 1 
        2  2132 1 1  14 GLN HE22 H   6.378 -12.799  -4.626 1.00 . A A .  14 GLN HE22 1 1 
        2  2133 1 1  14 GLN HG2  H   4.289  -9.924  -4.879 1.00 . A A .  14 GLN HG2  1 1 
        2  2134 1 1  14 GLN HG3  H   4.322 -10.357  -6.558 1.00 . A A .  14 GLN HG3  1 1 
        2  2135 1 1  14 GLN N    N   7.484  -8.218  -4.802 1.00 . A A .  14 GLN N    1 1 
        2  2136 1 1  14 GLN NE2  N   5.616 -12.177  -4.903 1.00 . A A .  14 GLN NE2  1 1 
        2  2137 1 1  14 GLN O    O   4.734  -6.201  -3.833 1.00 . A A .  14 GLN O    1 1 
        2  2138 1 1  14 GLN OE1  O   7.194 -10.970  -5.820 1.00 . A A .  14 GLN OE1  1 1 
        2  2139 1 1  15 GLY C    C   5.362  -6.974  -0.607 1.00 . A A .  15 GLY C    1 1 
        2  2140 1 1  15 GLY CA   C   4.514  -7.834  -1.559 1.00 . A A .  15 GLY CA   1 1 
        2  2141 1 1  15 GLY H    H   5.544  -9.116  -3.053 1.00 . A A .  15 GLY H    1 1 
        2  2142 1 1  15 GLY HA2  H   3.549  -7.327  -1.748 1.00 . A A .  15 GLY HA2  1 1 
        2  2143 1 1  15 GLY HA3  H   4.236  -8.771  -1.040 1.00 . A A .  15 GLY HA3  1 1 
        2  2144 1 1  15 GLY N    N   5.174  -8.180  -2.844 1.00 . A A .  15 GLY N    1 1 
        2  2145 1 1  15 GLY O    O   5.833  -7.427   0.439 1.00 . A A .  15 GLY O    1 1 
        2  2146 1 1  16 ASN C    C   6.212  -3.307  -0.723 1.00 . A A .  16 ASN C    1 1 
        2  2147 1 1  16 ASN CA   C   6.590  -4.811  -0.497 1.00 . A A .  16 ASN CA   1 1 
        2  2148 1 1  16 ASN CB   C   7.951  -5.191  -1.139 1.00 . A A .  16 ASN CB   1 1 
        2  2149 1 1  16 ASN CG   C   9.169  -4.520  -0.530 1.00 . A A .  16 ASN CG   1 1 
        2  2150 1 1  16 ASN H    H   5.140  -5.590  -1.953 1.00 . A A .  16 ASN H    1 1 
        2  2151 1 1  16 ASN HA   H   6.644  -4.953   0.595 1.00 . A A .  16 ASN HA   1 1 
        2  2152 1 1  16 ASN HB2  H   8.091  -6.290  -1.116 1.00 . A A .  16 ASN HB2  1 1 
        2  2153 1 1  16 ASN HB3  H   7.939  -4.951  -2.218 1.00 . A A .  16 ASN HB3  1 1 
        2  2154 1 1  16 ASN HD21 H   9.502  -6.076   0.683 1.00 . A A .  16 ASN HD21 1 1 
        2  2155 1 1  16 ASN HD22 H  10.644  -4.633   0.757 1.00 . A A .  16 ASN HD22 1 1 
        2  2156 1 1  16 ASN N    N   5.540  -5.718  -1.017 1.00 . A A .  16 ASN N    1 1 
        2  2157 1 1  16 ASN ND2  N   9.812  -5.134   0.434 1.00 . A A .  16 ASN ND2  1 1 
        2  2158 1 1  16 ASN O    O   6.287  -2.530   0.230 1.00 . A A .  16 ASN O    1 1 
        2  2159 1 1  16 ASN OD1  O   9.569  -3.431  -0.922 1.00 . A A .  16 ASN OD1  1 1 
        2  2160 1 1  17 LEU C    C   4.365  -0.853  -1.704 1.00 . A A .  17 LEU C    1 1 
        2  2161 1 1  17 LEU CA   C   5.643  -1.505  -2.349 1.00 . A A .  17 LEU CA   1 1 
        2  2162 1 1  17 LEU CB   C   5.651  -1.369  -3.898 1.00 . A A .  17 LEU CB   1 1 
        2  2163 1 1  17 LEU CD1  C   8.207  -1.711  -4.209 1.00 . A A .  17 LEU CD1  1 1 
        2  2164 1 1  17 LEU CD2  C   6.612  -3.432  -5.099 1.00 . A A .  17 LEU CD2  1 1 
        2  2165 1 1  17 LEU CG   C   6.799  -1.947  -4.756 1.00 . A A .  17 LEU CG   1 1 
        2  2166 1 1  17 LEU H    H   5.896  -3.653  -2.665 1.00 . A A .  17 LEU H    1 1 
        2  2167 1 1  17 LEU HA   H   6.507  -0.921  -1.967 1.00 . A A .  17 LEU HA   1 1 
        2  2168 1 1  17 LEU HB2  H   4.698  -1.740  -4.321 1.00 . A A .  17 LEU HB2  1 1 
        2  2169 1 1  17 LEU HB3  H   5.614  -0.284  -4.122 1.00 . A A .  17 LEU HB3  1 1 
        2  2170 1 1  17 LEU HD11 H   8.417  -0.639  -4.053 1.00 . A A .  17 LEU HD11 1 1 
        2  2171 1 1  17 LEU HD12 H   8.386  -2.218  -3.243 1.00 . A A .  17 LEU HD12 1 1 
        2  2172 1 1  17 LEU HD13 H   8.979  -2.079  -4.910 1.00 . A A .  17 LEU HD13 1 1 
        2  2173 1 1  17 LEU HD21 H   6.771  -4.108  -4.242 1.00 . A A .  17 LEU HD21 1 1 
        2  2174 1 1  17 LEU HD22 H   5.605  -3.647  -5.500 1.00 . A A .  17 LEU HD22 1 1 
        2  2175 1 1  17 LEU HD23 H   7.331  -3.753  -5.875 1.00 . A A .  17 LEU HD23 1 1 
        2  2176 1 1  17 LEU HG   H   6.734  -1.405  -5.726 1.00 . A A .  17 LEU HG   1 1 
        2  2177 1 1  17 LEU N    N   5.831  -2.919  -1.953 1.00 . A A .  17 LEU N    1 1 
        2  2178 1 1  17 LEU O    O   4.495   0.012  -0.837 1.00 . A A .  17 LEU O    1 1 
        2  2179 1 1  18 ILE C    C   1.640  -2.048  -0.292 1.00 . A A .  18 ILE C    1 1 
        2  2180 1 1  18 ILE CA   C   1.883  -0.961  -1.375 1.00 . A A .  18 ILE CA   1 1 
        2  2181 1 1  18 ILE CB   C   0.777  -0.785  -2.465 1.00 . A A .  18 ILE CB   1 1 
        2  2182 1 1  18 ILE CD1  C   0.331   1.822  -2.435 1.00 . A A .  18 ILE CD1  1 1 
        2  2183 1 1  18 ILE CG1  C   0.925   0.612  -3.155 1.00 . A A .  18 ILE CG1  1 1 
        2  2184 1 1  18 ILE CG2  C  -0.670  -1.025  -2.010 1.00 . A A .  18 ILE CG2  1 1 
        2  2185 1 1  18 ILE H    H   3.185  -2.024  -2.811 1.00 . A A .  18 ILE H    1 1 
        2  2186 1 1  18 ILE HA   H   1.984   0.021  -0.866 1.00 . A A .  18 ILE HA   1 1 
        2  2187 1 1  18 ILE HB   H   0.947  -1.540  -3.267 1.00 . A A .  18 ILE HB   1 1 
        2  2188 1 1  18 ILE HD11 H   0.576   2.761  -2.963 1.00 . A A .  18 ILE HD11 1 1 
        2  2189 1 1  18 ILE HD12 H  -0.771   1.778  -2.369 1.00 . A A .  18 ILE HD12 1 1 
        2  2190 1 1  18 ILE HD13 H   0.704   1.928  -1.400 1.00 . A A .  18 ILE HD13 1 1 
        2  2191 1 1  18 ILE HG12 H   1.997   0.809  -3.346 1.00 . A A .  18 ILE HG12 1 1 
        2  2192 1 1  18 ILE HG13 H   0.507   0.535  -4.169 1.00 . A A .  18 ILE HG13 1 1 
        2  2193 1 1  18 ILE HG21 H  -0.827  -2.055  -1.641 1.00 . A A .  18 ILE HG21 1 1 
        2  2194 1 1  18 ILE HG22 H  -0.973  -0.336  -1.207 1.00 . A A .  18 ILE HG22 1 1 
        2  2195 1 1  18 ILE HG23 H  -1.378  -0.900  -2.848 1.00 . A A .  18 ILE HG23 1 1 
        2  2196 1 1  18 ILE N    N   3.160  -1.312  -2.076 1.00 . A A .  18 ILE N    1 1 
        2  2197 1 1  18 ILE O    O   1.260  -3.183  -0.588 1.00 . A A .  18 ILE O    1 1 
        2  2198 1 1  19 LYS C    C   1.639  -2.012   3.389 1.00 . A A .  19 LYS C    1 1 
        2  2199 1 1  19 LYS CA   C   2.096  -2.679   2.067 1.00 . A A .  19 LYS CA   1 1 
        2  2200 1 1  19 LYS CB   C   3.578  -3.117   2.057 1.00 . A A .  19 LYS CB   1 1 
        2  2201 1 1  19 LYS CD   C   3.428  -5.615   2.587 1.00 . A A .  19 LYS CD   1 1 
        2  2202 1 1  19 LYS CE   C   3.900  -6.812   3.429 1.00 . A A .  19 LYS CE   1 1 
        2  2203 1 1  19 LYS CG   C   3.988  -4.249   3.012 1.00 . A A .  19 LYS CG   1 1 
        2  2204 1 1  19 LYS H    H   2.371  -0.762   1.025 1.00 . A A .  19 LYS H    1 1 
        2  2205 1 1  19 LYS HA   H   1.470  -3.567   1.860 1.00 . A A .  19 LYS HA   1 1 
        2  2206 1 1  19 LYS HB2  H   3.847  -3.422   1.024 1.00 . A A .  19 LYS HB2  1 1 
        2  2207 1 1  19 LYS HB3  H   4.220  -2.236   2.255 1.00 . A A .  19 LYS HB3  1 1 
        2  2208 1 1  19 LYS HD2  H   2.323  -5.577   2.646 1.00 . A A .  19 LYS HD2  1 1 
        2  2209 1 1  19 LYS HD3  H   3.630  -5.800   1.512 1.00 . A A .  19 LYS HD3  1 1 
        2  2210 1 1  19 LYS HE2  H   3.746  -6.609   4.513 1.00 . A A .  19 LYS HE2  1 1 
        2  2211 1 1  19 LYS HE3  H   3.228  -7.672   3.204 1.00 . A A .  19 LYS HE3  1 1 
        2  2212 1 1  19 LYS HG2  H   5.096  -4.260   3.015 1.00 . A A .  19 LYS HG2  1 1 
        2  2213 1 1  19 LYS HG3  H   3.693  -3.992   4.048 1.00 . A A .  19 LYS HG3  1 1 
        2  2214 1 1  19 LYS HZ1  H   5.984  -6.450   3.404 1.00 . A A .  19 LYS HZ1  1 1 
        2  2215 1 1  19 LYS HZ2  H   5.625  -8.050   3.576 1.00 . A A .  19 LYS HZ2  1 1 
        2  2216 1 1  19 LYS HZ3  H   5.477  -7.315   2.105 1.00 . A A .  19 LYS HZ3  1 1 
        2  2217 1 1  19 LYS N    N   1.944  -1.692   0.966 1.00 . A A .  19 LYS N    1 1 
        2  2218 1 1  19 LYS NZ   N   5.314  -7.178   3.129 1.00 . A A .  19 LYS NZ   1 1 
        2  2219 1 1  19 LYS O    O   2.364  -1.195   3.966 1.00 . A A .  19 LYS O    1 1 
        2  2220 1 1  20 GLN C    C   0.224  -1.931   6.425 1.00 . A A .  20 GLN C    1 1 
        2  2221 1 1  20 GLN CA   C  -0.260  -1.588   4.966 1.00 . A A .  20 GLN CA   1 1 
        2  2222 1 1  20 GLN CB   C  -1.779  -1.808   4.736 1.00 . A A .  20 GLN CB   1 1 
        2  2223 1 1  20 GLN CD   C  -4.120  -0.787   4.761 1.00 . A A .  20 GLN CD   1 1 
        2  2224 1 1  20 GLN CG   C  -2.691  -0.696   5.306 1.00 . A A .  20 GLN CG   1 1 
        2  2225 1 1  20 GLN H    H  -0.063  -3.076   3.335 1.00 . A A .  20 GLN H    1 1 
        2  2226 1 1  20 GLN HA   H  -0.057  -0.510   4.806 1.00 . A A .  20 GLN HA   1 1 
        2  2227 1 1  20 GLN HB2  H  -1.994  -1.882   3.652 1.00 . A A .  20 GLN HB2  1 1 
        2  2228 1 1  20 GLN HB3  H  -2.095  -2.792   5.137 1.00 . A A .  20 GLN HB3  1 1 
        2  2229 1 1  20 GLN HE21 H  -4.146   1.165   4.270 1.00 . A A .  20 GLN HE21 1 1 
        2  2230 1 1  20 GLN HE22 H  -5.538   0.094   3.726 1.00 . A A .  20 GLN HE22 1 1 
        2  2231 1 1  20 GLN HG2  H  -2.733  -0.763   6.409 1.00 . A A .  20 GLN HG2  1 1 
        2  2232 1 1  20 GLN HG3  H  -2.262   0.301   5.085 1.00 . A A .  20 GLN HG3  1 1 
        2  2233 1 1  20 GLN N    N   0.426  -2.335   3.860 1.00 . A A .  20 GLN N    1 1 
        2  2234 1 1  20 GLN NE2  N  -4.671   0.284   4.244 1.00 . A A .  20 GLN NE2  1 1 
        2  2235 1 1  20 GLN O    O  -0.551  -2.258   7.324 1.00 . A A .  20 GLN O    1 1 
        2  2236 1 1  20 GLN OE1  O  -4.756  -1.837   4.771 1.00 . A A .  20 GLN OE1  1 1 
        2  2237 1 1  21 ASN C    C   3.700  -1.323   7.699 1.00 . A A .  21 ASN C    1 1 
        2  2238 1 1  21 ASN CA   C   2.270  -1.932   7.893 1.00 . A A .  21 ASN CA   1 1 
        2  2239 1 1  21 ASN CB   C   2.258  -3.371   8.440 1.00 . A A .  21 ASN CB   1 1 
        2  2240 1 1  21 ASN CG   C   3.017  -3.636   9.736 1.00 . A A .  21 ASN CG   1 1 
        2  2241 1 1  21 ASN H    H   1.998  -1.535   5.721 1.00 . A A .  21 ASN H    1 1 
        2  2242 1 1  21 ASN HA   H   1.756  -1.286   8.632 1.00 . A A .  21 ASN HA   1 1 
        2  2243 1 1  21 ASN HB2  H   1.212  -3.687   8.606 1.00 . A A .  21 ASN HB2  1 1 
        2  2244 1 1  21 ASN HB3  H   2.639  -4.072   7.675 1.00 . A A .  21 ASN HB3  1 1 
        2  2245 1 1  21 ASN HD21 H   2.304  -2.002  10.710 1.00 . A A .  21 ASN HD21 1 1 
        2  2246 1 1  21 ASN HD22 H   3.398  -3.174  11.593 1.00 . A A .  21 ASN HD22 1 1 
        2  2247 1 1  21 ASN N    N   1.538  -1.799   6.607 1.00 . A A .  21 ASN N    1 1 
        2  2248 1 1  21 ASN ND2  N   2.788  -2.918  10.813 1.00 . A A .  21 ASN ND2  1 1 
        2  2249 1 1  21 ASN O    O   4.048  -0.396   8.425 1.00 . A A .  21 ASN O    1 1 
        2  2250 1 1  21 ASN OD1  O   3.843  -4.540   9.798 1.00 . A A .  21 ASN OD1  1 1 
        2  2251 1 1  22 ALA C    C   5.484   0.447   5.772 1.00 . A A .  22 ALA C    1 1 
        2  2252 1 1  22 ALA CA   C   5.705  -1.027   6.254 1.00 . A A .  22 ALA CA   1 1 
        2  2253 1 1  22 ALA CB   C   6.386  -1.873   5.168 1.00 . A A .  22 ALA CB   1 1 
        2  2254 1 1  22 ALA H    H   4.091  -2.530   6.151 1.00 . A A .  22 ALA H    1 1 
        2  2255 1 1  22 ALA HA   H   6.403  -0.970   7.115 1.00 . A A .  22 ALA HA   1 1 
        2  2256 1 1  22 ALA HB1  H   6.625  -2.889   5.531 1.00 . A A .  22 ALA HB1  1 1 
        2  2257 1 1  22 ALA HB2  H   5.764  -1.978   4.261 1.00 . A A .  22 ALA HB2  1 1 
        2  2258 1 1  22 ALA HB3  H   7.344  -1.423   4.847 1.00 . A A .  22 ALA HB3  1 1 
        2  2259 1 1  22 ALA N    N   4.496  -1.770   6.702 1.00 . A A .  22 ALA N    1 1 
        2  2260 1 1  22 ALA O    O   6.287   1.312   6.120 1.00 . A A .  22 ALA O    1 1 
        2  2261 1 1  23 VAL C    C   3.500   2.970   5.949 1.00 . A A .  23 VAL C    1 1 
        2  2262 1 1  23 VAL CA   C   3.981   2.138   4.707 1.00 . A A .  23 VAL CA   1 1 
        2  2263 1 1  23 VAL CB   C   2.944   2.140   3.536 1.00 . A A .  23 VAL CB   1 1 
        2  2264 1 1  23 VAL CG1  C   2.537   3.571   3.110 1.00 . A A .  23 VAL CG1  1 1 
        2  2265 1 1  23 VAL CG2  C   3.479   1.430   2.268 1.00 . A A .  23 VAL CG2  1 1 
        2  2266 1 1  23 VAL H    H   3.832  -0.075   4.761 1.00 . A A .  23 VAL H    1 1 
        2  2267 1 1  23 VAL HA   H   4.876   2.666   4.335 1.00 . A A .  23 VAL HA   1 1 
        2  2268 1 1  23 VAL HB   H   2.026   1.608   3.861 1.00 . A A .  23 VAL HB   1 1 
        2  2269 1 1  23 VAL HG11 H   1.854   3.563   2.243 1.00 . A A .  23 VAL HG11 1 1 
        2  2270 1 1  23 VAL HG12 H   2.008   4.111   3.919 1.00 . A A .  23 VAL HG12 1 1 
        2  2271 1 1  23 VAL HG13 H   3.410   4.190   2.831 1.00 . A A .  23 VAL HG13 1 1 
        2  2272 1 1  23 VAL HG21 H   2.718   1.413   1.466 1.00 . A A .  23 VAL HG21 1 1 
        2  2273 1 1  23 VAL HG22 H   4.386   1.915   1.862 1.00 . A A .  23 VAL HG22 1 1 
        2  2274 1 1  23 VAL HG23 H   3.750   0.377   2.455 1.00 . A A .  23 VAL HG23 1 1 
        2  2275 1 1  23 VAL N    N   4.398   0.737   5.037 1.00 . A A .  23 VAL N    1 1 
        2  2276 1 1  23 VAL O    O   3.876   4.135   6.075 1.00 . A A .  23 VAL O    1 1 
        2  2277 1 1  24 GLU C    C   3.816   3.195   9.067 1.00 . A A .  24 GLU C    1 1 
        2  2278 1 1  24 GLU CA   C   2.517   2.921   8.241 1.00 . A A .  24 GLU CA   1 1 
        2  2279 1 1  24 GLU CB   C   1.470   1.958   8.846 1.00 . A A .  24 GLU CB   1 1 
        2  2280 1 1  24 GLU CD   C   1.999   0.986  11.164 1.00 . A A .  24 GLU CD   1 1 
        2  2281 1 1  24 GLU CG   C   1.188   1.992  10.354 1.00 . A A .  24 GLU CG   1 1 
        2  2282 1 1  24 GLU H    H   2.521   1.399   6.660 1.00 . A A .  24 GLU H    1 1 
        2  2283 1 1  24 GLU HA   H   2.019   3.903   8.128 1.00 . A A .  24 GLU HA   1 1 
        2  2284 1 1  24 GLU HB2  H   0.516   2.158   8.316 1.00 . A A .  24 GLU HB2  1 1 
        2  2285 1 1  24 GLU HB3  H   1.692   0.909   8.571 1.00 . A A .  24 GLU HB3  1 1 
        2  2286 1 1  24 GLU HG2  H   1.325   2.995  10.793 1.00 . A A .  24 GLU HG2  1 1 
        2  2287 1 1  24 GLU HG3  H   0.130   1.732  10.532 1.00 . A A .  24 GLU HG3  1 1 
        2  2288 1 1  24 GLU N    N   2.716   2.384   6.858 1.00 . A A .  24 GLU N    1 1 
        2  2289 1 1  24 GLU O    O   3.958   4.286   9.623 1.00 . A A .  24 GLU O    1 1 
        2  2290 1 1  24 GLU OE1  O   1.851  -0.238  10.943 1.00 . A A .  24 GLU OE1  1 1 
        2  2291 1 1  24 GLU OE2  O   2.780   1.416  12.035 1.00 . A A .  24 GLU OE2  1 1 
        2  2292 1 1  25 GLN C    C   7.151   3.308   9.185 1.00 . A A .  25 GLN C    1 1 
        2  2293 1 1  25 GLN CA   C   6.047   2.397   9.829 1.00 . A A .  25 GLN CA   1 1 
        2  2294 1 1  25 GLN CB   C   6.644   0.978  10.070 1.00 . A A .  25 GLN CB   1 1 
        2  2295 1 1  25 GLN CD   C   6.154   0.467  12.553 1.00 . A A .  25 GLN CD   1 1 
        2  2296 1 1  25 GLN CG   C   5.904   0.096  11.099 1.00 . A A .  25 GLN CG   1 1 
        2  2297 1 1  25 GLN H    H   4.466   1.356   8.684 1.00 . A A .  25 GLN H    1 1 
        2  2298 1 1  25 GLN HA   H   5.837   2.845  10.821 1.00 . A A .  25 GLN HA   1 1 
        2  2299 1 1  25 GLN HB2  H   6.689   0.435   9.106 1.00 . A A .  25 GLN HB2  1 1 
        2  2300 1 1  25 GLN HB3  H   7.703   1.060  10.390 1.00 . A A .  25 GLN HB3  1 1 
        2  2301 1 1  25 GLN HE21 H   4.285   1.200  12.741 1.00 . A A .  25 GLN HE21 1 1 
        2  2302 1 1  25 GLN HE22 H   5.427   1.253  14.207 1.00 . A A .  25 GLN HE22 1 1 
        2  2303 1 1  25 GLN HG2  H   4.819   0.052  10.880 1.00 . A A .  25 GLN HG2  1 1 
        2  2304 1 1  25 GLN HG3  H   6.247  -0.946  10.965 1.00 . A A .  25 GLN HG3  1 1 
        2  2305 1 1  25 GLN N    N   4.768   2.253   9.091 1.00 . A A .  25 GLN N    1 1 
        2  2306 1 1  25 GLN NE2  N   5.205   1.065  13.228 1.00 . A A .  25 GLN NE2  1 1 
        2  2307 1 1  25 GLN O    O   7.980   3.814   9.943 1.00 . A A .  25 GLN O    1 1 
        2  2308 1 1  25 GLN OE1  O   7.216   0.210  13.111 1.00 . A A .  25 GLN OE1  1 1 
        2  2309 1 1  26 LEU C    C   8.773   5.614   7.618 1.00 . A A .  26 LEU C    1 1 
        2  2310 1 1  26 LEU CA   C   8.344   4.185   7.170 1.00 . A A .  26 LEU CA   1 1 
        2  2311 1 1  26 LEU CB   C   8.272   4.009   5.627 1.00 . A A .  26 LEU CB   1 1 
        2  2312 1 1  26 LEU CD1  C   7.125   6.109   4.632 1.00 . A A .  26 LEU CD1  1 1 
        2  2313 1 1  26 LEU CD2  C   7.057   3.958   3.418 1.00 . A A .  26 LEU CD2  1 1 
        2  2314 1 1  26 LEU CG   C   7.094   4.594   4.828 1.00 . A A .  26 LEU CG   1 1 
        2  2315 1 1  26 LEU H    H   6.543   2.893   7.331 1.00 . A A .  26 LEU H    1 1 
        2  2316 1 1  26 LEU HA   H   9.228   3.570   7.438 1.00 . A A .  26 LEU HA   1 1 
        2  2317 1 1  26 LEU HB2  H   9.229   4.353   5.190 1.00 . A A .  26 LEU HB2  1 1 
        2  2318 1 1  26 LEU HB3  H   8.286   2.913   5.457 1.00 . A A .  26 LEU HB3  1 1 
        2  2319 1 1  26 LEU HD11 H   8.026   6.447   4.091 1.00 . A A .  26 LEU HD11 1 1 
        2  2320 1 1  26 LEU HD12 H   6.247   6.454   4.053 1.00 . A A .  26 LEU HD12 1 1 
        2  2321 1 1  26 LEU HD13 H   7.083   6.656   5.583 1.00 . A A .  26 LEU HD13 1 1 
        2  2322 1 1  26 LEU HD21 H   7.950   4.214   2.820 1.00 . A A .  26 LEU HD21 1 1 
        2  2323 1 1  26 LEU HD22 H   6.995   2.856   3.458 1.00 . A A .  26 LEU HD22 1 1 
        2  2324 1 1  26 LEU HD23 H   6.171   4.295   2.847 1.00 . A A .  26 LEU HD23 1 1 
        2  2325 1 1  26 LEU HG   H   6.152   4.333   5.343 1.00 . A A .  26 LEU HG   1 1 
        2  2326 1 1  26 LEU N    N   7.200   3.499   7.849 1.00 . A A .  26 LEU N    1 1 
        2  2327 1 1  26 LEU O    O   9.958   5.932   7.499 1.00 . A A .  26 LEU O    1 1 
        2  2328 1 1  27 GLN C    C   9.082   8.758   8.021 1.00 . A A .  27 GLN C    1 1 
        2  2329 1 1  27 GLN CA   C   8.169   7.750   8.799 1.00 . A A .  27 GLN CA   1 1 
        2  2330 1 1  27 GLN CB   C   8.564   7.441  10.266 1.00 . A A .  27 GLN CB   1 1 
        2  2331 1 1  27 GLN CD   C   7.465   9.505  11.410 1.00 . A A .  27 GLN CD   1 1 
        2  2332 1 1  27 GLN CG   C   8.687   8.617  11.253 1.00 . A A .  27 GLN CG   1 1 
        2  2333 1 1  27 GLN H    H   6.958   5.954   8.294 1.00 . A A .  27 GLN H    1 1 
        2  2334 1 1  27 GLN HA   H   7.193   8.269   8.861 1.00 . A A .  27 GLN HA   1 1 
        2  2335 1 1  27 GLN HB2  H   7.826   6.725  10.686 1.00 . A A .  27 GLN HB2  1 1 
        2  2336 1 1  27 GLN HB3  H   9.523   6.885  10.278 1.00 . A A .  27 GLN HB3  1 1 
        2  2337 1 1  27 GLN HE21 H   8.216  10.828  10.117 1.00 . A A .  27 GLN HE21 1 1 
        2  2338 1 1  27 GLN HE22 H   6.572  11.179  10.879 1.00 . A A .  27 GLN HE22 1 1 
        2  2339 1 1  27 GLN HG2  H   8.913   8.188  12.248 1.00 . A A .  27 GLN HG2  1 1 
        2  2340 1 1  27 GLN HG3  H   9.583   9.224  11.024 1.00 . A A .  27 GLN HG3  1 1 
        2  2341 1 1  27 GLN N    N   7.847   6.444   8.134 1.00 . A A .  27 GLN N    1 1 
        2  2342 1 1  27 GLN NE2  N   7.423  10.629  10.733 1.00 . A A .  27 GLN NE2  1 1 
        2  2343 1 1  27 GLN O    O  10.005   9.362   8.572 1.00 . A A .  27 GLN O    1 1 
        2  2344 1 1  27 GLN OE1  O   6.531   9.207  12.144 1.00 . A A .  27 GLN OE1  1 1 
        2  2345 1 1  28 VAL C    C   8.819  11.320   5.908 1.00 . A A .  28 VAL C    1 1 
        2  2346 1 1  28 VAL CA   C   9.513   9.920   5.859 1.00 . A A .  28 VAL CA   1 1 
        2  2347 1 1  28 VAL CB   C   9.590   9.329   4.408 1.00 . A A .  28 VAL CB   1 1 
        2  2348 1 1  28 VAL CG1  C  10.223  10.297   3.380 1.00 . A A .  28 VAL CG1  1 1 
        2  2349 1 1  28 VAL CG2  C  10.429   8.026   4.351 1.00 . A A .  28 VAL CG2  1 1 
        2  2350 1 1  28 VAL H    H   8.093   8.298   6.374 1.00 . A A .  28 VAL H    1 1 
        2  2351 1 1  28 VAL HA   H  10.558  10.013   6.227 1.00 . A A .  28 VAL HA   1 1 
        2  2352 1 1  28 VAL HB   H   8.563   9.092   4.058 1.00 . A A .  28 VAL HB   1 1 
        2  2353 1 1  28 VAL HG11 H   9.589  11.185   3.210 1.00 . A A .  28 VAL HG11 1 1 
        2  2354 1 1  28 VAL HG12 H  11.217  10.658   3.703 1.00 . A A .  28 VAL HG12 1 1 
        2  2355 1 1  28 VAL HG13 H  10.344   9.818   2.389 1.00 . A A .  28 VAL HG13 1 1 
        2  2356 1 1  28 VAL HG21 H  11.498   8.204   4.574 1.00 . A A .  28 VAL HG21 1 1 
        2  2357 1 1  28 VAL HG22 H  10.082   7.266   5.075 1.00 . A A .  28 VAL HG22 1 1 
        2  2358 1 1  28 VAL HG23 H  10.370   7.548   3.355 1.00 . A A .  28 VAL HG23 1 1 
        2  2359 1 1  28 VAL N    N   8.760   8.983   6.741 1.00 . A A .  28 VAL N    1 1 
        2  2360 1 1  28 VAL O    O   7.638  11.442   5.576 1.00 . A A .  28 VAL O    1 1 
        2  2361 1 1  29 GLY C    C  10.101  14.674   5.376 1.00 . A A .  29 GLY C    1 1 
        2  2362 1 1  29 GLY CA   C   9.135  13.772   6.169 1.00 . A A .  29 GLY CA   1 1 
        2  2363 1 1  29 GLY H    H  10.562  12.113   6.446 1.00 . A A .  29 GLY H    1 1 
        2  2364 1 1  29 GLY HA2  H   8.124  13.873   5.740 1.00 . A A .  29 GLY HA2  1 1 
        2  2365 1 1  29 GLY HA3  H   9.038  14.188   7.189 1.00 . A A .  29 GLY HA3  1 1 
        2  2366 1 1  29 GLY N    N   9.583  12.358   6.273 1.00 . A A .  29 GLY N    1 1 
        2  2367 1 1  29 GLY O    O  10.559  15.691   5.893 1.00 . A A .  29 GLY O    1 1 
        2  2368 1 1  30 GLN C    C  11.406  14.847   1.846 1.00 . A A .  30 GLN C    1 1 
        2  2369 1 1  30 GLN CA   C  11.598  14.816   3.395 1.00 . A A .  30 GLN CA   1 1 
        2  2370 1 1  30 GLN CB   C  12.856  14.021   3.843 1.00 . A A .  30 GLN CB   1 1 
        2  2371 1 1  30 GLN CD   C  14.675  14.499   2.049 1.00 . A A .  30 GLN CD   1 1 
        2  2372 1 1  30 GLN CG   C  14.223  14.645   3.493 1.00 . A A .  30 GLN CG   1 1 
        2  2373 1 1  30 GLN H    H  10.068  13.326   3.963 1.00 . A A .  30 GLN H    1 1 
        2  2374 1 1  30 GLN HA   H  11.740  15.876   3.696 1.00 . A A .  30 GLN HA   1 1 
        2  2375 1 1  30 GLN HB2  H  12.837  13.935   4.949 1.00 . A A .  30 GLN HB2  1 1 
        2  2376 1 1  30 GLN HB3  H  12.806  12.974   3.485 1.00 . A A .  30 GLN HB3  1 1 
        2  2377 1 1  30 GLN HE21 H  15.310  16.388   1.999 1.00 . A A .  30 GLN HE21 1 1 
        2  2378 1 1  30 GLN HE22 H  15.476  15.372   0.477 1.00 . A A .  30 GLN HE22 1 1 
        2  2379 1 1  30 GLN HG2  H  14.241  15.703   3.820 1.00 . A A .  30 GLN HG2  1 1 
        2  2380 1 1  30 GLN HG3  H  14.988  14.147   4.118 1.00 . A A .  30 GLN HG3  1 1 
        2  2381 1 1  30 GLN N    N  10.421  14.272   4.134 1.00 . A A .  30 GLN N    1 1 
        2  2382 1 1  30 GLN NE2  N  15.265  15.514   1.469 1.00 . A A .  30 GLN NE2  1 1 
        2  2383 1 1  30 GLN O    O  11.700  15.886   1.252 1.00 . A A .  30 GLN O    1 1 
        2  2384 1 1  30 GLN OE1  O  14.495  13.467   1.409 1.00 . A A .  30 GLN OE1  1 1 
        2  2385 1 1  31 SER C    C   9.482  13.111  -0.746 1.00 . A A .  31 SER C    1 1 
        2  2386 1 1  31 SER CA   C  10.864  13.669  -0.276 1.00 . A A .  31 SER CA   1 1 
        2  2387 1 1  31 SER CB   C  11.986  12.751  -0.834 1.00 . A A .  31 SER CB   1 1 
        2  2388 1 1  31 SER H    H  10.658  12.988   1.810 1.00 . A A .  31 SER H    1 1 
        2  2389 1 1  31 SER HA   H  11.003  14.669  -0.727 1.00 . A A .  31 SER HA   1 1 
        2  2390 1 1  31 SER HB2  H  12.009  11.786  -0.295 1.00 . A A .  31 SER HB2  1 1 
        2  2391 1 1  31 SER HB3  H  11.775  12.514  -1.895 1.00 . A A .  31 SER HB3  1 1 
        2  2392 1 1  31 SER HG   H  13.553  13.439   0.143 1.00 . A A .  31 SER HG   1 1 
        2  2393 1 1  31 SER N    N  10.977  13.746   1.202 1.00 . A A .  31 SER N    1 1 
        2  2394 1 1  31 SER O    O   8.968  12.134  -0.193 1.00 . A A .  31 SER O    1 1 
        2  2395 1 1  31 SER OG   O  13.268  13.373  -0.793 1.00 . A A .  31 SER OG   1 1 
        2  2396 1 1  32 LYS C    C   8.265  11.989  -3.595 1.00 . A A .  32 LYS C    1 1 
        2  2397 1 1  32 LYS CA   C   7.835  13.109  -2.608 1.00 . A A .  32 LYS CA   1 1 
        2  2398 1 1  32 LYS CB   C   6.930  14.188  -3.261 1.00 . A A .  32 LYS CB   1 1 
        2  2399 1 1  32 LYS CD   C   6.373  15.240  -5.555 1.00 . A A .  32 LYS CD   1 1 
        2  2400 1 1  32 LYS CE   C   5.660  16.590  -5.434 1.00 . A A .  32 LYS CE   1 1 
        2  2401 1 1  32 LYS CG   C   7.441  14.957  -4.486 1.00 . A A .  32 LYS CG   1 1 
        2  2402 1 1  32 LYS H    H   9.619  14.349  -2.299 1.00 . A A .  32 LYS H    1 1 
        2  2403 1 1  32 LYS HA   H   7.168  12.614  -1.877 1.00 . A A .  32 LYS HA   1 1 
        2  2404 1 1  32 LYS HB2  H   5.980  13.672  -3.506 1.00 . A A .  32 LYS HB2  1 1 
        2  2405 1 1  32 LYS HB3  H   6.644  14.915  -2.476 1.00 . A A .  32 LYS HB3  1 1 
        2  2406 1 1  32 LYS HD2  H   6.896  15.249  -6.536 1.00 . A A .  32 LYS HD2  1 1 
        2  2407 1 1  32 LYS HD3  H   5.656  14.403  -5.657 1.00 . A A .  32 LYS HD3  1 1 
        2  2408 1 1  32 LYS HE2  H   6.426  17.395  -5.367 1.00 . A A .  32 LYS HE2  1 1 
        2  2409 1 1  32 LYS HE3  H   5.124  16.793  -6.383 1.00 . A A .  32 LYS HE3  1 1 
        2  2410 1 1  32 LYS HG2  H   7.948  15.890  -4.177 1.00 . A A .  32 LYS HG2  1 1 
        2  2411 1 1  32 LYS HG3  H   8.255  14.422  -5.005 1.00 . A A .  32 LYS HG3  1 1 
        2  2412 1 1  32 LYS HZ1  H   4.330  17.627  -4.160 1.00 . A A .  32 LYS HZ1  1 1 
        2  2413 1 1  32 LYS HZ2  H   3.936  16.014  -4.312 1.00 . A A .  32 LYS HZ2  1 1 
        2  2414 1 1  32 LYS HZ3  H   5.225  16.513  -3.397 1.00 . A A .  32 LYS HZ3  1 1 
        2  2415 1 1  32 LYS N    N   8.951  13.697  -1.833 1.00 . A A .  32 LYS N    1 1 
        2  2416 1 1  32 LYS NZ   N   4.727  16.666  -4.284 1.00 . A A .  32 LYS NZ   1 1 
        2  2417 1 1  32 LYS O    O   7.633  10.933  -3.626 1.00 . A A .  32 LYS O    1 1 
        2  2418 1 1  33 GLN C    C  10.422   9.919  -4.862 1.00 . A A .  33 GLN C    1 1 
        2  2419 1 1  33 GLN CA   C   9.820  11.246  -5.392 1.00 . A A .  33 GLN CA   1 1 
        2  2420 1 1  33 GLN CB   C  10.727  11.999  -6.396 1.00 . A A .  33 GLN CB   1 1 
        2  2421 1 1  33 GLN CD   C  12.758  13.484  -6.851 1.00 . A A .  33 GLN CD   1 1 
        2  2422 1 1  33 GLN CG   C  12.041  12.594  -5.845 1.00 . A A .  33 GLN CG   1 1 
        2  2423 1 1  33 GLN H    H   9.808  13.110  -4.196 1.00 . A A .  33 GLN H    1 1 
        2  2424 1 1  33 GLN HA   H   8.933  10.931  -5.982 1.00 . A A .  33 GLN HA   1 1 
        2  2425 1 1  33 GLN HB2  H  10.962  11.325  -7.244 1.00 . A A .  33 GLN HB2  1 1 
        2  2426 1 1  33 GLN HB3  H  10.119  12.809  -6.851 1.00 . A A .  33 GLN HB3  1 1 
        2  2427 1 1  33 GLN HE21 H  11.751  15.120  -6.216 1.00 . A A .  33 GLN HE21 1 1 
        2  2428 1 1  33 GLN HE22 H  12.995  15.300  -7.575 1.00 . A A .  33 GLN HE22 1 1 
        2  2429 1 1  33 GLN HG2  H  11.868  13.167  -4.914 1.00 . A A .  33 GLN HG2  1 1 
        2  2430 1 1  33 GLN HG3  H  12.731  11.782  -5.550 1.00 . A A .  33 GLN HG3  1 1 
        2  2431 1 1  33 GLN N    N   9.330  12.213  -4.380 1.00 . A A .  33 GLN N    1 1 
        2  2432 1 1  33 GLN NE2  N  12.469  14.764  -6.882 1.00 . A A .  33 GLN NE2  1 1 
        2  2433 1 1  33 GLN O    O  10.264   8.896  -5.527 1.00 . A A .  33 GLN O    1 1 
        2  2434 1 1  33 GLN OE1  O  13.596  13.036  -7.626 1.00 . A A .  33 GLN OE1  1 1 
        2  2435 1 1  34 GLN C    C  10.152   7.842  -2.465 1.00 . A A .  34 GLN C    1 1 
        2  2436 1 1  34 GLN CA   C  11.393   8.653  -2.963 1.00 . A A .  34 GLN CA   1 1 
        2  2437 1 1  34 GLN CB   C  12.380   8.932  -1.802 1.00 . A A .  34 GLN CB   1 1 
        2  2438 1 1  34 GLN CD   C  14.739   9.619  -1.089 1.00 . A A .  34 GLN CD   1 1 
        2  2439 1 1  34 GLN CG   C  13.766   9.446  -2.249 1.00 . A A .  34 GLN CG   1 1 
        2  2440 1 1  34 GLN H    H  10.988  10.819  -3.193 1.00 . A A .  34 GLN H    1 1 
        2  2441 1 1  34 GLN HA   H  11.904   7.990  -3.692 1.00 . A A .  34 GLN HA   1 1 
        2  2442 1 1  34 GLN HB2  H  11.923   9.636  -1.081 1.00 . A A .  34 GLN HB2  1 1 
        2  2443 1 1  34 GLN HB3  H  12.525   7.993  -1.230 1.00 . A A .  34 GLN HB3  1 1 
        2  2444 1 1  34 GLN HE21 H  14.408  11.596  -1.012 1.00 . A A .  34 GLN HE21 1 1 
        2  2445 1 1  34 GLN HE22 H  15.595  10.852   0.181 1.00 . A A .  34 GLN HE22 1 1 
        2  2446 1 1  34 GLN HG2  H  14.219   8.729  -2.959 1.00 . A A .  34 GLN HG2  1 1 
        2  2447 1 1  34 GLN HG3  H  13.672  10.389  -2.820 1.00 . A A .  34 GLN HG3  1 1 
        2  2448 1 1  34 GLN N    N  11.030   9.910  -3.663 1.00 . A A .  34 GLN N    1 1 
        2  2449 1 1  34 GLN NE2  N  14.957  10.822  -0.618 1.00 . A A .  34 GLN NE2  1 1 
        2  2450 1 1  34 GLN O    O  10.024   6.681  -2.853 1.00 . A A .  34 GLN O    1 1 
        2  2451 1 1  34 GLN OE1  O  15.325   8.664  -0.591 1.00 . A A .  34 GLN OE1  1 1 
        2  2452 1 1  35 VAL C    C   7.024   7.315  -2.432 1.00 . A A .  35 VAL C    1 1 
        2  2453 1 1  35 VAL CA   C   7.972   7.732  -1.263 1.00 . A A .  35 VAL CA   1 1 
        2  2454 1 1  35 VAL CB   C   7.297   8.512  -0.092 1.00 . A A .  35 VAL CB   1 1 
        2  2455 1 1  35 VAL CG1  C   6.572   9.805  -0.489 1.00 . A A .  35 VAL CG1  1 1 
        2  2456 1 1  35 VAL CG2  C   6.313   7.630   0.704 1.00 . A A .  35 VAL CG2  1 1 
        2  2457 1 1  35 VAL H    H   9.344   9.442  -1.549 1.00 . A A .  35 VAL H    1 1 
        2  2458 1 1  35 VAL HA   H   8.308   6.772  -0.820 1.00 . A A .  35 VAL HA   1 1 
        2  2459 1 1  35 VAL HB   H   8.100   8.791   0.626 1.00 . A A .  35 VAL HB   1 1 
        2  2460 1 1  35 VAL HG11 H   7.229  10.482  -1.056 1.00 . A A .  35 VAL HG11 1 1 
        2  2461 1 1  35 VAL HG12 H   5.688   9.623  -1.124 1.00 . A A .  35 VAL HG12 1 1 
        2  2462 1 1  35 VAL HG13 H   6.233  10.367   0.401 1.00 . A A .  35 VAL HG13 1 1 
        2  2463 1 1  35 VAL HG21 H   6.796   6.710   1.081 1.00 . A A .  35 VAL HG21 1 1 
        2  2464 1 1  35 VAL HG22 H   5.916   8.167   1.587 1.00 . A A .  35 VAL HG22 1 1 
        2  2465 1 1  35 VAL HG23 H   5.447   7.319   0.095 1.00 . A A .  35 VAL HG23 1 1 
        2  2466 1 1  35 VAL N    N   9.230   8.431  -1.677 1.00 . A A .  35 VAL N    1 1 
        2  2467 1 1  35 VAL O    O   6.537   6.184  -2.426 1.00 . A A .  35 VAL O    1 1 
        2  2468 1 1  36 SER C    C   6.683   6.777  -5.614 1.00 . A A .  36 SER C    1 1 
        2  2469 1 1  36 SER CA   C   6.033   7.819  -4.659 1.00 . A A .  36 SER CA   1 1 
        2  2470 1 1  36 SER CB   C   5.675   9.145  -5.377 1.00 . A A .  36 SER CB   1 1 
        2  2471 1 1  36 SER H    H   7.329   9.066  -3.358 1.00 . A A .  36 SER H    1 1 
        2  2472 1 1  36 SER HA   H   5.092   7.342  -4.316 1.00 . A A .  36 SER HA   1 1 
        2  2473 1 1  36 SER HB2  H   5.414   9.922  -4.630 1.00 . A A .  36 SER HB2  1 1 
        2  2474 1 1  36 SER HB3  H   6.549   9.550  -5.926 1.00 . A A .  36 SER HB3  1 1 
        2  2475 1 1  36 SER HG   H   4.787   8.403  -6.983 1.00 . A A .  36 SER HG   1 1 
        2  2476 1 1  36 SER N    N   6.812   8.174  -3.441 1.00 . A A .  36 SER N    1 1 
        2  2477 1 1  36 SER O    O   5.949   5.955  -6.165 1.00 . A A .  36 SER O    1 1 
        2  2478 1 1  36 SER OG   O   4.555   9.014  -6.247 1.00 . A A .  36 SER OG   1 1 
        2  2479 1 1  37 ALA C    C   8.706   4.265  -5.560 1.00 . A A .  37 ALA C    1 1 
        2  2480 1 1  37 ALA CA   C   8.718   5.591  -6.390 1.00 . A A .  37 ALA CA   1 1 
        2  2481 1 1  37 ALA CB   C  10.155   6.031  -6.703 1.00 . A A .  37 ALA CB   1 1 
        2  2482 1 1  37 ALA H    H   8.532   7.490  -5.284 1.00 . A A .  37 ALA H    1 1 
        2  2483 1 1  37 ALA HA   H   8.216   5.361  -7.353 1.00 . A A .  37 ALA HA   1 1 
        2  2484 1 1  37 ALA HB1  H  10.717   5.250  -7.245 1.00 . A A .  37 ALA HB1  1 1 
        2  2485 1 1  37 ALA HB2  H  10.183   6.939  -7.332 1.00 . A A .  37 ALA HB2  1 1 
        2  2486 1 1  37 ALA HB3  H  10.727   6.265  -5.785 1.00 . A A .  37 ALA HB3  1 1 
        2  2487 1 1  37 ALA N    N   8.017   6.748  -5.775 1.00 . A A .  37 ALA N    1 1 
        2  2488 1 1  37 ALA O    O   8.440   3.210  -6.139 1.00 . A A .  37 ALA O    1 1 
        2  2489 1 1  38 LEU C    C   7.377   2.551  -3.188 1.00 . A A .  38 LEU C    1 1 
        2  2490 1 1  38 LEU CA   C   8.822   3.135  -3.338 1.00 . A A .  38 LEU CA   1 1 
        2  2491 1 1  38 LEU CB   C   9.431   3.457  -1.945 1.00 . A A .  38 LEU CB   1 1 
        2  2492 1 1  38 LEU CD1  C  11.882   3.907  -2.650 1.00 . A A .  38 LEU CD1  1 1 
        2  2493 1 1  38 LEU CD2  C  11.316   3.352  -0.286 1.00 . A A .  38 LEU CD2  1 1 
        2  2494 1 1  38 LEU CG   C  10.927   3.110  -1.760 1.00 . A A .  38 LEU CG   1 1 
        2  2495 1 1  38 LEU H    H   9.147   5.265  -3.880 1.00 . A A .  38 LEU H    1 1 
        2  2496 1 1  38 LEU HA   H   9.398   2.308  -3.794 1.00 . A A .  38 LEU HA   1 1 
        2  2497 1 1  38 LEU HB2  H   9.235   4.510  -1.664 1.00 . A A .  38 LEU HB2  1 1 
        2  2498 1 1  38 LEU HB3  H   8.887   2.877  -1.171 1.00 . A A .  38 LEU HB3  1 1 
        2  2499 1 1  38 LEU HD11 H  11.678   3.760  -3.725 1.00 . A A .  38 LEU HD11 1 1 
        2  2500 1 1  38 LEU HD12 H  11.830   4.994  -2.458 1.00 . A A .  38 LEU HD12 1 1 
        2  2501 1 1  38 LEU HD13 H  12.932   3.602  -2.488 1.00 . A A .  38 LEU HD13 1 1 
        2  2502 1 1  38 LEU HD21 H  12.369   3.076  -0.091 1.00 . A A .  38 LEU HD21 1 1 
        2  2503 1 1  38 LEU HD22 H  11.196   4.412   0.005 1.00 . A A .  38 LEU HD22 1 1 
        2  2504 1 1  38 LEU HD23 H  10.701   2.749   0.407 1.00 . A A .  38 LEU HD23 1 1 
        2  2505 1 1  38 LEU HG   H  11.064   2.029  -1.969 1.00 . A A .  38 LEU HG   1 1 
        2  2506 1 1  38 LEU N    N   8.952   4.318  -4.238 1.00 . A A .  38 LEU N    1 1 
        2  2507 1 1  38 LEU O    O   7.236   1.331  -3.128 1.00 . A A .  38 LEU O    1 1 
        2  2508 1 1  39 LEU C    C   4.574   2.447  -4.807 1.00 . A A .  39 LEU C    1 1 
        2  2509 1 1  39 LEU CA   C   4.930   2.929  -3.356 1.00 . A A .  39 LEU CA   1 1 
        2  2510 1 1  39 LEU CB   C   4.003   4.104  -2.937 1.00 . A A .  39 LEU CB   1 1 
        2  2511 1 1  39 LEU CD1  C   3.346   5.752  -1.139 1.00 . A A .  39 LEU CD1  1 1 
        2  2512 1 1  39 LEU CD2  C   3.181   3.336  -0.640 1.00 . A A .  39 LEU CD2  1 1 
        2  2513 1 1  39 LEU CG   C   3.975   4.384  -1.418 1.00 . A A .  39 LEU CG   1 1 
        2  2514 1 1  39 LEU H    H   6.569   4.379  -3.042 1.00 . A A .  39 LEU H    1 1 
        2  2515 1 1  39 LEU HA   H   4.738   2.060  -2.696 1.00 . A A .  39 LEU HA   1 1 
        2  2516 1 1  39 LEU HB2  H   4.328   5.016  -3.480 1.00 . A A .  39 LEU HB2  1 1 
        2  2517 1 1  39 LEU HB3  H   2.972   3.930  -3.296 1.00 . A A .  39 LEU HB3  1 1 
        2  2518 1 1  39 LEU HD11 H   3.916   6.575  -1.608 1.00 . A A .  39 LEU HD11 1 1 
        2  2519 1 1  39 LEU HD12 H   2.301   5.811  -1.501 1.00 . A A .  39 LEU HD12 1 1 
        2  2520 1 1  39 LEU HD13 H   3.317   5.954  -0.055 1.00 . A A .  39 LEU HD13 1 1 
        2  2521 1 1  39 LEU HD21 H   2.093   3.452  -0.778 1.00 . A A .  39 LEU HD21 1 1 
        2  2522 1 1  39 LEU HD22 H   3.438   2.298  -0.909 1.00 . A A .  39 LEU HD22 1 1 
        2  2523 1 1  39 LEU HD23 H   3.377   3.425   0.440 1.00 . A A .  39 LEU HD23 1 1 
        2  2524 1 1  39 LEU HG   H   5.013   4.408  -1.026 1.00 . A A .  39 LEU HG   1 1 
        2  2525 1 1  39 LEU N    N   6.333   3.382  -3.158 1.00 . A A .  39 LEU N    1 1 
        2  2526 1 1  39 LEU O    O   3.832   1.474  -4.953 1.00 . A A .  39 LEU O    1 1 
        2  2527 1 1  40 GLY C    C   3.825   3.652  -7.956 1.00 . A A .  40 GLY C    1 1 
        2  2528 1 1  40 GLY CA   C   4.856   2.763  -7.254 1.00 . A A .  40 GLY CA   1 1 
        2  2529 1 1  40 GLY H    H   5.713   3.890  -5.546 1.00 . A A .  40 GLY H    1 1 
        2  2530 1 1  40 GLY HA2  H   5.818   2.825  -7.798 1.00 . A A .  40 GLY HA2  1 1 
        2  2531 1 1  40 GLY HA3  H   4.549   1.704  -7.355 1.00 . A A .  40 GLY HA3  1 1 
        2  2532 1 1  40 GLY N    N   5.087   3.126  -5.840 1.00 . A A .  40 GLY N    1 1 
        2  2533 1 1  40 GLY O    O   2.720   3.201  -8.268 1.00 . A A .  40 GLY O    1 1 
        2  2534 1 1  41 THR C    C   4.087   7.153  -9.278 1.00 . A A .  41 THR C    1 1 
        2  2535 1 1  41 THR CA   C   3.243   5.918  -8.809 1.00 . A A .  41 THR CA   1 1 
        2  2536 1 1  41 THR CB   C   2.110   6.359  -7.827 1.00 . A A .  41 THR CB   1 1 
        2  2537 1 1  41 THR CG2  C   1.110   7.360  -8.398 1.00 . A A .  41 THR CG2  1 1 
        2  2538 1 1  41 THR H    H   4.992   5.228  -7.636 1.00 . A A .  41 THR H    1 1 
        2  2539 1 1  41 THR HA   H   2.762   5.437  -9.681 1.00 . A A .  41 THR HA   1 1 
        2  2540 1 1  41 THR HB   H   2.573   6.791  -6.916 1.00 . A A .  41 THR HB   1 1 
        2  2541 1 1  41 THR HG1  H   1.845   4.447  -7.715 1.00 . A A .  41 THR HG1  1 1 
        2  2542 1 1  41 THR HG21 H   0.552   6.961  -9.262 1.00 . A A .  41 THR HG21 1 1 
        2  2543 1 1  41 THR HG22 H   0.354   7.626  -7.638 1.00 . A A .  41 THR HG22 1 1 
        2  2544 1 1  41 THR HG23 H   1.576   8.306  -8.720 1.00 . A A .  41 THR HG23 1 1 
        2  2545 1 1  41 THR N    N   4.164   4.928  -8.179 1.00 . A A .  41 THR N    1 1 
        2  2546 1 1  41 THR O    O   4.712   7.788  -8.417 1.00 . A A .  41 THR O    1 1 
        2  2547 1 1  41 THR OG1  O   1.328   5.230  -7.443 1.00 . A A .  41 THR OG1  1 1 
        2  2548 1 1  42 PRO C    C   3.644  10.084 -10.675 1.00 . A A .  42 PRO C    1 1 
        2  2549 1 1  42 PRO CA   C   4.646   8.928 -10.962 1.00 . A A .  42 PRO CA   1 1 
        2  2550 1 1  42 PRO CB   C   4.946   8.683 -12.463 1.00 . A A .  42 PRO CB   1 1 
        2  2551 1 1  42 PRO CD   C   3.573   6.814 -11.716 1.00 . A A .  42 PRO CD   1 1 
        2  2552 1 1  42 PRO CG   C   3.823   7.727 -12.930 1.00 . A A .  42 PRO CG   1 1 
        2  2553 1 1  42 PRO HA   H   5.605   9.119 -10.437 1.00 . A A .  42 PRO HA   1 1 
        2  2554 1 1  42 PRO HB2  H   4.992   9.610 -13.062 1.00 . A A .  42 PRO HB2  1 1 
        2  2555 1 1  42 PRO HB3  H   5.931   8.184 -12.560 1.00 . A A .  42 PRO HB3  1 1 
        2  2556 1 1  42 PRO HD2  H   2.496   6.579 -11.612 1.00 . A A .  42 PRO HD2  1 1 
        2  2557 1 1  42 PRO HD3  H   4.129   5.861 -11.812 1.00 . A A .  42 PRO HD3  1 1 
        2  2558 1 1  42 PRO HG2  H   2.910   8.315 -13.149 1.00 . A A .  42 PRO HG2  1 1 
        2  2559 1 1  42 PRO HG3  H   4.087   7.167 -13.844 1.00 . A A .  42 PRO HG3  1 1 
        2  2560 1 1  42 PRO N    N   4.083   7.593 -10.566 1.00 . A A .  42 PRO N    1 1 
        2  2561 1 1  42 PRO O    O   2.865  10.501 -11.536 1.00 . A A .  42 PRO O    1 1 
        2  2562 1 1  43 SER C    C   2.393  12.805  -9.330 1.00 . A A .  43 SER C    1 1 
        2  2563 1 1  43 SER CA   C   2.500  11.332  -8.868 1.00 . A A .  43 SER CA   1 1 
        2  2564 1 1  43 SER CB   C   2.422  11.129  -7.332 1.00 . A A .  43 SER CB   1 1 
        2  2565 1 1  43 SER H    H   4.252  10.010  -8.802 1.00 . A A .  43 SER H    1 1 
        2  2566 1 1  43 SER HA   H   1.572  10.851  -9.237 1.00 . A A .  43 SER HA   1 1 
        2  2567 1 1  43 SER HB2  H   1.596  11.737  -6.918 1.00 . A A .  43 SER HB2  1 1 
        2  2568 1 1  43 SER HB3  H   2.141  10.077  -7.122 1.00 . A A .  43 SER HB3  1 1 
        2  2569 1 1  43 SER HG   H   4.026  10.580  -6.383 1.00 . A A .  43 SER HG   1 1 
        2  2570 1 1  43 SER N    N   3.636  10.550  -9.417 1.00 . A A .  43 SER N    1 1 
        2  2571 1 1  43 SER O    O   1.485  13.118 -10.107 1.00 . A A .  43 SER O    1 1 
        2  2572 1 1  43 SER OG   O   3.633  11.438  -6.635 1.00 . A A .  43 SER OG   1 1 
        2  2573 1 1  44 ILE C    C   4.698  15.575  -9.554 1.00 . A A .  44 ILE C    1 1 
        2  2574 1 1  44 ILE CA   C   3.224  15.149  -9.210 1.00 . A A .  44 ILE CA   1 1 
        2  2575 1 1  44 ILE CB   C   2.549  16.044  -8.101 1.00 . A A .  44 ILE CB   1 1 
        2  2576 1 1  44 ILE CD1  C   0.449  16.283  -6.598 1.00 . A A .  44 ILE CD1  1 1 
        2  2577 1 1  44 ILE CG1  C   1.070  15.641  -7.836 1.00 . A A .  44 ILE CG1  1 1 
        2  2578 1 1  44 ILE CG2  C   2.571  17.541  -8.513 1.00 . A A .  44 ILE CG2  1 1 
        2  2579 1 1  44 ILE H    H   3.939  13.296  -8.188 1.00 . A A .  44 ILE H    1 1 
        2  2580 1 1  44 ILE HA   H   2.624  15.299 -10.129 1.00 . A A .  44 ILE HA   1 1 
        2  2581 1 1  44 ILE HB   H   3.109  15.921  -7.155 1.00 . A A .  44 ILE HB   1 1 
        2  2582 1 1  44 ILE HD11 H   0.369  17.383  -6.666 1.00 . A A .  44 ILE HD11 1 1 
        2  2583 1 1  44 ILE HD12 H  -0.578  15.908  -6.447 1.00 . A A .  44 ILE HD12 1 1 
        2  2584 1 1  44 ILE HD13 H   1.021  16.054  -5.682 1.00 . A A .  44 ILE HD13 1 1 
        2  2585 1 1  44 ILE HG12 H   0.445  15.854  -8.725 1.00 . A A .  44 ILE HG12 1 1 
        2  2586 1 1  44 ILE HG13 H   0.990  14.547  -7.691 1.00 . A A .  44 ILE HG13 1 1 
        2  2587 1 1  44 ILE HG21 H   3.591  17.918  -8.706 1.00 . A A .  44 ILE HG21 1 1 
        2  2588 1 1  44 ILE HG22 H   1.983  17.716  -9.432 1.00 . A A .  44 ILE HG22 1 1 
        2  2589 1 1  44 ILE HG23 H   2.156  18.195  -7.725 1.00 . A A .  44 ILE HG23 1 1 
        2  2590 1 1  44 ILE N    N   3.261  13.703  -8.841 1.00 . A A .  44 ILE N    1 1 
        2  2591 1 1  44 ILE O    O   5.424  15.968  -8.635 1.00 . A A .  44 ILE O    1 1 
        2  2592 1 1  45 PRO C    C   6.707  17.511 -11.423 1.00 . A A .  45 PRO C    1 1 
        2  2593 1 1  45 PRO CA   C   6.571  15.982 -11.170 1.00 . A A .  45 PRO CA   1 1 
        2  2594 1 1  45 PRO CB   C   6.863  15.082 -12.401 1.00 . A A .  45 PRO CB   1 1 
        2  2595 1 1  45 PRO CD   C   4.486  14.868 -11.950 1.00 . A A .  45 PRO CD   1 1 
        2  2596 1 1  45 PRO CG   C   5.496  14.932 -13.108 1.00 . A A .  45 PRO CG   1 1 
        2  2597 1 1  45 PRO HA   H   7.274  15.688 -10.363 1.00 . A A .  45 PRO HA   1 1 
        2  2598 1 1  45 PRO HB2  H   7.647  15.484 -13.068 1.00 . A A .  45 PRO HB2  1 1 
        2  2599 1 1  45 PRO HB3  H   7.216  14.092 -12.049 1.00 . A A .  45 PRO HB3  1 1 
        2  2600 1 1  45 PRO HD2  H   3.536  15.370 -12.212 1.00 . A A .  45 PRO HD2  1 1 
        2  2601 1 1  45 PRO HD3  H   4.250  13.821 -11.677 1.00 . A A .  45 PRO HD3  1 1 
        2  2602 1 1  45 PRO HG2  H   5.300  15.827 -13.731 1.00 . A A .  45 PRO HG2  1 1 
        2  2603 1 1  45 PRO HG3  H   5.448  14.049 -13.768 1.00 . A A .  45 PRO HG3  1 1 
        2  2604 1 1  45 PRO N    N   5.175  15.548 -10.829 1.00 . A A .  45 PRO N    1 1 
        2  2605 1 1  45 PRO O    O   6.783  17.969 -12.567 1.00 . A A .  45 PRO O    1 1 
        2  2606 1 1  46 ASP C    C   8.009  20.238  -9.349 1.00 . A A .  46 ASP C    1 1 
        2  2607 1 1  46 ASP CA   C   6.911  19.761 -10.371 1.00 . A A .  46 ASP CA   1 1 
        2  2608 1 1  46 ASP CB   C   5.523  20.419 -10.162 1.00 . A A .  46 ASP CB   1 1 
        2  2609 1 1  46 ASP CG   C   5.536  21.944 -10.030 1.00 . A A .  46 ASP CG   1 1 
        2  2610 1 1  46 ASP H    H   6.601  17.780  -9.452 1.00 . A A .  46 ASP H    1 1 
        2  2611 1 1  46 ASP HA   H   7.218  20.060 -11.391 1.00 . A A .  46 ASP HA   1 1 
        2  2612 1 1  46 ASP HB2  H   4.882  20.171 -11.028 1.00 . A A .  46 ASP HB2  1 1 
        2  2613 1 1  46 ASP HB3  H   4.995  19.991  -9.295 1.00 . A A .  46 ASP HB3  1 1 
        2  2614 1 1  46 ASP N    N   6.760  18.284 -10.329 1.00 . A A .  46 ASP N    1 1 
        2  2615 1 1  46 ASP O    O   7.924  19.895  -8.163 1.00 . A A .  46 ASP O    1 1 
        2  2616 1 1  46 ASP OD1  O   6.171  22.613 -10.873 1.00 . A A .  46 ASP OD1  1 1 
        2  2617 1 1  46 ASP OD2  O   4.971  22.482  -9.052 1.00 . A A .  46 ASP OD2  1 1 
        2  2618 1 1  47 PRO C    C   9.247  23.235  -8.251 1.00 . A A .  47 PRO C    1 1 
        2  2619 1 1  47 PRO CA   C   9.816  21.870  -8.758 1.00 . A A .  47 PRO CA   1 1 
        2  2620 1 1  47 PRO CB   C  11.116  22.069  -9.592 1.00 . A A .  47 PRO CB   1 1 
        2  2621 1 1  47 PRO CD   C   9.398  21.318 -11.140 1.00 . A A .  47 PRO CD   1 1 
        2  2622 1 1  47 PRO CG   C  10.605  22.267 -11.041 1.00 . A A .  47 PRO CG   1 1 
        2  2623 1 1  47 PRO HA   H  10.045  21.260  -7.863 1.00 . A A .  47 PRO HA   1 1 
        2  2624 1 1  47 PRO HB2  H  11.746  22.906  -9.240 1.00 . A A .  47 PRO HB2  1 1 
        2  2625 1 1  47 PRO HB3  H  11.734  21.151  -9.530 1.00 . A A .  47 PRO HB3  1 1 
        2  2626 1 1  47 PRO HD2  H   8.569  21.769 -11.720 1.00 . A A .  47 PRO HD2  1 1 
        2  2627 1 1  47 PRO HD3  H   9.675  20.360 -11.622 1.00 . A A .  47 PRO HD3  1 1 
        2  2628 1 1  47 PRO HG2  H  10.270  23.314 -11.180 1.00 . A A .  47 PRO HG2  1 1 
        2  2629 1 1  47 PRO HG3  H  11.377  22.059 -11.801 1.00 . A A .  47 PRO HG3  1 1 
        2  2630 1 1  47 PRO N    N   9.002  21.080  -9.733 1.00 . A A .  47 PRO N    1 1 
        2  2631 1 1  47 PRO O    O   9.881  23.826  -7.374 1.00 . A A .  47 PRO O    1 1 
        2  2632 1 1  48 PHE C    C   6.817  25.126  -7.087 1.00 . A A .  48 PHE C    1 1 
        2  2633 1 1  48 PHE CA   C   7.604  25.101  -8.427 1.00 . A A .  48 PHE CA   1 1 
        2  2634 1 1  48 PHE CB   C   6.834  25.638  -9.661 1.00 . A A .  48 PHE CB   1 1 
        2  2635 1 1  48 PHE CD1  C   7.297  28.145  -9.860 1.00 . A A .  48 PHE CD1  1 1 
        2  2636 1 1  48 PHE CD2  C   5.096  27.440  -9.155 1.00 . A A .  48 PHE CD2  1 1 
        2  2637 1 1  48 PHE CE1  C   6.902  29.480  -9.752 1.00 . A A .  48 PHE CE1  1 1 
        2  2638 1 1  48 PHE CE2  C   4.703  28.775  -9.045 1.00 . A A .  48 PHE CE2  1 1 
        2  2639 1 1  48 PHE CG   C   6.399  27.108  -9.560 1.00 . A A .  48 PHE CG   1 1 
        2  2640 1 1  48 PHE CZ   C   5.606  29.792  -9.344 1.00 . A A .  48 PHE CZ   1 1 
        2  2641 1 1  48 PHE H    H   7.635  23.143  -9.463 1.00 . A A .  48 PHE H    1 1 
        2  2642 1 1  48 PHE HA   H   8.476  25.773  -8.285 1.00 . A A .  48 PHE HA   1 1 
        2  2643 1 1  48 PHE HB2  H   7.466  25.520 -10.564 1.00 . A A .  48 PHE HB2  1 1 
        2  2644 1 1  48 PHE HB3  H   5.953  24.998  -9.872 1.00 . A A .  48 PHE HB3  1 1 
        2  2645 1 1  48 PHE HD1  H   8.309  27.916 -10.172 1.00 . A A .  48 PHE HD1  1 1 
        2  2646 1 1  48 PHE HD2  H   4.388  26.656  -8.911 1.00 . A A .  48 PHE HD2  1 1 
        2  2647 1 1  48 PHE HE1  H   7.606  30.271  -9.982 1.00 . A A .  48 PHE HE1  1 1 
        2  2648 1 1  48 PHE HE2  H   3.697  29.015  -8.726 1.00 . A A .  48 PHE HE2  1 1 
        2  2649 1 1  48 PHE HZ   H   5.302  30.828  -9.258 1.00 . A A .  48 PHE HZ   1 1 
        2  2650 1 1  48 PHE N    N   8.124  23.753  -8.784 1.00 . A A .  48 PHE N    1 1 
        2  2651 1 1  48 PHE O    O   7.312  25.721  -6.126 1.00 . A A .  48 PHE O    1 1 
        2  2652 1 1  49 HIS C    C   3.982  23.132  -5.745 1.00 . A A .  49 HIS C    1 1 
        2  2653 1 1  49 HIS CA   C   4.871  24.410  -5.717 1.00 . A A .  49 HIS CA   1 1 
        2  2654 1 1  49 HIS CB   C   4.102  25.718  -5.434 1.00 . A A .  49 HIS CB   1 1 
        2  2655 1 1  49 HIS CD2  C   3.706  25.113  -2.834 1.00 . A A .  49 HIS CD2  1 1 
        2  2656 1 1  49 HIS CE1  C   2.361  26.667  -2.418 1.00 . A A .  49 HIS CE1  1 1 
        2  2657 1 1  49 HIS CG   C   3.499  25.876  -4.019 1.00 . A A .  49 HIS CG   1 1 
        2  2658 1 1  49 HIS H    H   5.389  23.923  -7.823 1.00 . A A .  49 HIS H    1 1 
        2  2659 1 1  49 HIS HA   H   5.618  24.265  -4.906 1.00 . A A .  49 HIS HA   1 1 
        2  2660 1 1  49 HIS HB2  H   4.788  26.576  -5.582 1.00 . A A .  49 HIS HB2  1 1 
        2  2661 1 1  49 HIS HB3  H   3.302  25.851  -6.189 1.00 . A A .  49 HIS HB3  1 1 
        2  2662 1 1  49 HIS HD1  H   2.277  27.648  -4.355 1.00 . A A .  49 HIS HD1  1 1 
        2  2663 1 1  49 HIS HD2  H   4.338  24.239  -2.753 1.00 . A A .  49 HIS HD2  1 1 
        2  2664 1 1  49 HIS HE1  H   1.680  27.303  -1.869 1.00 . A A .  49 HIS HE1  1 1 
        2  2665 1 1  49 HIS N    N   5.608  24.534  -7.011 1.00 . A A .  49 HIS N    1 1 
        2  2666 1 1  49 HIS ND1  N   2.618  26.902  -3.741 1.00 . A A .  49 HIS ND1  1 1 
        2  2667 1 1  49 HIS NE2  N   2.963  25.615  -1.780 1.00 . A A .  49 HIS NE2  1 1 
        2  2668 1 1  49 HIS O    O   2.752  23.183  -5.875 1.00 . A A .  49 HIS O    1 1 
        2  2669 1 1  50 ALA C    C   3.374  20.003  -4.714 1.00 . A A .  50 ALA C    1 1 
        2  2670 1 1  50 ALA CA   C   4.040  20.673  -5.934 1.00 . A A .  50 ALA CA   1 1 
        2  2671 1 1  50 ALA CB   C   5.207  19.870  -6.510 1.00 . A A .  50 ALA CB   1 1 
        2  2672 1 1  50 ALA H    H   5.668  22.096  -5.696 1.00 . A A .  50 ALA H    1 1 
        2  2673 1 1  50 ALA HA   H   3.308  20.790  -6.763 1.00 . A A .  50 ALA HA   1 1 
        2  2674 1 1  50 ALA HB1  H   5.727  20.444  -7.299 1.00 . A A .  50 ALA HB1  1 1 
        2  2675 1 1  50 ALA HB2  H   5.972  19.612  -5.759 1.00 . A A .  50 ALA HB2  1 1 
        2  2676 1 1  50 ALA HB3  H   4.864  18.944  -6.987 1.00 . A A .  50 ALA HB3  1 1 
        2  2677 1 1  50 ALA N    N   4.642  21.979  -5.606 1.00 . A A .  50 ALA N    1 1 
        2  2678 1 1  50 ALA O    O   3.994  19.266  -3.942 1.00 . A A .  50 ALA O    1 1 
        2  2679 1 1  51 GLN C    C   0.866  18.541  -3.157 1.00 . A A .  51 GLN C    1 1 
        2  2680 1 1  51 GLN CA   C   1.364  20.019  -3.273 1.00 . A A .  51 GLN CA   1 1 
        2  2681 1 1  51 GLN CB   C   0.309  21.159  -3.170 1.00 . A A .  51 GLN CB   1 1 
        2  2682 1 1  51 GLN CD   C   0.059  23.712  -3.290 1.00 . A A .  51 GLN CD   1 1 
        2  2683 1 1  51 GLN CG   C   0.934  22.547  -2.858 1.00 . A A .  51 GLN CG   1 1 
        2  2684 1 1  51 GLN H    H   1.767  21.018  -5.192 1.00 . A A .  51 GLN H    1 1 
        2  2685 1 1  51 GLN HA   H   2.060  20.144  -2.420 1.00 . A A .  51 GLN HA   1 1 
        2  2686 1 1  51 GLN HB2  H  -0.303  21.191  -4.094 1.00 . A A .  51 GLN HB2  1 1 
        2  2687 1 1  51 GLN HB3  H  -0.422  20.967  -2.362 1.00 . A A .  51 GLN HB3  1 1 
        2  2688 1 1  51 GLN HE21 H   1.104  23.902  -4.978 1.00 . A A .  51 GLN HE21 1 1 
        2  2689 1 1  51 GLN HE22 H  -0.280  25.076  -4.659 1.00 . A A .  51 GLN HE22 1 1 
        2  2690 1 1  51 GLN HG2  H   1.122  22.628  -1.771 1.00 . A A .  51 GLN HG2  1 1 
        2  2691 1 1  51 GLN HG3  H   1.942  22.658  -3.304 1.00 . A A .  51 GLN HG3  1 1 
        2  2692 1 1  51 GLN N    N   2.081  20.278  -4.554 1.00 . A A .  51 GLN N    1 1 
        2  2693 1 1  51 GLN NE2  N   0.266  24.231  -4.478 1.00 . A A .  51 GLN NE2  1 1 
        2  2694 1 1  51 GLN O    O   1.529  17.609  -3.623 1.00 . A A .  51 GLN O    1 1 
        2  2695 1 1  51 GLN OE1  O  -0.822  24.169  -2.571 1.00 . A A .  51 GLN OE1  1 1 
        2  2696 1 1  52 ARG C    C  -1.126  16.008  -3.243 1.00 . A A .  52 ARG C    1 1 
        2  2697 1 1  52 ARG CA   C  -0.737  16.973  -2.074 1.00 . A A .  52 ARG CA   1 1 
        2  2698 1 1  52 ARG CB   C  -1.891  17.165  -1.050 1.00 . A A .  52 ARG CB   1 1 
        2  2699 1 1  52 ARG CD   C  -3.527  18.697  -2.403 1.00 . A A .  52 ARG CD   1 1 
        2  2700 1 1  52 ARG CG   C  -3.314  17.438  -1.549 1.00 . A A .  52 ARG CG   1 1 
        2  2701 1 1  52 ARG CZ   C  -5.298  17.901  -3.978 1.00 . A A .  52 ARG CZ   1 1 
        2  2702 1 1  52 ARG H    H  -0.591  19.171  -1.997 1.00 . A A .  52 ARG H    1 1 
        2  2703 1 1  52 ARG HA   H   0.094  16.512  -1.492 1.00 . A A .  52 ARG HA   1 1 
        2  2704 1 1  52 ARG HB2  H  -1.968  16.226  -0.464 1.00 . A A .  52 ARG HB2  1 1 
        2  2705 1 1  52 ARG HB3  H  -1.601  17.919  -0.291 1.00 . A A .  52 ARG HB3  1 1 
        2  2706 1 1  52 ARG HD2  H  -3.387  19.606  -1.784 1.00 . A A .  52 ARG HD2  1 1 
        2  2707 1 1  52 ARG HD3  H  -2.773  18.788  -3.209 1.00 . A A .  52 ARG HD3  1 1 
        2  2708 1 1  52 ARG HE   H  -5.670  19.180  -2.520 1.00 . A A .  52 ARG HE   1 1 
        2  2709 1 1  52 ARG HG2  H  -3.654  16.534  -2.095 1.00 . A A .  52 ARG HG2  1 1 
        2  2710 1 1  52 ARG HG3  H  -3.974  17.469  -0.662 1.00 . A A .  52 ARG HG3  1 1 
        2  2711 1 1  52 ARG HH11 H  -3.484  17.252  -4.471 1.00 . A A .  52 ARG HH11 1 1 
        2  2712 1 1  52 ARG HH12 H  -4.902  16.426  -5.288 1.00 . A A .  52 ARG HH12 1 1 
        2  2713 1 1  52 ARG HH21 H  -7.206  18.272  -3.557 1.00 . A A .  52 ARG HH21 1 1 
        2  2714 1 1  52 ARG HH22 H  -6.844  16.906  -4.713 1.00 . A A .  52 ARG HH22 1 1 
        2  2715 1 1  52 ARG N    N  -0.245  18.321  -2.448 1.00 . A A .  52 ARG N    1 1 
        2  2716 1 1  52 ARG NE   N  -4.896  18.702  -2.989 1.00 . A A .  52 ARG NE   1 1 
        2  2717 1 1  52 ARG NH1  N  -4.478  17.204  -4.728 1.00 . A A .  52 ARG NH1  1 1 
        2  2718 1 1  52 ARG NH2  N  -6.577  17.767  -4.179 1.00 . A A .  52 ARG NH2  1 1 
        2  2719 1 1  52 ARG O    O  -1.745  16.414  -4.229 1.00 . A A .  52 ARG O    1 1 
        2  2720 1 1  53 TRP C    C  -2.463  12.934  -3.467 1.00 . A A .  53 TRP C    1 1 
        2  2721 1 1  53 TRP CA   C  -1.173  13.618  -3.993 1.00 . A A .  53 TRP CA   1 1 
        2  2722 1 1  53 TRP CB   C   0.078  12.704  -4.034 1.00 . A A .  53 TRP CB   1 1 
        2  2723 1 1  53 TRP CD1  C  -0.995  10.638  -5.371 1.00 . A A .  53 TRP CD1  1 1 
        2  2724 1 1  53 TRP CD2  C   0.876  10.173  -4.259 1.00 . A A .  53 TRP CD2  1 1 
        2  2725 1 1  53 TRP CE2  C   0.346   8.987  -4.834 1.00 . A A .  53 TRP CE2  1 1 
        2  2726 1 1  53 TRP CE3  C   2.094  10.110  -3.506 1.00 . A A .  53 TRP CE3  1 1 
        2  2727 1 1  53 TRP CG   C   0.005  11.235  -4.561 1.00 . A A .  53 TRP CG   1 1 
        2  2728 1 1  53 TRP CH2  C   2.170   7.707  -3.880 1.00 . A A .  53 TRP CH2  1 1 
        2  2729 1 1  53 TRP CZ2  C   1.000   7.740  -4.631 1.00 . A A .  53 TRP CZ2  1 1 
        2  2730 1 1  53 TRP CZ3  C   2.710   8.878  -3.319 1.00 . A A .  53 TRP CZ3  1 1 
        2  2731 1 1  53 TRP H    H  -0.595  14.521  -2.062 1.00 . A A .  53 TRP H    1 1 
        2  2732 1 1  53 TRP HA   H  -1.341  14.013  -5.017 1.00 . A A .  53 TRP HA   1 1 
        2  2733 1 1  53 TRP HB2  H   0.874  13.227  -4.599 1.00 . A A .  53 TRP HB2  1 1 
        2  2734 1 1  53 TRP HB3  H   0.463  12.596  -3.004 1.00 . A A .  53 TRP HB3  1 1 
        2  2735 1 1  53 TRP HD1  H  -1.841  11.160  -5.787 1.00 . A A .  53 TRP HD1  1 1 
        2  2736 1 1  53 TRP HE1  H  -1.419   8.577  -5.994 1.00 . A A .  53 TRP HE1  1 1 
        2  2737 1 1  53 TRP HE3  H   2.518  10.999  -3.064 1.00 . A A .  53 TRP HE3  1 1 
        2  2738 1 1  53 TRP HH2  H   2.675   6.764  -3.717 1.00 . A A .  53 TRP HH2  1 1 
        2  2739 1 1  53 TRP HZ2  H   0.603   6.830  -5.063 1.00 . A A .  53 TRP HZ2  1 1 
        2  2740 1 1  53 TRP HZ3  H   3.621   8.809  -2.736 1.00 . A A .  53 TRP HZ3  1 1 
        2  2741 1 1  53 TRP N    N  -0.805  14.726  -3.056 1.00 . A A .  53 TRP N    1 1 
        2  2742 1 1  53 TRP NE1  N  -0.805   9.257  -5.534 1.00 . A A .  53 TRP NE1  1 1 
        2  2743 1 1  53 TRP O    O  -2.416  12.265  -2.435 1.00 . A A .  53 TRP O    1 1 
        2  2744 1 1  54 ASP C    C  -5.554  11.460  -4.658 1.00 . A A .  54 ASP C    1 1 
        2  2745 1 1  54 ASP CA   C  -4.921  12.574  -3.758 1.00 . A A .  54 ASP CA   1 1 
        2  2746 1 1  54 ASP CB   C  -5.844  13.814  -3.608 1.00 . A A .  54 ASP CB   1 1 
        2  2747 1 1  54 ASP CG   C  -6.200  14.619  -4.859 1.00 . A A .  54 ASP CG   1 1 
        2  2748 1 1  54 ASP H    H  -3.568  13.825  -4.901 1.00 . A A .  54 ASP H    1 1 
        2  2749 1 1  54 ASP HA   H  -4.855  12.130  -2.749 1.00 . A A .  54 ASP HA   1 1 
        2  2750 1 1  54 ASP HB2  H  -6.790  13.499  -3.134 1.00 . A A .  54 ASP HB2  1 1 
        2  2751 1 1  54 ASP HB3  H  -5.389  14.513  -2.883 1.00 . A A .  54 ASP HB3  1 1 
        2  2752 1 1  54 ASP N    N  -3.584  13.091  -4.182 1.00 . A A .  54 ASP N    1 1 
        2  2753 1 1  54 ASP O    O  -6.774  11.419  -4.851 1.00 . A A .  54 ASP O    1 1 
        2  2754 1 1  54 ASP OD1  O  -5.328  14.822  -5.733 1.00 . A A .  54 ASP OD1  1 1 
        2  2755 1 1  54 ASP OD2  O  -7.291  15.224  -4.897 1.00 . A A .  54 ASP OD2  1 1 
        2  2756 1 1  55 TYR C    C  -5.856   8.428  -6.036 1.00 . A A .  55 TYR C    1 1 
        2  2757 1 1  55 TYR CA   C  -5.173   9.781  -6.417 1.00 . A A .  55 TYR CA   1 1 
        2  2758 1 1  55 TYR CB   C  -3.992   9.522  -7.384 1.00 . A A .  55 TYR CB   1 1 
        2  2759 1 1  55 TYR CD1  C  -3.629  12.076  -7.906 1.00 . A A .  55 TYR CD1  1 1 
        2  2760 1 1  55 TYR CD2  C  -2.143  10.417  -8.833 1.00 . A A .  55 TYR CD2  1 1 
        2  2761 1 1  55 TYR CE1  C  -2.853  13.088  -8.476 1.00 . A A .  55 TYR CE1  1 1 
        2  2762 1 1  55 TYR CE2  C  -1.376  11.433  -9.413 1.00 . A A .  55 TYR CE2  1 1 
        2  2763 1 1  55 TYR CG   C  -3.271  10.715  -8.059 1.00 . A A .  55 TYR CG   1 1 
        2  2764 1 1  55 TYR CZ   C  -1.724  12.767  -9.223 1.00 . A A .  55 TYR CZ   1 1 
        2  2765 1 1  55 TYR H    H  -3.792  10.566  -4.853 1.00 . A A .  55 TYR H    1 1 
        2  2766 1 1  55 TYR HA   H  -5.902  10.396  -6.991 1.00 . A A .  55 TYR HA   1 1 
        2  2767 1 1  55 TYR HB2  H  -3.239   8.898  -6.866 1.00 . A A .  55 TYR HB2  1 1 
        2  2768 1 1  55 TYR HB3  H  -4.362   8.875  -8.205 1.00 . A A .  55 TYR HB3  1 1 
        2  2769 1 1  55 TYR HD1  H  -4.492  12.372  -7.321 1.00 . A A .  55 TYR HD1  1 1 
        2  2770 1 1  55 TYR HD2  H  -1.835   9.389  -8.981 1.00 . A A .  55 TYR HD2  1 1 
        2  2771 1 1  55 TYR HE1  H  -3.131  14.124  -8.326 1.00 . A A .  55 TYR HE1  1 1 
        2  2772 1 1  55 TYR HE2  H  -0.522  11.171 -10.022 1.00 . A A .  55 TYR HE2  1 1 
        2  2773 1 1  55 TYR HH   H  -0.073  13.429  -9.980 1.00 . A A .  55 TYR HH   1 1 
        2  2774 1 1  55 TYR N    N  -4.754  10.538  -5.209 1.00 . A A .  55 TYR N    1 1 
        2  2775 1 1  55 TYR O    O  -5.247   7.560  -5.405 1.00 . A A .  55 TYR O    1 1 
        2  2776 1 1  55 TYR OH   O  -0.964  13.764  -9.761 1.00 . A A .  55 TYR OH   1 1 
        2  2777 1 1  56 THR C    C  -7.636   6.193  -7.739 1.00 . A A .  56 THR C    1 1 
        2  2778 1 1  56 THR CA   C  -7.840   6.968  -6.409 1.00 . A A .  56 THR CA   1 1 
        2  2779 1 1  56 THR CB   C  -9.332   7.260  -6.094 1.00 . A A .  56 THR CB   1 1 
        2  2780 1 1  56 THR CG2  C -10.221   6.024  -6.000 1.00 . A A .  56 THR CG2  1 1 
        2  2781 1 1  56 THR H    H  -7.474   9.069  -7.001 1.00 . A A .  56 THR H    1 1 
        2  2782 1 1  56 THR HA   H  -7.456   6.357  -5.571 1.00 . A A .  56 THR HA   1 1 
        2  2783 1 1  56 THR HB   H  -9.754   7.932  -6.870 1.00 . A A .  56 THR HB   1 1 
        2  2784 1 1  56 THR HG1  H  -8.775   8.615  -4.840 1.00 . A A .  56 THR HG1  1 1 
        2  2785 1 1  56 THR HG21 H -11.266   6.311  -5.782 1.00 . A A .  56 THR HG21 1 1 
        2  2786 1 1  56 THR HG22 H -10.232   5.442  -6.936 1.00 . A A .  56 THR HG22 1 1 
        2  2787 1 1  56 THR HG23 H  -9.908   5.331  -5.202 1.00 . A A .  56 THR HG23 1 1 
        2  2788 1 1  56 THR N    N  -7.111   8.267  -6.474 1.00 . A A .  56 THR N    1 1 
        2  2789 1 1  56 THR O    O  -7.986   6.676  -8.822 1.00 . A A .  56 THR O    1 1 
        2  2790 1 1  56 THR OG1  O  -9.429   7.908  -4.826 1.00 . A A .  56 THR OG1  1 1 
        2  2791 1 1  57 SER C    C  -6.678   2.652  -8.511 1.00 . A A .  57 SER C    1 1 
        2  2792 1 1  57 SER CA   C  -6.789   4.158  -8.873 1.00 . A A .  57 SER CA   1 1 
        2  2793 1 1  57 SER CB   C  -5.497   4.657  -9.552 1.00 . A A .  57 SER CB   1 1 
        2  2794 1 1  57 SER H    H  -6.478   4.854  -6.811 1.00 . A A .  57 SER H    1 1 
        2  2795 1 1  57 SER HA   H  -7.629   4.282  -9.588 1.00 . A A .  57 SER HA   1 1 
        2  2796 1 1  57 SER HB2  H  -4.678   4.743  -8.812 1.00 . A A .  57 SER HB2  1 1 
        2  2797 1 1  57 SER HB3  H  -5.154   3.932 -10.307 1.00 . A A .  57 SER HB3  1 1 
        2  2798 1 1  57 SER HG   H  -6.469   6.329  -9.713 1.00 . A A .  57 SER HG   1 1 
        2  2799 1 1  57 SER N    N  -7.036   4.996  -7.667 1.00 . A A .  57 SER N    1 1 
        2  2800 1 1  57 SER O    O  -6.047   2.290  -7.516 1.00 . A A .  57 SER O    1 1 
        2  2801 1 1  57 SER OG   O  -5.727   5.915 -10.186 1.00 . A A .  57 SER OG   1 1 
        2  2802 1 1  58 THR C    C  -6.561  -0.548 -10.096 1.00 . A A .  58 THR C    1 1 
        2  2803 1 1  58 THR CA   C  -7.323   0.309  -9.040 1.00 . A A .  58 THR CA   1 1 
        2  2804 1 1  58 THR CB   C  -8.757  -0.195  -8.745 1.00 . A A .  58 THR CB   1 1 
        2  2805 1 1  58 THR CG2  C  -9.805  -0.040  -9.830 1.00 . A A .  58 THR CG2  1 1 
        2  2806 1 1  58 THR H    H  -7.643   2.163 -10.198 1.00 . A A .  58 THR H    1 1 
        2  2807 1 1  58 THR HA   H  -6.825   0.155  -8.064 1.00 . A A .  58 THR HA   1 1 
        2  2808 1 1  58 THR HB   H  -9.120   0.355  -7.851 1.00 . A A .  58 THR HB   1 1 
        2  2809 1 1  58 THR HG1  H  -7.979  -1.719  -7.773 1.00 . A A .  58 THR HG1  1 1 
        2  2810 1 1  58 THR HG21 H -10.050   1.016 -10.040 1.00 . A A .  58 THR HG21 1 1 
        2  2811 1 1  58 THR HG22 H  -9.516  -0.509 -10.781 1.00 . A A .  58 THR HG22 1 1 
        2  2812 1 1  58 THR HG23 H -10.733  -0.534  -9.500 1.00 . A A .  58 THR HG23 1 1 
        2  2813 1 1  58 THR N    N  -7.281   1.770  -9.326 1.00 . A A .  58 THR N    1 1 
        2  2814 1 1  58 THR O    O  -6.852  -0.525 -11.297 1.00 . A A .  58 THR O    1 1 
        2  2815 1 1  58 THR OG1  O  -8.722  -1.585  -8.405 1.00 . A A .  58 THR OG1  1 1 
        2  2816 1 1  59 GLN C    C  -5.272  -3.735 -10.129 1.00 . A A .  59 GLN C    1 1 
        2  2817 1 1  59 GLN CA   C  -4.783  -2.282 -10.373 1.00 . A A .  59 GLN CA   1 1 
        2  2818 1 1  59 GLN CB   C  -3.311  -2.059  -9.954 1.00 . A A .  59 GLN CB   1 1 
        2  2819 1 1  59 GLN CD   C  -0.829  -2.497 -10.401 1.00 . A A .  59 GLN CD   1 1 
        2  2820 1 1  59 GLN CG   C  -2.267  -2.875 -10.751 1.00 . A A .  59 GLN CG   1 1 
        2  2821 1 1  59 GLN H    H  -5.773  -1.467  -8.568 1.00 . A A .  59 GLN H    1 1 
        2  2822 1 1  59 GLN HA   H  -4.851  -2.026 -11.451 1.00 . A A .  59 GLN HA   1 1 
        2  2823 1 1  59 GLN HB2  H  -3.082  -0.979 -10.070 1.00 . A A .  59 GLN HB2  1 1 
        2  2824 1 1  59 GLN HB3  H  -3.179  -2.279  -8.877 1.00 . A A .  59 GLN HB3  1 1 
        2  2825 1 1  59 GLN HE21 H  -0.329  -4.398 -10.003 1.00 . A A .  59 GLN HE21 1 1 
        2  2826 1 1  59 GLN HE22 H   0.962  -3.098  -9.894 1.00 . A A .  59 GLN HE22 1 1 
        2  2827 1 1  59 GLN HG2  H  -2.431  -3.959 -10.578 1.00 . A A .  59 GLN HG2  1 1 
        2  2828 1 1  59 GLN HG3  H  -2.398  -2.721 -11.837 1.00 . A A .  59 GLN HG3  1 1 
        2  2829 1 1  59 GLN N    N  -5.613  -1.339  -9.577 1.00 . A A .  59 GLN N    1 1 
        2  2830 1 1  59 GLN NE2  N   0.050  -3.446 -10.196 1.00 . A A .  59 GLN NE2  1 1 
        2  2831 1 1  59 GLN O    O  -5.225  -4.250  -9.008 1.00 . A A .  59 GLN O    1 1 
        2  2832 1 1  59 GLN OE1  O  -0.469  -1.325 -10.297 1.00 . A A .  59 GLN OE1  1 1 
        2  2833 1 1  60 ARG C    C  -6.238  -6.579 -12.362 1.00 . A A .  60 ARG C    1 1 
        2  2834 1 1  60 ARG CA   C  -6.447  -5.697 -11.089 1.00 . A A .  60 ARG CA   1 1 
        2  2835 1 1  60 ARG CB   C  -7.917  -5.489 -10.649 1.00 . A A .  60 ARG CB   1 1 
        2  2836 1 1  60 ARG CD   C  -8.858  -3.334 -11.788 1.00 . A A .  60 ARG CD   1 1 
        2  2837 1 1  60 ARG CG   C  -8.929  -4.855 -11.608 1.00 . A A .  60 ARG CG   1 1 
        2  2838 1 1  60 ARG CZ   C  -9.570  -1.924 -13.728 1.00 . A A .  60 ARG CZ   1 1 
        2  2839 1 1  60 ARG H    H  -5.906  -3.791 -12.016 1.00 . A A .  60 ARG H    1 1 
        2  2840 1 1  60 ARG HA   H  -5.972  -6.275 -10.269 1.00 . A A .  60 ARG HA   1 1 
        2  2841 1 1  60 ARG HB2  H  -8.294  -6.494 -10.390 1.00 . A A .  60 ARG HB2  1 1 
        2  2842 1 1  60 ARG HB3  H  -7.914  -4.931  -9.692 1.00 . A A .  60 ARG HB3  1 1 
        2  2843 1 1  60 ARG HD2  H  -9.210  -2.822 -10.869 1.00 . A A .  60 ARG HD2  1 1 
        2  2844 1 1  60 ARG HD3  H  -7.821  -2.993 -11.950 1.00 . A A .  60 ARG HD3  1 1 
        2  2845 1 1  60 ARG HE   H -10.324  -3.701 -13.381 1.00 . A A .  60 ARG HE   1 1 
        2  2846 1 1  60 ARG HG2  H  -8.864  -5.368 -12.583 1.00 . A A .  60 ARG HG2  1 1 
        2  2847 1 1  60 ARG HG3  H  -9.936  -5.112 -11.227 1.00 . A A .  60 ARG HG3  1 1 
        2  2848 1 1  60 ARG HH11 H  -8.239  -0.969 -12.589 1.00 . A A .  60 ARG HH11 1 1 
        2  2849 1 1  60 ARG HH12 H  -8.754  -0.139 -14.131 1.00 . A A .  60 ARG HH12 1 1 
        2  2850 1 1  60 ARG HH21 H -10.792  -2.750 -15.047 1.00 . A A .  60 ARG HH21 1 1 
        2  2851 1 1  60 ARG HH22 H -10.131  -1.103 -15.456 1.00 . A A .  60 ARG HH22 1 1 
        2  2852 1 1  60 ARG N    N  -5.778  -4.374 -11.189 1.00 . A A .  60 ARG N    1 1 
        2  2853 1 1  60 ARG NE   N  -9.711  -2.987 -12.950 1.00 . A A .  60 ARG NE   1 1 
        2  2854 1 1  60 ARG NH1  N  -8.784  -0.909 -13.462 1.00 . A A .  60 ARG NH1  1 1 
        2  2855 1 1  60 ARG NH2  N -10.256  -1.901 -14.832 1.00 . A A .  60 ARG NH2  1 1 
        2  2856 1 1  60 ARG O    O  -7.183  -7.026 -13.015 1.00 . A A .  60 ARG O    1 1 
        2  2857 1 1  61 VAL C    C  -4.703  -9.011 -14.126 1.00 . A A .  61 VAL C    1 1 
        2  2858 1 1  61 VAL CA   C  -4.584  -7.458 -14.006 1.00 . A A .  61 VAL CA   1 1 
        2  2859 1 1  61 VAL CB   C  -3.186  -6.878 -14.415 1.00 . A A .  61 VAL CB   1 1 
        2  2860 1 1  61 VAL CG1  C  -1.992  -7.395 -13.597 1.00 . A A .  61 VAL CG1  1 1 
        2  2861 1 1  61 VAL CG2  C  -2.888  -7.067 -15.915 1.00 . A A .  61 VAL CG2  1 1 
        2  2862 1 1  61 VAL H    H  -4.283  -6.364 -12.108 1.00 . A A .  61 VAL H    1 1 
        2  2863 1 1  61 VAL HA   H  -5.289  -7.061 -14.762 1.00 . A A .  61 VAL HA   1 1 
        2  2864 1 1  61 VAL HB   H  -3.231  -5.776 -14.267 1.00 . A A .  61 VAL HB   1 1 
        2  2865 1 1  61 VAL HG11 H  -1.828  -8.481 -13.724 1.00 . A A .  61 VAL HG11 1 1 
        2  2866 1 1  61 VAL HG12 H  -1.054  -6.888 -13.890 1.00 . A A .  61 VAL HG12 1 1 
        2  2867 1 1  61 VAL HG13 H  -2.122  -7.212 -12.515 1.00 . A A .  61 VAL HG13 1 1 
        2  2868 1 1  61 VAL HG21 H  -1.953  -6.555 -16.210 1.00 . A A .  61 VAL HG21 1 1 
        2  2869 1 1  61 VAL HG22 H  -2.779  -8.130 -16.200 1.00 . A A .  61 VAL HG22 1 1 
        2  2870 1 1  61 VAL HG23 H  -3.694  -6.643 -16.539 1.00 . A A .  61 VAL HG23 1 1 
        2  2871 1 1  61 VAL N    N  -4.970  -6.835 -12.704 1.00 . A A .  61 VAL N    1 1 
        2  2872 1 1  61 VAL O    O  -4.879  -9.507 -15.241 1.00 . A A .  61 VAL O    1 1 
        2  2873 1 1  62 ASP C    C  -5.690 -12.045 -13.404 1.00 . A A .  62 ASP C    1 1 
        2  2874 1 1  62 ASP CA   C  -4.398 -11.234 -13.055 1.00 . A A .  62 ASP CA   1 1 
        2  2875 1 1  62 ASP CB   C  -3.832 -11.614 -11.656 1.00 . A A .  62 ASP CB   1 1 
        2  2876 1 1  62 ASP CG   C  -2.856 -12.785 -11.627 1.00 . A A .  62 ASP CG   1 1 
        2  2877 1 1  62 ASP H    H  -4.500  -9.227 -12.155 1.00 . A A .  62 ASP H    1 1 
        2  2878 1 1  62 ASP HA   H  -3.629 -11.454 -13.825 1.00 . A A .  62 ASP HA   1 1 
        2  2879 1 1  62 ASP HB2  H  -3.290 -10.767 -11.200 1.00 . A A .  62 ASP HB2  1 1 
        2  2880 1 1  62 ASP HB3  H  -4.649 -11.824 -10.941 1.00 . A A .  62 ASP HB3  1 1 
        2  2881 1 1  62 ASP N    N  -4.578  -9.762 -13.024 1.00 . A A .  62 ASP N    1 1 
        2  2882 1 1  62 ASP O    O  -6.822 -11.562 -13.303 1.00 . A A .  62 ASP O    1 1 
        2  2883 1 1  62 ASP OD1  O  -2.887 -13.650 -12.525 1.00 . A A .  62 ASP OD1  1 1 
        2  2884 1 1  62 ASP OD2  O  -2.038 -12.859 -10.684 1.00 . A A .  62 ASP OD2  1 1 
        2  2885 1 1  63 ARG C    C  -7.352 -14.817 -12.601 1.00 . A A .  63 ARG C    1 1 
        2  2886 1 1  63 ARG CA   C  -6.613 -14.317 -13.903 1.00 . A A .  63 ARG CA   1 1 
        2  2887 1 1  63 ARG CB   C  -6.129 -15.457 -14.847 1.00 . A A .  63 ARG CB   1 1 
        2  2888 1 1  63 ARG CD   C  -4.006 -16.165 -13.574 1.00 . A A .  63 ARG CD   1 1 
        2  2889 1 1  63 ARG CG   C  -5.267 -16.620 -14.301 1.00 . A A .  63 ARG CG   1 1 
        2  2890 1 1  63 ARG CZ   C  -2.268 -17.125 -12.081 1.00 . A A .  63 ARG CZ   1 1 
        2  2891 1 1  63 ARG H    H  -4.516 -13.601 -13.531 1.00 . A A .  63 ARG H    1 1 
        2  2892 1 1  63 ARG HA   H  -7.402 -13.802 -14.488 1.00 . A A .  63 ARG HA   1 1 
        2  2893 1 1  63 ARG HB2  H  -7.034 -15.910 -15.301 1.00 . A A .  63 ARG HB2  1 1 
        2  2894 1 1  63 ARG HB3  H  -5.619 -14.996 -15.718 1.00 . A A .  63 ARG HB3  1 1 
        2  2895 1 1  63 ARG HD2  H  -3.392 -15.510 -14.228 1.00 . A A .  63 ARG HD2  1 1 
        2  2896 1 1  63 ARG HD3  H  -4.335 -15.537 -12.723 1.00 . A A .  63 ARG HD3  1 1 
        2  2897 1 1  63 ARG HE   H  -3.288 -18.231 -13.388 1.00 . A A .  63 ARG HE   1 1 
        2  2898 1 1  63 ARG HG2  H  -5.887 -17.243 -13.629 1.00 . A A .  63 ARG HG2  1 1 
        2  2899 1 1  63 ARG HG3  H  -5.014 -17.275 -15.158 1.00 . A A .  63 ARG HG3  1 1 
        2  2900 1 1  63 ARG HH11 H  -2.358 -15.103 -11.954 1.00 . A A .  63 ARG HH11 1 1 
        2  2901 1 1  63 ARG HH12 H  -1.340 -15.992 -10.704 1.00 . A A .  63 ARG HH12 1 1 
        2  2902 1 1  63 ARG HH21 H  -1.873 -19.078 -12.066 1.00 . A A .  63 ARG HH21 1 1 
        2  2903 1 1  63 ARG HH22 H  -0.960 -17.999 -10.905 1.00 . A A .  63 ARG HH22 1 1 
        2  2904 1 1  63 ARG N    N  -5.494 -13.330 -13.733 1.00 . A A .  63 ARG N    1 1 
        2  2905 1 1  63 ARG NE   N  -3.178 -17.273 -13.049 1.00 . A A .  63 ARG NE   1 1 
        2  2906 1 1  63 ARG NH1  N  -1.931 -15.977 -11.550 1.00 . A A .  63 ARG NH1  1 1 
        2  2907 1 1  63 ARG NH2  N  -1.665 -18.182 -11.624 1.00 . A A .  63 ARG NH2  1 1 
        2  2908 1 1  63 ARG O    O  -7.866 -15.938 -12.544 1.00 . A A .  63 ARG O    1 1 
        2  2909 1 1  64 LEU C    C  -8.542 -12.872  -9.611 1.00 . A A .  64 LEU C    1 1 
        2  2910 1 1  64 LEU CA   C  -8.100 -14.221 -10.291 1.00 . A A .  64 LEU CA   1 1 
        2  2911 1 1  64 LEU CB   C  -7.202 -15.106  -9.369 1.00 . A A .  64 LEU CB   1 1 
        2  2912 1 1  64 LEU CD1  C  -5.806 -14.692  -7.285 1.00 . A A .  64 LEU CD1  1 1 
        2  2913 1 1  64 LEU CD2  C  -4.659 -14.879  -9.511 1.00 . A A .  64 LEU CD2  1 1 
        2  2914 1 1  64 LEU CG   C  -5.931 -14.436  -8.790 1.00 . A A .  64 LEU CG   1 1 
        2  2915 1 1  64 LEU H    H  -7.079 -13.017 -11.817 1.00 . A A .  64 LEU H    1 1 
        2  2916 1 1  64 LEU HA   H  -9.029 -14.784 -10.500 1.00 . A A .  64 LEU HA   1 1 
        2  2917 1 1  64 LEU HB2  H  -7.855 -15.467  -8.549 1.00 . A A .  64 LEU HB2  1 1 
        2  2918 1 1  64 LEU HB3  H  -6.948 -16.037  -9.906 1.00 . A A .  64 LEU HB3  1 1 
        2  2919 1 1  64 LEU HD11 H  -4.903 -14.215  -6.867 1.00 . A A .  64 LEU HD11 1 1 
        2  2920 1 1  64 LEU HD12 H  -6.666 -14.263  -6.737 1.00 . A A .  64 LEU HD12 1 1 
        2  2921 1 1  64 LEU HD13 H  -5.748 -15.762  -7.028 1.00 . A A .  64 LEU HD13 1 1 
        2  2922 1 1  64 LEU HD21 H  -3.786 -14.286  -9.183 1.00 . A A .  64 LEU HD21 1 1 
        2  2923 1 1  64 LEU HD22 H  -4.398 -15.935  -9.346 1.00 . A A .  64 LEU HD22 1 1 
        2  2924 1 1  64 LEU HD23 H  -4.739 -14.726 -10.601 1.00 . A A .  64 LEU HD23 1 1 
        2  2925 1 1  64 LEU HG   H  -5.993 -13.335  -8.913 1.00 . A A .  64 LEU HG   1 1 
        2  2926 1 1  64 LEU N    N  -7.435 -13.955 -11.584 1.00 . A A .  64 LEU N    1 1 
        2  2927 1 1  64 LEU O    O  -8.267 -11.775 -10.110 1.00 . A A .  64 LEU O    1 1 
        2  2928 1 1  65 ALA C    C  -7.935 -11.304  -6.866 1.00 . A A .  65 ALA C    1 1 
        2  2929 1 1  65 ALA CA   C  -9.286 -11.779  -7.514 1.00 . A A .  65 ALA CA   1 1 
        2  2930 1 1  65 ALA CB   C -10.345 -12.156  -6.468 1.00 . A A .  65 ALA CB   1 1 
        2  2931 1 1  65 ALA H    H  -9.444 -13.896  -8.144 1.00 . A A .  65 ALA H    1 1 
        2  2932 1 1  65 ALA HA   H  -9.702 -10.927  -8.094 1.00 . A A .  65 ALA HA   1 1 
        2  2933 1 1  65 ALA HB1  H -11.296 -12.477  -6.932 1.00 . A A .  65 ALA HB1  1 1 
        2  2934 1 1  65 ALA HB2  H -10.008 -12.973  -5.804 1.00 . A A .  65 ALA HB2  1 1 
        2  2935 1 1  65 ALA HB3  H -10.585 -11.298  -5.813 1.00 . A A .  65 ALA HB3  1 1 
        2  2936 1 1  65 ALA N    N  -9.144 -12.951  -8.414 1.00 . A A .  65 ALA N    1 1 
        2  2937 1 1  65 ALA O    O  -7.648 -11.557  -5.694 1.00 . A A .  65 ALA O    1 1 
        2  2938 1 1  66 ARG C    C  -6.162  -8.324  -7.390 1.00 . A A .  66 ARG C    1 1 
        2  2939 1 1  66 ARG CA   C  -5.926  -9.855  -7.187 1.00 . A A .  66 ARG CA   1 1 
        2  2940 1 1  66 ARG CB   C  -4.717 -10.414  -7.977 1.00 . A A .  66 ARG CB   1 1 
        2  2941 1 1  66 ARG CD   C  -2.174 -10.461  -8.301 1.00 . A A .  66 ARG CD   1 1 
        2  2942 1 1  66 ARG CG   C  -3.346  -9.983  -7.420 1.00 . A A .  66 ARG CG   1 1 
        2  2943 1 1  66 ARG CZ   C  -0.854  -9.512 -10.199 1.00 . A A .  66 ARG CZ   1 1 
        2  2944 1 1  66 ARG H    H  -7.493 -10.488  -8.621 1.00 . A A .  66 ARG H    1 1 
        2  2945 1 1  66 ARG HA   H  -5.754 -10.035  -6.104 1.00 . A A .  66 ARG HA   1 1 
        2  2946 1 1  66 ARG HB2  H  -4.755 -11.523  -7.970 1.00 . A A .  66 ARG HB2  1 1 
        2  2947 1 1  66 ARG HB3  H  -4.800 -10.125  -9.044 1.00 . A A .  66 ARG HB3  1 1 
        2  2948 1 1  66 ARG HD2  H  -1.319 -10.716  -7.642 1.00 . A A .  66 ARG HD2  1 1 
        2  2949 1 1  66 ARG HD3  H  -2.433 -11.399  -8.825 1.00 . A A .  66 ARG HD3  1 1 
        2  2950 1 1  66 ARG HE   H  -1.853  -8.386  -8.896 1.00 . A A .  66 ARG HE   1 1 
        2  2951 1 1  66 ARG HG2  H  -3.305  -8.886  -7.260 1.00 . A A .  66 ARG HG2  1 1 
        2  2952 1 1  66 ARG HG3  H  -3.216 -10.396  -6.402 1.00 . A A .  66 ARG HG3  1 1 
        2  2953 1 1  66 ARG HH11 H  -1.104 -11.478 -10.504 1.00 . A A .  66 ARG HH11 1 1 
        2  2954 1 1  66 ARG HH12 H   0.203 -10.625 -11.466 1.00 . A A .  66 ARG HH12 1 1 
        2  2955 1 1  66 ARG HH21 H  -0.526  -7.531 -10.193 1.00 . A A .  66 ARG HH21 1 1 
        2  2956 1 1  66 ARG HH22 H   0.474  -8.569 -11.333 1.00 . A A .  66 ARG HH22 1 1 
        2  2957 1 1  66 ARG N    N  -7.138 -10.580  -7.662 1.00 . A A .  66 ARG N    1 1 
        2  2958 1 1  66 ARG NE   N  -1.757  -9.379  -9.230 1.00 . A A .  66 ARG NE   1 1 
        2  2959 1 1  66 ARG NH1  N  -0.494 -10.654 -10.724 1.00 . A A .  66 ARG NH1  1 1 
        2  2960 1 1  66 ARG NH2  N  -0.288  -8.442 -10.669 1.00 . A A .  66 ARG NH2  1 1 
        2  2961 1 1  66 ARG O    O  -5.583  -7.685  -8.273 1.00 . A A .  66 ARG O    1 1 
        2  2962 1 1  67 THR C    C  -7.022  -5.411  -5.778 1.00 . A A .  67 THR C    1 1 
        2  2963 1 1  67 THR CA   C  -7.623  -6.415  -6.802 1.00 . A A .  67 THR CA   1 1 
        2  2964 1 1  67 THR CB   C  -9.186  -6.407  -6.690 1.00 . A A .  67 THR CB   1 1 
        2  2965 1 1  67 THR CG2  C  -9.923  -7.263  -7.715 1.00 . A A .  67 THR CG2  1 1 
        2  2966 1 1  67 THR H    H  -7.620  -8.491  -6.090 1.00 . A A .  67 THR H    1 1 
        2  2967 1 1  67 THR HA   H  -7.379  -6.057  -7.822 1.00 . A A .  67 THR HA   1 1 
        2  2968 1 1  67 THR HB   H  -9.519  -5.359  -6.833 1.00 . A A .  67 THR HB   1 1 
        2  2969 1 1  67 THR HG1  H  -9.023  -6.349  -4.776 1.00 . A A .  67 THR HG1  1 1 
        2  2970 1 1  67 THR HG21 H -11.011  -7.233  -7.530 1.00 . A A .  67 THR HG21 1 1 
        2  2971 1 1  67 THR HG22 H  -9.765  -6.913  -8.748 1.00 . A A .  67 THR HG22 1 1 
        2  2972 1 1  67 THR HG23 H  -9.618  -8.323  -7.679 1.00 . A A .  67 THR HG23 1 1 
        2  2973 1 1  67 THR N    N  -7.078  -7.774  -6.584 1.00 . A A .  67 THR N    1 1 
        2  2974 1 1  67 THR O    O  -7.515  -5.309  -4.649 1.00 . A A .  67 THR O    1 1 
        2  2975 1 1  67 THR OG1  O  -9.610  -6.819  -5.388 1.00 . A A .  67 THR OG1  1 1 
        2  2976 1 1  68 GLU C    C  -6.529  -2.252  -5.730 1.00 . A A .  68 GLU C    1 1 
        2  2977 1 1  68 GLU CA   C  -5.560  -3.455  -5.433 1.00 . A A .  68 GLU CA   1 1 
        2  2978 1 1  68 GLU CB   C  -4.147  -3.044  -5.908 1.00 . A A .  68 GLU CB   1 1 
        2  2979 1 1  68 GLU CD   C  -1.628  -3.272  -5.832 1.00 . A A .  68 GLU CD   1 1 
        2  2980 1 1  68 GLU CG   C  -2.965  -3.966  -5.567 1.00 . A A .  68 GLU CG   1 1 
        2  2981 1 1  68 GLU H    H  -5.658  -4.775  -7.140 1.00 . A A .  68 GLU H    1 1 
        2  2982 1 1  68 GLU HA   H  -5.528  -3.668  -4.345 1.00 . A A .  68 GLU HA   1 1 
        2  2983 1 1  68 GLU HB2  H  -4.157  -2.866  -6.999 1.00 . A A .  68 GLU HB2  1 1 
        2  2984 1 1  68 GLU HB3  H  -3.936  -2.059  -5.468 1.00 . A A .  68 GLU HB3  1 1 
        2  2985 1 1  68 GLU HG2  H  -2.972  -4.282  -4.509 1.00 . A A .  68 GLU HG2  1 1 
        2  2986 1 1  68 GLU HG3  H  -2.984  -4.895  -6.166 1.00 . A A .  68 GLU HG3  1 1 
        2  2987 1 1  68 GLU N    N  -6.011  -4.639  -6.186 1.00 . A A .  68 GLU N    1 1 
        2  2988 1 1  68 GLU O    O  -6.757  -1.895  -6.890 1.00 . A A .  68 GLU O    1 1 
        2  2989 1 1  68 GLU OE1  O  -1.276  -3.046  -7.010 1.00 . A A .  68 GLU OE1  1 1 
        2  2990 1 1  68 GLU OE2  O  -0.951  -2.875  -4.864 1.00 . A A .  68 GLU OE2  1 1 
        2  2991 1 1  69 ILE C    C  -6.868   0.687  -4.024 1.00 . A A .  69 ILE C    1 1 
        2  2992 1 1  69 ILE CA   C  -7.784  -0.336  -4.774 1.00 . A A .  69 ILE CA   1 1 
        2  2993 1 1  69 ILE CB   C  -9.250  -0.387  -4.221 1.00 . A A .  69 ILE CB   1 1 
        2  2994 1 1  69 ILE CD1  C -10.148  -2.820  -4.504 1.00 . A A .  69 ILE CD1  1 1 
        2  2995 1 1  69 ILE CG1  C -10.192  -1.369  -4.981 1.00 . A A .  69 ILE CG1  1 1 
        2  2996 1 1  69 ILE CG2  C  -9.901   1.024  -4.342 1.00 . A A .  69 ILE CG2  1 1 
        2  2997 1 1  69 ILE H    H  -6.845  -2.077  -3.782 1.00 . A A .  69 ILE H    1 1 
        2  2998 1 1  69 ILE HA   H  -7.859  -0.014  -5.832 1.00 . A A .  69 ILE HA   1 1 
        2  2999 1 1  69 ILE HB   H  -9.245  -0.641  -3.144 1.00 . A A .  69 ILE HB   1 1 
        2  3000 1 1  69 ILE HD11 H  -9.163  -3.298  -4.634 1.00 . A A .  69 ILE HD11 1 1 
        2  3001 1 1  69 ILE HD12 H -10.415  -2.914  -3.436 1.00 . A A .  69 ILE HD12 1 1 
        2  3002 1 1  69 ILE HD13 H -10.870  -3.439  -5.067 1.00 . A A .  69 ILE HD13 1 1 
        2  3003 1 1  69 ILE HG12 H -11.247  -1.046  -4.869 1.00 . A A .  69 ILE HG12 1 1 
        2  3004 1 1  69 ILE HG13 H -10.003  -1.325  -6.070 1.00 . A A .  69 ILE HG13 1 1 
        2  3005 1 1  69 ILE HG21 H -10.949   1.030  -3.987 1.00 . A A .  69 ILE HG21 1 1 
        2  3006 1 1  69 ILE HG22 H  -9.375   1.782  -3.731 1.00 . A A .  69 ILE HG22 1 1 
        2  3007 1 1  69 ILE HG23 H  -9.892   1.380  -5.387 1.00 . A A .  69 ILE HG23 1 1 
        2  3008 1 1  69 ILE N    N  -7.068  -1.639  -4.678 1.00 . A A .  69 ILE N    1 1 
        2  3009 1 1  69 ILE O    O  -6.828   0.708  -2.792 1.00 . A A .  69 ILE O    1 1 
        2  3010 1 1  70 LYS C    C  -5.555   3.839  -4.206 1.00 . A A .  70 LYS C    1 1 
        2  3011 1 1  70 LYS CA   C  -5.054   2.374  -4.239 1.00 . A A .  70 LYS CA   1 1 
        2  3012 1 1  70 LYS CB   C  -3.747   2.203  -5.067 1.00 . A A .  70 LYS CB   1 1 
        2  3013 1 1  70 LYS CD   C  -1.828   0.539  -5.625 1.00 . A A .  70 LYS CD   1 1 
        2  3014 1 1  70 LYS CE   C  -2.065   0.250  -7.110 1.00 . A A .  70 LYS CE   1 1 
        2  3015 1 1  70 LYS CG   C  -3.076   0.848  -4.799 1.00 . A A .  70 LYS CG   1 1 
        2  3016 1 1  70 LYS H    H  -6.360   1.546  -5.778 1.00 . A A .  70 LYS H    1 1 
        2  3017 1 1  70 LYS HA   H  -4.792   2.081  -3.204 1.00 . A A .  70 LYS HA   1 1 
        2  3018 1 1  70 LYS HB2  H  -3.953   2.350  -6.143 1.00 . A A .  70 LYS HB2  1 1 
        2  3019 1 1  70 LYS HB3  H  -3.038   3.011  -4.797 1.00 . A A .  70 LYS HB3  1 1 
        2  3020 1 1  70 LYS HD2  H  -1.085   1.352  -5.507 1.00 . A A .  70 LYS HD2  1 1 
        2  3021 1 1  70 LYS HD3  H  -1.370  -0.349  -5.136 1.00 . A A .  70 LYS HD3  1 1 
        2  3022 1 1  70 LYS HE2  H  -3.005  -0.326  -7.254 1.00 . A A .  70 LYS HE2  1 1 
        2  3023 1 1  70 LYS HE3  H  -2.206   1.197  -7.673 1.00 . A A .  70 LYS HE3  1 1 
        2  3024 1 1  70 LYS HG2  H  -2.791   0.803  -3.727 1.00 . A A .  70 LYS HG2  1 1 
        2  3025 1 1  70 LYS HG3  H  -3.809   0.028  -4.913 1.00 . A A .  70 LYS HG3  1 1 
        2  3026 1 1  70 LYS HZ1  H   0.000  -0.236  -7.252 1.00 . A A .  70 LYS HZ1  1 1 
        2  3027 1 1  70 LYS HZ2  H  -0.995  -1.567  -7.301 1.00 . A A .  70 LYS HZ2  1 1 
        2  3028 1 1  70 LYS HZ3  H  -0.816  -0.631  -8.646 1.00 . A A .  70 LYS HZ3  1 1 
        2  3029 1 1  70 LYS N    N  -6.115   1.492  -4.783 1.00 . A A .  70 LYS N    1 1 
        2  3030 1 1  70 LYS NZ   N  -0.908  -0.541  -7.616 1.00 . A A .  70 LYS NZ   1 1 
        2  3031 1 1  70 LYS O    O  -5.345   4.629  -5.131 1.00 . A A .  70 LYS O    1 1 
        2  3032 1 1  71 ASN C    C  -5.724   6.083  -1.597 1.00 . A A .  71 ASN C    1 1 
        2  3033 1 1  71 ASN CA   C  -6.629   5.537  -2.741 1.00 . A A .  71 ASN CA   1 1 
        2  3034 1 1  71 ASN CB   C  -8.147   5.588  -2.453 1.00 . A A .  71 ASN CB   1 1 
        2  3035 1 1  71 ASN CG   C  -8.724   4.630  -1.424 1.00 . A A .  71 ASN CG   1 1 
        2  3036 1 1  71 ASN H    H  -6.590   3.334  -2.609 1.00 . A A .  71 ASN H    1 1 
        2  3037 1 1  71 ASN HA   H  -6.496   6.197  -3.626 1.00 . A A .  71 ASN HA   1 1 
        2  3038 1 1  71 ASN HB2  H  -8.439   6.631  -2.225 1.00 . A A .  71 ASN HB2  1 1 
        2  3039 1 1  71 ASN HB3  H  -8.666   5.374  -3.403 1.00 . A A .  71 ASN HB3  1 1 
        2  3040 1 1  71 ASN HD21 H  -8.683   6.019  -0.022 1.00 . A A .  71 ASN HD21 1 1 
        2  3041 1 1  71 ASN HD22 H  -9.178   4.318   0.430 1.00 . A A .  71 ASN HD22 1 1 
        2  3042 1 1  71 ASN N    N  -6.217   4.159  -3.095 1.00 . A A .  71 ASN N    1 1 
        2  3043 1 1  71 ASN ND2  N  -9.054   5.091  -0.243 1.00 . A A .  71 ASN ND2  1 1 
        2  3044 1 1  71 ASN O    O  -6.025   5.934  -0.410 1.00 . A A .  71 ASN O    1 1 
        2  3045 1 1  71 ASN OD1  O  -8.867   3.437  -1.674 1.00 . A A .  71 ASN OD1  1 1 
        2  3046 1 1  72 PHE C    C  -3.526   8.737  -1.063 1.00 . A A .  72 PHE C    1 1 
        2  3047 1 1  72 PHE CA   C  -3.571   7.187  -1.018 1.00 . A A .  72 PHE CA   1 1 
        2  3048 1 1  72 PHE CB   C  -2.224   6.520  -1.401 1.00 . A A .  72 PHE CB   1 1 
        2  3049 1 1  72 PHE CD1  C  -1.094   5.916   0.807 1.00 . A A .  72 PHE CD1  1 1 
        2  3050 1 1  72 PHE CD2  C  -0.045   7.587  -0.581 1.00 . A A .  72 PHE CD2  1 1 
        2  3051 1 1  72 PHE CE1  C  -0.052   6.020   1.728 1.00 . A A .  72 PHE CE1  1 1 
        2  3052 1 1  72 PHE CE2  C   0.998   7.692   0.342 1.00 . A A .  72 PHE CE2  1 1 
        2  3053 1 1  72 PHE CG   C  -1.103   6.692  -0.363 1.00 . A A .  72 PHE CG   1 1 
        2  3054 1 1  72 PHE CZ   C   0.997   6.902   1.490 1.00 . A A .  72 PHE CZ   1 1 
        2  3055 1 1  72 PHE H    H  -4.459   6.718  -2.999 1.00 . A A .  72 PHE H    1 1 
        2  3056 1 1  72 PHE HA   H  -3.824   6.858   0.013 1.00 . A A .  72 PHE HA   1 1 
        2  3057 1 1  72 PHE HB2  H  -2.380   5.432  -1.548 1.00 . A A .  72 PHE HB2  1 1 
        2  3058 1 1  72 PHE HB3  H  -1.885   6.883  -2.392 1.00 . A A .  72 PHE HB3  1 1 
        2  3059 1 1  72 PHE HD1  H  -1.897   5.222   1.004 1.00 . A A .  72 PHE HD1  1 1 
        2  3060 1 1  72 PHE HD2  H  -0.020   8.195  -1.479 1.00 . A A .  72 PHE HD2  1 1 
        2  3061 1 1  72 PHE HE1  H  -0.058   5.409   2.622 1.00 . A A .  72 PHE HE1  1 1 
        2  3062 1 1  72 PHE HE2  H   1.826   8.362   0.154 1.00 . A A .  72 PHE HE2  1 1 
        2  3063 1 1  72 PHE HZ   H   1.814   6.975   2.197 1.00 . A A .  72 PHE HZ   1 1 
        2  3064 1 1  72 PHE N    N  -4.590   6.685  -1.981 1.00 . A A .  72 PHE N    1 1 
        2  3065 1 1  72 PHE O    O  -3.061   9.317  -2.050 1.00 . A A .  72 PHE O    1 1 
        2  3066 1 1  73 THR C    C  -2.946  11.420   0.979 1.00 . A A .  73 THR C    1 1 
        2  3067 1 1  73 THR CA   C  -4.079  10.886   0.056 1.00 . A A .  73 THR CA   1 1 
        2  3068 1 1  73 THR CB   C  -5.501  11.341   0.500 1.00 . A A .  73 THR CB   1 1 
        2  3069 1 1  73 THR CG2  C  -5.700  12.855   0.445 1.00 . A A .  73 THR CG2  1 1 
        2  3070 1 1  73 THR H    H  -4.371   8.818   0.774 1.00 . A A .  73 THR H    1 1 
        2  3071 1 1  73 THR HA   H  -3.938  11.295  -0.962 1.00 . A A .  73 THR HA   1 1 
        2  3072 1 1  73 THR HB   H  -5.700  10.981   1.529 1.00 . A A .  73 THR HB   1 1 
        2  3073 1 1  73 THR HG1  H  -6.427  11.272  -1.189 1.00 . A A .  73 THR HG1  1 1 
        2  3074 1 1  73 THR HG21 H  -6.736  13.125   0.723 1.00 . A A .  73 THR HG21 1 1 
        2  3075 1 1  73 THR HG22 H  -5.037  13.393   1.147 1.00 . A A .  73 THR HG22 1 1 
        2  3076 1 1  73 THR HG23 H  -5.511  13.269  -0.562 1.00 . A A .  73 THR HG23 1 1 
        2  3077 1 1  73 THR N    N  -4.011   9.398   0.001 1.00 . A A .  73 THR N    1 1 
        2  3078 1 1  73 THR O    O  -3.048  11.365   2.207 1.00 . A A .  73 THR O    1 1 
        2  3079 1 1  73 THR OG1  O  -6.500  10.797  -0.359 1.00 . A A .  73 THR OG1  1 1 
        2  3080 1 1  74 VAL C    C  -0.273  13.824   0.840 1.00 . A A .  74 VAL C    1 1 
        2  3081 1 1  74 VAL CA   C  -0.630  12.337   1.109 1.00 . A A .  74 VAL CA   1 1 
        2  3082 1 1  74 VAL CB   C   0.522  11.320   0.863 1.00 . A A .  74 VAL CB   1 1 
        2  3083 1 1  74 VAL CG1  C   0.934  11.156  -0.600 1.00 . A A .  74 VAL CG1  1 1 
        2  3084 1 1  74 VAL CG2  C   1.801  11.642   1.667 1.00 . A A .  74 VAL CG2  1 1 
        2  3085 1 1  74 VAL H    H  -1.918  11.936  -0.657 1.00 . A A .  74 VAL H    1 1 
        2  3086 1 1  74 VAL HA   H  -0.846  12.258   2.190 1.00 . A A .  74 VAL HA   1 1 
        2  3087 1 1  74 VAL HB   H   0.144  10.338   1.217 1.00 . A A .  74 VAL HB   1 1 
        2  3088 1 1  74 VAL HG11 H   1.781  10.456  -0.709 1.00 . A A .  74 VAL HG11 1 1 
        2  3089 1 1  74 VAL HG12 H   0.113  10.765  -1.229 1.00 . A A .  74 VAL HG12 1 1 
        2  3090 1 1  74 VAL HG13 H   1.247  12.115  -1.037 1.00 . A A .  74 VAL HG13 1 1 
        2  3091 1 1  74 VAL HG21 H   1.596  11.841   2.733 1.00 . A A .  74 VAL HG21 1 1 
        2  3092 1 1  74 VAL HG22 H   2.527  10.809   1.634 1.00 . A A .  74 VAL HG22 1 1 
        2  3093 1 1  74 VAL HG23 H   2.316  12.536   1.267 1.00 . A A .  74 VAL HG23 1 1 
        2  3094 1 1  74 VAL N    N  -1.864  11.925   0.375 1.00 . A A .  74 VAL N    1 1 
        2  3095 1 1  74 VAL O    O  -0.261  14.299  -0.298 1.00 . A A .  74 VAL O    1 1 
        2  3096 1 1  75 PHE C    C   1.661  16.428   1.837 1.00 . A A .  75 PHE C    1 1 
        2  3097 1 1  75 PHE CA   C   0.168  16.013   1.929 1.00 . A A .  75 PHE CA   1 1 
        2  3098 1 1  75 PHE CB   C  -0.524  16.574   3.203 1.00 . A A .  75 PHE CB   1 1 
        2  3099 1 1  75 PHE CD1  C  -2.713  15.312   3.658 1.00 . A A .  75 PHE CD1  1 1 
        2  3100 1 1  75 PHE CD2  C  -2.843  17.469   2.579 1.00 . A A .  75 PHE CD2  1 1 
        2  3101 1 1  75 PHE CE1  C  -4.097  15.172   3.551 1.00 . A A .  75 PHE CE1  1 1 
        2  3102 1 1  75 PHE CE2  C  -4.230  17.332   2.478 1.00 . A A .  75 PHE CE2  1 1 
        2  3103 1 1  75 PHE CG   C  -2.065  16.458   3.164 1.00 . A A .  75 PHE CG   1 1 
        2  3104 1 1  75 PHE CZ   C  -4.853  16.182   2.961 1.00 . A A .  75 PHE CZ   1 1 
        2  3105 1 1  75 PHE H    H   0.005  14.005   2.809 1.00 . A A .  75 PHE H    1 1 
        2  3106 1 1  75 PHE HA   H  -0.373  16.438   1.065 1.00 . A A .  75 PHE HA   1 1 
        2  3107 1 1  75 PHE HB2  H  -0.137  16.076   4.113 1.00 . A A .  75 PHE HB2  1 1 
        2  3108 1 1  75 PHE HB3  H  -0.255  17.640   3.337 1.00 . A A .  75 PHE HB3  1 1 
        2  3109 1 1  75 PHE HD1  H  -2.138  14.507   4.097 1.00 . A A .  75 PHE HD1  1 1 
        2  3110 1 1  75 PHE HD2  H  -2.371  18.361   2.185 1.00 . A A .  75 PHE HD2  1 1 
        2  3111 1 1  75 PHE HE1  H  -4.577  14.272   3.917 1.00 . A A .  75 PHE HE1  1 1 
        2  3112 1 1  75 PHE HE2  H  -4.819  18.118   2.021 1.00 . A A .  75 PHE HE2  1 1 
        2  3113 1 1  75 PHE HZ   H  -5.927  16.072   2.877 1.00 . A A .  75 PHE HZ   1 1 
        2  3114 1 1  75 PHE N    N   0.028  14.541   1.927 1.00 . A A .  75 PHE N    1 1 
        2  3115 1 1  75 PHE O    O   2.500  15.962   2.612 1.00 . A A .  75 PHE O    1 1 
        2  3116 1 1  76 PHE C    C   3.412  19.326   0.546 1.00 . A A .  76 PHE C    1 1 
        2  3117 1 1  76 PHE CA   C   3.355  17.761   0.604 1.00 . A A .  76 PHE CA   1 1 
        2  3118 1 1  76 PHE CB   C   3.871  17.221  -0.759 1.00 . A A .  76 PHE CB   1 1 
        2  3119 1 1  76 PHE CD1  C   4.864  14.917  -0.216 1.00 . A A .  76 PHE CD1  1 1 
        2  3120 1 1  76 PHE CD2  C   3.086  15.069  -1.840 1.00 . A A .  76 PHE CD2  1 1 
        2  3121 1 1  76 PHE CE1  C   4.926  13.536  -0.422 1.00 . A A .  76 PHE CE1  1 1 
        2  3122 1 1  76 PHE CE2  C   3.191  13.702  -2.083 1.00 . A A .  76 PHE CE2  1 1 
        2  3123 1 1  76 PHE CG   C   3.935  15.699  -0.922 1.00 . A A .  76 PHE CG   1 1 
        2  3124 1 1  76 PHE CZ   C   4.097  12.933  -1.362 1.00 . A A .  76 PHE CZ   1 1 
        2  3125 1 1  76 PHE H    H   1.187  17.642   0.314 1.00 . A A .  76 PHE H    1 1 
        2  3126 1 1  76 PHE HA   H   4.045  17.419   1.397 1.00 . A A .  76 PHE HA   1 1 
        2  3127 1 1  76 PHE HB2  H   3.274  17.673  -1.577 1.00 . A A .  76 PHE HB2  1 1 
        2  3128 1 1  76 PHE HB3  H   4.892  17.619  -0.926 1.00 . A A .  76 PHE HB3  1 1 
        2  3129 1 1  76 PHE HD1  H   5.556  15.384   0.475 1.00 . A A .  76 PHE HD1  1 1 
        2  3130 1 1  76 PHE HD2  H   2.345  15.637  -2.384 1.00 . A A .  76 PHE HD2  1 1 
        2  3131 1 1  76 PHE HE1  H   5.627  12.921   0.125 1.00 . A A .  76 PHE HE1  1 1 
        2  3132 1 1  76 PHE HE2  H   2.566  13.248  -2.835 1.00 . A A .  76 PHE HE2  1 1 
        2  3133 1 1  76 PHE HZ   H   4.171  11.867  -1.533 1.00 . A A .  76 PHE HZ   1 1 
        2  3134 1 1  76 PHE N    N   1.972  17.301   0.873 1.00 . A A .  76 PHE N    1 1 
        2  3135 1 1  76 PHE O    O   2.459  19.977   0.102 1.00 . A A .  76 PHE O    1 1 
        2  3136 1 1  77 GLU C    C   5.289  21.464  -0.931 1.00 . A A .  77 GLU C    1 1 
        2  3137 1 1  77 GLU CA   C   4.877  21.333   0.575 1.00 . A A .  77 GLU CA   1 1 
        2  3138 1 1  77 GLU CB   C   5.917  21.781   1.624 1.00 . A A .  77 GLU CB   1 1 
        2  3139 1 1  77 GLU CD   C   7.589  23.513   2.418 1.00 . A A .  77 GLU CD   1 1 
        2  3140 1 1  77 GLU CG   C   6.404  23.235   1.506 1.00 . A A .  77 GLU CG   1 1 
        2  3141 1 1  77 GLU H    H   5.296  19.271   1.271 1.00 . A A .  77 GLU H    1 1 
        2  3142 1 1  77 GLU HA   H   3.964  21.946   0.722 1.00 . A A .  77 GLU HA   1 1 
        2  3143 1 1  77 GLU HB2  H   5.488  21.639   2.638 1.00 . A A .  77 GLU HB2  1 1 
        2  3144 1 1  77 GLU HB3  H   6.793  21.103   1.592 1.00 . A A .  77 GLU HB3  1 1 
        2  3145 1 1  77 GLU HG2  H   6.733  23.485   0.484 1.00 . A A .  77 GLU HG2  1 1 
        2  3146 1 1  77 GLU HG3  H   5.601  23.951   1.753 1.00 . A A .  77 GLU HG3  1 1 
        2  3147 1 1  77 GLU N    N   4.568  19.904   0.902 1.00 . A A .  77 GLU N    1 1 
        2  3148 1 1  77 GLU O    O   4.467  21.845  -1.767 1.00 . A A .  77 GLU O    1 1 
        2  3149 1 1  77 GLU OE1  O   8.702  23.030   2.113 1.00 . A A .  77 GLU OE1  1 1 
        2  3150 1 1  77 GLU OE2  O   7.416  24.194   3.448 1.00 . A A .  77 GLU OE2  1 1 
        2  3151 1 1  78 ASN C    C   7.404  19.154  -2.515 1.00 . A A .  78 ASN C    1 1 
        2  3152 1 1  78 ASN CA   C   6.901  20.625  -2.629 1.00 . A A .  78 ASN CA   1 1 
        2  3153 1 1  78 ASN CB   C   7.874  21.638  -3.273 1.00 . A A .  78 ASN CB   1 1 
        2  3154 1 1  78 ASN CG   C   8.059  21.475  -4.777 1.00 . A A .  78 ASN CG   1 1 
        2  3155 1 1  78 ASN H    H   7.026  20.746  -0.422 1.00 . A A .  78 ASN H    1 1 
        2  3156 1 1  78 ASN HA   H   5.991  20.587  -3.260 1.00 . A A .  78 ASN HA   1 1 
        2  3157 1 1  78 ASN HB2  H   7.472  22.658  -3.115 1.00 . A A .  78 ASN HB2  1 1 
        2  3158 1 1  78 ASN HB3  H   8.857  21.654  -2.770 1.00 . A A .  78 ASN HB3  1 1 
        2  3159 1 1  78 ASN HD21 H   9.225  19.866  -4.565 1.00 . A A .  78 ASN HD21 1 1 
        2  3160 1 1  78 ASN HD22 H   8.720  20.384  -6.260 1.00 . A A .  78 ASN HD22 1 1 
        2  3161 1 1  78 ASN N    N   6.527  21.065  -1.259 1.00 . A A .  78 ASN N    1 1 
        2  3162 1 1  78 ASN ND2  N   8.828  20.520  -5.245 1.00 . A A .  78 ASN ND2  1 1 
        2  3163 1 1  78 ASN O    O   6.657  18.229  -2.839 1.00 . A A .  78 ASN O    1 1 
        2  3164 1 1  78 ASN OD1  O   7.471  22.198  -5.569 1.00 . A A .  78 ASN OD1  1 1 
        2  3165 1 1  79 GLU C    C   8.736  17.138  -0.200 1.00 . A A .  79 GLU C    1 1 
        2  3166 1 1  79 GLU CA   C   9.124  17.593  -1.644 1.00 . A A .  79 GLU CA   1 1 
        2  3167 1 1  79 GLU CB   C  10.657  17.534  -1.873 1.00 . A A .  79 GLU CB   1 1 
        2  3168 1 1  79 GLU CD   C  10.806  15.984  -3.988 1.00 . A A .  79 GLU CD   1 1 
        2  3169 1 1  79 GLU CG   C  11.113  17.324  -3.332 1.00 . A A .  79 GLU CG   1 1 
        2  3170 1 1  79 GLU H    H   9.115  19.790  -1.707 1.00 . A A .  79 GLU H    1 1 
        2  3171 1 1  79 GLU HA   H   8.667  16.839  -2.312 1.00 . A A .  79 GLU HA   1 1 
        2  3172 1 1  79 GLU HB2  H  11.142  18.449  -1.478 1.00 . A A .  79 GLU HB2  1 1 
        2  3173 1 1  79 GLU HB3  H  11.107  16.730  -1.263 1.00 . A A .  79 GLU HB3  1 1 
        2  3174 1 1  79 GLU HG2  H  10.718  18.118  -3.987 1.00 . A A .  79 GLU HG2  1 1 
        2  3175 1 1  79 GLU HG3  H  12.210  17.438  -3.378 1.00 . A A .  79 GLU HG3  1 1 
        2  3176 1 1  79 GLU N    N   8.627  18.941  -2.007 1.00 . A A .  79 GLU N    1 1 
        2  3177 1 1  79 GLU O    O   8.361  15.977  -0.036 1.00 . A A .  79 GLU O    1 1 
        2  3178 1 1  79 GLU OE1  O  10.852  14.930  -3.324 1.00 . A A .  79 GLU OE1  1 1 
        2  3179 1 1  79 GLU OE2  O  10.527  15.970  -5.205 1.00 . A A .  79 GLU OE2  1 1 
        2  3180 1 1  80 GLN C    C   7.321  17.043   2.685 1.00 . A A .  80 GLN C    1 1 
        2  3181 1 1  80 GLN CA   C   8.740  17.494   2.248 1.00 . A A .  80 GLN CA   1 1 
        2  3182 1 1  80 GLN CB   C   9.428  18.444   3.250 1.00 . A A .  80 GLN CB   1 1 
        2  3183 1 1  80 GLN CD   C   9.470  20.608   4.610 1.00 . A A .  80 GLN CD   1 1 
        2  3184 1 1  80 GLN CG   C   8.787  19.821   3.492 1.00 . A A .  80 GLN CG   1 1 
        2  3185 1 1  80 GLN H    H   8.787  18.979   0.600 1.00 . A A .  80 GLN H    1 1 
        2  3186 1 1  80 GLN HA   H   9.389  16.593   2.273 1.00 . A A .  80 GLN HA   1 1 
        2  3187 1 1  80 GLN HB2  H   9.499  17.891   4.211 1.00 . A A .  80 GLN HB2  1 1 
        2  3188 1 1  80 GLN HB3  H  10.483  18.578   2.934 1.00 . A A .  80 GLN HB3  1 1 
        2  3189 1 1  80 GLN HE21 H   9.391  22.303   3.541 1.00 . A A .  80 GLN HE21 1 1 
        2  3190 1 1  80 GLN HE22 H  10.119  22.344   5.232 1.00 . A A .  80 GLN HE22 1 1 
        2  3191 1 1  80 GLN HG2  H   8.787  20.406   2.553 1.00 . A A .  80 GLN HG2  1 1 
        2  3192 1 1  80 GLN HG3  H   7.723  19.715   3.770 1.00 . A A .  80 GLN HG3  1 1 
        2  3193 1 1  80 GLN N    N   8.827  17.985   0.846 1.00 . A A .  80 GLN N    1 1 
        2  3194 1 1  80 GLN NE2  N   9.802  21.857   4.393 1.00 . A A .  80 GLN NE2  1 1 
        2  3195 1 1  80 GLN O    O   6.321  17.714   2.406 1.00 . A A .  80 GLN O    1 1 
        2  3196 1 1  80 GLN OE1  O   9.693  20.121   5.714 1.00 . A A .  80 GLN OE1  1 1 
        2  3197 1 1  81 VAL C    C   5.361  15.598   4.940 1.00 . A A .  81 VAL C    1 1 
        2  3198 1 1  81 VAL CA   C   5.973  15.159   3.571 1.00 . A A .  81 VAL CA   1 1 
        2  3199 1 1  81 VAL CB   C   6.107  13.593   3.526 1.00 . A A .  81 VAL CB   1 1 
        2  3200 1 1  81 VAL CG1  C   4.725  12.948   3.278 1.00 . A A .  81 VAL CG1  1 1 
        2  3201 1 1  81 VAL CG2  C   7.112  13.030   2.508 1.00 . A A .  81 VAL CG2  1 1 
        2  3202 1 1  81 VAL H    H   8.163  15.420   3.506 1.00 . A A .  81 VAL H    1 1 
        2  3203 1 1  81 VAL HA   H   5.272  15.441   2.755 1.00 . A A .  81 VAL HA   1 1 
        2  3204 1 1  81 VAL HB   H   6.436  13.232   4.516 1.00 . A A .  81 VAL HB   1 1 
        2  3205 1 1  81 VAL HG11 H   4.005  13.207   4.077 1.00 . A A .  81 VAL HG11 1 1 
        2  3206 1 1  81 VAL HG12 H   4.282  13.281   2.324 1.00 . A A .  81 VAL HG12 1 1 
        2  3207 1 1  81 VAL HG13 H   4.784  11.844   3.251 1.00 . A A .  81 VAL HG13 1 1 
        2  3208 1 1  81 VAL HG21 H   6.986  11.945   2.339 1.00 . A A .  81 VAL HG21 1 1 
        2  3209 1 1  81 VAL HG22 H   7.079  13.538   1.530 1.00 . A A .  81 VAL HG22 1 1 
        2  3210 1 1  81 VAL HG23 H   8.145  13.160   2.863 1.00 . A A .  81 VAL HG23 1 1 
        2  3211 1 1  81 VAL N    N   7.255  15.871   3.336 1.00 . A A .  81 VAL N    1 1 
        2  3212 1 1  81 VAL O    O   6.007  15.498   5.988 1.00 . A A .  81 VAL O    1 1 
        2  3213 1 1  82 VAL C    C   2.670  15.229   6.784 1.00 . A A .  82 VAL C    1 1 
        2  3214 1 1  82 VAL CA   C   3.356  16.472   6.121 1.00 . A A .  82 VAL CA   1 1 
        2  3215 1 1  82 VAL CB   C   2.397  17.657   5.773 1.00 . A A .  82 VAL CB   1 1 
        2  3216 1 1  82 VAL CG1  C   1.611  18.168   7.000 1.00 . A A .  82 VAL CG1  1 1 
        2  3217 1 1  82 VAL CG2  C   3.135  18.884   5.173 1.00 . A A .  82 VAL CG2  1 1 
        2  3218 1 1  82 VAL H    H   3.657  16.040   3.974 1.00 . A A .  82 VAL H    1 1 
        2  3219 1 1  82 VAL HA   H   4.083  16.852   6.867 1.00 . A A .  82 VAL HA   1 1 
        2  3220 1 1  82 VAL HB   H   1.660  17.319   5.018 1.00 . A A .  82 VAL HB   1 1 
        2  3221 1 1  82 VAL HG11 H   2.278  18.540   7.801 1.00 . A A .  82 VAL HG11 1 1 
        2  3222 1 1  82 VAL HG12 H   0.931  18.998   6.730 1.00 . A A .  82 VAL HG12 1 1 
        2  3223 1 1  82 VAL HG13 H   0.975  17.383   7.447 1.00 . A A .  82 VAL HG13 1 1 
        2  3224 1 1  82 VAL HG21 H   3.645  18.650   4.218 1.00 . A A .  82 VAL HG21 1 1 
        2  3225 1 1  82 VAL HG22 H   2.433  19.709   4.949 1.00 . A A .  82 VAL HG22 1 1 
        2  3226 1 1  82 VAL HG23 H   3.906  19.285   5.857 1.00 . A A .  82 VAL HG23 1 1 
        2  3227 1 1  82 VAL N    N   4.103  16.040   4.907 1.00 . A A .  82 VAL N    1 1 
        2  3228 1 1  82 VAL O    O   3.071  14.851   7.886 1.00 . A A .  82 VAL O    1 1 
        2  3229 1 1  83 ARG C    C   0.413  12.507   5.421 1.00 . A A .  83 ARG C    1 1 
        2  3230 1 1  83 ARG CA   C   1.120  13.290   6.582 1.00 . A A .  83 ARG CA   1 1 
        2  3231 1 1  83 ARG CB   C   0.209  13.432   7.835 1.00 . A A .  83 ARG CB   1 1 
        2  3232 1 1  83 ARG CD   C  -2.225  13.661   8.692 1.00 . A A .  83 ARG CD   1 1 
        2  3233 1 1  83 ARG CG   C  -1.184  14.060   7.627 1.00 . A A .  83 ARG CG   1 1 
        2  3234 1 1  83 ARG CZ   C  -3.729  11.651   8.479 1.00 . A A .  83 ARG CZ   1 1 
        2  3235 1 1  83 ARG H    H   1.513  14.948   5.181 1.00 . A A .  83 ARG H    1 1 
        2  3236 1 1  83 ARG HA   H   1.980  12.658   6.892 1.00 . A A .  83 ARG HA   1 1 
        2  3237 1 1  83 ARG HB2  H   0.122  12.417   8.265 1.00 . A A .  83 ARG HB2  1 1 
        2  3238 1 1  83 ARG HB3  H   0.749  13.993   8.623 1.00 . A A .  83 ARG HB3  1 1 
        2  3239 1 1  83 ARG HD2  H  -1.847  13.891   9.709 1.00 . A A .  83 ARG HD2  1 1 
        2  3240 1 1  83 ARG HD3  H  -3.118  14.302   8.561 1.00 . A A .  83 ARG HD3  1 1 
        2  3241 1 1  83 ARG HE   H  -1.780  11.519   8.502 1.00 . A A .  83 ARG HE   1 1 
        2  3242 1 1  83 ARG HG2  H  -1.079  15.163   7.610 1.00 . A A .  83 ARG HG2  1 1 
        2  3243 1 1  83 ARG HG3  H  -1.604  13.816   6.631 1.00 . A A .  83 ARG HG3  1 1 
        2  3244 1 1  83 ARG HH11 H  -4.781  13.317   8.615 1.00 . A A .  83 ARG HH11 1 1 
        2  3245 1 1  83 ARG HH12 H  -5.725  11.775   8.224 1.00 . A A .  83 ARG HH12 1 1 
        2  3246 1 1  83 ARG HH21 H  -2.901   9.874   8.099 1.00 . A A .  83 ARG HH21 1 1 
        2  3247 1 1  83 ARG HH22 H  -4.735   9.939   8.166 1.00 . A A .  83 ARG HH22 1 1 
        2  3248 1 1  83 ARG N    N   1.676  14.594   6.129 1.00 . A A .  83 ARG N    1 1 
        2  3249 1 1  83 ARG NE   N  -2.531  12.209   8.585 1.00 . A A .  83 ARG NE   1 1 
        2  3250 1 1  83 ARG NH1  N  -4.859  12.308   8.514 1.00 . A A .  83 ARG NH1  1 1 
        2  3251 1 1  83 ARG NH2  N  -3.774  10.364   8.316 1.00 . A A .  83 ARG NH2  1 1 
        2  3252 1 1  83 ARG O    O  -0.021  13.100   4.429 1.00 . A A .  83 ARG O    1 1 
        2  3253 1 1  84 TRP C    C  -1.858   9.796   5.355 1.00 . A A .  84 TRP C    1 1 
        2  3254 1 1  84 TRP CA   C  -0.562  10.335   4.683 1.00 . A A .  84 TRP CA   1 1 
        2  3255 1 1  84 TRP CB   C   0.257   9.198   4.035 1.00 . A A .  84 TRP CB   1 1 
        2  3256 1 1  84 TRP CD1  C   0.875   6.975   5.370 1.00 . A A .  84 TRP CD1  1 1 
        2  3257 1 1  84 TRP CD2  C   2.446   8.562   5.347 1.00 . A A .  84 TRP CD2  1 1 
        2  3258 1 1  84 TRP CE2  C   2.908   7.440   6.080 1.00 . A A .  84 TRP CE2  1 1 
        2  3259 1 1  84 TRP CE3  C   3.306   9.692   5.147 1.00 . A A .  84 TRP CE3  1 1 
        2  3260 1 1  84 TRP CG   C   1.148   8.292   4.915 1.00 . A A .  84 TRP CG   1 1 
        2  3261 1 1  84 TRP CH2  C   5.025   8.567   6.449 1.00 . A A .  84 TRP CH2  1 1 
        2  3262 1 1  84 TRP CZ2  C   4.218   7.446   6.638 1.00 . A A .  84 TRP CZ2  1 1 
        2  3263 1 1  84 TRP CZ3  C   4.577   9.674   5.705 1.00 . A A .  84 TRP CZ3  1 1 
        2  3264 1 1  84 TRP H    H   0.737  10.782   6.396 1.00 . A A .  84 TRP H    1 1 
        2  3265 1 1  84 TRP HA   H  -0.883  10.943   3.817 1.00 . A A .  84 TRP HA   1 1 
        2  3266 1 1  84 TRP HB2  H  -0.427   8.562   3.442 1.00 . A A .  84 TRP HB2  1 1 
        2  3267 1 1  84 TRP HB3  H   0.925   9.645   3.279 1.00 . A A .  84 TRP HB3  1 1 
        2  3268 1 1  84 TRP HD1  H  -0.015   6.404   5.139 1.00 . A A .  84 TRP HD1  1 1 
        2  3269 1 1  84 TRP HE1  H   2.110   5.481   6.423 1.00 . A A .  84 TRP HE1  1 1 
        2  3270 1 1  84 TRP HE3  H   2.974  10.544   4.566 1.00 . A A .  84 TRP HE3  1 1 
        2  3271 1 1  84 TRP HH2  H   6.017   8.599   6.872 1.00 . A A .  84 TRP HH2  1 1 
        2  3272 1 1  84 TRP HZ2  H   4.578   6.589   7.195 1.00 . A A .  84 TRP HZ2  1 1 
        2  3273 1 1  84 TRP HZ3  H   5.238  10.519   5.564 1.00 . A A .  84 TRP HZ3  1 1 
        2  3274 1 1  84 TRP N    N   0.246  11.188   5.594 1.00 . A A .  84 TRP N    1 1 
        2  3275 1 1  84 TRP NE1  N   1.951   6.447   6.104 1.00 . A A .  84 TRP NE1  1 1 
        2  3276 1 1  84 TRP O    O  -1.824   9.227   6.451 1.00 . A A .  84 TRP O    1 1 
        2  3277 1 1  85 GLU C    C  -4.295   8.017   3.868 1.00 . A A .  85 GLU C    1 1 
        2  3278 1 1  85 GLU CA   C  -4.231   9.185   4.904 1.00 . A A .  85 GLU CA   1 1 
        2  3279 1 1  85 GLU CB   C  -5.424  10.168   4.795 1.00 . A A .  85 GLU CB   1 1 
        2  3280 1 1  85 GLU CD   C  -6.650  10.012   7.039 1.00 . A A .  85 GLU CD   1 1 
        2  3281 1 1  85 GLU CG   C  -6.698   9.728   5.549 1.00 . A A .  85 GLU CG   1 1 
        2  3282 1 1  85 GLU H    H  -2.879  10.475   3.759 1.00 . A A .  85 GLU H    1 1 
        2  3283 1 1  85 GLU HA   H  -4.220   8.771   5.932 1.00 . A A .  85 GLU HA   1 1 
        2  3284 1 1  85 GLU HB2  H  -5.137  11.174   5.166 1.00 . A A .  85 GLU HB2  1 1 
        2  3285 1 1  85 GLU HB3  H  -5.678  10.338   3.732 1.00 . A A .  85 GLU HB3  1 1 
        2  3286 1 1  85 GLU HG2  H  -7.574  10.264   5.145 1.00 . A A .  85 GLU HG2  1 1 
        2  3287 1 1  85 GLU HG3  H  -6.925   8.656   5.399 1.00 . A A .  85 GLU HG3  1 1 
        2  3288 1 1  85 GLU N    N  -2.984   9.948   4.644 1.00 . A A .  85 GLU N    1 1 
        2  3289 1 1  85 GLU O    O  -4.658   8.207   2.699 1.00 . A A .  85 GLU O    1 1 
        2  3290 1 1  85 GLU OE1  O  -6.091   9.191   7.795 1.00 . A A .  85 GLU OE1  1 1 
        2  3291 1 1  85 GLU OE2  O  -7.029  11.123   7.465 1.00 . A A .  85 GLU OE2  1 1 
        2  3292 1 1  86 GLY C    C  -4.780   4.580   3.550 1.00 . A A .  86 GLY C    1 1 
        2  3293 1 1  86 GLY CA   C  -3.716   5.663   3.382 1.00 . A A .  86 GLY CA   1 1 
        2  3294 1 1  86 GLY H    H  -3.621   6.783   5.286 1.00 . A A .  86 GLY H    1 1 
        2  3295 1 1  86 GLY HA2  H  -3.687   5.975   2.321 1.00 . A A .  86 GLY HA2  1 1 
        2  3296 1 1  86 GLY HA3  H  -2.732   5.198   3.561 1.00 . A A .  86 GLY HA3  1 1 
        2  3297 1 1  86 GLY N    N  -3.849   6.824   4.288 1.00 . A A .  86 GLY N    1 1 
        2  3298 1 1  86 GLY O    O  -4.475   3.475   4.007 1.00 . A A .  86 GLY O    1 1 
        2  3299 1 1  87 ASP C    C  -7.343   3.010   1.982 1.00 . A A .  87 ASP C    1 1 
        2  3300 1 1  87 ASP CA   C  -7.164   3.960   3.224 1.00 . A A .  87 ASP CA   1 1 
        2  3301 1 1  87 ASP CB   C  -8.434   4.807   3.486 1.00 . A A .  87 ASP CB   1 1 
        2  3302 1 1  87 ASP CG   C  -8.493   5.475   4.853 1.00 . A A .  87 ASP CG   1 1 
        2  3303 1 1  87 ASP H    H  -6.060   5.811   2.668 1.00 . A A .  87 ASP H    1 1 
        2  3304 1 1  87 ASP HA   H  -7.026   3.291   4.100 1.00 . A A .  87 ASP HA   1 1 
        2  3305 1 1  87 ASP HB2  H  -8.571   5.573   2.701 1.00 . A A .  87 ASP HB2  1 1 
        2  3306 1 1  87 ASP HB3  H  -9.335   4.170   3.423 1.00 . A A .  87 ASP HB3  1 1 
        2  3307 1 1  87 ASP N    N  -5.998   4.882   3.096 1.00 . A A .  87 ASP N    1 1 
        2  3308 1 1  87 ASP O    O  -8.447   2.806   1.467 1.00 . A A .  87 ASP O    1 1 
        2  3309 1 1  87 ASP OD1  O  -8.598   4.756   5.870 1.00 . A A .  87 ASP OD1  1 1 
        2  3310 1 1  87 ASP OD2  O  -8.454   6.722   4.911 1.00 . A A .  87 ASP OD2  1 1 
        2  3311 1 1  88 TYR C    C  -6.598   0.029   0.739 1.00 . A A .  88 TYR C    1 1 
        2  3312 1 1  88 TYR CA   C  -6.220   1.488   0.374 1.00 . A A .  88 TYR CA   1 1 
        2  3313 1 1  88 TYR CB   C  -4.871   1.652  -0.367 1.00 . A A .  88 TYR CB   1 1 
        2  3314 1 1  88 TYR CD1  C  -3.187   0.084   0.772 1.00 . A A .  88 TYR CD1  1 1 
        2  3315 1 1  88 TYR CD2  C  -2.593   2.402   0.464 1.00 . A A .  88 TYR CD2  1 1 
        2  3316 1 1  88 TYR CE1  C  -1.934  -0.158   1.340 1.00 . A A .  88 TYR CE1  1 1 
        2  3317 1 1  88 TYR CE2  C  -1.340   2.158   1.032 1.00 . A A .  88 TYR CE2  1 1 
        2  3318 1 1  88 TYR CG   C  -3.539   1.373   0.339 1.00 . A A .  88 TYR CG   1 1 
        2  3319 1 1  88 TYR CZ   C  -1.016   0.880   1.478 1.00 . A A .  88 TYR CZ   1 1 
        2  3320 1 1  88 TYR H    H  -5.403   2.629   2.085 1.00 . A A .  88 TYR H    1 1 
        2  3321 1 1  88 TYR HA   H  -6.973   1.859  -0.360 1.00 . A A .  88 TYR HA   1 1 
        2  3322 1 1  88 TYR HB2  H  -4.895   1.017  -1.268 1.00 . A A .  88 TYR HB2  1 1 
        2  3323 1 1  88 TYR HB3  H  -4.870   2.688  -0.769 1.00 . A A .  88 TYR HB3  1 1 
        2  3324 1 1  88 TYR HD1  H  -3.870  -0.748   0.649 1.00 . A A .  88 TYR HD1  1 1 
        2  3325 1 1  88 TYR HD2  H  -2.814   3.389   0.081 1.00 . A A .  88 TYR HD2  1 1 
        2  3326 1 1  88 TYR HE1  H  -1.669  -1.169   1.617 1.00 . A A .  88 TYR HE1  1 1 
        2  3327 1 1  88 TYR HE2  H  -0.605   2.954   1.090 1.00 . A A .  88 TYR HE2  1 1 
        2  3328 1 1  88 TYR HH   H   0.271  -0.294   2.227 1.00 . A A .  88 TYR HH   1 1 
        2  3329 1 1  88 TYR N    N  -6.240   2.396   1.539 1.00 . A A .  88 TYR N    1 1 
        2  3330 1 1  88 TYR O    O  -6.405  -0.423   1.873 1.00 . A A .  88 TYR O    1 1 
        2  3331 1 1  88 TYR OH   O   0.210   0.640   2.015 1.00 . A A .  88 TYR OH   1 1 
        2  3332 1 1  89 PHE C    C  -6.137  -3.042  -0.095 1.00 . A A .  89 PHE C    1 1 
        2  3333 1 1  89 PHE CA   C  -7.435  -2.166  -0.051 1.00 . A A .  89 PHE CA   1 1 
        2  3334 1 1  89 PHE CB   C  -8.469  -2.569  -1.127 1.00 . A A .  89 PHE CB   1 1 
        2  3335 1 1  89 PHE CD1  C  -8.405  -5.083  -1.578 1.00 . A A .  89 PHE CD1  1 1 
        2  3336 1 1  89 PHE CD2  C -10.203  -4.219  -0.218 1.00 . A A .  89 PHE CD2  1 1 
        2  3337 1 1  89 PHE CE1  C  -8.916  -6.373  -1.440 1.00 . A A .  89 PHE CE1  1 1 
        2  3338 1 1  89 PHE CE2  C -10.715  -5.511  -0.080 1.00 . A A .  89 PHE CE2  1 1 
        2  3339 1 1  89 PHE CG   C  -9.040  -3.989  -0.969 1.00 . A A .  89 PHE CG   1 1 
        2  3340 1 1  89 PHE CZ   C -10.071  -6.585  -0.692 1.00 . A A .  89 PHE CZ   1 1 
        2  3341 1 1  89 PHE H    H  -7.142  -0.260  -1.164 1.00 . A A .  89 PHE H    1 1 
        2  3342 1 1  89 PHE HA   H  -7.943  -2.276   0.927 1.00 . A A .  89 PHE HA   1 1 
        2  3343 1 1  89 PHE HB2  H  -9.311  -1.848  -1.110 1.00 . A A .  89 PHE HB2  1 1 
        2  3344 1 1  89 PHE HB3  H  -8.033  -2.464  -2.138 1.00 . A A .  89 PHE HB3  1 1 
        2  3345 1 1  89 PHE HD1  H  -7.495  -4.933  -2.147 1.00 . A A .  89 PHE HD1  1 1 
        2  3346 1 1  89 PHE HD2  H -10.713  -3.395   0.266 1.00 . A A .  89 PHE HD2  1 1 
        2  3347 1 1  89 PHE HE1  H  -8.408  -7.207  -1.909 1.00 . A A .  89 PHE HE1  1 1 
        2  3348 1 1  89 PHE HE2  H -11.612  -5.676   0.506 1.00 . A A .  89 PHE HE2  1 1 
        2  3349 1 1  89 PHE HZ   H -10.467  -7.587  -0.580 1.00 . A A .  89 PHE HZ   1 1 
        2  3350 1 1  89 PHE N    N  -7.115  -0.725  -0.243 1.00 . A A .  89 PHE N    1 1 
        2  3351 1 1  89 PHE O    O  -5.483  -3.053  -1.147 1.00 . A A .  89 PHE O    1 1 
        2  3352 1 1  90 PRO C    C  -4.483  -5.930   0.243 1.00 . A A .  90 PRO C    1 1 
        2  3353 1 1  90 PRO CA   C  -4.454  -4.559   0.969 1.00 . A A .  90 PRO CA   1 1 
        2  3354 1 1  90 PRO CB   C  -4.163  -4.640   2.495 1.00 . A A .  90 PRO CB   1 1 
        2  3355 1 1  90 PRO CD   C  -6.404  -3.787   2.291 1.00 . A A .  90 PRO CD   1 1 
        2  3356 1 1  90 PRO CG   C  -5.562  -4.750   3.142 1.00 . A A .  90 PRO CG   1 1 
        2  3357 1 1  90 PRO HA   H  -3.655  -3.943   0.508 1.00 . A A .  90 PRO HA   1 1 
        2  3358 1 1  90 PRO HB2  H  -3.490  -5.467   2.781 1.00 . A A .  90 PRO HB2  1 1 
        2  3359 1 1  90 PRO HB3  H  -3.672  -3.701   2.822 1.00 . A A .  90 PRO HB3  1 1 
        2  3360 1 1  90 PRO HD2  H  -7.464  -4.095   2.228 1.00 . A A .  90 PRO HD2  1 1 
        2  3361 1 1  90 PRO HD3  H  -6.365  -2.769   2.724 1.00 . A A .  90 PRO HD3  1 1 
        2  3362 1 1  90 PRO HG2  H  -5.944  -5.786   3.053 1.00 . A A .  90 PRO HG2  1 1 
        2  3363 1 1  90 PRO HG3  H  -5.559  -4.478   4.213 1.00 . A A .  90 PRO HG3  1 1 
        2  3364 1 1  90 PRO N    N  -5.746  -3.803   0.964 1.00 . A A .  90 PRO N    1 1 
        2  3365 1 1  90 PRO O    O  -4.246  -6.987   0.836 1.00 . A A .  90 PRO O    1 1 
        2  3366 1 1  91 SER C    C  -2.647  -7.004  -2.244 1.00 . A A .  91 SER C    1 1 
        2  3367 1 1  91 SER CA   C  -4.190  -7.018  -1.976 1.00 . A A .  91 SER CA   1 1 
        2  3368 1 1  91 SER CB   C  -5.022  -6.935  -3.273 1.00 . A A .  91 SER CB   1 1 
        2  3369 1 1  91 SER H    H  -4.781  -4.932  -1.432 1.00 . A A .  91 SER H    1 1 
        2  3370 1 1  91 SER HA   H  -4.440  -7.987  -1.496 1.00 . A A .  91 SER HA   1 1 
        2  3371 1 1  91 SER HB2  H  -6.098  -7.065  -3.046 1.00 . A A .  91 SER HB2  1 1 
        2  3372 1 1  91 SER HB3  H  -4.924  -5.938  -3.742 1.00 . A A .  91 SER HB3  1 1 
        2  3373 1 1  91 SER HG   H  -3.690  -7.729  -4.419 1.00 . A A .  91 SER HG   1 1 
        2  3374 1 1  91 SER N    N  -4.611  -5.888  -1.094 1.00 . A A .  91 SER N    1 1 
        2  3375 1 1  91 SER O    O  -2.173  -6.874  -3.377 1.00 . A A .  91 SER O    1 1 
        2  3376 1 1  91 SER OG   O  -4.616  -7.929  -4.218 1.00 . A A .  91 SER OG   1 1 
        2  3377 1 1  92 GLN C    C   0.573  -7.873  -1.393 1.00 . A A .  92 GLN C    1 1 
        2  3378 1 1  92 GLN CA   C  -0.455  -6.747  -1.105 1.00 . A A .  92 GLN CA   1 1 
        2  3379 1 1  92 GLN CB   C  -0.239  -5.963   0.218 1.00 . A A .  92 GLN CB   1 1 
        2  3380 1 1  92 GLN CD   C  -0.523  -5.823   2.776 1.00 . A A .  92 GLN CD   1 1 
        2  3381 1 1  92 GLN CG   C  -0.492  -6.717   1.542 1.00 . A A .  92 GLN CG   1 1 
        2  3382 1 1  92 GLN H    H  -2.471  -7.154  -0.309 1.00 . A A .  92 GLN H    1 1 
        2  3383 1 1  92 GLN HA   H  -0.275  -5.994  -1.904 1.00 . A A .  92 GLN HA   1 1 
        2  3384 1 1  92 GLN HB2  H   0.792  -5.558   0.224 1.00 . A A .  92 GLN HB2  1 1 
        2  3385 1 1  92 GLN HB3  H  -0.881  -5.058   0.165 1.00 . A A .  92 GLN HB3  1 1 
        2  3386 1 1  92 GLN HE21 H  -0.310  -7.410   3.949 1.00 . A A .  92 GLN HE21 1 1 
        2  3387 1 1  92 GLN HE22 H  -0.495  -5.762   4.733 1.00 . A A .  92 GLN HE22 1 1 
        2  3388 1 1  92 GLN HG2  H  -1.459  -7.251   1.510 1.00 . A A .  92 GLN HG2  1 1 
        2  3389 1 1  92 GLN HG3  H   0.274  -7.509   1.658 1.00 . A A .  92 GLN HG3  1 1 
        2  3390 1 1  92 GLN N    N  -1.885  -7.154  -1.155 1.00 . A A .  92 GLN N    1 1 
        2  3391 1 1  92 GLN NE2  N  -0.314  -6.386   3.941 1.00 . A A .  92 GLN NE2  1 1 
        2  3392 1 1  92 GLN O    O   1.494  -8.127  -0.612 1.00 . A A .  92 GLN O    1 1 
        2  3393 1 1  92 GLN OE1  O  -0.768  -4.621   2.736 1.00 . A A .  92 GLN OE1  1 1 
        2  3394 1 1  93 ASP C    C   1.002  -9.481  -4.729 1.00 . A A .  93 ASP C    1 1 
        2  3395 1 1  93 ASP CA   C   1.444  -9.315  -3.239 1.00 . A A .  93 ASP CA   1 1 
        2  3396 1 1  93 ASP CB   C   1.664 -10.664  -2.519 1.00 . A A .  93 ASP CB   1 1 
        2  3397 1 1  93 ASP CG   C   2.956 -11.348  -2.954 1.00 . A A .  93 ASP CG   1 1 
        2  3398 1 1  93 ASP H    H  -0.385  -8.076  -3.090 1.00 . A A .  93 ASP H    1 1 
        2  3399 1 1  93 ASP HA   H   2.401  -8.758  -3.219 1.00 . A A .  93 ASP HA   1 1 
        2  3400 1 1  93 ASP HB2  H   1.728 -10.518  -1.427 1.00 . A A .  93 ASP HB2  1 1 
        2  3401 1 1  93 ASP HB3  H   0.813 -11.349  -2.676 1.00 . A A .  93 ASP HB3  1 1 
        2  3402 1 1  93 ASP N    N   0.423  -8.465  -2.586 1.00 . A A .  93 ASP N    1 1 
        2  3403 1 1  93 ASP O    O   0.134 -10.300  -5.051 1.00 . A A .  93 ASP O    1 1 
        2  3404 1 1  93 ASP OD1  O   2.942 -12.105  -3.947 1.00 . A A .  93 ASP OD1  1 1 
        2  3405 1 1  93 ASP OD2  O   4.013 -11.086  -2.343 1.00 . A A .  93 ASP OD2  1 1 
        2  3406 1 1  94 GLU C    C   1.805  -9.846  -7.956 1.00 . A A .  94 GLU C    1 1 
        2  3407 1 1  94 GLU CA   C   1.195  -8.685  -7.076 1.00 . A A .  94 GLU CA   1 1 
        2  3408 1 1  94 GLU CB   C   1.475  -7.255  -7.627 1.00 . A A .  94 GLU CB   1 1 
        2  3409 1 1  94 GLU CD   C  -0.843  -6.380  -8.336 1.00 . A A .  94 GLU CD   1 1 
        2  3410 1 1  94 GLU CG   C   0.337  -6.230  -7.390 1.00 . A A .  94 GLU CG   1 1 
        2  3411 1 1  94 GLU H    H   2.173  -7.948  -5.238 1.00 . A A .  94 GLU H    1 1 
        2  3412 1 1  94 GLU HA   H   0.101  -8.844  -7.130 1.00 . A A .  94 GLU HA   1 1 
        2  3413 1 1  94 GLU HB2  H   2.418  -6.852  -7.207 1.00 . A A .  94 GLU HB2  1 1 
        2  3414 1 1  94 GLU HB3  H   1.680  -7.277  -8.716 1.00 . A A .  94 GLU HB3  1 1 
        2  3415 1 1  94 GLU HG2  H  -0.039  -6.260  -6.352 1.00 . A A .  94 GLU HG2  1 1 
        2  3416 1 1  94 GLU HG3  H   0.720  -5.203  -7.522 1.00 . A A .  94 GLU HG3  1 1 
        2  3417 1 1  94 GLU N    N   1.595  -8.692  -5.638 1.00 . A A .  94 GLU N    1 1 
        2  3418 1 1  94 GLU O    O   2.282  -9.624  -9.073 1.00 . A A .  94 GLU O    1 1 
        2  3419 1 1  94 GLU OE1  O  -0.713  -6.040  -9.533 1.00 . A A .  94 GLU OE1  1 1 
        2  3420 1 1  94 GLU OE2  O  -1.869  -6.964  -7.943 1.00 . A A .  94 GLU OE2  1 1 
        2  3421 1 1  95 GLN C    C   1.504 -13.574  -7.480 1.00 . A A .  95 GLN C    1 1 
        2  3422 1 1  95 GLN CA   C   2.085 -12.328  -8.232 1.00 . A A .  95 GLN CA   1 1 
        2  3423 1 1  95 GLN CB   C   3.628 -12.404  -8.387 1.00 . A A .  95 GLN CB   1 1 
        2  3424 1 1  95 GLN CD   C   5.656 -13.569  -9.430 1.00 . A A .  95 GLN CD   1 1 
        2  3425 1 1  95 GLN CG   C   4.138 -13.553  -9.279 1.00 . A A .  95 GLN CG   1 1 
        2  3426 1 1  95 GLN H    H   1.317 -11.121  -6.517 1.00 . A A .  95 GLN H    1 1 
        2  3427 1 1  95 GLN HA   H   1.626 -12.284  -9.240 1.00 . A A .  95 GLN HA   1 1 
        2  3428 1 1  95 GLN HB2  H   4.004 -11.448  -8.802 1.00 . A A .  95 GLN HB2  1 1 
        2  3429 1 1  95 GLN HB3  H   4.085 -12.483  -7.381 1.00 . A A .  95 GLN HB3  1 1 
        2  3430 1 1  95 GLN HE21 H   5.882 -14.190  -7.555 1.00 . A A .  95 GLN HE21 1 1 
        2  3431 1 1  95 GLN HE22 H   7.389 -13.896  -8.568 1.00 . A A .  95 GLN HE22 1 1 
        2  3432 1 1  95 GLN HG2  H   3.803 -14.535  -8.895 1.00 . A A .  95 GLN HG2  1 1 
        2  3433 1 1  95 GLN HG3  H   3.697 -13.472 -10.290 1.00 . A A .  95 GLN HG3  1 1 
        2  3434 1 1  95 GLN N    N   1.695 -11.100  -7.478 1.00 . A A .  95 GLN N    1 1 
        2  3435 1 1  95 GLN NE2  N   6.382 -14.015  -8.431 1.00 . A A .  95 GLN NE2  1 1 
        2  3436 1 1  95 GLN O    O   2.174 -14.151  -6.620 1.00 . A A .  95 GLN O    1 1 
        2  3437 1 1  95 GLN OE1  O   6.208 -13.186 -10.455 1.00 . A A .  95 GLN OE1  1 1 
        2  3438 1 1  96 LEU C    C  -0.782 -16.324  -7.804 1.00 . A A .  96 LEU C    1 1 
        2  3439 1 1  96 LEU CA   C  -0.462 -15.011  -7.008 1.00 . A A .  96 LEU CA   1 1 
        2  3440 1 1  96 LEU CB   C  -1.780 -14.396  -6.446 1.00 . A A .  96 LEU CB   1 1 
        2  3441 1 1  96 LEU CD1  C  -3.050 -12.850  -4.923 1.00 . A A .  96 LEU CD1  1 1 
        2  3442 1 1  96 LEU CD2  C  -0.827 -13.674  -4.156 1.00 . A A .  96 LEU CD2  1 1 
        2  3443 1 1  96 LEU CG   C  -1.644 -13.276  -5.390 1.00 . A A .  96 LEU CG   1 1 
        2  3444 1 1  96 LEU H    H  -0.220 -13.407  -8.492 1.00 . A A .  96 LEU H    1 1 
        2  3445 1 1  96 LEU HA   H   0.158 -15.322  -6.147 1.00 . A A .  96 LEU HA   1 1 
        2  3446 1 1  96 LEU HB2  H  -2.387 -14.015  -7.291 1.00 . A A .  96 LEU HB2  1 1 
        2  3447 1 1  96 LEU HB3  H  -2.397 -15.205  -6.005 1.00 . A A .  96 LEU HB3  1 1 
        2  3448 1 1  96 LEU HD11 H  -3.580 -13.661  -4.391 1.00 . A A .  96 LEU HD11 1 1 
        2  3449 1 1  96 LEU HD12 H  -3.002 -11.987  -4.233 1.00 . A A .  96 LEU HD12 1 1 
        2  3450 1 1  96 LEU HD13 H  -3.694 -12.544  -5.765 1.00 . A A .  96 LEU HD13 1 1 
        2  3451 1 1  96 LEU HD21 H  -0.834 -12.870  -3.397 1.00 . A A .  96 LEU HD21 1 1 
        2  3452 1 1  96 LEU HD22 H  -1.203 -14.589  -3.665 1.00 . A A .  96 LEU HD22 1 1 
        2  3453 1 1  96 LEU HD23 H   0.240 -13.838  -4.398 1.00 . A A .  96 LEU HD23 1 1 
        2  3454 1 1  96 LEU HG   H  -1.158 -12.393  -5.853 1.00 . A A .  96 LEU HG   1 1 
        2  3455 1 1  96 LEU N    N   0.265 -13.985  -7.804 1.00 . A A .  96 LEU N    1 1 
        2  3456 1 1  96 LEU O    O  -0.841 -16.358  -9.039 1.00 . A A .  96 LEU O    1 1 
        2  3457 1 1  97 ALA C    C  -3.277 -18.379  -7.819 1.00 . A A .  97 ALA C    1 1 
        2  3458 1 1  97 ALA CA   C  -1.749 -18.605  -7.579 1.00 . A A .  97 ALA CA   1 1 
        2  3459 1 1  97 ALA CB   C  -1.505 -19.725  -6.554 1.00 . A A .  97 ALA CB   1 1 
        2  3460 1 1  97 ALA H    H  -0.964 -17.251  -6.046 1.00 . A A .  97 ALA H    1 1 
        2  3461 1 1  97 ALA HA   H  -1.269 -18.902  -8.530 1.00 . A A .  97 ALA HA   1 1 
        2  3462 1 1  97 ALA HB1  H  -1.941 -19.495  -5.564 1.00 . A A .  97 ALA HB1  1 1 
        2  3463 1 1  97 ALA HB2  H  -1.943 -20.687  -6.877 1.00 . A A .  97 ALA HB2  1 1 
        2  3464 1 1  97 ALA HB3  H  -0.425 -19.911  -6.401 1.00 . A A .  97 ALA HB3  1 1 
        2  3465 1 1  97 ALA N    N  -1.050 -17.406  -7.053 1.00 . A A .  97 ALA N    1 1 
        2  3466 1 1  97 ALA O    O  -3.894 -17.497  -7.212 1.00 . A A .  97 ALA O    1 1 
        2  3467 1 1  98 LYS C    C  -6.321 -19.451  -8.061 1.00 . A A .  98 LYS C    1 1 
        2  3468 1 1  98 LYS CA   C  -5.307 -18.946  -9.128 1.00 . A A .  98 LYS CA   1 1 
        2  3469 1 1  98 LYS CB   C  -5.521 -19.585 -10.530 1.00 . A A .  98 LYS CB   1 1 
        2  3470 1 1  98 LYS CD   C  -8.094 -19.600 -10.927 1.00 . A A .  98 LYS CD   1 1 
        2  3471 1 1  98 LYS CE   C  -9.255 -18.662 -11.291 1.00 . A A .  98 LYS CE   1 1 
        2  3472 1 1  98 LYS CG   C  -6.724 -19.030 -11.326 1.00 . A A .  98 LYS CG   1 1 
        2  3473 1 1  98 LYS H    H  -3.349 -19.981  -9.025 1.00 . A A .  98 LYS H    1 1 
        2  3474 1 1  98 LYS HA   H  -5.445 -17.855  -9.267 1.00 . A A .  98 LYS HA   1 1 
        2  3475 1 1  98 LYS HB2  H  -4.626 -19.377 -11.151 1.00 . A A .  98 LYS HB2  1 1 
        2  3476 1 1  98 LYS HB3  H  -5.566 -20.690 -10.461 1.00 . A A .  98 LYS HB3  1 1 
        2  3477 1 1  98 LYS HD2  H  -8.225 -20.593 -11.401 1.00 . A A .  98 LYS HD2  1 1 
        2  3478 1 1  98 LYS HD3  H  -8.130 -19.813  -9.844 1.00 . A A .  98 LYS HD3  1 1 
        2  3479 1 1  98 LYS HE2  H  -9.040 -17.630 -10.931 1.00 . A A .  98 LYS HE2  1 1 
        2  3480 1 1  98 LYS HE3  H  -9.356 -18.567 -12.395 1.00 . A A .  98 LYS HE3  1 1 
        2  3481 1 1  98 LYS HG2  H  -6.707 -17.923 -11.271 1.00 . A A .  98 LYS HG2  1 1 
        2  3482 1 1  98 LYS HG3  H  -6.559 -19.247 -12.401 1.00 . A A .  98 LYS HG3  1 1 
        2  3483 1 1  98 LYS HZ1  H -10.746 -20.127 -10.961 1.00 . A A .  98 LYS HZ1  1 1 
        2  3484 1 1  98 LYS HZ2  H -10.364 -19.256  -9.615 1.00 . A A .  98 LYS HZ2  1 1 
        2  3485 1 1  98 LYS HZ3  H -11.321 -18.584 -10.774 1.00 . A A .  98 LYS HZ3  1 1 
        2  3486 1 1  98 LYS N    N  -3.889 -19.166  -8.721 1.00 . A A .  98 LYS N    1 1 
        2  3487 1 1  98 LYS NZ   N -10.493 -19.181 -10.650 1.00 . A A .  98 LYS NZ   1 1 
        2  3488 1 1  98 LYS O    O  -6.500 -20.659  -7.892 1.00 . A A .  98 LYS O    1 1 
        2  3489 1 1  99 ALA C    C  -9.515 -18.419  -7.071 1.00 . A A .  99 ALA C    1 1 
        2  3490 1 1  99 ALA CA   C  -8.132 -18.825  -6.475 1.00 . A A .  99 ALA CA   1 1 
        2  3491 1 1  99 ALA CB   C  -7.741 -18.229  -5.116 1.00 . A A .  99 ALA CB   1 1 
        2  3492 1 1  99 ALA H    H  -6.601 -17.581  -7.452 1.00 . A A .  99 ALA H    1 1 
        2  3493 1 1  99 ALA HA   H  -8.193 -19.921  -6.324 1.00 . A A .  99 ALA HA   1 1 
        2  3494 1 1  99 ALA HB1  H  -7.594 -17.133  -5.142 1.00 . A A .  99 ALA HB1  1 1 
        2  3495 1 1  99 ALA HB2  H  -8.496 -18.439  -4.337 1.00 . A A .  99 ALA HB2  1 1 
        2  3496 1 1  99 ALA HB3  H  -6.791 -18.670  -4.755 1.00 . A A .  99 ALA HB3  1 1 
        2  3497 1 1  99 ALA N    N  -7.031 -18.509  -7.418 1.00 . A A .  99 ALA N    1 1 
        2  3498 1 1  99 ALA O    O -10.047 -19.161  -7.905 1.00 . A A .  99 ALA O    1 1 
        2  3499 1 1 100 ALA C    C -11.544 -16.222  -8.517 1.00 . A A . 100 ALA C    1 1 
        2  3500 1 1 100 ALA CA   C -11.476 -16.889  -7.105 1.00 . A A . 100 ALA CA   1 1 
        2  3501 1 1 100 ALA CB   C -12.003 -15.930  -6.024 1.00 . A A . 100 ALA CB   1 1 
        2  3502 1 1 100 ALA H    H  -9.593 -16.741  -5.973 1.00 . A A . 100 ALA H    1 1 
        2  3503 1 1 100 ALA HA   H -12.117 -17.792  -7.075 1.00 . A A . 100 ALA HA   1 1 
        2  3504 1 1 100 ALA HB1  H -11.415 -14.996  -5.962 1.00 . A A . 100 ALA HB1  1 1 
        2  3505 1 1 100 ALA HB2  H -13.052 -15.636  -6.211 1.00 . A A . 100 ALA HB2  1 1 
        2  3506 1 1 100 ALA HB3  H -11.982 -16.396  -5.020 1.00 . A A . 100 ALA HB3  1 1 
        2  3507 1 1 100 ALA N    N -10.104 -17.274  -6.683 1.00 . A A . 100 ALA N    1 1 
        2  3508 1 1 100 ALA O    O -10.659 -15.417  -8.818 1.00 . A A . 100 ALA O    1 1 
        2  3509 1 1 101 PRO C    C -13.076 -14.423 -10.860 1.00 . A A . 101 PRO C    1 1 
        2  3510 1 1 101 PRO CA   C -12.561 -15.890 -10.789 1.00 . A A . 101 PRO CA   1 1 
        2  3511 1 1 101 PRO CB   C -13.469 -16.905 -11.543 1.00 . A A . 101 PRO CB   1 1 
        2  3512 1 1 101 PRO CD   C -13.639 -17.450  -9.176 1.00 . A A . 101 PRO CD   1 1 
        2  3513 1 1 101 PRO CG   C -14.467 -17.399 -10.470 1.00 . A A . 101 PRO CG   1 1 
        2  3514 1 1 101 PRO HA   H -11.550 -15.939 -11.242 1.00 . A A . 101 PRO HA   1 1 
        2  3515 1 1 101 PRO HB2  H -13.982 -16.470 -12.421 1.00 . A A . 101 PRO HB2  1 1 
        2  3516 1 1 101 PRO HB3  H -12.863 -17.748 -11.922 1.00 . A A . 101 PRO HB3  1 1 
        2  3517 1 1 101 PRO HD2  H -14.247 -17.167  -8.295 1.00 . A A . 101 PRO HD2  1 1 
        2  3518 1 1 101 PRO HD3  H -13.244 -18.470  -9.004 1.00 . A A . 101 PRO HD3  1 1 
        2  3519 1 1 101 PRO HG2  H -15.288 -16.663 -10.362 1.00 . A A . 101 PRO HG2  1 1 
        2  3520 1 1 101 PRO HG3  H -14.930 -18.369 -10.725 1.00 . A A . 101 PRO HG3  1 1 
        2  3521 1 1 101 PRO N    N -12.535 -16.491  -9.413 1.00 . A A . 101 PRO N    1 1 
        2  3522 1 1 101 PRO O    O -14.262 -14.168 -11.083 1.00 . A A . 101 PRO O    1 1 
        2  3523 1 1 102 LYS C    C -11.332 -11.339 -11.815 1.00 . A A . 102 LYS C    1 1 
        2  3524 1 1 102 LYS CA   C -12.462 -12.014 -10.982 1.00 . A A . 102 LYS CA   1 1 
        2  3525 1 1 102 LYS CB   C -12.779 -11.348  -9.625 1.00 . A A . 102 LYS CB   1 1 
        2  3526 1 1 102 LYS CD   C -14.585  -9.633 -10.324 1.00 . A A . 102 LYS CD   1 1 
        2  3527 1 1 102 LYS CE   C -15.098  -8.182 -10.222 1.00 . A A . 102 LYS CE   1 1 
        2  3528 1 1 102 LYS CG   C -13.238  -9.876  -9.628 1.00 . A A . 102 LYS CG   1 1 
        2  3529 1 1 102 LYS H    H -11.275 -13.778 -10.304 1.00 . A A . 102 LYS H    1 1 
        2  3530 1 1 102 LYS HA   H -13.375 -11.945 -11.606 1.00 . A A . 102 LYS HA   1 1 
        2  3531 1 1 102 LYS HB2  H -13.550 -11.956  -9.108 1.00 . A A . 102 LYS HB2  1 1 
        2  3532 1 1 102 LYS HB3  H -11.883 -11.419  -8.981 1.00 . A A . 102 LYS HB3  1 1 
        2  3533 1 1 102 LYS HD2  H -14.476  -9.878 -11.401 1.00 . A A . 102 LYS HD2  1 1 
        2  3534 1 1 102 LYS HD3  H -15.351 -10.346  -9.958 1.00 . A A . 102 LYS HD3  1 1 
        2  3535 1 1 102 LYS HE2  H -14.289  -7.468 -10.498 1.00 . A A . 102 LYS HE2  1 1 
        2  3536 1 1 102 LYS HE3  H -15.876  -8.029 -11.005 1.00 . A A . 102 LYS HE3  1 1 
        2  3537 1 1 102 LYS HG2  H -13.287  -9.560  -8.567 1.00 . A A . 102 LYS HG2  1 1 
        2  3538 1 1 102 LYS HG3  H -12.450  -9.236 -10.072 1.00 . A A . 102 LYS HG3  1 1 
        2  3539 1 1 102 LYS HZ1  H -16.431  -8.503  -8.616 1.00 . A A . 102 LYS HZ1  1 1 
        2  3540 1 1 102 LYS HZ2  H -14.960  -7.983  -8.123 1.00 . A A . 102 LYS HZ2  1 1 
        2  3541 1 1 102 LYS HZ3  H -16.023  -6.919  -8.786 1.00 . A A . 102 LYS HZ3  1 1 
        2  3542 1 1 102 LYS N    N -12.156 -13.456 -10.723 1.00 . A A . 102 LYS N    1 1 
        2  3543 1 1 102 LYS NZ   N -15.656  -7.877  -8.872 1.00 . A A . 102 LYS NZ   1 1 
        2  3544 1 1 102 LYS O    O -10.595 -10.476 -11.330 1.00 . A A . 102 LYS O    1 1 
        2  3545 1 1 103 GLN C    C -10.923  -9.738 -14.629 1.00 . A A . 103 GLN C    1 1 
        2  3546 1 1 103 GLN CA   C -10.313 -11.059 -14.072 1.00 . A A . 103 GLN CA   1 1 
        2  3547 1 1 103 GLN CB   C -10.010 -12.114 -15.167 1.00 . A A . 103 GLN CB   1 1 
        2  3548 1 1 103 GLN CD   C  -8.629 -12.747 -17.223 1.00 . A A . 103 GLN CD   1 1 
        2  3549 1 1 103 GLN CG   C  -8.893 -11.698 -16.150 1.00 . A A . 103 GLN CG   1 1 
        2  3550 1 1 103 GLN H    H -11.960 -12.382 -13.392 1.00 . A A . 103 GLN H    1 1 
        2  3551 1 1 103 GLN HA   H  -9.354 -10.840 -13.554 1.00 . A A . 103 GLN HA   1 1 
        2  3552 1 1 103 GLN HB2  H  -9.709 -13.064 -14.678 1.00 . A A . 103 GLN HB2  1 1 
        2  3553 1 1 103 GLN HB3  H -10.935 -12.351 -15.732 1.00 . A A . 103 GLN HB3  1 1 
        2  3554 1 1 103 GLN HE21 H  -9.596 -11.653 -18.595 1.00 . A A . 103 GLN HE21 1 1 
        2  3555 1 1 103 GLN HE22 H  -8.862 -13.273 -19.106 1.00 . A A . 103 GLN HE22 1 1 
        2  3556 1 1 103 GLN HG2  H  -9.125 -10.721 -16.617 1.00 . A A . 103 GLN HG2  1 1 
        2  3557 1 1 103 GLN HG3  H  -7.947 -11.530 -15.603 1.00 . A A . 103 GLN HG3  1 1 
        2  3558 1 1 103 GLN N    N -11.262 -11.689 -13.110 1.00 . A A . 103 GLN N    1 1 
        2  3559 1 1 103 GLN NE2  N  -9.084 -12.536 -18.434 1.00 . A A . 103 GLN NE2  1 1 
        2  3560 1 1 103 GLN O    O -11.633  -9.730 -15.638 1.00 . A A . 103 GLN O    1 1 
        2  3561 1 1 103 GLN OE1  O  -8.006 -13.777 -16.988 1.00 . A A . 103 GLN OE1  1 1 
        2  3562 1 1 104 PHE C    C -10.486  -6.151 -14.675 1.00 . A A . 104 PHE C    1 1 
        2  3563 1 1 104 PHE CA   C -11.377  -7.336 -14.157 1.00 . A A . 104 PHE CA   1 1 
        2  3564 1 1 104 PHE CB   C -12.102  -7.060 -12.810 1.00 . A A . 104 PHE CB   1 1 
        2  3565 1 1 104 PHE CD1  C -14.414  -6.237 -13.514 1.00 . A A . 104 PHE CD1  1 1 
        2  3566 1 1 104 PHE CD2  C -13.061  -4.789 -12.133 1.00 . A A . 104 PHE CD2  1 1 
        2  3567 1 1 104 PHE CE1  C -15.437  -5.288 -13.508 1.00 . A A . 104 PHE CE1  1 1 
        2  3568 1 1 104 PHE CE2  C -14.084  -3.839 -12.128 1.00 . A A . 104 PHE CE2  1 1 
        2  3569 1 1 104 PHE CG   C -13.209  -5.998 -12.832 1.00 . A A . 104 PHE CG   1 1 
        2  3570 1 1 104 PHE CZ   C -15.270  -4.090 -12.816 1.00 . A A . 104 PHE CZ   1 1 
        2  3571 1 1 104 PHE H    H -10.218  -8.856 -13.019 1.00 . A A . 104 PHE H    1 1 
        2  3572 1 1 104 PHE HA   H -12.161  -7.472 -14.927 1.00 . A A . 104 PHE HA   1 1 
        2  3573 1 1 104 PHE HB2  H -12.586  -7.998 -12.463 1.00 . A A . 104 PHE HB2  1 1 
        2  3574 1 1 104 PHE HB3  H -11.357  -6.832 -12.025 1.00 . A A . 104 PHE HB3  1 1 
        2  3575 1 1 104 PHE HD1  H -14.560  -7.164 -14.057 1.00 . A A . 104 PHE HD1  1 1 
        2  3576 1 1 104 PHE HD2  H -12.154  -4.574 -11.585 1.00 . A A . 104 PHE HD2  1 1 
        2  3577 1 1 104 PHE HE1  H -16.357  -5.481 -14.046 1.00 . A A . 104 PHE HE1  1 1 
        2  3578 1 1 104 PHE HE2  H -13.954  -2.908 -11.590 1.00 . A A . 104 PHE HE2  1 1 
        2  3579 1 1 104 PHE HZ   H -16.062  -3.351 -12.815 1.00 . A A . 104 PHE HZ   1 1 
        2  3580 1 1 104 PHE N    N -10.667  -8.634 -13.917 1.00 . A A . 104 PHE N    1 1 
        2  3581 1 1 104 PHE O    O -10.877  -4.986 -14.547 1.00 . A A . 104 PHE O    1 1 
        2  3582 1 1 105 GLY C    C  -8.539  -4.833 -17.086 1.00 . A A . 105 GLY C    1 1 
        2  3583 1 1 105 GLY CA   C  -8.341  -5.386 -15.671 1.00 . A A . 105 GLY CA   1 1 
        2  3584 1 1 105 GLY H    H  -9.078  -7.428 -15.230 1.00 . A A . 105 GLY H    1 1 
        2  3585 1 1 105 GLY HA2  H  -8.356  -4.542 -14.958 1.00 . A A . 105 GLY HA2  1 1 
        2  3586 1 1 105 GLY HA3  H  -7.318  -5.794 -15.563 1.00 . A A . 105 GLY HA3  1 1 
        2  3587 1 1 105 GLY N    N  -9.317  -6.429 -15.279 1.00 . A A . 105 GLY N    1 1 
        2  3588 1 1 105 GLY O    O  -9.206  -3.811 -17.258 1.00 . A A . 105 GLY O    1 1 
        2  3589 1 1 106 ARG C    C  -8.379  -6.443 -20.318 1.00 . A A . 106 ARG C    1 1 
        2  3590 1 1 106 ARG CA   C  -8.103  -5.142 -19.512 1.00 . A A . 106 ARG CA   1 1 
        2  3591 1 1 106 ARG CB   C  -6.828  -4.382 -19.964 1.00 . A A . 106 ARG CB   1 1 
        2  3592 1 1 106 ARG CD   C  -5.603  -3.092 -21.787 1.00 . A A . 106 ARG CD   1 1 
        2  3593 1 1 106 ARG CG   C  -6.901  -3.819 -21.400 1.00 . A A . 106 ARG CG   1 1 
        2  3594 1 1 106 ARG CZ   C  -6.105  -1.383 -23.557 1.00 . A A . 106 ARG CZ   1 1 
        2  3595 1 1 106 ARG H    H  -7.465  -6.362 -17.782 1.00 . A A . 106 ARG H    1 1 
        2  3596 1 1 106 ARG HA   H  -8.969  -4.458 -19.642 1.00 . A A . 106 ARG HA   1 1 
        2  3597 1 1 106 ARG HB2  H  -6.649  -3.545 -19.258 1.00 . A A . 106 ARG HB2  1 1 
        2  3598 1 1 106 ARG HB3  H  -5.944  -5.045 -19.863 1.00 . A A . 106 ARG HB3  1 1 
        2  3599 1 1 106 ARG HD2  H  -5.347  -2.291 -21.065 1.00 . A A . 106 ARG HD2  1 1 
        2  3600 1 1 106 ARG HD3  H  -4.753  -3.801 -21.714 1.00 . A A . 106 ARG HD3  1 1 
        2  3601 1 1 106 ARG HE   H  -5.327  -3.154 -23.964 1.00 . A A . 106 ARG HE   1 1 
        2  3602 1 1 106 ARG HG2  H  -7.086  -4.643 -22.120 1.00 . A A . 106 ARG HG2  1 1 
        2  3603 1 1 106 ARG HG3  H  -7.771  -3.141 -21.496 1.00 . A A . 106 ARG HG3  1 1 
        2  3604 1 1 106 ARG HH11 H  -6.623  -0.808 -21.755 1.00 . A A . 106 ARG HH11 1 1 
        2  3605 1 1 106 ARG HH12 H  -6.902   0.405 -23.096 1.00 . A A . 106 ARG HH12 1 1 
        2  3606 1 1 106 ARG HH21 H  -5.657  -1.768 -25.456 1.00 . A A . 106 ARG HH21 1 1 
        2  3607 1 1 106 ARG HH22 H  -6.381  -0.143 -25.086 1.00 . A A . 106 ARG HH22 1 1 
        2  3608 1 1 106 ARG N    N  -7.939  -5.502 -18.078 1.00 . A A . 106 ARG N    1 1 
        2  3609 1 1 106 ARG NE   N  -5.671  -2.586 -23.184 1.00 . A A . 106 ARG NE   1 1 
        2  3610 1 1 106 ARG NH1  N  -6.593  -0.496 -22.727 1.00 . A A . 106 ARG NH1  1 1 
        2  3611 1 1 106 ARG NH2  N  -6.046  -1.071 -24.818 1.00 . A A . 106 ARG NH2  1 1 
        2  3612 1 1 106 ARG O    O  -7.448  -7.121 -20.766 1.00 . A A . 106 ARG O    1 1 
        2  3613 1 1 107 ASN C    C -10.171  -7.809 -22.754 1.00 . A A . 107 ASN C    1 1 
        2  3614 1 1 107 ASN CA   C -10.054  -8.040 -21.212 1.00 . A A . 107 ASN CA   1 1 
        2  3615 1 1 107 ASN CB   C -11.369  -8.591 -20.603 1.00 . A A . 107 ASN CB   1 1 
        2  3616 1 1 107 ASN CG   C -11.235  -9.114 -19.177 1.00 . A A . 107 ASN CG   1 1 
        2  3617 1 1 107 ASN H    H -10.345  -6.192 -20.028 1.00 . A A . 107 ASN H    1 1 
        2  3618 1 1 107 ASN HA   H  -9.275  -8.820 -21.056 1.00 . A A . 107 ASN HA   1 1 
        2  3619 1 1 107 ASN HB2  H -12.180  -7.842 -20.691 1.00 . A A . 107 ASN HB2  1 1 
        2  3620 1 1 107 ASN HB3  H -11.717  -9.445 -21.215 1.00 . A A . 107 ASN HB3  1 1 
        2  3621 1 1 107 ASN HD21 H -12.656  -7.870 -18.521 1.00 . A A . 107 ASN HD21 1 1 
        2  3622 1 1 107 ASN HD22 H -11.861  -9.018 -17.313 1.00 . A A . 107 ASN HD22 1 1 
        2  3623 1 1 107 ASN N    N  -9.662  -6.783 -20.512 1.00 . A A . 107 ASN N    1 1 
        2  3624 1 1 107 ASN ND2  N -11.961  -8.563 -18.235 1.00 . A A . 107 ASN ND2  1 1 
        2  3625 1 1 107 ASN O    O -11.259  -7.607 -23.302 1.00 . A A . 107 ASN O    1 1 
        2  3626 1 1 107 ASN OD1  O -10.477 -10.035 -18.894 1.00 . A A . 107 ASN OD1  1 1 
        2  3627 1 1 108 LEU C    C  -9.205  -8.803 -25.785 1.00 . A A . 108 LEU C    1 1 
        2  3628 1 1 108 LEU CA   C  -8.929  -7.559 -24.894 1.00 . A A . 108 LEU CA   1 1 
        2  3629 1 1 108 LEU CB   C  -7.640  -6.758 -25.212 1.00 . A A . 108 LEU CB   1 1 
        2  3630 1 1 108 LEU CD1  C  -5.208  -6.424 -25.719 1.00 . A A . 108 LEU CD1  1 1 
        2  3631 1 1 108 LEU CD2  C  -5.795  -7.744 -23.688 1.00 . A A . 108 LEU CD2  1 1 
        2  3632 1 1 108 LEU CG   C  -6.243  -7.401 -25.112 1.00 . A A . 108 LEU CG   1 1 
        2  3633 1 1 108 LEU H    H  -8.186  -7.883 -22.842 1.00 . A A . 108 LEU H    1 1 
        2  3634 1 1 108 LEU HA   H  -9.723  -6.818 -25.136 1.00 . A A . 108 LEU HA   1 1 
        2  3635 1 1 108 LEU HB2  H  -7.767  -6.388 -26.250 1.00 . A A . 108 LEU HB2  1 1 
        2  3636 1 1 108 LEU HB3  H  -7.663  -5.834 -24.599 1.00 . A A . 108 LEU HB3  1 1 
        2  3637 1 1 108 LEU HD11 H  -4.192  -6.860 -25.719 1.00 . A A . 108 LEU HD11 1 1 
        2  3638 1 1 108 LEU HD12 H  -5.441  -6.182 -26.772 1.00 . A A . 108 LEU HD12 1 1 
        2  3639 1 1 108 LEU HD13 H  -5.153  -5.471 -25.163 1.00 . A A . 108 LEU HD13 1 1 
        2  3640 1 1 108 LEU HD21 H  -6.388  -8.565 -23.249 1.00 . A A . 108 LEU HD21 1 1 
        2  3641 1 1 108 LEU HD22 H  -4.747  -8.097 -23.669 1.00 . A A . 108 LEU HD22 1 1 
        2  3642 1 1 108 LEU HD23 H  -5.859  -6.885 -22.997 1.00 . A A . 108 LEU HD23 1 1 
        2  3643 1 1 108 LEU HG   H  -6.203  -8.326 -25.722 1.00 . A A . 108 LEU HG   1 1 
        2  3644 1 1 108 LEU N    N  -9.019  -7.847 -23.440 1.00 . A A . 108 LEU N    1 1 
        2  3645 1 1 108 LEU O    O  -8.296  -9.453 -26.309 1.00 . A A . 108 LEU O    1 1 
        2  3646 1 1 109 ALA C    C -11.017  -9.988 -28.278 1.00 . A A . 109 ALA C    1 1 
        2  3647 1 1 109 ALA CA   C -10.930 -10.292 -26.763 1.00 . A A . 109 ALA CA   1 1 
        2  3648 1 1 109 ALA CB   C -12.247 -10.798 -26.176 1.00 . A A . 109 ALA CB   1 1 
        2  3649 1 1 109 ALA H    H -11.145  -8.591 -25.376 1.00 . A A . 109 ALA H    1 1 
        2  3650 1 1 109 ALA HA   H -10.215 -11.127 -26.586 1.00 . A A . 109 ALA HA   1 1 
        2  3651 1 1 109 ALA HB1  H -12.665 -11.636 -26.763 1.00 . A A . 109 ALA HB1  1 1 
        2  3652 1 1 109 ALA HB2  H -12.045 -11.191 -25.169 1.00 . A A . 109 ALA HB2  1 1 
        2  3653 1 1 109 ALA HB3  H -13.031 -10.022 -26.107 1.00 . A A . 109 ALA HB3  1 1 
        2  3654 1 1 109 ALA N    N -10.498  -9.121 -25.969 1.00 . A A . 109 ALA N    1 1 
        2  3655 1 1 109 ALA O    O -11.976  -9.412 -28.797 1.00 . A A . 109 ALA O    1 1 
        2  3656 1 1 110 ARG C    C -10.236 -11.410 -31.217 1.00 . A A . 110 ARG C    1 1 
        2  3657 1 1 110 ARG CA   C  -9.750 -10.181 -30.404 1.00 . A A . 110 ARG CA   1 1 
        2  3658 1 1 110 ARG CB   C  -8.253  -9.827 -30.602 1.00 . A A . 110 ARG CB   1 1 
        2  3659 1 1 110 ARG CD   C  -7.514 -10.439 -33.044 1.00 . A A . 110 ARG CD   1 1 
        2  3660 1 1 110 ARG CG   C  -7.847  -9.354 -32.010 1.00 . A A . 110 ARG CG   1 1 
        2  3661 1 1 110 ARG CZ   C  -5.972 -12.280 -32.310 1.00 . A A . 110 ARG CZ   1 1 
        2  3662 1 1 110 ARG H    H  -9.252 -10.760 -28.284 1.00 . A A . 110 ARG H    1 1 
        2  3663 1 1 110 ARG HA   H -10.327  -9.281 -30.713 1.00 . A A . 110 ARG HA   1 1 
        2  3664 1 1 110 ARG HB2  H  -8.018  -8.989 -29.910 1.00 . A A . 110 ARG HB2  1 1 
        2  3665 1 1 110 ARG HB3  H  -7.600 -10.652 -30.260 1.00 . A A . 110 ARG HB3  1 1 
        2  3666 1 1 110 ARG HD2  H  -8.329 -11.177 -33.166 1.00 . A A . 110 ARG HD2  1 1 
        2  3667 1 1 110 ARG HD3  H  -7.482  -9.949 -34.039 1.00 . A A . 110 ARG HD3  1 1 
        2  3668 1 1 110 ARG HE   H  -5.329 -10.575 -33.073 1.00 . A A . 110 ARG HE   1 1 
        2  3669 1 1 110 ARG HG2  H  -8.641  -8.699 -32.425 1.00 . A A . 110 ARG HG2  1 1 
        2  3670 1 1 110 ARG HG3  H  -6.975  -8.674 -31.912 1.00 . A A . 110 ARG HG3  1 1 
        2  3671 1 1 110 ARG HH11 H  -7.870 -12.692 -31.859 1.00 . A A . 110 ARG HH11 1 1 
        2  3672 1 1 110 ARG HH12 H  -6.638 -13.986 -31.491 1.00 . A A . 110 ARG HH12 1 1 
        2  3673 1 1 110 ARG HH21 H  -4.014 -12.069 -32.578 1.00 . A A . 110 ARG HH21 1 1 
        2  3674 1 1 110 ARG HH22 H  -4.589 -13.631 -31.849 1.00 . A A . 110 ARG HH22 1 1 
        2  3675 1 1 110 ARG N    N  -9.948 -10.408 -28.951 1.00 . A A . 110 ARG N    1 1 
        2  3676 1 1 110 ARG NE   N  -6.187 -11.065 -32.808 1.00 . A A . 110 ARG NE   1 1 
        2  3677 1 1 110 ARG NH1  N  -6.911 -13.081 -31.873 1.00 . A A . 110 ARG NH1  1 1 
        2  3678 1 1 110 ARG NH2  N  -4.743 -12.701 -32.242 1.00 . A A . 110 ARG NH2  1 1 
        2  3679 1 1 110 ARG O    O  -9.567 -12.448 -31.255 1.00 . A A . 110 ARG O    1 1 
        2  3680 1 1 111 ASP C    C -11.327 -12.567 -34.120 1.00 . A A . 111 ASP C    1 1 
        2  3681 1 1 111 ASP CA   C -11.983 -12.346 -32.716 1.00 . A A . 111 ASP CA   1 1 
        2  3682 1 1 111 ASP CB   C -13.516 -12.088 -32.731 1.00 . A A . 111 ASP CB   1 1 
        2  3683 1 1 111 ASP CG   C -14.052 -10.911 -33.541 1.00 . A A . 111 ASP CG   1 1 
        2  3684 1 1 111 ASP H    H -11.900 -10.404 -31.710 1.00 . A A . 111 ASP H    1 1 
        2  3685 1 1 111 ASP HA   H -11.861 -13.297 -32.162 1.00 . A A . 111 ASP HA   1 1 
        2  3686 1 1 111 ASP HB2  H -14.036 -12.989 -33.102 1.00 . A A . 111 ASP HB2  1 1 
        2  3687 1 1 111 ASP HB3  H -13.877 -11.991 -31.689 1.00 . A A . 111 ASP HB3  1 1 
        2  3688 1 1 111 ASP N    N -11.378 -11.266 -31.894 1.00 . A A . 111 ASP N    1 1 
        2  3689 1 1 111 ASP O    O -10.358 -11.910 -34.515 1.00 . A A . 111 ASP O    1 1 
        2  3690 1 1 111 ASP OD1  O -13.614 -10.707 -34.695 1.00 . A A . 111 ASP OD1  1 1 
        2  3691 1 1 111 ASP OD2  O -14.974 -10.224 -33.055 1.00 . A A . 111 ASP OD2  1 1 
        2  3692 1 1 112 LYS C    C -13.281 -13.582 -36.964 1.00 . A A . 112 LYS C    1 1 
        2  3693 1 1 112 LYS CA   C -11.837 -13.445 -36.378 1.00 . A A . 112 LYS CA   1 1 
        2  3694 1 1 112 LYS CB   C -10.827 -14.512 -36.870 1.00 . A A . 112 LYS CB   1 1 
        2  3695 1 1 112 LYS CD   C  -9.583 -15.532 -38.896 1.00 . A A . 112 LYS CD   1 1 
        2  3696 1 1 112 LYS CE   C  -8.128 -15.468 -38.416 1.00 . A A . 112 LYS CE   1 1 
        2  3697 1 1 112 LYS CG   C -10.478 -14.396 -38.366 1.00 . A A . 112 LYS CG   1 1 
        2  3698 1 1 112 LYS H    H -12.702 -13.930 -34.415 1.00 . A A . 112 LYS H    1 1 
        2  3699 1 1 112 LYS HA   H -11.473 -12.443 -36.689 1.00 . A A . 112 LYS HA   1 1 
        2  3700 1 1 112 LYS HB2  H  -9.901 -14.412 -36.269 1.00 . A A . 112 LYS HB2  1 1 
        2  3701 1 1 112 LYS HB3  H -11.222 -15.522 -36.641 1.00 . A A . 112 LYS HB3  1 1 
        2  3702 1 1 112 LYS HD2  H -10.049 -16.506 -38.642 1.00 . A A . 112 LYS HD2  1 1 
        2  3703 1 1 112 LYS HD3  H  -9.619 -15.481 -40.005 1.00 . A A . 112 LYS HD3  1 1 
        2  3704 1 1 112 LYS HE2  H  -7.688 -14.476 -38.666 1.00 . A A . 112 LYS HE2  1 1 
        2  3705 1 1 112 LYS HE3  H  -8.084 -15.532 -37.306 1.00 . A A . 112 LYS HE3  1 1 
        2  3706 1 1 112 LYS HG2  H -11.415 -14.413 -38.961 1.00 . A A . 112 LYS HG2  1 1 
        2  3707 1 1 112 LYS HG3  H -10.027 -13.408 -38.583 1.00 . A A . 112 LYS HG3  1 1 
        2  3708 1 1 112 LYS HZ1  H  -6.360 -16.599 -38.769 1.00 . A A . 112 LYS HZ1  1 1 
        2  3709 1 1 112 LYS HZ2  H  -7.734 -17.501 -38.814 1.00 . A A . 112 LYS HZ2  1 1 
        2  3710 1 1 112 LYS HZ3  H  -7.359 -16.524 -40.072 1.00 . A A . 112 LYS HZ3  1 1 
        2  3711 1 1 112 LYS N    N -11.896 -13.510 -34.889 1.00 . A A . 112 LYS N    1 1 
        2  3712 1 1 112 LYS NZ   N  -7.352 -16.574 -39.045 1.00 . A A . 112 LYS NZ   1 1 
        2  3713 1 1 112 LYS O    O -13.660 -14.622 -37.511 1.00 . A A . 112 LYS O    1 1 
        2  3714 1 1 113 LYS C    C -15.700 -11.878 -38.645 1.00 . A A . 113 LYS C    1 1 
        2  3715 1 1 113 LYS CA   C -15.508 -12.513 -37.241 1.00 . A A . 113 LYS CA   1 1 
        2  3716 1 1 113 LYS CB   C -16.250 -11.724 -36.134 1.00 . A A . 113 LYS CB   1 1 
        2  3717 1 1 113 LYS CD   C -18.349 -10.662 -35.243 1.00 . A A . 113 LYS CD   1 1 
        2  3718 1 1 113 LYS CE   C -19.879 -10.678 -35.162 1.00 . A A . 113 LYS CE   1 1 
        2  3719 1 1 113 LYS CG   C -17.789 -11.727 -36.210 1.00 . A A . 113 LYS CG   1 1 
        2  3720 1 1 113 LYS H    H -13.714 -11.798 -36.173 1.00 . A A . 113 LYS H    1 1 
        2  3721 1 1 113 LYS HA   H -15.903 -13.551 -37.229 1.00 . A A . 113 LYS HA   1 1 
        2  3722 1 1 113 LYS HB2  H -15.964 -12.135 -35.143 1.00 . A A . 113 LYS HB2  1 1 
        2  3723 1 1 113 LYS HB3  H -15.866 -10.680 -36.117 1.00 . A A . 113 LYS HB3  1 1 
        2  3724 1 1 113 LYS HD2  H -17.909 -10.804 -34.233 1.00 . A A . 113 LYS HD2  1 1 
        2  3725 1 1 113 LYS HD3  H -17.975  -9.673 -35.584 1.00 . A A . 113 LYS HD3  1 1 
        2  3726 1 1 113 LYS HE2  H -20.325 -10.757 -36.178 1.00 . A A . 113 LYS HE2  1 1 
        2  3727 1 1 113 LYS HE3  H -20.225 -11.582 -34.614 1.00 . A A . 113 LYS HE3  1 1 
        2  3728 1 1 113 LYS HG2  H -18.134 -11.506 -37.240 1.00 . A A . 113 LYS HG2  1 1 
        2  3729 1 1 113 LYS HG3  H -18.171 -12.737 -35.964 1.00 . A A . 113 LYS HG3  1 1 
        2  3730 1 1 113 LYS HZ1  H -21.330  -9.351 -34.326 1.00 . A A . 113 LYS HZ1  1 1 
        2  3731 1 1 113 LYS HZ2  H -19.841  -9.251 -33.608 1.00 . A A . 113 LYS HZ2  1 1 
        2  3732 1 1 113 LYS HZ3  H -20.074  -8.605 -35.106 1.00 . A A . 113 LYS HZ3  1 1 
        2  3733 1 1 113 LYS N    N -14.073 -12.507 -36.846 1.00 . A A . 113 LYS N    1 1 
        2  3734 1 1 113 LYS NZ   N -20.319  -9.419 -34.502 1.00 . A A . 113 LYS NZ   1 1 
        2  3735 1 1 113 LYS O    O -15.575 -10.660 -38.817 1.00 . A A . 113 LYS O    1 1 
        2  3736 1 1 114 LYS C    C -17.814 -11.607 -41.121 1.00 . A A . 114 LYS C    1 1 
        2  3737 1 1 114 LYS CA   C -16.372 -12.190 -41.014 1.00 . A A . 114 LYS CA   1 1 
        2  3738 1 1 114 LYS CB   C -16.034 -13.322 -42.018 1.00 . A A . 114 LYS CB   1 1 
        2  3739 1 1 114 LYS CD   C -17.337 -13.553 -44.247 1.00 . A A . 114 LYS CD   1 1 
        2  3740 1 1 114 LYS CE   C -18.107 -12.598 -45.178 1.00 . A A . 114 LYS CE   1 1 
        2  3741 1 1 114 LYS CG   C -16.137 -12.927 -43.510 1.00 . A A . 114 LYS CG   1 1 
        2  3742 1 1 114 LYS H    H -16.127 -13.686 -39.394 1.00 . A A . 114 LYS H    1 1 
        2  3743 1 1 114 LYS HA   H -15.657 -11.369 -41.247 1.00 . A A . 114 LYS HA   1 1 
        2  3744 1 1 114 LYS HB2  H -14.982 -13.628 -41.829 1.00 . A A . 114 LYS HB2  1 1 
        2  3745 1 1 114 LYS HB3  H -16.622 -14.234 -41.796 1.00 . A A . 114 LYS HB3  1 1 
        2  3746 1 1 114 LYS HD2  H -16.953 -14.401 -44.851 1.00 . A A . 114 LYS HD2  1 1 
        2  3747 1 1 114 LYS HD3  H -18.044 -14.047 -43.550 1.00 . A A . 114 LYS HD3  1 1 
        2  3748 1 1 114 LYS HE2  H -17.409 -11.998 -45.803 1.00 . A A . 114 LYS HE2  1 1 
        2  3749 1 1 114 LYS HE3  H -18.681 -13.212 -45.909 1.00 . A A . 114 LYS HE3  1 1 
        2  3750 1 1 114 LYS HG2  H -16.107 -11.825 -43.624 1.00 . A A . 114 LYS HG2  1 1 
        2  3751 1 1 114 LYS HG3  H -15.210 -13.259 -44.023 1.00 . A A . 114 LYS HG3  1 1 
        2  3752 1 1 114 LYS HZ1  H -19.049 -12.044 -43.386 1.00 . A A . 114 LYS HZ1  1 1 
        2  3753 1 1 114 LYS HZ2  H -18.770 -10.743 -44.301 1.00 . A A . 114 LYS HZ2  1 1 
        2  3754 1 1 114 LYS HZ3  H -20.011 -11.756 -44.697 1.00 . A A . 114 LYS HZ3  1 1 
        2  3755 1 1 114 LYS N    N -16.074 -12.695 -39.644 1.00 . A A . 114 LYS N    1 1 
        2  3756 1 1 114 LYS NZ   N -19.034 -11.741 -44.383 1.00 . A A . 114 LYS NZ   1 1 
        2  3757 1 1 114 LYS O    O -18.736 -12.227 -41.661 1.00 . A A . 114 LYS O    1 1 
        2  3758 1 1 115 GLN C    C -19.139  -8.644 -42.038 1.00 . A A . 115 GLN C    1 1 
        2  3759 1 1 115 GLN CA   C -19.202  -9.566 -40.776 1.00 . A A . 115 GLN CA   1 1 
        2  3760 1 1 115 GLN CB   C -19.587  -8.941 -39.408 1.00 . A A . 115 GLN CB   1 1 
        2  3761 1 1 115 GLN CD   C -19.158  -7.189 -37.587 1.00 . A A . 115 GLN CD   1 1 
        2  3762 1 1 115 GLN CG   C -18.548  -8.053 -38.689 1.00 . A A . 115 GLN CG   1 1 
        2  3763 1 1 115 GLN H    H -17.184 -10.091 -40.029 1.00 . A A . 115 GLN H    1 1 
        2  3764 1 1 115 GLN HA   H -20.038 -10.256 -40.992 1.00 . A A . 115 GLN HA   1 1 
        2  3765 1 1 115 GLN HB2  H -20.538  -8.386 -39.547 1.00 . A A . 115 GLN HB2  1 1 
        2  3766 1 1 115 GLN HB3  H -19.865  -9.773 -38.729 1.00 . A A . 115 GLN HB3  1 1 
        2  3767 1 1 115 GLN HE21 H -18.896  -5.516 -38.662 1.00 . A A . 115 GLN HE21 1 1 
        2  3768 1 1 115 GLN HE22 H -19.659  -5.378 -36.998 1.00 . A A . 115 GLN HE22 1 1 
        2  3769 1 1 115 GLN HG2  H -17.776  -8.694 -38.223 1.00 . A A . 115 GLN HG2  1 1 
        2  3770 1 1 115 GLN HG3  H -17.977  -7.425 -39.397 1.00 . A A . 115 GLN HG3  1 1 
        2  3771 1 1 115 GLN N    N -17.960 -10.364 -40.644 1.00 . A A . 115 GLN N    1 1 
        2  3772 1 1 115 GLN NE2  N -19.273  -5.899 -37.791 1.00 . A A . 115 GLN NE2  1 1 
        2  3773 1 1 115 GLN O    O -19.044  -9.158 -43.159 1.00 . A A . 115 GLN O    1 1 
        2  3774 1 1 115 GLN OE1  O -19.545  -7.664 -36.522 1.00 . A A . 115 GLN OE1  1 1 
        2  3775 1 1 116 ARG C    C -18.217  -5.153 -42.366 1.00 . A A . 116 ARG C    1 1 
        2  3776 1 1 116 ARG CA   C -19.028  -6.335 -42.969 1.00 . A A . 116 ARG CA   1 1 
        2  3777 1 1 116 ARG CB   C -20.419  -5.915 -43.501 1.00 . A A . 116 ARG CB   1 1 
        2  3778 1 1 116 ARG CD   C -19.860  -3.862 -45.073 1.00 . A A . 116 ARG CD   1 1 
        2  3779 1 1 116 ARG CG   C -20.458  -5.264 -44.895 1.00 . A A . 116 ARG CG   1 1 
        2  3780 1 1 116 ARG CZ   C -21.631  -2.152 -44.581 1.00 . A A . 116 ARG CZ   1 1 
        2  3781 1 1 116 ARG H    H -19.232  -7.032 -40.890 1.00 . A A . 116 ARG H    1 1 
        2  3782 1 1 116 ARG HA   H -18.449  -6.794 -43.798 1.00 . A A . 116 ARG HA   1 1 
        2  3783 1 1 116 ARG HB2  H -21.055  -6.822 -43.579 1.00 . A A . 116 ARG HB2  1 1 
        2  3784 1 1 116 ARG HB3  H -20.946  -5.279 -42.763 1.00 . A A . 116 ARG HB3  1 1 
        2  3785 1 1 116 ARG HD2  H -18.780  -3.879 -44.824 1.00 . A A . 116 ARG HD2  1 1 
        2  3786 1 1 116 ARG HD3  H -19.861  -3.597 -46.150 1.00 . A A . 116 ARG HD3  1 1 
        2  3787 1 1 116 ARG HE   H -20.025  -2.316 -43.483 1.00 . A A . 116 ARG HE   1 1 
        2  3788 1 1 116 ARG HG2  H -19.968  -5.943 -45.622 1.00 . A A . 116 ARG HG2  1 1 
        2  3789 1 1 116 ARG HG3  H -21.518  -5.254 -45.219 1.00 . A A . 116 ARG HG3  1 1 
        2  3790 1 1 116 ARG HH11 H -22.105  -3.309 -46.088 1.00 . A A . 116 ARG HH11 1 1 
        2  3791 1 1 116 ARG HH12 H -23.274  -1.947 -45.713 1.00 . A A . 116 ARG HH12 1 1 
        2  3792 1 1 116 ARG HH21 H -21.202  -0.870 -43.153 1.00 . A A . 116 ARG HH21 1 1 
        2  3793 1 1 116 ARG HH22 H -22.802  -0.607 -44.060 1.00 . A A . 116 ARG HH22 1 1 
        2  3794 1 1 116 ARG N    N -19.205  -7.320 -41.871 1.00 . A A . 116 ARG N    1 1 
        2  3795 1 1 116 ARG NE   N -20.504  -2.786 -44.277 1.00 . A A . 116 ARG NE   1 1 
        2  3796 1 1 116 ARG NH1  N -22.427  -2.497 -45.561 1.00 . A A . 116 ARG NH1  1 1 
        2  3797 1 1 116 ARG NH2  N -21.950  -1.126 -43.853 1.00 . A A . 116 ARG NH2  1 1 
        2  3798 1 1 116 ARG O    O -18.765  -4.320 -41.636 1.00 . A A . 116 ARG O    1 1 
        2  3799 1 1 117 GLY C    C -16.076  -2.660 -42.800 1.00 . A A . 117 GLY C    1 1 
        2  3800 1 1 117 GLY CA   C -16.020  -4.038 -42.116 1.00 . A A . 117 GLY CA   1 1 
        2  3801 1 1 117 GLY H    H -16.541  -5.953 -43.079 1.00 . A A . 117 GLY H    1 1 
        2  3802 1 1 117 GLY HA2  H -16.202  -3.912 -41.032 1.00 . A A . 117 GLY HA2  1 1 
        2  3803 1 1 117 GLY HA3  H -14.978  -4.397 -42.179 1.00 . A A . 117 GLY HA3  1 1 
        2  3804 1 1 117 GLY N    N -16.909  -5.094 -42.662 1.00 . A A . 117 GLY N    1 1 
        2  3805 1 1 117 GLY O    O -15.091  -2.218 -43.392 1.00 . A A . 117 GLY O    1 1 
        2  3806 1 1 118 ARG C    C -18.737  -0.065 -42.419 1.00 . A A . 118 ARG C    1 1 
        2  3807 1 1 118 ARG CA   C -17.452  -0.609 -43.128 1.00 . A A . 118 ARG CA   1 1 
        2  3808 1 1 118 ARG CB   C -17.549  -0.504 -44.677 1.00 . A A . 118 ARG CB   1 1 
        2  3809 1 1 118 ARG CD   C -17.880   2.000 -45.479 1.00 . A A . 118 ARG CD   1 1 
        2  3810 1 1 118 ARG CG   C -16.959   0.781 -45.301 1.00 . A A . 118 ARG CG   1 1 
        2  3811 1 1 118 ARG CZ   C -18.997   3.617 -43.933 1.00 . A A . 118 ARG CZ   1 1 
        2  3812 1 1 118 ARG H    H -17.921  -2.528 -42.121 1.00 . A A . 118 ARG H    1 1 
        2  3813 1 1 118 ARG HA   H -16.602   0.001 -42.763 1.00 . A A . 118 ARG HA   1 1 
        2  3814 1 1 118 ARG HB2  H -16.967  -1.334 -45.130 1.00 . A A . 118 ARG HB2  1 1 
        2  3815 1 1 118 ARG HB3  H -18.580  -0.686 -45.033 1.00 . A A . 118 ARG HB3  1 1 
        2  3816 1 1 118 ARG HD2  H -17.318   2.769 -46.047 1.00 . A A . 118 ARG HD2  1 1 
        2  3817 1 1 118 ARG HD3  H -18.759   1.726 -46.097 1.00 . A A . 118 ARG HD3  1 1 
        2  3818 1 1 118 ARG HE   H -18.316   1.893 -43.324 1.00 . A A . 118 ARG HE   1 1 
        2  3819 1 1 118 ARG HG2  H -16.035   1.075 -44.765 1.00 . A A . 118 ARG HG2  1 1 
        2  3820 1 1 118 ARG HG3  H -16.593   0.505 -46.311 1.00 . A A . 118 ARG HG3  1 1 
        2  3821 1 1 118 ARG HH11 H -18.777   4.380 -45.725 1.00 . A A . 118 ARG HH11 1 1 
        2  3822 1 1 118 ARG HH12 H -19.748   5.376 -44.532 1.00 . A A . 118 ARG HH12 1 1 
        2  3823 1 1 118 ARG HH21 H -19.305   2.918 -42.129 1.00 . A A . 118 ARG HH21 1 1 
        2  3824 1 1 118 ARG HH22 H -20.030   4.573 -42.502 1.00 . A A . 118 ARG HH22 1 1 
        2  3825 1 1 118 ARG N    N -17.228  -2.000 -42.668 1.00 . A A . 118 ARG N    1 1 
        2  3826 1 1 118 ARG NE   N -18.305   2.521 -44.168 1.00 . A A . 118 ARG NE   1 1 
        2  3827 1 1 118 ARG NH1  N -19.210   4.556 -44.817 1.00 . A A . 118 ARG NH1  1 1 
        2  3828 1 1 118 ARG NH2  N -19.484   3.743 -42.734 1.00 . A A . 118 ARG NH2  1 1 
        2  3829 1 1 118 ARG O    O -19.784  -0.757 -42.384 1.00 . A A . 118 ARG O    1 1 
        2  3830 1 1 118 ARG OXT  O -18.717   1.098 -41.951 1.00 . A A . 118 ARG OXT  1 1 
        3  3831 1 1   1 MET C    C  10.997  23.354   4.147 1.00 . A A .   1 MET C    1 1 
        3  3832 1 1   1 MET CA   C  11.651  23.348   2.722 1.00 . A A .   1 MET CA   1 1 
        3  3833 1 1   1 MET CB   C  11.103  24.492   1.833 1.00 . A A .   1 MET CB   1 1 
        3  3834 1 1   1 MET CE   C  12.365  24.053  -2.112 1.00 . A A .   1 MET CE   1 1 
        3  3835 1 1   1 MET CG   C  11.841  24.728   0.508 1.00 . A A .   1 MET CG   1 1 
        3  3836 1 1   1 MET H1   H  11.757  21.225   2.690 1.00 . A A .   1 MET H1   1 1 
        3  3837 1 1   1 MET H2   H  10.456  21.842   1.892 1.00 . A A .   1 MET H2   1 1 
        3  3838 1 1   1 MET H3   H  11.970  21.924   1.166 1.00 . A A .   1 MET H3   1 1 
        3  3839 1 1   1 MET HA   H  12.730  23.547   2.902 1.00 . A A .   1 MET HA   1 1 
        3  3840 1 1   1 MET HB2  H  10.022  24.349   1.626 1.00 . A A .   1 MET HB2  1 1 
        3  3841 1 1   1 MET HB3  H  11.148  25.438   2.414 1.00 . A A .   1 MET HB3  1 1 
        3  3842 1 1   1 MET HE1  H  12.211  23.398  -2.988 1.00 . A A .   1 MET HE1  1 1 
        3  3843 1 1   1 MET HE2  H  12.089  25.081  -2.409 1.00 . A A .   1 MET HE2  1 1 
        3  3844 1 1   1 MET HE3  H  13.443  24.044  -1.870 1.00 . A A .   1 MET HE3  1 1 
        3  3845 1 1   1 MET HG2  H  11.564  25.724   0.110 1.00 . A A .   1 MET HG2  1 1 
        3  3846 1 1   1 MET HG3  H  12.940  24.747   0.635 1.00 . A A .   1 MET HG3  1 1 
        3  3847 1 1   1 MET N    N  11.497  22.019   2.068 1.00 . A A .   1 MET N    1 1 
        3  3848 1 1   1 MET O    O  11.723  23.553   5.121 1.00 . A A .   1 MET O    1 1 
        3  3849 1 1   1 MET SD   S  11.375  23.491  -0.718 1.00 . A A .   1 MET SD   1 1 
        3  3850 1 1   2 ALA C    C   7.677  22.191   5.429 1.00 . A A .   2 ALA C    1 1 
        3  3851 1 1   2 ALA CA   C   8.977  23.047   5.568 1.00 . A A .   2 ALA CA   1 1 
        3  3852 1 1   2 ALA CB   C   8.693  24.465   6.097 1.00 . A A .   2 ALA CB   1 1 
        3  3853 1 1   2 ALA H    H   9.227  22.787   3.391 1.00 . A A .   2 ALA H    1 1 
        3  3854 1 1   2 ALA HA   H   9.636  22.543   6.306 1.00 . A A .   2 ALA HA   1 1 
        3  3855 1 1   2 ALA HB1  H   8.054  25.049   5.409 1.00 . A A .   2 ALA HB1  1 1 
        3  3856 1 1   2 ALA HB2  H   8.176  24.437   7.074 1.00 . A A .   2 ALA HB2  1 1 
        3  3857 1 1   2 ALA HB3  H   9.627  25.036   6.245 1.00 . A A .   2 ALA HB3  1 1 
        3  3858 1 1   2 ALA N    N   9.672  23.140   4.260 1.00 . A A .   2 ALA N    1 1 
        3  3859 1 1   2 ALA O    O   6.577  22.724   5.250 1.00 . A A .   2 ALA O    1 1 
        3  3860 1 1   3 GLY C    C   6.365  19.338   6.858 1.00 . A A .   3 GLY C    1 1 
        3  3861 1 1   3 GLY CA   C   6.676  19.921   5.478 1.00 . A A .   3 GLY CA   1 1 
        3  3862 1 1   3 GLY H    H   8.792  20.545   5.602 1.00 . A A .   3 GLY H    1 1 
        3  3863 1 1   3 GLY HA2  H   5.765  20.411   5.088 1.00 . A A .   3 GLY HA2  1 1 
        3  3864 1 1   3 GLY HA3  H   6.879  19.113   4.752 1.00 . A A .   3 GLY HA3  1 1 
        3  3865 1 1   3 GLY N    N   7.822  20.860   5.518 1.00 . A A .   3 GLY N    1 1 
        3  3866 1 1   3 GLY O    O   5.551  19.904   7.594 1.00 . A A .   3 GLY O    1 1 
        3  3867 1 1   4 SER C    C   8.132  16.710   8.881 1.00 . A A .   4 SER C    1 1 
        3  3868 1 1   4 SER CA   C   6.964  17.711   8.628 1.00 . A A .   4 SER CA   1 1 
        3  3869 1 1   4 SER CB   C   5.612  17.041   8.982 1.00 . A A .   4 SER CB   1 1 
        3  3870 1 1   4 SER H    H   7.439  17.683   6.474 1.00 . A A .   4 SER H    1 1 
        3  3871 1 1   4 SER HA   H   7.083  18.575   9.316 1.00 . A A .   4 SER HA   1 1 
        3  3872 1 1   4 SER HB2  H   5.398  16.192   8.306 1.00 . A A .   4 SER HB2  1 1 
        3  3873 1 1   4 SER HB3  H   5.658  16.609   9.999 1.00 . A A .   4 SER HB3  1 1 
        3  3874 1 1   4 SER HG   H   4.856  18.743   8.417 1.00 . A A .   4 SER HG   1 1 
        3  3875 1 1   4 SER N    N   6.998  18.218   7.230 1.00 . A A .   4 SER N    1 1 
        3  3876 1 1   4 SER O    O   8.209  15.646   8.259 1.00 . A A .   4 SER O    1 1 
        3  3877 1 1   4 SER OG   O   4.538  17.983   8.948 1.00 . A A .   4 SER OG   1 1 
        3  3878 1 1   5 GLY C    C   9.287  15.330  11.653 1.00 . A A .   5 GLY C    1 1 
        3  3879 1 1   5 GLY CA   C   9.926  16.040  10.449 1.00 . A A .   5 GLY CA   1 1 
        3  3880 1 1   5 GLY H    H   8.809  17.923  10.319 1.00 . A A .   5 GLY H    1 1 
        3  3881 1 1   5 GLY HA2  H  10.292  15.312   9.699 1.00 . A A .   5 GLY HA2  1 1 
        3  3882 1 1   5 GLY HA3  H  10.830  16.570  10.802 1.00 . A A .   5 GLY HA3  1 1 
        3  3883 1 1   5 GLY N    N   9.001  17.034   9.852 1.00 . A A .   5 GLY N    1 1 
        3  3884 1 1   5 GLY O    O   9.455  15.769  12.791 1.00 . A A .   5 GLY O    1 1 
        3  3885 1 1   6 ILE C    C   7.706  12.172  12.429 1.00 . A A .   6 ILE C    1 1 
        3  3886 1 1   6 ILE CA   C   7.532  13.708  12.333 1.00 . A A .   6 ILE CA   1 1 
        3  3887 1 1   6 ILE CB   C   6.065  14.187  12.000 1.00 . A A .   6 ILE CB   1 1 
        3  3888 1 1   6 ILE CD1  C   3.730  14.545  13.073 1.00 . A A .   6 ILE CD1  1 1 
        3  3889 1 1   6 ILE CG1  C   5.094  13.859  13.165 1.00 . A A .   6 ILE CG1  1 1 
        3  3890 1 1   6 ILE CG2  C   5.542  13.686  10.646 1.00 . A A .   6 ILE CG2  1 1 
        3  3891 1 1   6 ILE H    H   8.480  14.030  10.384 1.00 . A A .   6 ILE H    1 1 
        3  3892 1 1   6 ILE HA   H   7.729  14.151  13.323 1.00 . A A .   6 ILE HA   1 1 
        3  3893 1 1   6 ILE HB   H   6.127  15.296  11.942 1.00 . A A .   6 ILE HB   1 1 
        3  3894 1 1   6 ILE HD11 H   3.820  15.644  13.001 1.00 . A A .   6 ILE HD11 1 1 
        3  3895 1 1   6 ILE HD12 H   3.143  14.206  12.200 1.00 . A A .   6 ILE HD12 1 1 
        3  3896 1 1   6 ILE HD13 H   3.120  14.329  13.970 1.00 . A A .   6 ILE HD13 1 1 
        3  3897 1 1   6 ILE HG12 H   4.953  12.765  13.256 1.00 . A A .   6 ILE HG12 1 1 
        3  3898 1 1   6 ILE HG13 H   5.557  14.164  14.125 1.00 . A A .   6 ILE HG13 1 1 
        3  3899 1 1   6 ILE HG21 H   4.618  14.207  10.334 1.00 . A A .   6 ILE HG21 1 1 
        3  3900 1 1   6 ILE HG22 H   6.296  13.874   9.866 1.00 . A A .   6 ILE HG22 1 1 
        3  3901 1 1   6 ILE HG23 H   5.331  12.601  10.636 1.00 . A A .   6 ILE HG23 1 1 
        3  3902 1 1   6 ILE N    N   8.514  14.277  11.374 1.00 . A A .   6 ILE N    1 1 
        3  3903 1 1   6 ILE O    O   7.504  11.431  11.463 1.00 . A A .   6 ILE O    1 1 
        3  3904 1 1   7 ILE C    C   6.388   9.865  14.318 1.00 . A A .   7 ILE C    1 1 
        3  3905 1 1   7 ILE CA   C   7.871  10.249  14.000 1.00 . A A .   7 ILE CA   1 1 
        3  3906 1 1   7 ILE CB   C   8.945   9.869  15.066 1.00 . A A .   7 ILE CB   1 1 
        3  3907 1 1   7 ILE CD1  C   9.425   7.470  14.161 1.00 . A A .   7 ILE CD1  1 1 
        3  3908 1 1   7 ILE CG1  C   9.051   8.345  15.357 1.00 . A A .   7 ILE CG1  1 1 
        3  3909 1 1   7 ILE CG2  C   8.815  10.596  16.427 1.00 . A A .   7 ILE CG2  1 1 
        3  3910 1 1   7 ILE H    H   8.392  12.403  14.266 1.00 . A A .   7 ILE H    1 1 
        3  3911 1 1   7 ILE HA   H   8.156   9.664  13.100 1.00 . A A .   7 ILE HA   1 1 
        3  3912 1 1   7 ILE HB   H   9.924  10.184  14.641 1.00 . A A .   7 ILE HB   1 1 
        3  3913 1 1   7 ILE HD11 H   9.621   6.432  14.486 1.00 . A A .   7 ILE HD11 1 1 
        3  3914 1 1   7 ILE HD12 H   8.623   7.423  13.405 1.00 . A A .   7 ILE HD12 1 1 
        3  3915 1 1   7 ILE HD13 H  10.342   7.825  13.654 1.00 . A A .   7 ILE HD13 1 1 
        3  3916 1 1   7 ILE HG12 H   9.821   8.189  16.140 1.00 . A A .   7 ILE HG12 1 1 
        3  3917 1 1   7 ILE HG13 H   8.110   7.974  15.809 1.00 . A A .   7 ILE HG13 1 1 
        3  3918 1 1   7 ILE HG21 H   8.789  11.694  16.321 1.00 . A A .   7 ILE HG21 1 1 
        3  3919 1 1   7 ILE HG22 H   7.904  10.306  16.981 1.00 . A A .   7 ILE HG22 1 1 
        3  3920 1 1   7 ILE HG23 H   9.677  10.370  17.082 1.00 . A A .   7 ILE HG23 1 1 
        3  3921 1 1   7 ILE N    N   8.008  11.693  13.639 1.00 . A A .   7 ILE N    1 1 
        3  3922 1 1   7 ILE O    O   5.992   9.653  15.466 1.00 . A A .   7 ILE O    1 1 
        3  3923 1 1   8 TYR C    C   4.013   7.830  13.309 1.00 . A A .   8 TYR C    1 1 
        3  3924 1 1   8 TYR CA   C   4.142   9.378  13.355 1.00 . A A .   8 TYR CA   1 1 
        3  3925 1 1   8 TYR CB   C   3.427  10.093  12.182 1.00 . A A .   8 TYR CB   1 1 
        3  3926 1 1   8 TYR CD1  C   1.293  11.209  13.055 1.00 . A A .   8 TYR CD1  1 1 
        3  3927 1 1   8 TYR CD2  C   1.091   9.257  11.651 1.00 . A A .   8 TYR CD2  1 1 
        3  3928 1 1   8 TYR CE1  C  -0.100  11.286  13.149 1.00 . A A .   8 TYR CE1  1 1 
        3  3929 1 1   8 TYR CE2  C  -0.299   9.348  11.730 1.00 . A A .   8 TYR CE2  1 1 
        3  3930 1 1   8 TYR CG   C   1.903  10.186  12.309 1.00 . A A .   8 TYR CG   1 1 
        3  3931 1 1   8 TYR CZ   C  -0.895  10.350  12.491 1.00 . A A .   8 TYR CZ   1 1 
        3  3932 1 1   8 TYR H    H   5.999   9.981  12.355 1.00 . A A .   8 TYR H    1 1 
        3  3933 1 1   8 TYR HA   H   3.736   9.772  14.308 1.00 . A A .   8 TYR HA   1 1 
        3  3934 1 1   8 TYR HB2  H   3.809  11.128  12.073 1.00 . A A .   8 TYR HB2  1 1 
        3  3935 1 1   8 TYR HB3  H   3.699   9.615  11.220 1.00 . A A .   8 TYR HB3  1 1 
        3  3936 1 1   8 TYR HD1  H   1.901  11.941  13.575 1.00 . A A .   8 TYR HD1  1 1 
        3  3937 1 1   8 TYR HD2  H   1.550   8.442  11.106 1.00 . A A .   8 TYR HD2  1 1 
        3  3938 1 1   8 TYR HE1  H  -0.557  12.058  13.755 1.00 . A A .   8 TYR HE1  1 1 
        3  3939 1 1   8 TYR HE2  H  -0.918   8.609  11.241 1.00 . A A .   8 TYR HE2  1 1 
        3  3940 1 1   8 TYR HH   H  -2.477   9.604  13.245 1.00 . A A .   8 TYR HH   1 1 
        3  3941 1 1   8 TYR N    N   5.572   9.761  13.260 1.00 . A A .   8 TYR N    1 1 
        3  3942 1 1   8 TYR O    O   4.677   7.155  12.517 1.00 . A A .   8 TYR O    1 1 
        3  3943 1 1   8 TYR OH   O  -2.251  10.353  12.656 1.00 . A A .   8 TYR OH   1 1 
        3  3944 1 1   9 LYS C    C   1.739   5.359  14.827 1.00 . A A .   9 LYS C    1 1 
        3  3945 1 1   9 LYS CA   C   3.155   5.772  14.369 1.00 . A A .   9 LYS CA   1 1 
        3  3946 1 1   9 LYS CB   C   4.267   5.322  15.355 1.00 . A A .   9 LYS CB   1 1 
        3  3947 1 1   9 LYS CD   C   5.529   3.567  13.857 1.00 . A A .   9 LYS CD   1 1 
        3  3948 1 1   9 LYS CE   C   6.728   4.477  13.551 1.00 . A A .   9 LYS CE   1 1 
        3  3949 1 1   9 LYS CG   C   4.788   3.886  15.171 1.00 . A A .   9 LYS CG   1 1 
        3  3950 1 1   9 LYS H    H   2.660   7.889  14.786 1.00 . A A .   9 LYS H    1 1 
        3  3951 1 1   9 LYS HA   H   3.347   5.308  13.384 1.00 . A A .   9 LYS HA   1 1 
        3  3952 1 1   9 LYS HB2  H   5.130   6.016  15.307 1.00 . A A .   9 LYS HB2  1 1 
        3  3953 1 1   9 LYS HB3  H   3.915   5.439  16.400 1.00 . A A .   9 LYS HB3  1 1 
        3  3954 1 1   9 LYS HD2  H   5.861   2.509  13.920 1.00 . A A .   9 LYS HD2  1 1 
        3  3955 1 1   9 LYS HD3  H   4.810   3.576  13.018 1.00 . A A .   9 LYS HD3  1 1 
        3  3956 1 1   9 LYS HE2  H   6.391   5.532  13.444 1.00 . A A .   9 LYS HE2  1 1 
        3  3957 1 1   9 LYS HE3  H   7.431   4.481  14.414 1.00 . A A .   9 LYS HE3  1 1 
        3  3958 1 1   9 LYS HG2  H   5.457   3.655  16.025 1.00 . A A .   9 LYS HG2  1 1 
        3  3959 1 1   9 LYS HG3  H   3.950   3.168  15.284 1.00 . A A .   9 LYS HG3  1 1 
        3  3960 1 1   9 LYS HZ1  H   8.268   4.563  12.095 1.00 . A A .   9 LYS HZ1  1 1 
        3  3961 1 1   9 LYS HZ2  H   7.723   3.035  12.341 1.00 . A A .   9 LYS HZ2  1 1 
        3  3962 1 1   9 LYS HZ3  H   6.828   4.114  11.454 1.00 . A A .   9 LYS HZ3  1 1 
        3  3963 1 1   9 LYS N    N   3.213   7.250  14.209 1.00 . A A .   9 LYS N    1 1 
        3  3964 1 1   9 LYS NZ   N   7.416   4.031  12.309 1.00 . A A .   9 LYS NZ   1 1 
        3  3965 1 1   9 LYS O    O   1.351   5.645  15.965 1.00 . A A .   9 LYS O    1 1 
        3  3966 1 1  10 GLN C    C  -0.538   2.701  14.166 1.00 . A A .  10 GLN C    1 1 
        3  3967 1 1  10 GLN CA   C  -0.417   4.268  14.294 1.00 . A A .  10 GLN CA   1 1 
        3  3968 1 1  10 GLN CB   C  -1.459   4.990  13.407 1.00 . A A .  10 GLN CB   1 1 
        3  3969 1 1  10 GLN CD   C  -1.815   7.427  14.368 1.00 . A A .  10 GLN CD   1 1 
        3  3970 1 1  10 GLN CG   C  -1.380   6.512  13.243 1.00 . A A .  10 GLN CG   1 1 
        3  3971 1 1  10 GLN H    H   1.253   4.793  12.967 1.00 . A A .  10 GLN H    1 1 
        3  3972 1 1  10 GLN HA   H  -0.643   4.518  15.349 1.00 . A A .  10 GLN HA   1 1 
        3  3973 1 1  10 GLN HB2  H  -1.394   4.576  12.378 1.00 . A A .  10 GLN HB2  1 1 
        3  3974 1 1  10 GLN HB3  H  -2.471   4.709  13.758 1.00 . A A .  10 GLN HB3  1 1 
        3  3975 1 1  10 GLN HE21 H  -0.408   6.723  15.609 1.00 . A A .  10 GLN HE21 1 1 
        3  3976 1 1  10 GLN HE22 H  -1.527   8.058  16.212 1.00 . A A .  10 GLN HE22 1 1 
        3  3977 1 1  10 GLN HG2  H  -0.365   6.806  12.918 1.00 . A A .  10 GLN HG2  1 1 
        3  3978 1 1  10 GLN HG3  H  -2.012   6.759  12.368 1.00 . A A .  10 GLN HG3  1 1 
        3  3979 1 1  10 GLN N    N   0.966   4.696  13.951 1.00 . A A .  10 GLN N    1 1 
        3  3980 1 1  10 GLN NE2  N  -1.192   7.382  15.522 1.00 . A A .  10 GLN NE2  1 1 
        3  3981 1 1  10 GLN O    O  -0.977   2.220  13.114 1.00 . A A .  10 GLN O    1 1 
        3  3982 1 1  10 GLN OE1  O  -2.674   8.287  14.187 1.00 . A A .  10 GLN OE1  1 1 
        3  3983 1 1  11 PRO C    C  -1.360  -0.480  15.204 1.00 . A A .  11 PRO C    1 1 
        3  3984 1 1  11 PRO CA   C  -0.071   0.367  14.979 1.00 . A A .  11 PRO CA   1 1 
        3  3985 1 1  11 PRO CB   C   1.088   0.050  15.962 1.00 . A A .  11 PRO CB   1 1 
        3  3986 1 1  11 PRO CD   C   0.369   2.313  16.474 1.00 . A A .  11 PRO CD   1 1 
        3  3987 1 1  11 PRO CG   C   0.854   1.018  17.148 1.00 . A A .  11 PRO CG   1 1 
        3  3988 1 1  11 PRO HA   H   0.257   0.155  13.943 1.00 . A A .  11 PRO HA   1 1 
        3  3989 1 1  11 PRO HB2  H   1.133  -1.008  16.277 1.00 . A A .  11 PRO HB2  1 1 
        3  3990 1 1  11 PRO HB3  H   2.054   0.279  15.471 1.00 . A A .  11 PRO HB3  1 1 
        3  3991 1 1  11 PRO HD2  H  -0.400   2.833  17.076 1.00 . A A .  11 PRO HD2  1 1 
        3  3992 1 1  11 PRO HD3  H   1.204   3.020  16.318 1.00 . A A .  11 PRO HD3  1 1 
        3  3993 1 1  11 PRO HG2  H   0.061   0.613  17.808 1.00 . A A .  11 PRO HG2  1 1 
        3  3994 1 1  11 PRO HG3  H   1.757   1.167  17.765 1.00 . A A .  11 PRO HG3  1 1 
        3  3995 1 1  11 PRO N    N  -0.178   1.861  15.178 1.00 . A A .  11 PRO N    1 1 
        3  3996 1 1  11 PRO O    O  -1.331  -1.563  15.792 1.00 . A A .  11 PRO O    1 1 
        3  3997 1 1  12 ILE C    C  -4.601   0.103  13.521 1.00 . A A .  12 ILE C    1 1 
        3  3998 1 1  12 ILE CA   C  -3.784  -0.675  14.591 1.00 . A A .  12 ILE CA   1 1 
        3  3999 1 1  12 ILE CB   C  -4.463  -0.869  15.980 1.00 . A A .  12 ILE CB   1 1 
        3  4000 1 1  12 ILE CD1  C  -6.802  -1.728  15.128 1.00 . A A .  12 ILE CD1  1 1 
        3  4001 1 1  12 ILE CG1  C  -5.570  -1.958  15.992 1.00 . A A .  12 ILE CG1  1 1 
        3  4002 1 1  12 ILE CG2  C  -4.908   0.400  16.722 1.00 . A A .  12 ILE CG2  1 1 
        3  4003 1 1  12 ILE H    H  -2.231   0.856  14.097 1.00 . A A .  12 ILE H    1 1 
        3  4004 1 1  12 ILE HA   H  -3.598  -1.698  14.206 1.00 . A A .  12 ILE HA   1 1 
        3  4005 1 1  12 ILE HB   H  -3.676  -1.320  16.623 1.00 . A A .  12 ILE HB   1 1 
        3  4006 1 1  12 ILE HD11 H  -6.589  -1.822  14.049 1.00 . A A .  12 ILE HD11 1 1 
        3  4007 1 1  12 ILE HD12 H  -7.593  -2.465  15.355 1.00 . A A .  12 ILE HD12 1 1 
        3  4008 1 1  12 ILE HD13 H  -7.243  -0.727  15.274 1.00 . A A .  12 ILE HD13 1 1 
        3  4009 1 1  12 ILE HG12 H  -5.115  -2.929  15.714 1.00 . A A .  12 ILE HG12 1 1 
        3  4010 1 1  12 ILE HG13 H  -5.893  -2.106  17.042 1.00 . A A .  12 ILE HG13 1 1 
        3  4011 1 1  12 ILE HG21 H  -5.217   0.170  17.758 1.00 . A A .  12 ILE HG21 1 1 
        3  4012 1 1  12 ILE HG22 H  -4.090   1.140  16.789 1.00 . A A .  12 ILE HG22 1 1 
        3  4013 1 1  12 ILE HG23 H  -5.760   0.909  16.237 1.00 . A A .  12 ILE HG23 1 1 
        3  4014 1 1  12 ILE N    N  -2.465   0.020  14.652 1.00 . A A .  12 ILE N    1 1 
        3  4015 1 1  12 ILE O    O  -5.150   1.174  13.796 1.00 . A A .  12 ILE O    1 1 
        3  4016 1 1  13 TYR C    C  -5.556  -0.475   9.962 1.00 . A A .  13 TYR C    1 1 
        3  4017 1 1  13 TYR CA   C  -5.046   0.426  11.114 1.00 . A A .  13 TYR CA   1 1 
        3  4018 1 1  13 TYR CB   C  -3.890   1.353  10.631 1.00 . A A .  13 TYR CB   1 1 
        3  4019 1 1  13 TYR CD1  C  -4.232   3.659  11.641 1.00 . A A .  13 TYR CD1  1 1 
        3  4020 1 1  13 TYR CD2  C  -4.831   3.338   9.327 1.00 . A A .  13 TYR CD2  1 1 
        3  4021 1 1  13 TYR CE1  C  -4.606   5.000  11.553 1.00 . A A .  13 TYR CE1  1 1 
        3  4022 1 1  13 TYR CE2  C  -5.204   4.680   9.239 1.00 . A A .  13 TYR CE2  1 1 
        3  4023 1 1  13 TYR CG   C  -4.328   2.817  10.526 1.00 . A A .  13 TYR CG   1 1 
        3  4024 1 1  13 TYR CZ   C  -5.091   5.513  10.353 1.00 . A A .  13 TYR CZ   1 1 
        3  4025 1 1  13 TYR H    H  -4.149  -1.296  12.132 1.00 . A A .  13 TYR H    1 1 
        3  4026 1 1  13 TYR HA   H  -5.898   1.044  11.459 1.00 . A A .  13 TYR HA   1 1 
        3  4027 1 1  13 TYR HB2  H  -3.011   1.299  11.305 1.00 . A A .  13 TYR HB2  1 1 
        3  4028 1 1  13 TYR HB3  H  -3.473   1.011   9.664 1.00 . A A .  13 TYR HB3  1 1 
        3  4029 1 1  13 TYR HD1  H  -3.881   3.264  12.587 1.00 . A A .  13 TYR HD1  1 1 
        3  4030 1 1  13 TYR HD2  H  -4.929   2.706   8.453 1.00 . A A .  13 TYR HD2  1 1 
        3  4031 1 1  13 TYR HE1  H  -4.540   5.638  12.425 1.00 . A A .  13 TYR HE1  1 1 
        3  4032 1 1  13 TYR HE2  H  -5.564   5.056   8.293 1.00 . A A .  13 TYR HE2  1 1 
        3  4033 1 1  13 TYR HH   H  -5.723   7.080   9.362 1.00 . A A .  13 TYR HH   1 1 
        3  4034 1 1  13 TYR N    N  -4.603  -0.384  12.270 1.00 . A A .  13 TYR N    1 1 
        3  4035 1 1  13 TYR O    O  -4.894  -1.433   9.558 1.00 . A A .  13 TYR O    1 1 
        3  4036 1 1  13 TYR OH   O  -5.458   6.825  10.294 1.00 . A A .  13 TYR OH   1 1 
        3  4037 1 1  14 GLN C    C  -6.493  -1.016   6.972 1.00 . A A .  14 GLN C    1 1 
        3  4038 1 1  14 GLN CA   C  -7.334  -0.821   8.259 1.00 . A A .  14 GLN CA   1 1 
        3  4039 1 1  14 GLN CB   C  -8.740  -0.248   8.008 1.00 . A A .  14 GLN CB   1 1 
        3  4040 1 1  14 GLN CD   C  -8.175   2.192   7.153 1.00 . A A .  14 GLN CD   1 1 
        3  4041 1 1  14 GLN CG   C  -8.985   0.916   7.047 1.00 . A A .  14 GLN CG   1 1 
        3  4042 1 1  14 GLN H    H  -7.147   0.704   9.855 1.00 . A A .  14 GLN H    1 1 
        3  4043 1 1  14 GLN HA   H  -7.528  -1.841   8.638 1.00 . A A .  14 GLN HA   1 1 
        3  4044 1 1  14 GLN HB2  H  -9.348  -1.085   7.607 1.00 . A A .  14 GLN HB2  1 1 
        3  4045 1 1  14 GLN HB3  H  -9.226  -0.026   8.973 1.00 . A A .  14 GLN HB3  1 1 
        3  4046 1 1  14 GLN HE21 H  -8.532   2.502   5.229 1.00 . A A .  14 GLN HE21 1 1 
        3  4047 1 1  14 GLN HE22 H  -7.130   3.400   5.982 1.00 . A A .  14 GLN HE22 1 1 
        3  4048 1 1  14 GLN HG2  H  -8.894   0.513   6.022 1.00 . A A .  14 GLN HG2  1 1 
        3  4049 1 1  14 GLN HG3  H -10.055   1.166   7.141 1.00 . A A .  14 GLN HG3  1 1 
        3  4050 1 1  14 GLN N    N  -6.706  -0.099   9.399 1.00 . A A .  14 GLN N    1 1 
        3  4051 1 1  14 GLN NE2  N  -8.012   2.881   6.049 1.00 . A A .  14 GLN NE2  1 1 
        3  4052 1 1  14 GLN O    O  -6.514  -2.096   6.377 1.00 . A A .  14 GLN O    1 1 
        3  4053 1 1  14 GLN OE1  O  -7.649   2.595   8.183 1.00 . A A .  14 GLN OE1  1 1 
        3  4054 1 1  15 GLY C    C  -3.561  -0.947   5.765 1.00 . A A .  15 GLY C    1 1 
        3  4055 1 1  15 GLY CA   C  -4.788  -0.088   5.447 1.00 . A A .  15 GLY CA   1 1 
        3  4056 1 1  15 GLY H    H  -5.814   0.824   7.195 1.00 . A A .  15 GLY H    1 1 
        3  4057 1 1  15 GLY HA2  H  -5.312  -0.461   4.546 1.00 . A A .  15 GLY HA2  1 1 
        3  4058 1 1  15 GLY HA3  H  -4.456   0.926   5.169 1.00 . A A .  15 GLY HA3  1 1 
        3  4059 1 1  15 GLY N    N  -5.729   0.014   6.572 1.00 . A A .  15 GLY N    1 1 
        3  4060 1 1  15 GLY O    O  -2.568  -0.459   6.311 1.00 . A A .  15 GLY O    1 1 
        3  4061 1 1  16 ASN C    C  -1.238  -3.052   5.050 1.00 . A A .  16 ASN C    1 1 
        3  4062 1 1  16 ASN CA   C  -2.626  -3.248   5.736 1.00 . A A .  16 ASN CA   1 1 
        3  4063 1 1  16 ASN CB   C  -3.204  -4.672   5.566 1.00 . A A .  16 ASN CB   1 1 
        3  4064 1 1  16 ASN CG   C  -4.107  -5.085   6.734 1.00 . A A .  16 ASN CG   1 1 
        3  4065 1 1  16 ASN H    H  -4.654  -2.487   5.277 1.00 . A A .  16 ASN H    1 1 
        3  4066 1 1  16 ASN HA   H  -2.400  -3.130   6.808 1.00 . A A .  16 ASN HA   1 1 
        3  4067 1 1  16 ASN HB2  H  -3.718  -4.795   4.594 1.00 . A A .  16 ASN HB2  1 1 
        3  4068 1 1  16 ASN HB3  H  -2.383  -5.413   5.543 1.00 . A A .  16 ASN HB3  1 1 
        3  4069 1 1  16 ASN HD21 H  -5.753  -4.571   5.742 1.00 . A A .  16 ASN HD21 1 1 
        3  4070 1 1  16 ASN HD22 H  -5.929  -5.072   7.491 1.00 . A A .  16 ASN HD22 1 1 
        3  4071 1 1  16 ASN N    N  -3.666  -2.234   5.411 1.00 . A A .  16 ASN N    1 1 
        3  4072 1 1  16 ASN ND2  N  -5.409  -5.037   6.584 1.00 . A A .  16 ASN ND2  1 1 
        3  4073 1 1  16 ASN O    O  -0.215  -3.263   5.707 1.00 . A A .  16 ASN O    1 1 
        3  4074 1 1  16 ASN OD1  O  -3.626  -5.422   7.812 1.00 . A A .  16 ASN OD1  1 1 
        3  4075 1 1  17 LEU C    C   0.226  -0.442   3.926 1.00 . A A .  17 LEU C    1 1 
        3  4076 1 1  17 LEU CA   C   0.000  -1.865   3.269 1.00 . A A .  17 LEU CA   1 1 
        3  4077 1 1  17 LEU CB   C  -0.057  -1.723   1.725 1.00 . A A .  17 LEU CB   1 1 
        3  4078 1 1  17 LEU CD1  C   1.402  -3.736   1.077 1.00 . A A .  17 LEU CD1  1 1 
        3  4079 1 1  17 LEU CD2  C  -1.096  -3.911   0.843 1.00 . A A .  17 LEU CD2  1 1 
        3  4080 1 1  17 LEU CG   C   0.105  -2.964   0.826 1.00 . A A .  17 LEU CG   1 1 
        3  4081 1 1  17 LEU H    H  -2.126  -2.451   3.382 1.00 . A A .  17 LEU H    1 1 
        3  4082 1 1  17 LEU HA   H   0.903  -2.454   3.530 1.00 . A A .  17 LEU HA   1 1 
        3  4083 1 1  17 LEU HB2  H  -0.987  -1.199   1.431 1.00 . A A .  17 LEU HB2  1 1 
        3  4084 1 1  17 LEU HB3  H   0.744  -1.021   1.415 1.00 . A A .  17 LEU HB3  1 1 
        3  4085 1 1  17 LEU HD11 H   2.290  -3.080   1.037 1.00 . A A .  17 LEU HD11 1 1 
        3  4086 1 1  17 LEU HD12 H   1.413  -4.239   2.061 1.00 . A A .  17 LEU HD12 1 1 
        3  4087 1 1  17 LEU HD13 H   1.553  -4.524   0.316 1.00 . A A .  17 LEU HD13 1 1 
        3  4088 1 1  17 LEU HD21 H  -2.047  -3.377   0.661 1.00 . A A .  17 LEU HD21 1 1 
        3  4089 1 1  17 LEU HD22 H  -1.011  -4.678   0.052 1.00 . A A .  17 LEU HD22 1 1 
        3  4090 1 1  17 LEU HD23 H  -1.205  -4.453   1.800 1.00 . A A .  17 LEU HD23 1 1 
        3  4091 1 1  17 LEU HG   H   0.165  -2.562  -0.210 1.00 . A A .  17 LEU HG   1 1 
        3  4092 1 1  17 LEU N    N  -1.197  -2.561   3.801 1.00 . A A .  17 LEU N    1 1 
        3  4093 1 1  17 LEU O    O   1.320  -0.199   4.434 1.00 . A A .  17 LEU O    1 1 
        3  4094 1 1  18 ILE C    C  -0.192   2.307   5.625 1.00 . A A .  18 ILE C    1 1 
        3  4095 1 1  18 ILE CA   C  -0.624   1.910   4.180 1.00 . A A .  18 ILE CA   1 1 
        3  4096 1 1  18 ILE CB   C  -1.965   2.630   3.757 1.00 . A A .  18 ILE CB   1 1 
        3  4097 1 1  18 ILE CD1  C  -1.147   2.894   1.290 1.00 . A A .  18 ILE CD1  1 1 
        3  4098 1 1  18 ILE CG1  C  -2.272   2.537   2.246 1.00 . A A .  18 ILE CG1  1 1 
        3  4099 1 1  18 ILE CG2  C  -2.118   4.095   4.214 1.00 . A A .  18 ILE CG2  1 1 
        3  4100 1 1  18 ILE H    H  -1.670   0.073   3.560 1.00 . A A .  18 ILE H    1 1 
        3  4101 1 1  18 ILE HA   H   0.179   2.278   3.495 1.00 . A A .  18 ILE HA   1 1 
        3  4102 1 1  18 ILE HB   H  -2.802   2.091   4.251 1.00 . A A .  18 ILE HB   1 1 
        3  4103 1 1  18 ILE HD11 H  -1.538   3.175   0.296 1.00 . A A .  18 ILE HD11 1 1 
        3  4104 1 1  18 ILE HD12 H  -0.530   3.735   1.643 1.00 . A A .  18 ILE HD12 1 1 
        3  4105 1 1  18 ILE HD13 H  -0.454   2.044   1.154 1.00 . A A .  18 ILE HD13 1 1 
        3  4106 1 1  18 ILE HG12 H  -2.584   1.497   2.054 1.00 . A A .  18 ILE HG12 1 1 
        3  4107 1 1  18 ILE HG13 H  -3.180   3.126   2.012 1.00 . A A .  18 ILE HG13 1 1 
        3  4108 1 1  18 ILE HG21 H  -2.417   4.127   5.276 1.00 . A A .  18 ILE HG21 1 1 
        3  4109 1 1  18 ILE HG22 H  -1.187   4.675   4.120 1.00 . A A .  18 ILE HG22 1 1 
        3  4110 1 1  18 ILE HG23 H  -2.910   4.636   3.668 1.00 . A A .  18 ILE HG23 1 1 
        3  4111 1 1  18 ILE N    N  -0.779   0.451   3.895 1.00 . A A .  18 ILE N    1 1 
        3  4112 1 1  18 ILE O    O   0.619   3.229   5.757 1.00 . A A .  18 ILE O    1 1 
        3  4113 1 1  19 LYS C    C  -0.395   0.975   9.145 1.00 . A A .  19 LYS C    1 1 
        3  4114 1 1  19 LYS CA   C  -0.435   2.110   8.077 1.00 . A A .  19 LYS CA   1 1 
        3  4115 1 1  19 LYS CB   C  -1.311   3.287   8.567 1.00 . A A .  19 LYS CB   1 1 
        3  4116 1 1  19 LYS CD   C  -1.569   5.792   8.806 1.00 . A A .  19 LYS CD   1 1 
        3  4117 1 1  19 LYS CE   C  -1.130   7.205   8.413 1.00 . A A .  19 LYS CE   1 1 
        3  4118 1 1  19 LYS CG   C  -0.893   4.664   8.013 1.00 . A A .  19 LYS CG   1 1 
        3  4119 1 1  19 LYS H    H  -1.434   0.971   6.437 1.00 . A A .  19 LYS H    1 1 
        3  4120 1 1  19 LYS HA   H   0.609   2.463   8.091 1.00 . A A .  19 LYS HA   1 1 
        3  4121 1 1  19 LYS HB2  H  -2.367   3.085   8.328 1.00 . A A .  19 LYS HB2  1 1 
        3  4122 1 1  19 LYS HB3  H  -1.256   3.335   9.676 1.00 . A A .  19 LYS HB3  1 1 
        3  4123 1 1  19 LYS HD2  H  -2.666   5.719   8.668 1.00 . A A .  19 LYS HD2  1 1 
        3  4124 1 1  19 LYS HD3  H  -1.415   5.645   9.895 1.00 . A A .  19 LYS HD3  1 1 
        3  4125 1 1  19 LYS HE2  H  -1.310   7.372   7.331 1.00 . A A .  19 LYS HE2  1 1 
        3  4126 1 1  19 LYS HE3  H  -1.801   7.931   8.921 1.00 . A A .  19 LYS HE3  1 1 
        3  4127 1 1  19 LYS HG2  H   0.211   4.757   8.048 1.00 . A A .  19 LYS HG2  1 1 
        3  4128 1 1  19 LYS HG3  H  -1.136   4.739   6.935 1.00 . A A .  19 LYS HG3  1 1 
        3  4129 1 1  19 LYS HZ1  H   0.548   8.403   9.026 1.00 . A A .  19 LYS HZ1  1 1 
        3  4130 1 1  19 LYS HZ2  H   0.621   6.841   9.590 1.00 . A A .  19 LYS HZ2  1 1 
        3  4131 1 1  19 LYS HZ3  H   0.970   7.151   8.050 1.00 . A A .  19 LYS HZ3  1 1 
        3  4132 1 1  19 LYS N    N  -0.770   1.724   6.681 1.00 . A A .  19 LYS N    1 1 
        3  4133 1 1  19 LYS NZ   N   0.296   7.442   8.778 1.00 . A A .  19 LYS NZ   1 1 
        3  4134 1 1  19 LYS O    O   0.146   1.239  10.222 1.00 . A A .  19 LYS O    1 1 
        3  4135 1 1  20 GLN C    C   0.831  -1.704  10.189 1.00 . A A .  20 GLN C    1 1 
        3  4136 1 1  20 GLN CA   C  -0.664  -1.401   9.830 1.00 . A A .  20 GLN CA   1 1 
        3  4137 1 1  20 GLN CB   C  -1.395  -2.627   9.246 1.00 . A A .  20 GLN CB   1 1 
        3  4138 1 1  20 GLN CD   C  -3.006  -3.628  10.988 1.00 . A A .  20 GLN CD   1 1 
        3  4139 1 1  20 GLN CG   C  -1.690  -3.779  10.230 1.00 . A A .  20 GLN CG   1 1 
        3  4140 1 1  20 GLN H    H  -1.380  -0.365   8.002 1.00 . A A .  20 GLN H    1 1 
        3  4141 1 1  20 GLN HA   H  -1.169  -1.122  10.776 1.00 . A A .  20 GLN HA   1 1 
        3  4142 1 1  20 GLN HB2  H  -2.360  -2.307   8.798 1.00 . A A .  20 GLN HB2  1 1 
        3  4143 1 1  20 GLN HB3  H  -0.805  -3.032   8.400 1.00 . A A .  20 GLN HB3  1 1 
        3  4144 1 1  20 GLN HE21 H  -3.949  -4.746   9.636 1.00 . A A .  20 GLN HE21 1 1 
        3  4145 1 1  20 GLN HE22 H  -4.939  -3.992  10.966 1.00 . A A .  20 GLN HE22 1 1 
        3  4146 1 1  20 GLN HG2  H  -1.695  -4.730   9.662 1.00 . A A .  20 GLN HG2  1 1 
        3  4147 1 1  20 GLN HG3  H  -0.875  -3.907  10.965 1.00 . A A .  20 GLN HG3  1 1 
        3  4148 1 1  20 GLN N    N  -0.866  -0.258   8.886 1.00 . A A .  20 GLN N    1 1 
        3  4149 1 1  20 GLN NE2  N  -4.051  -4.298  10.559 1.00 . A A .  20 GLN NE2  1 1 
        3  4150 1 1  20 GLN O    O   1.116  -1.919  11.369 1.00 . A A .  20 GLN O    1 1 
        3  4151 1 1  20 GLN OE1  O  -3.113  -2.890  11.962 1.00 . A A .  20 GLN OE1  1 1 
        3  4152 1 1  21 ASN C    C   4.097  -0.906   8.408 1.00 . A A .  21 ASN C    1 1 
        3  4153 1 1  21 ASN CA   C   3.218  -1.545   9.522 1.00 . A A .  21 ASN CA   1 1 
        3  4154 1 1  21 ASN CB   C   3.852  -2.815  10.149 1.00 . A A .  21 ASN CB   1 1 
        3  4155 1 1  21 ASN CG   C   3.794  -4.099   9.339 1.00 . A A .  21 ASN CG   1 1 
        3  4156 1 1  21 ASN H    H   1.373  -1.427   8.297 1.00 . A A .  21 ASN H    1 1 
        3  4157 1 1  21 ASN HA   H   3.274  -0.752  10.303 1.00 . A A .  21 ASN HA   1 1 
        3  4158 1 1  21 ASN HB2  H   4.913  -2.606  10.378 1.00 . A A .  21 ASN HB2  1 1 
        3  4159 1 1  21 ASN HB3  H   3.405  -2.981  11.148 1.00 . A A .  21 ASN HB3  1 1 
        3  4160 1 1  21 ASN HD21 H   2.076  -4.619  10.201 1.00 . A A .  21 ASN HD21 1 1 
        3  4161 1 1  21 ASN HD22 H   2.805  -5.756   8.947 1.00 . A A .  21 ASN HD22 1 1 
        3  4162 1 1  21 ASN N    N   1.770  -1.670   9.211 1.00 . A A .  21 ASN N    1 1 
        3  4163 1 1  21 ASN ND2  N   2.806  -4.933   9.555 1.00 . A A .  21 ASN ND2  1 1 
        3  4164 1 1  21 ASN O    O   4.666   0.151   8.670 1.00 . A A .  21 ASN O    1 1 
        3  4165 1 1  21 ASN OD1  O   4.641  -4.371   8.495 1.00 . A A .  21 ASN OD1  1 1 
        3  4166 1 1  22 ALA C    C   5.534   0.265   5.774 1.00 . A A .  22 ALA C    1 1 
        3  4167 1 1  22 ALA CA   C   5.441  -1.183   6.337 1.00 . A A .  22 ALA CA   1 1 
        3  4168 1 1  22 ALA CB   C   5.463  -2.243   5.226 1.00 . A A .  22 ALA CB   1 1 
        3  4169 1 1  22 ALA H    H   3.677  -2.314   7.037 1.00 . A A .  22 ALA H    1 1 
        3  4170 1 1  22 ALA HA   H   6.367  -1.319   6.935 1.00 . A A .  22 ALA HA   1 1 
        3  4171 1 1  22 ALA HB1  H   4.566  -2.200   4.581 1.00 . A A .  22 ALA HB1  1 1 
        3  4172 1 1  22 ALA HB2  H   6.342  -2.128   4.566 1.00 . A A .  22 ALA HB2  1 1 
        3  4173 1 1  22 ALA HB3  H   5.519  -3.267   5.644 1.00 . A A .  22 ALA HB3  1 1 
        3  4174 1 1  22 ALA N    N   4.282  -1.510   7.224 1.00 . A A .  22 ALA N    1 1 
        3  4175 1 1  22 ALA O    O   6.609   0.870   5.801 1.00 . A A .  22 ALA O    1 1 
        3  4176 1 1  23 VAL C    C   4.285   3.262   6.132 1.00 . A A .  23 VAL C    1 1 
        3  4177 1 1  23 VAL CA   C   4.304   2.255   4.926 1.00 . A A .  23 VAL CA   1 1 
        3  4178 1 1  23 VAL CB   C   3.097   2.422   3.965 1.00 . A A .  23 VAL CB   1 1 
        3  4179 1 1  23 VAL CG1  C   2.822   3.867   3.503 1.00 . A A .  23 VAL CG1  1 1 
        3  4180 1 1  23 VAL CG2  C   3.202   1.550   2.692 1.00 . A A .  23 VAL CG2  1 1 
        3  4181 1 1  23 VAL H    H   3.603   0.182   5.336 1.00 . A A .  23 VAL H    1 1 
        3  4182 1 1  23 VAL HA   H   5.200   2.505   4.334 1.00 . A A .  23 VAL HA   1 1 
        3  4183 1 1  23 VAL HB   H   2.227   2.062   4.533 1.00 . A A .  23 VAL HB   1 1 
        3  4184 1 1  23 VAL HG11 H   1.898   3.949   2.895 1.00 . A A .  23 VAL HG11 1 1 
        3  4185 1 1  23 VAL HG12 H   2.667   4.553   4.356 1.00 . A A .  23 VAL HG12 1 1 
        3  4186 1 1  23 VAL HG13 H   3.667   4.273   2.920 1.00 . A A .  23 VAL HG13 1 1 
        3  4187 1 1  23 VAL HG21 H   2.233   1.528   2.163 1.00 . A A .  23 VAL HG21 1 1 
        3  4188 1 1  23 VAL HG22 H   3.982   1.901   1.992 1.00 . A A .  23 VAL HG22 1 1 
        3  4189 1 1  23 VAL HG23 H   3.426   0.496   2.939 1.00 . A A .  23 VAL HG23 1 1 
        3  4190 1 1  23 VAL N    N   4.408   0.821   5.329 1.00 . A A .  23 VAL N    1 1 
        3  4191 1 1  23 VAL O    O   4.724   4.397   5.940 1.00 . A A .  23 VAL O    1 1 
        3  4192 1 1  24 GLU C    C   5.736   3.485   9.058 1.00 . A A .  24 GLU C    1 1 
        3  4193 1 1  24 GLU CA   C   4.241   3.671   8.571 1.00 . A A .  24 GLU CA   1 1 
        3  4194 1 1  24 GLU CB   C   3.231   3.328   9.687 1.00 . A A .  24 GLU CB   1 1 
        3  4195 1 1  24 GLU CD   C   2.324   5.647  10.411 1.00 . A A .  24 GLU CD   1 1 
        3  4196 1 1  24 GLU CG   C   3.088   4.388  10.792 1.00 . A A .  24 GLU CG   1 1 
        3  4197 1 1  24 GLU H    H   3.537   1.914   7.425 1.00 . A A .  24 GLU H    1 1 
        3  4198 1 1  24 GLU HA   H   4.127   4.745   8.325 1.00 . A A .  24 GLU HA   1 1 
        3  4199 1 1  24 GLU HB2  H   2.223   3.152   9.271 1.00 . A A .  24 GLU HB2  1 1 
        3  4200 1 1  24 GLU HB3  H   3.496   2.349  10.133 1.00 . A A .  24 GLU HB3  1 1 
        3  4201 1 1  24 GLU HG2  H   2.559   3.924  11.642 1.00 . A A .  24 GLU HG2  1 1 
        3  4202 1 1  24 GLU HG3  H   4.067   4.712  11.178 1.00 . A A .  24 GLU HG3  1 1 
        3  4203 1 1  24 GLU N    N   3.855   2.892   7.352 1.00 . A A .  24 GLU N    1 1 
        3  4204 1 1  24 GLU O    O   6.286   4.371   9.722 1.00 . A A .  24 GLU O    1 1 
        3  4205 1 1  24 GLU OE1  O   2.884   6.523   9.720 1.00 . A A .  24 GLU OE1  1 1 
        3  4206 1 1  24 GLU OE2  O   1.144   5.792  10.795 1.00 . A A .  24 GLU OE2  1 1 
        3  4207 1 1  25 GLN C    C   8.847   2.729   8.089 1.00 . A A .  25 GLN C    1 1 
        3  4208 1 1  25 GLN CA   C   7.805   2.086   9.049 1.00 . A A .  25 GLN CA   1 1 
        3  4209 1 1  25 GLN CB   C   8.009   0.562   9.227 1.00 . A A .  25 GLN CB   1 1 
        3  4210 1 1  25 GLN CD   C   8.722   0.356  11.702 1.00 . A A .  25 GLN CD   1 1 
        3  4211 1 1  25 GLN CG   C   9.118   0.178  10.235 1.00 . A A .  25 GLN CG   1 1 
        3  4212 1 1  25 GLN H    H   5.763   1.631   8.337 1.00 . A A .  25 GLN H    1 1 
        3  4213 1 1  25 GLN HA   H   8.008   2.554  10.025 1.00 . A A .  25 GLN HA   1 1 
        3  4214 1 1  25 GLN HB2  H   7.072   0.068   9.555 1.00 . A A .  25 GLN HB2  1 1 
        3  4215 1 1  25 GLN HB3  H   8.231   0.097   8.246 1.00 . A A .  25 GLN HB3  1 1 
        3  4216 1 1  25 GLN HE21 H   8.832  -1.613  12.024 1.00 . A A .  25 GLN HE21 1 1 
        3  4217 1 1  25 GLN HE22 H   8.378  -0.522  13.433 1.00 . A A .  25 GLN HE22 1 1 
        3  4218 1 1  25 GLN HG2  H   9.414  -0.871  10.037 1.00 . A A .  25 GLN HG2  1 1 
        3  4219 1 1  25 GLN HG3  H  10.038   0.761  10.046 1.00 . A A .  25 GLN HG3  1 1 
        3  4220 1 1  25 GLN N    N   6.380   2.352   8.741 1.00 . A A .  25 GLN N    1 1 
        3  4221 1 1  25 GLN NE2  N   8.622  -0.710  12.457 1.00 . A A .  25 GLN NE2  1 1 
        3  4222 1 1  25 GLN O    O   9.908   3.119   8.581 1.00 . A A .  25 GLN O    1 1 
        3  4223 1 1  25 GLN OE1  O   8.489   1.459  12.193 1.00 . A A .  25 GLN OE1  1 1 
        3  4224 1 1  26 LEU C    C   9.573   5.313   6.466 1.00 . A A .  26 LEU C    1 1 
        3  4225 1 1  26 LEU CA   C   9.335   3.867   5.922 1.00 . A A .  26 LEU CA   1 1 
        3  4226 1 1  26 LEU CB   C   8.852   3.824   4.446 1.00 . A A .  26 LEU CB   1 1 
        3  4227 1 1  26 LEU CD1  C   7.292   5.848   3.922 1.00 . A A .  26 LEU CD1  1 1 
        3  4228 1 1  26 LEU CD2  C   6.995   3.715   2.736 1.00 . A A .  26 LEU CD2  1 1 
        3  4229 1 1  26 LEU CG   C   7.448   4.331   4.078 1.00 . A A .  26 LEU CG   1 1 
        3  4230 1 1  26 LEU H    H   7.741   2.387   6.439 1.00 . A A .  26 LEU H    1 1 
        3  4231 1 1  26 LEU HA   H  10.349   3.429   5.865 1.00 . A A .  26 LEU HA   1 1 
        3  4232 1 1  26 LEU HB2  H   9.613   4.321   3.817 1.00 . A A .  26 LEU HB2  1 1 
        3  4233 1 1  26 LEU HB3  H   8.924   2.755   4.155 1.00 . A A .  26 LEU HB3  1 1 
        3  4234 1 1  26 LEU HD11 H   7.913   6.253   3.103 1.00 . A A .  26 LEU HD11 1 1 
        3  4235 1 1  26 LEU HD12 H   6.240   6.128   3.709 1.00 . A A .  26 LEU HD12 1 1 
        3  4236 1 1  26 LEU HD13 H   7.547   6.410   4.826 1.00 . A A .  26 LEU HD13 1 1 
        3  4237 1 1  26 LEU HD21 H   7.642   4.040   1.902 1.00 . A A .  26 LEU HD21 1 1 
        3  4238 1 1  26 LEU HD22 H   6.990   2.610   2.763 1.00 . A A .  26 LEU HD22 1 1 
        3  4239 1 1  26 LEU HD23 H   5.965   4.020   2.476 1.00 . A A .  26 LEU HD23 1 1 
        3  4240 1 1  26 LEU HG   H   6.753   3.986   4.858 1.00 . A A .  26 LEU HG   1 1 
        3  4241 1 1  26 LEU N    N   8.555   2.922   6.783 1.00 . A A .  26 LEU N    1 1 
        3  4242 1 1  26 LEU O    O  10.657   5.858   6.262 1.00 . A A .  26 LEU O    1 1 
        3  4243 1 1  27 GLN C    C   9.368   8.382   7.062 1.00 . A A .  27 GLN C    1 1 
        3  4244 1 1  27 GLN CA   C   8.553   7.242   7.738 1.00 . A A .  27 GLN CA   1 1 
        3  4245 1 1  27 GLN CB   C   8.711   7.106   9.269 1.00 . A A .  27 GLN CB   1 1 
        3  4246 1 1  27 GLN CD   C   6.437   8.293   9.939 1.00 . A A .  27 GLN CD   1 1 
        3  4247 1 1  27 GLN CG   C   7.956   8.173  10.093 1.00 . A A .  27 GLN CG   1 1 
        3  4248 1 1  27 GLN H    H   7.776   5.237   7.261 1.00 . A A .  27 GLN H    1 1 
        3  4249 1 1  27 GLN HA   H   7.503   7.545   7.596 1.00 . A A .  27 GLN HA   1 1 
        3  4250 1 1  27 GLN HB2  H   8.371   6.108   9.611 1.00 . A A .  27 GLN HB2  1 1 
        3  4251 1 1  27 GLN HB3  H   9.784   7.126   9.534 1.00 . A A .  27 GLN HB3  1 1 
        3  4252 1 1  27 GLN HE21 H   6.183   6.313   9.750 1.00 . A A .  27 GLN HE21 1 1 
        3  4253 1 1  27 GLN HE22 H   4.680   7.351   9.792 1.00 . A A .  27 GLN HE22 1 1 
        3  4254 1 1  27 GLN HG2  H   8.164   8.007  11.164 1.00 . A A .  27 GLN HG2  1 1 
        3  4255 1 1  27 GLN HG3  H   8.390   9.171   9.887 1.00 . A A .  27 GLN HG3  1 1 
        3  4256 1 1  27 GLN N    N   8.557   5.886   7.132 1.00 . A A .  27 GLN N    1 1 
        3  4257 1 1  27 GLN NE2  N   5.705   7.221   9.750 1.00 . A A .  27 GLN NE2  1 1 
        3  4258 1 1  27 GLN O    O  10.269   8.988   7.647 1.00 . A A .  27 GLN O    1 1 
        3  4259 1 1  27 GLN OE1  O   5.884   9.384  10.000 1.00 . A A .  27 GLN OE1  1 1 
        3  4260 1 1  28 VAL C    C   9.081  11.041   5.130 1.00 . A A .  28 VAL C    1 1 
        3  4261 1 1  28 VAL CA   C   9.719   9.628   4.938 1.00 . A A .  28 VAL CA   1 1 
        3  4262 1 1  28 VAL CB   C   9.661   9.141   3.443 1.00 . A A .  28 VAL CB   1 1 
        3  4263 1 1  28 VAL CG1  C  10.256  10.162   2.444 1.00 . A A .  28 VAL CG1  1 1 
        3  4264 1 1  28 VAL CG2  C  10.432   7.816   3.217 1.00 . A A .  28 VAL CG2  1 1 
        3  4265 1 1  28 VAL H    H   8.323   7.981   5.444 1.00 . A A .  28 VAL H    1 1 
        3  4266 1 1  28 VAL HA   H  10.790   9.659   5.231 1.00 . A A .  28 VAL HA   1 1 
        3  4267 1 1  28 VAL HB   H   8.601   8.972   3.159 1.00 . A A .  28 VAL HB   1 1 
        3  4268 1 1  28 VAL HG11 H   9.650  11.082   2.389 1.00 . A A .  28 VAL HG11 1 1 
        3  4269 1 1  28 VAL HG12 H  11.287  10.456   2.716 1.00 . A A .  28 VAL HG12 1 1 
        3  4270 1 1  28 VAL HG13 H  10.279   9.758   1.415 1.00 . A A .  28 VAL HG13 1 1 
        3  4271 1 1  28 VAL HG21 H  10.379   7.490   2.161 1.00 . A A .  28 VAL HG21 1 1 
        3  4272 1 1  28 VAL HG22 H  11.502   7.901   3.484 1.00 . A A .  28 VAL HG22 1 1 
        3  4273 1 1  28 VAL HG23 H  10.020   6.981   3.812 1.00 . A A .  28 VAL HG23 1 1 
        3  4274 1 1  28 VAL N    N   9.005   8.655   5.804 1.00 . A A .  28 VAL N    1 1 
        3  4275 1 1  28 VAL O    O   7.886  11.224   4.895 1.00 . A A .  28 VAL O    1 1 
        3  4276 1 1  29 GLY C    C  10.487  14.303   4.522 1.00 . A A .  29 GLY C    1 1 
        3  4277 1 1  29 GLY CA   C   9.543  13.465   5.409 1.00 . A A .  29 GLY CA   1 1 
        3  4278 1 1  29 GLY H    H  10.885  11.728   5.604 1.00 . A A .  29 GLY H    1 1 
        3  4279 1 1  29 GLY HA2  H   8.503  13.623   5.070 1.00 . A A .  29 GLY HA2  1 1 
        3  4280 1 1  29 GLY HA3  H   9.561  13.890   6.431 1.00 . A A .  29 GLY HA3  1 1 
        3  4281 1 1  29 GLY N    N   9.914  12.028   5.485 1.00 . A A .  29 GLY N    1 1 
        3  4282 1 1  29 GLY O    O  10.984  15.337   4.969 1.00 . A A .  29 GLY O    1 1 
        3  4283 1 1  30 GLN C    C  11.361  14.630   0.921 1.00 . A A .  30 GLN C    1 1 
        3  4284 1 1  30 GLN CA   C  11.797  14.375   2.398 1.00 . A A .  30 GLN CA   1 1 
        3  4285 1 1  30 GLN CB   C  13.017  13.423   2.513 1.00 . A A .  30 GLN CB   1 1 
        3  4286 1 1  30 GLN CD   C  14.940  15.148   2.198 1.00 . A A .  30 GLN CD   1 1 
        3  4287 1 1  30 GLN CG   C  14.296  13.842   1.758 1.00 . A A .  30 GLN CG   1 1 
        3  4288 1 1  30 GLN H    H  10.340  12.902   3.167 1.00 . A A .  30 GLN H    1 1 
        3  4289 1 1  30 GLN HA   H  12.125  15.362   2.784 1.00 . A A .  30 GLN HA   1 1 
        3  4290 1 1  30 GLN HB2  H  13.270  13.295   3.585 1.00 . A A .  30 GLN HB2  1 1 
        3  4291 1 1  30 GLN HB3  H  12.739  12.408   2.165 1.00 . A A .  30 GLN HB3  1 1 
        3  4292 1 1  30 GLN HE21 H  13.849  16.189   0.886 1.00 . A A .  30 GLN HE21 1 1 
        3  4293 1 1  30 GLN HE22 H  15.067  17.091   1.939 1.00 . A A .  30 GLN HE22 1 1 
        3  4294 1 1  30 GLN HG2  H  15.047  13.042   1.901 1.00 . A A .  30 GLN HG2  1 1 
        3  4295 1 1  30 GLN HG3  H  14.119  13.849   0.665 1.00 . A A .  30 GLN HG3  1 1 
        3  4296 1 1  30 GLN N    N  10.712  13.850   3.274 1.00 . A A .  30 GLN N    1 1 
        3  4297 1 1  30 GLN NE2  N  14.614  16.252   1.568 1.00 . A A .  30 GLN NE2  1 1 
        3  4298 1 1  30 GLN O    O  11.662  15.709   0.404 1.00 . A A .  30 GLN O    1 1 
        3  4299 1 1  30 GLN OE1  O  15.752  15.193   3.114 1.00 . A A .  30 GLN OE1  1 1 
        3  4300 1 1  31 SER C    C   9.112  12.889  -1.525 1.00 . A A .  31 SER C    1 1 
        3  4301 1 1  31 SER CA   C  10.322  13.805  -1.186 1.00 . A A .  31 SER CA   1 1 
        3  4302 1 1  31 SER CB   C  11.531  13.494  -2.109 1.00 . A A .  31 SER CB   1 1 
        3  4303 1 1  31 SER H    H  10.450  12.850   0.797 1.00 . A A .  31 SER H    1 1 
        3  4304 1 1  31 SER HA   H  10.018  14.851  -1.375 1.00 . A A .  31 SER HA   1 1 
        3  4305 1 1  31 SER HB2  H  12.359  14.194  -1.885 1.00 . A A .  31 SER HB2  1 1 
        3  4306 1 1  31 SER HB3  H  11.927  12.479  -1.912 1.00 . A A .  31 SER HB3  1 1 
        3  4307 1 1  31 SER HG   H  10.639  14.445  -3.652 1.00 . A A .  31 SER HG   1 1 
        3  4308 1 1  31 SER N    N  10.725  13.663   0.239 1.00 . A A .  31 SER N    1 1 
        3  4309 1 1  31 SER O    O   8.985  11.766  -1.018 1.00 . A A .  31 SER O    1 1 
        3  4310 1 1  31 SER OG   O  11.200  13.604  -3.495 1.00 . A A .  31 SER OG   1 1 
        3  4311 1 1  32 LYS C    C   7.613  11.293  -3.863 1.00 . A A .  32 LYS C    1 1 
        3  4312 1 1  32 LYS CA   C   7.177  12.526  -3.033 1.00 . A A .  32 LYS CA   1 1 
        3  4313 1 1  32 LYS CB   C   6.123  13.404  -3.733 1.00 . A A .  32 LYS CB   1 1 
        3  4314 1 1  32 LYS CD   C   5.350  15.033  -5.526 1.00 . A A .  32 LYS CD   1 1 
        3  4315 1 1  32 LYS CE   C   5.423  16.387  -4.811 1.00 . A A .  32 LYS CE   1 1 
        3  4316 1 1  32 LYS CG   C   6.452  14.046  -5.083 1.00 . A A .  32 LYS CG   1 1 
        3  4317 1 1  32 LYS H    H   8.546  14.262  -2.867 1.00 . A A .  32 LYS H    1 1 
        3  4318 1 1  32 LYS HA   H   6.629  12.111  -2.163 1.00 . A A .  32 LYS HA   1 1 
        3  4319 1 1  32 LYS HB2  H   5.205  12.793  -3.853 1.00 . A A .  32 LYS HB2  1 1 
        3  4320 1 1  32 LYS HB3  H   5.837  14.190  -3.008 1.00 . A A .  32 LYS HB3  1 1 
        3  4321 1 1  32 LYS HD2  H   5.445  15.198  -6.620 1.00 . A A .  32 LYS HD2  1 1 
        3  4322 1 1  32 LYS HD3  H   4.358  14.563  -5.385 1.00 . A A .  32 LYS HD3  1 1 
        3  4323 1 1  32 LYS HE2  H   5.570  16.275  -3.715 1.00 . A A .  32 LYS HE2  1 1 
        3  4324 1 1  32 LYS HE3  H   6.334  16.938  -5.145 1.00 . A A .  32 LYS HE3  1 1 
        3  4325 1 1  32 LYS HG2  H   7.438  14.544  -5.061 1.00 . A A .  32 LYS HG2  1 1 
        3  4326 1 1  32 LYS HG3  H   6.559  13.259  -5.854 1.00 . A A .  32 LYS HG3  1 1 
        3  4327 1 1  32 LYS HZ1  H   3.948  17.222  -6.092 1.00 . A A .  32 LYS HZ1  1 1 
        3  4328 1 1  32 LYS HZ2  H   3.333  16.831  -4.630 1.00 . A A .  32 LYS HZ2  1 1 
        3  4329 1 1  32 LYS HZ3  H   4.259  18.157  -4.748 1.00 . A A .  32 LYS HZ3  1 1 
        3  4330 1 1  32 LYS N    N   8.263  13.358  -2.454 1.00 . A A .  32 LYS N    1 1 
        3  4331 1 1  32 LYS NZ   N   4.193  17.176  -5.085 1.00 . A A .  32 LYS NZ   1 1 
        3  4332 1 1  32 LYS O    O   7.003  10.233  -3.718 1.00 . A A .  32 LYS O    1 1 
        3  4333 1 1  33 GLN C    C   9.838   9.089  -4.649 1.00 . A A .  33 GLN C    1 1 
        3  4334 1 1  33 GLN CA   C   9.215  10.262  -5.453 1.00 . A A .  33 GLN CA   1 1 
        3  4335 1 1  33 GLN CB   C  10.085  10.774  -6.625 1.00 . A A .  33 GLN CB   1 1 
        3  4336 1 1  33 GLN CD   C  12.618  10.459  -6.130 1.00 . A A .  33 GLN CD   1 1 
        3  4337 1 1  33 GLN CG   C  11.450  11.414  -6.317 1.00 . A A .  33 GLN CG   1 1 
        3  4338 1 1  33 GLN H    H   9.192  12.284  -4.554 1.00 . A A .  33 GLN H    1 1 
        3  4339 1 1  33 GLN HA   H   8.338   9.798  -5.952 1.00 . A A .  33 GLN HA   1 1 
        3  4340 1 1  33 GLN HB2  H  10.212   9.952  -7.356 1.00 . A A .  33 GLN HB2  1 1 
        3  4341 1 1  33 GLN HB3  H   9.483  11.521  -7.183 1.00 . A A .  33 GLN HB3  1 1 
        3  4342 1 1  33 GLN HE21 H  12.941  10.388  -8.098 1.00 . A A .  33 GLN HE21 1 1 
        3  4343 1 1  33 GLN HE22 H  14.060   9.438  -6.984 1.00 . A A .  33 GLN HE22 1 1 
        3  4344 1 1  33 GLN HG2  H  11.694  12.125  -7.131 1.00 . A A .  33 GLN HG2  1 1 
        3  4345 1 1  33 GLN HG3  H  11.386  12.059  -5.424 1.00 . A A .  33 GLN HG3  1 1 
        3  4346 1 1  33 GLN N    N   8.669  11.410  -4.687 1.00 . A A .  33 GLN N    1 1 
        3  4347 1 1  33 GLN NE2  N  13.237  10.008  -7.195 1.00 . A A .  33 GLN NE2  1 1 
        3  4348 1 1  33 GLN O    O   9.833   7.978  -5.178 1.00 . A A .  33 GLN O    1 1 
        3  4349 1 1  33 GLN OE1  O  13.014  10.117  -5.023 1.00 . A A .  33 GLN OE1  1 1 
        3  4350 1 1  34 GLN C    C   9.373   7.346  -2.010 1.00 . A A .  34 GLN C    1 1 
        3  4351 1 1  34 GLN CA   C  10.632   8.125  -2.507 1.00 . A A .  34 GLN CA   1 1 
        3  4352 1 1  34 GLN CB   C  11.520   8.580  -1.328 1.00 . A A .  34 GLN CB   1 1 
        3  4353 1 1  34 GLN CD   C  13.910   7.708  -1.889 1.00 . A A .  34 GLN CD   1 1 
        3  4354 1 1  34 GLN CG   C  12.983   8.906  -1.686 1.00 . A A .  34 GLN CG   1 1 
        3  4355 1 1  34 GLN H    H  10.239  10.244  -3.053 1.00 . A A .  34 GLN H    1 1 
        3  4356 1 1  34 GLN HA   H  11.213   7.389  -3.099 1.00 . A A .  34 GLN HA   1 1 
        3  4357 1 1  34 GLN HB2  H  11.070   9.468  -0.840 1.00 . A A .  34 GLN HB2  1 1 
        3  4358 1 1  34 GLN HB3  H  11.518   7.796  -0.545 1.00 . A A .  34 GLN HB3  1 1 
        3  4359 1 1  34 GLN HE21 H  15.470   8.845  -1.398 1.00 . A A .  34 GLN HE21 1 1 
        3  4360 1 1  34 GLN HE22 H  15.796   7.063  -1.742 1.00 . A A .  34 GLN HE22 1 1 
        3  4361 1 1  34 GLN HG2  H  13.022   9.548  -2.585 1.00 . A A .  34 GLN HG2  1 1 
        3  4362 1 1  34 GLN HG3  H  13.375   9.545  -0.872 1.00 . A A .  34 GLN HG3  1 1 
        3  4363 1 1  34 GLN N    N  10.291   9.273  -3.392 1.00 . A A .  34 GLN N    1 1 
        3  4364 1 1  34 GLN NE2  N  15.190   7.905  -1.684 1.00 . A A .  34 GLN NE2  1 1 
        3  4365 1 1  34 GLN O    O   9.254   6.160  -2.326 1.00 . A A .  34 GLN O    1 1 
        3  4366 1 1  34 GLN OE1  O  13.522   6.592  -2.234 1.00 . A A .  34 GLN OE1  1 1 
        3  4367 1 1  35 VAL C    C   6.291   6.726  -2.040 1.00 . A A .  35 VAL C    1 1 
        3  4368 1 1  35 VAL CA   C   7.147   7.331  -0.879 1.00 . A A .  35 VAL CA   1 1 
        3  4369 1 1  35 VAL CB   C   6.382   8.267   0.108 1.00 . A A .  35 VAL CB   1 1 
        3  4370 1 1  35 VAL CG1  C   5.714   9.500  -0.520 1.00 . A A .  35 VAL CG1  1 1 
        3  4371 1 1  35 VAL CG2  C   5.317   7.513   0.927 1.00 . A A .  35 VAL CG2  1 1 
        3  4372 1 1  35 VAL H    H   8.532   9.016  -1.307 1.00 . A A .  35 VAL H    1 1 
        3  4373 1 1  35 VAL HA   H   7.456   6.454  -0.274 1.00 . A A .  35 VAL HA   1 1 
        3  4374 1 1  35 VAL HB   H   7.127   8.636   0.848 1.00 . A A .  35 VAL HB   1 1 
        3  4375 1 1  35 VAL HG11 H   6.423  10.083  -1.127 1.00 . A A .  35 VAL HG11 1 1 
        3  4376 1 1  35 VAL HG12 H   4.875   9.239  -1.189 1.00 . A A .  35 VAL HG12 1 1 
        3  4377 1 1  35 VAL HG13 H   5.317  10.183   0.254 1.00 . A A .  35 VAL HG13 1 1 
        3  4378 1 1  35 VAL HG21 H   5.743   6.632   1.440 1.00 . A A .  35 VAL HG21 1 1 
        3  4379 1 1  35 VAL HG22 H   4.878   8.164   1.708 1.00 . A A .  35 VAL HG22 1 1 
        3  4380 1 1  35 VAL HG23 H   4.486   7.149   0.299 1.00 . A A .  35 VAL HG23 1 1 
        3  4381 1 1  35 VAL N    N   8.428   7.993  -1.301 1.00 . A A .  35 VAL N    1 1 
        3  4382 1 1  35 VAL O    O   5.839   5.583  -1.936 1.00 . A A .  35 VAL O    1 1 
        3  4383 1 1  36 SER C    C   6.176   5.880  -5.196 1.00 . A A .  36 SER C    1 1 
        3  4384 1 1  36 SER CA   C   5.451   6.972  -4.371 1.00 . A A .  36 SER CA   1 1 
        3  4385 1 1  36 SER CB   C   5.147   8.238  -5.210 1.00 . A A .  36 SER CB   1 1 
        3  4386 1 1  36 SER H    H   6.630   8.369  -3.129 1.00 . A A .  36 SER H    1 1 
        3  4387 1 1  36 SER HA   H   4.496   6.508  -4.048 1.00 . A A .  36 SER HA   1 1 
        3  4388 1 1  36 SER HB2  H   4.898   9.078  -4.531 1.00 . A A .  36 SER HB2  1 1 
        3  4389 1 1  36 SER HB3  H   6.040   8.574  -5.772 1.00 . A A .  36 SER HB3  1 1 
        3  4390 1 1  36 SER HG   H   4.282   7.468  -6.815 1.00 . A A .  36 SER HG   1 1 
        3  4391 1 1  36 SER N    N   6.144   7.458  -3.151 1.00 . A A .  36 SER N    1 1 
        3  4392 1 1  36 SER O    O   5.489   5.026  -5.754 1.00 . A A .  36 SER O    1 1 
        3  4393 1 1  36 SER OG   O   4.033   8.086  -6.086 1.00 . A A .  36 SER OG   1 1 
        3  4394 1 1  37 ALA C    C   8.179   3.400  -4.740 1.00 . A A .  37 ALA C    1 1 
        3  4395 1 1  37 ALA CA   C   8.251   4.632  -5.696 1.00 . A A .  37 ALA CA   1 1 
        3  4396 1 1  37 ALA CB   C   9.701   5.048  -5.962 1.00 . A A .  37 ALA CB   1 1 
        3  4397 1 1  37 ALA H    H   7.994   6.594  -4.736 1.00 . A A .  37 ALA H    1 1 
        3  4398 1 1  37 ALA HA   H   7.809   4.304  -6.659 1.00 . A A .  37 ALA HA   1 1 
        3  4399 1 1  37 ALA HB1  H  10.283   4.235  -6.427 1.00 . A A .  37 ALA HB1  1 1 
        3  4400 1 1  37 ALA HB2  H   9.761   5.902  -6.661 1.00 . A A .  37 ALA HB2  1 1 
        3  4401 1 1  37 ALA HB3  H  10.221   5.354  -5.031 1.00 . A A .  37 ALA HB3  1 1 
        3  4402 1 1  37 ALA N    N   7.517   5.839  -5.244 1.00 . A A .  37 ALA N    1 1 
        3  4403 1 1  37 ALA O    O   8.003   2.290  -5.240 1.00 . A A .  37 ALA O    1 1 
        3  4404 1 1  38 LEU C    C   6.618   1.805  -2.481 1.00 . A A .  38 LEU C    1 1 
        3  4405 1 1  38 LEU CA   C   8.050   2.452  -2.439 1.00 . A A .  38 LEU CA   1 1 
        3  4406 1 1  38 LEU CB   C   8.431   2.919  -1.006 1.00 . A A .  38 LEU CB   1 1 
        3  4407 1 1  38 LEU CD1  C  10.894   3.689  -1.309 1.00 . A A .  38 LEU CD1  1 1 
        3  4408 1 1  38 LEU CD2  C  10.070   2.969   0.912 1.00 . A A .  38 LEU CD2  1 1 
        3  4409 1 1  38 LEU CG   C   9.914   2.748  -0.604 1.00 . A A .  38 LEU CG   1 1 
        3  4410 1 1  38 LEU H    H   8.449   4.533  -3.099 1.00 . A A .  38 LEU H    1 1 
        3  4411 1 1  38 LEU HA   H   8.718   1.626  -2.739 1.00 . A A .  38 LEU HA   1 1 
        3  4412 1 1  38 LEU HB2  H   8.095   3.960  -0.832 1.00 . A A .  38 LEU HB2  1 1 
        3  4413 1 1  38 LEU HB3  H   7.847   2.320  -0.277 1.00 . A A .  38 LEU HB3  1 1 
        3  4414 1 1  38 LEU HD11 H  10.794   3.671  -2.408 1.00 . A A .  38 LEU HD11 1 1 
        3  4415 1 1  38 LEU HD12 H  10.778   4.741  -0.994 1.00 . A A .  38 LEU HD12 1 1 
        3  4416 1 1  38 LEU HD13 H  11.938   3.402  -1.098 1.00 . A A .  38 LEU HD13 1 1 
        3  4417 1 1  38 LEU HD21 H  11.102   2.770   1.250 1.00 . A A .  38 LEU HD21 1 1 
        3  4418 1 1  38 LEU HD22 H   9.828   4.009   1.197 1.00 . A A .  38 LEU HD22 1 1 
        3  4419 1 1  38 LEU HD23 H   9.418   2.299   1.502 1.00 . A A .  38 LEU HD23 1 1 
        3  4420 1 1  38 LEU HG   H  10.210   1.702  -0.809 1.00 . A A .  38 LEU HG   1 1 
        3  4421 1 1  38 LEU N    N   8.266   3.566  -3.408 1.00 . A A .  38 LEU N    1 1 
        3  4422 1 1  38 LEU O    O   6.500   0.577  -2.575 1.00 . A A .  38 LEU O    1 1 
        3  4423 1 1  39 LEU C    C   4.001   1.639  -4.300 1.00 . A A .  39 LEU C    1 1 
        3  4424 1 1  39 LEU CA   C   4.177   2.164  -2.818 1.00 . A A .  39 LEU CA   1 1 
        3  4425 1 1  39 LEU CB   C   3.210   3.339  -2.519 1.00 . A A .  39 LEU CB   1 1 
        3  4426 1 1  39 LEU CD1  C   2.630   5.182  -0.916 1.00 . A A .  39 LEU CD1  1 1 
        3  4427 1 1  39 LEU CD2  C   1.987   2.915  -0.257 1.00 . A A .  39 LEU CD2  1 1 
        3  4428 1 1  39 LEU CG   C   3.049   3.709  -1.025 1.00 . A A .  39 LEU CG   1 1 
        3  4429 1 1  39 LEU H    H   5.779   3.623  -2.372 1.00 . A A .  39 LEU H    1 1 
        3  4430 1 1  39 LEU HA   H   3.911   1.320  -2.153 1.00 . A A .  39 LEU HA   1 1 
        3  4431 1 1  39 LEU HB2  H   3.588   4.223  -3.071 1.00 . A A .  39 LEU HB2  1 1 
        3  4432 1 1  39 LEU HB3  H   2.219   3.161  -2.969 1.00 . A A .  39 LEU HB3  1 1 
        3  4433 1 1  39 LEU HD11 H   3.328   5.867  -1.431 1.00 . A A .  39 LEU HD11 1 1 
        3  4434 1 1  39 LEU HD12 H   1.620   5.329  -1.345 1.00 . A A .  39 LEU HD12 1 1 
        3  4435 1 1  39 LEU HD13 H   2.599   5.508   0.139 1.00 . A A .  39 LEU HD13 1 1 
        3  4436 1 1  39 LEU HD21 H   2.160   1.831  -0.212 1.00 . A A .  39 LEU HD21 1 1 
        3  4437 1 1  39 LEU HD22 H   1.955   3.248   0.794 1.00 . A A .  39 LEU HD22 1 1 
        3  4438 1 1  39 LEU HD23 H   0.957   3.077  -0.617 1.00 . A A .  39 LEU HD23 1 1 
        3  4439 1 1  39 LEU HG   H   4.022   3.612  -0.500 1.00 . A A .  39 LEU HG   1 1 
        3  4440 1 1  39 LEU N    N   5.555   2.620  -2.481 1.00 . A A .  39 LEU N    1 1 
        3  4441 1 1  39 LEU O    O   3.378   0.590  -4.486 1.00 . A A .  39 LEU O    1 1 
        3  4442 1 1  40 GLY C    C   3.599   2.680  -7.625 1.00 . A A .  40 GLY C    1 1 
        3  4443 1 1  40 GLY CA   C   4.573   1.907  -6.720 1.00 . A A .  40 GLY CA   1 1 
        3  4444 1 1  40 GLY H    H   5.146   3.120  -4.964 1.00 . A A .  40 GLY H    1 1 
        3  4445 1 1  40 GLY HA2  H   5.594   2.032  -7.129 1.00 . A A .  40 GLY HA2  1 1 
        3  4446 1 1  40 GLY HA3  H   4.372   0.824  -6.822 1.00 . A A .  40 GLY HA3  1 1 
        3  4447 1 1  40 GLY N    N   4.571   2.331  -5.297 1.00 . A A .  40 GLY N    1 1 
        3  4448 1 1  40 GLY O    O   2.608   2.103  -8.078 1.00 . A A .  40 GLY O    1 1 
        3  4449 1 1  41 THR C    C   3.639   6.272  -8.888 1.00 . A A .  41 THR C    1 1 
        3  4450 1 1  41 THR CA   C   2.918   4.904  -8.583 1.00 . A A .  41 THR CA   1 1 
        3  4451 1 1  41 THR CB   C   1.614   5.106  -7.753 1.00 . A A .  41 THR CB   1 1 
        3  4452 1 1  41 THR CG2  C   0.612   6.152  -8.203 1.00 . A A .  41 THR CG2  1 1 
        3  4453 1 1  41 THR H    H   4.599   4.355  -7.247 1.00 . A A .  41 THR H    1 1 
        3  4454 1 1  41 THR HA   H   2.670   4.423  -9.549 1.00 . A A .  41 THR HA   1 1 
        3  4455 1 1  41 THR HB   H   1.897   5.324  -6.703 1.00 . A A .  41 THR HB   1 1 
        3  4456 1 1  41 THR HG1  H   1.544   3.201  -8.005 1.00 . A A .  41 THR HG1  1 1 
        3  4457 1 1  41 THR HG21 H   0.236   5.978  -9.223 1.00 . A A .  41 THR HG21 1 1 
        3  4458 1 1  41 THR HG22 H  -0.277   6.138  -7.547 1.00 . A A .  41 THR HG22 1 1 
        3  4459 1 1  41 THR HG23 H   1.008   7.182  -8.168 1.00 . A A .  41 THR HG23 1 1 
        3  4460 1 1  41 THR N    N   3.842   3.982  -7.839 1.00 . A A .  41 THR N    1 1 
        3  4461 1 1  41 THR O    O   4.454   6.717  -8.071 1.00 . A A .  41 THR O    1 1 
        3  4462 1 1  41 THR OG1  O   0.879   3.891  -7.787 1.00 . A A .  41 THR OG1  1 1 
        3  4463 1 1  42 PRO C    C   2.856   9.456  -9.353 1.00 . A A .  42 PRO C    1 1 
        3  4464 1 1  42 PRO CA   C   3.752   8.449 -10.143 1.00 . A A .  42 PRO CA   1 1 
        3  4465 1 1  42 PRO CB   C   3.622   8.642 -11.681 1.00 . A A .  42 PRO CB   1 1 
        3  4466 1 1  42 PRO CD   C   2.633   6.490 -11.174 1.00 . A A .  42 PRO CD   1 1 
        3  4467 1 1  42 PRO CG   C   2.448   7.717 -12.080 1.00 . A A .  42 PRO CG   1 1 
        3  4468 1 1  42 PRO HA   H   4.816   8.566  -9.857 1.00 . A A .  42 PRO HA   1 1 
        3  4469 1 1  42 PRO HB2  H   3.455   9.692 -11.986 1.00 . A A .  42 PRO HB2  1 1 
        3  4470 1 1  42 PRO HB3  H   4.549   8.304 -12.182 1.00 . A A .  42 PRO HB3  1 1 
        3  4471 1 1  42 PRO HD2  H   1.668   6.035 -10.905 1.00 . A A .  42 PRO HD2  1 1 
        3  4472 1 1  42 PRO HD3  H   3.245   5.708 -11.663 1.00 . A A .  42 PRO HD3  1 1 
        3  4473 1 1  42 PRO HG2  H   1.487   8.215 -11.847 1.00 . A A .  42 PRO HG2  1 1 
        3  4474 1 1  42 PRO HG3  H   2.436   7.467 -13.154 1.00 . A A .  42 PRO HG3  1 1 
        3  4475 1 1  42 PRO N    N   3.346   7.014  -9.991 1.00 . A A .  42 PRO N    1 1 
        3  4476 1 1  42 PRO O    O   1.623   9.420  -9.436 1.00 . A A .  42 PRO O    1 1 
        3  4477 1 1  43 SER C    C   2.492  12.716  -8.802 1.00 . A A .  43 SER C    1 1 
        3  4478 1 1  43 SER CA   C   2.804  11.473  -7.897 1.00 . A A .  43 SER CA   1 1 
        3  4479 1 1  43 SER CB   C   3.684  11.759  -6.652 1.00 . A A .  43 SER CB   1 1 
        3  4480 1 1  43 SER H    H   4.513  10.388  -8.725 1.00 . A A .  43 SER H    1 1 
        3  4481 1 1  43 SER HA   H   1.830  11.104  -7.530 1.00 . A A .  43 SER HA   1 1 
        3  4482 1 1  43 SER HB2  H   4.743  11.931  -6.924 1.00 . A A .  43 SER HB2  1 1 
        3  4483 1 1  43 SER HB3  H   3.361  12.676  -6.135 1.00 . A A .  43 SER HB3  1 1 
        3  4484 1 1  43 SER HG   H   3.697   9.860  -6.121 1.00 . A A .  43 SER HG   1 1 
        3  4485 1 1  43 SER N    N   3.499  10.380  -8.629 1.00 . A A .  43 SER N    1 1 
        3  4486 1 1  43 SER O    O   2.263  12.572 -10.006 1.00 . A A .  43 SER O    1 1 
        3  4487 1 1  43 SER OG   O   3.577  10.724  -5.688 1.00 . A A .  43 SER OG   1 1 
        3  4488 1 1  44 ILE C    C   3.292  16.181  -8.797 1.00 . A A .  44 ILE C    1 1 
        3  4489 1 1  44 ILE CA   C   2.082  15.179  -8.953 1.00 . A A .  44 ILE CA   1 1 
        3  4490 1 1  44 ILE CB   C   0.696  15.758  -8.471 1.00 . A A .  44 ILE CB   1 1 
        3  4491 1 1  44 ILE CD1  C  -1.801  15.129  -8.077 1.00 . A A .  44 ILE CD1  1 1 
        3  4492 1 1  44 ILE CG1  C  -0.466  14.741  -8.710 1.00 . A A .  44 ILE CG1  1 1 
        3  4493 1 1  44 ILE CG2  C   0.359  17.077  -9.213 1.00 . A A .  44 ILE CG2  1 1 
        3  4494 1 1  44 ILE H    H   2.714  13.920  -7.241 1.00 . A A .  44 ILE H    1 1 
        3  4495 1 1  44 ILE HA   H   1.967  14.979 -10.039 1.00 . A A .  44 ILE HA   1 1 
        3  4496 1 1  44 ILE HB   H   0.753  15.971  -7.384 1.00 . A A .  44 ILE HB   1 1 
        3  4497 1 1  44 ILE HD11 H  -2.267  16.002  -8.568 1.00 . A A .  44 ILE HD11 1 1 
        3  4498 1 1  44 ILE HD12 H  -2.526  14.299  -8.153 1.00 . A A .  44 ILE HD12 1 1 
        3  4499 1 1  44 ILE HD13 H  -1.693  15.378  -7.007 1.00 . A A .  44 ILE HD13 1 1 
        3  4500 1 1  44 ILE HG12 H  -0.599  14.559  -9.795 1.00 . A A .  44 ILE HG12 1 1 
        3  4501 1 1  44 ILE HG13 H  -0.191  13.754  -8.291 1.00 . A A .  44 ILE HG13 1 1 
        3  4502 1 1  44 ILE HG21 H   1.116  17.863  -9.042 1.00 . A A .  44 ILE HG21 1 1 
        3  4503 1 1  44 ILE HG22 H   0.282  16.926 -10.306 1.00 . A A .  44 ILE HG22 1 1 
        3  4504 1 1  44 ILE HG23 H  -0.598  17.510  -8.872 1.00 . A A .  44 ILE HG23 1 1 
        3  4505 1 1  44 ILE N    N   2.433  13.927  -8.222 1.00 . A A .  44 ILE N    1 1 
        3  4506 1 1  44 ILE O    O   3.316  16.946  -7.821 1.00 . A A .  44 ILE O    1 1 
        3  4507 1 1  45 PRO C    C   5.181  18.461 -10.567 1.00 . A A .  45 PRO C    1 1 
        3  4508 1 1  45 PRO CA   C   5.415  17.210  -9.669 1.00 . A A .  45 PRO CA   1 1 
        3  4509 1 1  45 PRO CB   C   6.599  16.310 -10.122 1.00 . A A .  45 PRO CB   1 1 
        3  4510 1 1  45 PRO CD   C   4.556  15.122 -10.689 1.00 . A A .  45 PRO CD   1 1 
        3  4511 1 1  45 PRO CG   C   5.983  15.385 -11.200 1.00 . A A .  45 PRO CG   1 1 
        3  4512 1 1  45 PRO HA   H   5.612  17.544  -8.631 1.00 . A A .  45 PRO HA   1 1 
        3  4513 1 1  45 PRO HB2  H   7.469  16.881 -10.496 1.00 . A A .  45 PRO HB2  1 1 
        3  4514 1 1  45 PRO HB3  H   6.953  15.712  -9.259 1.00 . A A .  45 PRO HB3  1 1 
        3  4515 1 1  45 PRO HD2  H   3.814  15.119 -11.509 1.00 . A A .  45 PRO HD2  1 1 
        3  4516 1 1  45 PRO HD3  H   4.504  14.138 -10.188 1.00 . A A .  45 PRO HD3  1 1 
        3  4517 1 1  45 PRO HG2  H   5.948  15.916 -12.171 1.00 . A A .  45 PRO HG2  1 1 
        3  4518 1 1  45 PRO HG3  H   6.562  14.457 -11.350 1.00 . A A .  45 PRO HG3  1 1 
        3  4519 1 1  45 PRO N    N   4.293  16.217  -9.722 1.00 . A A .  45 PRO N    1 1 
        3  4520 1 1  45 PRO O    O   5.755  18.595 -11.652 1.00 . A A .  45 PRO O    1 1 
        3  4521 1 1  46 ASP C    C   5.205  21.730 -10.481 1.00 . A A .  46 ASP C    1 1 
        3  4522 1 1  46 ASP CA   C   4.085  20.677 -10.780 1.00 . A A .  46 ASP CA   1 1 
        3  4523 1 1  46 ASP CB   C   2.669  21.154 -10.394 1.00 . A A .  46 ASP CB   1 1 
        3  4524 1 1  46 ASP CG   C   2.226  22.399 -11.152 1.00 . A A .  46 ASP CG   1 1 
        3  4525 1 1  46 ASP H    H   3.885  19.149  -9.214 1.00 . A A .  46 ASP H    1 1 
        3  4526 1 1  46 ASP HA   H   4.031  20.478 -11.864 1.00 . A A .  46 ASP HA   1 1 
        3  4527 1 1  46 ASP HB2  H   1.930  20.357 -10.598 1.00 . A A .  46 ASP HB2  1 1 
        3  4528 1 1  46 ASP HB3  H   2.590  21.370  -9.319 1.00 . A A .  46 ASP HB3  1 1 
        3  4529 1 1  46 ASP N    N   4.350  19.394 -10.085 1.00 . A A .  46 ASP N    1 1 
        3  4530 1 1  46 ASP O    O   5.393  22.080  -9.312 1.00 . A A .  46 ASP O    1 1 
        3  4531 1 1  46 ASP OD1  O   1.747  22.274 -12.297 1.00 . A A .  46 ASP OD1  1 1 
        3  4532 1 1  46 ASP OD2  O   2.403  23.513 -10.615 1.00 . A A .  46 ASP OD2  1 1 
        3  4533 1 1  47 PRO C    C   6.396  24.786 -10.801 1.00 . A A .  47 PRO C    1 1 
        3  4534 1 1  47 PRO CA   C   6.931  23.386 -11.218 1.00 . A A .  47 PRO CA   1 1 
        3  4535 1 1  47 PRO CB   C   7.714  23.412 -12.558 1.00 . A A .  47 PRO CB   1 1 
        3  4536 1 1  47 PRO CD   C   5.814  21.943 -12.905 1.00 . A A .  47 PRO CD   1 1 
        3  4537 1 1  47 PRO CG   C   6.664  23.006 -13.619 1.00 . A A .  47 PRO CG   1 1 
        3  4538 1 1  47 PRO HA   H   7.613  23.058 -10.408 1.00 . A A .  47 PRO HA   1 1 
        3  4539 1 1  47 PRO HB2  H   8.193  24.384 -12.777 1.00 . A A .  47 PRO HB2  1 1 
        3  4540 1 1  47 PRO HB3  H   8.522  22.655 -12.522 1.00 . A A .  47 PRO HB3  1 1 
        3  4541 1 1  47 PRO HD2  H   4.759  21.968 -13.240 1.00 . A A .  47 PRO HD2  1 1 
        3  4542 1 1  47 PRO HD3  H   6.203  20.918 -13.068 1.00 . A A .  47 PRO HD3  1 1 
        3  4543 1 1  47 PRO HG2  H   6.032  23.879 -13.877 1.00 . A A .  47 PRO HG2  1 1 
        3  4544 1 1  47 PRO HG3  H   7.116  22.637 -14.554 1.00 . A A .  47 PRO HG3  1 1 
        3  4545 1 1  47 PRO N    N   5.939  22.293 -11.476 1.00 . A A .  47 PRO N    1 1 
        3  4546 1 1  47 PRO O    O   7.204  25.607 -10.361 1.00 . A A .  47 PRO O    1 1 
        3  4547 1 1  48 PHE C    C   4.177  25.955  -8.729 1.00 . A A .  48 PHE C    1 1 
        3  4548 1 1  48 PHE CA   C   4.461  26.240 -10.239 1.00 . A A .  48 PHE CA   1 1 
        3  4549 1 1  48 PHE CB   C   3.232  26.646 -11.087 1.00 . A A .  48 PHE CB   1 1 
        3  4550 1 1  48 PHE CD1  C   2.514  28.721  -9.721 1.00 . A A .  48 PHE CD1  1 1 
        3  4551 1 1  48 PHE CD2  C   2.551  28.871 -12.128 1.00 . A A .  48 PHE CD2  1 1 
        3  4552 1 1  48 PHE CE1  C   2.073  30.043  -9.643 1.00 . A A .  48 PHE CE1  1 1 
        3  4553 1 1  48 PHE CE2  C   2.107  30.194 -12.051 1.00 . A A .  48 PHE CE2  1 1 
        3  4554 1 1  48 PHE CG   C   2.765  28.113 -10.965 1.00 . A A .  48 PHE CG   1 1 
        3  4555 1 1  48 PHE CZ   C   1.869  30.776 -10.809 1.00 . A A .  48 PHE CZ   1 1 
        3  4556 1 1  48 PHE H    H   4.500  24.241 -11.159 1.00 . A A .  48 PHE H    1 1 
        3  4557 1 1  48 PHE HA   H   5.172  27.090 -10.266 1.00 . A A .  48 PHE HA   1 1 
        3  4558 1 1  48 PHE HB2  H   3.456  26.448 -12.156 1.00 . A A .  48 PHE HB2  1 1 
        3  4559 1 1  48 PHE HB3  H   2.386  25.965 -10.883 1.00 . A A .  48 PHE HB3  1 1 
        3  4560 1 1  48 PHE HD1  H   2.687  28.172  -8.806 1.00 . A A .  48 PHE HD1  1 1 
        3  4561 1 1  48 PHE HD2  H   2.723  28.437 -13.106 1.00 . A A .  48 PHE HD2  1 1 
        3  4562 1 1  48 PHE HE1  H   1.894  30.494  -8.676 1.00 . A A .  48 PHE HE1  1 1 
        3  4563 1 1  48 PHE HE2  H   1.948  30.761 -12.960 1.00 . A A .  48 PHE HE2  1 1 
        3  4564 1 1  48 PHE HZ   H   1.527  31.801 -10.750 1.00 . A A .  48 PHE HZ   1 1 
        3  4565 1 1  48 PHE N    N   5.082  25.056 -10.894 1.00 . A A .  48 PHE N    1 1 
        3  4566 1 1  48 PHE O    O   4.740  26.652  -7.882 1.00 . A A .  48 PHE O    1 1 
        3  4567 1 1  49 HIS C    C   2.783  23.021  -6.943 1.00 . A A .  49 HIS C    1 1 
        3  4568 1 1  49 HIS CA   C   3.119  24.540  -6.980 1.00 . A A .  49 HIS CA   1 1 
        3  4569 1 1  49 HIS CB   C   2.046  25.443  -6.328 1.00 . A A .  49 HIS CB   1 1 
        3  4570 1 1  49 HIS CD2  C   0.614  24.547  -4.342 1.00 . A A .  49 HIS CD2  1 1 
        3  4571 1 1  49 HIS CE1  C   2.013  24.728  -2.796 1.00 . A A .  49 HIS CE1  1 1 
        3  4572 1 1  49 HIS CG   C   1.779  25.140  -4.850 1.00 . A A .  49 HIS CG   1 1 
        3  4573 1 1  49 HIS H    H   2.963  24.419  -9.199 1.00 . A A .  49 HIS H    1 1 
        3  4574 1 1  49 HIS HA   H   4.057  24.697  -6.408 1.00 . A A .  49 HIS HA   1 1 
        3  4575 1 1  49 HIS HB2  H   2.368  26.500  -6.407 1.00 . A A .  49 HIS HB2  1 1 
        3  4576 1 1  49 HIS HB3  H   1.100  25.384  -6.901 1.00 . A A .  49 HIS HB3  1 1 
        3  4577 1 1  49 HIS HD1  H   3.687  25.578  -3.888 1.00 . A A .  49 HIS HD1  1 1 
        3  4578 1 1  49 HIS HD2  H  -0.239  24.287  -4.946 1.00 . A A .  49 HIS HD2  1 1 
        3  4579 1 1  49 HIS HE1  H   2.471  24.629  -1.821 1.00 . A A .  49 HIS HE1  1 1 
        3  4580 1 1  49 HIS N    N   3.326  24.968  -8.389 1.00 . A A .  49 HIS N    1 1 
        3  4581 1 1  49 HIS ND1  N   2.706  25.284  -3.837 1.00 . A A .  49 HIS ND1  1 1 
        3  4582 1 1  49 HIS NE2  N   0.737  24.264  -2.995 1.00 . A A .  49 HIS NE2  1 1 
        3  4583 1 1  49 HIS O    O   1.651  22.612  -7.230 1.00 . A A .  49 HIS O    1 1 
        3  4584 1 1  50 ALA C    C   2.800  20.191  -5.322 1.00 . A A .  50 ALA C    1 1 
        3  4585 1 1  50 ALA CA   C   3.614  20.725  -6.532 1.00 . A A .  50 ALA CA   1 1 
        3  4586 1 1  50 ALA CB   C   5.044  20.173  -6.600 1.00 . A A .  50 ALA CB   1 1 
        3  4587 1 1  50 ALA H    H   4.691  22.620  -6.440 1.00 . A A .  50 ALA H    1 1 
        3  4588 1 1  50 ALA HA   H   3.121  20.398  -7.468 1.00 . A A .  50 ALA HA   1 1 
        3  4589 1 1  50 ALA HB1  H   5.628  20.615  -7.426 1.00 . A A .  50 ALA HB1  1 1 
        3  4590 1 1  50 ALA HB2  H   5.620  20.351  -5.677 1.00 . A A .  50 ALA HB2  1 1 
        3  4591 1 1  50 ALA HB3  H   5.050  19.095  -6.792 1.00 . A A .  50 ALA HB3  1 1 
        3  4592 1 1  50 ALA N    N   3.759  22.194  -6.541 1.00 . A A .  50 ALA N    1 1 
        3  4593 1 1  50 ALA O    O   3.342  19.855  -4.266 1.00 . A A .  50 ALA O    1 1 
        3  4594 1 1  51 GLN C    C   0.604  18.276  -3.873 1.00 . A A .  51 GLN C    1 1 
        3  4595 1 1  51 GLN CA   C   0.524  19.743  -4.436 1.00 . A A .  51 GLN CA   1 1 
        3  4596 1 1  51 GLN CB   C  -0.897  20.036  -5.014 1.00 . A A .  51 GLN CB   1 1 
        3  4597 1 1  51 GLN CD   C  -2.707  21.729  -5.592 1.00 . A A .  51 GLN CD   1 1 
        3  4598 1 1  51 GLN CG   C  -1.251  21.526  -5.181 1.00 . A A .  51 GLN CG   1 1 
        3  4599 1 1  51 GLN H    H   1.175  20.529  -6.384 1.00 . A A .  51 GLN H    1 1 
        3  4600 1 1  51 GLN HA   H   0.710  20.426  -3.581 1.00 . A A .  51 GLN HA   1 1 
        3  4601 1 1  51 GLN HB2  H  -1.030  19.481  -5.959 1.00 . A A .  51 GLN HB2  1 1 
        3  4602 1 1  51 GLN HB3  H  -1.669  19.608  -4.348 1.00 . A A .  51 GLN HB3  1 1 
        3  4603 1 1  51 GLN HE21 H  -2.152  22.705  -7.245 1.00 . A A .  51 GLN HE21 1 1 
        3  4604 1 1  51 GLN HE22 H  -3.951  22.496  -6.917 1.00 . A A .  51 GLN HE22 1 1 
        3  4605 1 1  51 GLN HG2  H  -1.102  22.053  -4.220 1.00 . A A .  51 GLN HG2  1 1 
        3  4606 1 1  51 GLN HG3  H  -0.558  22.015  -5.892 1.00 . A A .  51 GLN HG3  1 1 
        3  4607 1 1  51 GLN N    N   1.485  20.061  -5.523 1.00 . A A .  51 GLN N    1 1 
        3  4608 1 1  51 GLN NE2  N  -2.957  22.384  -6.699 1.00 . A A .  51 GLN NE2  1 1 
        3  4609 1 1  51 GLN O    O   1.415  17.441  -4.291 1.00 . A A .  51 GLN O    1 1 
        3  4610 1 1  51 GLN OE1  O  -3.639  21.298  -4.916 1.00 . A A .  51 GLN OE1  1 1 
        3  4611 1 1  52 ARG C    C  -0.881  15.567  -3.536 1.00 . A A .  52 ARG C    1 1 
        3  4612 1 1  52 ARG CA   C  -0.600  16.629  -2.426 1.00 . A A .  52 ARG CA   1 1 
        3  4613 1 1  52 ARG CB   C  -1.759  16.758  -1.400 1.00 . A A .  52 ARG CB   1 1 
        3  4614 1 1  52 ARG CD   C  -3.736  17.803  -2.785 1.00 . A A .  52 ARG CD   1 1 
        3  4615 1 1  52 ARG CG   C  -3.226  16.723  -1.832 1.00 . A A .  52 ARG CG   1 1 
        3  4616 1 1  52 ARG CZ   C  -6.067  18.324  -3.540 1.00 . A A .  52 ARG CZ   1 1 
        3  4617 1 1  52 ARG H    H  -0.925  18.775  -2.728 1.00 . A A .  52 ARG H    1 1 
        3  4618 1 1  52 ARG HA   H   0.284  16.327  -1.817 1.00 . A A .  52 ARG HA   1 1 
        3  4619 1 1  52 ARG HB2  H  -1.689  15.892  -0.717 1.00 . A A .  52 ARG HB2  1 1 
        3  4620 1 1  52 ARG HB3  H  -1.566  17.617  -0.729 1.00 . A A .  52 ARG HB3  1 1 
        3  4621 1 1  52 ARG HD2  H  -3.617  18.807  -2.328 1.00 . A A .  52 ARG HD2  1 1 
        3  4622 1 1  52 ARG HD3  H  -3.159  17.799  -3.732 1.00 . A A .  52 ARG HD3  1 1 
        3  4623 1 1  52 ARG HE   H  -5.575  16.557  -2.872 1.00 . A A .  52 ARG HE   1 1 
        3  4624 1 1  52 ARG HG2  H  -3.415  15.717  -2.249 1.00 . A A .  52 ARG HG2  1 1 
        3  4625 1 1  52 ARG HG3  H  -3.829  16.737  -0.901 1.00 . A A .  52 ARG HG3  1 1 
        3  4626 1 1  52 ARG HH11 H  -4.846  19.855  -3.908 1.00 . A A .  52 ARG HH11 1 1 
        3  4627 1 1  52 ARG HH12 H  -6.609  20.099  -4.285 1.00 . A A .  52 ARG HH12 1 1 
        3  4628 1 1  52 ARG HH21 H  -7.359  16.855  -3.359 1.00 . A A .  52 ARG HH21 1 1 
        3  4629 1 1  52 ARG HH22 H  -8.017  18.474  -3.982 1.00 . A A .  52 ARG HH22 1 1 
        3  4630 1 1  52 ARG N    N  -0.293  17.994  -2.913 1.00 . A A .  52 ARG N    1 1 
        3  4631 1 1  52 ARG NE   N  -5.158  17.490  -3.064 1.00 . A A .  52 ARG NE   1 1 
        3  4632 1 1  52 ARG NH1  N  -5.828  19.552  -3.923 1.00 . A A .  52 ARG NH1  1 1 
        3  4633 1 1  52 ARG NH2  N  -7.278  17.863  -3.635 1.00 . A A .  52 ARG NH2  1 1 
        3  4634 1 1  52 ARG O    O  -1.523  15.866  -4.547 1.00 . A A .  52 ARG O    1 1 
        3  4635 1 1  53 TRP C    C  -2.085  12.558  -3.785 1.00 . A A .  53 TRP C    1 1 
        3  4636 1 1  53 TRP CA   C  -0.746  13.191  -4.240 1.00 . A A .  53 TRP CA   1 1 
        3  4637 1 1  53 TRP CB   C   0.477  12.257  -4.246 1.00 . A A .  53 TRP CB   1 1 
        3  4638 1 1  53 TRP CD1  C  -0.490  10.411  -5.902 1.00 . A A .  53 TRP CD1  1 1 
        3  4639 1 1  53 TRP CD2  C   0.950   9.654  -4.390 1.00 . A A .  53 TRP CD2  1 1 
        3  4640 1 1  53 TRP CE2  C   0.400   8.567  -5.114 1.00 . A A .  53 TRP CE2  1 1 
        3  4641 1 1  53 TRP CE3  C   1.950   9.414  -3.400 1.00 . A A .  53 TRP CE3  1 1 
        3  4642 1 1  53 TRP CG   C   0.346  10.830  -4.844 1.00 . A A .  53 TRP CG   1 1 
        3  4643 1 1  53 TRP CH2  C   1.738   7.025  -3.813 1.00 . A A .  53 TRP CH2  1 1 
        3  4644 1 1  53 TRP CZ2  C   0.779   7.235  -4.798 1.00 . A A .  53 TRP CZ2  1 1 
        3  4645 1 1  53 TRP CZ3  C   2.325   8.105  -3.129 1.00 . A A .  53 TRP CZ3  1 1 
        3  4646 1 1  53 TRP H    H  -0.222  14.170  -2.315 1.00 . A A .  53 TRP H    1 1 
        3  4647 1 1  53 TRP HA   H  -0.848  13.574  -5.279 1.00 . A A .  53 TRP HA   1 1 
        3  4648 1 1  53 TRP HB2  H   1.307  12.768  -4.768 1.00 . A A .  53 TRP HB2  1 1 
        3  4649 1 1  53 TRP HB3  H   0.822  12.109  -3.211 1.00 . A A .  53 TRP HB3  1 1 
        3  4650 1 1  53 TRP HD1  H  -1.110  11.066  -6.491 1.00 . A A .  53 TRP HD1  1 1 
        3  4651 1 1  53 TRP HE1  H  -0.993   8.472  -6.767 1.00 . A A .  53 TRP HE1  1 1 
        3  4652 1 1  53 TRP HE3  H   2.437  10.240  -2.897 1.00 . A A .  53 TRP HE3  1 1 
        3  4653 1 1  53 TRP HH2  H   2.056   6.019  -3.576 1.00 . A A .  53 TRP HH2  1 1 
        3  4654 1 1  53 TRP HZ2  H   0.329   6.397  -5.311 1.00 . A A .  53 TRP HZ2  1 1 
        3  4655 1 1  53 TRP HZ3  H   3.092   7.912  -2.391 1.00 . A A .  53 TRP HZ3  1 1 
        3  4656 1 1  53 TRP N    N  -0.429  14.329  -3.317 1.00 . A A .  53 TRP N    1 1 
        3  4657 1 1  53 TRP NE1  N  -0.473   9.021  -6.071 1.00 . A A .  53 TRP NE1  1 1 
        3  4658 1 1  53 TRP O    O  -2.134  11.874  -2.760 1.00 . A A .  53 TRP O    1 1 
        3  4659 1 1  54 ASP C    C  -5.288  11.555  -5.020 1.00 . A A .  54 ASP C    1 1 
        3  4660 1 1  54 ASP CA   C  -4.552  12.576  -4.093 1.00 . A A .  54 ASP CA   1 1 
        3  4661 1 1  54 ASP CB   C  -5.233  13.965  -4.043 1.00 . A A .  54 ASP CB   1 1 
        3  4662 1 1  54 ASP CG   C  -6.426  14.110  -3.118 1.00 . A A .  54 ASP CG   1 1 
        3  4663 1 1  54 ASP H    H  -2.965  13.526  -5.279 1.00 . A A .  54 ASP H    1 1 
        3  4664 1 1  54 ASP HA   H  -4.557  12.165  -3.063 1.00 . A A .  54 ASP HA   1 1 
        3  4665 1 1  54 ASP HB2  H  -4.516  14.743  -3.739 1.00 . A A .  54 ASP HB2  1 1 
        3  4666 1 1  54 ASP HB3  H  -5.545  14.278  -5.052 1.00 . A A .  54 ASP HB3  1 1 
        3  4667 1 1  54 ASP N    N  -3.156  12.841  -4.542 1.00 . A A .  54 ASP N    1 1 
        3  4668 1 1  54 ASP O    O  -6.292  11.873  -5.670 1.00 . A A .  54 ASP O    1 1 
        3  4669 1 1  54 ASP OD1  O  -6.882  13.117  -2.509 1.00 . A A .  54 ASP OD1  1 1 
        3  4670 1 1  54 ASP OD2  O  -6.932  15.251  -3.007 1.00 . A A .  54 ASP OD2  1 1 
        3  4671 1 1  55 TYR C    C  -6.394   8.382  -5.366 1.00 . A A .  55 TYR C    1 1 
        3  4672 1 1  55 TYR CA   C  -5.309   9.290  -6.017 1.00 . A A .  55 TYR CA   1 1 
        3  4673 1 1  55 TYR CB   C  -4.128   8.420  -6.533 1.00 . A A .  55 TYR CB   1 1 
        3  4674 1 1  55 TYR CD1  C  -3.191  10.304  -8.064 1.00 . A A .  55 TYR CD1  1 1 
        3  4675 1 1  55 TYR CD2  C  -2.618   8.007  -8.521 1.00 . A A .  55 TYR CD2  1 1 
        3  4676 1 1  55 TYR CE1  C  -2.304  10.723  -9.057 1.00 . A A .  55 TYR CE1  1 1 
        3  4677 1 1  55 TYR CE2  C  -1.734   8.430  -9.518 1.00 . A A .  55 TYR CE2  1 1 
        3  4678 1 1  55 TYR CG   C  -3.332   8.937  -7.751 1.00 . A A .  55 TYR CG   1 1 
        3  4679 1 1  55 TYR CZ   C  -1.557   9.789  -9.763 1.00 . A A .  55 TYR CZ   1 1 
        3  4680 1 1  55 TYR H    H  -3.900  10.204  -4.578 1.00 . A A .  55 TYR H    1 1 
        3  4681 1 1  55 TYR HA   H  -5.757   9.790  -6.903 1.00 . A A .  55 TYR HA   1 1 
        3  4682 1 1  55 TYR HB2  H  -3.417   8.209  -5.708 1.00 . A A .  55 TYR HB2  1 1 
        3  4683 1 1  55 TYR HB3  H  -4.507   7.412  -6.791 1.00 . A A .  55 TYR HB3  1 1 
        3  4684 1 1  55 TYR HD1  H  -3.710  11.069  -7.500 1.00 . A A .  55 TYR HD1  1 1 
        3  4685 1 1  55 TYR HD2  H  -2.698   6.945  -8.314 1.00 . A A .  55 TYR HD2  1 1 
        3  4686 1 1  55 TYR HE1  H  -2.154  11.784  -9.197 1.00 . A A .  55 TYR HE1  1 1 
        3  4687 1 1  55 TYR HE2  H  -1.153   7.705 -10.071 1.00 . A A .  55 TYR HE2  1 1 
        3  4688 1 1  55 TYR HH   H   0.294   9.888 -10.204 1.00 . A A .  55 TYR HH   1 1 
        3  4689 1 1  55 TYR N    N  -4.795  10.312  -5.072 1.00 . A A .  55 TYR N    1 1 
        3  4690 1 1  55 TYR O    O  -6.097   7.569  -4.488 1.00 . A A .  55 TYR O    1 1 
        3  4691 1 1  55 TYR OH   O  -0.551  10.199 -10.584 1.00 . A A .  55 TYR OH   1 1 
        3  4692 1 1  56 THR C    C  -8.432   6.469  -7.111 1.00 . A A .  56 THR C    1 1 
        3  4693 1 1  56 THR CA   C  -8.595   7.322  -5.808 1.00 . A A .  56 THR CA   1 1 
        3  4694 1 1  56 THR CB   C -10.039   7.875  -5.651 1.00 . A A .  56 THR CB   1 1 
        3  4695 1 1  56 THR CG2  C -11.074   6.772  -5.444 1.00 . A A .  56 THR CG2  1 1 
        3  4696 1 1  56 THR H    H  -7.763   9.221  -6.560 1.00 . A A .  56 THR H    1 1 
        3  4697 1 1  56 THR HA   H  -8.393   6.700  -4.912 1.00 . A A .  56 THR HA   1 1 
        3  4698 1 1  56 THR HB   H -10.308   8.466  -6.550 1.00 . A A .  56 THR HB   1 1 
        3  4699 1 1  56 THR HG1  H -10.626   8.192  -3.862 1.00 . A A .  56 THR HG1  1 1 
        3  4700 1 1  56 THR HG21 H -12.095   7.184  -5.398 1.00 . A A .  56 THR HG21 1 1 
        3  4701 1 1  56 THR HG22 H -11.081   6.033  -6.266 1.00 . A A .  56 THR HG22 1 1 
        3  4702 1 1  56 THR HG23 H -10.906   6.204  -4.510 1.00 . A A .  56 THR HG23 1 1 
        3  4703 1 1  56 THR N    N  -7.621   8.450  -5.901 1.00 . A A .  56 THR N    1 1 
        3  4704 1 1  56 THR O    O  -9.033   6.785  -8.144 1.00 . A A .  56 THR O    1 1 
        3  4705 1 1  56 THR OG1  O -10.141   8.718  -4.508 1.00 . A A .  56 THR OG1  1 1 
        3  4706 1 1  57 SER C    C  -7.204   3.250  -8.297 1.00 . A A .  57 SER C    1 1 
        3  4707 1 1  57 SER CA   C  -7.063   4.788  -8.303 1.00 . A A .  57 SER CA   1 1 
        3  4708 1 1  57 SER CB   C  -5.575   5.207  -8.480 1.00 . A A .  57 SER CB   1 1 
        3  4709 1 1  57 SER H    H  -7.032   5.368  -6.198 1.00 . A A .  57 SER H    1 1 
        3  4710 1 1  57 SER HA   H  -7.604   5.176  -9.192 1.00 . A A .  57 SER HA   1 1 
        3  4711 1 1  57 SER HB2  H  -5.242   4.921  -9.492 1.00 . A A .  57 SER HB2  1 1 
        3  4712 1 1  57 SER HB3  H  -5.499   6.308  -8.446 1.00 . A A .  57 SER HB3  1 1 
        3  4713 1 1  57 SER HG   H  -5.067   4.741  -6.634 1.00 . A A .  57 SER HG   1 1 
        3  4714 1 1  57 SER N    N  -7.559   5.453  -7.074 1.00 . A A .  57 SER N    1 1 
        3  4715 1 1  57 SER O    O  -6.968   2.591  -7.282 1.00 . A A .  57 SER O    1 1 
        3  4716 1 1  57 SER OG   O  -4.679   4.641  -7.526 1.00 . A A .  57 SER OG   1 1 
        3  4717 1 1  58 THR C    C  -6.394   1.076 -11.020 1.00 . A A .  58 THR C    1 1 
        3  4718 1 1  58 THR CA   C  -7.274   1.232  -9.748 1.00 . A A .  58 THR CA   1 1 
        3  4719 1 1  58 THR CB   C  -8.583   0.411  -9.745 1.00 . A A .  58 THR CB   1 1 
        3  4720 1 1  58 THR CG2  C  -9.568   0.678 -10.876 1.00 . A A .  58 THR CG2  1 1 
        3  4721 1 1  58 THR H    H  -7.629   3.332 -10.251 1.00 . A A .  58 THR H    1 1 
        3  4722 1 1  58 THR HA   H  -6.681   0.827  -8.904 1.00 . A A .  58 THR HA   1 1 
        3  4723 1 1  58 THR HB   H  -9.092   0.630  -8.782 1.00 . A A .  58 THR HB   1 1 
        3  4724 1 1  58 THR HG1  H  -7.514  -1.157  -9.202 1.00 . A A .  58 THR HG1  1 1 
        3  4725 1 1  58 THR HG21 H  -9.148   0.426 -11.866 1.00 . A A .  58 THR HG21 1 1 
        3  4726 1 1  58 THR HG22 H -10.482   0.070 -10.746 1.00 . A A .  58 THR HG22 1 1 
        3  4727 1 1  58 THR HG23 H  -9.885   1.735 -10.917 1.00 . A A .  58 THR HG23 1 1 
        3  4728 1 1  58 THR N    N  -7.505   2.677  -9.472 1.00 . A A .  58 THR N    1 1 
        3  4729 1 1  58 THR O    O  -6.553   1.783 -12.020 1.00 . A A .  58 THR O    1 1 
        3  4730 1 1  58 THR OG1  O  -8.287  -0.986  -9.780 1.00 . A A .  58 THR OG1  1 1 
        3  4731 1 1  59 GLN C    C  -4.040  -1.458 -12.183 1.00 . A A .  59 GLN C    1 1 
        3  4732 1 1  59 GLN CA   C  -4.312   0.049 -11.920 1.00 . A A .  59 GLN CA   1 1 
        3  4733 1 1  59 GLN CB   C  -3.103   0.906 -11.450 1.00 . A A .  59 GLN CB   1 1 
        3  4734 1 1  59 GLN CD   C  -1.546   1.601  -9.482 1.00 . A A .  59 GLN CD   1 1 
        3  4735 1 1  59 GLN CG   C  -2.586   0.643 -10.024 1.00 . A A .  59 GLN CG   1 1 
        3  4736 1 1  59 GLN H    H  -5.491  -0.447 -10.107 1.00 . A A .  59 GLN H    1 1 
        3  4737 1 1  59 GLN HA   H  -4.625   0.488 -12.893 1.00 . A A .  59 GLN HA   1 1 
        3  4738 1 1  59 GLN HB2  H  -2.273   0.791 -12.176 1.00 . A A .  59 GLN HB2  1 1 
        3  4739 1 1  59 GLN HB3  H  -3.416   1.965 -11.546 1.00 . A A .  59 GLN HB3  1 1 
        3  4740 1 1  59 GLN HE21 H  -2.879   3.086  -9.324 1.00 . A A .  59 GLN HE21 1 1 
        3  4741 1 1  59 GLN HE22 H  -1.108   3.432  -8.936 1.00 . A A .  59 GLN HE22 1 1 
        3  4742 1 1  59 GLN HG2  H  -3.421   0.620  -9.301 1.00 . A A .  59 GLN HG2  1 1 
        3  4743 1 1  59 GLN HG3  H  -2.157  -0.374  -9.992 1.00 . A A .  59 GLN HG3  1 1 
        3  4744 1 1  59 GLN N    N  -5.426   0.165 -10.934 1.00 . A A .  59 GLN N    1 1 
        3  4745 1 1  59 GLN NE2  N  -1.905   2.821  -9.155 1.00 . A A .  59 GLN NE2  1 1 
        3  4746 1 1  59 GLN O    O  -3.095  -2.058 -11.671 1.00 . A A .  59 GLN O    1 1 
        3  4747 1 1  59 GLN OE1  O  -0.397   1.237  -9.254 1.00 . A A .  59 GLN OE1  1 1 
        3  4748 1 1  60 ARG C    C  -5.113  -4.440 -13.872 1.00 . A A .  60 ARG C    1 1 
        3  4749 1 1  60 ARG CA   C  -5.355  -3.494 -12.668 1.00 . A A .  60 ARG CA   1 1 
        3  4750 1 1  60 ARG CB   C  -6.838  -3.525 -12.183 1.00 . A A .  60 ARG CB   1 1 
        3  4751 1 1  60 ARG CD   C  -9.349  -3.102 -12.608 1.00 . A A .  60 ARG CD   1 1 
        3  4752 1 1  60 ARG CG   C  -7.913  -2.953 -13.134 1.00 . A A .  60 ARG CG   1 1 
        3  4753 1 1  60 ARG CZ   C -10.883  -5.015 -12.148 1.00 . A A .  60 ARG CZ   1 1 
        3  4754 1 1  60 ARG H    H  -5.640  -1.442 -13.342 1.00 . A A .  60 ARG H    1 1 
        3  4755 1 1  60 ARG HA   H  -4.789  -3.882 -11.791 1.00 . A A .  60 ARG HA   1 1 
        3  4756 1 1  60 ARG HB2  H  -7.084  -4.575 -11.927 1.00 . A A .  60 ARG HB2  1 1 
        3  4757 1 1  60 ARG HB3  H  -6.890  -2.985 -11.215 1.00 . A A .  60 ARG HB3  1 1 
        3  4758 1 1  60 ARG HD2  H  -9.414  -2.711 -11.570 1.00 . A A .  60 ARG HD2  1 1 
        3  4759 1 1  60 ARG HD3  H -10.018  -2.465 -13.223 1.00 . A A .  60 ARG HD3  1 1 
        3  4760 1 1  60 ARG HE   H  -9.191  -5.235 -13.128 1.00 . A A .  60 ARG HE   1 1 
        3  4761 1 1  60 ARG HG2  H  -7.723  -1.873 -13.292 1.00 . A A .  60 ARG HG2  1 1 
        3  4762 1 1  60 ARG HG3  H  -7.836  -3.399 -14.146 1.00 . A A .  60 ARG HG3  1 1 
        3  4763 1 1  60 ARG HH11 H -11.612  -3.296 -11.541 1.00 . A A .  60 ARG HH11 1 1 
        3  4764 1 1  60 ARG HH12 H -12.607  -4.786 -11.157 1.00 . A A .  60 ARG HH12 1 1 
        3  4765 1 1  60 ARG HH21 H -10.262  -6.821 -12.654 1.00 . A A .  60 ARG HH21 1 1 
        3  4766 1 1  60 ARG HH22 H -11.857  -6.734 -11.771 1.00 . A A .  60 ARG HH22 1 1 
        3  4767 1 1  60 ARG N    N  -4.963  -2.088 -12.926 1.00 . A A .  60 ARG N    1 1 
        3  4768 1 1  60 ARG NE   N  -9.786  -4.515 -12.696 1.00 . A A .  60 ARG NE   1 1 
        3  4769 1 1  60 ARG NH1  N -11.800  -4.299 -11.549 1.00 . A A .  60 ARG NH1  1 1 
        3  4770 1 1  60 ARG NH2  N -11.042  -6.296 -12.210 1.00 . A A .  60 ARG NH2  1 1 
        3  4771 1 1  60 ARG O    O  -5.616  -4.211 -14.975 1.00 . A A .  60 ARG O    1 1 
        3  4772 1 1  61 VAL C    C  -5.488  -7.628 -14.705 1.00 . A A .  61 VAL C    1 1 
        3  4773 1 1  61 VAL CA   C  -4.263  -6.659 -14.610 1.00 . A A .  61 VAL CA   1 1 
        3  4774 1 1  61 VAL CB   C  -2.881  -7.361 -14.385 1.00 . A A .  61 VAL CB   1 1 
        3  4775 1 1  61 VAL CG1  C  -2.751  -8.215 -13.113 1.00 . A A .  61 VAL CG1  1 1 
        3  4776 1 1  61 VAL CG2  C  -2.471  -8.213 -15.602 1.00 . A A .  61 VAL CG2  1 1 
        3  4777 1 1  61 VAL H    H  -3.860  -5.546 -12.760 1.00 . A A .  61 VAL H    1 1 
        3  4778 1 1  61 VAL HA   H  -4.187  -6.188 -15.609 1.00 . A A .  61 VAL HA   1 1 
        3  4779 1 1  61 VAL HB   H  -2.116  -6.555 -14.320 1.00 . A A .  61 VAL HB   1 1 
        3  4780 1 1  61 VAL HG11 H  -3.419  -9.096 -13.119 1.00 . A A .  61 VAL HG11 1 1 
        3  4781 1 1  61 VAL HG12 H  -1.720  -8.596 -12.994 1.00 . A A .  61 VAL HG12 1 1 
        3  4782 1 1  61 VAL HG13 H  -2.981  -7.644 -12.196 1.00 . A A .  61 VAL HG13 1 1 
        3  4783 1 1  61 VAL HG21 H  -1.448  -8.619 -15.491 1.00 . A A .  61 VAL HG21 1 1 
        3  4784 1 1  61 VAL HG22 H  -3.148  -9.072 -15.770 1.00 . A A .  61 VAL HG22 1 1 
        3  4785 1 1  61 VAL HG23 H  -2.476  -7.608 -16.526 1.00 . A A .  61 VAL HG23 1 1 
        3  4786 1 1  61 VAL N    N  -4.398  -5.544 -13.628 1.00 . A A .  61 VAL N    1 1 
        3  4787 1 1  61 VAL O    O  -5.843  -8.036 -15.813 1.00 . A A .  61 VAL O    1 1 
        3  4788 1 1  62 ASP C    C  -8.547  -8.716 -13.662 1.00 . A A .  62 ASP C    1 1 
        3  4789 1 1  62 ASP CA   C  -7.051  -9.151 -13.510 1.00 . A A .  62 ASP CA   1 1 
        3  4790 1 1  62 ASP CB   C  -6.762  -9.828 -12.145 1.00 . A A .  62 ASP CB   1 1 
        3  4791 1 1  62 ASP CG   C  -7.189 -11.281 -11.961 1.00 . A A .  62 ASP CG   1 1 
        3  4792 1 1  62 ASP H    H  -5.654  -7.637 -12.727 1.00 . A A .  62 ASP H    1 1 
        3  4793 1 1  62 ASP HA   H  -6.798  -9.873 -14.316 1.00 . A A .  62 ASP HA   1 1 
        3  4794 1 1  62 ASP HB2  H  -5.672  -9.821 -11.943 1.00 . A A .  62 ASP HB2  1 1 
        3  4795 1 1  62 ASP HB3  H  -7.205  -9.239 -11.321 1.00 . A A .  62 ASP HB3  1 1 
        3  4796 1 1  62 ASP N    N  -6.094  -8.014 -13.572 1.00 . A A .  62 ASP N    1 1 
        3  4797 1 1  62 ASP O    O  -8.949  -7.567 -13.435 1.00 . A A .  62 ASP O    1 1 
        3  4798 1 1  62 ASP OD1  O  -8.298 -11.676 -12.377 1.00 . A A .  62 ASP OD1  1 1 
        3  4799 1 1  62 ASP OD2  O  -6.430 -12.028 -11.311 1.00 . A A .  62 ASP OD2  1 1 
        3  4800 1 1  63 ARG C    C -11.245  -9.647 -12.188 1.00 . A A .  63 ARG C    1 1 
        3  4801 1 1  63 ARG CA   C -10.841  -9.681 -13.707 1.00 . A A .  63 ARG CA   1 1 
        3  4802 1 1  63 ARG CB   C -11.444 -10.908 -14.443 1.00 . A A .  63 ARG CB   1 1 
        3  4803 1 1  63 ARG CD   C -13.487 -12.210 -15.213 1.00 . A A .  63 ARG CD   1 1 
        3  4804 1 1  63 ARG CG   C -12.987 -10.945 -14.495 1.00 . A A .  63 ARG CG   1 1 
        3  4805 1 1  63 ARG CZ   C -15.731 -13.180 -15.736 1.00 . A A .  63 ARG CZ   1 1 
        3  4806 1 1  63 ARG H    H  -8.875 -10.613 -13.775 1.00 . A A .  63 ARG H    1 1 
        3  4807 1 1  63 ARG HA   H -11.250  -8.769 -14.183 1.00 . A A .  63 ARG HA   1 1 
        3  4808 1 1  63 ARG HB2  H -11.060 -10.918 -15.485 1.00 . A A .  63 ARG HB2  1 1 
        3  4809 1 1  63 ARG HB3  H -11.057 -11.837 -13.977 1.00 . A A .  63 ARG HB3  1 1 
        3  4810 1 1  63 ARG HD2  H -13.091 -12.237 -16.250 1.00 . A A .  63 ARG HD2  1 1 
        3  4811 1 1  63 ARG HD3  H -13.097 -13.111 -14.694 1.00 . A A .  63 ARG HD3  1 1 
        3  4812 1 1  63 ARG HE   H -15.501 -11.445 -14.806 1.00 . A A .  63 ARG HE   1 1 
        3  4813 1 1  63 ARG HG2  H -13.402 -10.909 -13.468 1.00 . A A .  63 ARG HG2  1 1 
        3  4814 1 1  63 ARG HG3  H -13.363 -10.037 -15.009 1.00 . A A .  63 ARG HG3  1 1 
        3  4815 1 1  63 ARG HH11 H -14.232 -14.296 -16.340 1.00 . A A .  63 ARG HH11 1 1 
        3  4816 1 1  63 ARG HH12 H -15.906 -14.946 -16.684 1.00 . A A .  63 ARG HH12 1 1 
        3  4817 1 1  63 ARG HH21 H -17.383 -12.208 -15.211 1.00 . A A .  63 ARG HH21 1 1 
        3  4818 1 1  63 ARG HH22 H -17.591 -13.799 -16.064 1.00 . A A .  63 ARG HH22 1 1 
        3  4819 1 1  63 ARG N    N  -9.375  -9.724 -13.968 1.00 . A A .  63 ARG N    1 1 
        3  4820 1 1  63 ARG NE   N -14.971 -12.217 -15.221 1.00 . A A .  63 ARG NE   1 1 
        3  4821 1 1  63 ARG NH1  N -15.252 -14.254 -16.313 1.00 . A A .  63 ARG NH1  1 1 
        3  4822 1 1  63 ARG NH2  N -17.023 -13.050 -15.663 1.00 . A A .  63 ARG NH2  1 1 
        3  4823 1 1  63 ARG O    O -12.202  -8.941 -11.857 1.00 . A A .  63 ARG O    1 1 
        3  4824 1 1  64 LEU C    C  -9.555 -10.530  -8.950 1.00 . A A .  64 LEU C    1 1 
        3  4825 1 1  64 LEU CA   C -10.827 -10.362  -9.840 1.00 . A A .  64 LEU CA   1 1 
        3  4826 1 1  64 LEU CB   C -12.025 -11.276  -9.460 1.00 . A A .  64 LEU CB   1 1 
        3  4827 1 1  64 LEU CD1  C -11.809 -13.638  -8.524 1.00 . A A .  64 LEU CD1  1 1 
        3  4828 1 1  64 LEU CD2  C -13.135 -13.253 -10.615 1.00 . A A .  64 LEU CD2  1 1 
        3  4829 1 1  64 LEU CG   C -11.923 -12.783  -9.794 1.00 . A A .  64 LEU CG   1 1 
        3  4830 1 1  64 LEU H    H  -9.739 -10.888 -11.706 1.00 . A A .  64 LEU H    1 1 
        3  4831 1 1  64 LEU HA   H -11.177  -9.339  -9.590 1.00 . A A .  64 LEU HA   1 1 
        3  4832 1 1  64 LEU HB2  H -12.250 -11.122  -8.386 1.00 . A A .  64 LEU HB2  1 1 
        3  4833 1 1  64 LEU HB3  H -12.913 -10.832  -9.955 1.00 . A A .  64 LEU HB3  1 1 
        3  4834 1 1  64 LEU HD11 H -12.704 -13.560  -7.880 1.00 . A A .  64 LEU HD11 1 1 
        3  4835 1 1  64 LEU HD12 H -11.676 -14.708  -8.769 1.00 . A A .  64 LEU HD12 1 1 
        3  4836 1 1  64 LEU HD13 H -10.941 -13.347  -7.906 1.00 . A A .  64 LEU HD13 1 1 
        3  4837 1 1  64 LEU HD21 H -13.056 -14.324 -10.876 1.00 . A A .  64 LEU HD21 1 1 
        3  4838 1 1  64 LEU HD22 H -14.090 -13.116 -10.076 1.00 . A A .  64 LEU HD22 1 1 
        3  4839 1 1  64 LEU HD23 H -13.210 -12.698 -11.568 1.00 . A A .  64 LEU HD23 1 1 
        3  4840 1 1  64 LEU HG   H -11.025 -12.980 -10.416 1.00 . A A .  64 LEU HG   1 1 
        3  4841 1 1  64 LEU N    N -10.549 -10.377 -11.298 1.00 . A A .  64 LEU N    1 1 
        3  4842 1 1  64 LEU O    O  -9.226  -9.601  -8.205 1.00 . A A .  64 LEU O    1 1 
        3  4843 1 1  65 ALA C    C  -6.579 -11.240  -7.787 1.00 . A A .  65 ALA C    1 1 
        3  4844 1 1  65 ALA CA   C  -7.863 -12.094  -7.996 1.00 . A A .  65 ALA CA   1 1 
        3  4845 1 1  65 ALA CB   C  -7.512 -13.559  -8.316 1.00 . A A .  65 ALA CB   1 1 
        3  4846 1 1  65 ALA H    H  -9.057 -12.245  -9.846 1.00 . A A .  65 ALA H    1 1 
        3  4847 1 1  65 ALA HA   H  -8.383 -12.104  -7.018 1.00 . A A .  65 ALA HA   1 1 
        3  4848 1 1  65 ALA HB1  H  -7.016 -13.664  -9.301 1.00 . A A .  65 ALA HB1  1 1 
        3  4849 1 1  65 ALA HB2  H  -6.833 -13.998  -7.564 1.00 . A A .  65 ALA HB2  1 1 
        3  4850 1 1  65 ALA HB3  H  -8.414 -14.198  -8.334 1.00 . A A .  65 ALA HB3  1 1 
        3  4851 1 1  65 ALA N    N  -8.859 -11.675  -9.015 1.00 . A A .  65 ALA N    1 1 
        3  4852 1 1  65 ALA O    O  -6.149 -11.080  -6.641 1.00 . A A .  65 ALA O    1 1 
        3  4853 1 1  66 ARG C    C  -5.302  -8.326  -9.291 1.00 . A A .  66 ARG C    1 1 
        3  4854 1 1  66 ARG CA   C  -4.856  -9.728  -8.749 1.00 . A A .  66 ARG CA   1 1 
        3  4855 1 1  66 ARG CB   C  -3.587 -10.283  -9.443 1.00 . A A .  66 ARG CB   1 1 
        3  4856 1 1  66 ARG CD   C  -2.448 -11.429  -7.416 1.00 . A A .  66 ARG CD   1 1 
        3  4857 1 1  66 ARG CG   C  -3.005 -11.580  -8.837 1.00 . A A .  66 ARG CG   1 1 
        3  4858 1 1  66 ARG CZ   C  -2.954 -13.492  -6.084 1.00 . A A .  66 ARG CZ   1 1 
        3  4859 1 1  66 ARG H    H  -6.318 -11.071  -9.761 1.00 . A A .  66 ARG H    1 1 
        3  4860 1 1  66 ARG HA   H  -4.599  -9.538  -7.689 1.00 . A A .  66 ARG HA   1 1 
        3  4861 1 1  66 ARG HB2  H  -3.812 -10.473 -10.513 1.00 . A A .  66 ARG HB2  1 1 
        3  4862 1 1  66 ARG HB3  H  -2.802  -9.502  -9.458 1.00 . A A .  66 ARG HB3  1 1 
        3  4863 1 1  66 ARG HD2  H  -1.524 -10.817  -7.447 1.00 . A A .  66 ARG HD2  1 1 
        3  4864 1 1  66 ARG HD3  H  -3.122 -10.856  -6.752 1.00 . A A .  66 ARG HD3  1 1 
        3  4865 1 1  66 ARG HE   H  -1.211 -13.188  -6.977 1.00 . A A .  66 ARG HE   1 1 
        3  4866 1 1  66 ARG HG2  H  -3.780 -12.371  -8.879 1.00 . A A .  66 ARG HG2  1 1 
        3  4867 1 1  66 ARG HG3  H  -2.203 -11.945  -9.509 1.00 . A A .  66 ARG HG3  1 1 
        3  4868 1 1  66 ARG HH11 H  -4.524 -12.276  -6.213 1.00 . A A .  66 ARG HH11 1 1 
        3  4869 1 1  66 ARG HH12 H  -4.735 -13.779  -5.203 1.00 . A A .  66 ARG HH12 1 1 
        3  4870 1 1  66 ARG HH21 H  -1.546 -14.873  -5.839 1.00 . A A .  66 ARG HH21 1 1 
        3  4871 1 1  66 ARG HH22 H  -3.149 -15.169  -5.036 1.00 . A A .  66 ARG HH22 1 1 
        3  4872 1 1  66 ARG N    N  -5.963 -10.719  -8.851 1.00 . A A .  66 ARG N    1 1 
        3  4873 1 1  66 ARG NE   N  -2.131 -12.760  -6.836 1.00 . A A .  66 ARG NE   1 1 
        3  4874 1 1  66 ARG NH1  N  -4.187 -13.154  -5.796 1.00 . A A .  66 ARG NH1  1 1 
        3  4875 1 1  66 ARG NH2  N  -2.508 -14.618  -5.609 1.00 . A A .  66 ARG NH2  1 1 
        3  4876 1 1  66 ARG O    O  -4.724  -7.758 -10.223 1.00 . A A .  66 ARG O    1 1 
        3  4877 1 1  67 THR C    C  -6.061  -5.407  -7.912 1.00 . A A .  67 THR C    1 1 
        3  4878 1 1  67 THR CA   C  -6.805  -6.387  -8.873 1.00 . A A .  67 THR CA   1 1 
        3  4879 1 1  67 THR CB   C  -8.351  -6.316  -8.650 1.00 . A A .  67 THR CB   1 1 
        3  4880 1 1  67 THR CG2  C  -8.941  -4.964  -9.048 1.00 . A A .  67 THR CG2  1 1 
        3  4881 1 1  67 THR H    H  -6.799  -8.442  -8.016 1.00 . A A .  67 THR H    1 1 
        3  4882 1 1  67 THR HA   H  -6.611  -6.110  -9.930 1.00 . A A .  67 THR HA   1 1 
        3  4883 1 1  67 THR HB   H  -8.579  -6.507  -7.580 1.00 . A A .  67 THR HB   1 1 
        3  4884 1 1  67 THR HG1  H  -8.985  -8.129  -8.957 1.00 . A A .  67 THR HG1  1 1 
        3  4885 1 1  67 THR HG21 H  -8.797  -4.763 -10.121 1.00 . A A .  67 THR HG21 1 1 
        3  4886 1 1  67 THR HG22 H -10.027  -4.932  -8.850 1.00 . A A .  67 THR HG22 1 1 
        3  4887 1 1  67 THR HG23 H  -8.485  -4.115  -8.506 1.00 . A A .  67 THR HG23 1 1 
        3  4888 1 1  67 THR N    N  -6.324  -7.768  -8.627 1.00 . A A .  67 THR N    1 1 
        3  4889 1 1  67 THR O    O  -6.149  -5.550  -6.689 1.00 . A A .  67 THR O    1 1 
        3  4890 1 1  67 THR OG1  O  -9.039  -7.285  -9.440 1.00 . A A .  67 THR OG1  1 1 
        3  4891 1 1  68 GLU C    C  -5.636  -2.110  -7.528 1.00 . A A .  68 GLU C    1 1 
        3  4892 1 1  68 GLU CA   C  -4.705  -3.350  -7.658 1.00 . A A .  68 GLU CA   1 1 
        3  4893 1 1  68 GLU CB   C  -3.337  -3.054  -8.308 1.00 . A A .  68 GLU CB   1 1 
        3  4894 1 1  68 GLU CD   C  -2.063  -2.073  -6.236 1.00 . A A .  68 GLU CD   1 1 
        3  4895 1 1  68 GLU CG   C  -2.482  -1.941  -7.679 1.00 . A A .  68 GLU CG   1 1 
        3  4896 1 1  68 GLU H    H  -5.461  -4.295  -9.478 1.00 . A A .  68 GLU H    1 1 
        3  4897 1 1  68 GLU HA   H  -4.476  -3.762  -6.651 1.00 . A A .  68 GLU HA   1 1 
        3  4898 1 1  68 GLU HB2  H  -2.744  -3.991  -8.323 1.00 . A A .  68 GLU HB2  1 1 
        3  4899 1 1  68 GLU HB3  H  -3.478  -2.792  -9.373 1.00 . A A .  68 GLU HB3  1 1 
        3  4900 1 1  68 GLU HG2  H  -1.569  -1.829  -8.290 1.00 . A A .  68 GLU HG2  1 1 
        3  4901 1 1  68 GLU HG3  H  -3.009  -0.977  -7.749 1.00 . A A .  68 GLU HG3  1 1 
        3  4902 1 1  68 GLU N    N  -5.366  -4.405  -8.468 1.00 . A A .  68 GLU N    1 1 
        3  4903 1 1  68 GLU O    O  -6.161  -1.572  -8.514 1.00 . A A .  68 GLU O    1 1 
        3  4904 1 1  68 GLU OE1  O  -2.943  -2.207  -5.364 1.00 . A A .  68 GLU OE1  1 1 
        3  4905 1 1  68 GLU OE2  O  -0.848  -1.938  -5.951 1.00 . A A .  68 GLU OE2  1 1 
        3  4906 1 1  69 ILE C    C  -5.672   0.338  -4.930 1.00 . A A .  69 ILE C    1 1 
        3  4907 1 1  69 ILE CA   C  -6.584  -0.473  -5.918 1.00 . A A .  69 ILE CA   1 1 
        3  4908 1 1  69 ILE CB   C  -7.992  -0.751  -5.277 1.00 . A A .  69 ILE CB   1 1 
        3  4909 1 1  69 ILE CD1  C  -8.730  -3.197  -5.670 1.00 . A A .  69 ILE CD1  1 1 
        3  4910 1 1  69 ILE CG1  C  -8.910  -1.729  -6.061 1.00 . A A .  69 ILE CG1  1 1 
        3  4911 1 1  69 ILE CG2  C  -8.758   0.598  -5.155 1.00 . A A .  69 ILE CG2  1 1 
        3  4912 1 1  69 ILE H    H  -5.139  -2.105  -5.631 1.00 . A A .  69 ILE H    1 1 
        3  4913 1 1  69 ILE HA   H  -6.748   0.138  -6.825 1.00 . A A .  69 ILE HA   1 1 
        3  4914 1 1  69 ILE HB   H  -7.850  -1.144  -4.251 1.00 . A A .  69 ILE HB   1 1 
        3  4915 1 1  69 ILE HD11 H  -7.711  -3.576  -5.856 1.00 . A A .  69 ILE HD11 1 1 
        3  4916 1 1  69 ILE HD12 H  -8.950  -3.379  -4.603 1.00 . A A .  69 ILE HD12 1 1 
        3  4917 1 1  69 ILE HD13 H  -9.412  -3.847  -6.245 1.00 . A A .  69 ILE HD13 1 1 
        3  4918 1 1  69 ILE HG12 H  -9.979  -1.489  -5.884 1.00 . A A .  69 ILE HG12 1 1 
        3  4919 1 1  69 ILE HG13 H  -8.773  -1.607  -7.152 1.00 . A A .  69 ILE HG13 1 1 
        3  4920 1 1  69 ILE HG21 H  -9.771   0.474  -4.732 1.00 . A A .  69 ILE HG21 1 1 
        3  4921 1 1  69 ILE HG22 H  -8.238   1.324  -4.503 1.00 . A A .  69 ILE HG22 1 1 
        3  4922 1 1  69 ILE HG23 H  -8.862   1.075  -6.146 1.00 . A A .  69 ILE HG23 1 1 
        3  4923 1 1  69 ILE N    N  -5.820  -1.687  -6.276 1.00 . A A .  69 ILE N    1 1 
        3  4924 1 1  69 ILE O    O  -5.421  -0.107  -3.807 1.00 . A A .  69 ILE O    1 1 
        3  4925 1 1  70 LYS C    C  -5.361   3.721  -4.233 1.00 . A A .  70 LYS C    1 1 
        3  4926 1 1  70 LYS CA   C  -4.471   2.455  -4.480 1.00 . A A .  70 LYS CA   1 1 
        3  4927 1 1  70 LYS CB   C  -3.113   2.831  -5.112 1.00 . A A .  70 LYS CB   1 1 
        3  4928 1 1  70 LYS CD   C  -0.723   2.270  -5.624 1.00 . A A .  70 LYS CD   1 1 
        3  4929 1 1  70 LYS CE   C   0.474   1.314  -5.682 1.00 . A A .  70 LYS CE   1 1 
        3  4930 1 1  70 LYS CG   C  -2.053   1.702  -5.111 1.00 . A A .  70 LYS CG   1 1 
        3  4931 1 1  70 LYS H    H  -5.784   1.900  -6.137 1.00 . A A .  70 LYS H    1 1 
        3  4932 1 1  70 LYS HA   H  -4.241   1.992  -3.497 1.00 . A A .  70 LYS HA   1 1 
        3  4933 1 1  70 LYS HB2  H  -3.255   3.194  -6.147 1.00 . A A .  70 LYS HB2  1 1 
        3  4934 1 1  70 LYS HB3  H  -2.703   3.699  -4.554 1.00 . A A .  70 LYS HB3  1 1 
        3  4935 1 1  70 LYS HD2  H  -0.884   2.724  -6.618 1.00 . A A .  70 LYS HD2  1 1 
        3  4936 1 1  70 LYS HD3  H  -0.430   3.126  -4.982 1.00 . A A .  70 LYS HD3  1 1 
        3  4937 1 1  70 LYS HE2  H   1.383   1.935  -5.834 1.00 . A A .  70 LYS HE2  1 1 
        3  4938 1 1  70 LYS HE3  H   0.644   0.831  -4.702 1.00 . A A .  70 LYS HE3  1 1 
        3  4939 1 1  70 LYS HG2  H  -1.940   1.284  -4.094 1.00 . A A .  70 LYS HG2  1 1 
        3  4940 1 1  70 LYS HG3  H  -2.400   0.857  -5.738 1.00 . A A .  70 LYS HG3  1 1 
        3  4941 1 1  70 LYS HZ1  H   0.007   0.668  -7.657 1.00 . A A .  70 LYS HZ1  1 1 
        3  4942 1 1  70 LYS HZ2  H   1.288  -0.110  -7.007 1.00 . A A .  70 LYS HZ2  1 1 
        3  4943 1 1  70 LYS HZ3  H  -0.221  -0.537  -6.495 1.00 . A A .  70 LYS HZ3  1 1 
        3  4944 1 1  70 LYS N    N  -5.226   1.526  -5.352 1.00 . A A .  70 LYS N    1 1 
        3  4945 1 1  70 LYS NZ   N   0.379   0.294  -6.759 1.00 . A A .  70 LYS NZ   1 1 
        3  4946 1 1  70 LYS O    O  -5.392   4.663  -5.036 1.00 . A A .  70 LYS O    1 1 
        3  4947 1 1  71 ASN C    C  -5.929   5.521  -1.452 1.00 . A A .  71 ASN C    1 1 
        3  4948 1 1  71 ASN CA   C  -6.813   4.855  -2.559 1.00 . A A .  71 ASN CA   1 1 
        3  4949 1 1  71 ASN CB   C  -8.177   4.395  -1.979 1.00 . A A .  71 ASN CB   1 1 
        3  4950 1 1  71 ASN CG   C  -9.210   3.944  -3.004 1.00 . A A .  71 ASN CG   1 1 
        3  4951 1 1  71 ASN H    H  -6.022   2.784  -2.635 1.00 . A A .  71 ASN H    1 1 
        3  4952 1 1  71 ASN HA   H  -7.029   5.600  -3.354 1.00 . A A .  71 ASN HA   1 1 
        3  4953 1 1  71 ASN HB2  H  -8.016   3.603  -1.223 1.00 . A A .  71 ASN HB2  1 1 
        3  4954 1 1  71 ASN HB3  H  -8.626   5.236  -1.416 1.00 . A A .  71 ASN HB3  1 1 
        3  4955 1 1  71 ASN HD21 H -10.273   3.064  -1.559 1.00 . A A .  71 ASN HD21 1 1 
        3  4956 1 1  71 ASN HD22 H -10.916   3.016  -3.286 1.00 . A A .  71 ASN HD22 1 1 
        3  4957 1 1  71 ASN N    N  -6.069   3.690  -3.102 1.00 . A A .  71 ASN N    1 1 
        3  4958 1 1  71 ASN ND2  N -10.224   3.240  -2.567 1.00 . A A .  71 ASN ND2  1 1 
        3  4959 1 1  71 ASN O    O  -5.894   5.061  -0.306 1.00 . A A .  71 ASN O    1 1 
        3  4960 1 1  71 ASN OD1  O  -9.151   4.229  -4.196 1.00 . A A .  71 ASN OD1  1 1 
        3  4961 1 1  72 PHE C    C  -4.034   8.692  -1.218 1.00 . A A .  72 PHE C    1 1 
        3  4962 1 1  72 PHE CA   C  -4.118   7.158  -0.974 1.00 . A A .  72 PHE CA   1 1 
        3  4963 1 1  72 PHE CB   C  -2.782   6.427  -1.281 1.00 . A A .  72 PHE CB   1 1 
        3  4964 1 1  72 PHE CD1  C  -1.515   6.236   0.934 1.00 . A A .  72 PHE CD1  1 1 
        3  4965 1 1  72 PHE CD2  C  -0.522   7.537  -0.838 1.00 . A A .  72 PHE CD2  1 1 
        3  4966 1 1  72 PHE CE1  C  -0.374   6.435   1.715 1.00 . A A .  72 PHE CE1  1 1 
        3  4967 1 1  72 PHE CE2  C   0.615   7.731  -0.049 1.00 . A A .  72 PHE CE2  1 1 
        3  4968 1 1  72 PHE CG   C  -1.598   6.770  -0.361 1.00 . A A .  72 PHE CG   1 1 
        3  4969 1 1  72 PHE CZ   C   0.686   7.180   1.223 1.00 . A A .  72 PHE CZ   1 1 
        3  4970 1 1  72 PHE H    H  -5.294   6.806  -2.832 1.00 . A A .  72 PHE H    1 1 
        3  4971 1 1  72 PHE HA   H  -4.370   6.981   0.091 1.00 . A A .  72 PHE HA   1 1 
        3  4972 1 1  72 PHE HB2  H  -2.948   5.333  -1.216 1.00 . A A .  72 PHE HB2  1 1 
        3  4973 1 1  72 PHE HB3  H  -2.502   6.594  -2.340 1.00 . A A .  72 PHE HB3  1 1 
        3  4974 1 1  72 PHE HD1  H  -2.293   5.601   1.334 1.00 . A A .  72 PHE HD1  1 1 
        3  4975 1 1  72 PHE HD2  H  -0.552   7.958  -1.836 1.00 . A A .  72 PHE HD2  1 1 
        3  4976 1 1  72 PHE HE1  H  -0.292   5.987   2.693 1.00 . A A .  72 PHE HE1  1 1 
        3  4977 1 1  72 PHE HE2  H   1.471   8.281  -0.412 1.00 . A A .  72 PHE HE2  1 1 
        3  4978 1 1  72 PHE HZ   H   1.578   7.316   1.822 1.00 . A A .  72 PHE HZ   1 1 
        3  4979 1 1  72 PHE N    N  -5.170   6.553  -1.840 1.00 . A A .  72 PHE N    1 1 
        3  4980 1 1  72 PHE O    O  -3.632   9.132  -2.301 1.00 . A A .  72 PHE O    1 1 
        3  4981 1 1  73 THR C    C  -2.948  11.275   0.760 1.00 . A A .  73 THR C    1 1 
        3  4982 1 1  73 THR CA   C  -4.134  10.957  -0.199 1.00 . A A .  73 THR CA   1 1 
        3  4983 1 1  73 THR CB   C  -5.428  11.731   0.178 1.00 . A A .  73 THR CB   1 1 
        3  4984 1 1  73 THR CG2  C  -5.248  13.247   0.129 1.00 . A A .  73 THR CG2  1 1 
        3  4985 1 1  73 THR H    H  -4.677   9.014   0.673 1.00 . A A .  73 THR H    1 1 
        3  4986 1 1  73 THR HA   H  -3.889  11.296  -1.221 1.00 . A A .  73 THR HA   1 1 
        3  4987 1 1  73 THR HB   H  -5.756  11.418   1.192 1.00 . A A .  73 THR HB   1 1 
        3  4988 1 1  73 THR HG1  H  -6.491  12.174  -1.429 1.00 . A A .  73 THR HG1  1 1 
        3  4989 1 1  73 THR HG21 H  -6.203  13.773   0.306 1.00 . A A .  73 THR HG21 1 1 
        3  4990 1 1  73 THR HG22 H  -4.530  13.614   0.882 1.00 . A A .  73 THR HG22 1 1 
        3  4991 1 1  73 THR HG23 H  -4.868  13.577  -0.857 1.00 . A A .  73 THR HG23 1 1 
        3  4992 1 1  73 THR N    N  -4.369   9.487  -0.191 1.00 . A A .  73 THR N    1 1 
        3  4993 1 1  73 THR O    O  -3.013  11.017   1.966 1.00 . A A .  73 THR O    1 1 
        3  4994 1 1  73 THR OG1  O  -6.463  11.441  -0.756 1.00 . A A .  73 THR OG1  1 1 
        3  4995 1 1  74 VAL C    C  -0.234  13.681   0.713 1.00 . A A .  74 VAL C    1 1 
        3  4996 1 1  74 VAL CA   C  -0.657  12.216   0.988 1.00 . A A .  74 VAL CA   1 1 
        3  4997 1 1  74 VAL CB   C   0.471  11.175   0.758 1.00 . A A .  74 VAL CB   1 1 
        3  4998 1 1  74 VAL CG1  C   0.930  11.047  -0.696 1.00 . A A .  74 VAL CG1  1 1 
        3  4999 1 1  74 VAL CG2  C   1.737  11.442   1.597 1.00 . A A .  74 VAL CG2  1 1 
        3  5000 1 1  74 VAL H    H  -1.918  11.930  -0.819 1.00 . A A .  74 VAL H    1 1 
        3  5001 1 1  74 VAL HA   H  -0.913  12.146   2.064 1.00 . A A .  74 VAL HA   1 1 
        3  5002 1 1  74 VAL HB   H   0.064  10.195   1.080 1.00 . A A .  74 VAL HB   1 1 
        3  5003 1 1  74 VAL HG11 H   1.808  10.388  -0.782 1.00 . A A .  74 VAL HG11 1 1 
        3  5004 1 1  74 VAL HG12 H   0.140  10.637  -1.352 1.00 . A A .  74 VAL HG12 1 1 
        3  5005 1 1  74 VAL HG13 H   1.226  12.022  -1.110 1.00 . A A .  74 VAL HG13 1 1 
        3  5006 1 1  74 VAL HG21 H   1.518  11.628   2.663 1.00 . A A .  74 VAL HG21 1 1 
        3  5007 1 1  74 VAL HG22 H   2.427  10.577   1.543 1.00 . A A .  74 VAL HG22 1 1 
        3  5008 1 1  74 VAL HG23 H   2.286  12.328   1.225 1.00 . A A .  74 VAL HG23 1 1 
        3  5009 1 1  74 VAL N    N  -1.879  11.858   0.210 1.00 . A A .  74 VAL N    1 1 
        3  5010 1 1  74 VAL O    O  -0.096  14.110  -0.437 1.00 . A A .  74 VAL O    1 1 
        3  5011 1 1  75 PHE C    C   1.682  16.282   1.688 1.00 . A A .  75 PHE C    1 1 
        3  5012 1 1  75 PHE CA   C   0.182  15.891   1.743 1.00 . A A .  75 PHE CA   1 1 
        3  5013 1 1  75 PHE CB   C  -0.544  16.528   2.960 1.00 . A A .  75 PHE CB   1 1 
        3  5014 1 1  75 PHE CD1  C  -2.800  17.413   2.131 1.00 . A A .  75 PHE CD1  1 1 
        3  5015 1 1  75 PHE CD2  C  -2.784  15.379   3.434 1.00 . A A .  75 PHE CD2  1 1 
        3  5016 1 1  75 PHE CE1  C  -4.183  17.304   1.979 1.00 . A A .  75 PHE CE1  1 1 
        3  5017 1 1  75 PHE CE2  C  -4.166  15.271   3.283 1.00 . A A .  75 PHE CE2  1 1 
        3  5018 1 1  75 PHE CG   C  -2.082  16.451   2.857 1.00 . A A .  75 PHE CG   1 1 
        3  5019 1 1  75 PHE CZ   C  -4.864  16.233   2.556 1.00 . A A .  75 PHE CZ   1 1 
        3  5020 1 1  75 PHE H    H  -0.087  13.929   2.692 1.00 . A A .  75 PHE H    1 1 
        3  5021 1 1  75 PHE HA   H  -0.310  16.288   0.836 1.00 . A A .  75 PHE HA   1 1 
        3  5022 1 1  75 PHE HB2  H  -0.207  16.063   3.907 1.00 . A A .  75 PHE HB2  1 1 
        3  5023 1 1  75 PHE HB3  H  -0.255  17.593   3.057 1.00 . A A .  75 PHE HB3  1 1 
        3  5024 1 1  75 PHE HD1  H  -2.280  18.237   1.657 1.00 . A A .  75 PHE HD1  1 1 
        3  5025 1 1  75 PHE HD2  H  -2.246  14.605   3.966 1.00 . A A .  75 PHE HD2  1 1 
        3  5026 1 1  75 PHE HE1  H  -4.721  18.044   1.400 1.00 . A A .  75 PHE HE1  1 1 
        3  5027 1 1  75 PHE HE2  H  -4.692  14.428   3.714 1.00 . A A .  75 PHE HE2  1 1 
        3  5028 1 1  75 PHE HZ   H  -5.936  16.142   2.430 1.00 . A A .  75 PHE HZ   1 1 
        3  5029 1 1  75 PHE N    N  -0.004  14.427   1.795 1.00 . A A .  75 PHE N    1 1 
        3  5030 1 1  75 PHE O    O   2.524  15.728   2.401 1.00 . A A .  75 PHE O    1 1 
        3  5031 1 1  76 PHE C    C   3.249  19.378   0.690 1.00 . A A .  76 PHE C    1 1 
        3  5032 1 1  76 PHE CA   C   3.348  17.817   0.667 1.00 . A A .  76 PHE CA   1 1 
        3  5033 1 1  76 PHE CB   C   3.998  17.390  -0.685 1.00 . A A .  76 PHE CB   1 1 
        3  5034 1 1  76 PHE CD1  C   4.796  14.974  -0.284 1.00 . A A .  76 PHE CD1  1 1 
        3  5035 1 1  76 PHE CD2  C   3.101  15.396  -1.944 1.00 . A A .  76 PHE CD2  1 1 
        3  5036 1 1  76 PHE CE1  C   4.651  13.600  -0.490 1.00 . A A .  76 PHE CE1  1 1 
        3  5037 1 1  76 PHE CE2  C   2.981  14.029  -2.169 1.00 . A A .  76 PHE CE2  1 1 
        3  5038 1 1  76 PHE CG   C   3.997  15.888  -0.992 1.00 . A A .  76 PHE CG   1 1 
        3  5039 1 1  76 PHE CZ   C   3.738  13.130  -1.428 1.00 . A A .  76 PHE CZ   1 1 
        3  5040 1 1  76 PHE H    H   1.214  17.604   0.256 1.00 . A A .  76 PHE H    1 1 
        3  5041 1 1  76 PHE HA   H   3.997  17.491   1.499 1.00 . A A .  76 PHE HA   1 1 
        3  5042 1 1  76 PHE HB2  H   3.510  17.944  -1.514 1.00 . A A .  76 PHE HB2  1 1 
        3  5043 1 1  76 PHE HB3  H   5.041  17.755  -0.695 1.00 . A A .  76 PHE HB3  1 1 
        3  5044 1 1  76 PHE HD1  H   5.525  15.343   0.424 1.00 . A A .  76 PHE HD1  1 1 
        3  5045 1 1  76 PHE HD2  H   2.471  16.076  -2.497 1.00 . A A .  76 PHE HD2  1 1 
        3  5046 1 1  76 PHE HE1  H   5.242  12.880   0.059 1.00 . A A .  76 PHE HE1  1 1 
        3  5047 1 1  76 PHE HE2  H   2.302  13.686  -2.926 1.00 . A A .  76 PHE HE2  1 1 
        3  5048 1 1  76 PHE HZ   H   3.649  12.066  -1.600 1.00 . A A .  76 PHE HZ   1 1 
        3  5049 1 1  76 PHE N    N   1.985  17.257   0.830 1.00 . A A .  76 PHE N    1 1 
        3  5050 1 1  76 PHE O    O   2.270  19.945   0.188 1.00 . A A .  76 PHE O    1 1 
        3  5051 1 1  77 GLU C    C   4.635  21.935  -0.531 1.00 . A A .  77 GLU C    1 1 
        3  5052 1 1  77 GLU CA   C   4.397  21.558   0.973 1.00 . A A .  77 GLU CA   1 1 
        3  5053 1 1  77 GLU CB   C   5.311  22.208   2.035 1.00 . A A .  77 GLU CB   1 1 
        3  5054 1 1  77 GLU CD   C   7.801  21.533   1.477 1.00 . A A .  77 GLU CD   1 1 
        3  5055 1 1  77 GLU CG   C   6.759  22.602   1.726 1.00 . A A .  77 GLU CG   1 1 
        3  5056 1 1  77 GLU H    H   5.064  19.508   1.557 1.00 . A A .  77 GLU H    1 1 
        3  5057 1 1  77 GLU HA   H   3.392  21.969   1.211 1.00 . A A .  77 GLU HA   1 1 
        3  5058 1 1  77 GLU HB2  H   4.813  23.155   2.333 1.00 . A A .  77 GLU HB2  1 1 
        3  5059 1 1  77 GLU HB3  H   5.281  21.617   2.972 1.00 . A A .  77 GLU HB3  1 1 
        3  5060 1 1  77 GLU HG2  H   6.799  23.302   0.875 1.00 . A A .  77 GLU HG2  1 1 
        3  5061 1 1  77 GLU HG3  H   7.110  23.207   2.583 1.00 . A A .  77 GLU HG3  1 1 
        3  5062 1 1  77 GLU N    N   4.283  20.073   1.192 1.00 . A A .  77 GLU N    1 1 
        3  5063 1 1  77 GLU O    O   3.787  22.550  -1.177 1.00 . A A .  77 GLU O    1 1 
        3  5064 1 1  77 GLU OE1  O   7.545  20.531   0.778 1.00 . A A .  77 GLU OE1  1 1 
        3  5065 1 1  77 GLU OE2  O   8.946  21.739   1.922 1.00 . A A .  77 GLU OE2  1 1 
        3  5066 1 1  78 ASN C    C   6.593  19.859  -2.751 1.00 . A A .  78 ASN C    1 1 
        3  5067 1 1  78 ASN CA   C   6.012  21.299  -2.513 1.00 . A A .  78 ASN CA   1 1 
        3  5068 1 1  78 ASN CB   C   6.908  22.456  -3.002 1.00 . A A .  78 ASN CB   1 1 
        3  5069 1 1  78 ASN CG   C   7.034  22.582  -4.511 1.00 . A A .  78 ASN CG   1 1 
        3  5070 1 1  78 ASN H    H   6.383  21.069  -0.329 1.00 . A A .  78 ASN H    1 1 
        3  5071 1 1  78 ASN HA   H   5.044  21.341  -3.055 1.00 . A A .  78 ASN HA   1 1 
        3  5072 1 1  78 ASN HB2  H   6.472  23.411  -2.648 1.00 . A A .  78 ASN HB2  1 1 
        3  5073 1 1  78 ASN HB3  H   7.905  22.417  -2.524 1.00 . A A .  78 ASN HB3  1 1 
        3  5074 1 1  78 ASN HD21 H   8.692  21.466  -4.528 1.00 . A A .  78 ASN HD21 1 1 
        3  5075 1 1  78 ASN HD22 H   8.068  22.142  -6.124 1.00 . A A .  78 ASN HD22 1 1 
        3  5076 1 1  78 ASN N    N   5.764  21.477  -1.065 1.00 . A A .  78 ASN N    1 1 
        3  5077 1 1  78 ASN ND2  N   8.058  22.022  -5.107 1.00 . A A .  78 ASN ND2  1 1 
        3  5078 1 1  78 ASN O    O   6.006  19.100  -3.524 1.00 . A A .  78 ASN O    1 1 
        3  5079 1 1  78 ASN OD1  O   6.208  23.192  -5.182 1.00 . A A .  78 ASN OD1  1 1 
        3  5080 1 1  79 GLU C    C   8.102  17.330  -0.745 1.00 . A A .  79 GLU C    1 1 
        3  5081 1 1  79 GLU CA   C   8.239  18.105  -2.094 1.00 . A A .  79 GLU CA   1 1 
        3  5082 1 1  79 GLU CB   C   9.725  18.094  -2.565 1.00 . A A .  79 GLU CB   1 1 
        3  5083 1 1  79 GLU CD   C   9.478  16.477  -4.576 1.00 . A A .  79 GLU CD   1 1 
        3  5084 1 1  79 GLU CG   C   9.918  17.844  -4.072 1.00 . A A .  79 GLU CG   1 1 
        3  5085 1 1  79 GLU H    H   7.957  20.153  -1.338 1.00 . A A .  79 GLU H    1 1 
        3  5086 1 1  79 GLU HA   H   7.658  17.489  -2.809 1.00 . A A .  79 GLU HA   1 1 
        3  5087 1 1  79 GLU HB2  H  10.236  19.034  -2.281 1.00 . A A .  79 GLU HB2  1 1 
        3  5088 1 1  79 GLU HB3  H  10.303  17.312  -2.029 1.00 . A A .  79 GLU HB3  1 1 
        3  5089 1 1  79 GLU HG2  H   9.398  18.614  -4.668 1.00 . A A .  79 GLU HG2  1 1 
        3  5090 1 1  79 GLU HG3  H  10.987  17.947  -4.328 1.00 . A A .  79 GLU HG3  1 1 
        3  5091 1 1  79 GLU N    N   7.707  19.491  -2.085 1.00 . A A .  79 GLU N    1 1 
        3  5092 1 1  79 GLU O    O   7.760  16.145  -0.800 1.00 . A A .  79 GLU O    1 1 
        3  5093 1 1  79 GLU OE1  O   9.796  15.443  -3.944 1.00 . A A .  79 GLU OE1  1 1 
        3  5094 1 1  79 GLU OE2  O   8.790  16.435  -5.616 1.00 . A A .  79 GLU OE2  1 1 
        3  5095 1 1  80 GLN C    C   7.370  16.825   2.457 1.00 . A A .  80 GLN C    1 1 
        3  5096 1 1  80 GLN CA   C   8.664  17.094   1.655 1.00 . A A .  80 GLN CA   1 1 
        3  5097 1 1  80 GLN CB   C   9.883  17.606   2.450 1.00 . A A .  80 GLN CB   1 1 
        3  5098 1 1  80 GLN CD   C  10.977  19.042   4.245 1.00 . A A .  80 GLN CD   1 1 
        3  5099 1 1  80 GLN CG   C   9.683  18.669   3.529 1.00 . A A .  80 GLN CG   1 1 
        3  5100 1 1  80 GLN H    H   8.224  18.924   0.491 1.00 . A A .  80 GLN H    1 1 
        3  5101 1 1  80 GLN HA   H   9.017  16.103   1.294 1.00 . A A .  80 GLN HA   1 1 
        3  5102 1 1  80 GLN HB2  H  10.325  16.722   2.941 1.00 . A A .  80 GLN HB2  1 1 
        3  5103 1 1  80 GLN HB3  H  10.670  17.922   1.734 1.00 . A A .  80 GLN HB3  1 1 
        3  5104 1 1  80 GLN HE21 H  10.959  17.370   5.322 1.00 . A A .  80 GLN HE21 1 1 
        3  5105 1 1  80 GLN HE22 H  12.288  18.593   5.624 1.00 . A A .  80 GLN HE22 1 1 
        3  5106 1 1  80 GLN HG2  H   9.237  19.581   3.097 1.00 . A A .  80 GLN HG2  1 1 
        3  5107 1 1  80 GLN HG3  H   8.947  18.320   4.275 1.00 . A A .  80 GLN HG3  1 1 
        3  5108 1 1  80 GLN N    N   8.448  17.908   0.426 1.00 . A A .  80 GLN N    1 1 
        3  5109 1 1  80 GLN NE2  N  11.376  18.309   5.257 1.00 . A A .  80 GLN NE2  1 1 
        3  5110 1 1  80 GLN O    O   6.438  17.637   2.491 1.00 . A A .  80 GLN O    1 1 
        3  5111 1 1  80 GLN OE1  O  11.656  20.003   3.899 1.00 . A A .  80 GLN OE1  1 1 
        3  5112 1 1  81 VAL C    C   5.400  15.510   4.735 1.00 . A A .  81 VAL C    1 1 
        3  5113 1 1  81 VAL CA   C   5.980  15.003   3.378 1.00 . A A .  81 VAL CA   1 1 
        3  5114 1 1  81 VAL CB   C   6.033  13.434   3.348 1.00 . A A .  81 VAL CB   1 1 
        3  5115 1 1  81 VAL CG1  C   4.616  12.849   3.155 1.00 . A A .  81 VAL CG1  1 1 
        3  5116 1 1  81 VAL CG2  C   6.964  12.808   2.287 1.00 . A A .  81 VAL CG2  1 1 
        3  5117 1 1  81 VAL H    H   8.137  15.052   2.985 1.00 . A A .  81 VAL H    1 1 
        3  5118 1 1  81 VAL HA   H   5.278  15.320   2.575 1.00 . A A .  81 VAL HA   1 1 
        3  5119 1 1  81 VAL HB   H   6.392  13.070   4.332 1.00 . A A .  81 VAL HB   1 1 
        3  5120 1 1  81 VAL HG11 H   3.963  13.064   4.022 1.00 . A A .  81 VAL HG11 1 1 
        3  5121 1 1  81 VAL HG12 H   4.109  13.259   2.265 1.00 . A A .  81 VAL HG12 1 1 
        3  5122 1 1  81 VAL HG13 H   4.635  11.751   3.043 1.00 . A A .  81 VAL HG13 1 1 
        3  5123 1 1  81 VAL HG21 H   6.789  11.724   2.159 1.00 . A A .  81 VAL HG21 1 1 
        3  5124 1 1  81 VAL HG22 H   6.896  13.290   1.299 1.00 . A A .  81 VAL HG22 1 1 
        3  5125 1 1  81 VAL HG23 H   8.018  12.904   2.589 1.00 . A A .  81 VAL HG23 1 1 
        3  5126 1 1  81 VAL N    N   7.293  15.631   3.063 1.00 . A A .  81 VAL N    1 1 
        3  5127 1 1  81 VAL O    O   6.098  15.588   5.749 1.00 . A A .  81 VAL O    1 1 
        3  5128 1 1  82 VAL C    C   2.685  15.175   6.622 1.00 . A A .  82 VAL C    1 1 
        3  5129 1 1  82 VAL CA   C   3.355  16.372   5.876 1.00 . A A .  82 VAL CA   1 1 
        3  5130 1 1  82 VAL CB   C   2.420  17.519   5.375 1.00 . A A .  82 VAL CB   1 1 
        3  5131 1 1  82 VAL CG1  C   1.476  18.074   6.458 1.00 . A A .  82 VAL CG1  1 1 
        3  5132 1 1  82 VAL CG2  C   3.224  18.721   4.804 1.00 . A A .  82 VAL CG2  1 1 
        3  5133 1 1  82 VAL H    H   3.646  15.716   3.791 1.00 . A A .  82 VAL H    1 1 
        3  5134 1 1  82 VAL HA   H   4.072  16.838   6.578 1.00 . A A .  82 VAL HA   1 1 
        3  5135 1 1  82 VAL HB   H   1.790  17.130   4.552 1.00 . A A .  82 VAL HB   1 1 
        3  5136 1 1  82 VAL HG11 H   2.028  18.478   7.328 1.00 . A A .  82 VAL HG11 1 1 
        3  5137 1 1  82 VAL HG12 H   0.846  18.892   6.062 1.00 . A A .  82 VAL HG12 1 1 
        3  5138 1 1  82 VAL HG13 H   0.783  17.307   6.847 1.00 . A A .  82 VAL HG13 1 1 
        3  5139 1 1  82 VAL HG21 H   2.651  19.276   4.038 1.00 . A A .  82 VAL HG21 1 1 
        3  5140 1 1  82 VAL HG22 H   3.534  19.439   5.586 1.00 . A A .  82 VAL HG22 1 1 
        3  5141 1 1  82 VAL HG23 H   4.152  18.405   4.297 1.00 . A A .  82 VAL HG23 1 1 
        3  5142 1 1  82 VAL N    N   4.104  15.827   4.711 1.00 . A A .  82 VAL N    1 1 
        3  5143 1 1  82 VAL O    O   3.170  14.798   7.691 1.00 . A A .  82 VAL O    1 1 
        3  5144 1 1  83 ARG C    C   0.351  12.473   5.379 1.00 . A A .  83 ARG C    1 1 
        3  5145 1 1  83 ARG CA   C   1.148  13.208   6.507 1.00 . A A .  83 ARG CA   1 1 
        3  5146 1 1  83 ARG CB   C   0.410  13.247   7.869 1.00 . A A .  83 ARG CB   1 1 
        3  5147 1 1  83 ARG CD   C  -2.206  13.268   7.546 1.00 . A A .  83 ARG CD   1 1 
        3  5148 1 1  83 ARG CG   C  -0.923  13.991   7.989 1.00 . A A .  83 ARG CG   1 1 
        3  5149 1 1  83 ARG CZ   C  -2.771  11.598   9.346 1.00 . A A .  83 ARG CZ   1 1 
        3  5150 1 1  83 ARG H    H   1.386  14.903   5.127 1.00 . A A .  83 ARG H    1 1 
        3  5151 1 1  83 ARG HA   H   2.058  12.591   6.680 1.00 . A A .  83 ARG HA   1 1 
        3  5152 1 1  83 ARG HB2  H   0.304  12.211   8.245 1.00 . A A .  83 ARG HB2  1 1 
        3  5153 1 1  83 ARG HB3  H   1.107  13.701   8.604 1.00 . A A .  83 ARG HB3  1 1 
        3  5154 1 1  83 ARG HD2  H  -3.078  13.922   7.755 1.00 . A A .  83 ARG HD2  1 1 
        3  5155 1 1  83 ARG HD3  H  -2.206  13.196   6.439 1.00 . A A .  83 ARG HD3  1 1 
        3  5156 1 1  83 ARG HE   H  -2.429  11.069   7.473 1.00 . A A .  83 ARG HE   1 1 
        3  5157 1 1  83 ARG HG2  H  -1.022  14.311   9.043 1.00 . A A .  83 ARG HG2  1 1 
        3  5158 1 1  83 ARG HG3  H  -0.864  14.953   7.441 1.00 . A A .  83 ARG HG3  1 1 
        3  5159 1 1  83 ARG HH11 H  -2.366  13.372  10.064 1.00 . A A .  83 ARG HH11 1 1 
        3  5160 1 1  83 ARG HH12 H  -2.844  12.085  11.285 1.00 . A A .  83 ARG HH12 1 1 
        3  5161 1 1  83 ARG HH21 H  -3.508   9.765   8.859 1.00 . A A .  83 ARG HH21 1 1 
        3  5162 1 1  83 ARG HH22 H  -3.373  10.221  10.618 1.00 . A A .  83 ARG HH22 1 1 
        3  5163 1 1  83 ARG N    N   1.632  14.544   6.054 1.00 . A A .  83 ARG N    1 1 
        3  5164 1 1  83 ARG NE   N  -2.462  11.902   8.087 1.00 . A A .  83 ARG NE   1 1 
        3  5165 1 1  83 ARG NH1  N  -2.691  12.445  10.338 1.00 . A A .  83 ARG NH1  1 1 
        3  5166 1 1  83 ARG NH2  N  -3.165  10.393   9.632 1.00 . A A .  83 ARG NH2  1 1 
        3  5167 1 1  83 ARG O    O  -0.199  13.088   4.459 1.00 . A A .  83 ARG O    1 1 
        3  5168 1 1  84 TRP C    C  -1.837   9.779   5.275 1.00 . A A .  84 TRP C    1 1 
        3  5169 1 1  84 TRP CA   C  -0.529  10.276   4.602 1.00 . A A .  84 TRP CA   1 1 
        3  5170 1 1  84 TRP CB   C   0.279   9.094   4.023 1.00 . A A .  84 TRP CB   1 1 
        3  5171 1 1  84 TRP CD1  C   0.992   6.988   5.505 1.00 . A A .  84 TRP CD1  1 1 
        3  5172 1 1  84 TRP CD2  C   2.553   8.555   5.225 1.00 . A A .  84 TRP CD2  1 1 
        3  5173 1 1  84 TRP CE2  C   3.071   7.502   6.022 1.00 . A A .  84 TRP CE2  1 1 
        3  5174 1 1  84 TRP CE3  C   3.403   9.635   4.822 1.00 . A A .  84 TRP CE3  1 1 
        3  5175 1 1  84 TRP CG   C   1.225   8.261   4.921 1.00 . A A .  84 TRP CG   1 1 
        3  5176 1 1  84 TRP CH2  C   5.239   8.599   6.027 1.00 . A A .  84 TRP CH2  1 1 
        3  5177 1 1  84 TRP CZ2  C   4.441   7.530   6.425 1.00 . A A .  84 TRP CZ2  1 1 
        3  5178 1 1  84 TRP CZ3  C   4.725   9.639   5.236 1.00 . A A .  84 TRP CZ3  1 1 
        3  5179 1 1  84 TRP H    H   0.757  10.754   6.309 1.00 . A A .  84 TRP H    1 1 
        3  5180 1 1  84 TRP HA   H  -0.844  10.861   3.718 1.00 . A A .  84 TRP HA   1 1 
        3  5181 1 1  84 TRP HB2  H  -0.427   8.406   3.524 1.00 . A A .  84 TRP HB2  1 1 
        3  5182 1 1  84 TRP HB3  H   0.896   9.475   3.193 1.00 . A A .  84 TRP HB3  1 1 
        3  5183 1 1  84 TRP HD1  H   0.088   6.405   5.392 1.00 . A A .  84 TRP HD1  1 1 
        3  5184 1 1  84 TRP HE1  H   2.298   5.578   6.576 1.00 . A A .  84 TRP HE1  1 1 
        3  5185 1 1  84 TRP HE3  H   3.028  10.419   4.182 1.00 . A A .  84 TRP HE3  1 1 
        3  5186 1 1  84 TRP HH2  H   6.279   8.663   6.302 1.00 . A A .  84 TRP HH2  1 1 
        3  5187 1 1  84 TRP HZ2  H   4.851   6.726   7.024 1.00 . A A .  84 TRP HZ2  1 1 
        3  5188 1 1  84 TRP HZ3  H   5.391  10.444   4.948 1.00 . A A .  84 TRP HZ3  1 1 
        3  5189 1 1  84 TRP N    N   0.288  11.141   5.487 1.00 . A A .  84 TRP N    1 1 
        3  5190 1 1  84 TRP NE1  N   2.110   6.530   6.231 1.00 . A A .  84 TRP NE1  1 1 
        3  5191 1 1  84 TRP O    O  -1.894   9.580   6.494 1.00 . A A .  84 TRP O    1 1 
        3  5192 1 1  85 GLU C    C  -4.712   8.037   3.687 1.00 . A A .  85 GLU C    1 1 
        3  5193 1 1  85 GLU CA   C  -4.089   8.819   4.886 1.00 . A A .  85 GLU CA   1 1 
        3  5194 1 1  85 GLU CB   C  -5.082   9.803   5.549 1.00 . A A .  85 GLU CB   1 1 
        3  5195 1 1  85 GLU CD   C  -5.581   8.338   7.647 1.00 . A A .  85 GLU CD   1 1 
        3  5196 1 1  85 GLU CG   C  -6.121   9.145   6.476 1.00 . A A .  85 GLU CG   1 1 
        3  5197 1 1  85 GLU H    H  -2.801   9.954   3.506 1.00 . A A .  85 GLU H    1 1 
        3  5198 1 1  85 GLU HA   H  -3.770   8.077   5.648 1.00 . A A .  85 GLU HA   1 1 
        3  5199 1 1  85 GLU HB2  H  -4.525  10.546   6.155 1.00 . A A .  85 GLU HB2  1 1 
        3  5200 1 1  85 GLU HB3  H  -5.602  10.404   4.777 1.00 . A A .  85 GLU HB3  1 1 
        3  5201 1 1  85 GLU HG2  H  -6.774   9.928   6.900 1.00 . A A .  85 GLU HG2  1 1 
        3  5202 1 1  85 GLU HG3  H  -6.796   8.497   5.893 1.00 . A A .  85 GLU HG3  1 1 
        3  5203 1 1  85 GLU N    N  -2.873   9.548   4.455 1.00 . A A .  85 GLU N    1 1 
        3  5204 1 1  85 GLU O    O  -4.919   8.578   2.594 1.00 . A A .  85 GLU O    1 1 
        3  5205 1 1  85 GLU OE1  O  -4.458   8.595   8.132 1.00 . A A .  85 GLU OE1  1 1 
        3  5206 1 1  85 GLU OE2  O  -6.294   7.417   8.102 1.00 . A A .  85 GLU OE2  1 1 
        3  5207 1 1  86 GLY C    C  -5.863   4.428   3.266 1.00 . A A .  86 GLY C    1 1 
        3  5208 1 1  86 GLY CA   C  -5.575   5.883   2.855 1.00 . A A .  86 GLY CA   1 1 
        3  5209 1 1  86 GLY H    H  -4.799   6.411   4.846 1.00 . A A .  86 GLY H    1 1 
        3  5210 1 1  86 GLY HA2  H  -6.517   6.332   2.488 1.00 . A A .  86 GLY HA2  1 1 
        3  5211 1 1  86 GLY HA3  H  -4.877   5.871   1.999 1.00 . A A .  86 GLY HA3  1 1 
        3  5212 1 1  86 GLY N    N  -5.001   6.748   3.903 1.00 . A A .  86 GLY N    1 1 
        3  5213 1 1  86 GLY O    O  -5.777   4.045   4.438 1.00 . A A .  86 GLY O    1 1 
        3  5214 1 1  87 ASP C    C  -5.688   1.249   1.673 1.00 . A A .  87 ASP C    1 1 
        3  5215 1 1  87 ASP CA   C  -6.662   2.233   2.402 1.00 . A A .  87 ASP CA   1 1 
        3  5216 1 1  87 ASP CB   C  -8.132   2.083   1.935 1.00 . A A .  87 ASP CB   1 1 
        3  5217 1 1  87 ASP CG   C  -9.145   2.691   2.896 1.00 . A A .  87 ASP CG   1 1 
        3  5218 1 1  87 ASP H    H  -6.256   4.136   1.341 1.00 . A A .  87 ASP H    1 1 
        3  5219 1 1  87 ASP HA   H  -6.623   1.931   3.470 1.00 . A A .  87 ASP HA   1 1 
        3  5220 1 1  87 ASP HB2  H  -8.288   2.516   0.932 1.00 . A A .  87 ASP HB2  1 1 
        3  5221 1 1  87 ASP HB3  H  -8.386   1.011   1.830 1.00 . A A .  87 ASP HB3  1 1 
        3  5222 1 1  87 ASP N    N  -6.210   3.641   2.244 1.00 . A A .  87 ASP N    1 1 
        3  5223 1 1  87 ASP O    O  -4.935   0.555   2.356 1.00 . A A .  87 ASP O    1 1 
        3  5224 1 1  87 ASP OD1  O  -9.552   2.010   3.861 1.00 . A A .  87 ASP OD1  1 1 
        3  5225 1 1  87 ASP OD2  O  -9.526   3.862   2.716 1.00 . A A .  87 ASP OD2  1 1 
        3  5226 1 1  88 TYR C    C  -5.607  -1.189  -0.447 1.00 . A A .  88 TYR C    1 1 
        3  5227 1 1  88 TYR CA   C  -4.921   0.205  -0.504 1.00 . A A .  88 TYR CA   1 1 
        3  5228 1 1  88 TYR CB   C  -3.414   0.217  -0.179 1.00 . A A .  88 TYR CB   1 1 
        3  5229 1 1  88 TYR CD1  C  -2.520  -1.571  -1.816 1.00 . A A .  88 TYR CD1  1 1 
        3  5230 1 1  88 TYR CD2  C  -1.230   0.423  -1.421 1.00 . A A .  88 TYR CD2  1 1 
        3  5231 1 1  88 TYR CE1  C  -1.527  -2.031  -2.683 1.00 . A A .  88 TYR CE1  1 1 
        3  5232 1 1  88 TYR CE2  C  -0.227  -0.046  -2.270 1.00 . A A .  88 TYR CE2  1 1 
        3  5233 1 1  88 TYR CG   C  -2.396  -0.321  -1.189 1.00 . A A .  88 TYR CG   1 1 
        3  5234 1 1  88 TYR CZ   C  -0.393  -1.260  -2.928 1.00 . A A .  88 TYR CZ   1 1 
        3  5235 1 1  88 TYR H    H  -6.407   1.817  -0.079 1.00 . A A .  88 TYR H    1 1 
        3  5236 1 1  88 TYR HA   H  -5.005   0.597  -1.535 1.00 . A A .  88 TYR HA   1 1 
        3  5237 1 1  88 TYR HB2  H  -3.163   1.278   0.006 1.00 . A A .  88 TYR HB2  1 1 
        3  5238 1 1  88 TYR HB3  H  -3.231  -0.295   0.785 1.00 . A A .  88 TYR HB3  1 1 
        3  5239 1 1  88 TYR HD1  H  -3.382  -2.204  -1.654 1.00 . A A .  88 TYR HD1  1 1 
        3  5240 1 1  88 TYR HD2  H  -1.085   1.389  -0.967 1.00 . A A .  88 TYR HD2  1 1 
        3  5241 1 1  88 TYR HE1  H  -1.672  -2.967  -3.208 1.00 . A A .  88 TYR HE1  1 1 
        3  5242 1 1  88 TYR HE2  H   0.635   0.595  -2.438 1.00 . A A .  88 TYR HE2  1 1 
        3  5243 1 1  88 TYR HH   H  -0.115  -1.885  -4.715 1.00 . A A .  88 TYR HH   1 1 
        3  5244 1 1  88 TYR N    N  -5.687   1.208   0.318 1.00 . A A .  88 TYR N    1 1 
        3  5245 1 1  88 TYR O    O  -5.470  -1.917   0.538 1.00 . A A .  88 TYR O    1 1 
        3  5246 1 1  88 TYR OH   O   0.454  -1.634  -3.928 1.00 . A A .  88 TYR OH   1 1 
        3  5247 1 1  89 PHE C    C  -8.448  -2.599  -0.513 1.00 . A A .  89 PHE C    1 1 
        3  5248 1 1  89 PHE CA   C  -7.270  -2.712  -1.545 1.00 . A A .  89 PHE CA   1 1 
        3  5249 1 1  89 PHE CB   C  -6.482  -4.048  -1.510 1.00 . A A .  89 PHE CB   1 1 
        3  5250 1 1  89 PHE CD1  C  -8.137  -5.990  -1.267 1.00 . A A .  89 PHE CD1  1 1 
        3  5251 1 1  89 PHE CD2  C  -7.137  -5.596  -3.430 1.00 . A A .  89 PHE CD2  1 1 
        3  5252 1 1  89 PHE CE1  C  -8.867  -7.055  -1.799 1.00 . A A .  89 PHE CE1  1 1 
        3  5253 1 1  89 PHE CE2  C  -7.866  -6.663  -3.961 1.00 . A A .  89 PHE CE2  1 1 
        3  5254 1 1  89 PHE CG   C  -7.267  -5.242  -2.079 1.00 . A A .  89 PHE CG   1 1 
        3  5255 1 1  89 PHE CZ   C  -8.730  -7.389  -3.145 1.00 . A A .  89 PHE CZ   1 1 
        3  5256 1 1  89 PHE H    H  -6.149  -0.969  -2.349 1.00 . A A .  89 PHE H    1 1 
        3  5257 1 1  89 PHE HA   H  -7.735  -2.677  -2.549 1.00 . A A .  89 PHE HA   1 1 
        3  5258 1 1  89 PHE HB2  H  -5.540  -3.935  -2.084 1.00 . A A .  89 PHE HB2  1 1 
        3  5259 1 1  89 PHE HB3  H  -6.143  -4.272  -0.480 1.00 . A A .  89 PHE HB3  1 1 
        3  5260 1 1  89 PHE HD1  H  -8.257  -5.738  -0.220 1.00 . A A .  89 PHE HD1  1 1 
        3  5261 1 1  89 PHE HD2  H  -6.472  -5.041  -4.082 1.00 . A A .  89 PHE HD2  1 1 
        3  5262 1 1  89 PHE HE1  H  -9.538  -7.618  -1.162 1.00 . A A .  89 PHE HE1  1 1 
        3  5263 1 1  89 PHE HE2  H  -7.754  -6.920  -5.007 1.00 . A A .  89 PHE HE2  1 1 
        3  5264 1 1  89 PHE HZ   H  -9.296  -8.215  -3.557 1.00 . A A .  89 PHE HZ   1 1 
        3  5265 1 1  89 PHE N    N  -6.360  -1.531  -1.508 1.00 . A A .  89 PHE N    1 1 
        3  5266 1 1  89 PHE O    O  -8.314  -3.149   0.586 1.00 . A A .  89 PHE O    1 1 
        3  5267 1 1  90 PRO C    C -11.624  -2.776   0.586 1.00 . A A .  90 PRO C    1 1 
        3  5268 1 1  90 PRO CA   C -10.628  -1.628   0.267 1.00 . A A .  90 PRO CA   1 1 
        3  5269 1 1  90 PRO CB   C -11.277  -0.327  -0.285 1.00 . A A .  90 PRO CB   1 1 
        3  5270 1 1  90 PRO CD   C  -9.829  -1.149  -2.030 1.00 . A A .  90 PRO CD   1 1 
        3  5271 1 1  90 PRO CG   C -11.204  -0.496  -1.819 1.00 . A A .  90 PRO CG   1 1 
        3  5272 1 1  90 PRO HA   H -10.109  -1.357   1.207 1.00 . A A .  90 PRO HA   1 1 
        3  5273 1 1  90 PRO HB2  H -12.304  -0.151   0.083 1.00 . A A .  90 PRO HB2  1 1 
        3  5274 1 1  90 PRO HB3  H -10.668   0.541   0.036 1.00 . A A .  90 PRO HB3  1 1 
        3  5275 1 1  90 PRO HD2  H  -9.813  -1.801  -2.923 1.00 . A A .  90 PRO HD2  1 1 
        3  5276 1 1  90 PRO HD3  H  -9.045  -0.376  -2.149 1.00 . A A .  90 PRO HD3  1 1 
        3  5277 1 1  90 PRO HG2  H -12.009  -1.177  -2.160 1.00 . A A .  90 PRO HG2  1 1 
        3  5278 1 1  90 PRO HG3  H -11.317   0.456  -2.366 1.00 . A A .  90 PRO HG3  1 1 
        3  5279 1 1  90 PRO N    N  -9.602  -1.922  -0.791 1.00 . A A .  90 PRO N    1 1 
        3  5280 1 1  90 PRO O    O -12.835  -2.674   0.373 1.00 . A A .  90 PRO O    1 1 
        3  5281 1 1  91 SER C    C -11.300  -5.065   3.339 1.00 . A A .  91 SER C    1 1 
        3  5282 1 1  91 SER CA   C -11.893  -4.872   1.907 1.00 . A A .  91 SER CA   1 1 
        3  5283 1 1  91 SER CB   C -11.906  -6.155   1.048 1.00 . A A .  91 SER CB   1 1 
        3  5284 1 1  91 SER H    H -10.062  -3.797   1.225 1.00 . A A .  91 SER H    1 1 
        3  5285 1 1  91 SER HA   H -12.943  -4.534   2.024 1.00 . A A .  91 SER HA   1 1 
        3  5286 1 1  91 SER HB2  H -12.227  -5.916   0.014 1.00 . A A .  91 SER HB2  1 1 
        3  5287 1 1  91 SER HB3  H -10.887  -6.579   0.960 1.00 . A A .  91 SER HB3  1 1 
        3  5288 1 1  91 SER HG   H -13.674  -6.786   1.559 1.00 . A A .  91 SER HG   1 1 
        3  5289 1 1  91 SER N    N -11.091  -3.845   1.186 1.00 . A A .  91 SER N    1 1 
        3  5290 1 1  91 SER O    O -10.592  -6.034   3.628 1.00 . A A .  91 SER O    1 1 
        3  5291 1 1  91 SER OG   O -12.781  -7.141   1.592 1.00 . A A .  91 SER OG   1 1 
        3  5292 1 1  92 GLN C    C -11.446  -2.750   6.311 1.00 . A A .  92 GLN C    1 1 
        3  5293 1 1  92 GLN CA   C -10.771  -3.877   5.466 1.00 . A A .  92 GLN CA   1 1 
        3  5294 1 1  92 GLN CB   C  -9.244  -3.628   5.287 1.00 . A A .  92 GLN CB   1 1 
        3  5295 1 1  92 GLN CD   C  -8.708  -1.414   3.906 1.00 . A A .  92 GLN CD   1 1 
        3  5296 1 1  92 GLN CG   C  -8.665  -2.920   4.054 1.00 . A A .  92 GLN CG   1 1 
        3  5297 1 1  92 GLN H    H -12.099  -3.303   3.826 1.00 . A A .  92 GLN H    1 1 
        3  5298 1 1  92 GLN HA   H -10.852  -4.820   6.049 1.00 . A A .  92 GLN HA   1 1 
        3  5299 1 1  92 GLN HB2  H  -8.828  -3.188   6.215 1.00 . A A .  92 GLN HB2  1 1 
        3  5300 1 1  92 GLN HB3  H  -8.784  -4.639   5.279 1.00 . A A .  92 GLN HB3  1 1 
        3  5301 1 1  92 GLN HE21 H -10.616  -1.259   4.355 1.00 . A A .  92 GLN HE21 1 1 
        3  5302 1 1  92 GLN HE22 H  -9.725   0.246   3.804 1.00 . A A .  92 GLN HE22 1 1 
        3  5303 1 1  92 GLN HG2  H  -7.593  -3.195   4.027 1.00 . A A .  92 GLN HG2  1 1 
        3  5304 1 1  92 GLN HG3  H  -9.049  -3.369   3.124 1.00 . A A .  92 GLN HG3  1 1 
        3  5305 1 1  92 GLN N    N -11.536  -4.067   4.207 1.00 . A A .  92 GLN N    1 1 
        3  5306 1 1  92 GLN NE2  N  -9.857  -0.786   3.843 1.00 . A A .  92 GLN NE2  1 1 
        3  5307 1 1  92 GLN O    O -11.658  -1.643   5.810 1.00 . A A .  92 GLN O    1 1 
        3  5308 1 1  92 GLN OE1  O  -7.683  -0.756   3.770 1.00 . A A .  92 GLN OE1  1 1 
        3  5309 1 1  93 ASP C    C -11.623  -2.363  10.011 1.00 . A A .  93 ASP C    1 1 
        3  5310 1 1  93 ASP CA   C -12.089  -1.956   8.572 1.00 . A A .  93 ASP CA   1 1 
        3  5311 1 1  93 ASP CB   C -13.572  -1.531   8.481 1.00 . A A .  93 ASP CB   1 1 
        3  5312 1 1  93 ASP CG   C -13.822  -0.120   9.025 1.00 . A A .  93 ASP CG   1 1 
        3  5313 1 1  93 ASP H    H -11.425  -3.951   7.883 1.00 . A A .  93 ASP H    1 1 
        3  5314 1 1  93 ASP HA   H -11.493  -1.061   8.303 1.00 . A A .  93 ASP HA   1 1 
        3  5315 1 1  93 ASP HB2  H -13.906  -1.536   7.427 1.00 . A A .  93 ASP HB2  1 1 
        3  5316 1 1  93 ASP HB3  H -14.233  -2.242   9.006 1.00 . A A .  93 ASP HB3  1 1 
        3  5317 1 1  93 ASP N    N -11.760  -3.029   7.584 1.00 . A A .  93 ASP N    1 1 
        3  5318 1 1  93 ASP O    O -12.422  -2.692  10.893 1.00 . A A .  93 ASP O    1 1 
        3  5319 1 1  93 ASP OD1  O -13.644   0.116  10.239 1.00 . A A .  93 ASP OD1  1 1 
        3  5320 1 1  93 ASP OD2  O -14.164   0.779   8.225 1.00 . A A .  93 ASP OD2  1 1 
        3  5321 1 1  94 GLU C    C  -9.629  -1.103  12.441 1.00 . A A .  94 GLU C    1 1 
        3  5322 1 1  94 GLU CA   C  -9.699  -2.427  11.590 1.00 . A A .  94 GLU CA   1 1 
        3  5323 1 1  94 GLU CB   C  -8.300  -3.094  11.519 1.00 . A A .  94 GLU CB   1 1 
        3  5324 1 1  94 GLU CD   C  -7.974  -4.488   9.352 1.00 . A A .  94 GLU CD   1 1 
        3  5325 1 1  94 GLU CG   C  -8.223  -4.484  10.853 1.00 . A A .  94 GLU CG   1 1 
        3  5326 1 1  94 GLU H    H  -9.774  -2.638   9.414 1.00 . A A .  94 GLU H    1 1 
        3  5327 1 1  94 GLU HA   H -10.350  -3.076  12.186 1.00 . A A .  94 GLU HA   1 1 
        3  5328 1 1  94 GLU HB2  H  -7.564  -2.408  11.057 1.00 . A A .  94 GLU HB2  1 1 
        3  5329 1 1  94 GLU HB3  H  -7.941  -3.218  12.561 1.00 . A A .  94 GLU HB3  1 1 
        3  5330 1 1  94 GLU HG2  H  -7.399  -5.058  11.312 1.00 . A A .  94 GLU HG2  1 1 
        3  5331 1 1  94 GLU HG3  H  -9.132  -5.079  11.047 1.00 . A A .  94 GLU HG3  1 1 
        3  5332 1 1  94 GLU N    N -10.303  -2.289  10.233 1.00 . A A .  94 GLU N    1 1 
        3  5333 1 1  94 GLU O    O  -9.741  -1.135  13.668 1.00 . A A .  94 GLU O    1 1 
        3  5334 1 1  94 GLU OE1  O  -8.886  -4.126   8.577 1.00 . A A .  94 GLU OE1  1 1 
        3  5335 1 1  94 GLU OE2  O  -6.856  -4.859   8.938 1.00 . A A .  94 GLU OE2  1 1 
        3  5336 1 1  95 GLN C    C -10.246   2.332  11.147 1.00 . A A .  95 GLN C    1 1 
        3  5337 1 1  95 GLN CA   C  -9.754   1.374  12.288 1.00 . A A .  95 GLN CA   1 1 
        3  5338 1 1  95 GLN CB   C  -8.495   1.890  13.034 1.00 . A A .  95 GLN CB   1 1 
        3  5339 1 1  95 GLN CD   C  -7.771   4.339  13.486 1.00 . A A .  95 GLN CD   1 1 
        3  5340 1 1  95 GLN CG   C  -8.696   3.185  13.853 1.00 . A A .  95 GLN CG   1 1 
        3  5341 1 1  95 GLN H    H  -9.725  -0.289  10.794 1.00 . A A .  95 GLN H    1 1 
        3  5342 1 1  95 GLN HA   H -10.588   1.297  13.018 1.00 . A A .  95 GLN HA   1 1 
        3  5343 1 1  95 GLN HB2  H  -8.140   1.103  13.732 1.00 . A A .  95 GLN HB2  1 1 
        3  5344 1 1  95 GLN HB3  H  -7.663   1.999  12.314 1.00 . A A .  95 GLN HB3  1 1 
        3  5345 1 1  95 GLN HE21 H  -8.609   4.469  11.711 1.00 . A A .  95 GLN HE21 1 1 
        3  5346 1 1  95 GLN HE22 H  -7.242   5.630  12.122 1.00 . A A .  95 GLN HE22 1 1 
        3  5347 1 1  95 GLN HG2  H  -9.743   3.541  13.819 1.00 . A A .  95 GLN HG2  1 1 
        3  5348 1 1  95 GLN HG3  H  -8.531   2.953  14.922 1.00 . A A .  95 GLN HG3  1 1 
        3  5349 1 1  95 GLN N    N  -9.476   0.024  11.739 1.00 . A A .  95 GLN N    1 1 
        3  5350 1 1  95 GLN NE2  N  -7.999   4.984  12.364 1.00 . A A .  95 GLN NE2  1 1 
        3  5351 1 1  95 GLN O    O  -9.502   3.198  10.678 1.00 . A A .  95 GLN O    1 1 
        3  5352 1 1  95 GLN OE1  O  -6.839   4.687  14.202 1.00 . A A .  95 GLN OE1  1 1 
        3  5353 1 1  96 LEU C    C -11.692   3.315   8.430 1.00 . A A .  96 LEU C    1 1 
        3  5354 1 1  96 LEU CA   C -12.258   3.150   9.869 1.00 . A A .  96 LEU CA   1 1 
        3  5355 1 1  96 LEU CB   C -12.506   4.484  10.623 1.00 . A A .  96 LEU CB   1 1 
        3  5356 1 1  96 LEU CD1  C -14.865   5.030   9.773 1.00 . A A .  96 LEU CD1  1 1 
        3  5357 1 1  96 LEU CD2  C -13.416   6.826  10.745 1.00 . A A .  96 LEU CD2  1 1 
        3  5358 1 1  96 LEU CG   C -13.420   5.519   9.930 1.00 . A A .  96 LEU CG   1 1 
        3  5359 1 1  96 LEU H    H -12.020   1.385  11.152 1.00 . A A .  96 LEU H    1 1 
        3  5360 1 1  96 LEU HA   H -13.263   2.689   9.772 1.00 . A A .  96 LEU HA   1 1 
        3  5361 1 1  96 LEU HB2  H -12.924   4.239  11.621 1.00 . A A .  96 LEU HB2  1 1 
        3  5362 1 1  96 LEU HB3  H -11.523   4.950  10.831 1.00 . A A .  96 LEU HB3  1 1 
        3  5363 1 1  96 LEU HD11 H -15.507   5.802   9.310 1.00 . A A .  96 LEU HD11 1 1 
        3  5364 1 1  96 LEU HD12 H -14.933   4.143   9.116 1.00 . A A .  96 LEU HD12 1 1 
        3  5365 1 1  96 LEU HD13 H -15.327   4.754  10.738 1.00 . A A .  96 LEU HD13 1 1 
        3  5366 1 1  96 LEU HD21 H -13.814   6.684  11.767 1.00 . A A .  96 LEU HD21 1 1 
        3  5367 1 1  96 LEU HD22 H -12.398   7.243  10.846 1.00 . A A .  96 LEU HD22 1 1 
        3  5368 1 1  96 LEU HD23 H -14.031   7.608  10.263 1.00 . A A .  96 LEU HD23 1 1 
        3  5369 1 1  96 LEU HG   H -13.018   5.753   8.921 1.00 . A A .  96 LEU HG   1 1 
        3  5370 1 1  96 LEU N    N -11.528   2.202  10.765 1.00 . A A .  96 LEU N    1 1 
        3  5371 1 1  96 LEU O    O -10.708   4.030   8.220 1.00 . A A .  96 LEU O    1 1 
        3  5372 1 1  97 ALA C    C -12.428   4.294   5.406 1.00 . A A .  97 ALA C    1 1 
        3  5373 1 1  97 ALA CA   C -12.022   2.916   6.000 1.00 . A A .  97 ALA CA   1 1 
        3  5374 1 1  97 ALA CB   C -12.697   1.759   5.245 1.00 . A A .  97 ALA CB   1 1 
        3  5375 1 1  97 ALA H    H -13.085   2.032   7.733 1.00 . A A .  97 ALA H    1 1 
        3  5376 1 1  97 ALA HA   H -10.929   2.794   5.883 1.00 . A A .  97 ALA HA   1 1 
        3  5377 1 1  97 ALA HB1  H -13.800   1.798   5.309 1.00 . A A .  97 ALA HB1  1 1 
        3  5378 1 1  97 ALA HB2  H -12.422   1.751   4.175 1.00 . A A .  97 ALA HB2  1 1 
        3  5379 1 1  97 ALA HB3  H -12.387   0.778   5.652 1.00 . A A .  97 ALA HB3  1 1 
        3  5380 1 1  97 ALA N    N -12.366   2.728   7.432 1.00 . A A .  97 ALA N    1 1 
        3  5381 1 1  97 ALA O    O -13.412   4.912   5.826 1.00 . A A .  97 ALA O    1 1 
        3  5382 1 1  98 LYS C    C -11.799   5.950   2.173 1.00 . A A .  98 LYS C    1 1 
        3  5383 1 1  98 LYS CA   C -11.954   6.059   3.720 1.00 . A A .  98 LYS CA   1 1 
        3  5384 1 1  98 LYS CB   C -11.216   7.255   4.369 1.00 . A A .  98 LYS CB   1 1 
        3  5385 1 1  98 LYS CD   C  -8.938   6.368   5.358 1.00 . A A .  98 LYS CD   1 1 
        3  5386 1 1  98 LYS CE   C  -9.338   6.544   6.829 1.00 . A A .  98 LYS CE   1 1 
        3  5387 1 1  98 LYS CG   C  -9.679   7.297   4.384 1.00 . A A .  98 LYS CG   1 1 
        3  5388 1 1  98 LYS H    H -10.904   4.157   4.069 1.00 . A A .  98 LYS H    1 1 
        3  5389 1 1  98 LYS HA   H -13.033   6.290   3.849 1.00 . A A .  98 LYS HA   1 1 
        3  5390 1 1  98 LYS HB2  H -11.560   8.170   3.844 1.00 . A A .  98 LYS HB2  1 1 
        3  5391 1 1  98 LYS HB3  H -11.618   7.385   5.392 1.00 . A A .  98 LYS HB3  1 1 
        3  5392 1 1  98 LYS HD2  H  -9.079   5.316   5.041 1.00 . A A .  98 LYS HD2  1 1 
        3  5393 1 1  98 LYS HD3  H  -7.853   6.547   5.217 1.00 . A A .  98 LYS HD3  1 1 
        3  5394 1 1  98 LYS HE2  H  -9.364   7.621   7.104 1.00 . A A .  98 LYS HE2  1 1 
        3  5395 1 1  98 LYS HE3  H -10.378   6.176   6.973 1.00 . A A .  98 LYS HE3  1 1 
        3  5396 1 1  98 LYS HG2  H  -9.290   7.103   3.363 1.00 . A A .  98 LYS HG2  1 1 
        3  5397 1 1  98 LYS HG3  H  -9.375   8.343   4.591 1.00 . A A .  98 LYS HG3  1 1 
        3  5398 1 1  98 LYS HZ1  H  -8.151   4.878   7.352 1.00 . A A .  98 LYS HZ1  1 1 
        3  5399 1 1  98 LYS HZ2  H  -7.504   6.353   7.874 1.00 . A A .  98 LYS HZ2  1 1 
        3  5400 1 1  98 LYS HZ3  H  -8.792   5.604   8.644 1.00 . A A .  98 LYS HZ3  1 1 
        3  5401 1 1  98 LYS N    N -11.660   4.779   4.419 1.00 . A A .  98 LYS N    1 1 
        3  5402 1 1  98 LYS NZ   N  -8.398   5.810   7.716 1.00 . A A .  98 LYS NZ   1 1 
        3  5403 1 1  98 LYS O    O -11.024   6.670   1.534 1.00 . A A .  98 LYS O    1 1 
        3  5404 1 1  99 ALA C    C -13.550   5.986  -0.619 1.00 . A A .  99 ALA C    1 1 
        3  5405 1 1  99 ALA CA   C -12.673   4.913   0.093 1.00 . A A .  99 ALA CA   1 1 
        3  5406 1 1  99 ALA CB   C -13.135   3.468  -0.150 1.00 . A A .  99 ALA CB   1 1 
        3  5407 1 1  99 ALA H    H -13.183   4.530   2.219 1.00 . A A .  99 ALA H    1 1 
        3  5408 1 1  99 ALA HA   H -11.641   4.985  -0.307 1.00 . A A .  99 ALA HA   1 1 
        3  5409 1 1  99 ALA HB1  H -14.155   3.278   0.232 1.00 . A A .  99 ALA HB1  1 1 
        3  5410 1 1  99 ALA HB2  H -13.150   3.219  -1.226 1.00 . A A .  99 ALA HB2  1 1 
        3  5411 1 1  99 ALA HB3  H -12.459   2.740   0.338 1.00 . A A .  99 ALA HB3  1 1 
        3  5412 1 1  99 ALA N    N -12.642   5.101   1.563 1.00 . A A .  99 ALA N    1 1 
        3  5413 1 1  99 ALA O    O -14.675   5.732  -1.057 1.00 . A A .  99 ALA O    1 1 
        3  5414 1 1 100 ALA C    C -13.775   8.479  -2.757 1.00 . A A . 100 ALA C    1 1 
        3  5415 1 1 100 ALA CA   C -13.752   8.386  -1.201 1.00 . A A . 100 ALA CA   1 1 
        3  5416 1 1 100 ALA CB   C -13.088   9.623  -0.572 1.00 . A A . 100 ALA CB   1 1 
        3  5417 1 1 100 ALA H    H -12.139   7.297  -0.158 1.00 . A A . 100 ALA H    1 1 
        3  5418 1 1 100 ALA HA   H -14.781   8.343  -0.793 1.00 . A A . 100 ALA HA   1 1 
        3  5419 1 1 100 ALA HB1  H -13.614  10.554  -0.851 1.00 . A A . 100 ALA HB1  1 1 
        3  5420 1 1 100 ALA HB2  H -13.099   9.574   0.533 1.00 . A A . 100 ALA HB2  1 1 
        3  5421 1 1 100 ALA HB3  H -12.033   9.745  -0.884 1.00 . A A . 100 ALA HB3  1 1 
        3  5422 1 1 100 ALA N    N -13.002   7.208  -0.713 1.00 . A A . 100 ALA N    1 1 
        3  5423 1 1 100 ALA O    O -12.683   8.517  -3.340 1.00 . A A . 100 ALA O    1 1 
        3  5424 1 1 101 PRO C    C -14.585   9.856  -5.659 1.00 . A A . 101 PRO C    1 1 
        3  5425 1 1 101 PRO CA   C -14.958   8.509  -4.980 1.00 . A A . 101 PRO CA   1 1 
        3  5426 1 1 101 PRO CB   C -16.401   8.011  -5.265 1.00 . A A . 101 PRO CB   1 1 
        3  5427 1 1 101 PRO CD   C -16.288   8.413  -2.884 1.00 . A A . 101 PRO CD   1 1 
        3  5428 1 1 101 PRO CG   C -17.236   8.557  -4.085 1.00 . A A . 101 PRO CG   1 1 
        3  5429 1 1 101 PRO HA   H -14.268   7.724  -5.345 1.00 . A A . 101 PRO HA   1 1 
        3  5430 1 1 101 PRO HB2  H -16.796   8.322  -6.249 1.00 . A A . 101 PRO HB2  1 1 
        3  5431 1 1 101 PRO HB3  H -16.412   6.903  -5.249 1.00 . A A . 101 PRO HB3  1 1 
        3  5432 1 1 101 PRO HD2  H -16.482   9.189  -2.119 1.00 . A A . 101 PRO HD2  1 1 
        3  5433 1 1 101 PRO HD3  H -16.406   7.419  -2.407 1.00 . A A . 101 PRO HD3  1 1 
        3  5434 1 1 101 PRO HG2  H -17.477   9.625  -4.256 1.00 . A A . 101 PRO HG2  1 1 
        3  5435 1 1 101 PRO HG3  H -18.189   8.016  -3.947 1.00 . A A . 101 PRO HG3  1 1 
        3  5436 1 1 101 PRO N    N -14.936   8.538  -3.475 1.00 . A A . 101 PRO N    1 1 
        3  5437 1 1 101 PRO O    O -15.425  10.576  -6.204 1.00 . A A . 101 PRO O    1 1 
        3  5438 1 1 102 LYS C    C -11.666  11.176  -7.182 1.00 . A A . 102 LYS C    1 1 
        3  5439 1 1 102 LYS CA   C -12.735  11.465  -6.099 1.00 . A A . 102 LYS CA   1 1 
        3  5440 1 1 102 LYS CB   C -12.251  12.202  -4.829 1.00 . A A . 102 LYS CB   1 1 
        3  5441 1 1 102 LYS CD   C -10.490  14.000  -5.612 1.00 . A A . 102 LYS CD   1 1 
        3  5442 1 1 102 LYS CE   C  -9.233  13.628  -4.810 1.00 . A A . 102 LYS CE   1 1 
        3  5443 1 1 102 LYS CG   C -11.841  13.671  -4.975 1.00 . A A . 102 LYS CG   1 1 
        3  5444 1 1 102 LYS H    H -12.768   9.553  -4.972 1.00 . A A . 102 LYS H    1 1 
        3  5445 1 1 102 LYS HA   H -13.539  12.086  -6.545 1.00 . A A . 102 LYS HA   1 1 
        3  5446 1 1 102 LYS HB2  H -13.105  12.206  -4.117 1.00 . A A . 102 LYS HB2  1 1 
        3  5447 1 1 102 LYS HB3  H -11.475  11.615  -4.305 1.00 . A A . 102 LYS HB3  1 1 
        3  5448 1 1 102 LYS HD2  H -10.423  13.623  -6.650 1.00 . A A . 102 LYS HD2  1 1 
        3  5449 1 1 102 LYS HD3  H -10.473  15.102  -5.745 1.00 . A A . 102 LYS HD3  1 1 
        3  5450 1 1 102 LYS HE2  H  -8.387  14.239  -5.195 1.00 . A A . 102 LYS HE2  1 1 
        3  5451 1 1 102 LYS HE3  H  -9.321  13.948  -3.747 1.00 . A A . 102 LYS HE3  1 1 
        3  5452 1 1 102 LYS HG2  H -12.631  14.214  -5.534 1.00 . A A . 102 LYS HG2  1 1 
        3  5453 1 1 102 LYS HG3  H -11.876  14.132  -3.965 1.00 . A A . 102 LYS HG3  1 1 
        3  5454 1 1 102 LYS HZ1  H  -9.448  11.668  -5.596 1.00 . A A . 102 LYS HZ1  1 1 
        3  5455 1 1 102 LYS HZ2  H  -7.873  12.059  -5.206 1.00 . A A . 102 LYS HZ2  1 1 
        3  5456 1 1 102 LYS HZ3  H  -8.932  11.687  -4.013 1.00 . A A . 102 LYS HZ3  1 1 
        3  5457 1 1 102 LYS N    N -13.283  10.165  -5.624 1.00 . A A . 102 LYS N    1 1 
        3  5458 1 1 102 LYS NZ   N  -8.869  12.189  -4.908 1.00 . A A . 102 LYS NZ   1 1 
        3  5459 1 1 102 LYS O    O -10.473  11.024  -6.890 1.00 . A A . 102 LYS O    1 1 
        3  5460 1 1 103 GLN C    C -10.419  11.671 -10.262 1.00 . A A . 103 GLN C    1 1 
        3  5461 1 1 103 GLN CA   C -11.257  10.569  -9.555 1.00 . A A . 103 GLN CA   1 1 
        3  5462 1 1 103 GLN CB   C -12.176   9.714 -10.462 1.00 . A A . 103 GLN CB   1 1 
        3  5463 1 1 103 GLN CD   C -10.191   8.541 -11.743 1.00 . A A . 103 GLN CD   1 1 
        3  5464 1 1 103 GLN CG   C -11.601   9.102 -11.755 1.00 . A A . 103 GLN CG   1 1 
        3  5465 1 1 103 GLN H    H -13.128  11.156  -8.537 1.00 . A A . 103 GLN H    1 1 
        3  5466 1 1 103 GLN HA   H -10.536   9.833  -9.131 1.00 . A A . 103 GLN HA   1 1 
        3  5467 1 1 103 GLN HB2  H -12.579   8.886  -9.840 1.00 . A A . 103 GLN HB2  1 1 
        3  5468 1 1 103 GLN HB3  H -13.072  10.296 -10.761 1.00 . A A . 103 GLN HB3  1 1 
        3  5469 1 1 103 GLN HE21 H -10.760   6.918 -10.732 1.00 . A A . 103 GLN HE21 1 1 
        3  5470 1 1 103 GLN HE22 H  -8.983   7.086 -11.179 1.00 . A A . 103 GLN HE22 1 1 
        3  5471 1 1 103 GLN HG2  H -12.306   8.328 -12.117 1.00 . A A . 103 GLN HG2  1 1 
        3  5472 1 1 103 GLN HG3  H -11.643   9.873 -12.547 1.00 . A A . 103 GLN HG3  1 1 
        3  5473 1 1 103 GLN N    N -12.109  11.081  -8.447 1.00 . A A . 103 GLN N    1 1 
        3  5474 1 1 103 GLN NE2  N  -9.976   7.362 -11.216 1.00 . A A . 103 GLN NE2  1 1 
        3  5475 1 1 103 GLN O    O -10.673  12.070 -11.402 1.00 . A A . 103 GLN O    1 1 
        3  5476 1 1 103 GLN OE1  O  -9.250   9.180 -12.211 1.00 . A A . 103 GLN OE1  1 1 
        3  5477 1 1 104 PHE C    C  -6.985  11.154  -9.820 1.00 . A A . 104 PHE C    1 1 
        3  5478 1 1 104 PHE CA   C  -8.008  12.206 -10.350 1.00 . A A . 104 PHE CA   1 1 
        3  5479 1 1 104 PHE CB   C  -7.546  13.669 -10.425 1.00 . A A . 104 PHE CB   1 1 
        3  5480 1 1 104 PHE CD1  C  -8.241  15.205  -8.517 1.00 . A A . 104 PHE CD1  1 1 
        3  5481 1 1 104 PHE CD2  C  -5.924  14.538  -8.659 1.00 . A A . 104 PHE CD2  1 1 
        3  5482 1 1 104 PHE CE1  C  -7.936  16.031  -7.433 1.00 . A A . 104 PHE CE1  1 1 
        3  5483 1 1 104 PHE CE2  C  -5.622  15.359  -7.574 1.00 . A A . 104 PHE CE2  1 1 
        3  5484 1 1 104 PHE CG   C  -7.238  14.452  -9.149 1.00 . A A . 104 PHE CG   1 1 
        3  5485 1 1 104 PHE CZ   C  -6.628  16.106  -6.965 1.00 . A A . 104 PHE CZ   1 1 
        3  5486 1 1 104 PHE H    H  -9.288  11.658  -8.663 1.00 . A A . 104 PHE H    1 1 
        3  5487 1 1 104 PHE HA   H  -8.159  11.944 -11.422 1.00 . A A . 104 PHE HA   1 1 
        3  5488 1 1 104 PHE HB2  H  -6.661  13.710 -11.091 1.00 . A A . 104 PHE HB2  1 1 
        3  5489 1 1 104 PHE HB3  H  -8.312  14.223 -11.004 1.00 . A A . 104 PHE HB3  1 1 
        3  5490 1 1 104 PHE HD1  H  -9.259  15.174  -8.889 1.00 . A A . 104 PHE HD1  1 1 
        3  5491 1 1 104 PHE HD2  H  -5.127  13.977  -9.133 1.00 . A A . 104 PHE HD2  1 1 
        3  5492 1 1 104 PHE HE1  H  -8.717  16.622  -6.971 1.00 . A A . 104 PHE HE1  1 1 
        3  5493 1 1 104 PHE HE2  H  -4.606  15.421  -7.205 1.00 . A A . 104 PHE HE2  1 1 
        3  5494 1 1 104 PHE HZ   H  -6.380  16.747  -6.129 1.00 . A A . 104 PHE HZ   1 1 
        3  5495 1 1 104 PHE N    N  -9.296  12.024  -9.622 1.00 . A A . 104 PHE N    1 1 
        3  5496 1 1 104 PHE O    O  -6.067  11.452  -9.056 1.00 . A A . 104 PHE O    1 1 
        3  5497 1 1 105 GLY C    C  -6.180   7.729 -10.880 1.00 . A A . 105 GLY C    1 1 
        3  5498 1 1 105 GLY CA   C  -6.425   8.739  -9.759 1.00 . A A . 105 GLY CA   1 1 
        3  5499 1 1 105 GLY H    H  -8.082   9.781 -10.751 1.00 . A A . 105 GLY H    1 1 
        3  5500 1 1 105 GLY HA2  H  -5.471   9.050  -9.304 1.00 . A A . 105 GLY HA2  1 1 
        3  5501 1 1 105 GLY HA3  H  -6.987   8.236  -8.954 1.00 . A A . 105 GLY HA3  1 1 
        3  5502 1 1 105 GLY N    N  -7.203   9.896 -10.229 1.00 . A A . 105 GLY N    1 1 
        3  5503 1 1 105 GLY O    O  -7.038   6.889 -11.161 1.00 . A A . 105 GLY O    1 1 
        3  5504 1 1 106 ARG C    C  -3.187   6.965 -12.972 1.00 . A A . 106 ARG C    1 1 
        3  5505 1 1 106 ARG CA   C  -4.722   7.115 -12.793 1.00 . A A . 106 ARG CA   1 1 
        3  5506 1 1 106 ARG CB   C  -5.432   7.787 -14.002 1.00 . A A . 106 ARG CB   1 1 
        3  5507 1 1 106 ARG CD   C  -6.082   9.988 -15.205 1.00 . A A . 106 ARG CD   1 1 
        3  5508 1 1 106 ARG CG   C  -5.091   9.264 -14.278 1.00 . A A . 106 ARG CG   1 1 
        3  5509 1 1 106 ARG CZ   C  -8.269  11.163 -14.852 1.00 . A A . 106 ARG CZ   1 1 
        3  5510 1 1 106 ARG H    H  -4.408   8.590 -11.183 1.00 . A A . 106 ARG H    1 1 
        3  5511 1 1 106 ARG HA   H  -5.161   6.096 -12.713 1.00 . A A . 106 ARG HA   1 1 
        3  5512 1 1 106 ARG HB2  H  -5.237   7.187 -14.912 1.00 . A A . 106 ARG HB2  1 1 
        3  5513 1 1 106 ARG HB3  H  -6.521   7.670 -13.832 1.00 . A A . 106 ARG HB3  1 1 
        3  5514 1 1 106 ARG HD2  H  -5.604  10.940 -15.518 1.00 . A A . 106 ARG HD2  1 1 
        3  5515 1 1 106 ARG HD3  H  -6.251   9.405 -16.133 1.00 . A A . 106 ARG HD3  1 1 
        3  5516 1 1 106 ARG HE   H  -7.652   9.694 -13.686 1.00 . A A . 106 ARG HE   1 1 
        3  5517 1 1 106 ARG HG2  H  -4.997   9.840 -13.336 1.00 . A A . 106 ARG HG2  1 1 
        3  5518 1 1 106 ARG HG3  H  -4.077   9.318 -14.724 1.00 . A A . 106 ARG HG3  1 1 
        3  5519 1 1 106 ARG HH11 H  -7.285  11.824 -16.419 1.00 . A A . 106 ARG HH11 1 1 
        3  5520 1 1 106 ARG HH12 H  -8.888  12.633 -16.070 1.00 . A A . 106 ARG HH12 1 1 
        3  5521 1 1 106 ARG HH21 H  -9.420  10.603 -13.339 1.00 . A A . 106 ARG HH21 1 1 
        3  5522 1 1 106 ARG HH22 H -10.025  11.984 -14.367 1.00 . A A . 106 ARG HH22 1 1 
        3  5523 1 1 106 ARG N    N  -5.017   7.838 -11.526 1.00 . A A . 106 ARG N    1 1 
        3  5524 1 1 106 ARG NE   N  -7.370  10.248 -14.505 1.00 . A A . 106 ARG NE   1 1 
        3  5525 1 1 106 ARG NH1  N  -8.138  11.966 -15.877 1.00 . A A . 106 ARG NH1  1 1 
        3  5526 1 1 106 ARG NH2  N  -9.341  11.265 -14.128 1.00 . A A . 106 ARG NH2  1 1 
        3  5527 1 1 106 ARG O    O  -2.444   7.952 -12.930 1.00 . A A . 106 ARG O    1 1 
        3  5528 1 1 107 ASN C    C  -0.560   5.643 -14.502 1.00 . A A . 107 ASN C    1 1 
        3  5529 1 1 107 ASN CA   C  -1.245   5.429 -13.122 1.00 . A A . 107 ASN CA   1 1 
        3  5530 1 1 107 ASN CB   C  -1.099   3.985 -12.578 1.00 . A A . 107 ASN CB   1 1 
        3  5531 1 1 107 ASN CG   C   0.275   3.666 -12.011 1.00 . A A . 107 ASN CG   1 1 
        3  5532 1 1 107 ASN H    H  -3.408   4.984 -13.218 1.00 . A A . 107 ASN H    1 1 
        3  5533 1 1 107 ASN HA   H  -0.762   6.109 -12.385 1.00 . A A . 107 ASN HA   1 1 
        3  5534 1 1 107 ASN HB2  H  -1.810   3.829 -11.746 1.00 . A A . 107 ASN HB2  1 1 
        3  5535 1 1 107 ASN HB3  H  -1.390   3.233 -13.337 1.00 . A A . 107 ASN HB3  1 1 
        3  5536 1 1 107 ASN HD21 H   0.994   3.141 -13.802 1.00 . A A . 107 ASN HD21 1 1 
        3  5537 1 1 107 ASN HD22 H   2.138   3.125 -12.338 1.00 . A A . 107 ASN HD22 1 1 
        3  5538 1 1 107 ASN N    N  -2.704   5.727 -13.157 1.00 . A A . 107 ASN N    1 1 
        3  5539 1 1 107 ASN ND2  N   1.206   3.193 -12.801 1.00 . A A . 107 ASN ND2  1 1 
        3  5540 1 1 107 ASN O    O  -0.351   4.698 -15.270 1.00 . A A . 107 ASN O    1 1 
        3  5541 1 1 107 ASN OD1  O   0.526   3.867 -10.830 1.00 . A A . 107 ASN OD1  1 1 
        3  5542 1 1 108 LEU C    C   2.008   7.001 -16.071 1.00 . A A . 108 LEU C    1 1 
        3  5543 1 1 108 LEU CA   C   0.469   7.257 -16.087 1.00 . A A . 108 LEU CA   1 1 
        3  5544 1 1 108 LEU CB   C   0.054   8.722 -16.379 1.00 . A A . 108 LEU CB   1 1 
        3  5545 1 1 108 LEU CD1  C  -0.338   8.594 -18.914 1.00 . A A . 108 LEU CD1  1 1 
        3  5546 1 1 108 LEU CD2  C   0.126  10.789 -17.811 1.00 . A A . 108 LEU CD2  1 1 
        3  5547 1 1 108 LEU CG   C   0.425   9.278 -17.774 1.00 . A A . 108 LEU CG   1 1 
        3  5548 1 1 108 LEU H    H  -0.559   7.597 -14.147 1.00 . A A . 108 LEU H    1 1 
        3  5549 1 1 108 LEU HA   H   0.029   6.623 -16.883 1.00 . A A . 108 LEU HA   1 1 
        3  5550 1 1 108 LEU HB2  H  -1.043   8.825 -16.245 1.00 . A A . 108 LEU HB2  1 1 
        3  5551 1 1 108 LEU HB3  H   0.501   9.378 -15.604 1.00 . A A . 108 LEU HB3  1 1 
        3  5552 1 1 108 LEU HD11 H  -0.095   7.520 -18.998 1.00 . A A . 108 LEU HD11 1 1 
        3  5553 1 1 108 LEU HD12 H  -1.434   8.672 -18.797 1.00 . A A . 108 LEU HD12 1 1 
        3  5554 1 1 108 LEU HD13 H  -0.085   9.041 -19.894 1.00 . A A . 108 LEU HD13 1 1 
        3  5555 1 1 108 LEU HD21 H  -0.945  11.012 -17.651 1.00 . A A . 108 LEU HD21 1 1 
        3  5556 1 1 108 LEU HD22 H   0.694  11.338 -17.038 1.00 . A A . 108 LEU HD22 1 1 
        3  5557 1 1 108 LEU HD23 H   0.409  11.237 -18.782 1.00 . A A . 108 LEU HD23 1 1 
        3  5558 1 1 108 LEU HG   H   1.515   9.154 -17.948 1.00 . A A . 108 LEU HG   1 1 
        3  5559 1 1 108 LEU N    N  -0.172   6.895 -14.788 1.00 . A A . 108 LEU N    1 1 
        3  5560 1 1 108 LEU O    O   2.820   7.923 -15.950 1.00 . A A . 108 LEU O    1 1 
        3  5561 1 1 109 ALA C    C   3.941   3.794 -16.533 1.00 . A A . 109 ALA C    1 1 
        3  5562 1 1 109 ALA CA   C   3.790   5.273 -16.052 1.00 . A A . 109 ALA CA   1 1 
        3  5563 1 1 109 ALA CB   C   4.211   5.341 -14.568 1.00 . A A . 109 ALA CB   1 1 
        3  5564 1 1 109 ALA H    H   1.639   5.039 -16.028 1.00 . A A . 109 ALA H    1 1 
        3  5565 1 1 109 ALA HA   H   4.443   5.938 -16.655 1.00 . A A . 109 ALA HA   1 1 
        3  5566 1 1 109 ALA HB1  H   5.198   4.878 -14.386 1.00 . A A . 109 ALA HB1  1 1 
        3  5567 1 1 109 ALA HB2  H   4.278   6.385 -14.221 1.00 . A A . 109 ALA HB2  1 1 
        3  5568 1 1 109 ALA HB3  H   3.471   4.816 -13.933 1.00 . A A . 109 ALA HB3  1 1 
        3  5569 1 1 109 ALA N    N   2.392   5.718 -16.173 1.00 . A A . 109 ALA N    1 1 
        3  5570 1 1 109 ALA O    O   3.123   2.916 -16.240 1.00 . A A . 109 ALA O    1 1 
        3  5571 1 1 110 ARG C    C   6.408   2.020 -15.690 1.00 . A A . 110 ARG C    1 1 
        3  5572 1 1 110 ARG CA   C   5.730   2.167 -17.081 1.00 . A A . 110 ARG CA   1 1 
        3  5573 1 1 110 ARG CB   C   6.692   2.051 -18.283 1.00 . A A . 110 ARG CB   1 1 
        3  5574 1 1 110 ARG CD   C   8.606   0.304 -17.876 1.00 . A A . 110 ARG CD   1 1 
        3  5575 1 1 110 ARG CG   C   7.287   0.660 -18.583 1.00 . A A . 110 ARG CG   1 1 
        3  5576 1 1 110 ARG CZ   C   8.235  -1.546 -16.221 1.00 . A A . 110 ARG CZ   1 1 
        3  5577 1 1 110 ARG H    H   5.660   4.380 -17.224 1.00 . A A . 110 ARG H    1 1 
        3  5578 1 1 110 ARG HA   H   4.939   1.397 -17.204 1.00 . A A . 110 ARG HA   1 1 
        3  5579 1 1 110 ARG HB2  H   6.120   2.341 -19.191 1.00 . A A . 110 ARG HB2  1 1 
        3  5580 1 1 110 ARG HB3  H   7.497   2.810 -18.218 1.00 . A A . 110 ARG HB3  1 1 
        3  5581 1 1 110 ARG HD2  H   9.202  -0.376 -18.518 1.00 . A A . 110 ARG HD2  1 1 
        3  5582 1 1 110 ARG HD3  H   9.250   1.205 -17.804 1.00 . A A . 110 ARG HD3  1 1 
        3  5583 1 1 110 ARG HE   H   8.374   0.351 -15.691 1.00 . A A . 110 ARG HE   1 1 
        3  5584 1 1 110 ARG HG2  H   6.528  -0.136 -18.456 1.00 . A A . 110 ARG HG2  1 1 
        3  5585 1 1 110 ARG HG3  H   7.501   0.647 -19.673 1.00 . A A . 110 ARG HG3  1 1 
        3  5586 1 1 110 ARG HH11 H   8.340  -2.187 -18.072 1.00 . A A . 110 ARG HH11 1 1 
        3  5587 1 1 110 ARG HH12 H   8.054  -3.463 -16.792 1.00 . A A . 110 ARG HH12 1 1 
        3  5588 1 1 110 ARG HH21 H   8.071  -1.067 -14.302 1.00 . A A . 110 ARG HH21 1 1 
        3  5589 1 1 110 ARG HH22 H   7.904  -2.842 -14.741 1.00 . A A . 110 ARG HH22 1 1 
        3  5590 1 1 110 ARG N    N   5.105   3.526 -17.136 1.00 . A A . 110 ARG N    1 1 
        3  5591 1 1 110 ARG NE   N   8.427  -0.265 -16.516 1.00 . A A . 110 ARG NE   1 1 
        3  5592 1 1 110 ARG NH1  N   8.209  -2.506 -17.111 1.00 . A A . 110 ARG NH1  1 1 
        3  5593 1 1 110 ARG NH2  N   8.057  -1.861 -14.974 1.00 . A A . 110 ARG NH2  1 1 
        3  5594 1 1 110 ARG O    O   7.492   2.564 -15.455 1.00 . A A . 110 ARG O    1 1 
        3  5595 1 1 111 ASP C    C   7.244   0.989 -12.682 1.00 . A A . 111 ASP C    1 1 
        3  5596 1 1 111 ASP CA   C   5.948   1.608 -13.303 1.00 . A A . 111 ASP CA   1 1 
        3  5597 1 1 111 ASP CB   C   4.624   1.299 -12.558 1.00 . A A . 111 ASP CB   1 1 
        3  5598 1 1 111 ASP CG   C   4.406   2.243 -11.374 1.00 . A A . 111 ASP CG   1 1 
        3  5599 1 1 111 ASP H    H   4.802   1.036 -15.067 1.00 . A A . 111 ASP H    1 1 
        3  5600 1 1 111 ASP HA   H   6.092   2.705 -13.219 1.00 . A A . 111 ASP HA   1 1 
        3  5601 1 1 111 ASP HB2  H   3.747   1.428 -13.220 1.00 . A A . 111 ASP HB2  1 1 
        3  5602 1 1 111 ASP HB3  H   4.590   0.255 -12.202 1.00 . A A . 111 ASP HB3  1 1 
        3  5603 1 1 111 ASP N    N   5.729   1.341 -14.750 1.00 . A A . 111 ASP N    1 1 
        3  5604 1 1 111 ASP O    O   8.074   0.353 -13.342 1.00 . A A . 111 ASP O    1 1 
        3  5605 1 1 111 ASP OD1  O   5.021   2.014 -10.311 1.00 . A A . 111 ASP OD1  1 1 
        3  5606 1 1 111 ASP OD2  O   3.703   3.260 -11.536 1.00 . A A . 111 ASP OD2  1 1 
        3  5607 1 1 112 LYS C    C   8.651   1.245  -9.223 1.00 . A A . 112 LYS C    1 1 
        3  5608 1 1 112 LYS CA   C   8.773   1.427 -10.764 1.00 . A A . 112 LYS CA   1 1 
        3  5609 1 1 112 LYS CB   C   9.510   2.719 -11.224 1.00 . A A . 112 LYS CB   1 1 
        3  5610 1 1 112 LYS CD   C   7.600   4.482 -10.997 1.00 . A A . 112 LYS CD   1 1 
        3  5611 1 1 112 LYS CE   C   7.170   5.885 -10.539 1.00 . A A . 112 LYS CE   1 1 
        3  5612 1 1 112 LYS CG   C   9.067   4.119 -10.740 1.00 . A A . 112 LYS CG   1 1 
        3  5613 1 1 112 LYS H    H   6.566   1.651 -10.957 1.00 . A A . 112 LYS H    1 1 
        3  5614 1 1 112 LYS HA   H   9.388   0.579 -11.124 1.00 . A A . 112 LYS HA   1 1 
        3  5615 1 1 112 LYS HB2  H  10.576   2.604 -10.941 1.00 . A A . 112 LYS HB2  1 1 
        3  5616 1 1 112 LYS HB3  H   9.535   2.717 -12.333 1.00 . A A . 112 LYS HB3  1 1 
        3  5617 1 1 112 LYS HD2  H   7.335   4.321 -12.060 1.00 . A A . 112 LYS HD2  1 1 
        3  5618 1 1 112 LYS HD3  H   6.958   3.766 -10.444 1.00 . A A . 112 LYS HD3  1 1 
        3  5619 1 1 112 LYS HE2  H   6.055   5.907 -10.531 1.00 . A A . 112 LYS HE2  1 1 
        3  5620 1 1 112 LYS HE3  H   7.457   6.046  -9.475 1.00 . A A . 112 LYS HE3  1 1 
        3  5621 1 1 112 LYS HG2  H   9.298   4.228  -9.663 1.00 . A A . 112 LYS HG2  1 1 
        3  5622 1 1 112 LYS HG3  H   9.740   4.844 -11.237 1.00 . A A . 112 LYS HG3  1 1 
        3  5623 1 1 112 LYS HZ1  H   7.414   6.816 -12.409 1.00 . A A . 112 LYS HZ1  1 1 
        3  5624 1 1 112 LYS HZ2  H   7.425   7.899 -11.168 1.00 . A A . 112 LYS HZ2  1 1 
        3  5625 1 1 112 LYS HZ3  H   8.737   6.950 -11.459 1.00 . A A . 112 LYS HZ3  1 1 
        3  5626 1 1 112 LYS N    N   7.448   1.329 -11.410 1.00 . A A . 112 LYS N    1 1 
        3  5627 1 1 112 LYS NZ   N   7.709   6.948 -11.433 1.00 . A A . 112 LYS NZ   1 1 
        3  5628 1 1 112 LYS O    O   8.830   2.183  -8.440 1.00 . A A . 112 LYS O    1 1 
        3  5629 1 1 113 LYS C    C   9.611  -0.536  -6.654 1.00 . A A . 113 LYS C    1 1 
        3  5630 1 1 113 LYS CA   C   8.227  -0.294  -7.329 1.00 . A A . 113 LYS CA   1 1 
        3  5631 1 1 113 LYS CB   C   7.193  -1.426  -7.112 1.00 . A A . 113 LYS CB   1 1 
        3  5632 1 1 113 LYS CD   C   5.578  -2.490  -5.434 1.00 . A A . 113 LYS CD   1 1 
        3  5633 1 1 113 LYS CE   C   5.223  -2.789  -3.963 1.00 . A A . 113 LYS CE   1 1 
        3  5634 1 1 113 LYS CG   C   6.800  -1.580  -5.619 1.00 . A A . 113 LYS CG   1 1 
        3  5635 1 1 113 LYS H    H   8.066  -0.624  -9.532 1.00 . A A . 113 LYS H    1 1 
        3  5636 1 1 113 LYS HA   H   7.753   0.591  -6.859 1.00 . A A . 113 LYS HA   1 1 
        3  5637 1 1 113 LYS HB2  H   6.286  -1.188  -7.705 1.00 . A A . 113 LYS HB2  1 1 
        3  5638 1 1 113 LYS HB3  H   7.570  -2.389  -7.509 1.00 . A A . 113 LYS HB3  1 1 
        3  5639 1 1 113 LYS HD2  H   4.699  -2.066  -5.961 1.00 . A A . 113 LYS HD2  1 1 
        3  5640 1 1 113 LYS HD3  H   5.769  -3.460  -5.939 1.00 . A A . 113 LYS HD3  1 1 
        3  5641 1 1 113 LYS HE2  H   4.437  -3.578  -3.953 1.00 . A A . 113 LYS HE2  1 1 
        3  5642 1 1 113 LYS HE3  H   6.094  -3.258  -3.452 1.00 . A A . 113 LYS HE3  1 1 
        3  5643 1 1 113 LYS HG2  H   7.665  -1.980  -5.053 1.00 . A A . 113 LYS HG2  1 1 
        3  5644 1 1 113 LYS HG3  H   6.594  -0.581  -5.183 1.00 . A A . 113 LYS HG3  1 1 
        3  5645 1 1 113 LYS HZ1  H   5.511  -0.900  -3.020 1.00 . A A . 113 LYS HZ1  1 1 
        3  5646 1 1 113 LYS HZ2  H   4.068  -1.018  -3.769 1.00 . A A . 113 LYS HZ2  1 1 
        3  5647 1 1 113 LYS HZ3  H   4.304  -1.788  -2.325 1.00 . A A . 113 LYS HZ3  1 1 
        3  5648 1 1 113 LYS N    N   8.365   0.005  -8.780 1.00 . A A . 113 LYS N    1 1 
        3  5649 1 1 113 LYS NZ   N   4.751  -1.580  -3.227 1.00 . A A . 113 LYS NZ   1 1 
        3  5650 1 1 113 LYS O    O  10.108  -1.662  -6.563 1.00 . A A . 113 LYS O    1 1 
        3  5651 1 1 114 LYS C    C  11.191   0.287  -3.883 1.00 . A A . 114 LYS C    1 1 
        3  5652 1 1 114 LYS CA   C  11.474   0.528  -5.391 1.00 . A A . 114 LYS CA   1 1 
        3  5653 1 1 114 LYS CB   C  12.150   1.899  -5.681 1.00 . A A . 114 LYS CB   1 1 
        3  5654 1 1 114 LYS CD   C  13.986   3.591  -5.250 1.00 . A A . 114 LYS CD   1 1 
        3  5655 1 1 114 LYS CE   C  15.232   4.000  -4.446 1.00 . A A . 114 LYS CE   1 1 
        3  5656 1 1 114 LYS CG   C  13.531   2.134  -5.030 1.00 . A A . 114 LYS CG   1 1 
        3  5657 1 1 114 LYS H    H   9.594   1.387  -6.187 1.00 . A A . 114 LYS H    1 1 
        3  5658 1 1 114 LYS HA   H  12.135  -0.277  -5.774 1.00 . A A . 114 LYS HA   1 1 
        3  5659 1 1 114 LYS HB2  H  12.239   2.035  -6.779 1.00 . A A . 114 LYS HB2  1 1 
        3  5660 1 1 114 LYS HB3  H  11.462   2.698  -5.335 1.00 . A A . 114 LYS HB3  1 1 
        3  5661 1 1 114 LYS HD2  H  14.197   3.736  -6.330 1.00 . A A . 114 LYS HD2  1 1 
        3  5662 1 1 114 LYS HD3  H  13.158   4.298  -5.034 1.00 . A A . 114 LYS HD3  1 1 
        3  5663 1 1 114 LYS HE2  H  16.037   3.239  -4.543 1.00 . A A . 114 LYS HE2  1 1 
        3  5664 1 1 114 LYS HE3  H  15.663   4.918  -4.907 1.00 . A A . 114 LYS HE3  1 1 
        3  5665 1 1 114 LYS HG2  H  13.484   1.919  -3.944 1.00 . A A . 114 LYS HG2  1 1 
        3  5666 1 1 114 LYS HG3  H  14.279   1.429  -5.442 1.00 . A A . 114 LYS HG3  1 1 
        3  5667 1 1 114 LYS HZ1  H  14.667   3.449  -2.446 1.00 . A A . 114 LYS HZ1  1 1 
        3  5668 1 1 114 LYS HZ2  H  15.743   4.734  -2.511 1.00 . A A . 114 LYS HZ2  1 1 
        3  5669 1 1 114 LYS HZ3  H  14.179   4.984  -2.870 1.00 . A A . 114 LYS HZ3  1 1 
        3  5670 1 1 114 LYS N    N  10.198   0.554  -6.148 1.00 . A A . 114 LYS N    1 1 
        3  5671 1 1 114 LYS NZ   N  14.922   4.274  -3.015 1.00 . A A . 114 LYS NZ   1 1 
        3  5672 1 1 114 LYS O    O  11.239   1.218  -3.079 1.00 . A A . 114 LYS O    1 1 
        3  5673 1 1 115 GLN C    C  11.919  -1.398  -1.119 1.00 . A A . 115 GLN C    1 1 
        3  5674 1 1 115 GLN CA   C  10.659  -1.299  -2.048 1.00 . A A . 115 GLN CA   1 1 
        3  5675 1 1 115 GLN CB   C   9.671  -2.486  -1.982 1.00 . A A . 115 GLN CB   1 1 
        3  5676 1 1 115 GLN CD   C   9.013  -4.878  -2.539 1.00 . A A . 115 GLN CD   1 1 
        3  5677 1 1 115 GLN CG   C  10.130  -3.838  -2.559 1.00 . A A . 115 GLN CG   1 1 
        3  5678 1 1 115 GLN H    H  10.733  -1.614  -4.248 1.00 . A A . 115 GLN H    1 1 
        3  5679 1 1 115 GLN HA   H  10.061  -0.465  -1.629 1.00 . A A . 115 GLN HA   1 1 
        3  5680 1 1 115 GLN HB2  H   9.369  -2.627  -0.924 1.00 . A A . 115 GLN HB2  1 1 
        3  5681 1 1 115 GLN HB3  H   8.738  -2.165  -2.491 1.00 . A A . 115 GLN HB3  1 1 
        3  5682 1 1 115 GLN HE21 H   9.892  -5.881  -1.051 1.00 . A A . 115 GLN HE21 1 1 
        3  5683 1 1 115 GLN HE22 H   8.311  -6.532  -1.734 1.00 . A A . 115 GLN HE22 1 1 
        3  5684 1 1 115 GLN HG2  H  10.449  -3.726  -3.611 1.00 . A A . 115 GLN HG2  1 1 
        3  5685 1 1 115 GLN HG3  H  11.027  -4.205  -2.025 1.00 . A A . 115 GLN HG3  1 1 
        3  5686 1 1 115 GLN N    N  10.939  -0.967  -3.480 1.00 . A A . 115 GLN N    1 1 
        3  5687 1 1 115 GLN NE2  N   9.083  -5.863  -1.678 1.00 . A A . 115 GLN NE2  1 1 
        3  5688 1 1 115 GLN O    O  12.133  -2.386  -0.414 1.00 . A A . 115 GLN O    1 1 
        3  5689 1 1 115 GLN OE1  O   8.054  -4.809  -3.303 1.00 . A A . 115 GLN OE1  1 1 
        3  5690 1 1 116 ARG C    C  14.113   1.410  -0.116 1.00 . A A . 116 ARG C    1 1 
        3  5691 1 1 116 ARG CA   C  13.911  -0.145  -0.260 1.00 . A A . 116 ARG CA   1 1 
        3  5692 1 1 116 ARG CB   C  15.199  -0.774  -0.866 1.00 . A A . 116 ARG CB   1 1 
        3  5693 1 1 116 ARG CD   C  16.643  -2.904  -1.130 1.00 . A A . 116 ARG CD   1 1 
        3  5694 1 1 116 ARG CG   C  15.276  -2.308  -0.756 1.00 . A A . 116 ARG CG   1 1 
        3  5695 1 1 116 ARG CZ   C  17.945  -3.350  -3.217 1.00 . A A . 116 ARG CZ   1 1 
        3  5696 1 1 116 ARG H    H  12.342   0.451  -1.684 1.00 . A A . 116 ARG H    1 1 
        3  5697 1 1 116 ARG HA   H  13.729  -0.580   0.745 1.00 . A A . 116 ARG HA   1 1 
        3  5698 1 1 116 ARG HB2  H  15.319  -0.450  -1.918 1.00 . A A . 116 ARG HB2  1 1 
        3  5699 1 1 116 ARG HB3  H  16.073  -0.345  -0.333 1.00 . A A . 116 ARG HB3  1 1 
        3  5700 1 1 116 ARG HD2  H  17.454  -2.367  -0.594 1.00 . A A . 116 ARG HD2  1 1 
        3  5701 1 1 116 ARG HD3  H  16.671  -3.952  -0.760 1.00 . A A . 116 ARG HD3  1 1 
        3  5702 1 1 116 ARG HE   H  16.143  -2.519  -3.226 1.00 . A A . 116 ARG HE   1 1 
        3  5703 1 1 116 ARG HG2  H  15.052  -2.606   0.289 1.00 . A A . 116 ARG HG2  1 1 
        3  5704 1 1 116 ARG HG3  H  14.475  -2.789  -1.351 1.00 . A A . 116 ARG HG3  1 1 
        3  5705 1 1 116 ARG HH11 H  18.883  -3.888  -1.576 1.00 . A A . 116 ARG HH11 1 1 
        3  5706 1 1 116 ARG HH12 H  19.767  -4.201  -3.145 1.00 . A A . 116 ARG HH12 1 1 
        3  5707 1 1 116 ARG HH21 H  17.173  -2.893  -4.990 1.00 . A A . 116 ARG HH21 1 1 
        3  5708 1 1 116 ARG HH22 H  18.824  -3.654  -4.973 1.00 . A A . 116 ARG HH22 1 1 
        3  5709 1 1 116 ARG N    N  12.714  -0.317  -1.108 1.00 . A A . 116 ARG N    1 1 
        3  5710 1 1 116 ARG NE   N  16.863  -2.887  -2.598 1.00 . A A . 116 ARG NE   1 1 
        3  5711 1 1 116 ARG NH1  N  18.976  -3.866  -2.594 1.00 . A A . 116 ARG NH1  1 1 
        3  5712 1 1 116 ARG NH2  N  17.986  -3.289  -4.515 1.00 . A A . 116 ARG NH2  1 1 
        3  5713 1 1 116 ARG O    O  14.447   2.107  -1.087 1.00 . A A . 116 ARG O    1 1 
        3  5714 1 1 117 GLY C    C  15.341   4.046   1.556 1.00 . A A . 117 GLY C    1 1 
        3  5715 1 1 117 GLY CA   C  13.963   3.385   1.377 1.00 . A A . 117 GLY CA   1 1 
        3  5716 1 1 117 GLY H    H  13.432   1.274   1.734 1.00 . A A . 117 GLY H    1 1 
        3  5717 1 1 117 GLY HA2  H  13.416   3.942   0.595 1.00 . A A . 117 GLY HA2  1 1 
        3  5718 1 1 117 GLY HA3  H  13.389   3.581   2.299 1.00 . A A . 117 GLY HA3  1 1 
        3  5719 1 1 117 GLY N    N  13.900   1.928   1.101 1.00 . A A . 117 GLY N    1 1 
        3  5720 1 1 117 GLY O    O  15.589   4.701   2.568 1.00 . A A . 117 GLY O    1 1 
        3  5721 1 1 118 ARG C    C  17.644   4.905  -1.170 1.00 . A A . 118 ARG C    1 1 
        3  5722 1 1 118 ARG CA   C  17.427   4.705   0.374 1.00 . A A . 118 ARG CA   1 1 
        3  5723 1 1 118 ARG CB   C  18.583   3.998   1.112 1.00 . A A . 118 ARG CB   1 1 
        3  5724 1 1 118 ARG CD   C  20.411   5.949   0.876 1.00 . A A . 118 ARG CD   1 1 
        3  5725 1 1 118 ARG CG   C  19.710   4.866   1.709 1.00 . A A . 118 ARG CG   1 1 
        3  5726 1 1 118 ARG CZ   C  21.245   6.209  -1.448 1.00 . A A . 118 ARG CZ   1 1 
        3  5727 1 1 118 ARG H    H  15.805   3.279  -0.183 1.00 . A A . 118 ARG H    1 1 
        3  5728 1 1 118 ARG HA   H  17.266   5.715   0.799 1.00 . A A . 118 ARG HA   1 1 
        3  5729 1 1 118 ARG HB2  H  18.185   3.432   1.980 1.00 . A A . 118 ARG HB2  1 1 
        3  5730 1 1 118 ARG HB3  H  19.021   3.207   0.473 1.00 . A A . 118 ARG HB3  1 1 
        3  5731 1 1 118 ARG HD2  H  19.764   6.850   0.836 1.00 . A A . 118 ARG HD2  1 1 
        3  5732 1 1 118 ARG HD3  H  21.336   6.252   1.409 1.00 . A A . 118 ARG HD3  1 1 
        3  5733 1 1 118 ARG HE   H  19.988   4.835  -0.914 1.00 . A A . 118 ARG HE   1 1 
        3  5734 1 1 118 ARG HG2  H  19.319   5.348   2.629 1.00 . A A . 118 ARG HG2  1 1 
        3  5735 1 1 118 ARG HG3  H  20.479   4.161   2.088 1.00 . A A . 118 ARG HG3  1 1 
        3  5736 1 1 118 ARG HH11 H  22.367   7.266  -0.241 1.00 . A A . 118 ARG HH11 1 1 
        3  5737 1 1 118 ARG HH12 H  22.504   7.661  -2.024 1.00 . A A . 118 ARG HH12 1 1 
        3  5738 1 1 118 ARG HH21 H  20.096   5.273  -2.725 1.00 . A A . 118 ARG HH21 1 1 
        3  5739 1 1 118 ARG HH22 H  21.264   6.511  -3.426 1.00 . A A . 118 ARG HH22 1 1 
        3  5740 1 1 118 ARG N    N  16.175   3.923   0.524 1.00 . A A . 118 ARG N    1 1 
        3  5741 1 1 118 ARG NE   N  20.701   5.478  -0.495 1.00 . A A . 118 ARG NE   1 1 
        3  5742 1 1 118 ARG NH1  N  22.120   7.154  -1.226 1.00 . A A . 118 ARG NH1  1 1 
        3  5743 1 1 118 ARG NH2  N  20.880   5.947  -2.667 1.00 . A A . 118 ARG NH2  1 1 
        3  5744 1 1 118 ARG O    O  16.824   5.608  -1.805 1.00 . A A . 118 ARG O    1 1 
        3  5745 1 1 118 ARG OXT  O  18.604   4.364  -1.770 1.00 . A A . 118 ARG OXT  1 1 
        4  5746 1 1   1 MET C    C  10.061   2.013  12.440 1.00 . A A .   1 MET C    1 1 
        4  5747 1 1   1 MET CA   C  10.156   3.495  12.926 1.00 . A A .   1 MET CA   1 1 
        4  5748 1 1   1 MET CB   C  10.719   3.583  14.365 1.00 . A A .   1 MET CB   1 1 
        4  5749 1 1   1 MET CE   C  12.203   6.622  16.758 1.00 . A A .   1 MET CE   1 1 
        4  5750 1 1   1 MET CG   C  11.115   4.994  14.821 1.00 . A A .   1 MET CG   1 1 
        4  5751 1 1   1 MET H1   H   8.092   3.610  13.381 1.00 . A A .   1 MET H1   1 1 
        4  5752 1 1   1 MET H2   H   8.794   5.122  13.149 1.00 . A A .   1 MET H2   1 1 
        4  5753 1 1   1 MET H3   H   8.464   4.126  11.859 1.00 . A A .   1 MET H3   1 1 
        4  5754 1 1   1 MET HA   H  10.865   4.029  12.255 1.00 . A A .   1 MET HA   1 1 
        4  5755 1 1   1 MET HB2  H  10.010   3.140  15.093 1.00 . A A .   1 MET HB2  1 1 
        4  5756 1 1   1 MET HB3  H  11.624   2.943  14.440 1.00 . A A .   1 MET HB3  1 1 
        4  5757 1 1   1 MET HE1  H  12.898   7.024  15.999 1.00 . A A .   1 MET HE1  1 1 
        4  5758 1 1   1 MET HE2  H  11.278   7.227  16.731 1.00 . A A .   1 MET HE2  1 1 
        4  5759 1 1   1 MET HE3  H  12.669   6.763  17.750 1.00 . A A .   1 MET HE3  1 1 
        4  5760 1 1   1 MET HG2  H  11.847   5.459  14.134 1.00 . A A .   1 MET HG2  1 1 
        4  5761 1 1   1 MET HG3  H  10.248   5.678  14.872 1.00 . A A .   1 MET HG3  1 1 
        4  5762 1 1   1 MET N    N   8.811   4.131  12.840 1.00 . A A .   1 MET N    1 1 
        4  5763 1 1   1 MET O    O   9.655   1.133  13.204 1.00 . A A .   1 MET O    1 1 
        4  5764 1 1   1 MET SD   S  11.852   4.880  16.464 1.00 . A A .   1 MET SD   1 1 
        4  5765 1 1   2 ALA C    C  11.606  -0.467  10.830 1.00 . A A .   2 ALA C    1 1 
        4  5766 1 1   2 ALA CA   C  10.319   0.375  10.596 1.00 . A A .   2 ALA CA   1 1 
        4  5767 1 1   2 ALA CB   C   9.973   0.545   9.108 1.00 . A A .   2 ALA CB   1 1 
        4  5768 1 1   2 ALA H    H  10.669   2.545  10.587 1.00 . A A .   2 ALA H    1 1 
        4  5769 1 1   2 ALA HA   H   9.461  -0.166  11.049 1.00 . A A .   2 ALA HA   1 1 
        4  5770 1 1   2 ALA HB1  H  10.749   1.101   8.548 1.00 . A A .   2 ALA HB1  1 1 
        4  5771 1 1   2 ALA HB2  H   9.859  -0.431   8.602 1.00 . A A .   2 ALA HB2  1 1 
        4  5772 1 1   2 ALA HB3  H   9.016   1.081   8.969 1.00 . A A .   2 ALA HB3  1 1 
        4  5773 1 1   2 ALA N    N  10.416   1.743  11.174 1.00 . A A .   2 ALA N    1 1 
        4  5774 1 1   2 ALA O    O  12.501  -0.534   9.981 1.00 . A A .   2 ALA O    1 1 
        4  5775 1 1   3 GLY C    C  12.867  -3.388  11.897 1.00 . A A .   3 GLY C    1 1 
        4  5776 1 1   3 GLY CA   C  12.867  -1.930  12.378 1.00 . A A .   3 GLY CA   1 1 
        4  5777 1 1   3 GLY H    H  10.918  -0.905  12.649 1.00 . A A .   3 GLY H    1 1 
        4  5778 1 1   3 GLY HA2  H  13.804  -1.433  12.055 1.00 . A A .   3 GLY HA2  1 1 
        4  5779 1 1   3 GLY HA3  H  12.937  -1.940  13.482 1.00 . A A .   3 GLY HA3  1 1 
        4  5780 1 1   3 GLY N    N  11.679  -1.130  11.996 1.00 . A A .   3 GLY N    1 1 
        4  5781 1 1   3 GLY O    O  12.725  -4.306  12.706 1.00 . A A .   3 GLY O    1 1 
        4  5782 1 1   4 SER C    C  14.530  -5.616  10.053 1.00 . A A .   4 SER C    1 1 
        4  5783 1 1   4 SER CA   C  13.120  -4.957   9.992 1.00 . A A .   4 SER CA   1 1 
        4  5784 1 1   4 SER CB   C  12.564  -4.838   8.552 1.00 . A A .   4 SER CB   1 1 
        4  5785 1 1   4 SER H    H  13.109  -2.731  10.035 1.00 . A A .   4 SER H    1 1 
        4  5786 1 1   4 SER HA   H  12.422  -5.626  10.539 1.00 . A A .   4 SER HA   1 1 
        4  5787 1 1   4 SER HB2  H  11.512  -4.492   8.580 1.00 . A A .   4 SER HB2  1 1 
        4  5788 1 1   4 SER HB3  H  13.124  -4.082   7.966 1.00 . A A .   4 SER HB3  1 1 
        4  5789 1 1   4 SER HG   H  13.566  -6.319   7.826 1.00 . A A .   4 SER HG   1 1 
        4  5790 1 1   4 SER N    N  13.084  -3.597  10.591 1.00 . A A .   4 SER N    1 1 
        4  5791 1 1   4 SER O    O  15.228  -5.733   9.041 1.00 . A A .   4 SER O    1 1 
        4  5792 1 1   4 SER OG   O  12.627  -6.093   7.871 1.00 . A A .   4 SER OG   1 1 
        4  5793 1 1   5 GLY C    C  16.206  -8.258  11.142 1.00 . A A .   5 GLY C    1 1 
        4  5794 1 1   5 GLY CA   C  16.198  -6.763  11.482 1.00 . A A .   5 GLY CA   1 1 
        4  5795 1 1   5 GLY H    H  14.239  -5.832  11.996 1.00 . A A .   5 GLY H    1 1 
        4  5796 1 1   5 GLY HA2  H  16.996  -6.265  10.898 1.00 . A A .   5 GLY HA2  1 1 
        4  5797 1 1   5 GLY HA3  H  16.498  -6.616  12.536 1.00 . A A .   5 GLY HA3  1 1 
        4  5798 1 1   5 GLY N    N  14.897  -6.096  11.250 1.00 . A A .   5 GLY N    1 1 
        4  5799 1 1   5 GLY O    O  16.631  -8.637  10.049 1.00 . A A .   5 GLY O    1 1 
        4  5800 1 1   6 ILE C    C  14.332 -10.954  11.022 1.00 . A A .   6 ILE C    1 1 
        4  5801 1 1   6 ILE CA   C  15.615 -10.580  11.821 1.00 . A A .   6 ILE CA   1 1 
        4  5802 1 1   6 ILE CB   C  15.897 -11.380  13.132 1.00 . A A .   6 ILE CB   1 1 
        4  5803 1 1   6 ILE CD1  C  17.199 -13.359  12.051 1.00 . A A .   6 ILE CD1  1 1 
        4  5804 1 1   6 ILE CG1  C  16.039 -12.914  12.941 1.00 . A A .   6 ILE CG1  1 1 
        4  5805 1 1   6 ILE CG2  C  14.878 -11.125  14.259 1.00 . A A .   6 ILE CG2  1 1 
        4  5806 1 1   6 ILE H    H  15.341  -8.658  12.901 1.00 . A A .   6 ILE H    1 1 
        4  5807 1 1   6 ILE HA   H  16.473 -10.855  11.187 1.00 . A A .   6 ILE HA   1 1 
        4  5808 1 1   6 ILE HB   H  16.878 -11.016  13.512 1.00 . A A .   6 ILE HB   1 1 
        4  5809 1 1   6 ILE HD11 H  17.293 -14.460  12.056 1.00 . A A .   6 ILE HD11 1 1 
        4  5810 1 1   6 ILE HD12 H  17.068 -13.062  10.995 1.00 . A A .   6 ILE HD12 1 1 
        4  5811 1 1   6 ILE HD13 H  18.170 -12.953  12.391 1.00 . A A .   6 ILE HD13 1 1 
        4  5812 1 1   6 ILE HG12 H  16.182 -13.384  13.936 1.00 . A A .   6 ILE HG12 1 1 
        4  5813 1 1   6 ILE HG13 H  15.096 -13.347  12.560 1.00 . A A .   6 ILE HG13 1 1 
        4  5814 1 1   6 ILE HG21 H  15.220 -11.550  15.221 1.00 . A A .   6 ILE HG21 1 1 
        4  5815 1 1   6 ILE HG22 H  14.743 -10.043  14.408 1.00 . A A .   6 ILE HG22 1 1 
        4  5816 1 1   6 ILE HG23 H  13.880 -11.551  14.044 1.00 . A A .   6 ILE HG23 1 1 
        4  5817 1 1   6 ILE N    N  15.727  -9.105  12.065 1.00 . A A .   6 ILE N    1 1 
        4  5818 1 1   6 ILE O    O  13.352 -11.476  11.559 1.00 . A A .   6 ILE O    1 1 
        4  5819 1 1   7 ILE C    C  13.391 -12.442   8.205 1.00 . A A .   7 ILE C    1 1 
        4  5820 1 1   7 ILE CA   C  13.228 -11.010   8.783 1.00 . A A .   7 ILE CA   1 1 
        4  5821 1 1   7 ILE CB   C  13.041  -9.827   7.783 1.00 . A A .   7 ILE CB   1 1 
        4  5822 1 1   7 ILE CD1  C  11.260 -10.879   6.141 1.00 . A A .   7 ILE CD1  1 1 
        4  5823 1 1   7 ILE CG1  C  11.641  -9.770   7.115 1.00 . A A .   7 ILE CG1  1 1 
        4  5824 1 1   7 ILE CG2  C  14.161  -9.596   6.756 1.00 . A A .   7 ILE CG2  1 1 
        4  5825 1 1   7 ILE H    H  15.177 -10.143   9.410 1.00 . A A .   7 ILE H    1 1 
        4  5826 1 1   7 ILE HA   H  12.291 -10.998   9.384 1.00 . A A .   7 ILE HA   1 1 
        4  5827 1 1   7 ILE HB   H  13.039  -8.913   8.423 1.00 . A A .   7 ILE HB   1 1 
        4  5828 1 1   7 ILE HD11 H  11.992 -10.998   5.321 1.00 . A A .   7 ILE HD11 1 1 
        4  5829 1 1   7 ILE HD12 H  11.164 -11.862   6.634 1.00 . A A .   7 ILE HD12 1 1 
        4  5830 1 1   7 ILE HD13 H  10.283 -10.664   5.670 1.00 . A A .   7 ILE HD13 1 1 
        4  5831 1 1   7 ILE HG12 H  10.870  -9.710   7.908 1.00 . A A .   7 ILE HG12 1 1 
        4  5832 1 1   7 ILE HG13 H  11.556  -8.795   6.592 1.00 . A A .   7 ILE HG13 1 1 
        4  5833 1 1   7 ILE HG21 H  13.994  -8.663   6.188 1.00 . A A .   7 ILE HG21 1 1 
        4  5834 1 1   7 ILE HG22 H  15.152  -9.498   7.236 1.00 . A A .   7 ILE HG22 1 1 
        4  5835 1 1   7 ILE HG23 H  14.245 -10.410   6.015 1.00 . A A .   7 ILE HG23 1 1 
        4  5836 1 1   7 ILE N    N  14.364 -10.701   9.704 1.00 . A A .   7 ILE N    1 1 
        4  5837 1 1   7 ILE O    O  13.925 -12.656   7.113 1.00 . A A .   7 ILE O    1 1 
        4  5838 1 1   8 TYR C    C  11.979 -15.408   7.648 1.00 . A A .   8 TYR C    1 1 
        4  5839 1 1   8 TYR CA   C  13.079 -14.879   8.615 1.00 . A A .   8 TYR CA   1 1 
        4  5840 1 1   8 TYR CB   C  13.320 -15.720   9.895 1.00 . A A .   8 TYR CB   1 1 
        4  5841 1 1   8 TYR CD1  C  12.205 -14.761  11.986 1.00 . A A .   8 TYR CD1  1 1 
        4  5842 1 1   8 TYR CD2  C  11.291 -16.783  11.039 1.00 . A A .   8 TYR CD2  1 1 
        4  5843 1 1   8 TYR CE1  C  11.235 -14.794  12.990 1.00 . A A .   8 TYR CE1  1 1 
        4  5844 1 1   8 TYR CE2  C  10.321 -16.815  12.045 1.00 . A A .   8 TYR CE2  1 1 
        4  5845 1 1   8 TYR CG   C  12.240 -15.749  10.989 1.00 . A A .   8 TYR CG   1 1 
        4  5846 1 1   8 TYR CZ   C  10.293 -15.819  13.019 1.00 . A A .   8 TYR CZ   1 1 
        4  5847 1 1   8 TYR H    H  12.648 -13.142   9.912 1.00 . A A .   8 TYR H    1 1 
        4  5848 1 1   8 TYR HA   H  14.040 -14.986   8.064 1.00 . A A .   8 TYR HA   1 1 
        4  5849 1 1   8 TYR HB2  H  13.553 -16.759   9.589 1.00 . A A .   8 TYR HB2  1 1 
        4  5850 1 1   8 TYR HB3  H  14.272 -15.374  10.348 1.00 . A A .   8 TYR HB3  1 1 
        4  5851 1 1   8 TYR HD1  H  12.931 -13.960  11.990 1.00 . A A .   8 TYR HD1  1 1 
        4  5852 1 1   8 TYR HD2  H  11.294 -17.564  10.288 1.00 . A A .   8 TYR HD2  1 1 
        4  5853 1 1   8 TYR HE1  H  11.218 -14.022  13.749 1.00 . A A .   8 TYR HE1  1 1 
        4  5854 1 1   8 TYR HE2  H   9.596 -17.619  12.055 1.00 . A A .   8 TYR HE2  1 1 
        4  5855 1 1   8 TYR HH   H   8.796 -16.617  13.881 1.00 . A A .   8 TYR HH   1 1 
        4  5856 1 1   8 TYR N    N  12.919 -13.442   8.968 1.00 . A A .   8 TYR N    1 1 
        4  5857 1 1   8 TYR O    O  11.064 -16.143   8.027 1.00 . A A .   8 TYR O    1 1 
        4  5858 1 1   8 TYR OH   O   9.352 -15.844  14.003 1.00 . A A .   8 TYR OH   1 1 
        4  5859 1 1   9 LYS C    C  11.866 -15.324   3.946 1.00 . A A .   9 LYS C    1 1 
        4  5860 1 1   9 LYS CA   C  11.121 -15.415   5.309 1.00 . A A .   9 LYS CA   1 1 
        4  5861 1 1   9 LYS CB   C   9.872 -14.496   5.370 1.00 . A A .   9 LYS CB   1 1 
        4  5862 1 1   9 LYS CD   C   8.495 -15.084   3.251 1.00 . A A .   9 LYS CD   1 1 
        4  5863 1 1   9 LYS CE   C   7.165 -15.588   2.658 1.00 . A A .   9 LYS CE   1 1 
        4  5864 1 1   9 LYS CG   C   8.563 -15.061   4.780 1.00 . A A .   9 LYS CG   1 1 
        4  5865 1 1   9 LYS H    H  12.858 -14.359   6.192 1.00 . A A .   9 LYS H    1 1 
        4  5866 1 1   9 LYS HA   H  10.811 -16.465   5.493 1.00 . A A .   9 LYS HA   1 1 
        4  5867 1 1   9 LYS HB2  H   9.644 -14.283   6.436 1.00 . A A .   9 LYS HB2  1 1 
        4  5868 1 1   9 LYS HB3  H  10.098 -13.499   4.944 1.00 . A A .   9 LYS HB3  1 1 
        4  5869 1 1   9 LYS HD2  H   8.757 -14.093   2.829 1.00 . A A .   9 LYS HD2  1 1 
        4  5870 1 1   9 LYS HD3  H   9.284 -15.758   2.871 1.00 . A A .   9 LYS HD3  1 1 
        4  5871 1 1   9 LYS HE2  H   7.324 -15.783   1.571 1.00 . A A .   9 LYS HE2  1 1 
        4  5872 1 1   9 LYS HE3  H   6.904 -16.580   3.088 1.00 . A A .   9 LYS HE3  1 1 
        4  5873 1 1   9 LYS HG2  H   8.369 -16.067   5.201 1.00 . A A .   9 LYS HG2  1 1 
        4  5874 1 1   9 LYS HG3  H   7.747 -14.430   5.181 1.00 . A A .   9 LYS HG3  1 1 
        4  5875 1 1   9 LYS HZ1  H   5.826 -14.405   3.826 1.00 . A A .   9 LYS HZ1  1 1 
        4  5876 1 1   9 LYS HZ2  H   6.271 -13.697   2.427 1.00 . A A .   9 LYS HZ2  1 1 
        4  5877 1 1   9 LYS HZ3  H   5.165 -14.906   2.368 1.00 . A A .   9 LYS HZ3  1 1 
        4  5878 1 1   9 LYS N    N  12.088 -15.022   6.368 1.00 . A A .   9 LYS N    1 1 
        4  5879 1 1   9 LYS NZ   N   6.055 -14.614   2.834 1.00 . A A .   9 LYS NZ   1 1 
        4  5880 1 1   9 LYS O    O  12.363 -14.256   3.574 1.00 . A A .   9 LYS O    1 1 
        4  5881 1 1  10 GLN C    C  11.893 -15.502   0.786 1.00 . A A .  10 GLN C    1 1 
        4  5882 1 1  10 GLN CA   C  12.557 -16.464   1.848 1.00 . A A .  10 GLN CA   1 1 
        4  5883 1 1  10 GLN CB   C  12.547 -17.921   1.319 1.00 . A A .  10 GLN CB   1 1 
        4  5884 1 1  10 GLN CD   C  14.964 -18.694   1.933 1.00 . A A .  10 GLN CD   1 1 
        4  5885 1 1  10 GLN CG   C  13.461 -18.925   2.054 1.00 . A A .  10 GLN CG   1 1 
        4  5886 1 1  10 GLN H    H  11.499 -17.268   3.615 1.00 . A A .  10 GLN H    1 1 
        4  5887 1 1  10 GLN HA   H  13.607 -16.141   1.974 1.00 . A A .  10 GLN HA   1 1 
        4  5888 1 1  10 GLN HB2  H  11.510 -18.311   1.329 1.00 . A A .  10 GLN HB2  1 1 
        4  5889 1 1  10 GLN HB3  H  12.833 -17.928   0.247 1.00 . A A .  10 GLN HB3  1 1 
        4  5890 1 1  10 GLN HE21 H  15.309 -20.154   3.256 1.00 . A A .  10 GLN HE21 1 1 
        4  5891 1 1  10 GLN HE22 H  16.747 -19.261   2.530 1.00 . A A .  10 GLN HE22 1 1 
        4  5892 1 1  10 GLN HG2  H  13.181 -18.976   3.123 1.00 . A A .  10 GLN HG2  1 1 
        4  5893 1 1  10 GLN HG3  H  13.241 -19.933   1.651 1.00 . A A .  10 GLN HG3  1 1 
        4  5894 1 1  10 GLN N    N  11.917 -16.434   3.195 1.00 . A A .  10 GLN N    1 1 
        4  5895 1 1  10 GLN NE2  N  15.749 -19.446   2.664 1.00 . A A .  10 GLN NE2  1 1 
        4  5896 1 1  10 GLN O    O  10.686 -15.257   0.899 1.00 . A A .  10 GLN O    1 1 
        4  5897 1 1  10 GLN OE1  O  15.468 -17.858   1.189 1.00 . A A .  10 GLN OE1  1 1 
        4  5898 1 1  11 PRO C    C  10.967 -14.130  -2.090 1.00 . A A .  11 PRO C    1 1 
        4  5899 1 1  11 PRO CA   C  12.082 -13.796  -1.058 1.00 . A A .  11 PRO CA   1 1 
        4  5900 1 1  11 PRO CB   C  13.384 -13.212  -1.680 1.00 . A A .  11 PRO CB   1 1 
        4  5901 1 1  11 PRO CD   C  14.063 -15.148  -0.421 1.00 . A A .  11 PRO CD   1 1 
        4  5902 1 1  11 PRO CG   C  14.359 -14.409  -1.734 1.00 . A A .  11 PRO CG   1 1 
        4  5903 1 1  11 PRO HA   H  11.685 -13.020  -0.370 1.00 . A A .  11 PRO HA   1 1 
        4  5904 1 1  11 PRO HB2  H  13.237 -12.735  -2.665 1.00 . A A .  11 PRO HB2  1 1 
        4  5905 1 1  11 PRO HB3  H  13.789 -12.431  -1.005 1.00 . A A .  11 PRO HB3  1 1 
        4  5906 1 1  11 PRO HD2  H  14.328 -16.220  -0.467 1.00 . A A .  11 PRO HD2  1 1 
        4  5907 1 1  11 PRO HD3  H  14.631 -14.698   0.419 1.00 . A A .  11 PRO HD3  1 1 
        4  5908 1 1  11 PRO HG2  H  14.119 -15.055  -2.602 1.00 . A A .  11 PRO HG2  1 1 
        4  5909 1 1  11 PRO HG3  H  15.415 -14.100  -1.826 1.00 . A A .  11 PRO HG3  1 1 
        4  5910 1 1  11 PRO N    N  12.611 -14.936  -0.226 1.00 . A A .  11 PRO N    1 1 
        4  5911 1 1  11 PRO O    O  11.156 -14.130  -3.308 1.00 . A A .  11 PRO O    1 1 
        4  5912 1 1  12 ILE C    C   7.377 -13.753  -1.479 1.00 . A A .  12 ILE C    1 1 
        4  5913 1 1  12 ILE CA   C   8.496 -14.455  -2.307 1.00 . A A .  12 ILE CA   1 1 
        4  5914 1 1  12 ILE CB   C   8.229 -15.925  -2.750 1.00 . A A .  12 ILE CB   1 1 
        4  5915 1 1  12 ILE CD1  C   7.056 -15.371  -5.004 1.00 . A A .  12 ILE CD1  1 1 
        4  5916 1 1  12 ILE CG1  C   6.986 -16.101  -3.663 1.00 . A A .  12 ILE CG1  1 1 
        4  5917 1 1  12 ILE CG2  C   8.123 -16.950  -1.596 1.00 . A A .  12 ILE CG2  1 1 
        4  5918 1 1  12 ILE H    H   9.846 -14.549  -0.540 1.00 . A A .  12 ILE H    1 1 
        4  5919 1 1  12 ILE HA   H   8.614 -13.871  -3.241 1.00 . A A .  12 ILE HA   1 1 
        4  5920 1 1  12 ILE HB   H   9.115 -16.226  -3.351 1.00 . A A .  12 ILE HB   1 1 
        4  5921 1 1  12 ILE HD11 H   7.960 -15.641  -5.581 1.00 . A A .  12 ILE HD11 1 1 
        4  5922 1 1  12 ILE HD12 H   6.185 -15.629  -5.634 1.00 . A A .  12 ILE HD12 1 1 
        4  5923 1 1  12 ILE HD13 H   7.050 -14.272  -4.896 1.00 . A A .  12 ILE HD13 1 1 
        4  5924 1 1  12 ILE HG12 H   6.850 -17.180  -3.878 1.00 . A A .  12 ILE HG12 1 1 
        4  5925 1 1  12 ILE HG13 H   6.065 -15.802  -3.125 1.00 . A A .  12 ILE HG13 1 1 
        4  5926 1 1  12 ILE HG21 H   7.198 -16.831  -1.003 1.00 . A A .  12 ILE HG21 1 1 
        4  5927 1 1  12 ILE HG22 H   8.131 -17.986  -1.983 1.00 . A A .  12 ILE HG22 1 1 
        4  5928 1 1  12 ILE HG23 H   8.972 -16.866  -0.894 1.00 . A A .  12 ILE HG23 1 1 
        4  5929 1 1  12 ILE N    N   9.766 -14.327  -1.544 1.00 . A A .  12 ILE N    1 1 
        4  5930 1 1  12 ILE O    O   6.612 -14.384  -0.742 1.00 . A A .  12 ILE O    1 1 
        4  5931 1 1  13 TYR C    C   6.261 -10.174  -1.343 1.00 . A A .  13 TYR C    1 1 
        4  5932 1 1  13 TYR CA   C   6.442 -11.583  -0.711 1.00 . A A .  13 TYR CA   1 1 
        4  5933 1 1  13 TYR CB   C   7.008 -11.513   0.736 1.00 . A A .  13 TYR CB   1 1 
        4  5934 1 1  13 TYR CD1  C   4.792 -11.616   2.036 1.00 . A A .  13 TYR CD1  1 1 
        4  5935 1 1  13 TYR CD2  C   6.464 -10.025   2.730 1.00 . A A .  13 TYR CD2  1 1 
        4  5936 1 1  13 TYR CE1  C   3.991 -11.241   3.116 1.00 . A A .  13 TYR CE1  1 1 
        4  5937 1 1  13 TYR CE2  C   5.654  -9.649   3.807 1.00 . A A .  13 TYR CE2  1 1 
        4  5938 1 1  13 TYR CG   C   6.047 -11.016   1.831 1.00 . A A .  13 TYR CG   1 1 
        4  5939 1 1  13 TYR CZ   C   4.418 -10.257   4.000 1.00 . A A .  13 TYR CZ   1 1 
        4  5940 1 1  13 TYR H    H   8.116 -12.015  -2.094 1.00 . A A .  13 TYR H    1 1 
        4  5941 1 1  13 TYR HA   H   5.455 -12.085  -0.687 1.00 . A A .  13 TYR HA   1 1 
        4  5942 1 1  13 TYR HB2  H   7.354 -12.517   1.047 1.00 . A A .  13 TYR HB2  1 1 
        4  5943 1 1  13 TYR HB3  H   7.940 -10.912   0.732 1.00 . A A .  13 TYR HB3  1 1 
        4  5944 1 1  13 TYR HD1  H   4.434 -12.398   1.377 1.00 . A A .  13 TYR HD1  1 1 
        4  5945 1 1  13 TYR HD2  H   7.430  -9.549   2.622 1.00 . A A .  13 TYR HD2  1 1 
        4  5946 1 1  13 TYR HE1  H   3.046 -11.739   3.276 1.00 . A A .  13 TYR HE1  1 1 
        4  5947 1 1  13 TYR HE2  H   5.996  -8.880   4.489 1.00 . A A .  13 TYR HE2  1 1 
        4  5948 1 1  13 TYR HH   H   2.723 -10.344   5.027 1.00 . A A .  13 TYR HH   1 1 
        4  5949 1 1  13 TYR N    N   7.343 -12.410  -1.552 1.00 . A A .  13 TYR N    1 1 
        4  5950 1 1  13 TYR O    O   7.120  -9.297  -1.202 1.00 . A A .  13 TYR O    1 1 
        4  5951 1 1  13 TYR OH   O   3.635  -9.886   5.056 1.00 . A A .  13 TYR OH   1 1 
        4  5952 1 1  14 GLN C    C   4.278  -7.597  -1.140 1.00 . A A .  14 GLN C    1 1 
        4  5953 1 1  14 GLN CA   C   4.647  -8.559  -2.319 1.00 . A A .  14 GLN CA   1 1 
        4  5954 1 1  14 GLN CB   C   3.535  -8.650  -3.393 1.00 . A A .  14 GLN CB   1 1 
        4  5955 1 1  14 GLN CD   C   1.890 -10.443  -2.488 1.00 . A A .  14 GLN CD   1 1 
        4  5956 1 1  14 GLN CG   C   2.107  -9.028  -2.969 1.00 . A A .  14 GLN CG   1 1 
        4  5957 1 1  14 GLN H    H   4.496 -10.740  -2.142 1.00 . A A .  14 GLN H    1 1 
        4  5958 1 1  14 GLN HA   H   5.493  -8.073  -2.845 1.00 . A A .  14 GLN HA   1 1 
        4  5959 1 1  14 GLN HB2  H   3.472  -7.659  -3.889 1.00 . A A .  14 GLN HB2  1 1 
        4  5960 1 1  14 GLN HB3  H   3.884  -9.331  -4.191 1.00 . A A .  14 GLN HB3  1 1 
        4  5961 1 1  14 GLN HE21 H   1.372 -11.005  -4.318 1.00 . A A .  14 GLN HE21 1 1 
        4  5962 1 1  14 GLN HE22 H   1.437 -12.318  -3.044 1.00 . A A .  14 GLN HE22 1 1 
        4  5963 1 1  14 GLN HG2  H   1.763  -8.355  -2.169 1.00 . A A .  14 GLN HG2  1 1 
        4  5964 1 1  14 GLN HG3  H   1.415  -8.806  -3.800 1.00 . A A .  14 GLN HG3  1 1 
        4  5965 1 1  14 GLN N    N   5.105  -9.934  -1.975 1.00 . A A .  14 GLN N    1 1 
        4  5966 1 1  14 GLN NE2  N   1.464 -11.334  -3.355 1.00 . A A .  14 GLN NE2  1 1 
        4  5967 1 1  14 GLN O    O   4.203  -6.384  -1.358 1.00 . A A .  14 GLN O    1 1 
        4  5968 1 1  14 GLN OE1  O   2.130 -10.747  -1.325 1.00 . A A .  14 GLN OE1  1 1 
        4  5969 1 1  15 GLY C    C   4.889  -6.435   1.889 1.00 . A A .  15 GLY C    1 1 
        4  5970 1 1  15 GLY CA   C   3.783  -7.323   1.290 1.00 . A A .  15 GLY CA   1 1 
        4  5971 1 1  15 GLY H    H   4.119  -9.150   0.064 1.00 . A A .  15 GLY H    1 1 
        4  5972 1 1  15 GLY HA2  H   2.889  -6.701   1.119 1.00 . A A .  15 GLY HA2  1 1 
        4  5973 1 1  15 GLY HA3  H   3.477  -8.031   2.079 1.00 . A A .  15 GLY HA3  1 1 
        4  5974 1 1  15 GLY N    N   4.082  -8.124   0.084 1.00 . A A .  15 GLY N    1 1 
        4  5975 1 1  15 GLY O    O   5.235  -6.565   3.063 1.00 . A A .  15 GLY O    1 1 
        4  5976 1 1  16 ASN C    C   6.117  -3.111   0.895 1.00 . A A .  16 ASN C    1 1 
        4  5977 1 1  16 ASN CA   C   6.449  -4.557   1.407 1.00 . A A .  16 ASN CA   1 1 
        4  5978 1 1  16 ASN CB   C   7.807  -5.048   0.843 1.00 . A A .  16 ASN CB   1 1 
        4  5979 1 1  16 ASN CG   C   8.399  -6.255   1.557 1.00 . A A .  16 ASN CG   1 1 
        4  5980 1 1  16 ASN H    H   4.987  -5.606   0.124 1.00 . A A .  16 ASN H    1 1 
        4  5981 1 1  16 ASN HA   H   6.524  -4.466   2.504 1.00 . A A .  16 ASN HA   1 1 
        4  5982 1 1  16 ASN HB2  H   7.737  -5.225  -0.247 1.00 . A A .  16 ASN HB2  1 1 
        4  5983 1 1  16 ASN HB3  H   8.553  -4.237   0.944 1.00 . A A .  16 ASN HB3  1 1 
        4  5984 1 1  16 ASN HD21 H   7.986  -7.495   0.025 1.00 . A A .  16 ASN HD21 1 1 
        4  5985 1 1  16 ASN HD22 H   8.899  -8.147   1.481 1.00 . A A .  16 ASN HD22 1 1 
        4  5986 1 1  16 ASN N    N   5.356  -5.494   1.076 1.00 . A A .  16 ASN N    1 1 
        4  5987 1 1  16 ASN ND2  N   8.455  -7.406   0.933 1.00 . A A .  16 ASN ND2  1 1 
        4  5988 1 1  16 ASN O    O   6.158  -2.176   1.695 1.00 . A A .  16 ASN O    1 1 
        4  5989 1 1  16 ASN OD1  O   8.846  -6.172   2.696 1.00 . A A .  16 ASN OD1  1 1 
        4  5990 1 1  17 LEU C    C   4.084  -1.053  -0.499 1.00 . A A .  17 LEU C    1 1 
        4  5991 1 1  17 LEU CA   C   5.431  -1.637  -1.006 1.00 . A A .  17 LEU CA   1 1 
        4  5992 1 1  17 LEU CB   C   5.616  -1.715  -2.547 1.00 . A A .  17 LEU CB   1 1 
        4  5993 1 1  17 LEU CD1  C   3.926  -2.287  -4.367 1.00 . A A .  17 LEU CD1  1 1 
        4  5994 1 1  17 LEU CD2  C   5.891  -3.793  -4.003 1.00 . A A .  17 LEU CD2  1 1 
        4  5995 1 1  17 LEU CG   C   4.889  -2.850  -3.318 1.00 . A A .  17 LEU CG   1 1 
        4  5996 1 1  17 LEU H    H   5.748  -3.802  -0.958 1.00 . A A .  17 LEU H    1 1 
        4  5997 1 1  17 LEU HA   H   6.201  -0.904  -0.680 1.00 . A A .  17 LEU HA   1 1 
        4  5998 1 1  17 LEU HB2  H   5.364  -0.725  -2.975 1.00 . A A .  17 LEU HB2  1 1 
        4  5999 1 1  17 LEU HB3  H   6.709  -1.767  -2.728 1.00 . A A .  17 LEU HB3  1 1 
        4  6000 1 1  17 LEU HD11 H   3.379  -3.087  -4.900 1.00 . A A .  17 LEU HD11 1 1 
        4  6001 1 1  17 LEU HD12 H   3.153  -1.650  -3.905 1.00 . A A .  17 LEU HD12 1 1 
        4  6002 1 1  17 LEU HD13 H   4.433  -1.672  -5.132 1.00 . A A .  17 LEU HD13 1 1 
        4  6003 1 1  17 LEU HD21 H   5.373  -4.621  -4.522 1.00 . A A .  17 LEU HD21 1 1 
        4  6004 1 1  17 LEU HD22 H   6.510  -3.273  -4.757 1.00 . A A .  17 LEU HD22 1 1 
        4  6005 1 1  17 LEU HD23 H   6.582  -4.257  -3.276 1.00 . A A .  17 LEU HD23 1 1 
        4  6006 1 1  17 LEU HG   H   4.284  -3.473  -2.627 1.00 . A A .  17 LEU HG   1 1 
        4  6007 1 1  17 LEU N    N   5.793  -2.943  -0.402 1.00 . A A .  17 LEU N    1 1 
        4  6008 1 1  17 LEU O    O   4.118  -0.212   0.396 1.00 . A A .  17 LEU O    1 1 
        4  6009 1 1  18 ILE C    C   1.074  -1.875   0.608 1.00 . A A .  18 ILE C    1 1 
        4  6010 1 1  18 ILE CA   C   1.588  -0.967  -0.542 1.00 . A A .  18 ILE CA   1 1 
        4  6011 1 1  18 ILE CB   C   0.668  -0.815  -1.795 1.00 . A A .  18 ILE CB   1 1 
        4  6012 1 1  18 ILE CD1  C   0.643   1.808  -2.016 1.00 . A A .  18 ILE CD1  1 1 
        4  6013 1 1  18 ILE CG1  C   1.053   0.462  -2.608 1.00 . A A .  18 ILE CG1  1 1 
        4  6014 1 1  18 ILE CG2  C  -0.844  -0.848  -1.526 1.00 . A A .  18 ILE CG2  1 1 
        4  6015 1 1  18 ILE H    H   3.011  -2.119  -1.806 1.00 . A A .  18 ILE H    1 1 
        4  6016 1 1  18 ILE HA   H   1.722   0.052  -0.126 1.00 . A A .  18 ILE HA   1 1 
        4  6017 1 1  18 ILE HB   H   0.861  -1.668  -2.484 1.00 . A A .  18 ILE HB   1 1 
        4  6018 1 1  18 ILE HD11 H   1.000   2.644  -2.642 1.00 . A A .  18 ILE HD11 1 1 
        4  6019 1 1  18 ILE HD12 H  -0.451   1.912  -1.938 1.00 . A A .  18 ILE HD12 1 1 
        4  6020 1 1  18 ILE HD13 H   1.036   1.970  -1.000 1.00 . A A .  18 ILE HD13 1 1 
        4  6021 1 1  18 ILE HG12 H   2.147   0.464  -2.779 1.00 . A A .  18 ILE HG12 1 1 
        4  6022 1 1  18 ILE HG13 H   0.639   0.360  -3.626 1.00 . A A .  18 ILE HG13 1 1 
        4  6023 1 1  18 ILE HG21 H  -1.181  -1.841  -1.174 1.00 . A A .  18 ILE HG21 1 1 
        4  6024 1 1  18 ILE HG22 H  -1.151  -0.125  -0.752 1.00 . A A .  18 ILE HG22 1 1 
        4  6025 1 1  18 ILE HG23 H  -1.431  -0.632  -2.437 1.00 . A A .  18 ILE HG23 1 1 
        4  6026 1 1  18 ILE N    N   2.920  -1.488  -1.001 1.00 . A A .  18 ILE N    1 1 
        4  6027 1 1  18 ILE O    O   0.680  -3.022   0.387 1.00 . A A .  18 ILE O    1 1 
        4  6028 1 1  19 LYS C    C   0.706  -1.389   4.299 1.00 . A A .  19 LYS C    1 1 
        4  6029 1 1  19 LYS CA   C   1.145  -2.233   3.066 1.00 . A A .  19 LYS CA   1 1 
        4  6030 1 1  19 LYS CB   C   2.567  -2.824   3.225 1.00 . A A .  19 LYS CB   1 1 
        4  6031 1 1  19 LYS CD   C   2.052  -5.205   4.049 1.00 . A A .  19 LYS CD   1 1 
        4  6032 1 1  19 LYS CE   C   2.498  -6.316   5.012 1.00 . A A .  19 LYS CE   1 1 
        4  6033 1 1  19 LYS CG   C   2.781  -3.877   4.322 1.00 . A A .  19 LYS CG   1 1 
        4  6034 1 1  19 LYS H    H   1.500  -0.410   1.899 1.00 . A A .  19 LYS H    1 1 
        4  6035 1 1  19 LYS HA   H   0.434  -3.065   2.903 1.00 . A A .  19 LYS HA   1 1 
        4  6036 1 1  19 LYS HB2  H   2.882  -3.272   2.258 1.00 . A A .  19 LYS HB2  1 1 
        4  6037 1 1  19 LYS HB3  H   3.288  -1.998   3.383 1.00 . A A .  19 LYS HB3  1 1 
        4  6038 1 1  19 LYS HD2  H   0.958  -5.058   4.101 1.00 . A A .  19 LYS HD2  1 1 
        4  6039 1 1  19 LYS HD3  H   2.251  -5.507   3.003 1.00 . A A .  19 LYS HD3  1 1 
        4  6040 1 1  19 LYS HE2  H   3.611  -6.361   5.040 1.00 . A A .  19 LYS HE2  1 1 
        4  6041 1 1  19 LYS HE3  H   2.192  -6.087   6.056 1.00 . A A .  19 LYS HE3  1 1 
        4  6042 1 1  19 LYS HG2  H   3.877  -4.051   4.362 1.00 . A A .  19 LYS HG2  1 1 
        4  6043 1 1  19 LYS HG3  H   2.510  -3.458   5.308 1.00 . A A .  19 LYS HG3  1 1 
        4  6044 1 1  19 LYS HZ1  H   2.626  -8.421   4.756 1.00 . A A .  19 LYS HZ1  1 1 
        4  6045 1 1  19 LYS HZ2  H   1.078  -7.990   4.977 1.00 . A A .  19 LYS HZ2  1 1 
        4  6046 1 1  19 LYS HZ3  H   1.757  -7.714   3.559 1.00 . A A .  19 LYS HZ3  1 1 
        4  6047 1 1  19 LYS N    N   1.165  -1.376   1.852 1.00 . A A .  19 LYS N    1 1 
        4  6048 1 1  19 LYS NZ   N   1.974  -7.636   4.571 1.00 . A A .  19 LYS NZ   1 1 
        4  6049 1 1  19 LYS O    O   1.292  -0.342   4.596 1.00 . A A .  19 LYS O    1 1 
        4  6050 1 1  20 GLN C    C  -0.001  -0.876   7.442 1.00 . A A .  20 GLN C    1 1 
        4  6051 1 1  20 GLN CA   C  -0.894  -1.082   6.179 1.00 . A A .  20 GLN CA   1 1 
        4  6052 1 1  20 GLN CB   C  -2.306  -1.636   6.461 1.00 . A A .  20 GLN CB   1 1 
        4  6053 1 1  20 GLN CD   C  -3.563   0.576   7.169 1.00 . A A .  20 GLN CD   1 1 
        4  6054 1 1  20 GLN CG   C  -3.191  -0.869   7.464 1.00 . A A .  20 GLN CG   1 1 
        4  6055 1 1  20 GLN H    H  -0.859  -2.571   4.539 1.00 . A A .  20 GLN H    1 1 
        4  6056 1 1  20 GLN HA   H  -1.058  -0.056   5.806 1.00 . A A .  20 GLN HA   1 1 
        4  6057 1 1  20 GLN HB2  H  -2.869  -1.708   5.507 1.00 . A A .  20 GLN HB2  1 1 
        4  6058 1 1  20 GLN HB3  H  -2.241  -2.683   6.822 1.00 . A A .  20 GLN HB3  1 1 
        4  6059 1 1  20 GLN HE21 H  -1.780   1.189   7.808 1.00 . A A .  20 GLN HE21 1 1 
        4  6060 1 1  20 GLN HE22 H  -2.944   2.461   7.175 1.00 . A A .  20 GLN HE22 1 1 
        4  6061 1 1  20 GLN HG2  H  -4.137  -1.434   7.539 1.00 . A A .  20 GLN HG2  1 1 
        4  6062 1 1  20 GLN HG3  H  -2.762  -0.942   8.479 1.00 . A A .  20 GLN HG3  1 1 
        4  6063 1 1  20 GLN N    N  -0.319  -1.852   5.029 1.00 . A A .  20 GLN N    1 1 
        4  6064 1 1  20 GLN NE2  N  -2.698   1.515   7.475 1.00 . A A .  20 GLN NE2  1 1 
        4  6065 1 1  20 GLN O    O  -0.120   0.182   8.065 1.00 . A A .  20 GLN O    1 1 
        4  6066 1 1  20 GLN OE1  O  -4.654   0.894   6.702 1.00 . A A .  20 GLN OE1  1 1 
        4  6067 1 1  21 ASN C    C   3.231  -1.005   8.454 1.00 . A A .  21 ASN C    1 1 
        4  6068 1 1  21 ASN CA   C   1.864  -1.606   8.913 1.00 . A A .  21 ASN CA   1 1 
        4  6069 1 1  21 ASN CB   C   2.006  -2.930   9.702 1.00 . A A .  21 ASN CB   1 1 
        4  6070 1 1  21 ASN CG   C   2.704  -2.774  11.050 1.00 . A A .  21 ASN CG   1 1 
        4  6071 1 1  21 ASN H    H   0.875  -2.646   7.206 1.00 . A A .  21 ASN H    1 1 
        4  6072 1 1  21 ASN HA   H   1.442  -0.851   9.611 1.00 . A A .  21 ASN HA   1 1 
        4  6073 1 1  21 ASN HB2  H   1.000  -3.336   9.921 1.00 . A A .  21 ASN HB2  1 1 
        4  6074 1 1  21 ASN HB3  H   2.494  -3.706   9.083 1.00 . A A .  21 ASN HB3  1 1 
        4  6075 1 1  21 ASN HD21 H   4.225  -3.947  10.484 1.00 . A A .  21 ASN HD21 1 1 
        4  6076 1 1  21 ASN HD22 H   4.247  -3.238  12.180 1.00 . A A .  21 ASN HD22 1 1 
        4  6077 1 1  21 ASN N    N   0.879  -1.821   7.812 1.00 . A A .  21 ASN N    1 1 
        4  6078 1 1  21 ASN ND2  N   3.845  -3.385  11.250 1.00 . A A .  21 ASN ND2  1 1 
        4  6079 1 1  21 ASN O    O   3.679  -0.037   9.071 1.00 . A A .  21 ASN O    1 1 
        4  6080 1 1  21 ASN OD1  O   2.224  -2.085  11.945 1.00 . A A .  21 ASN OD1  1 1 
        4  6081 1 1  22 ALA C    C   5.178   0.417   6.344 1.00 . A A .  22 ALA C    1 1 
        4  6082 1 1  22 ALA CA   C   5.193  -1.025   6.931 1.00 . A A .  22 ALA CA   1 1 
        4  6083 1 1  22 ALA CB   C   5.771  -2.033   5.928 1.00 . A A .  22 ALA CB   1 1 
        4  6084 1 1  22 ALA H    H   3.389  -2.297   6.929 1.00 . A A .  22 ALA H    1 1 
        4  6085 1 1  22 ALA HA   H   5.889  -0.991   7.797 1.00 . A A .  22 ALA HA   1 1 
        4  6086 1 1  22 ALA HB1  H   5.844  -3.050   6.355 1.00 . A A .  22 ALA HB1  1 1 
        4  6087 1 1  22 ALA HB2  H   5.177  -2.100   4.999 1.00 . A A .  22 ALA HB2  1 1 
        4  6088 1 1  22 ALA HB3  H   6.796  -1.753   5.620 1.00 . A A .  22 ALA HB3  1 1 
        4  6089 1 1  22 ALA N    N   3.893  -1.557   7.421 1.00 . A A .  22 ALA N    1 1 
        4  6090 1 1  22 ALA O    O   6.097   1.182   6.644 1.00 . A A .  22 ALA O    1 1 
        4  6091 1 1  23 VAL C    C   3.561   3.187   6.308 1.00 . A A .  23 VAL C    1 1 
        4  6092 1 1  23 VAL CA   C   3.970   2.228   5.141 1.00 . A A .  23 VAL CA   1 1 
        4  6093 1 1  23 VAL CB   C   3.028   2.372   3.911 1.00 . A A .  23 VAL CB   1 1 
        4  6094 1 1  23 VAL CG1  C   2.981   3.812   3.347 1.00 . A A .  23 VAL CG1  1 1 
        4  6095 1 1  23 VAL CG2  C   3.402   1.448   2.742 1.00 . A A .  23 VAL CG2  1 1 
        4  6096 1 1  23 VAL H    H   3.432   0.094   5.396 1.00 . A A .  23 VAL H    1 1 
        4  6097 1 1  23 VAL HA   H   4.961   2.572   4.798 1.00 . A A .  23 VAL HA   1 1 
        4  6098 1 1  23 VAL HB   H   2.011   2.111   4.234 1.00 . A A .  23 VAL HB   1 1 
        4  6099 1 1  23 VAL HG11 H   2.355   3.875   2.436 1.00 . A A .  23 VAL HG11 1 1 
        4  6100 1 1  23 VAL HG12 H   2.553   4.526   4.075 1.00 . A A .  23 VAL HG12 1 1 
        4  6101 1 1  23 VAL HG13 H   3.983   4.191   3.078 1.00 . A A .  23 VAL HG13 1 1 
        4  6102 1 1  23 VAL HG21 H   2.702   1.553   1.894 1.00 . A A .  23 VAL HG21 1 1 
        4  6103 1 1  23 VAL HG22 H   4.420   1.643   2.356 1.00 . A A .  23 VAL HG22 1 1 
        4  6104 1 1  23 VAL HG23 H   3.383   0.381   3.026 1.00 . A A .  23 VAL HG23 1 1 
        4  6105 1 1  23 VAL N    N   4.147   0.808   5.574 1.00 . A A .  23 VAL N    1 1 
        4  6106 1 1  23 VAL O    O   4.068   4.307   6.336 1.00 . A A .  23 VAL O    1 1 
        4  6107 1 1  24 GLU C    C   3.935   3.752   9.330 1.00 . A A .  24 GLU C    1 1 
        4  6108 1 1  24 GLU CA   C   2.588   3.525   8.572 1.00 . A A .  24 GLU CA   1 1 
        4  6109 1 1  24 GLU CB   C   1.485   2.819   9.394 1.00 . A A .  24 GLU CB   1 1 
        4  6110 1 1  24 GLU CD   C   1.885   3.331  11.919 1.00 . A A .  24 GLU CD   1 1 
        4  6111 1 1  24 GLU CG   C   1.023   3.524  10.682 1.00 . A A .  24 GLU CG   1 1 
        4  6112 1 1  24 GLU H    H   2.428   1.798   7.202 1.00 . A A .  24 GLU H    1 1 
        4  6113 1 1  24 GLU HA   H   2.210   4.530   8.311 1.00 . A A .  24 GLU HA   1 1 
        4  6114 1 1  24 GLU HB2  H   0.588   2.725   8.747 1.00 . A A .  24 GLU HB2  1 1 
        4  6115 1 1  24 GLU HB3  H   1.775   1.774   9.620 1.00 . A A .  24 GLU HB3  1 1 
        4  6116 1 1  24 GLU HG2  H   0.902   4.610  10.517 1.00 . A A .  24 GLU HG2  1 1 
        4  6117 1 1  24 GLU HG3  H   0.013   3.169  10.947 1.00 . A A .  24 GLU HG3  1 1 
        4  6118 1 1  24 GLU N    N   2.722   2.778   7.280 1.00 . A A .  24 GLU N    1 1 
        4  6119 1 1  24 GLU O    O   4.269   4.897   9.651 1.00 . A A .  24 GLU O    1 1 
        4  6120 1 1  24 GLU OE1  O   2.189   2.173  12.284 1.00 . A A .  24 GLU OE1  1 1 
        4  6121 1 1  24 GLU OE2  O   2.242   4.333  12.564 1.00 . A A .  24 GLU OE2  1 1 
        4  6122 1 1  25 GLN C    C   7.237   3.350   9.506 1.00 . A A .  25 GLN C    1 1 
        4  6123 1 1  25 GLN CA   C   6.007   2.786  10.275 1.00 . A A .  25 GLN CA   1 1 
        4  6124 1 1  25 GLN CB   C   6.336   1.424  10.940 1.00 . A A .  25 GLN CB   1 1 
        4  6125 1 1  25 GLN CD   C   5.643   2.076  13.355 1.00 . A A .  25 GLN CD   1 1 
        4  6126 1 1  25 GLN CG   C   5.495   1.092  12.195 1.00 . A A .  25 GLN CG   1 1 
        4  6127 1 1  25 GLN H    H   4.335   1.801   9.203 1.00 . A A .  25 GLN H    1 1 
        4  6128 1 1  25 GLN HA   H   5.865   3.519  11.094 1.00 . A A .  25 GLN HA   1 1 
        4  6129 1 1  25 GLN HB2  H   6.227   0.602  10.205 1.00 . A A .  25 GLN HB2  1 1 
        4  6130 1 1  25 GLN HB3  H   7.402   1.390  11.238 1.00 . A A .  25 GLN HB3  1 1 
        4  6131 1 1  25 GLN HE21 H   3.698   2.518  13.301 1.00 . A A .  25 GLN HE21 1 1 
        4  6132 1 1  25 GLN HE22 H   4.742   3.321  14.572 1.00 . A A .  25 GLN HE22 1 1 
        4  6133 1 1  25 GLN HG2  H   4.433   0.974  11.902 1.00 . A A .  25 GLN HG2  1 1 
        4  6134 1 1  25 GLN HG3  H   5.797   0.095  12.563 1.00 . A A .  25 GLN HG3  1 1 
        4  6135 1 1  25 GLN N    N   4.723   2.689   9.552 1.00 . A A .  25 GLN N    1 1 
        4  6136 1 1  25 GLN NE2  N   4.559   2.590  13.881 1.00 . A A .  25 GLN NE2  1 1 
        4  6137 1 1  25 GLN O    O   8.155   3.800  10.201 1.00 . A A .  25 GLN O    1 1 
        4  6138 1 1  25 GLN OE1  O   6.741   2.437  13.778 1.00 . A A .  25 GLN OE1  1 1 
        4  6139 1 1  26 LEU C    C   8.816   5.486   7.807 1.00 . A A .  26 LEU C    1 1 
        4  6140 1 1  26 LEU CA   C   8.432   4.031   7.427 1.00 . A A .  26 LEU CA   1 1 
        4  6141 1 1  26 LEU CB   C   8.382   3.761   5.907 1.00 . A A .  26 LEU CB   1 1 
        4  6142 1 1  26 LEU CD1  C   7.296   5.811   4.714 1.00 . A A .  26 LEU CD1  1 1 
        4  6143 1 1  26 LEU CD2  C   7.236   3.562   3.693 1.00 . A A .  26 LEU CD2  1 1 
        4  6144 1 1  26 LEU CG   C   7.242   4.319   5.043 1.00 . A A .  26 LEU CG   1 1 
        4  6145 1 1  26 LEU H    H   6.571   2.840   7.670 1.00 . A A .  26 LEU H    1 1 
        4  6146 1 1  26 LEU HA   H   9.319   3.445   7.741 1.00 . A A .  26 LEU HA   1 1 
        4  6147 1 1  26 LEU HB2  H   9.357   4.048   5.470 1.00 . A A .  26 LEU HB2  1 1 
        4  6148 1 1  26 LEU HB3  H   8.367   2.655   5.813 1.00 . A A .  26 LEU HB3  1 1 
        4  6149 1 1  26 LEU HD11 H   8.199   6.086   4.141 1.00 . A A .  26 LEU HD11 1 1 
        4  6150 1 1  26 LEU HD12 H   6.412   6.115   4.115 1.00 . A A .  26 LEU HD12 1 1 
        4  6151 1 1  26 LEU HD13 H   7.267   6.454   5.602 1.00 . A A .  26 LEU HD13 1 1 
        4  6152 1 1  26 LEU HD21 H   8.176   3.727   3.135 1.00 . A A .  26 LEU HD21 1 1 
        4  6153 1 1  26 LEU HD22 H   7.112   2.472   3.830 1.00 . A A .  26 LEU HD22 1 1 
        4  6154 1 1  26 LEU HD23 H   6.403   3.888   3.044 1.00 . A A .  26 LEU HD23 1 1 
        4  6155 1 1  26 LEU HG   H   6.287   4.119   5.554 1.00 . A A .  26 LEU HG   1 1 
        4  6156 1 1  26 LEU N    N   7.293   3.392   8.159 1.00 . A A .  26 LEU N    1 1 
        4  6157 1 1  26 LEU O    O  10.011   5.780   7.865 1.00 . A A .  26 LEU O    1 1 
        4  6158 1 1  27 GLN C    C   9.079   8.638   8.128 1.00 . A A .  27 GLN C    1 1 
        4  6159 1 1  27 GLN CA   C   8.082   7.659   8.827 1.00 . A A .  27 GLN CA   1 1 
        4  6160 1 1  27 GLN CB   C   8.339   7.292  10.309 1.00 . A A .  27 GLN CB   1 1 
        4  6161 1 1  27 GLN CD   C   8.014   7.865  12.754 1.00 . A A .  27 GLN CD   1 1 
        4  6162 1 1  27 GLN CG   C   8.231   8.424  11.343 1.00 . A A .  27 GLN CG   1 1 
        4  6163 1 1  27 GLN H    H   6.924   5.879   8.217 1.00 . A A .  27 GLN H    1 1 
        4  6164 1 1  27 GLN HA   H   7.107   8.185   8.804 1.00 . A A .  27 GLN HA   1 1 
        4  6165 1 1  27 GLN HB2  H   7.598   6.510  10.589 1.00 . A A .  27 GLN HB2  1 1 
        4  6166 1 1  27 GLN HB3  H   9.325   6.797  10.409 1.00 . A A .  27 GLN HB3  1 1 
        4  6167 1 1  27 GLN HE21 H   6.390   8.990  12.968 1.00 . A A .  27 GLN HE21 1 1 
        4  6168 1 1  27 GLN HE22 H   6.848   7.850  14.336 1.00 . A A .  27 GLN HE22 1 1 
        4  6169 1 1  27 GLN HG2  H   9.153   9.034  11.341 1.00 . A A .  27 GLN HG2  1 1 
        4  6170 1 1  27 GLN HG3  H   7.418   9.124  11.068 1.00 . A A .  27 GLN HG3  1 1 
        4  6171 1 1  27 GLN N    N   7.832   6.352   8.133 1.00 . A A .  27 GLN N    1 1 
        4  6172 1 1  27 GLN NE2  N   7.011   8.335  13.451 1.00 . A A .  27 GLN NE2  1 1 
        4  6173 1 1  27 GLN O    O   9.964   9.218   8.759 1.00 . A A .  27 GLN O    1 1 
        4  6174 1 1  27 GLN OE1  O   8.698   6.957  13.226 1.00 . A A .  27 GLN OE1  1 1 
        4  6175 1 1  28 VAL C    C   9.161  10.957   5.579 1.00 . A A .  28 VAL C    1 1 
        4  6176 1 1  28 VAL CA   C   9.825   9.585   5.939 1.00 . A A .  28 VAL CA   1 1 
        4  6177 1 1  28 VAL CB   C  10.148   8.757   4.640 1.00 . A A .  28 VAL CB   1 1 
        4  6178 1 1  28 VAL CG1  C  11.094   9.509   3.673 1.00 . A A .  28 VAL CG1  1 1 
        4  6179 1 1  28 VAL CG2  C  10.818   7.392   4.923 1.00 . A A .  28 VAL CG2  1 1 
        4  6180 1 1  28 VAL H    H   8.229   8.144   6.416 1.00 . A A .  28 VAL H    1 1 
        4  6181 1 1  28 VAL HA   H  10.783   9.762   6.472 1.00 . A A .  28 VAL HA   1 1 
        4  6182 1 1  28 VAL HB   H   9.197   8.559   4.100 1.00 . A A .  28 VAL HB   1 1 
        4  6183 1 1  28 VAL HG11 H  10.635  10.433   3.280 1.00 . A A .  28 VAL HG11 1 1 
        4  6184 1 1  28 VAL HG12 H  12.047   9.796   4.156 1.00 . A A .  28 VAL HG12 1 1 
        4  6185 1 1  28 VAL HG13 H  11.344   8.897   2.786 1.00 . A A .  28 VAL HG13 1 1 
        4  6186 1 1  28 VAL HG21 H  11.107   6.875   3.989 1.00 . A A .  28 VAL HG21 1 1 
        4  6187 1 1  28 VAL HG22 H  11.729   7.487   5.543 1.00 . A A .  28 VAL HG22 1 1 
        4  6188 1 1  28 VAL HG23 H  10.140   6.695   5.447 1.00 . A A .  28 VAL HG23 1 1 
        4  6189 1 1  28 VAL N    N   8.892   8.819   6.810 1.00 . A A .  28 VAL N    1 1 
        4  6190 1 1  28 VAL O    O   8.052  10.989   5.039 1.00 . A A .  28 VAL O    1 1 
        4  6191 1 1  29 GLY C    C  10.497  14.073   4.426 1.00 . A A .  29 GLY C    1 1 
        4  6192 1 1  29 GLY CA   C   9.471  13.411   5.360 1.00 . A A .  29 GLY CA   1 1 
        4  6193 1 1  29 GLY H    H  10.831  11.883   6.158 1.00 . A A .  29 GLY H    1 1 
        4  6194 1 1  29 GLY HA2  H   8.478  13.416   4.879 1.00 . A A .  29 GLY HA2  1 1 
        4  6195 1 1  29 GLY HA3  H   9.341  14.060   6.246 1.00 . A A .  29 GLY HA3  1 1 
        4  6196 1 1  29 GLY N    N   9.883  12.061   5.817 1.00 . A A .  29 GLY N    1 1 
        4  6197 1 1  29 GLY O    O  11.096  15.082   4.797 1.00 . A A .  29 GLY O    1 1 
        4  6198 1 1  30 GLN C    C  11.284  14.391   0.930 1.00 . A A .  30 GLN C    1 1 
        4  6199 1 1  30 GLN CA   C  11.792  13.898   2.308 1.00 . A A .  30 GLN CA   1 1 
        4  6200 1 1  30 GLN CB   C  12.791  12.711   2.256 1.00 . A A .  30 GLN CB   1 1 
        4  6201 1 1  30 GLN CD   C  14.867  14.001   1.340 1.00 . A A .  30 GLN CD   1 1 
        4  6202 1 1  30 GLN CG   C  13.961  12.786   1.254 1.00 . A A .  30 GLN CG   1 1 
        4  6203 1 1  30 GLN H    H  10.206  12.606   3.126 1.00 . A A .  30 GLN H    1 1 
        4  6204 1 1  30 GLN HA   H  12.353  14.755   2.740 1.00 . A A .  30 GLN HA   1 1 
        4  6205 1 1  30 GLN HB2  H  13.201  12.567   3.276 1.00 . A A .  30 GLN HB2  1 1 
        4  6206 1 1  30 GLN HB3  H  12.254  11.767   2.035 1.00 . A A .  30 GLN HB3  1 1 
        4  6207 1 1  30 GLN HE21 H  14.006  14.819  -0.271 1.00 . A A .  30 GLN HE21 1 1 
        4  6208 1 1  30 GLN HE22 H  15.368  15.736   0.565 1.00 . A A .  30 GLN HE22 1 1 
        4  6209 1 1  30 GLN HG2  H  14.592  11.890   1.408 1.00 . A A .  30 GLN HG2  1 1 
        4  6210 1 1  30 GLN HG3  H  13.574  12.662   0.224 1.00 . A A .  30 GLN HG3  1 1 
        4  6211 1 1  30 GLN N    N  10.686  13.505   3.225 1.00 . A A .  30 GLN N    1 1 
        4  6212 1 1  30 GLN NE2  N  14.775  14.917   0.405 1.00 . A A .  30 GLN NE2  1 1 
        4  6213 1 1  30 GLN O    O  11.543  15.545   0.593 1.00 . A A .  30 GLN O    1 1 
        4  6214 1 1  30 GLN OE1  O  15.679  14.140   2.247 1.00 . A A .  30 GLN OE1  1 1 
        4  6215 1 1  31 SER C    C   9.219  13.002  -1.866 1.00 . A A .  31 SER C    1 1 
        4  6216 1 1  31 SER CA   C  10.451  13.782  -1.325 1.00 . A A .  31 SER CA   1 1 
        4  6217 1 1  31 SER CB   C  11.714  13.384  -2.135 1.00 . A A .  31 SER CB   1 1 
        4  6218 1 1  31 SER H    H  10.378  12.654   0.591 1.00 . A A .  31 SER H    1 1 
        4  6219 1 1  31 SER HA   H  10.294  14.865  -1.504 1.00 . A A .  31 SER HA   1 1 
        4  6220 1 1  31 SER HB2  H  12.095  12.404  -1.801 1.00 . A A .  31 SER HB2  1 1 
        4  6221 1 1  31 SER HB3  H  11.469  13.277  -3.210 1.00 . A A .  31 SER HB3  1 1 
        4  6222 1 1  31 SER HG   H  12.448  15.188  -2.567 1.00 . A A .  31 SER HG   1 1 
        4  6223 1 1  31 SER N    N  10.653  13.524   0.124 1.00 . A A .  31 SER N    1 1 
        4  6224 1 1  31 SER O    O   9.093  11.786  -1.681 1.00 . A A .  31 SER O    1 1 
        4  6225 1 1  31 SER OG   O  12.746  14.368  -2.020 1.00 . A A .  31 SER OG   1 1 
        4  6226 1 1  32 LYS C    C   7.352  11.983  -4.247 1.00 . A A .  32 LYS C    1 1 
        4  6227 1 1  32 LYS CA   C   7.154  13.158  -3.255 1.00 . A A .  32 LYS CA   1 1 
        4  6228 1 1  32 LYS CB   C   6.278  14.293  -3.839 1.00 . A A .  32 LYS CB   1 1 
        4  6229 1 1  32 LYS CD   C   7.752  16.214  -4.729 1.00 . A A .  32 LYS CD   1 1 
        4  6230 1 1  32 LYS CE   C   8.081  17.078  -5.953 1.00 . A A .  32 LYS CE   1 1 
        4  6231 1 1  32 LYS CG   C   6.755  15.096  -5.062 1.00 . A A .  32 LYS CG   1 1 
        4  6232 1 1  32 LYS H    H   8.571  14.723  -2.616 1.00 . A A .  32 LYS H    1 1 
        4  6233 1 1  32 LYS HA   H   6.559  12.714  -2.437 1.00 . A A .  32 LYS HA   1 1 
        4  6234 1 1  32 LYS HB2  H   5.302  13.841  -4.108 1.00 . A A .  32 LYS HB2  1 1 
        4  6235 1 1  32 LYS HB3  H   6.013  14.994  -3.023 1.00 . A A .  32 LYS HB3  1 1 
        4  6236 1 1  32 LYS HD2  H   7.314  16.834  -3.921 1.00 . A A .  32 LYS HD2  1 1 
        4  6237 1 1  32 LYS HD3  H   8.694  15.804  -4.315 1.00 . A A .  32 LYS HD3  1 1 
        4  6238 1 1  32 LYS HE2  H   8.687  16.503  -6.686 1.00 . A A .  32 LYS HE2  1 1 
        4  6239 1 1  32 LYS HE3  H   7.160  17.365  -6.499 1.00 . A A .  32 LYS HE3  1 1 
        4  6240 1 1  32 LYS HG2  H   7.134  14.442  -5.867 1.00 . A A .  32 LYS HG2  1 1 
        4  6241 1 1  32 LYS HG3  H   5.851  15.551  -5.510 1.00 . A A .  32 LYS HG3  1 1 
        4  6242 1 1  32 LYS HZ1  H   9.823  18.054  -5.225 1.00 . A A .  32 LYS HZ1  1 1 
        4  6243 1 1  32 LYS HZ2  H   8.844  19.044  -6.222 1.00 . A A .  32 LYS HZ2  1 1 
        4  6244 1 1  32 LYS HZ3  H   8.387  18.714  -4.662 1.00 . A A .  32 LYS HZ3  1 1 
        4  6245 1 1  32 LYS N    N   8.362  13.720  -2.602 1.00 . A A .  32 LYS N    1 1 
        4  6246 1 1  32 LYS NZ   N   8.813  18.287  -5.505 1.00 . A A .  32 LYS NZ   1 1 
        4  6247 1 1  32 LYS O    O   6.697  10.946  -4.124 1.00 . A A .  32 LYS O    1 1 
        4  6248 1 1  33 GLN C    C   9.392   9.890  -5.648 1.00 . A A .  33 GLN C    1 1 
        4  6249 1 1  33 GLN CA   C   8.604  11.116  -6.195 1.00 . A A .  33 GLN CA   1 1 
        4  6250 1 1  33 GLN CB   C   9.324  11.838  -7.352 1.00 . A A .  33 GLN CB   1 1 
        4  6251 1 1  33 GLN CD   C   8.287  10.666  -9.433 1.00 . A A .  33 GLN CD   1 1 
        4  6252 1 1  33 GLN CG   C   9.535  10.981  -8.612 1.00 . A A .  33 GLN CG   1 1 
        4  6253 1 1  33 GLN H    H   8.673  13.104  -5.167 1.00 . A A .  33 GLN H    1 1 
        4  6254 1 1  33 GLN HA   H   7.654  10.710  -6.595 1.00 . A A .  33 GLN HA   1 1 
        4  6255 1 1  33 GLN HB2  H   8.764  12.753  -7.635 1.00 . A A .  33 GLN HB2  1 1 
        4  6256 1 1  33 GLN HB3  H  10.314  12.196  -7.007 1.00 . A A .  33 GLN HB3  1 1 
        4  6257 1 1  33 GLN HE21 H   9.379   9.501 -10.627 1.00 . A A .  33 GLN HE21 1 1 
        4  6258 1 1  33 GLN HE22 H   7.591   9.701 -11.005 1.00 . A A .  33 GLN HE22 1 1 
        4  6259 1 1  33 GLN HG2  H  10.263  11.521  -9.242 1.00 . A A .  33 GLN HG2  1 1 
        4  6260 1 1  33 GLN HG3  H  10.046  10.042  -8.317 1.00 . A A .  33 GLN HG3  1 1 
        4  6261 1 1  33 GLN N    N   8.268  12.160  -5.199 1.00 . A A .  33 GLN N    1 1 
        4  6262 1 1  33 GLN NE2  N   8.436   9.856 -10.450 1.00 . A A .  33 GLN NE2  1 1 
        4  6263 1 1  33 GLN O    O   9.128   8.770  -6.081 1.00 . A A .  33 GLN O    1 1 
        4  6264 1 1  33 GLN OE1  O   7.172  11.133  -9.198 1.00 . A A .  33 GLN OE1  1 1 
        4  6265 1 1  34 GLN C    C   9.964   8.070  -3.164 1.00 . A A .  34 GLN C    1 1 
        4  6266 1 1  34 GLN CA   C  10.962   8.996  -3.940 1.00 . A A .  34 GLN CA   1 1 
        4  6267 1 1  34 GLN CB   C  12.045   9.546  -2.976 1.00 . A A .  34 GLN CB   1 1 
        4  6268 1 1  34 GLN CD   C  14.416  10.488  -2.708 1.00 . A A .  34 GLN CD   1 1 
        4  6269 1 1  34 GLN CG   C  13.278  10.164  -3.671 1.00 . A A .  34 GLN CG   1 1 
        4  6270 1 1  34 GLN H    H  10.306  11.075  -4.401 1.00 . A A .  34 GLN H    1 1 
        4  6271 1 1  34 GLN HA   H  11.467   8.334  -4.672 1.00 . A A .  34 GLN HA   1 1 
        4  6272 1 1  34 GLN HB2  H  11.588  10.271  -2.275 1.00 . A A .  34 GLN HB2  1 1 
        4  6273 1 1  34 GLN HB3  H  12.393   8.711  -2.332 1.00 . A A .  34 GLN HB3  1 1 
        4  6274 1 1  34 GLN HE21 H  14.151  12.470  -2.900 1.00 . A A .  34 GLN HE21 1 1 
        4  6275 1 1  34 GLN HE22 H  15.525  11.856  -1.842 1.00 . A A .  34 GLN HE22 1 1 
        4  6276 1 1  34 GLN HG2  H  13.681   9.452  -4.416 1.00 . A A .  34 GLN HG2  1 1 
        4  6277 1 1  34 GLN HG3  H  12.988  11.056  -4.258 1.00 . A A .  34 GLN HG3  1 1 
        4  6278 1 1  34 GLN N    N  10.315  10.097  -4.699 1.00 . A A .  34 GLN N    1 1 
        4  6279 1 1  34 GLN NE2  N  14.745  11.739  -2.495 1.00 . A A .  34 GLN NE2  1 1 
        4  6280 1 1  34 GLN O    O  10.021   6.854  -3.357 1.00 . A A .  34 GLN O    1 1 
        4  6281 1 1  34 GLN OE1  O  15.048   9.605  -2.139 1.00 . A A .  34 GLN OE1  1 1 
        4  6282 1 1  35 VAL C    C   6.953   7.154  -2.778 1.00 . A A .  35 VAL C    1 1 
        4  6283 1 1  35 VAL CA   C   7.931   7.804  -1.756 1.00 . A A .  35 VAL CA   1 1 
        4  6284 1 1  35 VAL CB   C   7.267   8.583  -0.583 1.00 . A A .  35 VAL CB   1 1 
        4  6285 1 1  35 VAL CG1  C   6.360   9.755  -0.985 1.00 . A A .  35 VAL CG1  1 1 
        4  6286 1 1  35 VAL CG2  C   6.451   7.652   0.338 1.00 . A A .  35 VAL CG2  1 1 
        4  6287 1 1  35 VAL H    H   9.012   9.650  -2.342 1.00 . A A .  35 VAL H    1 1 
        4  6288 1 1  35 VAL HA   H   8.437   6.934  -1.290 1.00 . A A .  35 VAL HA   1 1 
        4  6289 1 1  35 VAL HB   H   8.090   8.998   0.039 1.00 . A A .  35 VAL HB   1 1 
        4  6290 1 1  35 VAL HG11 H   6.889  10.490  -1.610 1.00 . A A .  35 VAL HG11 1 1 
        4  6291 1 1  35 VAL HG12 H   5.470   9.436  -1.555 1.00 . A A .  35 VAL HG12 1 1 
        4  6292 1 1  35 VAL HG13 H   6.001  10.301  -0.096 1.00 . A A .  35 VAL HG13 1 1 
        4  6293 1 1  35 VAL HG21 H   7.046   6.787   0.681 1.00 . A A .  35 VAL HG21 1 1 
        4  6294 1 1  35 VAL HG22 H   6.102   8.181   1.245 1.00 . A A .  35 VAL HG22 1 1 
        4  6295 1 1  35 VAL HG23 H   5.556   7.258  -0.178 1.00 . A A .  35 VAL HG23 1 1 
        4  6296 1 1  35 VAL N    N   9.031   8.620  -2.360 1.00 . A A .  35 VAL N    1 1 
        4  6297 1 1  35 VAL O    O   6.671   5.961  -2.647 1.00 . A A .  35 VAL O    1 1 
        4  6298 1 1  36 SER C    C   6.350   6.189  -5.752 1.00 . A A .  36 SER C    1 1 
        4  6299 1 1  36 SER CA   C   5.670   7.292  -4.893 1.00 . A A .  36 SER CA   1 1 
        4  6300 1 1  36 SER CB   C   5.038   8.422  -5.739 1.00 . A A .  36 SER CB   1 1 
        4  6301 1 1  36 SER H    H   6.888   8.835  -3.864 1.00 . A A .  36 SER H    1 1 
        4  6302 1 1  36 SER HA   H   4.816   6.780  -4.401 1.00 . A A .  36 SER HA   1 1 
        4  6303 1 1  36 SER HB2  H   4.023   8.109  -6.052 1.00 . A A .  36 SER HB2  1 1 
        4  6304 1 1  36 SER HB3  H   4.875   9.334  -5.134 1.00 . A A .  36 SER HB3  1 1 
        4  6305 1 1  36 SER HG   H   5.519   8.062  -7.568 1.00 . A A .  36 SER HG   1 1 
        4  6306 1 1  36 SER N    N   6.491   7.885  -3.806 1.00 . A A .  36 SER N    1 1 
        4  6307 1 1  36 SER O    O   5.701   5.187  -6.042 1.00 . A A .  36 SER O    1 1 
        4  6308 1 1  36 SER OG   O   5.786   8.743  -6.917 1.00 . A A .  36 SER OG   1 1 
        4  6309 1 1  37 ALA C    C   8.646   3.972  -5.937 1.00 . A A .  37 ALA C    1 1 
        4  6310 1 1  37 ALA CA   C   8.411   5.262  -6.783 1.00 . A A .  37 ALA CA   1 1 
        4  6311 1 1  37 ALA CB   C   9.738   5.882  -7.243 1.00 . A A .  37 ALA CB   1 1 
        4  6312 1 1  37 ALA H    H   8.051   7.238  -5.837 1.00 . A A .  37 ALA H    1 1 
        4  6313 1 1  37 ALA HA   H   7.858   4.947  -7.691 1.00 . A A .  37 ALA HA   1 1 
        4  6314 1 1  37 ALA HB1  H  10.364   5.157  -7.794 1.00 . A A .  37 ALA HB1  1 1 
        4  6315 1 1  37 ALA HB2  H   9.573   6.740  -7.922 1.00 . A A .  37 ALA HB2  1 1 
        4  6316 1 1  37 ALA HB3  H  10.340   6.253  -6.391 1.00 . A A .  37 ALA HB3  1 1 
        4  6317 1 1  37 ALA N    N   7.628   6.340  -6.128 1.00 . A A .  37 ALA N    1 1 
        4  6318 1 1  37 ALA O    O   8.499   2.875  -6.478 1.00 . A A .  37 ALA O    1 1 
        4  6319 1 1  38 LEU C    C   7.589   2.250  -3.442 1.00 . A A .  38 LEU C    1 1 
        4  6320 1 1  38 LEU CA   C   8.977   2.943  -3.694 1.00 . A A .  38 LEU CA   1 1 
        4  6321 1 1  38 LEU CB   C   9.640   3.376  -2.358 1.00 . A A .  38 LEU CB   1 1 
        4  6322 1 1  38 LEU CD1  C  11.978   4.045  -3.253 1.00 . A A .  38 LEU CD1  1 1 
        4  6323 1 1  38 LEU CD2  C  11.636   3.532  -0.838 1.00 . A A .  38 LEU CD2  1 1 
        4  6324 1 1  38 LEU CG   C  11.173   3.192  -2.270 1.00 . A A .  38 LEU CG   1 1 
        4  6325 1 1  38 LEU H    H   9.019   5.080  -4.320 1.00 . A A .  38 LEU H    1 1 
        4  6326 1 1  38 LEU HA   H   9.590   2.148  -4.159 1.00 . A A .  38 LEU HA   1 1 
        4  6327 1 1  38 LEU HB2  H   9.356   4.416  -2.098 1.00 . A A .  38 LEU HB2  1 1 
        4  6328 1 1  38 LEU HB3  H   9.214   2.770  -1.531 1.00 . A A .  38 LEU HB3  1 1 
        4  6329 1 1  38 LEU HD11 H  11.715   3.835  -4.305 1.00 . A A .  38 LEU HD11 1 1 
        4  6330 1 1  38 LEU HD12 H  11.827   5.127  -3.095 1.00 . A A .  38 LEU HD12 1 1 
        4  6331 1 1  38 LEU HD13 H  13.062   3.853  -3.160 1.00 . A A .  38 LEU HD13 1 1 
        4  6332 1 1  38 LEU HD21 H  12.723   3.374  -0.711 1.00 . A A .  38 LEU HD21 1 1 
        4  6333 1 1  38 LEU HD22 H  11.426   4.586  -0.576 1.00 . A A .  38 LEU HD22 1 1 
        4  6334 1 1  38 LEU HD23 H  11.136   2.899  -0.081 1.00 . A A .  38 LEU HD23 1 1 
        4  6335 1 1  38 LEU HG   H  11.409   2.122  -2.454 1.00 . A A .  38 LEU HG   1 1 
        4  6336 1 1  38 LEU N    N   8.952   4.100  -4.634 1.00 . A A .  38 LEU N    1 1 
        4  6337 1 1  38 LEU O    O   7.527   1.019  -3.408 1.00 . A A .  38 LEU O    1 1 
        4  6338 1 1  39 LEU C    C   4.586   1.912  -4.663 1.00 . A A .  39 LEU C    1 1 
        4  6339 1 1  39 LEU CA   C   5.120   2.486  -3.293 1.00 . A A .  39 LEU CA   1 1 
        4  6340 1 1  39 LEU CB   C   4.192   3.635  -2.815 1.00 . A A .  39 LEU CB   1 1 
        4  6341 1 1  39 LEU CD1  C   3.612   5.409  -1.136 1.00 . A A .  39 LEU CD1  1 1 
        4  6342 1 1  39 LEU CD2  C   3.894   3.059  -0.334 1.00 . A A .  39 LEU CD2  1 1 
        4  6343 1 1  39 LEU CG   C   4.373   4.094  -1.348 1.00 . A A .  39 LEU CG   1 1 
        4  6344 1 1  39 LEU H    H   6.696   4.033  -3.254 1.00 . A A .  39 LEU H    1 1 
        4  6345 1 1  39 LEU HA   H   5.059   1.649  -2.572 1.00 . A A .  39 LEU HA   1 1 
        4  6346 1 1  39 LEU HB2  H   4.351   4.501  -3.491 1.00 . A A .  39 LEU HB2  1 1 
        4  6347 1 1  39 LEU HB3  H   3.138   3.352  -2.980 1.00 . A A .  39 LEU HB3  1 1 
        4  6348 1 1  39 LEU HD11 H   4.020   6.219  -1.770 1.00 . A A .  39 LEU HD11 1 1 
        4  6349 1 1  39 LEU HD12 H   2.534   5.317  -1.369 1.00 . A A .  39 LEU HD12 1 1 
        4  6350 1 1  39 LEU HD13 H   3.692   5.759  -0.091 1.00 . A A .  39 LEU HD13 1 1 
        4  6351 1 1  39 LEU HD21 H   2.801   2.947  -0.332 1.00 . A A .  39 LEU HD21 1 1 
        4  6352 1 1  39 LEU HD22 H   4.321   2.060  -0.516 1.00 . A A .  39 LEU HD22 1 1 
        4  6353 1 1  39 LEU HD23 H   4.186   3.318   0.699 1.00 . A A .  39 LEU HD23 1 1 
        4  6354 1 1  39 LEU HG   H   5.446   4.298  -1.151 1.00 . A A .  39 LEU HG   1 1 
        4  6355 1 1  39 LEU N    N   6.507   3.020  -3.297 1.00 . A A .  39 LEU N    1 1 
        4  6356 1 1  39 LEU O    O   3.798   0.967  -4.652 1.00 . A A .  39 LEU O    1 1 
        4  6357 1 1  40 GLY C    C   3.525   2.963  -7.818 1.00 . A A .  40 GLY C    1 1 
        4  6358 1 1  40 GLY CA   C   4.583   2.069  -7.149 1.00 . A A .  40 GLY CA   1 1 
        4  6359 1 1  40 GLY H    H   5.589   3.322  -5.615 1.00 . A A .  40 GLY H    1 1 
        4  6360 1 1  40 GLY HA2  H   5.482   2.049  -7.793 1.00 . A A .  40 GLY HA2  1 1 
        4  6361 1 1  40 GLY HA3  H   4.223   1.022  -7.145 1.00 . A A .  40 GLY HA3  1 1 
        4  6362 1 1  40 GLY N    N   4.990   2.499  -5.794 1.00 . A A .  40 GLY N    1 1 
        4  6363 1 1  40 GLY O    O   2.404   2.508  -8.067 1.00 . A A .  40 GLY O    1 1 
        4  6364 1 1  41 THR C    C   3.721   6.559  -9.020 1.00 . A A .  41 THR C    1 1 
        4  6365 1 1  41 THR CA   C   2.906   5.272  -8.586 1.00 . A A .  41 THR CA   1 1 
        4  6366 1 1  41 THR CB   C   1.843   5.633  -7.495 1.00 . A A .  41 THR CB   1 1 
        4  6367 1 1  41 THR CG2  C   0.806   6.662  -7.913 1.00 . A A .  41 THR CG2  1 1 
        4  6368 1 1  41 THR H    H   4.711   4.546  -7.586 1.00 . A A .  41 THR H    1 1 
        4  6369 1 1  41 THR HA   H   2.391   4.857  -9.473 1.00 . A A .  41 THR HA   1 1 
        4  6370 1 1  41 THR HB   H   2.365   5.986  -6.582 1.00 . A A .  41 THR HB   1 1 
        4  6371 1 1  41 THR HG1  H   1.601   3.730  -7.514 1.00 . A A .  41 THR HG1  1 1 
        4  6372 1 1  41 THR HG21 H   0.002   6.749  -7.160 1.00 . A A .  41 THR HG21 1 1 
        4  6373 1 1  41 THR HG22 H   1.230   7.675  -8.029 1.00 . A A .  41 THR HG22 1 1 
        4  6374 1 1  41 THR HG23 H   0.319   6.387  -8.861 1.00 . A A .  41 THR HG23 1 1 
        4  6375 1 1  41 THR N    N   3.857   4.239  -8.073 1.00 . A A .  41 THR N    1 1 
        4  6376 1 1  41 THR O    O   4.659   6.937  -8.310 1.00 . A A .  41 THR O    1 1 
        4  6377 1 1  41 THR OG1  O   1.079   4.478  -7.162 1.00 . A A .  41 THR OG1  1 1 
        4  6378 1 1  42 PRO C    C   3.316   9.783  -9.451 1.00 . A A .  42 PRO C    1 1 
        4  6379 1 1  42 PRO CA   C   3.957   8.676 -10.344 1.00 . A A .  42 PRO CA   1 1 
        4  6380 1 1  42 PRO CB   C   3.658   8.872 -11.854 1.00 . A A .  42 PRO CB   1 1 
        4  6381 1 1  42 PRO CD   C   2.480   6.855 -11.180 1.00 . A A .  42 PRO CD   1 1 
        4  6382 1 1  42 PRO CG   C   2.345   8.088 -12.090 1.00 . A A .  42 PRO CG   1 1 
        4  6383 1 1  42 PRO HA   H   5.056   8.651 -10.198 1.00 . A A .  42 PRO HA   1 1 
        4  6384 1 1  42 PRO HB2  H   3.581   9.932 -12.158 1.00 . A A .  42 PRO HB2  1 1 
        4  6385 1 1  42 PRO HB3  H   4.476   8.423 -12.451 1.00 . A A .  42 PRO HB3  1 1 
        4  6386 1 1  42 PRO HD2  H   1.498   6.531 -10.792 1.00 . A A .  42 PRO HD2  1 1 
        4  6387 1 1  42 PRO HD3  H   2.931   6.000 -11.720 1.00 . A A .  42 PRO HD3  1 1 
        4  6388 1 1  42 PRO HG2  H   1.487   8.706 -11.759 1.00 . A A .  42 PRO HG2  1 1 
        4  6389 1 1  42 PRO HG3  H   2.183   7.828 -13.150 1.00 . A A .  42 PRO HG3  1 1 
        4  6390 1 1  42 PRO N    N   3.390   7.303 -10.106 1.00 . A A .  42 PRO N    1 1 
        4  6391 1 1  42 PRO O    O   2.103   9.796  -9.223 1.00 . A A .  42 PRO O    1 1 
        4  6392 1 1  43 SER C    C   3.193  13.083  -8.786 1.00 . A A .  43 SER C    1 1 
        4  6393 1 1  43 SER CA   C   3.681  11.795  -8.037 1.00 . A A .  43 SER CA   1 1 
        4  6394 1 1  43 SER CB   C   4.830  12.011  -7.005 1.00 . A A .  43 SER CB   1 1 
        4  6395 1 1  43 SER H    H   5.134  10.586  -9.171 1.00 . A A .  43 SER H    1 1 
        4  6396 1 1  43 SER HA   H   2.814  11.423  -7.458 1.00 . A A .  43 SER HA   1 1 
        4  6397 1 1  43 SER HB2  H   4.455  12.599  -6.147 1.00 . A A .  43 SER HB2  1 1 
        4  6398 1 1  43 SER HB3  H   5.143  11.054  -6.561 1.00 . A A .  43 SER HB3  1 1 
        4  6399 1 1  43 SER HG   H   6.384  12.065  -8.201 1.00 . A A .  43 SER HG   1 1 
        4  6400 1 1  43 SER N    N   4.141  10.715  -8.955 1.00 . A A .  43 SER N    1 1 
        4  6401 1 1  43 SER O    O   2.584  13.006  -9.856 1.00 . A A .  43 SER O    1 1 
        4  6402 1 1  43 SER OG   O   5.965  12.679  -7.562 1.00 . A A .  43 SER OG   1 1 
        4  6403 1 1  44 ILE C    C   4.909  16.051  -8.977 1.00 . A A .  44 ILE C    1 1 
        4  6404 1 1  44 ILE CA   C   3.409  15.561  -8.949 1.00 . A A .  44 ILE CA   1 1 
        4  6405 1 1  44 ILE CB   C   2.415  16.566  -8.270 1.00 . A A .  44 ILE CB   1 1 
        4  6406 1 1  44 ILE CD1  C   0.075  16.828  -7.210 1.00 . A A .  44 ILE CD1  1 1 
        4  6407 1 1  44 ILE CG1  C   0.970  15.998  -8.129 1.00 . A A .  44 ILE CG1  1 1 
        4  6408 1 1  44 ILE CG2  C   2.348  17.872  -9.101 1.00 . A A .  44 ILE CG2  1 1 
        4  6409 1 1  44 ILE H    H   4.117  14.146  -7.431 1.00 . A A .  44 ILE H    1 1 
        4  6410 1 1  44 ILE HA   H   3.074  15.445  -9.996 1.00 . A A .  44 ILE HA   1 1 
        4  6411 1 1  44 ILE HB   H   2.796  16.809  -7.257 1.00 . A A .  44 ILE HB   1 1 
        4  6412 1 1  44 ILE HD11 H  -0.070  17.862  -7.569 1.00 . A A .  44 ILE HD11 1 1 
        4  6413 1 1  44 ILE HD12 H  -0.921  16.371  -7.098 1.00 . A A .  44 ILE HD12 1 1 
        4  6414 1 1  44 ILE HD13 H   0.496  16.884  -6.191 1.00 . A A .  44 ILE HD13 1 1 
        4  6415 1 1  44 ILE HG12 H   0.506  15.878  -9.126 1.00 . A A .  44 ILE HG12 1 1 
        4  6416 1 1  44 ILE HG13 H   1.005  14.975  -7.706 1.00 . A A .  44 ILE HG13 1 1 
        4  6417 1 1  44 ILE HG21 H   1.901  18.702  -8.524 1.00 . A A .  44 ILE HG21 1 1 
        4  6418 1 1  44 ILE HG22 H   3.350  18.208  -9.414 1.00 . A A .  44 ILE HG22 1 1 
        4  6419 1 1  44 ILE HG23 H   1.755  17.754 -10.026 1.00 . A A .  44 ILE HG23 1 1 
        4  6420 1 1  44 ILE N    N   3.469  14.265  -8.218 1.00 . A A .  44 ILE N    1 1 
        4  6421 1 1  44 ILE O    O   5.325  16.704  -8.013 1.00 . A A .  44 ILE O    1 1 
        4  6422 1 1  45 PRO C    C   7.747  17.329 -10.373 1.00 . A A .  45 PRO C    1 1 
        4  6423 1 1  45 PRO CA   C   7.248  15.950  -9.870 1.00 . A A .  45 PRO CA   1 1 
        4  6424 1 1  45 PRO CB   C   7.796  14.727 -10.658 1.00 . A A .  45 PRO CB   1 1 
        4  6425 1 1  45 PRO CD   C   5.423  14.817 -11.109 1.00 . A A .  45 PRO CD   1 1 
        4  6426 1 1  45 PRO CG   C   6.769  14.530 -11.798 1.00 . A A .  45 PRO CG   1 1 
        4  6427 1 1  45 PRO HA   H   7.564  15.840  -8.815 1.00 . A A .  45 PRO HA   1 1 
        4  6428 1 1  45 PRO HB2  H   8.828  14.861 -11.028 1.00 . A A .  45 PRO HB2  1 1 
        4  6429 1 1  45 PRO HB3  H   7.799  13.838  -9.995 1.00 . A A .  45 PRO HB3  1 1 
        4  6430 1 1  45 PRO HD2  H   4.690  15.274 -11.798 1.00 . A A .  45 PRO HD2  1 1 
        4  6431 1 1  45 PRO HD3  H   4.992  13.871 -10.729 1.00 . A A .  45 PRO HD3  1 1 
        4  6432 1 1  45 PRO HG2  H   6.954  15.268 -12.603 1.00 . A A .  45 PRO HG2  1 1 
        4  6433 1 1  45 PRO HG3  H   6.812  13.523 -12.247 1.00 . A A .  45 PRO HG3  1 1 
        4  6434 1 1  45 PRO N    N   5.767  15.728  -9.989 1.00 . A A .  45 PRO N    1 1 
        4  6435 1 1  45 PRO O    O   8.430  17.431 -11.396 1.00 . A A .  45 PRO O    1 1 
        4  6436 1 1  46 ASP C    C   8.775  20.317  -8.671 1.00 . A A .  46 ASP C    1 1 
        4  6437 1 1  46 ASP CA   C   7.922  19.755  -9.860 1.00 . A A .  46 ASP CA   1 1 
        4  6438 1 1  46 ASP CB   C   6.773  20.680 -10.315 1.00 . A A .  46 ASP CB   1 1 
        4  6439 1 1  46 ASP CG   C   5.770  21.170  -9.290 1.00 . A A .  46 ASP CG   1 1 
        4  6440 1 1  46 ASP H    H   6.729  18.192  -8.897 1.00 . A A .  46 ASP H    1 1 
        4  6441 1 1  46 ASP HA   H   8.574  19.721 -10.751 1.00 . A A .  46 ASP HA   1 1 
        4  6442 1 1  46 ASP HB2  H   7.218  21.573 -10.792 1.00 . A A .  46 ASP HB2  1 1 
        4  6443 1 1  46 ASP HB3  H   6.218  20.191 -11.137 1.00 . A A .  46 ASP HB3  1 1 
        4  6444 1 1  46 ASP N    N   7.451  18.378  -9.595 1.00 . A A .  46 ASP N    1 1 
        4  6445 1 1  46 ASP O    O   8.390  20.142  -7.508 1.00 . A A .  46 ASP O    1 1 
        4  6446 1 1  46 ASP OD1  O   4.756  20.479  -9.053 1.00 . A A .  46 ASP OD1  1 1 
        4  6447 1 1  46 ASP OD2  O   5.988  22.262  -8.719 1.00 . A A .  46 ASP OD2  1 1 
        4  6448 1 1  47 PRO C    C   9.880  23.229  -7.464 1.00 . A A .  47 PRO C    1 1 
        4  6449 1 1  47 PRO CA   C  10.551  21.862  -7.819 1.00 . A A .  47 PRO CA   1 1 
        4  6450 1 1  47 PRO CB   C  11.968  22.057  -8.431 1.00 . A A .  47 PRO CB   1 1 
        4  6451 1 1  47 PRO CD   C  10.588  21.128 -10.196 1.00 . A A .  47 PRO CD   1 1 
        4  6452 1 1  47 PRO CG   C  11.709  22.151  -9.955 1.00 . A A .  47 PRO CG   1 1 
        4  6453 1 1  47 PRO HA   H  10.635  21.280  -6.881 1.00 . A A .  47 PRO HA   1 1 
        4  6454 1 1  47 PRO HB2  H  12.509  22.935  -8.031 1.00 . A A .  47 PRO HB2  1 1 
        4  6455 1 1  47 PRO HB3  H  12.590  21.168  -8.206 1.00 . A A .  47 PRO HB3  1 1 
        4  6456 1 1  47 PRO HD2  H   9.889  21.455 -10.989 1.00 . A A .  47 PRO HD2  1 1 
        4  6457 1 1  47 PRO HD3  H  10.985  20.133 -10.478 1.00 . A A .  47 PRO HD3  1 1 
        4  6458 1 1  47 PRO HG2  H  11.350  23.167 -10.210 1.00 . A A .  47 PRO HG2  1 1 
        4  6459 1 1  47 PRO HG3  H  12.610  21.952 -10.558 1.00 . A A .  47 PRO HG3  1 1 
        4  6460 1 1  47 PRO N    N   9.909  21.026  -8.888 1.00 . A A .  47 PRO N    1 1 
        4  6461 1 1  47 PRO O    O  10.336  23.882  -6.523 1.00 . A A .  47 PRO O    1 1 
        4  6462 1 1  48 PHE C    C   7.219  24.965  -6.736 1.00 . A A .  48 PHE C    1 1 
        4  6463 1 1  48 PHE CA   C   8.162  24.962  -7.970 1.00 . A A .  48 PHE CA   1 1 
        4  6464 1 1  48 PHE CB   C   7.506  25.361  -9.317 1.00 . A A .  48 PHE CB   1 1 
        4  6465 1 1  48 PHE CD1  C   7.727  27.894  -9.590 1.00 . A A .  48 PHE CD1  1 1 
        4  6466 1 1  48 PHE CD2  C   5.541  26.979  -9.121 1.00 . A A .  48 PHE CD2  1 1 
        4  6467 1 1  48 PHE CE1  C   7.184  29.181  -9.599 1.00 . A A .  48 PHE CE1  1 1 
        4  6468 1 1  48 PHE CE2  C   4.999  28.265  -9.129 1.00 . A A .  48 PHE CE2  1 1 
        4  6469 1 1  48 PHE CG   C   6.912  26.777  -9.347 1.00 . A A .  48 PHE CG   1 1 
        4  6470 1 1  48 PHE CZ   C   5.822  29.364  -9.369 1.00 . A A .  48 PHE CZ   1 1 
        4  6471 1 1  48 PHE H    H   8.486  22.950  -8.852 1.00 . A A .  48 PHE H    1 1 
        4  6472 1 1  48 PHE HA   H   8.948  25.719  -7.764 1.00 . A A .  48 PHE HA   1 1 
        4  6473 1 1  48 PHE HB2  H   8.261  25.280 -10.125 1.00 . A A .  48 PHE HB2  1 1 
        4  6474 1 1  48 PHE HB3  H   6.729  24.622  -9.601 1.00 . A A .  48 PHE HB3  1 1 
        4  6475 1 1  48 PHE HD1  H   8.788  27.768  -9.765 1.00 . A A .  48 PHE HD1  1 1 
        4  6476 1 1  48 PHE HD2  H   4.894  26.132  -8.924 1.00 . A A .  48 PHE HD2  1 1 
        4  6477 1 1  48 PHE HE1  H   7.824  30.035  -9.784 1.00 . A A .  48 PHE HE1  1 1 
        4  6478 1 1  48 PHE HE2  H   3.941  28.406  -8.948 1.00 . A A .  48 PHE HE2  1 1 
        4  6479 1 1  48 PHE HZ   H   5.402  30.362  -9.375 1.00 . A A .  48 PHE HZ   1 1 
        4  6480 1 1  48 PHE N    N   8.835  23.658  -8.191 1.00 . A A .  48 PHE N    1 1 
        4  6481 1 1  48 PHE O    O   7.537  25.644  -5.756 1.00 . A A .  48 PHE O    1 1 
        4  6482 1 1  49 HIS C    C   4.309  22.864  -5.671 1.00 . A A .  49 HIS C    1 1 
        4  6483 1 1  49 HIS CA   C   5.155  24.170  -5.602 1.00 . A A .  49 HIS CA   1 1 
        4  6484 1 1  49 HIS CB   C   4.311  25.465  -5.531 1.00 . A A .  49 HIS CB   1 1 
        4  6485 1 1  49 HIS CD2  C   3.530  25.031  -2.989 1.00 . A A .  49 HIS CD2  1 1 
        4  6486 1 1  49 HIS CE1  C   2.293  26.719  -2.824 1.00 . A A .  49 HIS CE1  1 1 
        4  6487 1 1  49 HIS CG   C   3.530  25.732  -4.228 1.00 . A A .  49 HIS CG   1 1 
        4  6488 1 1  49 HIS H    H   6.018  23.578  -7.565 1.00 . A A .  49 HIS H    1 1 
        4  6489 1 1  49 HIS HA   H   5.775  24.090  -4.686 1.00 . A A .  49 HIS HA   1 1 
        4  6490 1 1  49 HIS HB2  H   4.977  26.340  -5.674 1.00 . A A .  49 HIS HB2  1 1 
        4  6491 1 1  49 HIS HB3  H   3.609  25.496  -6.387 1.00 . A A .  49 HIS HB3  1 1 
        4  6492 1 1  49 HIS HD1  H   2.531  27.576  -4.806 1.00 . A A .  49 HIS HD1  1 1 
        4  6493 1 1  49 HIS HD2  H   4.081  24.123  -2.787 1.00 . A A .  49 HIS HD2  1 1 
        4  6494 1 1  49 HIS HE1  H   1.630  27.459  -2.394 1.00 . A A .  49 HIS HE1  1 1 
        4  6495 1 1  49 HIS N    N   6.072  24.259  -6.774 1.00 . A A .  49 HIS N    1 1 
        4  6496 1 1  49 HIS ND1  N   2.711  26.836  -4.119 1.00 . A A .  49 HIS ND1  1 1 
        4  6497 1 1  49 HIS NE2  N   2.721  25.665  -2.059 1.00 . A A .  49 HIS NE2  1 1 
        4  6498 1 1  49 HIS O    O   3.090  22.889  -5.877 1.00 . A A .  49 HIS O    1 1 
        4  6499 1 1  50 ALA C    C   3.577  19.938  -4.337 1.00 . A A .  50 ALA C    1 1 
        4  6500 1 1  50 ALA CA   C   4.334  20.398  -5.607 1.00 . A A .  50 ALA CA   1 1 
        4  6501 1 1  50 ALA CB   C   5.448  19.430  -5.986 1.00 . A A .  50 ALA CB   1 1 
        4  6502 1 1  50 ALA H    H   5.992  21.815  -5.420 1.00 . A A .  50 ALA H    1 1 
        4  6503 1 1  50 ALA HA   H   3.654  20.421  -6.488 1.00 . A A .  50 ALA HA   1 1 
        4  6504 1 1  50 ALA HB1  H   5.951  19.733  -6.920 1.00 . A A .  50 ALA HB1  1 1 
        4  6505 1 1  50 ALA HB2  H   6.218  19.346  -5.207 1.00 . A A .  50 ALA HB2  1 1 
        4  6506 1 1  50 ALA HB3  H   5.042  18.426  -6.162 1.00 . A A .  50 ALA HB3  1 1 
        4  6507 1 1  50 ALA N    N   4.966  21.720  -5.435 1.00 . A A .  50 ALA N    1 1 
        4  6508 1 1  50 ALA O    O   4.168  19.552  -3.322 1.00 . A A .  50 ALA O    1 1 
        4  6509 1 1  51 GLN C    C   0.783  18.305  -3.289 1.00 . A A .  51 GLN C    1 1 
        4  6510 1 1  51 GLN CA   C   1.353  19.759  -3.261 1.00 . A A .  51 GLN CA   1 1 
        4  6511 1 1  51 GLN CB   C   0.321  20.925  -3.244 1.00 . A A .  51 GLN CB   1 1 
        4  6512 1 1  51 GLN CD   C   0.011  23.446  -2.813 1.00 . A A .  51 GLN CD   1 1 
        4  6513 1 1  51 GLN CG   C   0.970  22.272  -2.832 1.00 . A A .  51 GLN CG   1 1 
        4  6514 1 1  51 GLN H    H   1.922  20.482  -5.271 1.00 . A A .  51 GLN H    1 1 
        4  6515 1 1  51 GLN HA   H   1.928  19.812  -2.315 1.00 . A A .  51 GLN HA   1 1 
        4  6516 1 1  51 GLN HB2  H  -0.180  21.015  -4.228 1.00 . A A .  51 GLN HB2  1 1 
        4  6517 1 1  51 GLN HB3  H  -0.492  20.719  -2.525 1.00 . A A .  51 GLN HB3  1 1 
        4  6518 1 1  51 GLN HE21 H   0.488  23.905  -4.689 1.00 . A A .  51 GLN HE21 1 1 
        4  6519 1 1  51 GLN HE22 H  -0.728  24.970  -3.811 1.00 . A A .  51 GLN HE22 1 1 
        4  6520 1 1  51 GLN HG2  H   1.408  22.162  -1.824 1.00 . A A .  51 GLN HG2  1 1 
        4  6521 1 1  51 GLN HG3  H   1.834  22.510  -3.481 1.00 . A A .  51 GLN HG3  1 1 
        4  6522 1 1  51 GLN N    N   2.248  20.016  -4.419 1.00 . A A .  51 GLN N    1 1 
        4  6523 1 1  51 GLN NE2  N  -0.147  24.135  -3.918 1.00 . A A .  51 GLN NE2  1 1 
        4  6524 1 1  51 GLN O    O   1.356  17.408  -3.910 1.00 . A A .  51 GLN O    1 1 
        4  6525 1 1  51 GLN OE1  O  -0.578  23.780  -1.790 1.00 . A A .  51 GLN OE1  1 1 
        4  6526 1 1  52 ARG C    C  -1.102  15.727  -3.448 1.00 . A A .  52 ARG C    1 1 
        4  6527 1 1  52 ARG CA   C  -0.805  16.688  -2.245 1.00 . A A .  52 ARG CA   1 1 
        4  6528 1 1  52 ARG CB   C  -2.029  16.858  -1.291 1.00 . A A .  52 ARG CB   1 1 
        4  6529 1 1  52 ARG CD   C  -3.636  18.370  -2.748 1.00 . A A .  52 ARG CD   1 1 
        4  6530 1 1  52 ARG CG   C  -3.417  17.099  -1.907 1.00 . A A .  52 ARG CG   1 1 
        4  6531 1 1  52 ARG CZ   C  -4.004  18.008  -5.204 1.00 . A A .  52 ARG CZ   1 1 
        4  6532 1 1  52 ARG H    H  -0.633  18.867  -2.020 1.00 . A A .  52 ARG H    1 1 
        4  6533 1 1  52 ARG HA   H  -0.012  16.214  -1.625 1.00 . A A .  52 ARG HA   1 1 
        4  6534 1 1  52 ARG HB2  H  -2.121  15.920  -0.701 1.00 . A A .  52 ARG HB2  1 1 
        4  6535 1 1  52 ARG HB3  H  -1.803  17.606  -0.506 1.00 . A A .  52 ARG HB3  1 1 
        4  6536 1 1  52 ARG HD2  H  -4.192  19.115  -2.145 1.00 . A A .  52 ARG HD2  1 1 
        4  6537 1 1  52 ARG HD3  H  -2.694  18.876  -3.009 1.00 . A A .  52 ARG HD3  1 1 
        4  6538 1 1  52 ARG HE   H  -5.292  17.395  -3.819 1.00 . A A .  52 ARG HE   1 1 
        4  6539 1 1  52 ARG HG2  H  -3.664  16.187  -2.489 1.00 . A A .  52 ARG HG2  1 1 
        4  6540 1 1  52 ARG HG3  H  -4.164  17.078  -1.089 1.00 . A A .  52 ARG HG3  1 1 
        4  6541 1 1  52 ARG HH11 H  -2.561  19.296  -4.901 1.00 . A A .  52 ARG HH11 1 1 
        4  6542 1 1  52 ARG HH12 H  -2.716  18.629  -6.600 1.00 . A A .  52 ARG HH12 1 1 
        4  6543 1 1  52 ARG HH21 H  -5.268  16.527  -5.657 1.00 . A A .  52 ARG HH21 1 1 
        4  6544 1 1  52 ARG HH22 H  -4.179  17.141  -6.992 1.00 . A A .  52 ARG HH22 1 1 
        4  6545 1 1  52 ARG N    N  -0.290  18.052  -2.533 1.00 . A A .  52 ARG N    1 1 
        4  6546 1 1  52 ARG NE   N  -4.447  18.021  -3.949 1.00 . A A .  52 ARG NE   1 1 
        4  6547 1 1  52 ARG NH1  N  -2.999  18.730  -5.625 1.00 . A A .  52 ARG NH1  1 1 
        4  6548 1 1  52 ARG NH2  N  -4.601  17.239  -6.066 1.00 . A A .  52 ARG NH2  1 1 
        4  6549 1 1  52 ARG O    O  -1.550  16.145  -4.516 1.00 . A A .  52 ARG O    1 1 
        4  6550 1 1  53 TRP C    C  -2.717  12.804  -3.497 1.00 . A A .  53 TRP C    1 1 
        4  6551 1 1  53 TRP CA   C  -1.400  13.335  -4.116 1.00 . A A .  53 TRP CA   1 1 
        4  6552 1 1  53 TRP CB   C  -0.228  12.333  -4.212 1.00 . A A .  53 TRP CB   1 1 
        4  6553 1 1  53 TRP CD1  C  -1.545  10.140  -5.111 1.00 . A A .  53 TRP CD1  1 1 
        4  6554 1 1  53 TRP CD2  C   0.532   9.801  -4.365 1.00 . A A .  53 TRP CD2  1 1 
        4  6555 1 1  53 TRP CE2  C  -0.072   8.558  -4.697 1.00 . A A .  53 TRP CE2  1 1 
        4  6556 1 1  53 TRP CE3  C   1.842   9.816  -3.772 1.00 . A A .  53 TRP CE3  1 1 
        4  6557 1 1  53 TRP CG   C  -0.401  10.828  -4.604 1.00 . A A .  53 TRP CG   1 1 
        4  6558 1 1  53 TRP CH2  C   1.872   7.384  -3.823 1.00 . A A .  53 TRP CH2  1 1 
        4  6559 1 1  53 TRP CZ2  C   0.614   7.336  -4.416 1.00 . A A .  53 TRP CZ2  1 1 
        4  6560 1 1  53 TRP CZ3  C   2.474   8.609  -3.492 1.00 . A A .  53 TRP CZ3  1 1 
        4  6561 1 1  53 TRP H    H  -0.692  14.216  -2.222 1.00 . A A .  53 TRP H    1 1 
        4  6562 1 1  53 TRP HA   H  -1.593  13.736  -5.134 1.00 . A A .  53 TRP HA   1 1 
        4  6563 1 1  53 TRP HB2  H   0.535  12.771  -4.884 1.00 . A A .  53 TRP HB2  1 1 
        4  6564 1 1  53 TRP HB3  H   0.261  12.276  -3.223 1.00 . A A .  53 TRP HB3  1 1 
        4  6565 1 1  53 TRP HD1  H  -2.496  10.600  -5.334 1.00 . A A .  53 TRP HD1  1 1 
        4  6566 1 1  53 TRP HE1  H  -2.039   8.030  -5.428 1.00 . A A .  53 TRP HE1  1 1 
        4  6567 1 1  53 TRP HE3  H   2.298  10.751  -3.478 1.00 . A A .  53 TRP HE3  1 1 
        4  6568 1 1  53 TRP HH2  H   2.386   6.460  -3.583 1.00 . A A .  53 TRP HH2  1 1 
        4  6569 1 1  53 TRP HZ2  H   0.169   6.379  -4.650 1.00 . A A .  53 TRP HZ2  1 1 
        4  6570 1 1  53 TRP HZ3  H   3.438   8.597  -2.992 1.00 . A A .  53 TRP HZ3  1 1 
        4  6571 1 1  53 TRP N    N  -0.909  14.427  -3.212 1.00 . A A .  53 TRP N    1 1 
        4  6572 1 1  53 TRP NE1  N  -1.349   8.749  -5.185 1.00 . A A .  53 TRP NE1  1 1 
        4  6573 1 1  53 TRP O    O  -2.667  12.021  -2.550 1.00 . A A .  53 TRP O    1 1 
        4  6574 1 1  54 ASP C    C  -6.083  11.992  -4.469 1.00 . A A .  54 ASP C    1 1 
        4  6575 1 1  54 ASP CA   C  -5.216  12.843  -3.488 1.00 . A A .  54 ASP CA   1 1 
        4  6576 1 1  54 ASP CB   C  -5.906  14.126  -2.973 1.00 . A A .  54 ASP CB   1 1 
        4  6577 1 1  54 ASP CG   C  -6.180  15.283  -3.922 1.00 . A A .  54 ASP CG   1 1 
        4  6578 1 1  54 ASP H    H  -3.820  14.049  -4.637 1.00 . A A .  54 ASP H    1 1 
        4  6579 1 1  54 ASP HA   H  -5.103  12.209  -2.589 1.00 . A A .  54 ASP HA   1 1 
        4  6580 1 1  54 ASP HB2  H  -6.867  13.853  -2.509 1.00 . A A .  54 ASP HB2  1 1 
        4  6581 1 1  54 ASP HB3  H  -5.294  14.524  -2.144 1.00 . A A .  54 ASP HB3  1 1 
        4  6582 1 1  54 ASP N    N  -3.874  13.233  -4.019 1.00 . A A .  54 ASP N    1 1 
        4  6583 1 1  54 ASP O    O  -7.264  12.269  -4.697 1.00 . A A .  54 ASP O    1 1 
        4  6584 1 1  54 ASP OD1  O  -5.989  15.173  -5.150 1.00 . A A .  54 ASP OD1  1 1 
        4  6585 1 1  54 ASP OD2  O  -6.491  16.385  -3.425 1.00 . A A .  54 ASP OD2  1 1 
        4  6586 1 1  55 TYR C    C  -6.515   8.874  -6.086 1.00 . A A .  55 TYR C    1 1 
        4  6587 1 1  55 TYR CA   C  -6.022  10.336  -6.299 1.00 . A A .  55 TYR CA   1 1 
        4  6588 1 1  55 TYR CB   C  -4.950  10.429  -7.426 1.00 . A A .  55 TYR CB   1 1 
        4  6589 1 1  55 TYR CD1  C  -5.347  12.919  -8.017 1.00 . A A .  55 TYR CD1  1 1 
        4  6590 1 1  55 TYR CD2  C  -3.079  12.151  -7.744 1.00 . A A .  55 TYR CD2  1 1 
        4  6591 1 1  55 TYR CE1  C  -4.883  14.223  -8.206 1.00 . A A .  55 TYR CE1  1 1 
        4  6592 1 1  55 TYR CE2  C  -2.616  13.458  -7.934 1.00 . A A .  55 TYR CE2  1 1 
        4  6593 1 1  55 TYR CG   C  -4.451  11.864  -7.758 1.00 . A A .  55 TYR CG   1 1 
        4  6594 1 1  55 TYR CZ   C  -3.520  14.493  -8.159 1.00 . A A .  55 TYR CZ   1 1 
        4  6595 1 1  55 TYR H    H  -4.504  10.866  -4.788 1.00 . A A .  55 TYR H    1 1 
        4  6596 1 1  55 TYR HA   H  -6.886  10.934  -6.662 1.00 . A A .  55 TYR HA   1 1 
        4  6597 1 1  55 TYR HB2  H  -4.092   9.775  -7.176 1.00 . A A .  55 TYR HB2  1 1 
        4  6598 1 1  55 TYR HB3  H  -5.369   9.999  -8.357 1.00 . A A .  55 TYR HB3  1 1 
        4  6599 1 1  55 TYR HD1  H  -6.416  12.746  -8.028 1.00 . A A .  55 TYR HD1  1 1 
        4  6600 1 1  55 TYR HD2  H  -2.352  11.368  -7.573 1.00 . A A .  55 TYR HD2  1 1 
        4  6601 1 1  55 TYR HE1  H  -5.594  15.023  -8.371 1.00 . A A .  55 TYR HE1  1 1 
        4  6602 1 1  55 TYR HE2  H  -1.552  13.644  -7.881 1.00 . A A .  55 TYR HE2  1 1 
        4  6603 1 1  55 TYR HH   H  -2.146  15.726  -8.579 1.00 . A A .  55 TYR HH   1 1 
        4  6604 1 1  55 TYR N    N  -5.496  10.925  -5.038 1.00 . A A .  55 TYR N    1 1 
        4  6605 1 1  55 TYR O    O  -5.740   7.980  -5.728 1.00 . A A .  55 TYR O    1 1 
        4  6606 1 1  55 TYR OH   O  -3.076  15.770  -8.341 1.00 . A A .  55 TYR OH   1 1 
        4  6607 1 1  56 THR C    C  -8.169   6.375  -7.357 1.00 . A A .  56 THR C    1 1 
        4  6608 1 1  56 THR CA   C  -8.463   7.317  -6.146 1.00 . A A .  56 THR CA   1 1 
        4  6609 1 1  56 THR CB   C  -9.999   7.531  -5.940 1.00 . A A .  56 THR CB   1 1 
        4  6610 1 1  56 THR CG2  C -10.745   6.262  -5.535 1.00 . A A .  56 THR CG2  1 1 
        4  6611 1 1  56 THR H    H  -8.381   9.492  -6.458 1.00 . A A .  56 THR H    1 1 
        4  6612 1 1  56 THR HA   H  -8.073   6.862  -5.212 1.00 . A A .  56 THR HA   1 1 
        4  6613 1 1  56 THR HB   H -10.441   7.923  -6.879 1.00 . A A .  56 THR HB   1 1 
        4  6614 1 1  56 THR HG1  H  -9.896   8.101  -4.077 1.00 . A A .  56 THR HG1  1 1 
        4  6615 1 1  56 THR HG21 H -11.825   6.467  -5.409 1.00 . A A .  56 THR HG21 1 1 
        4  6616 1 1  56 THR HG22 H -10.660   5.459  -6.288 1.00 . A A .  56 THR HG22 1 1 
        4  6617 1 1  56 THR HG23 H -10.386   5.846  -4.577 1.00 . A A .  56 THR HG23 1 1 
        4  6618 1 1  56 THR N    N  -7.814   8.645  -6.338 1.00 . A A .  56 THR N    1 1 
        4  6619 1 1  56 THR O    O  -8.771   6.495  -8.428 1.00 . A A .  56 THR O    1 1 
        4  6620 1 1  56 THR OG1  O -10.261   8.478  -4.906 1.00 . A A .  56 THR OG1  1 1 
        4  6621 1 1  57 SER C    C  -6.756   3.071  -7.904 1.00 . A A .  57 SER C    1 1 
        4  6622 1 1  57 SER CA   C  -6.688   4.587  -8.240 1.00 . A A .  57 SER CA   1 1 
        4  6623 1 1  57 SER CB   C  -5.229   5.068  -8.486 1.00 . A A .  57 SER CB   1 1 
        4  6624 1 1  57 SER H    H  -6.679   5.589  -6.300 1.00 . A A .  57 SER H    1 1 
        4  6625 1 1  57 SER HA   H  -7.249   4.758  -9.182 1.00 . A A .  57 SER HA   1 1 
        4  6626 1 1  57 SER HB2  H  -4.843   4.616  -9.414 1.00 . A A .  57 SER HB2  1 1 
        4  6627 1 1  57 SER HB3  H  -5.224   6.163  -8.661 1.00 . A A .  57 SER HB3  1 1 
        4  6628 1 1  57 SER HG   H  -4.765   4.987  -6.577 1.00 . A A .  57 SER HG   1 1 
        4  6629 1 1  57 SER N    N  -7.223   5.452  -7.160 1.00 . A A .  57 SER N    1 1 
        4  6630 1 1  57 SER O    O  -6.803   2.672  -6.736 1.00 . A A .  57 SER O    1 1 
        4  6631 1 1  57 SER OG   O  -4.331   4.756  -7.420 1.00 . A A .  57 SER OG   1 1 
        4  6632 1 1  58 THR C    C  -5.929   0.048  -9.976 1.00 . A A .  58 THR C    1 1 
        4  6633 1 1  58 THR CA   C  -6.560   0.741  -8.736 1.00 . A A .  58 THR CA   1 1 
        4  6634 1 1  58 THR CB   C  -7.867   0.024  -8.278 1.00 . A A .  58 THR CB   1 1 
        4  6635 1 1  58 THR CG2  C  -9.009  -0.050  -9.282 1.00 . A A .  58 THR CG2  1 1 
        4  6636 1 1  58 THR H    H  -6.690   2.637  -9.862 1.00 . A A .  58 THR H    1 1 
        4  6637 1 1  58 THR HA   H  -5.847   0.616  -7.893 1.00 . A A .  58 THR HA   1 1 
        4  6638 1 1  58 THR HB   H  -8.240   0.560  -7.381 1.00 . A A .  58 THR HB   1 1 
        4  6639 1 1  58 THR HG1  H  -7.205  -1.798  -8.613 1.00 . A A .  58 THR HG1  1 1 
        4  6640 1 1  58 THR HG21 H  -8.729  -0.579 -10.207 1.00 . A A .  58 THR HG21 1 1 
        4  6641 1 1  58 THR HG22 H  -9.873  -0.585  -8.847 1.00 . A A .  58 THR HG22 1 1 
        4  6642 1 1  58 THR HG23 H  -9.365   0.953  -9.575 1.00 . A A .  58 THR HG23 1 1 
        4  6643 1 1  58 THR N    N  -6.731   2.208  -8.935 1.00 . A A .  58 THR N    1 1 
        4  6644 1 1  58 THR O    O  -6.313   0.295 -11.128 1.00 . A A .  58 THR O    1 1 
        4  6645 1 1  58 THR OG1  O  -7.571  -1.309  -7.861 1.00 . A A .  58 THR OG1  1 1 
        4  6646 1 1  59 GLN C    C  -5.983  -3.083 -10.546 1.00 . A A .  59 GLN C    1 1 
        4  6647 1 1  59 GLN CA   C  -4.803  -2.055 -10.637 1.00 . A A .  59 GLN CA   1 1 
        4  6648 1 1  59 GLN CB   C  -3.457  -2.719 -10.266 1.00 . A A .  59 GLN CB   1 1 
        4  6649 1 1  59 GLN CD   C  -1.877  -0.637 -10.267 1.00 . A A .  59 GLN CD   1 1 
        4  6650 1 1  59 GLN CG   C  -2.182  -2.028 -10.798 1.00 . A A .  59 GLN CG   1 1 
        4  6651 1 1  59 GLN H    H  -4.892  -1.075  -8.688 1.00 . A A .  59 GLN H    1 1 
        4  6652 1 1  59 GLN HA   H  -4.732  -1.671 -11.673 1.00 . A A .  59 GLN HA   1 1 
        4  6653 1 1  59 GLN HB2  H  -3.381  -2.863  -9.170 1.00 . A A .  59 GLN HB2  1 1 
        4  6654 1 1  59 GLN HB3  H  -3.433  -3.747 -10.682 1.00 . A A .  59 GLN HB3  1 1 
        4  6655 1 1  59 GLN HE21 H  -2.295   0.187 -12.038 1.00 . A A .  59 GLN HE21 1 1 
        4  6656 1 1  59 GLN HE22 H  -1.798   1.296 -10.657 1.00 . A A .  59 GLN HE22 1 1 
        4  6657 1 1  59 GLN HG2  H  -1.322  -2.670 -10.529 1.00 . A A .  59 GLN HG2  1 1 
        4  6658 1 1  59 GLN HG3  H  -2.188  -2.041 -11.905 1.00 . A A .  59 GLN HG3  1 1 
        4  6659 1 1  59 GLN N    N  -5.066  -0.935  -9.700 1.00 . A A .  59 GLN N    1 1 
        4  6660 1 1  59 GLN NE2  N  -1.982   0.385 -11.084 1.00 . A A .  59 GLN NE2  1 1 
        4  6661 1 1  59 GLN O    O  -6.556  -3.303  -9.469 1.00 . A A .  59 GLN O    1 1 
        4  6662 1 1  59 GLN OE1  O  -1.528  -0.439  -9.108 1.00 . A A .  59 GLN OE1  1 1 
        4  6663 1 1  60 ARG C    C  -7.391  -5.815 -12.587 1.00 . A A .  60 ARG C    1 1 
        4  6664 1 1  60 ARG CA   C  -7.601  -4.487 -11.807 1.00 . A A .  60 ARG CA   1 1 
        4  6665 1 1  60 ARG CB   C  -8.744  -3.570 -12.312 1.00 . A A .  60 ARG CB   1 1 
        4  6666 1 1  60 ARG CD   C  -9.380  -1.654 -13.922 1.00 . A A .  60 ARG CD   1 1 
        4  6667 1 1  60 ARG CG   C  -8.613  -2.973 -13.727 1.00 . A A .  60 ARG CG   1 1 
        4  6668 1 1  60 ARG CZ   C  -9.041   0.740 -13.272 1.00 . A A .  60 ARG CZ   1 1 
        4  6669 1 1  60 ARG H    H  -5.863  -3.338 -12.519 1.00 . A A .  60 ARG H    1 1 
        4  6670 1 1  60 ARG HA   H  -7.939  -4.808 -10.797 1.00 . A A .  60 ARG HA   1 1 
        4  6671 1 1  60 ARG HB2  H  -9.696  -4.131 -12.247 1.00 . A A .  60 ARG HB2  1 1 
        4  6672 1 1  60 ARG HB3  H  -8.852  -2.767 -11.556 1.00 . A A .  60 ARG HB3  1 1 
        4  6673 1 1  60 ARG HD2  H  -9.446  -1.450 -15.012 1.00 . A A .  60 ARG HD2  1 1 
        4  6674 1 1  60 ARG HD3  H -10.424  -1.757 -13.558 1.00 . A A .  60 ARG HD3  1 1 
        4  6675 1 1  60 ARG HE   H  -7.839  -0.703 -12.669 1.00 . A A .  60 ARG HE   1 1 
        4  6676 1 1  60 ARG HG2  H  -7.555  -2.829 -14.021 1.00 . A A .  60 ARG HG2  1 1 
        4  6677 1 1  60 ARG HG3  H  -8.987  -3.721 -14.456 1.00 . A A .  60 ARG HG3  1 1 
        4  6678 1 1  60 ARG HH11 H -10.607   0.458 -14.422 1.00 . A A .  60 ARG HH11 1 1 
        4  6679 1 1  60 ARG HH12 H -10.290   2.183 -13.904 1.00 . A A .  60 ARG HH12 1 1 
        4  6680 1 1  60 ARG HH21 H  -7.516   1.202 -12.092 1.00 . A A .  60 ARG HH21 1 1 
        4  6681 1 1  60 ARG HH22 H  -8.596   2.578 -12.649 1.00 . A A .  60 ARG HH22 1 1 
        4  6682 1 1  60 ARG N    N  -6.362  -3.662 -11.688 1.00 . A A .  60 ARG N    1 1 
        4  6683 1 1  60 ARG NE   N  -8.678  -0.536 -13.236 1.00 . A A .  60 ARG NE   1 1 
        4  6684 1 1  60 ARG NH1  N -10.083   1.183 -13.930 1.00 . A A .  60 ARG NH1  1 1 
        4  6685 1 1  60 ARG NH2  N  -8.318   1.596 -12.615 1.00 . A A .  60 ARG NH2  1 1 
        4  6686 1 1  60 ARG O    O  -7.951  -6.025 -13.665 1.00 . A A .  60 ARG O    1 1 
        4  6687 1 1  61 VAL C    C  -7.639  -9.048 -11.853 1.00 . A A .  61 VAL C    1 1 
        4  6688 1 1  61 VAL CA   C  -6.512  -8.152 -12.447 1.00 . A A .  61 VAL CA   1 1 
        4  6689 1 1  61 VAL CB   C  -5.038  -8.623 -12.276 1.00 . A A .  61 VAL CB   1 1 
        4  6690 1 1  61 VAL CG1  C  -4.526  -8.852 -10.848 1.00 . A A .  61 VAL CG1  1 1 
        4  6691 1 1  61 VAL CG2  C  -4.755  -9.882 -13.117 1.00 . A A .  61 VAL CG2  1 1 
        4  6692 1 1  61 VAL H    H  -6.110  -6.425 -11.164 1.00 . A A .  61 VAL H    1 1 
        4  6693 1 1  61 VAL HA   H  -6.687  -8.145 -13.539 1.00 . A A .  61 VAL HA   1 1 
        4  6694 1 1  61 VAL HB   H  -4.409  -7.816 -12.712 1.00 . A A .  61 VAL HB   1 1 
        4  6695 1 1  61 VAL HG11 H  -4.997  -9.721 -10.353 1.00 . A A .  61 VAL HG11 1 1 
        4  6696 1 1  61 VAL HG12 H  -3.437  -9.042 -10.845 1.00 . A A .  61 VAL HG12 1 1 
        4  6697 1 1  61 VAL HG13 H  -4.690  -7.980 -10.190 1.00 . A A .  61 VAL HG13 1 1 
        4  6698 1 1  61 VAL HG21 H  -3.684 -10.154 -13.102 1.00 . A A .  61 VAL HG21 1 1 
        4  6699 1 1  61 VAL HG22 H  -5.325 -10.764 -12.768 1.00 . A A .  61 VAL HG22 1 1 
        4  6700 1 1  61 VAL HG23 H  -5.028  -9.710 -14.172 1.00 . A A .  61 VAL HG23 1 1 
        4  6701 1 1  61 VAL N    N  -6.615  -6.735 -11.996 1.00 . A A .  61 VAL N    1 1 
        4  6702 1 1  61 VAL O    O  -8.451  -9.585 -12.611 1.00 . A A .  61 VAL O    1 1 
        4  6703 1 1  62 ASP C    C  -9.945  -8.233  -9.677 1.00 . A A .  62 ASP C    1 1 
        4  6704 1 1  62 ASP CA   C  -9.004  -9.497  -9.827 1.00 . A A .  62 ASP CA   1 1 
        4  6705 1 1  62 ASP CB   C  -8.585 -10.181  -8.493 1.00 . A A .  62 ASP CB   1 1 
        4  6706 1 1  62 ASP CG   C  -9.703 -10.939  -7.787 1.00 . A A .  62 ASP CG   1 1 
        4  6707 1 1  62 ASP H    H  -6.985  -8.637 -10.035 1.00 . A A .  62 ASP H    1 1 
        4  6708 1 1  62 ASP HA   H  -9.546 -10.241 -10.443 1.00 . A A .  62 ASP HA   1 1 
        4  6709 1 1  62 ASP HB2  H  -7.775 -10.913  -8.680 1.00 . A A .  62 ASP HB2  1 1 
        4  6710 1 1  62 ASP HB3  H  -8.158  -9.442  -7.793 1.00 . A A .  62 ASP HB3  1 1 
        4  6711 1 1  62 ASP N    N  -7.735  -9.142 -10.516 1.00 . A A .  62 ASP N    1 1 
        4  6712 1 1  62 ASP O    O  -9.673  -7.133 -10.169 1.00 . A A .  62 ASP O    1 1 
        4  6713 1 1  62 ASP OD1  O -10.018 -12.082  -8.182 1.00 . A A .  62 ASP OD1  1 1 
        4  6714 1 1  62 ASP OD2  O -10.377 -10.348  -6.915 1.00 . A A .  62 ASP OD2  1 1 
        4  6715 1 1  63 ARG C    C -11.497  -6.766  -7.119 1.00 . A A .  63 ARG C    1 1 
        4  6716 1 1  63 ARG CA   C -11.946  -7.330  -8.522 1.00 . A A .  63 ARG CA   1 1 
        4  6717 1 1  63 ARG CB   C -13.426  -7.802  -8.454 1.00 . A A .  63 ARG CB   1 1 
        4  6718 1 1  63 ARG CD   C -14.668  -9.597  -9.890 1.00 . A A .  63 ARG CD   1 1 
        4  6719 1 1  63 ARG CG   C -14.096  -8.167  -9.796 1.00 . A A .  63 ARG CG   1 1 
        4  6720 1 1  63 ARG CZ   C -12.828 -11.279  -9.613 1.00 . A A .  63 ARG CZ   1 1 
        4  6721 1 1  63 ARG H    H -11.012  -9.314  -8.465 1.00 . A A .  63 ARG H    1 1 
        4  6722 1 1  63 ARG HA   H -11.899  -6.477  -9.227 1.00 . A A .  63 ARG HA   1 1 
        4  6723 1 1  63 ARG HB2  H -13.515  -8.622  -7.720 1.00 . A A .  63 ARG HB2  1 1 
        4  6724 1 1  63 ARG HB3  H -14.020  -6.980  -8.002 1.00 . A A .  63 ARG HB3  1 1 
        4  6725 1 1  63 ARG HD2  H -15.174  -9.912  -8.956 1.00 . A A .  63 ARG HD2  1 1 
        4  6726 1 1  63 ARG HD3  H -15.494  -9.576 -10.631 1.00 . A A .  63 ARG HD3  1 1 
        4  6727 1 1  63 ARG HE   H -13.456 -10.671 -11.372 1.00 . A A .  63 ARG HE   1 1 
        4  6728 1 1  63 ARG HG2  H -14.937  -7.460  -9.952 1.00 . A A .  63 ARG HG2  1 1 
        4  6729 1 1  63 ARG HG3  H -13.429  -7.962 -10.657 1.00 . A A .  63 ARG HG3  1 1 
        4  6730 1 1  63 ARG HH11 H -13.639 -10.783  -7.889 1.00 . A A .  63 ARG HH11 1 1 
        4  6731 1 1  63 ARG HH12 H -12.046 -11.708  -7.839 1.00 . A A .  63 ARG HH12 1 1 
        4  6732 1 1  63 ARG HH21 H -11.751 -11.854 -11.197 1.00 . A A .  63 ARG HH21 1 1 
        4  6733 1 1  63 ARG HH22 H -11.116 -12.233  -9.510 1.00 . A A .  63 ARG HH22 1 1 
        4  6734 1 1  63 ARG N    N -11.077  -8.434  -9.000 1.00 . A A .  63 ARG N    1 1 
        4  6735 1 1  63 ARG NE   N -13.672 -10.591 -10.375 1.00 . A A .  63 ARG NE   1 1 
        4  6736 1 1  63 ARG NH1  N -12.889 -11.331  -8.307 1.00 . A A .  63 ARG NH1  1 1 
        4  6737 1 1  63 ARG NH2  N -11.853 -11.920 -10.184 1.00 . A A .  63 ARG NH2  1 1 
        4  6738 1 1  63 ARG O    O -11.437  -5.547  -6.960 1.00 . A A .  63 ARG O    1 1 
        4  6739 1 1  64 LEU C    C  -9.878  -8.156  -3.973 1.00 . A A .  64 LEU C    1 1 
        4  6740 1 1  64 LEU CA   C -10.887  -7.238  -4.740 1.00 . A A .  64 LEU CA   1 1 
        4  6741 1 1  64 LEU CB   C -12.169  -6.931  -3.925 1.00 . A A .  64 LEU CB   1 1 
        4  6742 1 1  64 LEU CD1  C -13.732  -8.893  -4.606 1.00 . A A .  64 LEU CD1  1 1 
        4  6743 1 1  64 LEU CD2  C -12.682  -8.887  -2.330 1.00 . A A .  64 LEU CD2  1 1 
        4  6744 1 1  64 LEU CG   C -13.171  -8.014  -3.489 1.00 . A A .  64 LEU CG   1 1 
        4  6745 1 1  64 LEU H    H -11.276  -8.626  -6.400 1.00 . A A .  64 LEU H    1 1 
        4  6746 1 1  64 LEU HA   H -10.352  -6.268  -4.800 1.00 . A A .  64 LEU HA   1 1 
        4  6747 1 1  64 LEU HB2  H -11.859  -6.375  -3.017 1.00 . A A .  64 LEU HB2  1 1 
        4  6748 1 1  64 LEU HB3  H -12.739  -6.167  -4.492 1.00 . A A .  64 LEU HB3  1 1 
        4  6749 1 1  64 LEU HD11 H -12.971  -9.566  -5.041 1.00 . A A .  64 LEU HD11 1 1 
        4  6750 1 1  64 LEU HD12 H -14.553  -9.533  -4.235 1.00 . A A .  64 LEU HD12 1 1 
        4  6751 1 1  64 LEU HD13 H -14.150  -8.286  -5.429 1.00 . A A .  64 LEU HD13 1 1 
        4  6752 1 1  64 LEU HD21 H -12.263  -8.286  -1.502 1.00 . A A .  64 LEU HD21 1 1 
        4  6753 1 1  64 LEU HD22 H -13.509  -9.482  -1.902 1.00 . A A .  64 LEU HD22 1 1 
        4  6754 1 1  64 LEU HD23 H -11.903  -9.605  -2.637 1.00 . A A .  64 LEU HD23 1 1 
        4  6755 1 1  64 LEU HG   H -14.032  -7.435  -3.099 1.00 . A A .  64 LEU HG   1 1 
        4  6756 1 1  64 LEU N    N -11.224  -7.637  -6.129 1.00 . A A .  64 LEU N    1 1 
        4  6757 1 1  64 LEU O    O  -9.273  -7.671  -3.014 1.00 . A A .  64 LEU O    1 1 
        4  6758 1 1  65 ALA C    C  -7.382 -10.413  -3.796 1.00 . A A .  65 ALA C    1 1 
        4  6759 1 1  65 ALA CA   C  -8.913 -10.408  -3.525 1.00 . A A .  65 ALA CA   1 1 
        4  6760 1 1  65 ALA CB   C  -9.541 -11.795  -3.746 1.00 . A A .  65 ALA CB   1 1 
        4  6761 1 1  65 ALA H    H -10.125  -9.724  -5.235 1.00 . A A .  65 ALA H    1 1 
        4  6762 1 1  65 ALA HA   H  -9.043 -10.174  -2.449 1.00 . A A .  65 ALA HA   1 1 
        4  6763 1 1  65 ALA HB1  H -10.611 -11.805  -3.466 1.00 . A A .  65 ALA HB1  1 1 
        4  6764 1 1  65 ALA HB2  H  -9.477 -12.128  -4.799 1.00 . A A .  65 ALA HB2  1 1 
        4  6765 1 1  65 ALA HB3  H  -9.047 -12.566  -3.128 1.00 . A A .  65 ALA HB3  1 1 
        4  6766 1 1  65 ALA N    N  -9.713  -9.445  -4.325 1.00 . A A .  65 ALA N    1 1 
        4  6767 1 1  65 ALA O    O  -6.606 -10.425  -2.838 1.00 . A A .  65 ALA O    1 1 
        4  6768 1 1  66 ARG C    C  -5.426  -9.099  -6.532 1.00 . A A .  66 ARG C    1 1 
        4  6769 1 1  66 ARG CA   C  -5.533 -10.225  -5.448 1.00 . A A .  66 ARG CA   1 1 
        4  6770 1 1  66 ARG CB   C  -4.931 -11.570  -5.937 1.00 . A A .  66 ARG CB   1 1 
        4  6771 1 1  66 ARG CD   C  -4.047 -13.883  -5.368 1.00 . A A .  66 ARG CD   1 1 
        4  6772 1 1  66 ARG CG   C  -4.556 -12.547  -4.803 1.00 . A A .  66 ARG CG   1 1 
        4  6773 1 1  66 ARG CZ   C  -2.220 -14.862  -3.956 1.00 . A A .  66 ARG CZ   1 1 
        4  6774 1 1  66 ARG H    H  -7.725 -10.316  -5.743 1.00 . A A .  66 ARG H    1 1 
        4  6775 1 1  66 ARG HA   H  -4.934  -9.867  -4.585 1.00 . A A .  66 ARG HA   1 1 
        4  6776 1 1  66 ARG HB2  H  -5.624 -12.049  -6.659 1.00 . A A .  66 ARG HB2  1 1 
        4  6777 1 1  66 ARG HB3  H  -4.013 -11.364  -6.523 1.00 . A A .  66 ARG HB3  1 1 
        4  6778 1 1  66 ARG HD2  H  -4.888 -14.411  -5.864 1.00 . A A .  66 ARG HD2  1 1 
        4  6779 1 1  66 ARG HD3  H  -3.313 -13.731  -6.185 1.00 . A A .  66 ARG HD3  1 1 
        4  6780 1 1  66 ARG HE   H  -4.112 -15.383  -3.761 1.00 . A A .  66 ARG HE   1 1 
        4  6781 1 1  66 ARG HG2  H  -3.790 -12.078  -4.153 1.00 . A A .  66 ARG HG2  1 1 
        4  6782 1 1  66 ARG HG3  H  -5.428 -12.731  -4.144 1.00 . A A .  66 ARG HG3  1 1 
        4  6783 1 1  66 ARG HH11 H  -1.573 -13.438  -5.153 1.00 . A A .  66 ARG HH11 1 1 
        4  6784 1 1  66 ARG HH12 H  -0.278 -14.274  -4.119 1.00 . A A .  66 ARG HH12 1 1 
        4  6785 1 1  66 ARG HH21 H  -2.621 -16.321  -2.652 1.00 . A A .  66 ARG HH21 1 1 
        4  6786 1 1  66 ARG HH22 H  -0.847 -15.850  -2.873 1.00 . A A .  66 ARG HH22 1 1 
        4  6787 1 1  66 ARG N    N  -6.957 -10.417  -5.069 1.00 . A A .  66 ARG N    1 1 
        4  6788 1 1  66 ARG NE   N  -3.506 -14.750  -4.290 1.00 . A A .  66 ARG NE   1 1 
        4  6789 1 1  66 ARG NH1  N  -1.266 -14.135  -4.478 1.00 . A A .  66 ARG NH1  1 1 
        4  6790 1 1  66 ARG NH2  N  -1.890 -15.741  -3.060 1.00 . A A .  66 ARG NH2  1 1 
        4  6791 1 1  66 ARG O    O  -5.109  -9.355  -7.697 1.00 . A A .  66 ARG O    1 1 
        4  6792 1 1  67 THR C    C  -5.198  -5.388  -6.172 1.00 . A A .  67 THR C    1 1 
        4  6793 1 1  67 THR CA   C  -5.502  -6.656  -7.013 1.00 . A A .  67 THR CA   1 1 
        4  6794 1 1  67 THR CB   C  -6.665  -6.494  -8.019 1.00 . A A .  67 THR CB   1 1 
        4  6795 1 1  67 THR CG2  C  -7.920  -5.783  -7.538 1.00 . A A .  67 THR CG2  1 1 
        4  6796 1 1  67 THR H    H  -6.045  -7.768  -5.172 1.00 . A A .  67 THR H    1 1 
        4  6797 1 1  67 THR HA   H  -4.600  -6.856  -7.625 1.00 . A A .  67 THR HA   1 1 
        4  6798 1 1  67 THR HB   H  -6.961  -7.501  -8.369 1.00 . A A .  67 THR HB   1 1 
        4  6799 1 1  67 THR HG1  H  -6.428  -4.865  -9.049 1.00 . A A .  67 THR HG1  1 1 
        4  6800 1 1  67 THR HG21 H  -8.342  -6.276  -6.645 1.00 . A A .  67 THR HG21 1 1 
        4  6801 1 1  67 THR HG22 H  -7.746  -4.726  -7.270 1.00 . A A .  67 THR HG22 1 1 
        4  6802 1 1  67 THR HG23 H  -8.706  -5.786  -8.312 1.00 . A A .  67 THR HG23 1 1 
        4  6803 1 1  67 THR N    N  -5.681  -7.846  -6.128 1.00 . A A .  67 THR N    1 1 
        4  6804 1 1  67 THR O    O  -5.773  -5.195  -5.095 1.00 . A A .  67 THR O    1 1 
        4  6805 1 1  67 THR OG1  O  -6.177  -5.802  -9.158 1.00 . A A .  67 THR OG1  1 1 
        4  6806 1 1  68 GLU C    C  -4.542  -2.089  -5.980 1.00 . A A .  68 GLU C    1 1 
        4  6807 1 1  68 GLU CA   C  -3.754  -3.421  -5.817 1.00 . A A .  68 GLU CA   1 1 
        4  6808 1 1  68 GLU CB   C  -2.237  -3.292  -6.111 1.00 . A A .  68 GLU CB   1 1 
        4  6809 1 1  68 GLU CD   C   0.007  -2.491  -5.165 1.00 . A A .  68 GLU CD   1 1 
        4  6810 1 1  68 GLU CG   C  -1.485  -2.622  -4.943 1.00 . A A .  68 GLU CG   1 1 
        4  6811 1 1  68 GLU H    H  -3.962  -4.695  -7.604 1.00 . A A .  68 GLU H    1 1 
        4  6812 1 1  68 GLU HA   H  -3.811  -3.746  -4.752 1.00 . A A .  68 GLU HA   1 1 
        4  6813 1 1  68 GLU HB2  H  -1.793  -4.299  -6.260 1.00 . A A .  68 GLU HB2  1 1 
        4  6814 1 1  68 GLU HB3  H  -2.056  -2.745  -7.057 1.00 . A A .  68 GLU HB3  1 1 
        4  6815 1 1  68 GLU HG2  H  -1.903  -1.629  -4.722 1.00 . A A .  68 GLU HG2  1 1 
        4  6816 1 1  68 GLU HG3  H  -1.629  -3.203  -4.015 1.00 . A A .  68 GLU HG3  1 1 
        4  6817 1 1  68 GLU N    N  -4.306  -4.511  -6.658 1.00 . A A .  68 GLU N    1 1 
        4  6818 1 1  68 GLU O    O  -4.357  -1.325  -6.934 1.00 . A A .  68 GLU O    1 1 
        4  6819 1 1  68 GLU OE1  O   0.450  -1.486  -5.761 1.00 . A A .  68 GLU OE1  1 1 
        4  6820 1 1  68 GLU OE2  O   0.752  -3.382  -4.707 1.00 . A A .  68 GLU OE2  1 1 
        4  6821 1 1  69 ILE C    C  -5.072   0.527  -4.220 1.00 . A A .  69 ILE C    1 1 
        4  6822 1 1  69 ILE CA   C  -6.091  -0.507  -4.825 1.00 . A A .  69 ILE CA   1 1 
        4  6823 1 1  69 ILE CB   C  -7.369  -0.689  -3.925 1.00 . A A .  69 ILE CB   1 1 
        4  6824 1 1  69 ILE CD1  C  -8.314  -3.037  -4.645 1.00 . A A .  69 ILE CD1  1 1 
        4  6825 1 1  69 ILE CG1  C  -8.521  -1.528  -4.562 1.00 . A A .  69 ILE CG1  1 1 
        4  6826 1 1  69 ILE CG2  C  -8.032   0.668  -3.540 1.00 . A A .  69 ILE CG2  1 1 
        4  6827 1 1  69 ILE H    H  -5.605  -2.615  -4.388 1.00 . A A .  69 ILE H    1 1 
        4  6828 1 1  69 ILE HA   H  -6.421  -0.144  -5.815 1.00 . A A .  69 ILE HA   1 1 
        4  6829 1 1  69 ILE HB   H  -7.076  -1.168  -2.970 1.00 . A A .  69 ILE HB   1 1 
        4  6830 1 1  69 ILE HD11 H  -9.247  -3.540  -4.960 1.00 . A A .  69 ILE HD11 1 1 
        4  6831 1 1  69 ILE HD12 H  -7.553  -3.323  -5.390 1.00 . A A .  69 ILE HD12 1 1 
        4  6832 1 1  69 ILE HD13 H  -8.018  -3.486  -3.680 1.00 . A A .  69 ILE HD13 1 1 
        4  6833 1 1  69 ILE HG12 H  -9.449  -1.385  -3.969 1.00 . A A .  69 ILE HG12 1 1 
        4  6834 1 1  69 ILE HG13 H  -8.773  -1.135  -5.566 1.00 . A A .  69 ILE HG13 1 1 
        4  6835 1 1  69 ILE HG21 H  -7.360   1.323  -2.958 1.00 . A A .  69 ILE HG21 1 1 
        4  6836 1 1  69 ILE HG22 H  -8.363   1.243  -4.426 1.00 . A A .  69 ILE HG22 1 1 
        4  6837 1 1  69 ILE HG23 H  -8.913   0.510  -2.893 1.00 . A A .  69 ILE HG23 1 1 
        4  6838 1 1  69 ILE N    N  -5.402  -1.815  -4.993 1.00 . A A .  69 ILE N    1 1 
        4  6839 1 1  69 ILE O    O  -4.314   0.209  -3.298 1.00 . A A .  69 ILE O    1 1 
        4  6840 1 1  70 LYS C    C  -5.343   4.164  -4.096 1.00 . A A .  70 LYS C    1 1 
        4  6841 1 1  70 LYS CA   C  -4.412   2.909  -4.076 1.00 . A A .  70 LYS CA   1 1 
        4  6842 1 1  70 LYS CB   C  -3.046   3.215  -4.749 1.00 . A A .  70 LYS CB   1 1 
        4  6843 1 1  70 LYS CD   C  -1.514   1.244  -5.456 1.00 . A A .  70 LYS CD   1 1 
        4  6844 1 1  70 LYS CE   C  -0.432   1.766  -6.406 1.00 . A A .  70 LYS CE   1 1 
        4  6845 1 1  70 LYS CG   C  -1.919   2.250  -4.372 1.00 . A A .  70 LYS CG   1 1 
        4  6846 1 1  70 LYS H    H  -5.790   1.932  -5.468 1.00 . A A .  70 LYS H    1 1 
        4  6847 1 1  70 LYS HA   H  -4.214   2.686  -3.006 1.00 . A A .  70 LYS HA   1 1 
        4  6848 1 1  70 LYS HB2  H  -3.163   3.289  -5.845 1.00 . A A .  70 LYS HB2  1 1 
        4  6849 1 1  70 LYS HB3  H  -2.725   4.230  -4.437 1.00 . A A .  70 LYS HB3  1 1 
        4  6850 1 1  70 LYS HD2  H  -1.128   0.357  -4.921 1.00 . A A .  70 LYS HD2  1 1 
        4  6851 1 1  70 LYS HD3  H  -2.401   0.867  -6.006 1.00 . A A .  70 LYS HD3  1 1 
        4  6852 1 1  70 LYS HE2  H  -0.831   2.574  -7.056 1.00 . A A .  70 LYS HE2  1 1 
        4  6853 1 1  70 LYS HE3  H   0.391   2.234  -5.822 1.00 . A A .  70 LYS HE3  1 1 
        4  6854 1 1  70 LYS HG2  H  -1.040   2.838  -4.048 1.00 . A A .  70 LYS HG2  1 1 
        4  6855 1 1  70 LYS HG3  H  -2.195   1.675  -3.466 1.00 . A A .  70 LYS HG3  1 1 
        4  6856 1 1  70 LYS HZ1  H   0.300  -0.231  -6.586 1.00 . A A .  70 LYS HZ1  1 1 
        4  6857 1 1  70 LYS HZ2  H  -0.556   0.250  -7.910 1.00 . A A .  70 LYS HZ2  1 1 
        4  6858 1 1  70 LYS HZ3  H   0.992   0.833  -7.686 1.00 . A A .  70 LYS HZ3  1 1 
        4  6859 1 1  70 LYS N    N  -5.096   1.767  -4.721 1.00 . A A .  70 LYS N    1 1 
        4  6860 1 1  70 LYS NZ   N   0.108   0.632  -7.201 1.00 . A A .  70 LYS NZ   1 1 
        4  6861 1 1  70 LYS O    O  -5.260   5.008  -4.997 1.00 . A A .  70 LYS O    1 1 
        4  6862 1 1  71 ASN C    C  -5.687   6.185  -1.491 1.00 . A A .  71 ASN C    1 1 
        4  6863 1 1  71 ASN CA   C  -6.642   5.670  -2.616 1.00 . A A .  71 ASN CA   1 1 
        4  6864 1 1  71 ASN CB   C  -8.121   5.541  -2.189 1.00 . A A .  71 ASN CB   1 1 
        4  6865 1 1  71 ASN CG   C  -8.808   6.867  -1.898 1.00 . A A .  71 ASN CG   1 1 
        4  6866 1 1  71 ASN H    H  -6.216   3.516  -2.403 1.00 . A A .  71 ASN H    1 1 
        4  6867 1 1  71 ASN HA   H  -6.606   6.384  -3.469 1.00 . A A .  71 ASN HA   1 1 
        4  6868 1 1  71 ASN HB2  H  -8.688   5.051  -3.003 1.00 . A A .  71 ASN HB2  1 1 
        4  6869 1 1  71 ASN HB3  H  -8.231   4.858  -1.327 1.00 . A A .  71 ASN HB3  1 1 
        4  6870 1 1  71 ASN HD21 H  -8.331   6.757   0.033 1.00 . A A .  71 ASN HD21 1 1 
        4  6871 1 1  71 ASN HD22 H  -9.302   8.210  -0.544 1.00 . A A .  71 ASN HD22 1 1 
        4  6872 1 1  71 ASN N    N  -6.164   4.322  -3.047 1.00 . A A .  71 ASN N    1 1 
        4  6873 1 1  71 ASN ND2  N  -8.870   7.290  -0.658 1.00 . A A .  71 ASN ND2  1 1 
        4  6874 1 1  71 ASN O    O  -5.981   6.079  -0.297 1.00 . A A .  71 ASN O    1 1 
        4  6875 1 1  71 ASN OD1  O  -9.292   7.550  -2.793 1.00 . A A .  71 ASN OD1  1 1 
        4  6876 1 1  72 PHE C    C  -3.404   8.685  -0.931 1.00 . A A .  72 PHE C    1 1 
        4  6877 1 1  72 PHE CA   C  -3.460   7.143  -0.958 1.00 . A A .  72 PHE CA   1 1 
        4  6878 1 1  72 PHE CB   C  -2.157   6.448  -1.424 1.00 . A A .  72 PHE CB   1 1 
        4  6879 1 1  72 PHE CD1  C  -0.955   5.734   0.713 1.00 . A A .  72 PHE CD1  1 1 
        4  6880 1 1  72 PHE CD2  C   0.095   7.397  -0.679 1.00 . A A .  72 PHE CD2  1 1 
        4  6881 1 1  72 PHE CE1  C   0.137   5.767   1.581 1.00 . A A .  72 PHE CE1  1 1 
        4  6882 1 1  72 PHE CE2  C   1.192   7.426   0.185 1.00 . A A .  72 PHE CE2  1 1 
        4  6883 1 1  72 PHE CG   C  -0.987   6.542  -0.432 1.00 . A A .  72 PHE CG   1 1 
        4  6884 1 1  72 PHE CZ   C   1.216   6.602   1.306 1.00 . A A .  72 PHE CZ   1 1 
        4  6885 1 1  72 PHE H    H  -4.421   6.777  -2.919 1.00 . A A .  72 PHE H    1 1 
        4  6886 1 1  72 PHE HA   H  -3.682   6.778   0.064 1.00 . A A .  72 PHE HA   1 1 
        4  6887 1 1  72 PHE HB2  H  -2.358   5.371  -1.600 1.00 . A A .  72 PHE HB2  1 1 
        4  6888 1 1  72 PHE HB3  H  -1.849   6.835  -2.416 1.00 . A A .  72 PHE HB3  1 1 
        4  6889 1 1  72 PHE HD1  H  -1.777   5.064   0.925 1.00 . A A .  72 PHE HD1  1 1 
        4  6890 1 1  72 PHE HD2  H   0.089   8.040  -1.550 1.00 . A A .  72 PHE HD2  1 1 
        4  6891 1 1  72 PHE HE1  H   0.142   5.151   2.471 1.00 . A A .  72 PHE HE1  1 1 
        4  6892 1 1  72 PHE HE2  H   2.033   8.076  -0.023 1.00 . A A .  72 PHE HE2  1 1 
        4  6893 1 1  72 PHE HZ   H   2.066   6.626   1.978 1.00 . A A .  72 PHE HZ   1 1 
        4  6894 1 1  72 PHE N    N  -4.529   6.718  -1.900 1.00 . A A .  72 PHE N    1 1 
        4  6895 1 1  72 PHE O    O  -2.741   9.301  -1.770 1.00 . A A .  72 PHE O    1 1 
        4  6896 1 1  73 THR C    C  -3.082  11.363   0.951 1.00 . A A .  73 THR C    1 1 
        4  6897 1 1  73 THR CA   C  -4.239  10.792   0.093 1.00 . A A .  73 THR CA   1 1 
        4  6898 1 1  73 THR CB   C  -5.657  11.174   0.586 1.00 . A A .  73 THR CB   1 1 
        4  6899 1 1  73 THR CG2  C  -5.927  12.673   0.633 1.00 . A A .  73 THR CG2  1 1 
        4  6900 1 1  73 THR H    H  -4.526   8.684   0.744 1.00 . A A .  73 THR H    1 1 
        4  6901 1 1  73 THR HA   H  -4.163  11.207  -0.930 1.00 . A A .  73 THR HA   1 1 
        4  6902 1 1  73 THR HB   H  -5.824  10.755   1.594 1.00 . A A .  73 THR HB   1 1 
        4  6903 1 1  73 THR HG1  H  -6.267   9.779  -0.580 1.00 . A A .  73 THR HG1  1 1 
        4  6904 1 1  73 THR HG21 H  -6.952  12.876   0.994 1.00 . A A .  73 THR HG21 1 1 
        4  6905 1 1  73 THR HG22 H  -5.232  13.212   1.299 1.00 . A A .  73 THR HG22 1 1 
        4  6906 1 1  73 THR HG23 H  -5.844  13.138  -0.362 1.00 . A A .  73 THR HG23 1 1 
        4  6907 1 1  73 THR N    N  -4.132   9.304   0.016 1.00 . A A .  73 THR N    1 1 
        4  6908 1 1  73 THR O    O  -3.172  11.448   2.178 1.00 . A A .  73 THR O    1 1 
        4  6909 1 1  73 THR OG1  O  -6.631  10.625  -0.300 1.00 . A A .  73 THR OG1  1 1 
        4  6910 1 1  74 VAL C    C  -0.333  13.556   0.676 1.00 . A A .  74 VAL C    1 1 
        4  6911 1 1  74 VAL CA   C  -0.700  12.079   0.947 1.00 . A A .  74 VAL CA   1 1 
        4  6912 1 1  74 VAL CB   C   0.410  11.038   0.626 1.00 . A A .  74 VAL CB   1 1 
        4  6913 1 1  74 VAL CG1  C   0.735  10.878  -0.857 1.00 . A A .  74 VAL CG1  1 1 
        4  6914 1 1  74 VAL CG2  C   1.740  11.333   1.355 1.00 . A A .  74 VAL CG2  1 1 
        4  6915 1 1  74 VAL H    H  -2.069  11.642  -0.745 1.00 . A A .  74 VAL H    1 1 
        4  6916 1 1  74 VAL HA   H  -0.858  11.977   2.035 1.00 . A A .  74 VAL HA   1 1 
        4  6917 1 1  74 VAL HB   H   0.032  10.061   0.996 1.00 . A A .  74 VAL HB   1 1 
        4  6918 1 1  74 VAL HG11 H   1.540  10.142  -1.019 1.00 . A A .  74 VAL HG11 1 1 
        4  6919 1 1  74 VAL HG12 H  -0.136  10.535  -1.446 1.00 . A A .  74 VAL HG12 1 1 
        4  6920 1 1  74 VAL HG13 H   1.070  11.829  -1.296 1.00 . A A .  74 VAL HG13 1 1 
        4  6921 1 1  74 VAL HG21 H   1.601  11.539   2.430 1.00 . A A .  74 VAL HG21 1 1 
        4  6922 1 1  74 VAL HG22 H   2.446  10.485   1.280 1.00 . A A .  74 VAL HG22 1 1 
        4  6923 1 1  74 VAL HG23 H   2.247  12.217   0.923 1.00 . A A .  74 VAL HG23 1 1 
        4  6924 1 1  74 VAL N    N  -1.980  11.715   0.282 1.00 . A A .  74 VAL N    1 1 
        4  6925 1 1  74 VAL O    O  -0.336  14.039  -0.459 1.00 . A A .  74 VAL O    1 1 
        4  6926 1 1  75 PHE C    C   1.601  16.145   1.686 1.00 . A A .  75 PHE C    1 1 
        4  6927 1 1  75 PHE CA   C   0.109  15.731   1.777 1.00 . A A .  75 PHE CA   1 1 
        4  6928 1 1  75 PHE CB   C  -0.558  16.245   3.083 1.00 . A A .  75 PHE CB   1 1 
        4  6929 1 1  75 PHE CD1  C  -2.859  17.196   2.487 1.00 . A A .  75 PHE CD1  1 1 
        4  6930 1 1  75 PHE CD2  C  -2.765  15.019   3.529 1.00 . A A .  75 PHE CD2  1 1 
        4  6931 1 1  75 PHE CE1  C  -4.250  17.098   2.412 1.00 . A A .  75 PHE CE1  1 1 
        4  6932 1 1  75 PHE CE2  C  -4.155  14.925   3.462 1.00 . A A .  75 PHE CE2  1 1 
        4  6933 1 1  75 PHE CG   C  -2.099  16.157   3.045 1.00 . A A .  75 PHE CG   1 1 
        4  6934 1 1  75 PHE CZ   C  -4.895  15.964   2.902 1.00 . A A .  75 PHE CZ   1 1 
        4  6935 1 1  75 PHE H    H  -0.020  13.698   2.631 1.00 . A A .  75 PHE H    1 1 
        4  6936 1 1  75 PHE HA   H  -0.454  16.169   0.924 1.00 . A A .  75 PHE HA   1 1 
        4  6937 1 1  75 PHE HB2  H  -0.172  15.697   3.965 1.00 . A A .  75 PHE HB2  1 1 
        4  6938 1 1  75 PHE HB3  H  -0.263  17.294   3.276 1.00 . A A .  75 PHE HB3  1 1 
        4  6939 1 1  75 PHE HD1  H  -2.369  18.078   2.094 1.00 . A A .  75 PHE HD1  1 1 
        4  6940 1 1  75 PHE HD2  H  -2.203  14.190   3.944 1.00 . A A .  75 PHE HD2  1 1 
        4  6941 1 1  75 PHE HE1  H  -4.821  17.898   1.958 1.00 . A A .  75 PHE HE1  1 1 
        4  6942 1 1  75 PHE HE2  H  -4.651  14.039   3.835 1.00 . A A .  75 PHE HE2  1 1 
        4  6943 1 1  75 PHE HZ   H  -5.973  15.883   2.834 1.00 . A A .  75 PHE HZ   1 1 
        4  6944 1 1  75 PHE N    N  -0.014  14.257   1.763 1.00 . A A .  75 PHE N    1 1 
        4  6945 1 1  75 PHE O    O   2.427  15.722   2.500 1.00 . A A .  75 PHE O    1 1 
        4  6946 1 1  76 PHE C    C   3.463  18.938   0.527 1.00 . A A .  76 PHE C    1 1 
        4  6947 1 1  76 PHE CA   C   3.330  17.390   0.412 1.00 . A A .  76 PHE CA   1 1 
        4  6948 1 1  76 PHE CB   C   3.790  16.946  -1.005 1.00 . A A .  76 PHE CB   1 1 
        4  6949 1 1  76 PHE CD1  C   4.627  14.573  -0.525 1.00 . A A .  76 PHE CD1  1 1 
        4  6950 1 1  76 PHE CD2  C   2.947  14.882  -2.228 1.00 . A A .  76 PHE CD2  1 1 
        4  6951 1 1  76 PHE CE1  C   4.587  13.197  -0.743 1.00 . A A .  76 PHE CE1  1 1 
        4  6952 1 1  76 PHE CE2  C   2.945  13.511  -2.476 1.00 . A A .  76 PHE CE2  1 1 
        4  6953 1 1  76 PHE CG   C   3.788  15.432  -1.254 1.00 . A A .  76 PHE CG   1 1 
        4  6954 1 1  76 PHE CZ   C   3.756  12.668  -1.726 1.00 . A A .  76 PHE CZ   1 1 
        4  6955 1 1  76 PHE H    H   1.162  17.259   0.077 1.00 . A A .  76 PHE H    1 1 
        4  6956 1 1  76 PHE HA   H   4.014  16.923   1.150 1.00 . A A .  76 PHE HA   1 1 
        4  6957 1 1  76 PHE HB2  H   3.188  17.465  -1.777 1.00 . A A .  76 PHE HB2  1 1 
        4  6958 1 1  76 PHE HB3  H   4.821  17.315  -1.183 1.00 . A A .  76 PHE HB3  1 1 
        4  6959 1 1  76 PHE HD1  H   5.326  14.986   0.192 1.00 . A A .  76 PHE HD1  1 1 
        4  6960 1 1  76 PHE HD2  H   2.294  15.514  -2.808 1.00 . A A .  76 PHE HD2  1 1 
        4  6961 1 1  76 PHE HE1  H   5.222  12.528  -0.184 1.00 . A A .  76 PHE HE1  1 1 
        4  6962 1 1  76 PHE HE2  H   2.324  13.118  -3.266 1.00 . A A .  76 PHE HE2  1 1 
        4  6963 1 1  76 PHE HZ   H   3.763  11.601  -1.907 1.00 . A A .  76 PHE HZ   1 1 
        4  6964 1 1  76 PHE N    N   1.932  16.966   0.682 1.00 . A A .  76 PHE N    1 1 
        4  6965 1 1  76 PHE O    O   2.562  19.691   0.132 1.00 . A A .  76 PHE O    1 1 
        4  6966 1 1  77 GLU C    C   5.364  21.529  -0.110 1.00 . A A .  77 GLU C    1 1 
        4  6967 1 1  77 GLU CA   C   4.860  20.869   1.203 1.00 . A A .  77 GLU CA   1 1 
        4  6968 1 1  77 GLU CB   C   5.707  21.043   2.477 1.00 . A A .  77 GLU CB   1 1 
        4  6969 1 1  77 GLU CD   C   5.794  22.547   4.525 1.00 . A A .  77 GLU CD   1 1 
        4  6970 1 1  77 GLU CG   C   5.780  22.488   3.009 1.00 . A A .  77 GLU CG   1 1 
        4  6971 1 1  77 GLU H    H   5.287  18.698   1.363 1.00 . A A .  77 GLU H    1 1 
        4  6972 1 1  77 GLU HA   H   3.894  21.350   1.433 1.00 . A A .  77 GLU HA   1 1 
        4  6973 1 1  77 GLU HB2  H   5.259  20.394   3.262 1.00 . A A .  77 GLU HB2  1 1 
        4  6974 1 1  77 GLU HB3  H   6.728  20.644   2.343 1.00 . A A .  77 GLU HB3  1 1 
        4  6975 1 1  77 GLU HG2  H   6.673  23.011   2.625 1.00 . A A .  77 GLU HG2  1 1 
        4  6976 1 1  77 GLU HG3  H   4.918  23.097   2.691 1.00 . A A .  77 GLU HG3  1 1 
        4  6977 1 1  77 GLU N    N   4.606  19.408   1.044 1.00 . A A .  77 GLU N    1 1 
        4  6978 1 1  77 GLU O    O   4.619  22.287  -0.739 1.00 . A A .  77 GLU O    1 1 
        4  6979 1 1  77 GLU OE1  O   4.720  22.378   5.139 1.00 . A A .  77 GLU OE1  1 1 
        4  6980 1 1  77 GLU OE2  O   6.867  22.731   5.132 1.00 . A A .  77 GLU OE2  1 1 
        4  6981 1 1  78 ASN C    C   7.824  19.946  -2.276 1.00 . A A .  78 ASN C    1 1 
        4  6982 1 1  78 ASN CA   C   7.035  21.256  -1.940 1.00 . A A .  78 ASN CA   1 1 
        4  6983 1 1  78 ASN CB   C   7.806  22.568  -2.190 1.00 . A A .  78 ASN CB   1 1 
        4  6984 1 1  78 ASN CG   C   8.281  22.790  -3.624 1.00 . A A .  78 ASN CG   1 1 
        4  6985 1 1  78 ASN H    H   6.990  20.490   0.119 1.00 . A A .  78 ASN H    1 1 
        4  6986 1 1  78 ASN HA   H   6.142  21.240  -2.600 1.00 . A A .  78 ASN HA   1 1 
        4  6987 1 1  78 ASN HB2  H   7.148  23.417  -1.924 1.00 . A A .  78 ASN HB2  1 1 
        4  6988 1 1  78 ASN HB3  H   8.665  22.637  -1.495 1.00 . A A .  78 ASN HB3  1 1 
        4  6989 1 1  78 ASN HD21 H   9.548  24.208  -3.005 1.00 . A A .  78 ASN HD21 1 1 
        4  6990 1 1  78 ASN HD22 H   9.495  23.808  -4.801 1.00 . A A .  78 ASN HD22 1 1 
        4  6991 1 1  78 ASN N    N   6.589  21.183  -0.519 1.00 . A A .  78 ASN N    1 1 
        4  6992 1 1  78 ASN ND2  N   9.238  23.662  -3.811 1.00 . A A .  78 ASN ND2  1 1 
        4  6993 1 1  78 ASN O    O   7.402  19.188  -3.147 1.00 . A A .  78 ASN O    1 1 
        4  6994 1 1  78 ASN OD1  O   7.806  22.196  -4.588 1.00 . A A .  78 ASN OD1  1 1 
        4  6995 1 1  79 GLU C    C   8.878  17.433  -0.324 1.00 . A A .  79 GLU C    1 1 
        4  6996 1 1  79 GLU CA   C   9.486  18.287  -1.489 1.00 . A A .  79 GLU CA   1 1 
        4  6997 1 1  79 GLU CB   C  11.033  18.352  -1.379 1.00 . A A .  79 GLU CB   1 1 
        4  6998 1 1  79 GLU CD   C  11.683  17.350  -3.665 1.00 . A A .  79 GLU CD   1 1 
        4  6999 1 1  79 GLU CG   C  11.788  18.528  -2.710 1.00 . A A .  79 GLU CG   1 1 
        4  7000 1 1  79 GLU H    H   9.237  20.410  -0.948 1.00 . A A .  79 GLU H    1 1 
        4  7001 1 1  79 GLU HA   H   9.243  17.725  -2.412 1.00 . A A .  79 GLU HA   1 1 
        4  7002 1 1  79 GLU HB2  H  11.344  19.145  -0.672 1.00 . A A .  79 GLU HB2  1 1 
        4  7003 1 1  79 GLU HB3  H  11.419  17.422  -0.918 1.00 . A A .  79 GLU HB3  1 1 
        4  7004 1 1  79 GLU HG2  H  11.470  19.446  -3.234 1.00 . A A .  79 GLU HG2  1 1 
        4  7005 1 1  79 GLU HG3  H  12.862  18.668  -2.499 1.00 . A A .  79 GLU HG3  1 1 
        4  7006 1 1  79 GLU N    N   8.930  19.661  -1.575 1.00 . A A .  79 GLU N    1 1 
        4  7007 1 1  79 GLU O    O   8.503  16.282  -0.565 1.00 . A A .  79 GLU O    1 1 
        4  7008 1 1  79 GLU OE1  O  12.063  16.218  -3.293 1.00 . A A .  79 GLU OE1  1 1 
        4  7009 1 1  79 GLU OE2  O  11.190  17.553  -4.794 1.00 . A A .  79 GLU OE2  1 1 
        4  7010 1 1  80 GLN C    C   7.319  16.531   2.413 1.00 . A A .  80 GLN C    1 1 
        4  7011 1 1  80 GLN CA   C   8.729  17.103   2.127 1.00 . A A .  80 GLN CA   1 1 
        4  7012 1 1  80 GLN CB   C   9.364  17.807   3.352 1.00 . A A .  80 GLN CB   1 1 
        4  7013 1 1  80 GLN CD   C   9.306  19.603   5.199 1.00 . A A .  80 GLN CD   1 1 
        4  7014 1 1  80 GLN CG   C   8.681  19.073   3.906 1.00 . A A .  80 GLN CG   1 1 
        4  7015 1 1  80 GLN H    H   8.815  18.972   0.953 1.00 . A A .  80 GLN H    1 1 
        4  7016 1 1  80 GLN HA   H   9.409  16.241   1.949 1.00 . A A .  80 GLN HA   1 1 
        4  7017 1 1  80 GLN HB2  H   9.435  17.052   4.162 1.00 . A A .  80 GLN HB2  1 1 
        4  7018 1 1  80 GLN HB3  H  10.423  18.034   3.111 1.00 . A A .  80 GLN HB3  1 1 
        4  7019 1 1  80 GLN HE21 H   8.148  21.276   5.173 1.00 . A A .  80 GLN HE21 1 1 
        4  7020 1 1  80 GLN HE22 H   9.381  21.035   6.519 1.00 . A A .  80 GLN HE22 1 1 
        4  7021 1 1  80 GLN HG2  H   8.715  19.875   3.147 1.00 . A A .  80 GLN HG2  1 1 
        4  7022 1 1  80 GLN HG3  H   7.609  18.880   4.100 1.00 . A A .  80 GLN HG3  1 1 
        4  7023 1 1  80 GLN N    N   8.825  17.951   0.917 1.00 . A A .  80 GLN N    1 1 
        4  7024 1 1  80 GLN NE2  N   8.892  20.753   5.667 1.00 . A A .  80 GLN NE2  1 1 
        4  7025 1 1  80 GLN O    O   6.298  17.203   2.226 1.00 . A A .  80 GLN O    1 1 
        4  7026 1 1  80 GLN OE1  O  10.173  19.007   5.831 1.00 . A A .  80 GLN OE1  1 1 
        4  7027 1 1  81 VAL C    C   5.490  14.914   4.578 1.00 . A A .  81 VAL C    1 1 
        4  7028 1 1  81 VAL CA   C   6.024  14.549   3.154 1.00 . A A .  81 VAL CA   1 1 
        4  7029 1 1  81 VAL CB   C   6.181  12.990   3.031 1.00 . A A .  81 VAL CB   1 1 
        4  7030 1 1  81 VAL CG1  C   4.796  12.332   2.858 1.00 . A A .  81 VAL CG1  1 1 
        4  7031 1 1  81 VAL CG2  C   7.113  12.484   1.916 1.00 . A A .  81 VAL CG2  1 1 
        4  7032 1 1  81 VAL H    H   8.202  14.817   2.977 1.00 . A A .  81 VAL H    1 1 
        4  7033 1 1  81 VAL HA   H   5.275  14.869   2.399 1.00 . A A .  81 VAL HA   1 1 
        4  7034 1 1  81 VAL HB   H   6.598  12.596   3.979 1.00 . A A .  81 VAL HB   1 1 
        4  7035 1 1  81 VAL HG11 H   4.153  12.498   3.743 1.00 . A A .  81 VAL HG11 1 1 
        4  7036 1 1  81 VAL HG12 H   4.253  12.737   1.989 1.00 . A A .  81 VAL HG12 1 1 
        4  7037 1 1  81 VAL HG13 H   4.871  11.238   2.721 1.00 . A A .  81 VAL HG13 1 1 
        4  7038 1 1  81 VAL HG21 H   7.034  11.391   1.769 1.00 . A A .  81 VAL HG21 1 1 
        4  7039 1 1  81 VAL HG22 H   6.952  12.978   0.944 1.00 . A A .  81 VAL HG22 1 1 
        4  7040 1 1  81 VAL HG23 H   8.166  12.674   2.167 1.00 . A A .  81 VAL HG23 1 1 
        4  7041 1 1  81 VAL N    N   7.289  15.277   2.887 1.00 . A A .  81 VAL N    1 1 
        4  7042 1 1  81 VAL O    O   6.207  14.774   5.574 1.00 . A A .  81 VAL O    1 1 
        4  7043 1 1  82 VAL C    C   2.958  14.327   6.528 1.00 . A A .  82 VAL C    1 1 
        4  7044 1 1  82 VAL CA   C   3.554  15.651   5.951 1.00 . A A .  82 VAL CA   1 1 
        4  7045 1 1  82 VAL CB   C   2.551  16.835   5.764 1.00 . A A .  82 VAL CB   1 1 
        4  7046 1 1  82 VAL CG1  C   1.779  17.169   7.053 1.00 . A A .  82 VAL CG1  1 1 
        4  7047 1 1  82 VAL CG2  C   3.244  18.137   5.287 1.00 . A A .  82 VAL CG2  1 1 
        4  7048 1 1  82 VAL H    H   3.713  15.421   3.760 1.00 . A A .  82 VAL H    1 1 
        4  7049 1 1  82 VAL HA   H   4.319  15.983   6.683 1.00 . A A .  82 VAL HA   1 1 
        4  7050 1 1  82 VAL HB   H   1.803  16.560   4.995 1.00 . A A .  82 VAL HB   1 1 
        4  7051 1 1  82 VAL HG11 H   2.438  17.514   7.872 1.00 . A A .  82 VAL HG11 1 1 
        4  7052 1 1  82 VAL HG12 H   1.017  17.945   6.883 1.00 . A A .  82 VAL HG12 1 1 
        4  7053 1 1  82 VAL HG13 H   1.221  16.302   7.452 1.00 . A A .  82 VAL HG13 1 1 
        4  7054 1 1  82 VAL HG21 H   3.716  18.015   4.290 1.00 . A A .  82 VAL HG21 1 1 
        4  7055 1 1  82 VAL HG22 H   2.525  18.967   5.184 1.00 . A A .  82 VAL HG22 1 1 
        4  7056 1 1  82 VAL HG23 H   4.038  18.471   5.979 1.00 . A A .  82 VAL HG23 1 1 
        4  7057 1 1  82 VAL N    N   4.224  15.338   4.655 1.00 . A A .  82 VAL N    1 1 
        4  7058 1 1  82 VAL O    O   3.564  13.750   7.432 1.00 . A A .  82 VAL O    1 1 
        4  7059 1 1  83 ARG C    C   0.331  11.942   5.197 1.00 . A A .  83 ARG C    1 1 
        4  7060 1 1  83 ARG CA   C   1.312  12.474   6.299 1.00 . A A .  83 ARG CA   1 1 
        4  7061 1 1  83 ARG CB   C   0.808  12.309   7.755 1.00 . A A .  83 ARG CB   1 1 
        4  7062 1 1  83 ARG CD   C  -1.359  12.012   9.055 1.00 . A A .  83 ARG CD   1 1 
        4  7063 1 1  83 ARG CG   C  -0.550  12.927   8.118 1.00 . A A .  83 ARG CG   1 1 
        4  7064 1 1  83 ARG CZ   C  -2.446   9.812   8.608 1.00 . A A .  83 ARG CZ   1 1 
        4  7065 1 1  83 ARG H    H   1.520  14.359   5.161 1.00 . A A .  83 ARG H    1 1 
        4  7066 1 1  83 ARG HA   H   2.179  11.785   6.220 1.00 . A A .  83 ARG HA   1 1 
        4  7067 1 1  83 ARG HB2  H   0.808  11.220   7.960 1.00 . A A .  83 ARG HB2  1 1 
        4  7068 1 1  83 ARG HB3  H   1.575  12.684   8.461 1.00 . A A .  83 ARG HB3  1 1 
        4  7069 1 1  83 ARG HD2  H  -0.704  11.512   9.795 1.00 . A A .  83 ARG HD2  1 1 
        4  7070 1 1  83 ARG HD3  H  -2.034  12.633   9.672 1.00 . A A .  83 ARG HD3  1 1 
        4  7071 1 1  83 ARG HE   H  -2.853  11.422   7.532 1.00 . A A .  83 ARG HE   1 1 
        4  7072 1 1  83 ARG HG2  H  -0.369  13.907   8.605 1.00 . A A .  83 ARG HG2  1 1 
        4  7073 1 1  83 ARG HG3  H  -1.147  13.187   7.220 1.00 . A A .  83 ARG HG3  1 1 
        4  7074 1 1  83 ARG HH11 H  -0.771   9.474   9.605 1.00 . A A .  83 ARG HH11 1 1 
        4  7075 1 1  83 ARG HH12 H  -2.012   8.109   9.497 1.00 . A A .  83 ARG HH12 1 1 
        4  7076 1 1  83 ARG HH21 H  -4.248   9.925   7.750 1.00 . A A .  83 ARG HH21 1 1 
        4  7077 1 1  83 ARG HH22 H  -3.747   8.334   8.611 1.00 . A A .  83 ARG HH22 1 1 
        4  7078 1 1  83 ARG N    N   1.820  13.839   5.995 1.00 . A A .  83 ARG N    1 1 
        4  7079 1 1  83 ARG NE   N  -2.194  11.070   8.273 1.00 . A A .  83 ARG NE   1 1 
        4  7080 1 1  83 ARG NH1  N  -1.656   9.059   9.323 1.00 . A A .  83 ARG NH1  1 1 
        4  7081 1 1  83 ARG NH2  N  -3.546   9.276   8.201 1.00 . A A .  83 ARG NH2  1 1 
        4  7082 1 1  83 ARG O    O   0.015  12.622   4.216 1.00 . A A .  83 ARG O    1 1 
        4  7083 1 1  84 TRP C    C  -1.983   9.126   4.816 1.00 . A A .  84 TRP C    1 1 
        4  7084 1 1  84 TRP CA   C  -0.702   9.851   4.321 1.00 . A A .  84 TRP CA   1 1 
        4  7085 1 1  84 TRP CB   C   0.312   8.844   3.728 1.00 . A A .  84 TRP CB   1 1 
        4  7086 1 1  84 TRP CD1  C   0.943   6.830   5.355 1.00 . A A .  84 TRP CD1  1 1 
        4  7087 1 1  84 TRP CD2  C   2.526   8.383   5.106 1.00 . A A .  84 TRP CD2  1 1 
        4  7088 1 1  84 TRP CE2  C   2.962   7.397   6.024 1.00 . A A .  84 TRP CE2  1 1 
        4  7089 1 1  84 TRP CE3  C   3.390   9.473   4.764 1.00 . A A .  84 TRP CE3  1 1 
        4  7090 1 1  84 TRP CG   C   1.235   8.047   4.691 1.00 . A A .  84 TRP CG   1 1 
        4  7091 1 1  84 TRP CH2  C   5.078   8.564   6.266 1.00 . A A .  84 TRP CH2  1 1 
        4  7092 1 1  84 TRP CZ2  C   4.259   7.492   6.612 1.00 . A A .  84 TRP CZ2  1 1 
        4  7093 1 1  84 TRP CZ3  C   4.649   9.542   5.350 1.00 . A A .  84 TRP CZ3  1 1 
        4  7094 1 1  84 TRP H    H   0.231  10.277   6.257 1.00 . A A .  84 TRP H    1 1 
        4  7095 1 1  84 TRP HA   H  -0.996  10.494   3.472 1.00 . A A .  84 TRP HA   1 1 
        4  7096 1 1  84 TRP HB2  H  -0.235   8.134   3.084 1.00 . A A .  84 TRP HB2  1 1 
        4  7097 1 1  84 TRP HB3  H   0.975   9.388   3.037 1.00 . A A .  84 TRP HB3  1 1 
        4  7098 1 1  84 TRP HD1  H   0.036   6.256   5.237 1.00 . A A .  84 TRP HD1  1 1 
        4  7099 1 1  84 TRP HE1  H   2.140   5.524   6.651 1.00 . A A .  84 TRP HE1  1 1 
        4  7100 1 1  84 TRP HE3  H   3.071  10.225   4.056 1.00 . A A .  84 TRP HE3  1 1 
        4  7101 1 1  84 TRP HH2  H   6.064   8.661   6.696 1.00 . A A .  84 TRP HH2  1 1 
        4  7102 1 1  84 TRP HZ2  H   4.596   6.737   7.313 1.00 . A A .  84 TRP HZ2  1 1 
        4  7103 1 1  84 TRP HZ3  H   5.323  10.353   5.100 1.00 . A A .  84 TRP HZ3  1 1 
        4  7104 1 1  84 TRP N    N  -0.082  10.683   5.372 1.00 . A A .  84 TRP N    1 1 
        4  7105 1 1  84 TRP NE1  N   1.992   6.433   6.196 1.00 . A A .  84 TRP NE1  1 1 
        4  7106 1 1  84 TRP O    O  -1.927   8.275   5.710 1.00 . A A .  84 TRP O    1 1 
        4  7107 1 1  85 GLU C    C  -4.597   7.566   3.480 1.00 . A A .  85 GLU C    1 1 
        4  7108 1 1  85 GLU CA   C  -4.414   8.763   4.478 1.00 . A A .  85 GLU CA   1 1 
        4  7109 1 1  85 GLU CB   C  -5.623   9.736   4.460 1.00 . A A .  85 GLU CB   1 1 
        4  7110 1 1  85 GLU CD   C  -4.860  11.466   6.268 1.00 . A A .  85 GLU CD   1 1 
        4  7111 1 1  85 GLU CG   C  -5.432  11.203   4.895 1.00 . A A .  85 GLU CG   1 1 
        4  7112 1 1  85 GLU H    H  -3.051  10.190   3.485 1.00 . A A .  85 GLU H    1 1 
        4  7113 1 1  85 GLU HA   H  -4.391   8.371   5.515 1.00 . A A .  85 GLU HA   1 1 
        4  7114 1 1  85 GLU HB2  H  -6.079   9.765   3.455 1.00 . A A .  85 GLU HB2  1 1 
        4  7115 1 1  85 GLU HB3  H  -6.419   9.284   5.085 1.00 . A A .  85 GLU HB3  1 1 
        4  7116 1 1  85 GLU HG2  H  -4.789  11.718   4.161 1.00 . A A .  85 GLU HG2  1 1 
        4  7117 1 1  85 GLU HG3  H  -6.407  11.713   4.837 1.00 . A A .  85 GLU HG3  1 1 
        4  7118 1 1  85 GLU N    N  -3.118   9.420   4.173 1.00 . A A .  85 GLU N    1 1 
        4  7119 1 1  85 GLU O    O  -5.047   7.745   2.341 1.00 . A A .  85 GLU O    1 1 
        4  7120 1 1  85 GLU OE1  O  -5.379  10.916   7.258 1.00 . A A .  85 GLU OE1  1 1 
        4  7121 1 1  85 GLU OE2  O  -3.848  12.187   6.392 1.00 . A A .  85 GLU OE2  1 1 
        4  7122 1 1  86 GLY C    C  -5.004   4.148   2.944 1.00 . A A .  86 GLY C    1 1 
        4  7123 1 1  86 GLY CA   C  -3.940   5.243   2.950 1.00 . A A .  86 GLY CA   1 1 
        4  7124 1 1  86 GLY H    H  -3.681   6.411   4.804 1.00 . A A .  86 GLY H    1 1 
        4  7125 1 1  86 GLY HA2  H  -3.786   5.605   1.918 1.00 . A A .  86 GLY HA2  1 1 
        4  7126 1 1  86 GLY HA3  H  -2.979   4.760   3.199 1.00 . A A .  86 GLY HA3  1 1 
        4  7127 1 1  86 GLY N    N  -4.149   6.368   3.891 1.00 . A A .  86 GLY N    1 1 
        4  7128 1 1  86 GLY O    O  -4.827   3.126   3.609 1.00 . A A .  86 GLY O    1 1 
        4  7129 1 1  87 ASP C    C  -6.637   2.486   0.547 1.00 . A A .  87 ASP C    1 1 
        4  7130 1 1  87 ASP CA   C  -7.043   3.240   1.850 1.00 . A A .  87 ASP CA   1 1 
        4  7131 1 1  87 ASP CB   C  -8.475   3.820   1.819 1.00 . A A .  87 ASP CB   1 1 
        4  7132 1 1  87 ASP CG   C  -9.007   4.072   3.230 1.00 . A A .  87 ASP CG   1 1 
        4  7133 1 1  87 ASP H    H  -6.043   5.206   1.606 1.00 . A A .  87 ASP H    1 1 
        4  7134 1 1  87 ASP HA   H  -7.027   2.495   2.675 1.00 . A A .  87 ASP HA   1 1 
        4  7135 1 1  87 ASP HB2  H  -8.535   4.747   1.223 1.00 . A A .  87 ASP HB2  1 1 
        4  7136 1 1  87 ASP HB3  H  -9.168   3.108   1.335 1.00 . A A .  87 ASP HB3  1 1 
        4  7137 1 1  87 ASP N    N  -6.051   4.320   2.129 1.00 . A A .  87 ASP N    1 1 
        4  7138 1 1  87 ASP O    O  -6.956   2.865  -0.582 1.00 . A A .  87 ASP O    1 1 
        4  7139 1 1  87 ASP OD1  O  -9.271   3.085   3.951 1.00 . A A .  87 ASP OD1  1 1 
        4  7140 1 1  87 ASP OD2  O  -9.033   5.229   3.690 1.00 . A A .  87 ASP OD2  1 1 
        4  7141 1 1  88 TYR C    C  -4.743  -0.637  -0.258 1.00 . A A .  88 TYR C    1 1 
        4  7142 1 1  88 TYR CA   C  -4.916   0.914  -0.294 1.00 . A A .  88 TYR CA   1 1 
        4  7143 1 1  88 TYR CB   C  -3.569   1.692  -0.213 1.00 . A A .  88 TYR CB   1 1 
        4  7144 1 1  88 TYR CD1  C  -3.042   0.950   2.249 1.00 . A A .  88 TYR CD1  1 1 
        4  7145 1 1  88 TYR CD2  C  -1.441   2.251   1.010 1.00 . A A .  88 TYR CD2  1 1 
        4  7146 1 1  88 TYR CE1  C  -2.230   1.016   3.376 1.00 . A A .  88 TYR CE1  1 1 
        4  7147 1 1  88 TYR CE2  C  -0.609   2.288   2.134 1.00 . A A .  88 TYR CE2  1 1 
        4  7148 1 1  88 TYR CG   C  -2.677   1.602   1.049 1.00 . A A .  88 TYR CG   1 1 
        4  7149 1 1  88 TYR CZ   C  -1.020   1.691   3.322 1.00 . A A .  88 TYR CZ   1 1 
        4  7150 1 1  88 TYR H    H  -5.578   1.366   1.741 1.00 . A A .  88 TYR H    1 1 
        4  7151 1 1  88 TYR HA   H  -5.330   1.163  -1.294 1.00 . A A .  88 TYR HA   1 1 
        4  7152 1 1  88 TYR HB2  H  -2.962   1.387  -1.089 1.00 . A A .  88 TYR HB2  1 1 
        4  7153 1 1  88 TYR HB3  H  -3.790   2.763  -0.398 1.00 . A A .  88 TYR HB3  1 1 
        4  7154 1 1  88 TYR HD1  H  -3.969   0.404   2.344 1.00 . A A .  88 TYR HD1  1 1 
        4  7155 1 1  88 TYR HD2  H  -1.128   2.766   0.112 1.00 . A A .  88 TYR HD2  1 1 
        4  7156 1 1  88 TYR HE1  H  -2.577   0.562   4.292 1.00 . A A .  88 TYR HE1  1 1 
        4  7157 1 1  88 TYR HE2  H   0.338   2.807   2.073 1.00 . A A .  88 TYR HE2  1 1 
        4  7158 1 1  88 TYR HH   H   0.342   1.007   4.471 1.00 . A A .  88 TYR HH   1 1 
        4  7159 1 1  88 TYR N    N  -5.836   1.435   0.750 1.00 . A A .  88 TYR N    1 1 
        4  7160 1 1  88 TYR O    O  -3.636  -1.144  -0.068 1.00 . A A .  88 TYR O    1 1 
        4  7161 1 1  88 TYR OH   O  -0.258   1.773   4.444 1.00 . A A .  88 TYR OH   1 1 
        4  7162 1 1  89 PHE C    C  -5.293  -3.501   0.934 1.00 . A A .  89 PHE C    1 1 
        4  7163 1 1  89 PHE CA   C  -5.820  -2.895  -0.411 1.00 . A A .  89 PHE CA   1 1 
        4  7164 1 1  89 PHE CB   C  -5.163  -3.424  -1.713 1.00 . A A .  89 PHE CB   1 1 
        4  7165 1 1  89 PHE CD1  C  -6.142  -5.784  -1.946 1.00 . A A .  89 PHE CD1  1 1 
        4  7166 1 1  89 PHE CD2  C  -3.741  -5.515  -1.985 1.00 . A A .  89 PHE CD2  1 1 
        4  7167 1 1  89 PHE CE1  C  -5.987  -7.160  -2.118 1.00 . A A .  89 PHE CE1  1 1 
        4  7168 1 1  89 PHE CE2  C  -3.589  -6.890  -2.162 1.00 . A A .  89 PHE CE2  1 1 
        4  7169 1 1  89 PHE CG   C  -5.018  -4.942  -1.873 1.00 . A A .  89 PHE CG   1 1 
        4  7170 1 1  89 PHE CZ   C  -4.712  -7.711  -2.224 1.00 . A A .  89 PHE CZ   1 1 
        4  7171 1 1  89 PHE H    H  -6.686  -0.843  -0.610 1.00 . A A .  89 PHE H    1 1 
        4  7172 1 1  89 PHE HA   H  -6.882  -3.201  -0.477 1.00 . A A .  89 PHE HA   1 1 
        4  7173 1 1  89 PHE HB2  H  -5.760  -3.056  -2.565 1.00 . A A .  89 PHE HB2  1 1 
        4  7174 1 1  89 PHE HB3  H  -4.173  -2.944  -1.851 1.00 . A A .  89 PHE HB3  1 1 
        4  7175 1 1  89 PHE HD1  H  -7.142  -5.374  -1.885 1.00 . A A .  89 PHE HD1  1 1 
        4  7176 1 1  89 PHE HD2  H  -2.854  -4.893  -1.939 1.00 . A A .  89 PHE HD2  1 1 
        4  7177 1 1  89 PHE HE1  H  -6.859  -7.800  -2.168 1.00 . A A .  89 PHE HE1  1 1 
        4  7178 1 1  89 PHE HE2  H  -2.597  -7.315  -2.250 1.00 . A A .  89 PHE HE2  1 1 
        4  7179 1 1  89 PHE HZ   H  -4.592  -8.780  -2.344 1.00 . A A .  89 PHE HZ   1 1 
        4  7180 1 1  89 PHE N    N  -5.838  -1.396  -0.450 1.00 . A A .  89 PHE N    1 1 
        4  7181 1 1  89 PHE O    O  -4.129  -3.916   0.981 1.00 . A A .  89 PHE O    1 1 
        4  7182 1 1  90 PRO C    C  -5.583  -5.804   3.344 1.00 . A A .  90 PRO C    1 1 
        4  7183 1 1  90 PRO CA   C  -5.599  -4.246   3.315 1.00 . A A .  90 PRO CA   1 1 
        4  7184 1 1  90 PRO CB   C  -6.549  -3.573   4.340 1.00 . A A .  90 PRO CB   1 1 
        4  7185 1 1  90 PRO CD   C  -7.448  -3.054   2.145 1.00 . A A .  90 PRO CD   1 1 
        4  7186 1 1  90 PRO CG   C  -7.884  -3.404   3.579 1.00 . A A .  90 PRO CG   1 1 
        4  7187 1 1  90 PRO HA   H  -4.565  -3.903   3.519 1.00 . A A .  90 PRO HA   1 1 
        4  7188 1 1  90 PRO HB2  H  -6.655  -4.135   5.285 1.00 . A A .  90 PRO HB2  1 1 
        4  7189 1 1  90 PRO HB3  H  -6.139  -2.579   4.610 1.00 . A A .  90 PRO HB3  1 1 
        4  7190 1 1  90 PRO HD2  H  -8.141  -3.474   1.392 1.00 . A A .  90 PRO HD2  1 1 
        4  7191 1 1  90 PRO HD3  H  -7.408  -1.958   1.995 1.00 . A A .  90 PRO HD3  1 1 
        4  7192 1 1  90 PRO HG2  H  -8.441  -4.362   3.583 1.00 . A A .  90 PRO HG2  1 1 
        4  7193 1 1  90 PRO HG3  H  -8.538  -2.636   4.028 1.00 . A A .  90 PRO HG3  1 1 
        4  7194 1 1  90 PRO N    N  -6.094  -3.634   2.032 1.00 . A A .  90 PRO N    1 1 
        4  7195 1 1  90 PRO O    O  -6.181  -6.460   4.203 1.00 . A A .  90 PRO O    1 1 
        4  7196 1 1  91 SER C    C  -3.394  -8.238   1.381 1.00 . A A .  91 SER C    1 1 
        4  7197 1 1  91 SER CA   C  -4.640  -7.843   2.254 1.00 . A A .  91 SER CA   1 1 
        4  7198 1 1  91 SER CB   C  -5.938  -8.484   1.697 1.00 . A A .  91 SER CB   1 1 
        4  7199 1 1  91 SER H    H  -4.479  -5.675   1.721 1.00 . A A .  91 SER H    1 1 
        4  7200 1 1  91 SER HA   H  -4.427  -8.256   3.257 1.00 . A A .  91 SER HA   1 1 
        4  7201 1 1  91 SER HB2  H  -6.817  -8.141   2.274 1.00 . A A .  91 SER HB2  1 1 
        4  7202 1 1  91 SER HB3  H  -6.117  -8.145   0.657 1.00 . A A .  91 SER HB3  1 1 
        4  7203 1 1  91 SER HG   H  -5.094 -10.131   1.177 1.00 . A A .  91 SER HG   1 1 
        4  7204 1 1  91 SER N    N  -4.845  -6.378   2.384 1.00 . A A .  91 SER N    1 1 
        4  7205 1 1  91 SER O    O  -3.451  -9.172   0.574 1.00 . A A .  91 SER O    1 1 
        4  7206 1 1  91 SER OG   O  -5.858  -9.908   1.737 1.00 . A A .  91 SER OG   1 1 
        4  7207 1 1  92 GLN C    C  -0.042  -8.697   1.409 1.00 . A A .  92 GLN C    1 1 
        4  7208 1 1  92 GLN CA   C  -1.048  -7.707   0.754 1.00 . A A .  92 GLN CA   1 1 
        4  7209 1 1  92 GLN CB   C  -0.502  -6.269   0.565 1.00 . A A .  92 GLN CB   1 1 
        4  7210 1 1  92 GLN CD   C   0.244  -5.760  -1.863 1.00 . A A .  92 GLN CD   1 1 
        4  7211 1 1  92 GLN CG   C   0.649  -6.130  -0.446 1.00 . A A .  92 GLN CG   1 1 
        4  7212 1 1  92 GLN H    H  -2.372  -6.839   2.320 1.00 . A A .  92 GLN H    1 1 
        4  7213 1 1  92 GLN HA   H  -1.323  -8.090  -0.249 1.00 . A A .  92 GLN HA   1 1 
        4  7214 1 1  92 GLN HB2  H  -1.330  -5.587   0.276 1.00 . A A .  92 GLN HB2  1 1 
        4  7215 1 1  92 GLN HB3  H  -0.152  -5.879   1.541 1.00 . A A .  92 GLN HB3  1 1 
        4  7216 1 1  92 GLN HE21 H   0.480  -3.858  -1.390 1.00 . A A .  92 GLN HE21 1 1 
        4  7217 1 1  92 GLN HE22 H   0.300  -4.260  -3.183 1.00 . A A .  92 GLN HE22 1 1 
        4  7218 1 1  92 GLN HG2  H   1.370  -5.382  -0.065 1.00 . A A .  92 GLN HG2  1 1 
        4  7219 1 1  92 GLN HG3  H   1.251  -7.052  -0.489 1.00 . A A .  92 GLN HG3  1 1 
        4  7220 1 1  92 GLN N    N  -2.262  -7.561   1.602 1.00 . A A .  92 GLN N    1 1 
        4  7221 1 1  92 GLN NE2  N   0.246  -4.487  -2.169 1.00 . A A .  92 GLN NE2  1 1 
        4  7222 1 1  92 GLN O    O   0.912  -8.278   2.076 1.00 . A A .  92 GLN O    1 1 
        4  7223 1 1  92 GLN OE1  O  -0.050  -6.606  -2.701 1.00 . A A .  92 GLN OE1  1 1 
        4  7224 1 1  93 ASP C    C   0.436 -12.426   1.257 1.00 . A A .  93 ASP C    1 1 
        4  7225 1 1  93 ASP CA   C   0.398 -11.059   2.026 1.00 . A A .  93 ASP CA   1 1 
        4  7226 1 1  93 ASP CB   C  -0.252 -11.235   3.430 1.00 . A A .  93 ASP CB   1 1 
        4  7227 1 1  93 ASP CG   C   0.316 -10.325   4.505 1.00 . A A .  93 ASP CG   1 1 
        4  7228 1 1  93 ASP H    H  -1.107 -10.213   0.654 1.00 . A A .  93 ASP H    1 1 
        4  7229 1 1  93 ASP HA   H   1.448 -10.748   2.173 1.00 . A A .  93 ASP HA   1 1 
        4  7230 1 1  93 ASP HB2  H  -1.349 -11.116   3.382 1.00 . A A .  93 ASP HB2  1 1 
        4  7231 1 1  93 ASP HB3  H  -0.101 -12.268   3.795 1.00 . A A .  93 ASP HB3  1 1 
        4  7232 1 1  93 ASP N    N  -0.292 -10.008   1.241 1.00 . A A .  93 ASP N    1 1 
        4  7233 1 1  93 ASP O    O  -0.493 -13.234   1.336 1.00 . A A .  93 ASP O    1 1 
        4  7234 1 1  93 ASP OD1  O   1.408 -10.642   5.030 1.00 . A A .  93 ASP OD1  1 1 
        4  7235 1 1  93 ASP OD2  O  -0.265  -9.254   4.801 1.00 . A A .  93 ASP OD2  1 1 
        4  7236 1 1  94 GLU C    C   2.486 -14.965   1.329 1.00 . A A .  94 GLU C    1 1 
        4  7237 1 1  94 GLU CA   C   1.915 -14.105   0.150 1.00 . A A .  94 GLU CA   1 1 
        4  7238 1 1  94 GLU CB   C   2.898 -14.015  -1.045 1.00 . A A .  94 GLU CB   1 1 
        4  7239 1 1  94 GLU CD   C   1.490 -15.197  -2.830 1.00 . A A .  94 GLU CD   1 1 
        4  7240 1 1  94 GLU CG   C   2.794 -15.179  -2.050 1.00 . A A .  94 GLU CG   1 1 
        4  7241 1 1  94 GLU H    H   1.879 -11.896   0.060 1.00 . A A .  94 GLU H    1 1 
        4  7242 1 1  94 GLU HA   H   0.980 -14.586  -0.209 1.00 . A A .  94 GLU HA   1 1 
        4  7243 1 1  94 GLU HB2  H   2.748 -13.086  -1.619 1.00 . A A .  94 GLU HB2  1 1 
        4  7244 1 1  94 GLU HB3  H   3.943 -13.937  -0.692 1.00 . A A .  94 GLU HB3  1 1 
        4  7245 1 1  94 GLU HG2  H   3.611 -15.103  -2.788 1.00 . A A .  94 GLU HG2  1 1 
        4  7246 1 1  94 GLU HG3  H   2.928 -16.158  -1.556 1.00 . A A .  94 GLU HG3  1 1 
        4  7247 1 1  94 GLU N    N   1.579 -12.717   0.608 1.00 . A A .  94 GLU N    1 1 
        4  7248 1 1  94 GLU O    O   3.697 -15.174   1.492 1.00 . A A .  94 GLU O    1 1 
        4  7249 1 1  94 GLU OE1  O   1.238 -14.270  -3.627 1.00 . A A .  94 GLU OE1  1 1 
        4  7250 1 1  94 GLU OE2  O   0.669 -16.111  -2.619 1.00 . A A .  94 GLU OE2  1 1 
        4  7251 1 1  95 GLN C    C   0.509 -15.909   4.345 1.00 . A A .  95 GLN C    1 1 
        4  7252 1 1  95 GLN CA   C   1.881 -15.631   3.650 1.00 . A A .  95 GLN CA   1 1 
        4  7253 1 1  95 GLN CB   C   2.577 -14.422   4.340 1.00 . A A .  95 GLN CB   1 1 
        4  7254 1 1  95 GLN CD   C   4.308 -13.679   6.028 1.00 . A A .  95 GLN CD   1 1 
        4  7255 1 1  95 GLN CG   C   3.263 -14.736   5.683 1.00 . A A .  95 GLN CG   1 1 
        4  7256 1 1  95 GLN H    H   0.636 -14.983   2.029 1.00 . A A .  95 GLN H    1 1 
        4  7257 1 1  95 GLN HA   H   2.528 -16.530   3.688 1.00 . A A .  95 GLN HA   1 1 
        4  7258 1 1  95 GLN HB2  H   3.343 -14.018   3.655 1.00 . A A .  95 GLN HB2  1 1 
        4  7259 1 1  95 GLN HB3  H   1.863 -13.582   4.458 1.00 . A A .  95 GLN HB3  1 1 
        4  7260 1 1  95 GLN HE21 H   3.047 -12.724   7.235 1.00 . A A .  95 GLN HE21 1 1 
        4  7261 1 1  95 GLN HE22 H   4.722 -12.016   6.983 1.00 . A A .  95 GLN HE22 1 1 
        4  7262 1 1  95 GLN HG2  H   2.517 -14.851   6.493 1.00 . A A .  95 GLN HG2  1 1 
        4  7263 1 1  95 GLN HG3  H   3.788 -15.708   5.635 1.00 . A A .  95 GLN HG3  1 1 
        4  7264 1 1  95 GLN N    N   1.576 -15.337   2.234 1.00 . A A .  95 GLN N    1 1 
        4  7265 1 1  95 GLN NE2  N   4.017 -12.755   6.909 1.00 . A A .  95 GLN NE2  1 1 
        4  7266 1 1  95 GLN O    O  -0.498 -15.233   4.105 1.00 . A A .  95 GLN O    1 1 
        4  7267 1 1  95 GLN OE1  O   5.393 -13.665   5.453 1.00 . A A .  95 GLN OE1  1 1 
        4  7268 1 1  96 LEU C    C  -0.674 -15.877   7.292 1.00 . A A .  96 LEU C    1 1 
        4  7269 1 1  96 LEU CA   C  -0.591 -17.062   6.257 1.00 . A A .  96 LEU CA   1 1 
        4  7270 1 1  96 LEU CB   C  -0.404 -18.462   6.893 1.00 . A A .  96 LEU CB   1 1 
        4  7271 1 1  96 LEU CD1  C  -1.361 -20.608   7.797 1.00 . A A .  96 LEU CD1  1 1 
        4  7272 1 1  96 LEU CD2  C  -2.229 -18.467   8.729 1.00 . A A .  96 LEU CD2  1 1 
        4  7273 1 1  96 LEU CG   C  -1.677 -19.133   7.466 1.00 . A A .  96 LEU CG   1 1 
        4  7274 1 1  96 LEU H    H   1.297 -17.498   5.109 1.00 . A A .  96 LEU H    1 1 
        4  7275 1 1  96 LEU HA   H  -1.538 -17.088   5.678 1.00 . A A .  96 LEU HA   1 1 
        4  7276 1 1  96 LEU HB2  H  -0.019 -19.152   6.113 1.00 . A A .  96 LEU HB2  1 1 
        4  7277 1 1  96 LEU HB3  H   0.394 -18.437   7.661 1.00 . A A .  96 LEU HB3  1 1 
        4  7278 1 1  96 LEU HD11 H  -0.576 -20.705   8.570 1.00 . A A .  96 LEU HD11 1 1 
        4  7279 1 1  96 LEU HD12 H  -2.253 -21.143   8.171 1.00 . A A .  96 LEU HD12 1 1 
        4  7280 1 1  96 LEU HD13 H  -1.015 -21.166   6.908 1.00 . A A .  96 LEU HD13 1 1 
        4  7281 1 1  96 LEU HD21 H  -3.085 -19.030   9.146 1.00 . A A .  96 LEU HD21 1 1 
        4  7282 1 1  96 LEU HD22 H  -1.471 -18.387   9.530 1.00 . A A .  96 LEU HD22 1 1 
        4  7283 1 1  96 LEU HD23 H  -2.602 -17.446   8.538 1.00 . A A .  96 LEU HD23 1 1 
        4  7284 1 1  96 LEU HG   H  -2.470 -19.134   6.688 1.00 . A A .  96 LEU HG   1 1 
        4  7285 1 1  96 LEU N    N   0.529 -16.852   5.284 1.00 . A A .  96 LEU N    1 1 
        4  7286 1 1  96 LEU O    O  -0.197 -15.947   8.426 1.00 . A A .  96 LEU O    1 1 
        4  7287 1 1  97 ALA C    C  -2.107 -12.444   6.616 1.00 . A A .  97 ALA C    1 1 
        4  7288 1 1  97 ALA CA   C  -1.200 -13.432   7.439 1.00 . A A .  97 ALA CA   1 1 
        4  7289 1 1  97 ALA CB   C   0.250 -12.908   7.456 1.00 . A A .  97 ALA CB   1 1 
        4  7290 1 1  97 ALA H    H  -1.360 -14.822   5.785 1.00 . A A .  97 ALA H    1 1 
        4  7291 1 1  97 ALA HA   H  -1.596 -13.504   8.468 1.00 . A A .  97 ALA HA   1 1 
        4  7292 1 1  97 ALA HB1  H   0.677 -12.879   6.436 1.00 . A A .  97 ALA HB1  1 1 
        4  7293 1 1  97 ALA HB2  H   0.320 -11.885   7.868 1.00 . A A .  97 ALA HB2  1 1 
        4  7294 1 1  97 ALA HB3  H   0.904 -13.548   8.076 1.00 . A A .  97 ALA HB3  1 1 
        4  7295 1 1  97 ALA N    N  -1.251 -14.770   6.808 1.00 . A A .  97 ALA N    1 1 
        4  7296 1 1  97 ALA O    O  -2.458 -12.697   5.457 1.00 . A A .  97 ALA O    1 1 
        4  7297 1 1  98 LYS C    C  -2.871  -8.841   7.033 1.00 . A A .  98 LYS C    1 1 
        4  7298 1 1  98 LYS CA   C  -3.241 -10.248   6.489 1.00 . A A .  98 LYS CA   1 1 
        4  7299 1 1  98 LYS CB   C  -4.760 -10.544   6.634 1.00 . A A .  98 LYS CB   1 1 
        4  7300 1 1  98 LYS CD   C  -7.131 -10.125   5.838 1.00 . A A .  98 LYS CD   1 1 
        4  7301 1 1  98 LYS CE   C  -8.079  -9.554   4.768 1.00 . A A .  98 LYS CE   1 1 
        4  7302 1 1  98 LYS CG   C  -5.643  -9.811   5.603 1.00 . A A .  98 LYS CG   1 1 
        4  7303 1 1  98 LYS H    H  -2.108 -11.157   8.159 1.00 . A A .  98 LYS H    1 1 
        4  7304 1 1  98 LYS HA   H  -2.970 -10.293   5.411 1.00 . A A .  98 LYS HA   1 1 
        4  7305 1 1  98 LYS HB2  H  -4.927 -11.634   6.508 1.00 . A A .  98 LYS HB2  1 1 
        4  7306 1 1  98 LYS HB3  H  -5.088 -10.321   7.669 1.00 . A A .  98 LYS HB3  1 1 
        4  7307 1 1  98 LYS HD2  H  -7.289 -11.217   5.952 1.00 . A A .  98 LYS HD2  1 1 
        4  7308 1 1  98 LYS HD3  H  -7.421  -9.702   6.823 1.00 . A A .  98 LYS HD3  1 1 
        4  7309 1 1  98 LYS HE2  H  -9.111  -9.549   5.186 1.00 . A A .  98 LYS HE2  1 1 
        4  7310 1 1  98 LYS HE3  H  -7.845  -8.480   4.580 1.00 . A A .  98 LYS HE3  1 1 
        4  7311 1 1  98 LYS HG2  H  -5.478  -8.714   5.654 1.00 . A A .  98 LYS HG2  1 1 
        4  7312 1 1  98 LYS HG3  H  -5.331 -10.116   4.585 1.00 . A A .  98 LYS HG3  1 1 
        4  7313 1 1  98 LYS HZ1  H  -8.076 -11.369   3.680 1.00 . A A .  98 LYS HZ1  1 1 
        4  7314 1 1  98 LYS HZ2  H  -8.795 -10.140   2.852 1.00 . A A .  98 LYS HZ2  1 1 
        4  7315 1 1  98 LYS HZ3  H  -7.161 -10.207   2.962 1.00 . A A .  98 LYS HZ3  1 1 
        4  7316 1 1  98 LYS N    N  -2.481 -11.304   7.215 1.00 . A A .  98 LYS N    1 1 
        4  7317 1 1  98 LYS NZ   N  -8.034 -10.357   3.509 1.00 . A A .  98 LYS NZ   1 1 
        4  7318 1 1  98 LYS O    O  -2.946  -8.595   8.243 1.00 . A A .  98 LYS O    1 1 
        4  7319 1 1  99 ALA C    C  -3.597  -5.692   6.904 1.00 . A A .  99 ALA C    1 1 
        4  7320 1 1  99 ALA CA   C  -2.310  -6.482   6.489 1.00 . A A .  99 ALA CA   1 1 
        4  7321 1 1  99 ALA CB   C  -1.599  -5.857   5.277 1.00 . A A .  99 ALA CB   1 1 
        4  7322 1 1  99 ALA H    H  -2.059  -8.326   5.317 1.00 . A A .  99 ALA H    1 1 
        4  7323 1 1  99 ALA HA   H  -1.591  -6.446   7.335 1.00 . A A .  99 ALA HA   1 1 
        4  7324 1 1  99 ALA HB1  H  -2.253  -5.818   4.385 1.00 . A A .  99 ALA HB1  1 1 
        4  7325 1 1  99 ALA HB2  H  -1.279  -4.821   5.485 1.00 . A A .  99 ALA HB2  1 1 
        4  7326 1 1  99 ALA HB3  H  -0.696  -6.428   5.000 1.00 . A A .  99 ALA HB3  1 1 
        4  7327 1 1  99 ALA N    N  -2.548  -7.905   6.123 1.00 . A A .  99 ALA N    1 1 
        4  7328 1 1  99 ALA O    O  -4.154  -4.897   6.144 1.00 . A A .  99 ALA O    1 1 
        4  7329 1 1 100 ALA C    C  -5.539  -3.966   8.902 1.00 . A A . 100 ALA C    1 1 
        4  7330 1 1 100 ALA CA   C  -5.367  -5.498   8.636 1.00 . A A . 100 ALA CA   1 1 
        4  7331 1 1 100 ALA CB   C  -5.591  -6.314   9.924 1.00 . A A . 100 ALA CB   1 1 
        4  7332 1 1 100 ALA H    H  -3.569  -6.752   8.561 1.00 . A A . 100 ALA H    1 1 
        4  7333 1 1 100 ALA HA   H  -6.125  -5.818   7.892 1.00 . A A . 100 ALA HA   1 1 
        4  7334 1 1 100 ALA HB1  H  -6.575  -6.117  10.385 1.00 . A A . 100 ALA HB1  1 1 
        4  7335 1 1 100 ALA HB2  H  -5.551  -7.404   9.733 1.00 . A A . 100 ALA HB2  1 1 
        4  7336 1 1 100 ALA HB3  H  -4.832  -6.089  10.697 1.00 . A A . 100 ALA HB3  1 1 
        4  7337 1 1 100 ALA N    N  -4.040  -5.935   8.144 1.00 . A A . 100 ALA N    1 1 
        4  7338 1 1 100 ALA O    O  -4.532  -3.297   9.164 1.00 . A A . 100 ALA O    1 1 
        4  7339 1 1 101 PRO C    C  -6.735  -1.281  10.420 1.00 . A A . 101 PRO C    1 1 
        4  7340 1 1 101 PRO CA   C  -6.962  -1.885   9.006 1.00 . A A . 101 PRO CA   1 1 
        4  7341 1 1 101 PRO CB   C  -8.402  -1.697   8.452 1.00 . A A . 101 PRO CB   1 1 
        4  7342 1 1 101 PRO CD   C  -8.023  -4.076   8.516 1.00 . A A . 101 PRO CD   1 1 
        4  7343 1 1 101 PRO CG   C  -9.118  -3.028   8.761 1.00 . A A . 101 PRO CG   1 1 
        4  7344 1 1 101 PRO HA   H  -6.283  -1.369   8.297 1.00 . A A . 101 PRO HA   1 1 
        4  7345 1 1 101 PRO HB2  H  -8.933  -0.826   8.873 1.00 . A A . 101 PRO HB2  1 1 
        4  7346 1 1 101 PRO HB3  H  -8.354  -1.537   7.356 1.00 . A A . 101 PRO HB3  1 1 
        4  7347 1 1 101 PRO HD2  H  -8.186  -4.986   9.123 1.00 . A A . 101 PRO HD2  1 1 
        4  7348 1 1 101 PRO HD3  H  -7.999  -4.374   7.450 1.00 . A A . 101 PRO HD3  1 1 
        4  7349 1 1 101 PRO HG2  H  -9.436  -3.045   9.822 1.00 . A A . 101 PRO HG2  1 1 
        4  7350 1 1 101 PRO HG3  H -10.016  -3.187   8.139 1.00 . A A . 101 PRO HG3  1 1 
        4  7351 1 1 101 PRO N    N  -6.770  -3.371   8.876 1.00 . A A . 101 PRO N    1 1 
        4  7352 1 1 101 PRO O    O  -7.657  -0.863  11.126 1.00 . A A . 101 PRO O    1 1 
        4  7353 1 1 102 LYS C    C  -4.893   1.121  11.715 1.00 . A A . 102 LYS C    1 1 
        4  7354 1 1 102 LYS CA   C  -4.993  -0.417  11.982 1.00 . A A . 102 LYS CA   1 1 
        4  7355 1 1 102 LYS CB   C  -3.670  -1.034  12.520 1.00 . A A . 102 LYS CB   1 1 
        4  7356 1 1 102 LYS CD   C  -1.123  -1.255  12.133 1.00 . A A . 102 LYS CD   1 1 
        4  7357 1 1 102 LYS CE   C  -0.540   0.159  12.279 1.00 . A A . 102 LYS CE   1 1 
        4  7358 1 1 102 LYS CG   C  -2.526  -1.237  11.505 1.00 . A A . 102 LYS CG   1 1 
        4  7359 1 1 102 LYS H    H  -4.835  -1.751  10.205 1.00 . A A . 102 LYS H    1 1 
        4  7360 1 1 102 LYS HA   H  -5.732  -0.560  12.800 1.00 . A A . 102 LYS HA   1 1 
        4  7361 1 1 102 LYS HB2  H  -3.335  -0.412  13.374 1.00 . A A . 102 LYS HB2  1 1 
        4  7362 1 1 102 LYS HB3  H  -3.911  -2.014  12.980 1.00 . A A . 102 LYS HB3  1 1 
        4  7363 1 1 102 LYS HD2  H  -1.136  -1.798  13.098 1.00 . A A . 102 LYS HD2  1 1 
        4  7364 1 1 102 LYS HD3  H  -0.464  -1.855  11.473 1.00 . A A . 102 LYS HD3  1 1 
        4  7365 1 1 102 LYS HE2  H  -0.481   0.643  11.277 1.00 . A A . 102 LYS HE2  1 1 
        4  7366 1 1 102 LYS HE3  H  -1.216   0.817  12.869 1.00 . A A . 102 LYS HE3  1 1 
        4  7367 1 1 102 LYS HG2  H  -2.697  -2.196  10.975 1.00 . A A . 102 LYS HG2  1 1 
        4  7368 1 1 102 LYS HG3  H  -2.567  -0.475  10.702 1.00 . A A . 102 LYS HG3  1 1 
        4  7369 1 1 102 LYS HZ1  H   1.383  -0.700  12.526 1.00 . A A . 102 LYS HZ1  1 1 
        4  7370 1 1 102 LYS HZ2  H   1.401   0.970  12.663 1.00 . A A . 102 LYS HZ2  1 1 
        4  7371 1 1 102 LYS HZ3  H   0.820   0.008  13.909 1.00 . A A . 102 LYS HZ3  1 1 
        4  7372 1 1 102 LYS N    N  -5.453  -1.155  10.778 1.00 . A A . 102 LYS N    1 1 
        4  7373 1 1 102 LYS NZ   N   0.812   0.093  12.887 1.00 . A A . 102 LYS NZ   1 1 
        4  7374 1 1 102 LYS O    O  -3.815   1.666  11.458 1.00 . A A . 102 LYS O    1 1 
        4  7375 1 1 103 GLN C    C  -6.640   4.257  12.081 1.00 . A A . 103 GLN C    1 1 
        4  7376 1 1 103 GLN CA   C  -6.219   3.125  11.112 1.00 . A A . 103 GLN CA   1 1 
        4  7377 1 1 103 GLN CB   C  -7.108   2.970   9.854 1.00 . A A . 103 GLN CB   1 1 
        4  7378 1 1 103 GLN CD   C  -9.250   2.412   8.630 1.00 . A A . 103 GLN CD   1 1 
        4  7379 1 1 103 GLN CG   C  -8.563   2.492   9.993 1.00 . A A . 103 GLN CG   1 1 
        4  7380 1 1 103 GLN H    H  -6.858   1.160  11.853 1.00 . A A . 103 GLN H    1 1 
        4  7381 1 1 103 GLN HA   H  -5.247   3.457  10.679 1.00 . A A . 103 GLN HA   1 1 
        4  7382 1 1 103 GLN HB2  H  -7.103   3.945   9.329 1.00 . A A . 103 GLN HB2  1 1 
        4  7383 1 1 103 GLN HB3  H  -6.574   2.279   9.169 1.00 . A A . 103 GLN HB3  1 1 
        4  7384 1 1 103 GLN HE21 H -10.182   4.152   8.929 1.00 . A A . 103 GLN HE21 1 1 
        4  7385 1 1 103 GLN HE22 H -10.430   3.284   7.321 1.00 . A A . 103 GLN HE22 1 1 
        4  7386 1 1 103 GLN HG2  H  -8.602   1.485  10.443 1.00 . A A . 103 GLN HG2  1 1 
        4  7387 1 1 103 GLN HG3  H  -9.139   3.136  10.682 1.00 . A A . 103 GLN HG3  1 1 
        4  7388 1 1 103 GLN N    N  -6.055   1.793  11.749 1.00 . A A . 103 GLN N    1 1 
        4  7389 1 1 103 GLN NE2  N -10.062   3.378   8.272 1.00 . A A . 103 GLN NE2  1 1 
        4  7390 1 1 103 GLN O    O  -7.785   4.720  12.075 1.00 . A A . 103 GLN O    1 1 
        4  7391 1 1 103 GLN OE1  O  -9.042   1.486   7.854 1.00 . A A . 103 GLN OE1  1 1 
        4  7392 1 1 104 PHE C    C  -4.448   6.765  13.783 1.00 . A A . 104 PHE C    1 1 
        4  7393 1 1 104 PHE CA   C  -5.830   6.079  13.557 1.00 . A A . 104 PHE CA   1 1 
        4  7394 1 1 104 PHE CB   C  -6.685   5.941  14.845 1.00 . A A . 104 PHE CB   1 1 
        4  7395 1 1 104 PHE CD1  C  -8.478   7.760  14.756 1.00 . A A . 104 PHE CD1  1 1 
        4  7396 1 1 104 PHE CD2  C  -6.645   8.056  16.300 1.00 . A A . 104 PHE CD2  1 1 
        4  7397 1 1 104 PHE CE1  C  -9.014   8.985  15.155 1.00 . A A . 104 PHE CE1  1 1 
        4  7398 1 1 104 PHE CE2  C  -7.182   9.281  16.701 1.00 . A A . 104 PHE CE2  1 1 
        4  7399 1 1 104 PHE CG   C  -7.284   7.281  15.318 1.00 . A A . 104 PHE CG   1 1 
        4  7400 1 1 104 PHE CZ   C  -8.363   9.745  16.126 1.00 . A A . 104 PHE CZ   1 1 
        4  7401 1 1 104 PHE H    H  -4.768   4.297  12.776 1.00 . A A . 104 PHE H    1 1 
        4  7402 1 1 104 PHE HA   H  -6.399   6.739  12.875 1.00 . A A . 104 PHE HA   1 1 
        4  7403 1 1 104 PHE HB2  H  -7.522   5.239  14.662 1.00 . A A . 104 PHE HB2  1 1 
        4  7404 1 1 104 PHE HB3  H  -6.098   5.467  15.653 1.00 . A A . 104 PHE HB3  1 1 
        4  7405 1 1 104 PHE HD1  H  -8.986   7.181  13.993 1.00 . A A . 104 PHE HD1  1 1 
        4  7406 1 1 104 PHE HD2  H  -5.723   7.709  16.752 1.00 . A A . 104 PHE HD2  1 1 
        4  7407 1 1 104 PHE HE1  H  -9.936   9.341  14.712 1.00 . A A . 104 PHE HE1  1 1 
        4  7408 1 1 104 PHE HE2  H  -6.681   9.865  17.463 1.00 . A A . 104 PHE HE2  1 1 
        4  7409 1 1 104 PHE HZ   H  -8.783  10.691  16.442 1.00 . A A . 104 PHE HZ   1 1 
        4  7410 1 1 104 PHE N    N  -5.676   4.766  12.872 1.00 . A A . 104 PHE N    1 1 
        4  7411 1 1 104 PHE O    O  -3.947   6.843  14.909 1.00 . A A . 104 PHE O    1 1 
        4  7412 1 1 105 GLY C    C  -2.922   9.646  12.877 1.00 . A A . 105 GLY C    1 1 
        4  7413 1 1 105 GLY CA   C  -2.630   8.142  12.826 1.00 . A A . 105 GLY CA   1 1 
        4  7414 1 1 105 GLY H    H  -4.260   7.058  11.800 1.00 . A A . 105 GLY H    1 1 
        4  7415 1 1 105 GLY HA2  H  -1.999   7.836  13.685 1.00 . A A . 105 GLY HA2  1 1 
        4  7416 1 1 105 GLY HA3  H  -1.994   7.942  11.946 1.00 . A A . 105 GLY HA3  1 1 
        4  7417 1 1 105 GLY N    N  -3.854   7.318  12.713 1.00 . A A . 105 GLY N    1 1 
        4  7418 1 1 105 GLY O    O  -2.895  10.323  11.846 1.00 . A A . 105 GLY O    1 1 
        4  7419 1 1 106 ARG C    C  -2.265  12.538  14.326 1.00 . A A . 106 ARG C    1 1 
        4  7420 1 1 106 ARG CA   C  -3.524  11.621  14.256 1.00 . A A . 106 ARG CA   1 1 
        4  7421 1 1 106 ARG CB   C  -4.498  11.709  15.460 1.00 . A A . 106 ARG CB   1 1 
        4  7422 1 1 106 ARG CD   C  -4.520  13.613  17.184 1.00 . A A . 106 ARG CD   1 1 
        4  7423 1 1 106 ARG CG   C  -5.016  13.127  15.809 1.00 . A A . 106 ARG CG   1 1 
        4  7424 1 1 106 ARG CZ   C  -3.709  15.981  17.081 1.00 . A A . 106 ARG CZ   1 1 
        4  7425 1 1 106 ARG H    H  -3.242   9.488  14.836 1.00 . A A . 106 ARG H    1 1 
        4  7426 1 1 106 ARG HA   H  -4.108  11.959  13.372 1.00 . A A . 106 ARG HA   1 1 
        4  7427 1 1 106 ARG HB2  H  -5.379  11.076  15.220 1.00 . A A . 106 ARG HB2  1 1 
        4  7428 1 1 106 ARG HB3  H  -4.052  11.219  16.349 1.00 . A A . 106 ARG HB3  1 1 
        4  7429 1 1 106 ARG HD2  H  -5.105  13.107  17.979 1.00 . A A . 106 ARG HD2  1 1 
        4  7430 1 1 106 ARG HD3  H  -3.479  13.287  17.386 1.00 . A A . 106 ARG HD3  1 1 
        4  7431 1 1 106 ARG HE   H  -5.520  15.494  17.722 1.00 . A A . 106 ARG HE   1 1 
        4  7432 1 1 106 ARG HG2  H  -4.749  13.850  15.012 1.00 . A A . 106 ARG HG2  1 1 
        4  7433 1 1 106 ARG HG3  H  -6.125  13.123  15.808 1.00 . A A . 106 ARG HG3  1 1 
        4  7434 1 1 106 ARG HH11 H  -2.391  14.690  16.345 1.00 . A A . 106 ARG HH11 1 1 
        4  7435 1 1 106 ARG HH12 H  -1.911  16.471  16.384 1.00 . A A . 106 ARG HH12 1 1 
        4  7436 1 1 106 ARG HH21 H  -4.847  17.484  17.733 1.00 . A A . 106 ARG HH21 1 1 
        4  7437 1 1 106 ARG HH22 H  -3.193  17.892  17.075 1.00 . A A . 106 ARG HH22 1 1 
        4  7438 1 1 106 ARG N    N  -3.188  10.178  14.078 1.00 . A A . 106 ARG N    1 1 
        4  7439 1 1 106 ARG NE   N  -4.664  15.085  17.336 1.00 . A A . 106 ARG NE   1 1 
        4  7440 1 1 106 ARG NH1  N  -2.533  15.682  16.594 1.00 . A A . 106 ARG NH1  1 1 
        4  7441 1 1 106 ARG NH2  N  -3.949  17.238  17.312 1.00 . A A . 106 ARG NH2  1 1 
        4  7442 1 1 106 ARG O    O  -1.926  13.109  15.368 1.00 . A A . 106 ARG O    1 1 
        4  7443 1 1 107 ASN C    C  -1.357  15.139  12.579 1.00 . A A . 107 ASN C    1 1 
        4  7444 1 1 107 ASN CA   C  -0.623  13.820  12.972 1.00 . A A . 107 ASN CA   1 1 
        4  7445 1 1 107 ASN CB   C   0.416  13.393  11.914 1.00 . A A . 107 ASN CB   1 1 
        4  7446 1 1 107 ASN CG   C   1.746  14.134  12.017 1.00 . A A . 107 ASN CG   1 1 
        4  7447 1 1 107 ASN H    H  -1.990  12.153  12.400 1.00 . A A . 107 ASN H    1 1 
        4  7448 1 1 107 ASN HA   H  -0.073  13.949  13.931 1.00 . A A . 107 ASN HA   1 1 
        4  7449 1 1 107 ASN HB2  H   0.655  12.319  12.029 1.00 . A A . 107 ASN HB2  1 1 
        4  7450 1 1 107 ASN HB3  H   0.018  13.492  10.893 1.00 . A A . 107 ASN HB3  1 1 
        4  7451 1 1 107 ASN HD21 H   1.178  15.669  10.807 1.00 . A A . 107 ASN HD21 1 1 
        4  7452 1 1 107 ASN HD22 H   2.879  15.622  11.467 1.00 . A A . 107 ASN HD22 1 1 
        4  7453 1 1 107 ASN N    N  -1.642  12.757  13.154 1.00 . A A . 107 ASN N    1 1 
        4  7454 1 1 107 ASN ND2  N   1.973  15.189  11.274 1.00 . A A . 107 ASN ND2  1 1 
        4  7455 1 1 107 ASN O    O  -1.910  15.269  11.481 1.00 . A A . 107 ASN O    1 1 
        4  7456 1 1 107 ASN OD1  O   2.617  13.753  12.790 1.00 . A A . 107 ASN OD1  1 1 
        4  7457 1 1 108 LEU C    C  -1.124  18.297  14.434 1.00 . A A . 108 LEU C    1 1 
        4  7458 1 1 108 LEU CA   C  -1.844  17.457  13.340 1.00 . A A . 108 LEU CA   1 1 
        4  7459 1 1 108 LEU CB   C  -3.385  17.543  13.347 1.00 . A A . 108 LEU CB   1 1 
        4  7460 1 1 108 LEU CD1  C  -4.110  19.875  14.163 1.00 . A A . 108 LEU CD1  1 1 
        4  7461 1 1 108 LEU CD2  C  -3.491  19.565  11.754 1.00 . A A . 108 LEU CD2  1 1 
        4  7462 1 1 108 LEU CG   C  -4.065  18.883  12.998 1.00 . A A . 108 LEU CG   1 1 
        4  7463 1 1 108 LEU H    H  -0.809  15.779  14.337 1.00 . A A . 108 LEU H    1 1 
        4  7464 1 1 108 LEU HA   H  -1.494  17.789  12.342 1.00 . A A . 108 LEU HA   1 1 
        4  7465 1 1 108 LEU HB2  H  -3.760  16.811  12.604 1.00 . A A . 108 LEU HB2  1 1 
        4  7466 1 1 108 LEU HB3  H  -3.788  17.172  14.306 1.00 . A A . 108 LEU HB3  1 1 
        4  7467 1 1 108 LEU HD11 H  -4.734  20.753  13.912 1.00 . A A . 108 LEU HD11 1 1 
        4  7468 1 1 108 LEU HD12 H  -4.548  19.429  15.074 1.00 . A A . 108 LEU HD12 1 1 
        4  7469 1 1 108 LEU HD13 H  -3.114  20.266  14.437 1.00 . A A . 108 LEU HD13 1 1 
        4  7470 1 1 108 LEU HD21 H  -4.115  20.421  11.437 1.00 . A A . 108 LEU HD21 1 1 
        4  7471 1 1 108 LEU HD22 H  -2.469  19.957  11.910 1.00 . A A . 108 LEU HD22 1 1 
        4  7472 1 1 108 LEU HD23 H  -3.445  18.880  10.888 1.00 . A A . 108 LEU HD23 1 1 
        4  7473 1 1 108 LEU HG   H  -5.123  18.631  12.761 1.00 . A A . 108 LEU HG   1 1 
        4  7474 1 1 108 LEU N    N  -1.393  16.055  13.543 1.00 . A A . 108 LEU N    1 1 
        4  7475 1 1 108 LEU O    O  -1.536  18.302  15.603 1.00 . A A . 108 LEU O    1 1 
        4  7476 1 1 109 ALA C    C   1.630  20.814  14.198 1.00 . A A . 109 ALA C    1 1 
        4  7477 1 1 109 ALA CA   C   0.897  19.659  14.958 1.00 . A A . 109 ALA CA   1 1 
        4  7478 1 1 109 ALA CB   C   1.861  18.645  15.593 1.00 . A A . 109 ALA CB   1 1 
        4  7479 1 1 109 ALA H    H   0.318  18.647  13.089 1.00 . A A . 109 ALA H    1 1 
        4  7480 1 1 109 ALA HA   H   0.304  20.143  15.762 1.00 . A A . 109 ALA HA   1 1 
        4  7481 1 1 109 ALA HB1  H   2.630  19.131  16.221 1.00 . A A . 109 ALA HB1  1 1 
        4  7482 1 1 109 ALA HB2  H   1.320  17.930  16.240 1.00 . A A . 109 ALA HB2  1 1 
        4  7483 1 1 109 ALA HB3  H   2.381  18.050  14.818 1.00 . A A . 109 ALA HB3  1 1 
        4  7484 1 1 109 ALA N    N  -0.008  18.923  14.043 1.00 . A A . 109 ALA N    1 1 
        4  7485 1 1 109 ALA O    O   1.383  21.982  14.503 1.00 . A A . 109 ALA O    1 1 
        4  7486 1 1 110 ARG C    C   2.747  20.862  10.815 1.00 . A A . 110 ARG C    1 1 
        4  7487 1 1 110 ARG CA   C   2.993  21.485  12.220 1.00 . A A . 110 ARG CA   1 1 
        4  7488 1 1 110 ARG CB   C   4.471  21.820  12.545 1.00 . A A . 110 ARG CB   1 1 
        4  7489 1 1 110 ARG CD   C   6.199  22.667  10.745 1.00 . A A . 110 ARG CD   1 1 
        4  7490 1 1 110 ARG CG   C   5.076  23.002  11.751 1.00 . A A . 110 ARG CG   1 1 
        4  7491 1 1 110 ARG CZ   C   5.749  22.063   8.351 1.00 . A A . 110 ARG CZ   1 1 
        4  7492 1 1 110 ARG H    H   2.448  19.492  12.974 1.00 . A A . 110 ARG H    1 1 
        4  7493 1 1 110 ARG HA   H   2.406  22.425  12.292 1.00 . A A . 110 ARG HA   1 1 
        4  7494 1 1 110 ARG HB2  H   4.519  22.090  13.621 1.00 . A A . 110 ARG HB2  1 1 
        4  7495 1 1 110 ARG HB3  H   5.102  20.913  12.467 1.00 . A A . 110 ARG HB3  1 1 
        4  7496 1 1 110 ARG HD2  H   6.628  23.623  10.384 1.00 . A A . 110 ARG HD2  1 1 
        4  7497 1 1 110 ARG HD3  H   7.029  22.142  11.259 1.00 . A A . 110 ARG HD3  1 1 
        4  7498 1 1 110 ARG HE   H   4.966  21.096   9.871 1.00 . A A . 110 ARG HE   1 1 
        4  7499 1 1 110 ARG HG2  H   4.289  23.594  11.240 1.00 . A A . 110 ARG HG2  1 1 
        4  7500 1 1 110 ARG HG3  H   5.499  23.718  12.486 1.00 . A A . 110 ARG HG3  1 1 
        4  7501 1 1 110 ARG HH11 H   7.208  23.390   8.438 1.00 . A A . 110 ARG HH11 1 1 
        4  7502 1 1 110 ARG HH12 H   6.603  22.919   6.748 1.00 . A A . 110 ARG HH12 1 1 
        4  7503 1 1 110 ARG HH21 H   4.306  20.744   8.025 1.00 . A A . 110 ARG HH21 1 1 
        4  7504 1 1 110 ARG HH22 H   4.921  21.721   6.569 1.00 . A A . 110 ARG HH22 1 1 
        4  7505 1 1 110 ARG N    N   2.494  20.492  13.215 1.00 . A A . 110 ARG N    1 1 
        4  7506 1 1 110 ARG NE   N   5.673  21.823   9.651 1.00 . A A . 110 ARG NE   1 1 
        4  7507 1 1 110 ARG NH1  N   6.564  22.924   7.802 1.00 . A A . 110 ARG NH1  1 1 
        4  7508 1 1 110 ARG NH2  N   4.959  21.386   7.575 1.00 . A A . 110 ARG NH2  1 1 
        4  7509 1 1 110 ARG O    O   3.603  20.154  10.270 1.00 . A A . 110 ARG O    1 1 
        4  7510 1 1 111 ASP C    C   0.460  21.221   7.982 1.00 . A A . 111 ASP C    1 1 
        4  7511 1 1 111 ASP CA   C   1.038  20.307   9.118 1.00 . A A . 111 ASP CA   1 1 
        4  7512 1 1 111 ASP CB   C  -0.074  19.347   9.608 1.00 . A A . 111 ASP CB   1 1 
        4  7513 1 1 111 ASP CG   C   0.382  18.123  10.393 1.00 . A A . 111 ASP CG   1 1 
        4  7514 1 1 111 ASP H    H   0.902  21.602  10.856 1.00 . A A . 111 ASP H    1 1 
        4  7515 1 1 111 ASP HA   H   1.849  19.697   8.685 1.00 . A A . 111 ASP HA   1 1 
        4  7516 1 1 111 ASP HB2  H  -0.829  19.895  10.194 1.00 . A A . 111 ASP HB2  1 1 
        4  7517 1 1 111 ASP HB3  H  -0.625  18.969   8.732 1.00 . A A . 111 ASP HB3  1 1 
        4  7518 1 1 111 ASP N    N   1.557  21.105  10.251 1.00 . A A . 111 ASP N    1 1 
        4  7519 1 1 111 ASP O    O  -0.175  22.251   8.222 1.00 . A A . 111 ASP O    1 1 
        4  7520 1 1 111 ASP OD1  O   0.880  18.272  11.531 1.00 . A A . 111 ASP OD1  1 1 
        4  7521 1 1 111 ASP OD2  O   0.202  16.987   9.900 1.00 . A A . 111 ASP OD2  1 1 
        4  7522 1 1 112 LYS C    C  -1.298  20.244   5.196 1.00 . A A . 112 LYS C    1 1 
        4  7523 1 1 112 LYS CA   C  -0.156  21.253   5.567 1.00 . A A . 112 LYS CA   1 1 
        4  7524 1 1 112 LYS CB   C   0.878  21.510   4.451 1.00 . A A . 112 LYS CB   1 1 
        4  7525 1 1 112 LYS CD   C   1.522  22.566   2.263 1.00 . A A . 112 LYS CD   1 1 
        4  7526 1 1 112 LYS CE   C   1.180  23.501   1.101 1.00 . A A . 112 LYS CE   1 1 
        4  7527 1 1 112 LYS CG   C   0.371  22.369   3.270 1.00 . A A . 112 LYS CG   1 1 
        4  7528 1 1 112 LYS H    H   0.918  19.765   6.774 1.00 . A A . 112 LYS H    1 1 
        4  7529 1 1 112 LYS HA   H  -0.637  22.215   5.830 1.00 . A A . 112 LYS HA   1 1 
        4  7530 1 1 112 LYS HB2  H   1.761  22.025   4.890 1.00 . A A . 112 LYS HB2  1 1 
        4  7531 1 1 112 LYS HB3  H   1.268  20.546   4.068 1.00 . A A . 112 LYS HB3  1 1 
        4  7532 1 1 112 LYS HD2  H   2.412  22.938   2.815 1.00 . A A . 112 LYS HD2  1 1 
        4  7533 1 1 112 LYS HD3  H   1.802  21.569   1.868 1.00 . A A . 112 LYS HD3  1 1 
        4  7534 1 1 112 LYS HE2  H   0.408  23.035   0.449 1.00 . A A . 112 LYS HE2  1 1 
        4  7535 1 1 112 LYS HE3  H   0.713  24.440   1.472 1.00 . A A . 112 LYS HE3  1 1 
        4  7536 1 1 112 LYS HG2  H  -0.495  21.883   2.779 1.00 . A A . 112 LYS HG2  1 1 
        4  7537 1 1 112 LYS HG3  H   0.009  23.346   3.648 1.00 . A A . 112 LYS HG3  1 1 
        4  7538 1 1 112 LYS HZ1  H   3.124  24.302   0.905 1.00 . A A . 112 LYS HZ1  1 1 
        4  7539 1 1 112 LYS HZ2  H   2.934  22.981  -0.026 1.00 . A A . 112 LYS HZ2  1 1 
        4  7540 1 1 112 LYS HZ3  H   2.288  24.416  -0.491 1.00 . A A . 112 LYS HZ3  1 1 
        4  7541 1 1 112 LYS N    N   0.616  20.739   6.741 1.00 . A A . 112 LYS N    1 1 
        4  7542 1 1 112 LYS NZ   N   2.425  23.808   0.339 1.00 . A A . 112 LYS NZ   1 1 
        4  7543 1 1 112 LYS O    O  -1.299  19.601   4.145 1.00 . A A . 112 LYS O    1 1 
        4  7544 1 1 113 LYS C    C  -4.228  19.320   7.329 1.00 . A A . 113 LYS C    1 1 
        4  7545 1 1 113 LYS CA   C  -3.193  18.953   6.221 1.00 . A A . 113 LYS CA   1 1 
        4  7546 1 1 113 LYS CB   C  -2.408  17.646   6.501 1.00 . A A . 113 LYS CB   1 1 
        4  7547 1 1 113 LYS CD   C  -3.405  16.111   8.292 1.00 . A A . 113 LYS CD   1 1 
        4  7548 1 1 113 LYS CE   C  -4.061  14.751   8.549 1.00 . A A . 113 LYS CE   1 1 
        4  7549 1 1 113 LYS CG   C  -3.197  16.360   6.786 1.00 . A A . 113 LYS CG   1 1 
        4  7550 1 1 113 LYS H    H  -1.990  20.640   6.982 1.00 . A A . 113 LYS H    1 1 
        4  7551 1 1 113 LYS HA   H  -3.711  18.860   5.244 1.00 . A A . 113 LYS HA   1 1 
        4  7552 1 1 113 LYS HB2  H  -1.782  17.454   5.606 1.00 . A A . 113 LYS HB2  1 1 
        4  7553 1 1 113 LYS HB3  H  -1.659  17.802   7.298 1.00 . A A . 113 LYS HB3  1 1 
        4  7554 1 1 113 LYS HD2  H  -2.419  16.165   8.805 1.00 . A A . 113 LYS HD2  1 1 
        4  7555 1 1 113 LYS HD3  H  -4.011  16.926   8.735 1.00 . A A . 113 LYS HD3  1 1 
        4  7556 1 1 113 LYS HE2  H  -5.063  14.696   8.070 1.00 . A A . 113 LYS HE2  1 1 
        4  7557 1 1 113 LYS HE3  H  -3.479  13.940   8.062 1.00 . A A . 113 LYS HE3  1 1 
        4  7558 1 1 113 LYS HG2  H  -4.155  16.342   6.232 1.00 . A A . 113 LYS HG2  1 1 
        4  7559 1 1 113 LYS HG3  H  -2.612  15.515   6.368 1.00 . A A . 113 LYS HG3  1 1 
        4  7560 1 1 113 LYS HZ1  H  -4.536  13.598  10.264 1.00 . A A . 113 LYS HZ1  1 1 
        4  7561 1 1 113 LYS HZ2  H  -3.231  14.650  10.495 1.00 . A A . 113 LYS HZ2  1 1 
        4  7562 1 1 113 LYS HZ3  H  -4.747  15.225  10.474 1.00 . A A . 113 LYS HZ3  1 1 
        4  7563 1 1 113 LYS N    N  -2.232  20.095   6.144 1.00 . A A . 113 LYS N    1 1 
        4  7564 1 1 113 LYS NZ   N  -4.149  14.532  10.015 1.00 . A A . 113 LYS NZ   1 1 
        4  7565 1 1 113 LYS O    O  -3.839  19.677   8.444 1.00 . A A . 113 LYS O    1 1 
        4  7566 1 1 114 LYS C    C  -6.826  18.989   9.238 1.00 . A A . 114 LYS C    1 1 
        4  7567 1 1 114 LYS CA   C  -6.592  19.804   7.933 1.00 . A A . 114 LYS CA   1 1 
        4  7568 1 1 114 LYS CB   C  -7.842  20.100   7.065 1.00 . A A . 114 LYS CB   1 1 
        4  7569 1 1 114 LYS CD   C -10.112  21.226   6.840 1.00 . A A . 114 LYS CD   1 1 
        4  7570 1 1 114 LYS CE   C -11.266  22.015   7.487 1.00 . A A . 114 LYS CE   1 1 
        4  7571 1 1 114 LYS CG   C  -8.927  20.937   7.781 1.00 . A A . 114 LYS CG   1 1 
        4  7572 1 1 114 LYS H    H  -5.742  18.947   6.071 1.00 . A A . 114 LYS H    1 1 
        4  7573 1 1 114 LYS HA   H  -6.220  20.793   8.272 1.00 . A A . 114 LYS HA   1 1 
        4  7574 1 1 114 LYS HB2  H  -7.515  20.657   6.161 1.00 . A A . 114 LYS HB2  1 1 
        4  7575 1 1 114 LYS HB3  H  -8.279  19.157   6.682 1.00 . A A . 114 LYS HB3  1 1 
        4  7576 1 1 114 LYS HD2  H  -9.762  21.733   5.918 1.00 . A A . 114 LYS HD2  1 1 
        4  7577 1 1 114 LYS HD3  H -10.521  20.258   6.483 1.00 . A A . 114 LYS HD3  1 1 
        4  7578 1 1 114 LYS HE2  H -12.162  21.922   6.830 1.00 . A A . 114 LYS HE2  1 1 
        4  7579 1 1 114 LYS HE3  H -11.571  21.530   8.442 1.00 . A A . 114 LYS HE3  1 1 
        4  7580 1 1 114 LYS HG2  H  -9.284  20.400   8.683 1.00 . A A . 114 LYS HG2  1 1 
        4  7581 1 1 114 LYS HG3  H  -8.478  21.880   8.150 1.00 . A A . 114 LYS HG3  1 1 
        4  7582 1 1 114 LYS HZ1  H -11.689  24.007   8.096 1.00 . A A . 114 LYS HZ1  1 1 
        4  7583 1 1 114 LYS HZ2  H -10.115  23.583   8.313 1.00 . A A . 114 LYS HZ2  1 1 
        4  7584 1 1 114 LYS HZ3  H -10.667  23.924   6.811 1.00 . A A . 114 LYS HZ3  1 1 
        4  7585 1 1 114 LYS N    N  -5.539  19.235   7.033 1.00 . A A . 114 LYS N    1 1 
        4  7586 1 1 114 LYS NZ   N -10.922  23.454   7.689 1.00 . A A . 114 LYS NZ   1 1 
        4  7587 1 1 114 LYS O    O  -6.314  19.394  10.282 1.00 . A A . 114 LYS O    1 1 
        4  7588 1 1 115 GLN C    C  -8.252  15.587   9.870 1.00 . A A . 115 GLN C    1 1 
        4  7589 1 1 115 GLN CA   C  -7.692  16.955  10.371 1.00 . A A . 115 GLN CA   1 1 
        4  7590 1 1 115 GLN CB   C  -8.535  17.529  11.536 1.00 . A A . 115 GLN CB   1 1 
        4  7591 1 1 115 GLN CD   C  -7.236  16.313  13.445 1.00 . A A . 115 GLN CD   1 1 
        4  7592 1 1 115 GLN CG   C  -8.582  16.664  12.819 1.00 . A A . 115 GLN CG   1 1 
        4  7593 1 1 115 GLN H    H  -7.885  17.575   8.287 1.00 . A A . 115 GLN H    1 1 
        4  7594 1 1 115 GLN HA   H  -6.657  16.810  10.746 1.00 . A A . 115 GLN HA   1 1 
        4  7595 1 1 115 GLN HB2  H  -8.153  18.534  11.805 1.00 . A A . 115 GLN HB2  1 1 
        4  7596 1 1 115 GLN HB3  H  -9.574  17.706  11.193 1.00 . A A . 115 GLN HB3  1 1 
        4  7597 1 1 115 GLN HE21 H  -7.499  17.662  14.885 1.00 . A A . 115 GLN HE21 1 1 
        4  7598 1 1 115 GLN HE22 H  -5.934  16.692  14.861 1.00 . A A . 115 GLN HE22 1 1 
        4  7599 1 1 115 GLN HG2  H  -9.236  17.173  13.554 1.00 . A A . 115 GLN HG2  1 1 
        4  7600 1 1 115 GLN HG3  H  -9.111  15.716  12.609 1.00 . A A . 115 GLN HG3  1 1 
        4  7601 1 1 115 GLN N    N  -7.582  17.878   9.214 1.00 . A A . 115 GLN N    1 1 
        4  7602 1 1 115 GLN NE2  N  -6.884  16.912  14.556 1.00 . A A . 115 GLN NE2  1 1 
        4  7603 1 1 115 GLN O    O  -9.313  15.508   9.248 1.00 . A A . 115 GLN O    1 1 
        4  7604 1 1 115 GLN OE1  O  -6.475  15.492  12.935 1.00 . A A . 115 GLN OE1  1 1 
        4  7605 1 1 116 ARG C    C  -6.891  12.195  10.674 1.00 . A A . 116 ARG C    1 1 
        4  7606 1 1 116 ARG CA   C  -7.882  13.124   9.899 1.00 . A A . 116 ARG CA   1 1 
        4  7607 1 1 116 ARG CB   C  -7.882  12.831   8.380 1.00 . A A . 116 ARG CB   1 1 
        4  7608 1 1 116 ARG CD   C  -9.809  11.056   8.248 1.00 . A A . 116 ARG CD   1 1 
        4  7609 1 1 116 ARG CG   C  -8.359  11.440   7.926 1.00 . A A . 116 ARG CG   1 1 
        4  7610 1 1 116 ARG CZ   C -10.963   9.582   9.908 1.00 . A A . 116 ARG CZ   1 1 
        4  7611 1 1 116 ARG H    H  -6.911  14.767  10.992 1.00 . A A . 116 ARG H    1 1 
        4  7612 1 1 116 ARG HA   H  -8.912  12.969  10.283 1.00 . A A . 116 ARG HA   1 1 
        4  7613 1 1 116 ARG HB2  H  -8.497  13.587   7.854 1.00 . A A . 116 ARG HB2  1 1 
        4  7614 1 1 116 ARG HB3  H  -6.862  12.979   7.973 1.00 . A A . 116 ARG HB3  1 1 
        4  7615 1 1 116 ARG HD2  H -10.447  11.957   8.356 1.00 . A A . 116 ARG HD2  1 1 
        4  7616 1 1 116 ARG HD3  H -10.213  10.498   7.376 1.00 . A A . 116 ARG HD3  1 1 
        4  7617 1 1 116 ARG HE   H  -9.018   9.879   9.929 1.00 . A A . 116 ARG HE   1 1 
        4  7618 1 1 116 ARG HG2  H  -8.231  11.420   6.823 1.00 . A A . 116 ARG HG2  1 1 
        4  7619 1 1 116 ARG HG3  H  -7.639  10.667   8.259 1.00 . A A . 116 ARG HG3  1 1 
        4  7620 1 1 116 ARG HH11 H -12.203  10.481   8.680 1.00 . A A . 116 ARG HH11 1 1 
        4  7621 1 1 116 ARG HH12 H -12.948   9.280   9.841 1.00 . A A . 116 ARG HH12 1 1 
        4  7622 1 1 116 ARG HH21 H  -9.855   8.538  11.194 1.00 . A A . 116 ARG HH21 1 1 
        4  7623 1 1 116 ARG HH22 H -11.662   8.243  11.208 1.00 . A A . 116 ARG HH22 1 1 
        4  7624 1 1 116 ARG N    N  -7.498  14.530  10.187 1.00 . A A . 116 ARG N    1 1 
        4  7625 1 1 116 ARG NE   N  -9.874  10.193   9.456 1.00 . A A . 116 ARG NE   1 1 
        4  7626 1 1 116 ARG NH1  N -12.165   9.797   9.438 1.00 . A A . 116 ARG NH1  1 1 
        4  7627 1 1 116 ARG NH2  N -10.825   8.722  10.874 1.00 . A A . 116 ARG NH2  1 1 
        4  7628 1 1 116 ARG O    O  -5.680  12.192  10.420 1.00 . A A . 116 ARG O    1 1 
        4  7629 1 1 117 GLY C    C  -7.063   8.952  11.390 1.00 . A A . 117 GLY C    1 1 
        4  7630 1 1 117 GLY CA   C  -6.725  10.232  12.163 1.00 . A A . 117 GLY CA   1 1 
        4  7631 1 1 117 GLY H    H  -8.384  11.623  11.868 1.00 . A A . 117 GLY H    1 1 
        4  7632 1 1 117 GLY HA2  H  -5.640  10.410  12.217 1.00 . A A . 117 GLY HA2  1 1 
        4  7633 1 1 117 GLY HA3  H  -7.044  10.094  13.212 1.00 . A A . 117 GLY HA3  1 1 
        4  7634 1 1 117 GLY N    N  -7.428  11.399  11.604 1.00 . A A . 117 GLY N    1 1 
        4  7635 1 1 117 GLY O    O  -8.155   8.406  11.567 1.00 . A A . 117 GLY O    1 1 
        4  7636 1 1 118 ARG C    C  -5.023   6.545   9.366 1.00 . A A . 118 ARG C    1 1 
        4  7637 1 1 118 ARG CA   C  -6.359   7.314   9.653 1.00 . A A . 118 ARG CA   1 1 
        4  7638 1 1 118 ARG CB   C  -7.108   7.761   8.370 1.00 . A A . 118 ARG CB   1 1 
        4  7639 1 1 118 ARG CD   C  -6.822   6.212   6.340 1.00 . A A . 118 ARG CD   1 1 
        4  7640 1 1 118 ARG CG   C  -7.705   6.631   7.519 1.00 . A A . 118 ARG CG   1 1 
        4  7641 1 1 118 ARG CZ   C  -6.690   3.728   6.106 1.00 . A A . 118 ARG CZ   1 1 
        4  7642 1 1 118 ARG H    H  -5.359   9.153  10.391 1.00 . A A . 118 ARG H    1 1 
        4  7643 1 1 118 ARG HA   H  -7.002   6.598  10.202 1.00 . A A . 118 ARG HA   1 1 
        4  7644 1 1 118 ARG HB2  H  -7.970   8.380   8.682 1.00 . A A . 118 ARG HB2  1 1 
        4  7645 1 1 118 ARG HB3  H  -6.485   8.444   7.761 1.00 . A A . 118 ARG HB3  1 1 
        4  7646 1 1 118 ARG HD2  H  -6.920   6.957   5.526 1.00 . A A . 118 ARG HD2  1 1 
        4  7647 1 1 118 ARG HD3  H  -5.743   6.224   6.587 1.00 . A A . 118 ARG HD3  1 1 
        4  7648 1 1 118 ARG HE   H  -8.005   4.843   5.086 1.00 . A A . 118 ARG HE   1 1 
        4  7649 1 1 118 ARG HG2  H  -7.951   5.766   8.165 1.00 . A A . 118 ARG HG2  1 1 
        4  7650 1 1 118 ARG HG3  H  -8.683   6.958   7.114 1.00 . A A . 118 ARG HG3  1 1 
        4  7651 1 1 118 ARG HH11 H  -5.420   4.397   7.512 1.00 . A A . 118 ARG HH11 1 1 
        4  7652 1 1 118 ARG HH12 H  -5.307   2.617   6.994 1.00 . A A . 118 ARG HH12 1 1 
        4  7653 1 1 118 ARG HH21 H  -8.011   2.804   4.928 1.00 . A A . 118 ARG HH21 1 1 
        4  7654 1 1 118 ARG HH22 H  -6.712   1.772   5.760 1.00 . A A . 118 ARG HH22 1 1 
        4  7655 1 1 118 ARG N    N  -6.158   8.522  10.509 1.00 . A A . 118 ARG N    1 1 
        4  7656 1 1 118 ARG NE   N  -7.265   4.896   5.829 1.00 . A A . 118 ARG NE   1 1 
        4  7657 1 1 118 ARG NH1  N  -5.670   3.576   6.911 1.00 . A A . 118 ARG NH1  1 1 
        4  7658 1 1 118 ARG NH2  N  -7.170   2.660   5.549 1.00 . A A . 118 ARG NH2  1 1 
        4  7659 1 1 118 ARG O    O  -5.081   5.404   8.854 1.00 . A A . 118 ARG O    1 1 
        4  7660 1 1 118 ARG OXT  O  -3.912   7.066   9.631 1.00 . A A . 118 ARG OXT  1 1 
        5  7661 1 1   1 MET C    C   9.577  17.742  -7.732 1.00 . A A .   1 MET C    1 1 
        5  7662 1 1   1 MET CA   C   9.006  19.190  -7.713 1.00 . A A .   1 MET CA   1 1 
        5  7663 1 1   1 MET CB   C  10.020  20.264  -7.266 1.00 . A A .   1 MET CB   1 1 
        5  7664 1 1   1 MET CE   C  12.003  21.545  -3.866 1.00 . A A .   1 MET CE   1 1 
        5  7665 1 1   1 MET CG   C  10.520  20.246  -5.820 1.00 . A A .   1 MET CG   1 1 
        5  7666 1 1   1 MET H1   H   7.825  19.216  -5.943 1.00 . A A .   1 MET H1   1 1 
        5  7667 1 1   1 MET H2   H   7.340  20.290  -7.107 1.00 . A A .   1 MET H2   1 1 
        5  7668 1 1   1 MET H3   H   6.998  18.671  -7.275 1.00 . A A .   1 MET H3   1 1 
        5  7669 1 1   1 MET HA   H   8.780  19.449  -8.772 1.00 . A A .   1 MET HA   1 1 
        5  7670 1 1   1 MET HB2  H  10.906  20.225  -7.933 1.00 . A A .   1 MET HB2  1 1 
        5  7671 1 1   1 MET HB3  H   9.588  21.263  -7.472 1.00 . A A .   1 MET HB3  1 1 
        5  7672 1 1   1 MET HE1  H  12.529  20.603  -3.629 1.00 . A A .   1 MET HE1  1 1 
        5  7673 1 1   1 MET HE2  H  12.654  22.381  -3.553 1.00 . A A .   1 MET HE2  1 1 
        5  7674 1 1   1 MET HE3  H  11.082  21.591  -3.256 1.00 . A A .   1 MET HE3  1 1 
        5  7675 1 1   1 MET HG2  H   9.697  20.337  -5.087 1.00 . A A .   1 MET HG2  1 1 
        5  7676 1 1   1 MET HG3  H  11.065  19.314  -5.580 1.00 . A A .   1 MET HG3  1 1 
        5  7677 1 1   1 MET N    N   7.727  19.330  -6.965 1.00 . A A .   1 MET N    1 1 
        5  7678 1 1   1 MET O    O   9.354  16.957  -6.806 1.00 . A A .   1 MET O    1 1 
        5  7679 1 1   1 MET SD   S  11.634  21.657  -5.623 1.00 . A A .   1 MET SD   1 1 
        5  7680 1 1   2 ALA C    C  12.507  16.237  -8.472 1.00 . A A .   2 ALA C    1 1 
        5  7681 1 1   2 ALA CA   C  11.024  16.123  -8.945 1.00 . A A .   2 ALA CA   1 1 
        5  7682 1 1   2 ALA CB   C  10.951  15.735 -10.431 1.00 . A A .   2 ALA CB   1 1 
        5  7683 1 1   2 ALA H    H  10.579  18.191  -9.409 1.00 . A A .   2 ALA H    1 1 
        5  7684 1 1   2 ALA HA   H  10.503  15.332  -8.363 1.00 . A A .   2 ALA HA   1 1 
        5  7685 1 1   2 ALA HB1  H  11.414  16.490 -11.094 1.00 . A A .   2 ALA HB1  1 1 
        5  7686 1 1   2 ALA HB2  H  11.464  14.777 -10.632 1.00 . A A .   2 ALA HB2  1 1 
        5  7687 1 1   2 ALA HB3  H   9.907  15.597 -10.763 1.00 . A A .   2 ALA HB3  1 1 
        5  7688 1 1   2 ALA N    N  10.296  17.408  -8.815 1.00 . A A .   2 ALA N    1 1 
        5  7689 1 1   2 ALA O    O  13.145  17.286  -8.597 1.00 . A A .   2 ALA O    1 1 
        5  7690 1 1   3 GLY C    C  14.257  15.545  -5.761 1.00 . A A .   3 GLY C    1 1 
        5  7691 1 1   3 GLY CA   C  14.350  15.130  -7.237 1.00 . A A .   3 GLY CA   1 1 
        5  7692 1 1   3 GLY H    H  12.406  14.326  -7.960 1.00 . A A .   3 GLY H    1 1 
        5  7693 1 1   3 GLY HA2  H  14.803  14.124  -7.317 1.00 . A A .   3 GLY HA2  1 1 
        5  7694 1 1   3 GLY HA3  H  15.061  15.803  -7.754 1.00 . A A .   3 GLY HA3  1 1 
        5  7695 1 1   3 GLY N    N  13.030  15.136  -7.918 1.00 . A A .   3 GLY N    1 1 
        5  7696 1 1   3 GLY O    O  14.567  16.687  -5.416 1.00 . A A .   3 GLY O    1 1 
        5  7697 1 1   4 SER C    C  13.964  14.831  -2.381 1.00 . A A .   4 SER C    1 1 
        5  7698 1 1   4 SER CA   C  13.096  15.055  -3.646 1.00 . A A .   4 SER CA   1 1 
        5  7699 1 1   4 SER CB   C  11.731  14.321  -3.608 1.00 . A A .   4 SER CB   1 1 
        5  7700 1 1   4 SER H    H  13.564  13.735  -5.341 1.00 . A A .   4 SER H    1 1 
        5  7701 1 1   4 SER HA   H  12.833  16.136  -3.698 1.00 . A A .   4 SER HA   1 1 
        5  7702 1 1   4 SER HB2  H  11.289  14.271  -4.622 1.00 . A A .   4 SER HB2  1 1 
        5  7703 1 1   4 SER HB3  H  11.841  13.272  -3.272 1.00 . A A .   4 SER HB3  1 1 
        5  7704 1 1   4 SER HG   H  11.246  15.491  -2.003 1.00 . A A .   4 SER HG   1 1 
        5  7705 1 1   4 SER N    N  13.764  14.639  -4.906 1.00 . A A .   4 SER N    1 1 
        5  7706 1 1   4 SER O    O  13.865  13.806  -1.699 1.00 . A A .   4 SER O    1 1 
        5  7707 1 1   4 SER OG   O  10.783  14.998  -2.788 1.00 . A A .   4 SER OG   1 1 
        5  7708 1 1   5 GLY C    C  16.412  15.207  -0.202 1.00 . A A .   5 GLY C    1 1 
        5  7709 1 1   5 GLY CA   C  15.250  16.080  -0.672 1.00 . A A .   5 GLY CA   1 1 
        5  7710 1 1   5 GLY H    H  14.807  16.577  -2.764 1.00 . A A .   5 GLY H    1 1 
        5  7711 1 1   5 GLY HA2  H  15.577  17.133  -0.595 1.00 . A A .   5 GLY HA2  1 1 
        5  7712 1 1   5 GLY HA3  H  14.395  16.028   0.032 1.00 . A A .   5 GLY HA3  1 1 
        5  7713 1 1   5 GLY N    N  14.781  15.844  -2.054 1.00 . A A .   5 GLY N    1 1 
        5  7714 1 1   5 GLY O    O  17.579  15.494  -0.473 1.00 . A A .   5 GLY O    1 1 
        5  7715 1 1   6 ILE C    C  17.272  11.995   0.062 1.00 . A A .   6 ILE C    1 1 
        5  7716 1 1   6 ILE CA   C  17.048  13.161   1.060 1.00 . A A .   6 ILE CA   1 1 
        5  7717 1 1   6 ILE CB   C  16.730  12.774   2.549 1.00 . A A .   6 ILE CB   1 1 
        5  7718 1 1   6 ILE CD1  C  17.867  11.895   4.707 1.00 . A A .   6 ILE CD1  1 1 
        5  7719 1 1   6 ILE CG1  C  17.888  11.952   3.178 1.00 . A A .   6 ILE CG1  1 1 
        5  7720 1 1   6 ILE CG2  C  15.373  12.089   2.751 1.00 . A A .   6 ILE CG2  1 1 
        5  7721 1 1   6 ILE H    H  15.051  13.964   0.410 1.00 . A A .   6 ILE H    1 1 
        5  7722 1 1   6 ILE HA   H  18.009  13.695   1.165 1.00 . A A .   6 ILE HA   1 1 
        5  7723 1 1   6 ILE HB   H  16.689  13.745   3.091 1.00 . A A .   6 ILE HB   1 1 
        5  7724 1 1   6 ILE HD11 H  16.976  11.377   5.104 1.00 . A A .   6 ILE HD11 1 1 
        5  7725 1 1   6 ILE HD12 H  18.749  11.349   5.092 1.00 . A A .   6 ILE HD12 1 1 
        5  7726 1 1   6 ILE HD13 H  17.891  12.902   5.161 1.00 . A A .   6 ILE HD13 1 1 
        5  7727 1 1   6 ILE HG12 H  17.901  10.923   2.767 1.00 . A A .   6 ILE HG12 1 1 
        5  7728 1 1   6 ILE HG13 H  18.862  12.389   2.878 1.00 . A A .   6 ILE HG13 1 1 
        5  7729 1 1   6 ILE HG21 H  15.104  12.014   3.819 1.00 . A A .   6 ILE HG21 1 1 
        5  7730 1 1   6 ILE HG22 H  14.589  12.687   2.265 1.00 . A A .   6 ILE HG22 1 1 
        5  7731 1 1   6 ILE HG23 H  15.326  11.076   2.320 1.00 . A A .   6 ILE HG23 1 1 
        5  7732 1 1   6 ILE N    N  16.058  14.142   0.522 1.00 . A A .   6 ILE N    1 1 
        5  7733 1 1   6 ILE O    O  16.669  10.921   0.176 1.00 . A A .   6 ILE O    1 1 
        5  7734 1 1   7 ILE C    C  19.361  10.085  -1.702 1.00 . A A .   7 ILE C    1 1 
        5  7735 1 1   7 ILE CA   C  18.375  11.243  -2.053 1.00 . A A .   7 ILE CA   1 1 
        5  7736 1 1   7 ILE CB   C  18.631  12.029  -3.378 1.00 . A A .   7 ILE CB   1 1 
        5  7737 1 1   7 ILE CD1  C  17.255  10.438  -4.912 1.00 . A A .   7 ILE CD1  1 1 
        5  7738 1 1   7 ILE CG1  C  18.585  11.149  -4.659 1.00 . A A .   7 ILE CG1  1 1 
        5  7739 1 1   7 ILE CG2  C  19.939  12.851  -3.406 1.00 . A A .   7 ILE CG2  1 1 
        5  7740 1 1   7 ILE H    H  18.485  13.185  -0.985 1.00 . A A .   7 ILE H    1 1 
        5  7741 1 1   7 ILE HA   H  17.400  10.750  -2.233 1.00 . A A .   7 ILE HA   1 1 
        5  7742 1 1   7 ILE HB   H  17.798  12.762  -3.476 1.00 . A A .   7 ILE HB   1 1 
        5  7743 1 1   7 ILE HD11 H  17.267   9.925  -5.892 1.00 . A A .   7 ILE HD11 1 1 
        5  7744 1 1   7 ILE HD12 H  17.038   9.663  -4.154 1.00 . A A .   7 ILE HD12 1 1 
        5  7745 1 1   7 ILE HD13 H  16.400  11.139  -4.924 1.00 . A A .   7 ILE HD13 1 1 
        5  7746 1 1   7 ILE HG12 H  18.798  11.791  -5.538 1.00 . A A .   7 ILE HG12 1 1 
        5  7747 1 1   7 ILE HG13 H  19.406  10.405  -4.647 1.00 . A A .   7 ILE HG13 1 1 
        5  7748 1 1   7 ILE HG21 H  20.007  13.563  -2.564 1.00 . A A .   7 ILE HG21 1 1 
        5  7749 1 1   7 ILE HG22 H  20.843  12.217  -3.362 1.00 . A A .   7 ILE HG22 1 1 
        5  7750 1 1   7 ILE HG23 H  20.012  13.457  -4.329 1.00 . A A .   7 ILE HG23 1 1 
        5  7751 1 1   7 ILE N    N  18.153  12.214  -0.932 1.00 . A A .   7 ILE N    1 1 
        5  7752 1 1   7 ILE O    O  20.466   9.956  -2.234 1.00 . A A .   7 ILE O    1 1 
        5  7753 1 1   8 TYR C    C  18.516   7.040   0.232 1.00 . A A .   8 TYR C    1 1 
        5  7754 1 1   8 TYR CA   C  19.599   7.985  -0.370 1.00 . A A .   8 TYR CA   1 1 
        5  7755 1 1   8 TYR CB   C  20.724   8.339   0.635 1.00 . A A .   8 TYR CB   1 1 
        5  7756 1 1   8 TYR CD1  C  22.448   6.491   0.220 1.00 . A A .   8 TYR CD1  1 1 
        5  7757 1 1   8 TYR CD2  C  21.458   6.664   2.416 1.00 . A A .   8 TYR CD2  1 1 
        5  7758 1 1   8 TYR CE1  C  23.181   5.379   0.640 1.00 . A A .   8 TYR CE1  1 1 
        5  7759 1 1   8 TYR CE2  C  22.202   5.560   2.836 1.00 . A A .   8 TYR CE2  1 1 
        5  7760 1 1   8 TYR CG   C  21.567   7.141   1.101 1.00 . A A .   8 TYR CG   1 1 
        5  7761 1 1   8 TYR CZ   C  23.058   4.915   1.948 1.00 . A A .   8 TYR CZ   1 1 
        5  7762 1 1   8 TYR H    H  18.000   9.524  -0.398 1.00 . A A .   8 TYR H    1 1 
        5  7763 1 1   8 TYR HA   H  20.048   7.509  -1.264 1.00 . A A .   8 TYR HA   1 1 
        5  7764 1 1   8 TYR HB2  H  21.407   9.077   0.168 1.00 . A A .   8 TYR HB2  1 1 
        5  7765 1 1   8 TYR HB3  H  20.298   8.876   1.505 1.00 . A A .   8 TYR HB3  1 1 
        5  7766 1 1   8 TYR HD1  H  22.556   6.839  -0.801 1.00 . A A .   8 TYR HD1  1 1 
        5  7767 1 1   8 TYR HD2  H  20.783   7.141   3.117 1.00 . A A .   8 TYR HD2  1 1 
        5  7768 1 1   8 TYR HE1  H  23.838   4.873  -0.057 1.00 . A A .   8 TYR HE1  1 1 
        5  7769 1 1   8 TYR HE2  H  22.096   5.188   3.848 1.00 . A A .   8 TYR HE2  1 1 
        5  7770 1 1   8 TYR HH   H  23.551   3.086   1.672 1.00 . A A .   8 TYR HH   1 1 
        5  7771 1 1   8 TYR N    N  18.891   9.212  -0.805 1.00 . A A .   8 TYR N    1 1 
        5  7772 1 1   8 TYR O    O  17.886   7.374   1.243 1.00 . A A .   8 TYR O    1 1 
        5  7773 1 1   8 TYR OH   O  23.705   3.778   2.335 1.00 . A A .   8 TYR OH   1 1 
        5  7774 1 1   9 LYS C    C  17.698   3.499  -0.159 1.00 . A A .   9 LYS C    1 1 
        5  7775 1 1   9 LYS CA   C  17.184   4.958   0.017 1.00 . A A .   9 LYS CA   1 1 
        5  7776 1 1   9 LYS CB   C  15.907   5.226  -0.820 1.00 . A A .   9 LYS CB   1 1 
        5  7777 1 1   9 LYS CD   C  13.742   6.011   0.412 1.00 . A A .   9 LYS CD   1 1 
        5  7778 1 1   9 LYS CE   C  14.269   6.845   1.591 1.00 . A A .   9 LYS CE   1 1 
        5  7779 1 1   9 LYS CG   C  14.595   4.846  -0.111 1.00 . A A .   9 LYS CG   1 1 
        5  7780 1 1   9 LYS H    H  18.899   5.647  -1.174 1.00 . A A .   9 LYS H    1 1 
        5  7781 1 1   9 LYS HA   H  16.959   5.126   1.091 1.00 . A A .   9 LYS HA   1 1 
        5  7782 1 1   9 LYS HB2  H  15.862   6.281  -1.149 1.00 . A A .   9 LYS HB2  1 1 
        5  7783 1 1   9 LYS HB3  H  15.971   4.678  -1.783 1.00 . A A .   9 LYS HB3  1 1 
        5  7784 1 1   9 LYS HD2  H  13.456   6.668  -0.429 1.00 . A A .   9 LYS HD2  1 1 
        5  7785 1 1   9 LYS HD3  H  12.775   5.565   0.728 1.00 . A A .   9 LYS HD3  1 1 
        5  7786 1 1   9 LYS HE2  H  13.386   7.298   2.097 1.00 . A A .   9 LYS HE2  1 1 
        5  7787 1 1   9 LYS HE3  H  14.728   6.194   2.368 1.00 . A A .   9 LYS HE3  1 1 
        5  7788 1 1   9 LYS HG2  H  13.963   4.307  -0.849 1.00 . A A .   9 LYS HG2  1 1 
        5  7789 1 1   9 LYS HG3  H  14.756   4.091   0.683 1.00 . A A .   9 LYS HG3  1 1 
        5  7790 1 1   9 LYS HZ1  H  15.152   8.786   1.716 1.00 . A A .   9 LYS HZ1  1 1 
        5  7791 1 1   9 LYS HZ2  H  16.210   7.646   1.189 1.00 . A A .   9 LYS HZ2  1 1 
        5  7792 1 1   9 LYS HZ3  H  15.063   8.223   0.169 1.00 . A A .   9 LYS HZ3  1 1 
        5  7793 1 1   9 LYS N    N  18.261   5.893  -0.409 1.00 . A A .   9 LYS N    1 1 
        5  7794 1 1   9 LYS NZ   N  15.204   7.925   1.159 1.00 . A A .   9 LYS NZ   1 1 
        5  7795 1 1   9 LYS O    O  18.156   3.122  -1.243 1.00 . A A .   9 LYS O    1 1 
        5  7796 1 1  10 GLN C    C  17.189   0.270   1.235 1.00 . A A .  10 GLN C    1 1 
        5  7797 1 1  10 GLN CA   C  18.279   1.348   0.922 1.00 . A A .  10 GLN CA   1 1 
        5  7798 1 1  10 GLN CB   C  19.433   1.289   1.956 1.00 . A A .  10 GLN CB   1 1 
        5  7799 1 1  10 GLN CD   C  21.541   2.109   0.606 1.00 . A A .  10 GLN CD   1 1 
        5  7800 1 1  10 GLN CG   C  20.588   2.293   1.775 1.00 . A A .  10 GLN CG   1 1 
        5  7801 1 1  10 GLN H    H  17.281   3.115   1.770 1.00 . A A .  10 GLN H    1 1 
        5  7802 1 1  10 GLN HA   H  18.732   1.128  -0.060 1.00 . A A .  10 GLN HA   1 1 
        5  7803 1 1  10 GLN HB2  H  19.021   1.442   2.974 1.00 . A A .  10 GLN HB2  1 1 
        5  7804 1 1  10 GLN HB3  H  19.848   0.261   1.975 1.00 . A A .  10 GLN HB3  1 1 
        5  7805 1 1  10 GLN HE21 H  20.149   2.636  -0.739 1.00 . A A .  10 GLN HE21 1 1 
        5  7806 1 1  10 GLN HE22 H  21.850   2.241  -1.333 1.00 . A A .  10 GLN HE22 1 1 
        5  7807 1 1  10 GLN HG2  H  20.210   3.332   1.765 1.00 . A A .  10 GLN HG2  1 1 
        5  7808 1 1  10 GLN HG3  H  21.198   2.255   2.698 1.00 . A A .  10 GLN HG3  1 1 
        5  7809 1 1  10 GLN N    N  17.657   2.699   0.912 1.00 . A A .  10 GLN N    1 1 
        5  7810 1 1  10 GLN NE2  N  21.127   2.348  -0.616 1.00 . A A .  10 GLN NE2  1 1 
        5  7811 1 1  10 GLN O    O  16.628   0.327   2.338 1.00 . A A .  10 GLN O    1 1 
        5  7812 1 1  10 GLN OE1  O  22.726   1.843   0.786 1.00 . A A .  10 GLN OE1  1 1 
        5  7813 1 1  11 PRO C    C  16.031  -2.843   1.552 1.00 . A A .  11 PRO C    1 1 
        5  7814 1 1  11 PRO CA   C  15.702  -1.653   0.610 1.00 . A A .  11 PRO CA   1 1 
        5  7815 1 1  11 PRO CB   C  15.293  -2.050  -0.834 1.00 . A A .  11 PRO CB   1 1 
        5  7816 1 1  11 PRO CD   C  17.359  -0.806  -1.035 1.00 . A A .  11 PRO CD   1 1 
        5  7817 1 1  11 PRO CG   C  16.617  -2.015  -1.628 1.00 . A A .  11 PRO CG   1 1 
        5  7818 1 1  11 PRO HA   H  14.854  -1.092   1.052 1.00 . A A .  11 PRO HA   1 1 
        5  7819 1 1  11 PRO HB2  H  14.776  -3.024  -0.901 1.00 . A A .  11 PRO HB2  1 1 
        5  7820 1 1  11 PRO HB3  H  14.592  -1.289  -1.234 1.00 . A A .  11 PRO HB3  1 1 
        5  7821 1 1  11 PRO HD2  H  18.456  -0.951  -1.060 1.00 . A A .  11 PRO HD2  1 1 
        5  7822 1 1  11 PRO HD3  H  17.118   0.117  -1.600 1.00 . A A .  11 PRO HD3  1 1 
        5  7823 1 1  11 PRO HG2  H  17.191  -2.945  -1.440 1.00 . A A .  11 PRO HG2  1 1 
        5  7824 1 1  11 PRO HG3  H  16.463  -1.932  -2.718 1.00 . A A .  11 PRO HG3  1 1 
        5  7825 1 1  11 PRO N    N  16.844  -0.710   0.351 1.00 . A A .  11 PRO N    1 1 
        5  7826 1 1  11 PRO O    O  16.110  -4.005   1.145 1.00 . A A .  11 PRO O    1 1 
        5  7827 1 1  12 ILE C    C  15.345  -3.192   5.087 1.00 . A A .  12 ILE C    1 1 
        5  7828 1 1  12 ILE CA   C  16.350  -3.514   3.941 1.00 . A A .  12 ILE CA   1 1 
        5  7829 1 1  12 ILE CB   C  17.856  -3.646   4.322 1.00 . A A .  12 ILE CB   1 1 
        5  7830 1 1  12 ILE CD1  C  17.839  -6.190   4.860 1.00 . A A .  12 ILE CD1  1 1 
        5  7831 1 1  12 ILE CG1  C  18.155  -4.776   5.345 1.00 . A A .  12 ILE CG1  1 1 
        5  7832 1 1  12 ILE CG2  C  18.524  -2.347   4.832 1.00 . A A .  12 ILE CG2  1 1 
        5  7833 1 1  12 ILE H    H  16.218  -1.505   2.994 1.00 . A A .  12 ILE H    1 1 
        5  7834 1 1  12 ILE HA   H  16.058  -4.508   3.548 1.00 . A A .  12 ILE HA   1 1 
        5  7835 1 1  12 ILE HB   H  18.383  -3.919   3.382 1.00 . A A .  12 ILE HB   1 1 
        5  7836 1 1  12 ILE HD11 H  18.345  -6.429   3.906 1.00 . A A .  12 ILE HD11 1 1 
        5  7837 1 1  12 ILE HD12 H  18.176  -6.941   5.599 1.00 . A A .  12 ILE HD12 1 1 
        5  7838 1 1  12 ILE HD13 H  16.758  -6.362   4.712 1.00 . A A .  12 ILE HD13 1 1 
        5  7839 1 1  12 ILE HG12 H  19.234  -4.748   5.604 1.00 . A A .  12 ILE HG12 1 1 
        5  7840 1 1  12 ILE HG13 H  17.630  -4.581   6.301 1.00 . A A .  12 ILE HG13 1 1 
        5  7841 1 1  12 ILE HG21 H  19.611  -2.487   4.977 1.00 . A A .  12 ILE HG21 1 1 
        5  7842 1 1  12 ILE HG22 H  18.411  -1.511   4.118 1.00 . A A .  12 ILE HG22 1 1 
        5  7843 1 1  12 ILE HG23 H  18.107  -2.005   5.796 1.00 . A A .  12 ILE HG23 1 1 
        5  7844 1 1  12 ILE N    N  16.163  -2.520   2.842 1.00 . A A .  12 ILE N    1 1 
        5  7845 1 1  12 ILE O    O  15.682  -2.598   6.114 1.00 . A A .  12 ILE O    1 1 
        5  7846 1 1  13 TYR C    C  11.707  -4.014   5.354 1.00 . A A .  13 TYR C    1 1 
        5  7847 1 1  13 TYR CA   C  12.926  -3.101   5.698 1.00 . A A .  13 TYR CA   1 1 
        5  7848 1 1  13 TYR CB   C  12.645  -1.601   5.416 1.00 . A A .  13 TYR CB   1 1 
        5  7849 1 1  13 TYR CD1  C  11.836  -0.909   7.752 1.00 . A A .  13 TYR CD1  1 1 
        5  7850 1 1  13 TYR CD2  C  10.602  -0.147   5.824 1.00 . A A .  13 TYR CD2  1 1 
        5  7851 1 1  13 TYR CE1  C  10.950  -0.228   8.590 1.00 . A A .  13 TYR CE1  1 1 
        5  7852 1 1  13 TYR CE2  C   9.734   0.556   6.664 1.00 . A A .  13 TYR CE2  1 1 
        5  7853 1 1  13 TYR CG   C  11.660  -0.894   6.356 1.00 . A A .  13 TYR CG   1 1 
        5  7854 1 1  13 TYR CZ   C   9.895   0.499   8.046 1.00 . A A .  13 TYR CZ   1 1 
        5  7855 1 1  13 TYR H    H  13.911  -4.065   3.996 1.00 . A A .  13 TYR H    1 1 
        5  7856 1 1  13 TYR HA   H  13.207  -3.248   6.761 1.00 . A A .  13 TYR HA   1 1 
        5  7857 1 1  13 TYR HB2  H  13.595  -1.033   5.483 1.00 . A A .  13 TYR HB2  1 1 
        5  7858 1 1  13 TYR HB3  H  12.336  -1.484   4.359 1.00 . A A .  13 TYR HB3  1 1 
        5  7859 1 1  13 TYR HD1  H  12.658  -1.454   8.200 1.00 . A A .  13 TYR HD1  1 1 
        5  7860 1 1  13 TYR HD2  H  10.439  -0.097   4.755 1.00 . A A .  13 TYR HD2  1 1 
        5  7861 1 1  13 TYR HE1  H  11.088  -0.278   9.662 1.00 . A A .  13 TYR HE1  1 1 
        5  7862 1 1  13 TYR HE2  H   8.916   1.114   6.233 1.00 . A A .  13 TYR HE2  1 1 
        5  7863 1 1  13 TYR HH   H   9.021   0.690   9.739 1.00 . A A .  13 TYR HH   1 1 
        5  7864 1 1  13 TYR N    N  14.071  -3.544   4.861 1.00 . A A .  13 TYR N    1 1 
        5  7865 1 1  13 TYR O    O  11.432  -4.284   4.178 1.00 . A A .  13 TYR O    1 1 
        5  7866 1 1  13 TYR OH   O   9.001   1.120   8.865 1.00 . A A .  13 TYR OH   1 1 
        5  7867 1 1  14 GLN C    C   8.823  -5.381   5.177 1.00 . A A .  14 GLN C    1 1 
        5  7868 1 1  14 GLN CA   C   9.927  -5.520   6.264 1.00 . A A .  14 GLN CA   1 1 
        5  7869 1 1  14 GLN CB   C   9.362  -5.880   7.662 1.00 . A A .  14 GLN CB   1 1 
        5  7870 1 1  14 GLN CD   C   9.060  -3.637   8.973 1.00 . A A .  14 GLN CD   1 1 
        5  7871 1 1  14 GLN CG   C   8.432  -4.906   8.411 1.00 . A A .  14 GLN CG   1 1 
        5  7872 1 1  14 GLN H    H  11.274  -4.111   7.302 1.00 . A A .  14 GLN H    1 1 
        5  7873 1 1  14 GLN HA   H  10.476  -6.438   5.964 1.00 . A A .  14 GLN HA   1 1 
        5  7874 1 1  14 GLN HB2  H   8.808  -6.838   7.564 1.00 . A A .  14 GLN HB2  1 1 
        5  7875 1 1  14 GLN HB3  H  10.215  -6.139   8.320 1.00 . A A .  14 GLN HB3  1 1 
        5  7876 1 1  14 GLN HE21 H   7.268  -2.971   9.511 1.00 . A A .  14 GLN HE21 1 1 
        5  7877 1 1  14 GLN HE22 H   8.734  -1.939   9.902 1.00 . A A .  14 GLN HE22 1 1 
        5  7878 1 1  14 GLN HG2  H   7.532  -4.679   7.803 1.00 . A A .  14 GLN HG2  1 1 
        5  7879 1 1  14 GLN HG3  H   8.011  -5.467   9.271 1.00 . A A .  14 GLN HG3  1 1 
        5  7880 1 1  14 GLN N    N  10.988  -4.476   6.385 1.00 . A A .  14 GLN N    1 1 
        5  7881 1 1  14 GLN NE2  N   8.254  -2.705   9.415 1.00 . A A .  14 GLN NE2  1 1 
        5  7882 1 1  14 GLN O    O   8.387  -6.397   4.630 1.00 . A A .  14 GLN O    1 1 
        5  7883 1 1  14 GLN OE1  O  10.272  -3.465   9.064 1.00 . A A .  14 GLN OE1  1 1 
        5  7884 1 1  15 GLY C    C   8.027  -2.550   2.958 1.00 . A A .  15 GLY C    1 1 
        5  7885 1 1  15 GLY CA   C   7.669  -3.895   3.587 1.00 . A A .  15 GLY CA   1 1 
        5  7886 1 1  15 GLY H    H   8.922  -3.432   5.354 1.00 . A A .  15 GLY H    1 1 
        5  7887 1 1  15 GLY HA2  H   7.818  -4.700   2.839 1.00 . A A .  15 GLY HA2  1 1 
        5  7888 1 1  15 GLY HA3  H   6.586  -3.893   3.780 1.00 . A A .  15 GLY HA3  1 1 
        5  7889 1 1  15 GLY N    N   8.402  -4.157   4.844 1.00 . A A .  15 GLY N    1 1 
        5  7890 1 1  15 GLY O    O   7.272  -1.585   3.082 1.00 . A A .  15 GLY O    1 1 
        5  7891 1 1  16 ASN C    C   8.673  -0.742   0.376 1.00 . A A .  16 ASN C    1 1 
        5  7892 1 1  16 ASN CA   C   9.608  -1.300   1.509 1.00 . A A .  16 ASN CA   1 1 
        5  7893 1 1  16 ASN CB   C  11.042  -1.624   1.020 1.00 . A A .  16 ASN CB   1 1 
        5  7894 1 1  16 ASN CG   C  11.883  -0.446   0.556 1.00 . A A .  16 ASN CG   1 1 
        5  7895 1 1  16 ASN H    H   9.761  -3.329   2.392 1.00 . A A .  16 ASN H    1 1 
        5  7896 1 1  16 ASN HA   H   9.678  -0.491   2.264 1.00 . A A .  16 ASN HA   1 1 
        5  7897 1 1  16 ASN HB2  H  11.617  -2.143   1.813 1.00 . A A .  16 ASN HB2  1 1 
        5  7898 1 1  16 ASN HB3  H  10.998  -2.357   0.192 1.00 . A A .  16 ASN HB3  1 1 
        5  7899 1 1  16 ASN HD21 H  12.168   0.181   2.438 1.00 . A A .  16 ASN HD21 1 1 
        5  7900 1 1  16 ASN HD22 H  12.953   1.122   1.065 1.00 . A A .  16 ASN HD22 1 1 
        5  7901 1 1  16 ASN N    N   9.151  -2.518   2.235 1.00 . A A .  16 ASN N    1 1 
        5  7902 1 1  16 ASN ND2  N  12.391   0.362   1.457 1.00 . A A .  16 ASN ND2  1 1 
        5  7903 1 1  16 ASN O    O   8.739   0.458   0.109 1.00 . A A .  16 ASN O    1 1 
        5  7904 1 1  16 ASN OD1  O  12.131  -0.255  -0.628 1.00 . A A .  16 ASN OD1  1 1 
        5  7905 1 1  17 LEU C    C   5.468  -0.795  -0.646 1.00 . A A .  17 LEU C    1 1 
        5  7906 1 1  17 LEU CA   C   6.866  -1.121  -1.303 1.00 . A A .  17 LEU CA   1 1 
        5  7907 1 1  17 LEU CB   C   6.852  -2.148  -2.467 1.00 . A A .  17 LEU CB   1 1 
        5  7908 1 1  17 LEU CD1  C   7.968  -3.604  -4.192 1.00 . A A .  17 LEU CD1  1 1 
        5  7909 1 1  17 LEU CD2  C   8.927  -1.334  -3.778 1.00 . A A .  17 LEU CD2  1 1 
        5  7910 1 1  17 LEU CG   C   8.206  -2.516  -3.128 1.00 . A A .  17 LEU CG   1 1 
        5  7911 1 1  17 LEU H    H   7.846  -2.537   0.089 1.00 . A A .  17 LEU H    1 1 
        5  7912 1 1  17 LEU HA   H   7.208  -0.154  -1.722 1.00 . A A .  17 LEU HA   1 1 
        5  7913 1 1  17 LEU HB2  H   6.390  -3.090  -2.109 1.00 . A A .  17 LEU HB2  1 1 
        5  7914 1 1  17 LEU HB3  H   6.170  -1.768  -3.252 1.00 . A A .  17 LEU HB3  1 1 
        5  7915 1 1  17 LEU HD11 H   8.916  -3.931  -4.659 1.00 . A A .  17 LEU HD11 1 1 
        5  7916 1 1  17 LEU HD12 H   7.503  -4.509  -3.760 1.00 . A A .  17 LEU HD12 1 1 
        5  7917 1 1  17 LEU HD13 H   7.309  -3.255  -5.009 1.00 . A A .  17 LEU HD13 1 1 
        5  7918 1 1  17 LEU HD21 H   9.903  -1.639  -4.198 1.00 . A A .  17 LEU HD21 1 1 
        5  7919 1 1  17 LEU HD22 H   8.347  -0.886  -4.605 1.00 . A A .  17 LEU HD22 1 1 
        5  7920 1 1  17 LEU HD23 H   9.140  -0.526  -3.054 1.00 . A A .  17 LEU HD23 1 1 
        5  7921 1 1  17 LEU HG   H   8.880  -2.950  -2.360 1.00 . A A .  17 LEU HG   1 1 
        5  7922 1 1  17 LEU N    N   7.822  -1.573  -0.255 1.00 . A A .  17 LEU N    1 1 
        5  7923 1 1  17 LEU O    O   5.408   0.142   0.150 1.00 . A A .  17 LEU O    1 1 
        5  7924 1 1  18 ILE C    C   2.999  -2.311   0.996 1.00 . A A .  18 ILE C    1 1 
        5  7925 1 1  18 ILE CA   C   3.054  -1.351  -0.229 1.00 . A A .  18 ILE CA   1 1 
        5  7926 1 1  18 ILE CB   C   1.886  -1.616  -1.247 1.00 . A A .  18 ILE CB   1 1 
        5  7927 1 1  18 ILE CD1  C   1.103   0.829  -1.818 1.00 . A A .  18 ILE CD1  1 1 
        5  7928 1 1  18 ILE CG1  C   1.744  -0.475  -2.291 1.00 . A A .  18 ILE CG1  1 1 
        5  7929 1 1  18 ILE CG2  C   0.502  -1.921  -0.624 1.00 . A A .  18 ILE CG2  1 1 
        5  7930 1 1  18 ILE H    H   4.498  -2.260  -1.633 1.00 . A A .  18 ILE H    1 1 
        5  7931 1 1  18 ILE HA   H   2.958  -0.305   0.129 1.00 . A A .  18 ILE HA   1 1 
        5  7932 1 1  18 ILE HB   H   2.152  -2.528  -1.828 1.00 . A A .  18 ILE HB   1 1 
        5  7933 1 1  18 ILE HD11 H   1.201   1.616  -2.588 1.00 . A A .  18 ILE HD11 1 1 
        5  7934 1 1  18 ILE HD12 H   0.024   0.712  -1.616 1.00 . A A .  18 ILE HD12 1 1 
        5  7935 1 1  18 ILE HD13 H   1.552   1.217  -0.889 1.00 . A A .  18 ILE HD13 1 1 
        5  7936 1 1  18 ILE HG12 H   2.737  -0.250  -2.726 1.00 . A A .  18 ILE HG12 1 1 
        5  7937 1 1  18 ILE HG13 H   1.166  -0.873  -3.144 1.00 . A A .  18 ILE HG13 1 1 
        5  7938 1 1  18 ILE HG21 H   0.507  -2.865  -0.047 1.00 . A A .  18 ILE HG21 1 1 
        5  7939 1 1  18 ILE HG22 H   0.163  -1.125   0.063 1.00 . A A .  18 ILE HG22 1 1 
        5  7940 1 1  18 ILE HG23 H  -0.269  -2.042  -1.406 1.00 . A A .  18 ILE HG23 1 1 
        5  7941 1 1  18 ILE N    N   4.372  -1.525  -0.933 1.00 . A A .  18 ILE N    1 1 
        5  7942 1 1  18 ILE O    O   3.133  -3.529   0.839 1.00 . A A .  18 ILE O    1 1 
        5  7943 1 1  19 LYS C    C   1.712  -1.719   4.479 1.00 . A A .  19 LYS C    1 1 
        5  7944 1 1  19 LYS CA   C   2.477  -2.569   3.410 1.00 . A A .  19 LYS CA   1 1 
        5  7945 1 1  19 LYS CB   C   3.808  -3.190   3.933 1.00 . A A .  19 LYS CB   1 1 
        5  7946 1 1  19 LYS CD   C   4.691  -5.077   5.540 1.00 . A A .  19 LYS CD   1 1 
        5  7947 1 1  19 LYS CE   C   4.780  -6.300   4.616 1.00 . A A .  19 LYS CE   1 1 
        5  7948 1 1  19 LYS CG   C   3.586  -4.099   5.144 1.00 . A A .  19 LYS CG   1 1 
        5  7949 1 1  19 LYS H    H   2.584  -0.751   2.196 1.00 . A A .  19 LYS H    1 1 
        5  7950 1 1  19 LYS HA   H   1.824  -3.411   3.107 1.00 . A A .  19 LYS HA   1 1 
        5  7951 1 1  19 LYS HB2  H   4.250  -3.769   3.100 1.00 . A A .  19 LYS HB2  1 1 
        5  7952 1 1  19 LYS HB3  H   4.531  -2.386   4.152 1.00 . A A .  19 LYS HB3  1 1 
        5  7953 1 1  19 LYS HD2  H   5.661  -4.563   5.659 1.00 . A A .  19 LYS HD2  1 1 
        5  7954 1 1  19 LYS HD3  H   4.448  -5.431   6.564 1.00 . A A .  19 LYS HD3  1 1 
        5  7955 1 1  19 LYS HE2  H   3.794  -6.811   4.594 1.00 . A A .  19 LYS HE2  1 1 
        5  7956 1 1  19 LYS HE3  H   4.963  -5.999   3.562 1.00 . A A .  19 LYS HE3  1 1 
        5  7957 1 1  19 LYS HG2  H   3.370  -3.445   6.006 1.00 . A A .  19 LYS HG2  1 1 
        5  7958 1 1  19 LYS HG3  H   2.656  -4.670   4.978 1.00 . A A .  19 LYS HG3  1 1 
        5  7959 1 1  19 LYS HZ1  H   6.802  -6.904   4.897 1.00 . A A .  19 LYS HZ1  1 1 
        5  7960 1 1  19 LYS HZ2  H   5.851  -7.338   6.172 1.00 . A A .  19 LYS HZ2  1 1 
        5  7961 1 1  19 LYS HZ3  H   5.771  -8.188   4.739 1.00 . A A .  19 LYS HZ3  1 1 
        5  7962 1 1  19 LYS N    N   2.733  -1.764   2.193 1.00 . A A .  19 LYS N    1 1 
        5  7963 1 1  19 LYS NZ   N   5.832  -7.230   5.099 1.00 . A A .  19 LYS NZ   1 1 
        5  7964 1 1  19 LYS O    O   2.024  -0.551   4.727 1.00 . A A .  19 LYS O    1 1 
        5  7965 1 1  20 GLN C    C   0.823  -1.439   7.588 1.00 . A A .  20 GLN C    1 1 
        5  7966 1 1  20 GLN CA   C  -0.001  -1.747   6.301 1.00 . A A .  20 GLN CA   1 1 
        5  7967 1 1  20 GLN CB   C  -1.269  -2.608   6.520 1.00 . A A .  20 GLN CB   1 1 
        5  7968 1 1  20 GLN CD   C  -3.691  -2.587   7.376 1.00 . A A .  20 GLN CD   1 1 
        5  7969 1 1  20 GLN CG   C  -2.274  -2.057   7.555 1.00 . A A .  20 GLN CG   1 1 
        5  7970 1 1  20 GLN H    H   0.545  -3.298   4.828 1.00 . A A .  20 GLN H    1 1 
        5  7971 1 1  20 GLN HA   H  -0.370  -0.763   5.961 1.00 . A A .  20 GLN HA   1 1 
        5  7972 1 1  20 GLN HB2  H  -1.785  -2.707   5.540 1.00 . A A .  20 GLN HB2  1 1 
        5  7973 1 1  20 GLN HB3  H  -1.003  -3.643   6.808 1.00 . A A .  20 GLN HB3  1 1 
        5  7974 1 1  20 GLN HE21 H  -3.246  -4.333   8.299 1.00 . A A .  20 GLN HE21 1 1 
        5  7975 1 1  20 GLN HE22 H  -4.952  -4.081   7.621 1.00 . A A .  20 GLN HE22 1 1 
        5  7976 1 1  20 GLN HG2  H  -1.925  -2.272   8.584 1.00 . A A .  20 GLN HG2  1 1 
        5  7977 1 1  20 GLN HG3  H  -2.324  -0.954   7.506 1.00 . A A .  20 GLN HG3  1 1 
        5  7978 1 1  20 GLN N    N   0.733  -2.345   5.145 1.00 . A A .  20 GLN N    1 1 
        5  7979 1 1  20 GLN NE2  N  -3.994  -3.783   7.820 1.00 . A A .  20 GLN NE2  1 1 
        5  7980 1 1  20 GLN O    O   0.519  -0.438   8.233 1.00 . A A .  20 GLN O    1 1 
        5  7981 1 1  20 GLN OE1  O  -4.549  -1.920   6.804 1.00 . A A .  20 GLN OE1  1 1 
        5  7982 1 1  21 ASN C    C   3.940  -0.889   8.463 1.00 . A A .  21 ASN C    1 1 
        5  7983 1 1  21 ASN CA   C   2.837  -1.833   8.998 1.00 . A A .  21 ASN CA   1 1 
        5  7984 1 1  21 ASN CB   C   3.364  -3.119   9.678 1.00 . A A .  21 ASN CB   1 1 
        5  7985 1 1  21 ASN CG   C   4.516  -2.961  10.666 1.00 . A A .  21 ASN CG   1 1 
        5  7986 1 1  21 ASN H    H   1.975  -3.035   7.330 1.00 . A A .  21 ASN H    1 1 
        5  7987 1 1  21 ASN HA   H   2.307  -1.228   9.761 1.00 . A A .  21 ASN HA   1 1 
        5  7988 1 1  21 ASN HB2  H   2.537  -3.574  10.247 1.00 . A A .  21 ASN HB2  1 1 
        5  7989 1 1  21 ASN HB3  H   3.637  -3.865   8.906 1.00 . A A .  21 ASN HB3  1 1 
        5  7990 1 1  21 ASN HD21 H   5.347  -4.663   9.995 1.00 . A A .  21 ASN HD21 1 1 
        5  7991 1 1  21 ASN HD22 H   6.148  -3.772  11.411 1.00 . A A .  21 ASN HD22 1 1 
        5  7992 1 1  21 ASN N    N   1.857  -2.221   7.940 1.00 . A A .  21 ASN N    1 1 
        5  7993 1 1  21 ASN ND2  N   5.481  -3.848  10.633 1.00 . A A .  21 ASN ND2  1 1 
        5  7994 1 1  21 ASN O    O   3.975   0.266   8.879 1.00 . A A .  21 ASN O    1 1 
        5  7995 1 1  21 ASN OD1  O   4.577  -2.034  11.466 1.00 . A A .  21 ASN OD1  1 1 
        5  7996 1 1  22 ALA C    C   5.830   0.804   6.588 1.00 . A A .  22 ALA C    1 1 
        5  7997 1 1  22 ALA CA   C   6.053  -0.603   7.198 1.00 . A A .  22 ALA CA   1 1 
        5  7998 1 1  22 ALA CB   C   6.822  -1.539   6.269 1.00 . A A .  22 ALA CB   1 1 
        5  7999 1 1  22 ALA H    H   4.639  -2.293   7.227 1.00 . A A .  22 ALA H    1 1 
        5  8000 1 1  22 ALA HA   H   6.675  -0.453   8.105 1.00 . A A .  22 ALA HA   1 1 
        5  8001 1 1  22 ALA HB1  H   7.097  -2.481   6.774 1.00 . A A .  22 ALA HB1  1 1 
        5  8002 1 1  22 ALA HB2  H   6.246  -1.804   5.369 1.00 . A A .  22 ALA HB2  1 1 
        5  8003 1 1  22 ALA HB3  H   7.763  -1.100   5.903 1.00 . A A .  22 ALA HB3  1 1 
        5  8004 1 1  22 ALA N    N   4.845  -1.364   7.597 1.00 . A A .  22 ALA N    1 1 
        5  8005 1 1  22 ALA O    O   6.550   1.735   6.949 1.00 . A A .  22 ALA O    1 1 
        5  8006 1 1  23 VAL C    C   3.696   3.192   6.384 1.00 . A A .  23 VAL C    1 1 
        5  8007 1 1  23 VAL CA   C   4.388   2.332   5.273 1.00 . A A .  23 VAL CA   1 1 
        5  8008 1 1  23 VAL CB   C   3.546   2.266   3.965 1.00 . A A .  23 VAL CB   1 1 
        5  8009 1 1  23 VAL CG1  C   3.323   3.667   3.352 1.00 . A A .  23 VAL CG1  1 1 
        5  8010 1 1  23 VAL CG2  C   4.169   1.384   2.863 1.00 . A A .  23 VAL CG2  1 1 
        5  8011 1 1  23 VAL H    H   4.227   0.142   5.601 1.00 . A A .  23 VAL H    1 1 
        5  8012 1 1  23 VAL HA   H   5.311   2.884   5.020 1.00 . A A .  23 VAL HA   1 1 
        5  8013 1 1  23 VAL HB   H   2.557   1.844   4.212 1.00 . A A .  23 VAL HB   1 1 
        5  8014 1 1  23 VAL HG11 H   2.672   3.623   2.462 1.00 . A A .  23 VAL HG11 1 1 
        5  8015 1 1  23 VAL HG12 H   2.828   4.361   4.054 1.00 . A A .  23 VAL HG12 1 1 
        5  8016 1 1  23 VAL HG13 H   4.271   4.146   3.047 1.00 . A A .  23 VAL HG13 1 1 
        5  8017 1 1  23 VAL HG21 H   3.491   1.282   2.000 1.00 . A A .  23 VAL HG21 1 1 
        5  8018 1 1  23 VAL HG22 H   5.131   1.781   2.489 1.00 . A A .  23 VAL HG22 1 1 
        5  8019 1 1  23 VAL HG23 H   4.375   0.356   3.213 1.00 . A A .  23 VAL HG23 1 1 
        5  8020 1 1  23 VAL N    N   4.803   0.982   5.746 1.00 . A A .  23 VAL N    1 1 
        5  8021 1 1  23 VAL O    O   4.030   4.371   6.488 1.00 . A A .  23 VAL O    1 1 
        5  8022 1 1  24 GLU C    C   3.344   3.754   9.508 1.00 . A A .  24 GLU C    1 1 
        5  8023 1 1  24 GLU CA   C   2.268   3.385   8.414 1.00 . A A .  24 GLU CA   1 1 
        5  8024 1 1  24 GLU CB   C   1.078   2.546   8.932 1.00 . A A .  24 GLU CB   1 1 
        5  8025 1 1  24 GLU CD   C  -1.251   2.508   9.968 1.00 . A A .  24 GLU CD   1 1 
        5  8026 1 1  24 GLU CG   C   0.033   3.310   9.766 1.00 . A A .  24 GLU CG   1 1 
        5  8027 1 1  24 GLU H    H   2.743   1.619   7.192 1.00 . A A .  24 GLU H    1 1 
        5  8028 1 1  24 GLU HA   H   1.860   4.345   8.046 1.00 . A A .  24 GLU HA   1 1 
        5  8029 1 1  24 GLU HB2  H   0.533   2.117   8.063 1.00 . A A .  24 GLU HB2  1 1 
        5  8030 1 1  24 GLU HB3  H   1.440   1.663   9.495 1.00 . A A .  24 GLU HB3  1 1 
        5  8031 1 1  24 GLU HG2  H   0.432   3.583  10.759 1.00 . A A .  24 GLU HG2  1 1 
        5  8032 1 1  24 GLU HG3  H  -0.254   4.258   9.280 1.00 . A A .  24 GLU HG3  1 1 
        5  8033 1 1  24 GLU N    N   2.791   2.647   7.214 1.00 . A A .  24 GLU N    1 1 
        5  8034 1 1  24 GLU O    O   3.261   4.820  10.119 1.00 . A A .  24 GLU O    1 1 
        5  8035 1 1  24 GLU OE1  O  -2.110   2.495   9.056 1.00 . A A .  24 GLU OE1  1 1 
        5  8036 1 1  24 GLU OE2  O  -1.417   1.896  11.043 1.00 . A A .  24 GLU OE2  1 1 
        5  8037 1 1  25 GLN C    C   6.644   4.103  10.045 1.00 . A A .  25 GLN C    1 1 
        5  8038 1 1  25 GLN CA   C   5.532   3.133  10.563 1.00 . A A .  25 GLN CA   1 1 
        5  8039 1 1  25 GLN CB   C   6.096   1.701  10.806 1.00 . A A .  25 GLN CB   1 1 
        5  8040 1 1  25 GLN CD   C   7.827   0.172  11.862 1.00 . A A .  25 GLN CD   1 1 
        5  8041 1 1  25 GLN CG   C   7.224   1.573  11.846 1.00 . A A .  25 GLN CG   1 1 
        5  8042 1 1  25 GLN H    H   4.229   2.009   9.183 1.00 . A A .  25 GLN H    1 1 
        5  8043 1 1  25 GLN HA   H   5.172   3.537  11.528 1.00 . A A .  25 GLN HA   1 1 
        5  8044 1 1  25 GLN HB2  H   5.269   1.029  11.122 1.00 . A A .  25 GLN HB2  1 1 
        5  8045 1 1  25 GLN HB3  H   6.443   1.289   9.834 1.00 . A A .  25 GLN HB3  1 1 
        5  8046 1 1  25 GLN HE21 H   6.434  -0.453  13.123 1.00 . A A .  25 GLN HE21 1 1 
        5  8047 1 1  25 GLN HE22 H   7.686  -1.669  12.574 1.00 . A A .  25 GLN HE22 1 1 
        5  8048 1 1  25 GLN HG2  H   8.046   2.280  11.626 1.00 . A A .  25 GLN HG2  1 1 
        5  8049 1 1  25 GLN HG3  H   6.865   1.860  12.852 1.00 . A A .  25 GLN HG3  1 1 
        5  8050 1 1  25 GLN N    N   4.364   2.905   9.680 1.00 . A A .  25 GLN N    1 1 
        5  8051 1 1  25 GLN NE2  N   7.323  -0.712  12.688 1.00 . A A .  25 GLN NE2  1 1 
        5  8052 1 1  25 GLN O    O   7.227   4.792  10.883 1.00 . A A .  25 GLN O    1 1 
        5  8053 1 1  25 GLN OE1  O   8.744  -0.139  11.106 1.00 . A A .  25 GLN OE1  1 1 
        5  8054 1 1  26 LEU C    C   8.678   6.176   8.615 1.00 . A A .  26 LEU C    1 1 
        5  8055 1 1  26 LEU CA   C   8.261   4.725   8.233 1.00 . A A .  26 LEU CA   1 1 
        5  8056 1 1  26 LEU CB   C   8.451   4.427   6.718 1.00 . A A .  26 LEU CB   1 1 
        5  8057 1 1  26 LEU CD1  C   7.461   6.406   5.378 1.00 . A A .  26 LEU CD1  1 1 
        5  8058 1 1  26 LEU CD2  C   7.614   4.156   4.361 1.00 . A A .  26 LEU CD2  1 1 
        5  8059 1 1  26 LEU CG   C   7.410   4.912   5.693 1.00 . A A .  26 LEU CG   1 1 
        5  8060 1 1  26 LEU H    H   6.474   3.425   8.181 1.00 . A A .  26 LEU H    1 1 
        5  8061 1 1  26 LEU HA   H   9.059   4.111   8.700 1.00 . A A .  26 LEU HA   1 1 
        5  8062 1 1  26 LEU HB2  H   9.465   4.754   6.415 1.00 . A A .  26 LEU HB2  1 1 
        5  8063 1 1  26 LEU HB3  H   8.509   3.323   6.649 1.00 . A A .  26 LEU HB3  1 1 
        5  8064 1 1  26 LEU HD11 H   8.423   6.710   4.933 1.00 . A A .  26 LEU HD11 1 1 
        5  8065 1 1  26 LEU HD12 H   6.653   6.705   4.679 1.00 . A A .  26 LEU HD12 1 1 
        5  8066 1 1  26 LEU HD13 H   7.307   7.019   6.273 1.00 . A A .  26 LEU HD13 1 1 
        5  8067 1 1  26 LEU HD21 H   8.600   4.375   3.910 1.00 . A A .  26 LEU HD21 1 1 
        5  8068 1 1  26 LEU HD22 H   7.545   3.060   4.489 1.00 . A A .  26 LEU HD22 1 1 
        5  8069 1 1  26 LEU HD23 H   6.843   4.430   3.617 1.00 . A A .  26 LEU HD23 1 1 
        5  8070 1 1  26 LEU HG   H   6.400   4.678   6.074 1.00 . A A .  26 LEU HG   1 1 
        5  8071 1 1  26 LEU N    N   6.984   4.125   8.739 1.00 . A A .  26 LEU N    1 1 
        5  8072 1 1  26 LEU O    O   9.879   6.450   8.661 1.00 . A A .  26 LEU O    1 1 
        5  8073 1 1  27 GLN C    C   9.017   9.342   8.657 1.00 . A A .  27 GLN C    1 1 
        5  8074 1 1  27 GLN CA   C   7.978   8.447   9.424 1.00 . A A .  27 GLN CA   1 1 
        5  8075 1 1  27 GLN CB   C   8.205   8.317  10.954 1.00 . A A .  27 GLN CB   1 1 
        5  8076 1 1  27 GLN CD   C   8.157   9.443  13.255 1.00 . A A .  27 GLN CD   1 1 
        5  8077 1 1  27 GLN CG   C   7.960   9.612  11.754 1.00 . A A .  27 GLN CG   1 1 
        5  8078 1 1  27 GLN H    H   6.810   6.601   8.985 1.00 . A A .  27 GLN H    1 1 
        5  8079 1 1  27 GLN HA   H   7.015   8.979   9.299 1.00 . A A .  27 GLN HA   1 1 
        5  8080 1 1  27 GLN HB2  H   7.534   7.529  11.358 1.00 . A A .  27 GLN HB2  1 1 
        5  8081 1 1  27 GLN HB3  H   9.228   7.939  11.143 1.00 . A A .  27 GLN HB3  1 1 
        5  8082 1 1  27 GLN HE21 H   6.302   8.739  13.474 1.00 . A A .  27 GLN HE21 1 1 
        5  8083 1 1  27 GLN HE22 H   7.371   8.889  14.968 1.00 . A A .  27 GLN HE22 1 1 
        5  8084 1 1  27 GLN HG2  H   8.654  10.405  11.420 1.00 . A A .  27 GLN HG2  1 1 
        5  8085 1 1  27 GLN HG3  H   6.949  10.013  11.550 1.00 . A A .  27 GLN HG3  1 1 
        5  8086 1 1  27 GLN N    N   7.715   7.075   8.880 1.00 . A A .  27 GLN N    1 1 
        5  8087 1 1  27 GLN NE2  N   7.147   9.019  13.978 1.00 . A A .  27 GLN NE2  1 1 
        5  8088 1 1  27 GLN O    O   9.885   9.984   9.252 1.00 . A A .  27 GLN O    1 1 
        5  8089 1 1  27 GLN OE1  O   9.222   9.699  13.805 1.00 . A A .  27 GLN OE1  1 1 
        5  8090 1 1  28 VAL C    C   8.978  11.564   6.104 1.00 . A A .  28 VAL C    1 1 
        5  8091 1 1  28 VAL CA   C   9.748  10.246   6.449 1.00 . A A .  28 VAL CA   1 1 
        5  8092 1 1  28 VAL CB   C  10.145   9.443   5.160 1.00 . A A .  28 VAL CB   1 1 
        5  8093 1 1  28 VAL CG1  C  10.977  10.283   4.160 1.00 . A A .  28 VAL CG1  1 1 
        5  8094 1 1  28 VAL CG2  C  10.979   8.178   5.477 1.00 . A A .  28 VAL CG2  1 1 
        5  8095 1 1  28 VAL H    H   8.244   8.701   6.952 1.00 . A A .  28 VAL H    1 1 
        5  8096 1 1  28 VAL HA   H  10.690  10.497   6.983 1.00 . A A .  28 VAL HA   1 1 
        5  8097 1 1  28 VAL HB   H   9.217   9.117   4.643 1.00 . A A .  28 VAL HB   1 1 
        5  8098 1 1  28 VAL HG11 H  10.386  11.108   3.722 1.00 . A A .  28 VAL HG11 1 1 
        5  8099 1 1  28 VAL HG12 H  11.868  10.737   4.635 1.00 . A A .  28 VAL HG12 1 1 
        5  8100 1 1  28 VAL HG13 H  11.325   9.678   3.303 1.00 . A A .  28 VAL HG13 1 1 
        5  8101 1 1  28 VAL HG21 H  11.252   7.629   4.558 1.00 . A A .  28 VAL HG21 1 1 
        5  8102 1 1  28 VAL HG22 H  11.916   8.416   6.015 1.00 . A A .  28 VAL HG22 1 1 
        5  8103 1 1  28 VAL HG23 H  10.423   7.458   6.106 1.00 . A A .  28 VAL HG23 1 1 
        5  8104 1 1  28 VAL N    N   8.876   9.414   7.326 1.00 . A A .  28 VAL N    1 1 
        5  8105 1 1  28 VAL O    O   7.893  11.513   5.520 1.00 . A A .  28 VAL O    1 1 
        5  8106 1 1  29 GLY C    C   9.915  14.910   5.110 1.00 . A A .  29 GLY C    1 1 
        5  8107 1 1  29 GLY CA   C   9.035  14.047   6.035 1.00 . A A .  29 GLY CA   1 1 
        5  8108 1 1  29 GLY H    H  10.520  12.617   6.811 1.00 . A A .  29 GLY H    1 1 
        5  8109 1 1  29 GLY HA2  H   8.038  13.972   5.572 1.00 . A A .  29 GLY HA2  1 1 
        5  8110 1 1  29 GLY HA3  H   8.855  14.629   6.957 1.00 . A A .  29 GLY HA3  1 1 
        5  8111 1 1  29 GLY N    N   9.579  12.720   6.422 1.00 . A A .  29 GLY N    1 1 
        5  8112 1 1  29 GLY O    O   9.973  16.124   5.291 1.00 . A A .  29 GLY O    1 1 
        5  8113 1 1  30 GLN C    C  11.713  14.241   1.829 1.00 . A A .  30 GLN C    1 1 
        5  8114 1 1  30 GLN CA   C  11.542  14.972   3.216 1.00 . A A .  30 GLN CA   1 1 
        5  8115 1 1  30 GLN CB   C  12.889  15.074   3.994 1.00 . A A .  30 GLN CB   1 1 
        5  8116 1 1  30 GLN CD   C  13.527  17.574   3.974 1.00 . A A .  30 GLN CD   1 1 
        5  8117 1 1  30 GLN CG   C  13.863  16.165   3.506 1.00 . A A .  30 GLN CG   1 1 
        5  8118 1 1  30 GLN H    H  10.528  13.272   4.210 1.00 . A A .  30 GLN H    1 1 
        5  8119 1 1  30 GLN HA   H  11.176  15.989   2.978 1.00 . A A .  30 GLN HA   1 1 
        5  8120 1 1  30 GLN HB2  H  12.702  15.240   5.074 1.00 . A A .  30 GLN HB2  1 1 
        5  8121 1 1  30 GLN HB3  H  13.399  14.092   3.963 1.00 . A A .  30 GLN HB3  1 1 
        5  8122 1 1  30 GLN HE21 H  12.720  18.039   2.185 1.00 . A A .  30 GLN HE21 1 1 
        5  8123 1 1  30 GLN HE22 H  12.767  19.332   3.521 1.00 . A A .  30 GLN HE22 1 1 
        5  8124 1 1  30 GLN HG2  H  14.868  15.928   3.903 1.00 . A A .  30 GLN HG2  1 1 
        5  8125 1 1  30 GLN HG3  H  13.991  16.136   2.408 1.00 . A A .  30 GLN HG3  1 1 
        5  8126 1 1  30 GLN N    N  10.568  14.289   4.118 1.00 . A A .  30 GLN N    1 1 
        5  8127 1 1  30 GLN NE2  N  12.959  18.405   3.137 1.00 . A A .  30 GLN NE2  1 1 
        5  8128 1 1  30 GLN O    O  12.816  14.210   1.270 1.00 . A A .  30 GLN O    1 1 
        5  8129 1 1  30 GLN OE1  O  13.790  17.955   5.110 1.00 . A A .  30 GLN OE1  1 1 
        5  8130 1 1  31 SER C    C   9.298  12.574  -0.591 1.00 . A A .  31 SER C    1 1 
        5  8131 1 1  31 SER CA   C  10.714  12.946  -0.046 1.00 . A A .  31 SER CA   1 1 
        5  8132 1 1  31 SER CB   C  11.564  11.638  -0.009 1.00 . A A .  31 SER CB   1 1 
        5  8133 1 1  31 SER H    H   9.811  13.629   1.862 1.00 . A A .  31 SER H    1 1 
        5  8134 1 1  31 SER HA   H  11.197  13.647  -0.753 1.00 . A A .  31 SER HA   1 1 
        5  8135 1 1  31 SER HB2  H  11.123  10.903   0.692 1.00 . A A .  31 SER HB2  1 1 
        5  8136 1 1  31 SER HB3  H  11.544  11.177  -1.012 1.00 . A A .  31 SER HB3  1 1 
        5  8137 1 1  31 SER HG   H  12.950  12.816   0.645 1.00 . A A .  31 SER HG   1 1 
        5  8138 1 1  31 SER N    N  10.651  13.616   1.276 1.00 . A A .  31 SER N    1 1 
        5  8139 1 1  31 SER O    O   8.629  11.710  -0.020 1.00 . A A .  31 SER O    1 1 
        5  8140 1 1  31 SER OG   O  12.923  11.881   0.343 1.00 . A A .  31 SER OG   1 1 
        5  8141 1 1  32 LYS C    C   7.840  11.751  -3.603 1.00 . A A .  32 LYS C    1 1 
        5  8142 1 1  32 LYS CA   C   7.651  12.771  -2.451 1.00 . A A .  32 LYS CA   1 1 
        5  8143 1 1  32 LYS CB   C   6.800  13.998  -2.833 1.00 . A A .  32 LYS CB   1 1 
        5  8144 1 1  32 LYS CD   C   6.261  16.117  -4.141 1.00 . A A .  32 LYS CD   1 1 
        5  8145 1 1  32 LYS CE   C   4.820  15.796  -4.561 1.00 . A A .  32 LYS CE   1 1 
        5  8146 1 1  32 LYS CG   C   7.195  14.892  -4.012 1.00 . A A .  32 LYS CG   1 1 
        5  8147 1 1  32 LYS H    H   9.411  14.020  -1.964 1.00 . A A .  32 LYS H    1 1 
        5  8148 1 1  32 LYS HA   H   7.000  12.252  -1.721 1.00 . A A .  32 LYS HA   1 1 
        5  8149 1 1  32 LYS HB2  H   5.780  13.607  -3.007 1.00 . A A .  32 LYS HB2  1 1 
        5  8150 1 1  32 LYS HB3  H   6.700  14.624  -1.924 1.00 . A A .  32 LYS HB3  1 1 
        5  8151 1 1  32 LYS HD2  H   6.283  16.668  -3.176 1.00 . A A .  32 LYS HD2  1 1 
        5  8152 1 1  32 LYS HD3  H   6.716  16.814  -4.873 1.00 . A A .  32 LYS HD3  1 1 
        5  8153 1 1  32 LYS HE2  H   4.797  15.395  -5.597 1.00 . A A .  32 LYS HE2  1 1 
        5  8154 1 1  32 LYS HE3  H   4.398  14.981  -3.941 1.00 . A A .  32 LYS HE3  1 1 
        5  8155 1 1  32 LYS HG2  H   8.230  15.265  -3.867 1.00 . A A .  32 LYS HG2  1 1 
        5  8156 1 1  32 LYS HG3  H   7.220  14.327  -4.963 1.00 . A A .  32 LYS HG3  1 1 
        5  8157 1 1  32 LYS HZ1  H   4.123  17.715  -5.159 1.00 . A A .  32 LYS HZ1  1 1 
        5  8158 1 1  32 LYS HZ2  H   2.955  16.867  -4.371 1.00 . A A .  32 LYS HZ2  1 1 
        5  8159 1 1  32 LYS HZ3  H   4.179  17.554  -3.565 1.00 . A A .  32 LYS HZ3  1 1 
        5  8160 1 1  32 LYS N    N   8.894  13.157  -1.730 1.00 . A A .  32 LYS N    1 1 
        5  8161 1 1  32 LYS NZ   N   3.981  17.016  -4.422 1.00 . A A .  32 LYS NZ   1 1 
        5  8162 1 1  32 LYS O    O   7.122  10.750  -3.653 1.00 . A A .  32 LYS O    1 1 
        5  8163 1 1  33 GLN C    C   9.654   9.653  -5.196 1.00 . A A .  33 GLN C    1 1 
        5  8164 1 1  33 GLN CA   C   9.117  11.046  -5.620 1.00 . A A .  33 GLN CA   1 1 
        5  8165 1 1  33 GLN CB   C  10.050  11.824  -6.580 1.00 . A A .  33 GLN CB   1 1 
        5  8166 1 1  33 GLN CD   C  11.016  11.900  -8.947 1.00 . A A .  33 GLN CD   1 1 
        5  8167 1 1  33 GLN CG   C  10.544  11.020  -7.802 1.00 . A A .  33 GLN CG   1 1 
        5  8168 1 1  33 GLN H    H   9.347  12.831  -4.313 1.00 . A A .  33 GLN H    1 1 
        5  8169 1 1  33 GLN HA   H   8.172  10.837  -6.165 1.00 . A A .  33 GLN HA   1 1 
        5  8170 1 1  33 GLN HB2  H   9.491  12.720  -6.924 1.00 . A A .  33 GLN HB2  1 1 
        5  8171 1 1  33 GLN HB3  H  10.931  12.214  -6.034 1.00 . A A .  33 GLN HB3  1 1 
        5  8172 1 1  33 GLN HE21 H  12.883  11.234  -8.781 1.00 . A A .  33 GLN HE21 1 1 
        5  8173 1 1  33 GLN HE22 H  12.498  12.428 -10.119 1.00 . A A .  33 GLN HE22 1 1 
        5  8174 1 1  33 GLN HG2  H  11.329  10.307  -7.478 1.00 . A A .  33 GLN HG2  1 1 
        5  8175 1 1  33 GLN HG3  H   9.729  10.377  -8.183 1.00 . A A .  33 GLN HG3  1 1 
        5  8176 1 1  33 GLN N    N   8.797  11.988  -4.512 1.00 . A A .  33 GLN N    1 1 
        5  8177 1 1  33 GLN NE2  N  12.291  11.924  -9.251 1.00 . A A .  33 GLN NE2  1 1 
        5  8178 1 1  33 GLN O    O   9.241   8.656  -5.783 1.00 . A A .  33 GLN O    1 1 
        5  8179 1 1  33 GLN OE1  O  10.220  12.580  -9.589 1.00 . A A .  33 GLN OE1  1 1 
        5  8180 1 1  34 GLN C    C   9.860   7.456  -2.941 1.00 . A A .  34 GLN C    1 1 
        5  8181 1 1  34 GLN CA   C  10.995   8.296  -3.615 1.00 . A A .  34 GLN CA   1 1 
        5  8182 1 1  34 GLN CB   C  12.149   8.540  -2.615 1.00 . A A .  34 GLN CB   1 1 
        5  8183 1 1  34 GLN CD   C  14.463   9.512  -2.173 1.00 . A A .  34 GLN CD   1 1 
        5  8184 1 1  34 GLN CG   C  13.444   9.109  -3.229 1.00 . A A .  34 GLN CG   1 1 
        5  8185 1 1  34 GLN H    H  10.663  10.488  -3.733 1.00 . A A .  34 GLN H    1 1 
        5  8186 1 1  34 GLN HA   H  11.389   7.669  -4.441 1.00 . A A .  34 GLN HA   1 1 
        5  8187 1 1  34 GLN HB2  H  11.789   9.184  -1.792 1.00 . A A .  34 GLN HB2  1 1 
        5  8188 1 1  34 GLN HB3  H  12.391   7.577  -2.128 1.00 . A A .  34 GLN HB3  1 1 
        5  8189 1 1  34 GLN HE21 H  14.027  11.462  -2.372 1.00 . A A .  34 GLN HE21 1 1 
        5  8190 1 1  34 GLN HE22 H  15.300  10.966  -1.159 1.00 . A A .  34 GLN HE22 1 1 
        5  8191 1 1  34 GLN HG2  H  13.909   8.351  -3.886 1.00 . A A .  34 GLN HG2  1 1 
        5  8192 1 1  34 GLN HG3  H  13.229   9.963  -3.899 1.00 . A A .  34 GLN HG3  1 1 
        5  8193 1 1  34 GLN N    N  10.533   9.584  -4.190 1.00 . A A .  34 GLN N    1 1 
        5  8194 1 1  34 GLN NE2  N  14.674  10.785  -1.956 1.00 . A A .  34 GLN NE2  1 1 
        5  8195 1 1  34 GLN O    O   9.711   6.285  -3.289 1.00 . A A .  34 GLN O    1 1 
        5  8196 1 1  34 GLN OE1  O  15.078   8.684  -1.507 1.00 . A A .  34 GLN OE1  1 1 
        5  8197 1 1  35 VAL C    C   6.773   6.941  -2.576 1.00 . A A .  35 VAL C    1 1 
        5  8198 1 1  35 VAL CA   C   7.828   7.354  -1.503 1.00 . A A .  35 VAL CA   1 1 
        5  8199 1 1  35 VAL CB   C   7.277   8.142  -0.275 1.00 . A A .  35 VAL CB   1 1 
        5  8200 1 1  35 VAL CG1  C   6.499   9.424  -0.599 1.00 . A A .  35 VAL CG1  1 1 
        5  8201 1 1  35 VAL CG2  C   6.393   7.269   0.633 1.00 . A A .  35 VAL CG2  1 1 
        5  8202 1 1  35 VAL H    H   9.163   9.057  -1.945 1.00 . A A .  35 VAL H    1 1 
        5  8203 1 1  35 VAL HA   H   8.205   6.386  -1.115 1.00 . A A .  35 VAL HA   1 1 
        5  8204 1 1  35 VAL HB   H   8.141   8.458   0.349 1.00 . A A .  35 VAL HB   1 1 
        5  8205 1 1  35 VAL HG11 H   7.097  10.103  -1.222 1.00 . A A .  35 VAL HG11 1 1 
        5  8206 1 1  35 VAL HG12 H   5.558   9.237  -1.145 1.00 . A A .  35 VAL HG12 1 1 
        5  8207 1 1  35 VAL HG13 H   6.249   9.985   0.322 1.00 . A A .  35 VAL HG13 1 1 
        5  8208 1 1  35 VAL HG21 H   6.909   6.346   0.955 1.00 . A A .  35 VAL HG21 1 1 
        5  8209 1 1  35 VAL HG22 H   6.099   7.814   1.550 1.00 . A A .  35 VAL HG22 1 1 
        5  8210 1 1  35 VAL HG23 H   5.461   6.967   0.125 1.00 . A A .  35 VAL HG23 1 1 
        5  8211 1 1  35 VAL N    N   9.040   8.044  -2.045 1.00 . A A .  35 VAL N    1 1 
        5  8212 1 1  35 VAL O    O   6.337   5.789  -2.569 1.00 . A A .  35 VAL O    1 1 
        5  8213 1 1  36 SER C    C   6.079   6.445  -5.677 1.00 . A A .  36 SER C    1 1 
        5  8214 1 1  36 SER CA   C   5.528   7.478  -4.656 1.00 . A A .  36 SER CA   1 1 
        5  8215 1 1  36 SER CB   C   5.104   8.808  -5.320 1.00 . A A .  36 SER CB   1 1 
        5  8216 1 1  36 SER H    H   6.938   8.725  -3.483 1.00 . A A .  36 SER H    1 1 
        5  8217 1 1  36 SER HA   H   4.624   6.995  -4.224 1.00 . A A .  36 SER HA   1 1 
        5  8218 1 1  36 SER HB2  H   4.829   9.552  -4.547 1.00 . A A .  36 SER HB2  1 1 
        5  8219 1 1  36 SER HB3  H   5.940   9.262  -5.887 1.00 . A A .  36 SER HB3  1 1 
        5  8220 1 1  36 SER HG   H   4.266   8.202  -6.995 1.00 . A A .  36 SER HG   1 1 
        5  8221 1 1  36 SER N    N   6.427   7.827  -3.524 1.00 . A A .  36 SER N    1 1 
        5  8222 1 1  36 SER O    O   5.319   5.569  -6.089 1.00 . A A .  36 SER O    1 1 
        5  8223 1 1  36 SER OG   O   3.972   8.638  -6.165 1.00 . A A .  36 SER OG   1 1 
        5  8224 1 1  37 ALA C    C   8.087   3.994  -6.099 1.00 . A A .  37 ALA C    1 1 
        5  8225 1 1  37 ALA CA   C   8.014   5.384  -6.811 1.00 . A A .  37 ALA CA   1 1 
        5  8226 1 1  37 ALA CB   C   9.408   5.870  -7.230 1.00 . A A .  37 ALA CB   1 1 
        5  8227 1 1  37 ALA H    H   7.916   7.254  -5.628 1.00 . A A .  37 ALA H    1 1 
        5  8228 1 1  37 ALA HA   H   7.422   5.229  -7.736 1.00 . A A .  37 ALA HA   1 1 
        5  8229 1 1  37 ALA HB1  H   9.931   5.129  -7.861 1.00 . A A .  37 ALA HB1  1 1 
        5  8230 1 1  37 ALA HB2  H   9.353   6.806  -7.818 1.00 . A A .  37 ALA HB2  1 1 
        5  8231 1 1  37 ALA HB3  H  10.057   6.073  -6.356 1.00 . A A .  37 ALA HB3  1 1 
        5  8232 1 1  37 ALA N    N   7.370   6.482  -6.042 1.00 . A A .  37 ALA N    1 1 
        5  8233 1 1  37 ALA O    O   7.799   2.984  -6.744 1.00 . A A .  37 ALA O    1 1 
        5  8234 1 1  38 LEU C    C   6.909   2.118  -3.793 1.00 . A A .  38 LEU C    1 1 
        5  8235 1 1  38 LEU CA   C   8.354   2.696  -3.987 1.00 . A A .  38 LEU CA   1 1 
        5  8236 1 1  38 LEU CB   C   9.062   2.922  -2.623 1.00 . A A .  38 LEU CB   1 1 
        5  8237 1 1  38 LEU CD1  C  11.447   3.437  -3.518 1.00 . A A .  38 LEU CD1  1 1 
        5  8238 1 1  38 LEU CD2  C  11.080   2.851  -1.128 1.00 . A A .  38 LEU CD2  1 1 
        5  8239 1 1  38 LEU CG   C  10.577   2.613  -2.568 1.00 . A A .  38 LEU CG   1 1 
        5  8240 1 1  38 LEU H    H   8.617   4.870  -4.382 1.00 . A A .  38 LEU H    1 1 
        5  8241 1 1  38 LEU HA   H   8.889   1.905  -4.545 1.00 . A A .  38 LEU HA   1 1 
        5  8242 1 1  38 LEU HB2  H   8.860   3.944  -2.247 1.00 . A A .  38 LEU HB2  1 1 
        5  8243 1 1  38 LEU HB3  H   8.594   2.266  -1.859 1.00 . A A .  38 LEU HB3  1 1 
        5  8244 1 1  38 LEU HD11 H  11.148   3.316  -4.574 1.00 . A A .  38 LEU HD11 1 1 
        5  8245 1 1  38 LEU HD12 H  11.408   4.517  -3.293 1.00 . A A .  38 LEU HD12 1 1 
        5  8246 1 1  38 LEU HD13 H  12.507   3.130  -3.456 1.00 . A A .  38 LEU HD13 1 1 
        5  8247 1 1  38 LEU HD21 H  12.141   2.561  -1.019 1.00 . A A .  38 LEU HD21 1 1 
        5  8248 1 1  38 LEU HD22 H  10.987   3.909  -0.820 1.00 . A A .  38 LEU HD22 1 1 
        5  8249 1 1  38 LEU HD23 H  10.518   2.246  -0.393 1.00 . A A .  38 LEU HD23 1 1 
        5  8250 1 1  38 LEU HG   H  10.723   1.535  -2.796 1.00 . A A .  38 LEU HG   1 1 
        5  8251 1 1  38 LEU N    N   8.422   3.947  -4.798 1.00 . A A .  38 LEU N    1 1 
        5  8252 1 1  38 LEU O    O   6.697   0.925  -4.008 1.00 . A A .  38 LEU O    1 1 
        5  8253 1 1  39 LEU C    C   3.835   2.198  -4.775 1.00 . A A .  39 LEU C    1 1 
        5  8254 1 1  39 LEU CA   C   4.497   2.545  -3.387 1.00 . A A .  39 LEU CA   1 1 
        5  8255 1 1  39 LEU CB   C   3.728   3.708  -2.714 1.00 . A A .  39 LEU CB   1 1 
        5  8256 1 1  39 LEU CD1  C   3.446   5.319  -0.822 1.00 . A A .  39 LEU CD1  1 1 
        5  8257 1 1  39 LEU CD2  C   3.553   2.926  -0.251 1.00 . A A .  39 LEU CD2  1 1 
        5  8258 1 1  39 LEU CG   C   4.049   3.968  -1.237 1.00 . A A .  39 LEU CG   1 1 
        5  8259 1 1  39 LEU H    H   6.221   3.924  -3.264 1.00 . A A .  39 LEU H    1 1 
        5  8260 1 1  39 LEU HA   H   4.399   1.637  -2.759 1.00 . A A .  39 LEU HA   1 1 
        5  8261 1 1  39 LEU HB2  H   3.970   4.636  -3.261 1.00 . A A .  39 LEU HB2  1 1 
        5  8262 1 1  39 LEU HB3  H   2.640   3.588  -2.850 1.00 . A A .  39 LEU HB3  1 1 
        5  8263 1 1  39 LEU HD11 H   3.877   6.157  -1.399 1.00 . A A .  39 LEU HD11 1 1 
        5  8264 1 1  39 LEU HD12 H   2.352   5.346  -0.971 1.00 . A A .  39 LEU HD12 1 1 
        5  8265 1 1  39 LEU HD13 H   3.633   5.534   0.245 1.00 . A A .  39 LEU HD13 1 1 
        5  8266 1 1  39 LEU HD21 H   4.051   3.148   0.698 1.00 . A A .  39 LEU HD21 1 1 
        5  8267 1 1  39 LEU HD22 H   2.466   2.977  -0.067 1.00 . A A .  39 LEU HD22 1 1 
        5  8268 1 1  39 LEU HD23 H   3.810   1.874  -0.476 1.00 . A A .  39 LEU HD23 1 1 
        5  8269 1 1  39 LEU HG   H   5.149   4.053  -1.107 1.00 . A A .  39 LEU HG   1 1 
        5  8270 1 1  39 LEU N    N   5.930   2.948  -3.430 1.00 . A A .  39 LEU N    1 1 
        5  8271 1 1  39 LEU O    O   2.995   1.298  -4.840 1.00 . A A .  39 LEU O    1 1 
        5  8272 1 1  40 GLY C    C   2.797   3.705  -7.784 1.00 . A A .  40 GLY C    1 1 
        5  8273 1 1  40 GLY CA   C   3.753   2.645  -7.221 1.00 . A A .  40 GLY CA   1 1 
        5  8274 1 1  40 GLY H    H   4.941   3.603  -5.611 1.00 . A A .  40 GLY H    1 1 
        5  8275 1 1  40 GLY HA2  H   4.643   2.581  -7.876 1.00 . A A .  40 GLY HA2  1 1 
        5  8276 1 1  40 GLY HA3  H   3.279   1.649  -7.305 1.00 . A A .  40 GLY HA3  1 1 
        5  8277 1 1  40 GLY N    N   4.207   2.916  -5.841 1.00 . A A .  40 GLY N    1 1 
        5  8278 1 1  40 GLY O    O   1.601   3.438  -7.946 1.00 . A A .  40 GLY O    1 1 
        5  8279 1 1  41 THR C    C   3.528   7.192  -9.053 1.00 . A A .  41 THR C    1 1 
        5  8280 1 1  41 THR CA   C   2.521   6.074  -8.569 1.00 . A A .  41 THR CA   1 1 
        5  8281 1 1  41 THR CB   C   1.549   6.626  -7.484 1.00 . A A .  41 THR CB   1 1 
        5  8282 1 1  41 THR CG2  C   0.704   7.821  -7.898 1.00 . A A .  41 THR CG2  1 1 
        5  8283 1 1  41 THR H    H   4.242   5.063  -7.631 1.00 . A A .  41 THR H    1 1 
        5  8284 1 1  41 THR HA   H   1.926   5.721  -9.432 1.00 . A A .  41 THR HA   1 1 
        5  8285 1 1  41 THR HB   H   2.133   6.896  -6.579 1.00 . A A .  41 THR HB   1 1 
        5  8286 1 1  41 THR HG1  H   1.063   4.782  -7.380 1.00 . A A .  41 THR HG1  1 1 
        5  8287 1 1  41 THR HG21 H   0.027   7.597  -8.740 1.00 . A A .  41 THR HG21 1 1 
        5  8288 1 1  41 THR HG22 H   0.068   8.140  -7.056 1.00 . A A .  41 THR HG22 1 1 
        5  8289 1 1  41 THR HG23 H   1.305   8.706  -8.175 1.00 . A A .  41 THR HG23 1 1 
        5  8290 1 1  41 THR N    N   3.312   4.911  -8.056 1.00 . A A .  41 THR N    1 1 
        5  8291 1 1  41 THR O    O   4.484   7.474  -8.318 1.00 . A A .  41 THR O    1 1 
        5  8292 1 1  41 THR OG1  O   0.611   5.613  -7.126 1.00 . A A .  41 THR OG1  1 1 
        5  8293 1 1  42 PRO C    C   4.209  10.315  -9.808 1.00 . A A .  42 PRO C    1 1 
        5  8294 1 1  42 PRO CA   C   4.278   8.994 -10.634 1.00 . A A .  42 PRO CA   1 1 
        5  8295 1 1  42 PRO CB   C   3.875   9.174 -12.127 1.00 . A A .  42 PRO CB   1 1 
        5  8296 1 1  42 PRO CD   C   2.286   7.611 -11.195 1.00 . A A .  42 PRO CD   1 1 
        5  8297 1 1  42 PRO CG   C   2.380   8.791 -12.173 1.00 . A A .  42 PRO CG   1 1 
        5  8298 1 1  42 PRO HA   H   5.318   8.612 -10.592 1.00 . A A .  42 PRO HA   1 1 
        5  8299 1 1  42 PRO HB2  H   4.066  10.187 -12.526 1.00 . A A .  42 PRO HB2  1 1 
        5  8300 1 1  42 PRO HB3  H   4.462   8.470 -12.750 1.00 . A A .  42 PRO HB3  1 1 
        5  8301 1 1  42 PRO HD2  H   1.285   7.548 -10.731 1.00 . A A .  42 PRO HD2  1 1 
        5  8302 1 1  42 PRO HD3  H   2.489   6.650 -11.706 1.00 . A A .  42 PRO HD3  1 1 
        5  8303 1 1  42 PRO HG2  H   1.764   9.637 -11.808 1.00 . A A .  42 PRO HG2  1 1 
        5  8304 1 1  42 PRO HG3  H   2.032   8.538 -13.190 1.00 . A A .  42 PRO HG3  1 1 
        5  8305 1 1  42 PRO N    N   3.350   7.889 -10.207 1.00 . A A .  42 PRO N    1 1 
        5  8306 1 1  42 PRO O    O   3.327  10.526  -8.971 1.00 . A A .  42 PRO O    1 1 
        5  8307 1 1  43 SER C    C   4.385  13.608  -9.673 1.00 . A A .  43 SER C    1 1 
        5  8308 1 1  43 SER CA   C   5.372  12.455  -9.299 1.00 . A A .  43 SER CA   1 1 
        5  8309 1 1  43 SER CB   C   6.849  12.893  -9.579 1.00 . A A .  43 SER CB   1 1 
        5  8310 1 1  43 SER H    H   5.903  10.906 -10.712 1.00 . A A .  43 SER H    1 1 
        5  8311 1 1  43 SER HA   H   5.283  12.242  -8.215 1.00 . A A .  43 SER HA   1 1 
        5  8312 1 1  43 SER HB2  H   7.006  13.050 -10.664 1.00 . A A .  43 SER HB2  1 1 
        5  8313 1 1  43 SER HB3  H   7.066  13.868  -9.103 1.00 . A A .  43 SER HB3  1 1 
        5  8314 1 1  43 SER HG   H   8.682  12.239  -9.348 1.00 . A A .  43 SER HG   1 1 
        5  8315 1 1  43 SER N    N   5.183  11.199 -10.055 1.00 . A A .  43 SER N    1 1 
        5  8316 1 1  43 SER O    O   3.653  13.571 -10.665 1.00 . A A .  43 SER O    1 1 
        5  8317 1 1  43 SER OG   O   7.787  11.943  -9.081 1.00 . A A .  43 SER OG   1 1 
        5  8318 1 1  44 ILE C    C   5.029  16.991  -9.390 1.00 . A A .  44 ILE C    1 1 
        5  8319 1 1  44 ILE CA   C   3.827  15.986  -9.168 1.00 . A A .  44 ILE CA   1 1 
        5  8320 1 1  44 ILE CB   C   2.810  16.430  -8.057 1.00 . A A .  44 ILE CB   1 1 
        5  8321 1 1  44 ILE CD1  C   0.806  15.612  -6.620 1.00 . A A .  44 ILE CD1  1 1 
        5  8322 1 1  44 ILE CG1  C   1.643  15.411  -7.884 1.00 . A A .  44 ILE CG1  1 1 
        5  8323 1 1  44 ILE CG2  C   2.199  17.816  -8.385 1.00 . A A .  44 ILE CG2  1 1 
        5  8324 1 1  44 ILE H    H   5.284  14.566  -8.270 1.00 . A A .  44 ILE H    1 1 
        5  8325 1 1  44 ILE HA   H   3.241  15.931 -10.109 1.00 . A A .  44 ILE HA   1 1 
        5  8326 1 1  44 ILE HB   H   3.346  16.501  -7.095 1.00 . A A .  44 ILE HB   1 1 
        5  8327 1 1  44 ILE HD11 H   0.279  16.583  -6.594 1.00 . A A .  44 ILE HD11 1 1 
        5  8328 1 1  44 ILE HD12 H   0.022  14.838  -6.542 1.00 . A A .  44 ILE HD12 1 1 
        5  8329 1 1  44 ILE HD13 H   1.412  15.546  -5.700 1.00 . A A .  44 ILE HD13 1 1 
        5  8330 1 1  44 ILE HG12 H   0.986  15.425  -8.776 1.00 . A A .  44 ILE HG12 1 1 
        5  8331 1 1  44 ILE HG13 H   2.038  14.377  -7.847 1.00 . A A .  44 ILE HG13 1 1 
        5  8332 1 1  44 ILE HG21 H   2.961  18.605  -8.496 1.00 . A A .  44 ILE HG21 1 1 
        5  8333 1 1  44 ILE HG22 H   1.618  17.789  -9.326 1.00 . A A .  44 ILE HG22 1 1 
        5  8334 1 1  44 ILE HG23 H   1.514  18.165  -7.590 1.00 . A A .  44 ILE HG23 1 1 
        5  8335 1 1  44 ILE N    N   4.454  14.666  -8.856 1.00 . A A .  44 ILE N    1 1 
        5  8336 1 1  44 ILE O    O   5.523  17.554  -8.399 1.00 . A A .  44 ILE O    1 1 
        5  8337 1 1  45 PRO C    C   6.758  19.506 -11.022 1.00 . A A .  45 PRO C    1 1 
        5  8338 1 1  45 PRO CA   C   6.843  17.964 -10.837 1.00 . A A .  45 PRO CA   1 1 
        5  8339 1 1  45 PRO CB   C   7.419  17.210 -12.070 1.00 . A A .  45 PRO CB   1 1 
        5  8340 1 1  45 PRO CD   C   5.138  16.478 -11.851 1.00 . A A .  45 PRO CD   1 1 
        5  8341 1 1  45 PRO CG   C   6.165  16.891 -12.918 1.00 . A A .  45 PRO CG   1 1 
        5  8342 1 1  45 PRO HA   H   7.507  17.786  -9.974 1.00 . A A .  45 PRO HA   1 1 
        5  8343 1 1  45 PRO HB2  H   8.185  17.776 -12.630 1.00 . A A .  45 PRO HB2  1 1 
        5  8344 1 1  45 PRO HB3  H   7.895  16.267 -11.737 1.00 . A A .  45 PRO HB3  1 1 
        5  8345 1 1  45 PRO HD2  H   4.100  16.714 -12.146 1.00 . A A .  45 PRO HD2  1 1 
        5  8346 1 1  45 PRO HD3  H   5.202  15.387 -11.679 1.00 . A A .  45 PRO HD3  1 1 
        5  8347 1 1  45 PRO HG2  H   5.827  17.799 -13.454 1.00 . A A .  45 PRO HG2  1 1 
        5  8348 1 1  45 PRO HG3  H   6.340  16.101 -13.669 1.00 . A A .  45 PRO HG3  1 1 
        5  8349 1 1  45 PRO N    N   5.549  17.222 -10.633 1.00 . A A .  45 PRO N    1 1 
        5  8350 1 1  45 PRO O    O   7.345  20.077 -11.944 1.00 . A A .  45 PRO O    1 1 
        5  8351 1 1  46 ASP C    C   6.993  22.245  -8.947 1.00 . A A .  46 ASP C    1 1 
        5  8352 1 1  46 ASP CA   C   6.013  21.651 -10.017 1.00 . A A .  46 ASP CA   1 1 
        5  8353 1 1  46 ASP CB   C   4.532  22.041  -9.791 1.00 . A A .  46 ASP CB   1 1 
        5  8354 1 1  46 ASP CG   C   4.264  23.544  -9.691 1.00 . A A .  46 ASP CG   1 1 
        5  8355 1 1  46 ASP H    H   5.654  19.554  -9.396 1.00 . A A .  46 ASP H    1 1 
        5  8356 1 1  46 ASP HA   H   6.251  22.055 -11.019 1.00 . A A .  46 ASP HA   1 1 
        5  8357 1 1  46 ASP HB2  H   3.925  21.661 -10.633 1.00 . A A .  46 ASP HB2  1 1 
        5  8358 1 1  46 ASP HB3  H   4.108  21.563  -8.895 1.00 . A A .  46 ASP HB3  1 1 
        5  8359 1 1  46 ASP N    N   6.116  20.174 -10.061 1.00 . A A .  46 ASP N    1 1 
        5  8360 1 1  46 ASP O    O   6.920  21.838  -7.780 1.00 . A A .  46 ASP O    1 1 
        5  8361 1 1  46 ASP OD1  O   4.946  24.338 -10.374 1.00 . A A .  46 ASP OD1  1 1 
        5  8362 1 1  46 ASP OD2  O   3.404  23.947  -8.881 1.00 . A A .  46 ASP OD2  1 1 
        5  8363 1 1  47 PRO C    C   7.711  25.208  -7.575 1.00 . A A .  47 PRO C    1 1 
        5  8364 1 1  47 PRO CA   C   8.549  24.066  -8.227 1.00 . A A .  47 PRO CA   1 1 
        5  8365 1 1  47 PRO CB   C   9.763  24.606  -9.031 1.00 . A A .  47 PRO CB   1 1 
        5  8366 1 1  47 PRO CD   C   8.250  23.591 -10.646 1.00 . A A .  47 PRO CD   1 1 
        5  8367 1 1  47 PRO CG   C   9.227  24.766 -10.474 1.00 . A A .  47 PRO CG   1 1 
        5  8368 1 1  47 PRO HA   H   8.919  23.438  -7.395 1.00 . A A .  47 PRO HA   1 1 
        5  8369 1 1  47 PRO HB2  H  10.185  25.544  -8.625 1.00 . A A .  47 PRO HB2  1 1 
        5  8370 1 1  47 PRO HB3  H  10.577  23.855  -9.013 1.00 . A A .  47 PRO HB3  1 1 
        5  8371 1 1  47 PRO HD2  H   7.356  23.889 -11.227 1.00 . A A .  47 PRO HD2  1 1 
        5  8372 1 1  47 PRO HD3  H   8.721  22.732 -11.162 1.00 . A A .  47 PRO HD3  1 1 
        5  8373 1 1  47 PRO HG2  H   8.678  25.724 -10.565 1.00 . A A .  47 PRO HG2  1 1 
        5  8374 1 1  47 PRO HG3  H  10.030  24.772 -11.232 1.00 . A A .  47 PRO HG3  1 1 
        5  8375 1 1  47 PRO N    N   7.893  23.207  -9.263 1.00 . A A .  47 PRO N    1 1 
        5  8376 1 1  47 PRO O    O   8.176  25.752  -6.572 1.00 . A A .  47 PRO O    1 1 
        5  8377 1 1  48 PHE C    C   4.866  26.115  -6.263 1.00 . A A .  48 PHE C    1 1 
        5  8378 1 1  48 PHE CA   C   5.669  26.630  -7.491 1.00 . A A .  48 PHE CA   1 1 
        5  8379 1 1  48 PHE CB   C   4.824  27.251  -8.632 1.00 . A A .  48 PHE CB   1 1 
        5  8380 1 1  48 PHE CD1  C   4.590  29.756  -8.171 1.00 . A A .  48 PHE CD1  1 1 
        5  8381 1 1  48 PHE CD2  C   2.644  28.351  -7.892 1.00 . A A .  48 PHE CD2  1 1 
        5  8382 1 1  48 PHE CE1  C   3.840  30.869  -7.784 1.00 . A A .  48 PHE CE1  1 1 
        5  8383 1 1  48 PHE CE2  C   1.896  29.463  -7.504 1.00 . A A .  48 PHE CE2  1 1 
        5  8384 1 1  48 PHE CG   C   4.002  28.482  -8.227 1.00 . A A .  48 PHE CG   1 1 
        5  8385 1 1  48 PHE CZ   C   2.495  30.720  -7.451 1.00 . A A .  48 PHE CZ   1 1 
        5  8386 1 1  48 PHE H    H   6.200  25.021  -8.908 1.00 . A A .  48 PHE H    1 1 
        5  8387 1 1  48 PHE HA   H   6.330  27.437  -7.113 1.00 . A A .  48 PHE HA   1 1 
        5  8388 1 1  48 PHE HB2  H   5.498  27.532  -9.466 1.00 . A A .  48 PHE HB2  1 1 
        5  8389 1 1  48 PHE HB3  H   4.158  26.486  -9.079 1.00 . A A .  48 PHE HB3  1 1 
        5  8390 1 1  48 PHE HD1  H   5.636  29.884  -8.421 1.00 . A A .  48 PHE HD1  1 1 
        5  8391 1 1  48 PHE HD2  H   2.172  27.376  -7.921 1.00 . A A .  48 PHE HD2  1 1 
        5  8392 1 1  48 PHE HE1  H   4.307  31.845  -7.741 1.00 . A A .  48 PHE HE1  1 1 
        5  8393 1 1  48 PHE HE2  H   0.851  29.345  -7.243 1.00 . A A .  48 PHE HE2  1 1 
        5  8394 1 1  48 PHE HZ   H   1.915  31.583  -7.149 1.00 . A A .  48 PHE HZ   1 1 
        5  8395 1 1  48 PHE N    N   6.528  25.580  -8.101 1.00 . A A .  48 PHE N    1 1 
        5  8396 1 1  48 PHE O    O   5.160  26.546  -5.145 1.00 . A A .  48 PHE O    1 1 
        5  8397 1 1  49 HIS C    C   2.626  23.226  -5.648 1.00 . A A .  49 HIS C    1 1 
        5  8398 1 1  49 HIS CA   C   3.095  24.665  -5.299 1.00 . A A .  49 HIS CA   1 1 
        5  8399 1 1  49 HIS CB   C   1.954  25.642  -4.930 1.00 . A A .  49 HIS CB   1 1 
        5  8400 1 1  49 HIS CD2  C   1.375  24.392  -2.606 1.00 . A A .  49 HIS CD2  1 1 
        5  8401 1 1  49 HIS CE1  C   0.120  25.886  -1.834 1.00 . A A .  49 HIS CE1  1 1 
        5  8402 1 1  49 HIS CG   C   1.279  25.451  -3.553 1.00 . A A .  49 HIS CG   1 1 
        5  8403 1 1  49 HIS H    H   3.761  24.862  -7.410 1.00 . A A .  49 HIS H    1 1 
        5  8404 1 1  49 HIS HA   H   3.770  24.571  -4.424 1.00 . A A .  49 HIS HA   1 1 
        5  8405 1 1  49 HIS HB2  H   2.358  26.676  -4.934 1.00 . A A .  49 HIS HB2  1 1 
        5  8406 1 1  49 HIS HB3  H   1.176  25.635  -5.717 1.00 . A A .  49 HIS HB3  1 1 
        5  8407 1 1  49 HIS HD1  H   0.231  27.353  -3.430 1.00 . A A .  49 HIS HD1  1 1 
        5  8408 1 1  49 HIS HD2  H   1.948  23.485  -2.731 1.00 . A A .  49 HIS HD2  1 1 
        5  8409 1 1  49 HIS HE1  H  -0.503  26.432  -1.138 1.00 . A A .  49 HIS HE1  1 1 
        5  8410 1 1  49 HIS N    N   3.863  25.236  -6.441 1.00 . A A .  49 HIS N    1 1 
        5  8411 1 1  49 HIS ND1  N   0.435  26.422  -3.052 1.00 . A A .  49 HIS ND1  1 1 
        5  8412 1 1  49 HIS NE2  N   0.611  24.658  -1.482 1.00 . A A .  49 HIS NE2  1 1 
        5  8413 1 1  49 HIS O    O   1.451  22.982  -5.945 1.00 . A A .  49 HIS O    1 1 
        5  8414 1 1  50 ALA C    C   2.594  20.147  -4.574 1.00 . A A .  50 ALA C    1 1 
        5  8415 1 1  50 ALA CA   C   3.228  20.835  -5.810 1.00 . A A .  50 ALA CA   1 1 
        5  8416 1 1  50 ALA CB   C   4.531  20.173  -6.251 1.00 . A A .  50 ALA CB   1 1 
        5  8417 1 1  50 ALA H    H   4.517  22.579  -5.432 1.00 . A A .  50 ALA H    1 1 
        5  8418 1 1  50 ALA HA   H   2.541  20.762  -6.681 1.00 . A A .  50 ALA HA   1 1 
        5  8419 1 1  50 ALA HB1  H   4.940  20.667  -7.143 1.00 . A A .  50 ALA HB1  1 1 
        5  8420 1 1  50 ALA HB2  H   5.311  20.208  -5.474 1.00 . A A .  50 ALA HB2  1 1 
        5  8421 1 1  50 ALA HB3  H   4.373  19.128  -6.533 1.00 . A A .  50 ALA HB3  1 1 
        5  8422 1 1  50 ALA N    N   3.547  22.252  -5.552 1.00 . A A .  50 ALA N    1 1 
        5  8423 1 1  50 ALA O    O   3.281  19.651  -3.675 1.00 . A A .  50 ALA O    1 1 
        5  8424 1 1  51 GLN C    C   0.398  18.172  -3.121 1.00 . A A .  51 GLN C    1 1 
        5  8425 1 1  51 GLN CA   C   0.464  19.724  -3.386 1.00 . A A .  51 GLN CA   1 1 
        5  8426 1 1  51 GLN CB   C  -0.939  20.384  -3.598 1.00 . A A .  51 GLN CB   1 1 
        5  8427 1 1  51 GLN CD   C  -2.354  22.536  -3.488 1.00 . A A .  51 GLN CD   1 1 
        5  8428 1 1  51 GLN CG   C  -0.964  21.913  -3.412 1.00 . A A .  51 GLN CG   1 1 
        5  8429 1 1  51 GLN H    H   0.861  20.725  -5.294 1.00 . A A .  51 GLN H    1 1 
        5  8430 1 1  51 GLN HA   H   0.924  20.172  -2.481 1.00 . A A .  51 GLN HA   1 1 
        5  8431 1 1  51 GLN HB2  H  -1.357  20.098  -4.583 1.00 . A A .  51 GLN HB2  1 1 
        5  8432 1 1  51 GLN HB3  H  -1.665  19.985  -2.868 1.00 . A A .  51 GLN HB3  1 1 
        5  8433 1 1  51 GLN HE21 H  -1.496  24.329  -3.531 1.00 . A A .  51 GLN HE21 1 1 
        5  8434 1 1  51 GLN HE22 H  -3.337  24.244  -3.569 1.00 . A A .  51 GLN HE22 1 1 
        5  8435 1 1  51 GLN HG2  H  -0.533  22.166  -2.424 1.00 . A A .  51 GLN HG2  1 1 
        5  8436 1 1  51 GLN HG3  H  -0.304  22.399  -4.156 1.00 . A A .  51 GLN HG3  1 1 
        5  8437 1 1  51 GLN N    N   1.261  20.107  -4.577 1.00 . A A .  51 GLN N    1 1 
        5  8438 1 1  51 GLN NE2  N  -2.398  23.841  -3.576 1.00 . A A .  51 GLN NE2  1 1 
        5  8439 1 1  51 GLN O    O   1.175  17.370  -3.655 1.00 . A A .  51 GLN O    1 1 
        5  8440 1 1  51 GLN OE1  O  -3.401  21.888  -3.439 1.00 . A A .  51 GLN OE1  1 1 
        5  8441 1 1  52 ARG C    C  -1.172  15.436  -3.159 1.00 . A A .  52 ARG C    1 1 
        5  8442 1 1  52 ARG CA   C  -0.953  16.409  -1.958 1.00 . A A .  52 ARG CA   1 1 
        5  8443 1 1  52 ARG CB   C  -2.226  16.512  -1.050 1.00 . A A .  52 ARG CB   1 1 
        5  8444 1 1  52 ARG CD   C  -3.851  17.937  -2.540 1.00 . A A .  52 ARG CD   1 1 
        5  8445 1 1  52 ARG CG   C  -3.605  16.670  -1.707 1.00 . A A .  52 ARG CG   1 1 
        5  8446 1 1  52 ARG CZ   C  -5.943  18.600  -3.755 1.00 . A A .  52 ARG CZ   1 1 
        5  8447 1 1  52 ARG H    H  -1.046  18.594  -1.849 1.00 . A A .  52 ARG H    1 1 
        5  8448 1 1  52 ARG HA   H  -0.154  15.991  -1.312 1.00 . A A .  52 ARG HA   1 1 
        5  8449 1 1  52 ARG HB2  H  -2.296  15.578  -0.451 1.00 . A A .  52 ARG HB2  1 1 
        5  8450 1 1  52 ARG HB3  H  -2.080  17.292  -0.278 1.00 . A A .  52 ARG HB3  1 1 
        5  8451 1 1  52 ARG HD2  H  -3.893  18.833  -1.888 1.00 . A A .  52 ARG HD2  1 1 
        5  8452 1 1  52 ARG HD3  H  -3.040  18.088  -3.279 1.00 . A A .  52 ARG HD3  1 1 
        5  8453 1 1  52 ARG HE   H  -5.369  16.733  -3.576 1.00 . A A .  52 ARG HE   1 1 
        5  8454 1 1  52 ARG HG2  H  -3.787  15.760  -2.320 1.00 . A A .  52 ARG HG2  1 1 
        5  8455 1 1  52 ARG HG3  H  -4.371  16.603  -0.905 1.00 . A A .  52 ARG HG3  1 1 
        5  8456 1 1  52 ARG HH11 H  -4.815  20.192  -3.380 1.00 . A A .  52 ARG HH11 1 1 
        5  8457 1 1  52 ARG HH12 H  -6.431  20.493  -4.170 1.00 . A A .  52 ARG HH12 1 1 
        5  8458 1 1  52 ARG HH21 H  -7.183  17.107  -4.184 1.00 . A A .  52 ARG HH21 1 1 
        5  8459 1 1  52 ARG HH22 H  -7.714  18.807  -4.665 1.00 . A A .  52 ARG HH22 1 1 
        5  8460 1 1  52 ARG N    N  -0.534  17.797  -2.238 1.00 . A A .  52 ARG N    1 1 
        5  8461 1 1  52 ARG NE   N  -5.112  17.702  -3.270 1.00 . A A .  52 ARG NE   1 1 
        5  8462 1 1  52 ARG NH1  N  -5.728  19.892  -3.741 1.00 . A A .  52 ARG NH1  1 1 
        5  8463 1 1  52 ARG NH2  N  -7.041  18.145  -4.285 1.00 . A A .  52 ARG NH2  1 1 
        5  8464 1 1  52 ARG O    O  -1.568  15.830  -4.259 1.00 . A A .  52 ARG O    1 1 
        5  8465 1 1  53 TRP C    C  -2.784  12.505  -3.111 1.00 . A A .  53 TRP C    1 1 
        5  8466 1 1  53 TRP CA   C  -1.471  13.037  -3.741 1.00 . A A .  53 TRP CA   1 1 
        5  8467 1 1  53 TRP CB   C  -0.298  12.046  -3.804 1.00 . A A .  53 TRP CB   1 1 
        5  8468 1 1  53 TRP CD1  C  -1.614   9.899  -4.781 1.00 . A A .  53 TRP CD1  1 1 
        5  8469 1 1  53 TRP CD2  C   0.417   9.534  -3.943 1.00 . A A .  53 TRP CD2  1 1 
        5  8470 1 1  53 TRP CE2  C  -0.183   8.301  -4.315 1.00 . A A .  53 TRP CE2  1 1 
        5  8471 1 1  53 TRP CE3  C   1.713   9.543  -3.323 1.00 . A A .  53 TRP CE3  1 1 
        5  8472 1 1  53 TRP CG   C  -0.486  10.560  -4.213 1.00 . A A .  53 TRP CG   1 1 
        5  8473 1 1  53 TRP CH2  C   1.759   7.119  -3.468 1.00 . A A .  53 TRP CH2  1 1 
        5  8474 1 1  53 TRP CZ2  C   0.510   7.080  -4.081 1.00 . A A .  53 TRP CZ2  1 1 
        5  8475 1 1  53 TRP CZ3  C   2.351   8.336  -3.088 1.00 . A A .  53 TRP CZ3  1 1 
        5  8476 1 1  53 TRP H    H  -0.803  13.968  -1.872 1.00 . A A .  53 TRP H    1 1 
        5  8477 1 1  53 TRP HA   H  -1.661  13.397  -4.772 1.00 . A A .  53 TRP HA   1 1 
        5  8478 1 1  53 TRP HB2  H   0.488  12.481  -4.452 1.00 . A A .  53 TRP HB2  1 1 
        5  8479 1 1  53 TRP HB3  H   0.157  11.978  -2.800 1.00 . A A .  53 TRP HB3  1 1 
        5  8480 1 1  53 TRP HD1  H  -2.534  10.385  -5.059 1.00 . A A .  53 TRP HD1  1 1 
        5  8481 1 1  53 TRP HE1  H  -2.152   7.803  -5.091 1.00 . A A .  53 TRP HE1  1 1 
        5  8482 1 1  53 TRP HE3  H   2.160  10.472  -2.987 1.00 . A A .  53 TRP HE3  1 1 
        5  8483 1 1  53 TRP HH2  H   2.274   6.204  -3.237 1.00 . A A .  53 TRP HH2  1 1 
        5  8484 1 1  53 TRP HZ2  H   0.073   6.131  -4.359 1.00 . A A .  53 TRP HZ2  1 1 
        5  8485 1 1  53 TRP HZ3  H   3.310   8.314  -2.581 1.00 . A A .  53 TRP HZ3  1 1 
        5  8486 1 1  53 TRP N    N  -0.984  14.148  -2.876 1.00 . A A .  53 TRP N    1 1 
        5  8487 1 1  53 TRP NE1  N  -1.445   8.507  -4.839 1.00 . A A .  53 TRP NE1  1 1 
        5  8488 1 1  53 TRP O    O  -2.742  11.776  -2.121 1.00 . A A .  53 TRP O    1 1 
        5  8489 1 1  54 ASP C    C  -5.967  11.493  -4.348 1.00 . A A .  54 ASP C    1 1 
        5  8490 1 1  54 ASP CA   C  -5.274  12.398  -3.278 1.00 . A A .  54 ASP CA   1 1 
        5  8491 1 1  54 ASP CB   C  -6.086  13.646  -2.842 1.00 . A A .  54 ASP CB   1 1 
        5  8492 1 1  54 ASP CG   C  -6.293  14.821  -3.800 1.00 . A A .  54 ASP CG   1 1 
        5  8493 1 1  54 ASP H    H  -3.881  13.719  -4.274 1.00 . A A .  54 ASP H    1 1 
        5  8494 1 1  54 ASP HA   H  -5.194  11.773  -2.365 1.00 . A A .  54 ASP HA   1 1 
        5  8495 1 1  54 ASP HB2  H  -7.080  13.315  -2.493 1.00 . A A .  54 ASP HB2  1 1 
        5  8496 1 1  54 ASP HB3  H  -5.599  14.059  -1.940 1.00 . A A .  54 ASP HB3  1 1 
        5  8497 1 1  54 ASP N    N  -3.925  12.864  -3.704 1.00 . A A .  54 ASP N    1 1 
        5  8498 1 1  54 ASP O    O  -7.071  11.789  -4.812 1.00 . A A .  54 ASP O    1 1 
        5  8499 1 1  54 ASP OD1  O  -5.332  15.255  -4.474 1.00 . A A .  54 ASP OD1  1 1 
        5  8500 1 1  54 ASP OD2  O  -7.368  15.453  -3.784 1.00 . A A .  54 ASP OD2  1 1 
        5  8501 1 1  55 TYR C    C  -5.573   8.144  -5.904 1.00 . A A .  55 TYR C    1 1 
        5  8502 1 1  55 TYR CA   C  -5.636   9.701  -6.038 1.00 . A A .  55 TYR CA   1 1 
        5  8503 1 1  55 TYR CB   C  -4.666  10.139  -7.191 1.00 . A A .  55 TYR CB   1 1 
        5  8504 1 1  55 TYR CD1  C  -5.755  12.389  -7.739 1.00 . A A .  55 TYR CD1  1 1 
        5  8505 1 1  55 TYR CD2  C  -3.400  12.351  -7.206 1.00 . A A .  55 TYR CD2  1 1 
        5  8506 1 1  55 TYR CE1  C  -5.759  13.778  -7.615 1.00 . A A .  55 TYR CE1  1 1 
        5  8507 1 1  55 TYR CE2  C  -3.403  13.743  -7.102 1.00 . A A .  55 TYR CE2  1 1 
        5  8508 1 1  55 TYR CG   C  -4.590  11.652  -7.462 1.00 . A A .  55 TYR CG   1 1 
        5  8509 1 1  55 TYR CZ   C  -4.591  14.450  -7.267 1.00 . A A .  55 TYR CZ   1 1 
        5  8510 1 1  55 TYR H    H  -4.376  10.292  -4.347 1.00 . A A .  55 TYR H    1 1 
        5  8511 1 1  55 TYR HA   H  -6.668   9.973  -6.348 1.00 . A A .  55 TYR HA   1 1 
        5  8512 1 1  55 TYR HB2  H  -3.656   9.735  -6.987 1.00 . A A .  55 TYR HB2  1 1 
        5  8513 1 1  55 TYR HB3  H  -4.985   9.636  -8.120 1.00 . A A .  55 TYR HB3  1 1 
        5  8514 1 1  55 TYR HD1  H  -6.699  11.882  -7.896 1.00 . A A .  55 TYR HD1  1 1 
        5  8515 1 1  55 TYR HD2  H  -2.486  11.818  -6.976 1.00 . A A .  55 TYR HD2  1 1 
        5  8516 1 1  55 TYR HE1  H  -6.695  14.319  -7.668 1.00 . A A .  55 TYR HE1  1 1 
        5  8517 1 1  55 TYR HE2  H  -2.513  14.267  -6.782 1.00 . A A .  55 TYR HE2  1 1 
        5  8518 1 1  55 TYR HH   H  -4.970  15.579  -5.802 1.00 . A A .  55 TYR HH   1 1 
        5  8519 1 1  55 TYR N    N  -5.309  10.383  -4.756 1.00 . A A .  55 TYR N    1 1 
        5  8520 1 1  55 TYR O    O  -4.631   7.579  -5.335 1.00 . A A .  55 TYR O    1 1 
        5  8521 1 1  55 TYR OH   O  -4.685  15.707  -6.756 1.00 . A A .  55 TYR OH   1 1 
        5  8522 1 1  56 THR C    C  -5.845   5.453  -7.785 1.00 . A A .  56 THR C    1 1 
        5  8523 1 1  56 THR CA   C  -6.635   5.985  -6.545 1.00 . A A .  56 THR CA   1 1 
        5  8524 1 1  56 THR CB   C  -8.148   5.566  -6.604 1.00 . A A .  56 THR CB   1 1 
        5  8525 1 1  56 THR CG2  C  -8.383   4.106  -6.239 1.00 . A A .  56 THR CG2  1 1 
        5  8526 1 1  56 THR H    H  -7.330   8.040  -6.870 1.00 . A A .  56 THR H    1 1 
        5  8527 1 1  56 THR HA   H  -6.200   5.564  -5.618 1.00 . A A .  56 THR HA   1 1 
        5  8528 1 1  56 THR HB   H  -8.525   5.747  -7.631 1.00 . A A .  56 THR HB   1 1 
        5  8529 1 1  56 THR HG1  H  -8.494   6.515  -4.905 1.00 . A A .  56 THR HG1  1 1 
        5  8530 1 1  56 THR HG21 H  -9.460   3.861  -6.237 1.00 . A A .  56 THR HG21 1 1 
        5  8531 1 1  56 THR HG22 H  -7.912   3.413  -6.946 1.00 . A A .  56 THR HG22 1 1 
        5  8532 1 1  56 THR HG23 H  -7.995   3.843  -5.243 1.00 . A A .  56 THR HG23 1 1 
        5  8533 1 1  56 THR N    N  -6.559   7.469  -6.510 1.00 . A A .  56 THR N    1 1 
        5  8534 1 1  56 THR O    O  -6.327   5.561  -8.917 1.00 . A A .  56 THR O    1 1 
        5  8535 1 1  56 THR OG1  O  -8.987   6.327  -5.734 1.00 . A A .  56 THR OG1  1 1 
        5  8536 1 1  57 SER C    C  -3.841   2.962  -8.989 1.00 . A A .  57 SER C    1 1 
        5  8537 1 1  57 SER CA   C  -3.763   4.481  -8.720 1.00 . A A .  57 SER CA   1 1 
        5  8538 1 1  57 SER CB   C  -2.331   4.999  -8.485 1.00 . A A .  57 SER CB   1 1 
        5  8539 1 1  57 SER H    H  -4.272   4.930  -6.621 1.00 . A A .  57 SER H    1 1 
        5  8540 1 1  57 SER HA   H  -4.070   5.023  -9.643 1.00 . A A .  57 SER HA   1 1 
        5  8541 1 1  57 SER HB2  H  -1.733   4.760  -9.382 1.00 . A A .  57 SER HB2  1 1 
        5  8542 1 1  57 SER HB3  H  -2.402   6.101  -8.430 1.00 . A A .  57 SER HB3  1 1 
        5  8543 1 1  57 SER HG   H  -0.940   5.079  -7.130 1.00 . A A .  57 SER HG   1 1 
        5  8544 1 1  57 SER N    N  -4.629   4.917  -7.590 1.00 . A A .  57 SER N    1 1 
        5  8545 1 1  57 SER O    O  -3.205   2.135  -8.331 1.00 . A A .  57 SER O    1 1 
        5  8546 1 1  57 SER OG   O  -1.690   4.483  -7.318 1.00 . A A .  57 SER OG   1 1 
        5  8547 1 1  58 THR C    C  -5.750   0.513 -11.061 1.00 . A A .  58 THR C    1 1 
        5  8548 1 1  58 THR CA   C  -5.575   1.408  -9.803 1.00 . A A .  58 THR CA   1 1 
        5  8549 1 1  58 THR CB   C  -6.910   1.891  -9.152 1.00 . A A .  58 THR CB   1 1 
        5  8550 1 1  58 THR CG2  C  -7.787   2.822  -9.974 1.00 . A A .  58 THR CG2  1 1 
        5  8551 1 1  58 THR H    H  -5.060   3.458 -10.388 1.00 . A A .  58 THR H    1 1 
        5  8552 1 1  58 THR HA   H  -5.119   0.743  -9.041 1.00 . A A .  58 THR HA   1 1 
        5  8553 1 1  58 THR HB   H  -6.600   2.351  -8.193 1.00 . A A .  58 THR HB   1 1 
        5  8554 1 1  58 THR HG1  H  -8.648   1.067  -9.029 1.00 . A A .  58 THR HG1  1 1 
        5  8555 1 1  58 THR HG21 H  -8.201   2.322 -10.869 1.00 . A A .  58 THR HG21 1 1 
        5  8556 1 1  58 THR HG22 H  -8.642   3.196  -9.381 1.00 . A A .  58 THR HG22 1 1 
        5  8557 1 1  58 THR HG23 H  -7.256   3.718 -10.337 1.00 . A A .  58 THR HG23 1 1 
        5  8558 1 1  58 THR N    N  -4.695   2.607  -9.954 1.00 . A A .  58 THR N    1 1 
        5  8559 1 1  58 THR O    O  -5.265   0.787 -12.162 1.00 . A A .  58 THR O    1 1 
        5  8560 1 1  58 THR OG1  O  -7.741   0.793  -8.813 1.00 . A A .  58 THR OG1  1 1 
        5  8561 1 1  59 GLN C    C  -8.034  -2.426 -11.470 1.00 . A A .  59 GLN C    1 1 
        5  8562 1 1  59 GLN CA   C  -6.703  -1.673 -11.833 1.00 . A A .  59 GLN CA   1 1 
        5  8563 1 1  59 GLN CB   C  -5.443  -2.574 -11.919 1.00 . A A .  59 GLN CB   1 1 
        5  8564 1 1  59 GLN CD   C  -5.330  -2.847 -14.499 1.00 . A A .  59 GLN CD   1 1 
        5  8565 1 1  59 GLN CG   C  -5.304  -3.517 -13.131 1.00 . A A .  59 GLN CG   1 1 
        5  8566 1 1  59 GLN H    H  -7.029  -0.493  -9.979 1.00 . A A .  59 GLN H    1 1 
        5  8567 1 1  59 GLN HA   H  -6.872  -1.180 -12.809 1.00 . A A .  59 GLN HA   1 1 
        5  8568 1 1  59 GLN HB2  H  -4.541  -1.926 -11.919 1.00 . A A .  59 GLN HB2  1 1 
        5  8569 1 1  59 GLN HB3  H  -5.355  -3.172 -10.991 1.00 . A A .  59 GLN HB3  1 1 
        5  8570 1 1  59 GLN HE21 H  -3.341  -2.704 -14.521 1.00 . A A .  59 GLN HE21 1 1 
        5  8571 1 1  59 GLN HE22 H  -4.270  -2.058 -15.968 1.00 . A A .  59 GLN HE22 1 1 
        5  8572 1 1  59 GLN HG2  H  -4.362  -4.086 -13.008 1.00 . A A .  59 GLN HG2  1 1 
        5  8573 1 1  59 GLN HG3  H  -6.074  -4.307 -13.111 1.00 . A A .  59 GLN HG3  1 1 
        5  8574 1 1  59 GLN N    N  -6.433  -0.618 -10.821 1.00 . A A .  59 GLN N    1 1 
        5  8575 1 1  59 GLN NE2  N  -4.192  -2.520 -15.059 1.00 . A A .  59 GLN NE2  1 1 
        5  8576 1 1  59 GLN O    O  -8.676  -2.174 -10.442 1.00 . A A .  59 GLN O    1 1 
        5  8577 1 1  59 GLN OE1  O  -6.385  -2.601 -15.079 1.00 . A A .  59 GLN OE1  1 1 
        5  8578 1 1  60 ARG C    C  -9.723  -5.208 -11.147 1.00 . A A .  60 ARG C    1 1 
        5  8579 1 1  60 ARG CA   C  -9.772  -4.047 -12.212 1.00 . A A .  60 ARG CA   1 1 
        5  8580 1 1  60 ARG CB   C -10.234  -4.588 -13.594 1.00 . A A .  60 ARG CB   1 1 
        5  8581 1 1  60 ARG CD   C  -9.489  -2.865 -15.371 1.00 . A A .  60 ARG CD   1 1 
        5  8582 1 1  60 ARG CG   C -10.656  -3.574 -14.677 1.00 . A A .  60 ARG CG   1 1 
        5  8583 1 1  60 ARG CZ   C  -9.185  -1.295 -17.281 1.00 . A A .  60 ARG CZ   1 1 
        5  8584 1 1  60 ARG H    H  -7.857  -3.471 -13.158 1.00 . A A .  60 ARG H    1 1 
        5  8585 1 1  60 ARG HA   H -10.544  -3.329 -11.869 1.00 . A A .  60 ARG HA   1 1 
        5  8586 1 1  60 ARG HB2  H  -9.482  -5.294 -14.000 1.00 . A A .  60 ARG HB2  1 1 
        5  8587 1 1  60 ARG HB3  H -11.124  -5.231 -13.416 1.00 . A A .  60 ARG HB3  1 1 
        5  8588 1 1  60 ARG HD2  H  -8.964  -2.207 -14.651 1.00 . A A .  60 ARG HD2  1 1 
        5  8589 1 1  60 ARG HD3  H  -8.747  -3.613 -15.721 1.00 . A A .  60 ARG HD3  1 1 
        5  8590 1 1  60 ARG HE   H -10.959  -2.022 -16.764 1.00 . A A .  60 ARG HE   1 1 
        5  8591 1 1  60 ARG HG2  H -11.239  -4.142 -15.432 1.00 . A A .  60 ARG HG2  1 1 
        5  8592 1 1  60 ARG HG3  H -11.369  -2.840 -14.258 1.00 . A A .  60 ARG HG3  1 1 
        5  8593 1 1  60 ARG HH11 H  -7.485  -1.751 -16.358 1.00 . A A .  60 ARG HH11 1 1 
        5  8594 1 1  60 ARG HH12 H  -7.368  -0.587 -17.767 1.00 . A A .  60 ARG HH12 1 1 
        5  8595 1 1  60 ARG HH21 H -10.752  -0.708 -18.352 1.00 . A A .  60 ARG HH21 1 1 
        5  8596 1 1  60 ARG HH22 H  -9.128  -0.045 -18.826 1.00 . A A .  60 ARG HH22 1 1 
        5  8597 1 1  60 ARG N    N  -8.470  -3.342 -12.346 1.00 . A A .  60 ARG N    1 1 
        5  8598 1 1  60 ARG NE   N  -9.967  -2.050 -16.512 1.00 . A A .  60 ARG NE   1 1 
        5  8599 1 1  60 ARG NH1  N  -7.886  -1.192 -17.129 1.00 . A A .  60 ARG NH1  1 1 
        5  8600 1 1  60 ARG NH2  N  -9.740  -0.619 -18.244 1.00 . A A .  60 ARG NH2  1 1 
        5  8601 1 1  60 ARG O    O  -9.618  -6.391 -11.483 1.00 . A A .  60 ARG O    1 1 
        5  8602 1 1  61 VAL C    C -11.210  -6.401  -8.364 1.00 . A A .  61 VAL C    1 1 
        5  8603 1 1  61 VAL CA   C  -9.816  -5.794  -8.723 1.00 . A A .  61 VAL CA   1 1 
        5  8604 1 1  61 VAL CB   C  -9.027  -5.164  -7.526 1.00 . A A .  61 VAL CB   1 1 
        5  8605 1 1  61 VAL CG1  C  -9.739  -4.040  -6.760 1.00 . A A .  61 VAL CG1  1 1 
        5  8606 1 1  61 VAL CG2  C  -8.568  -6.235  -6.516 1.00 . A A .  61 VAL CG2  1 1 
        5  8607 1 1  61 VAL H    H  -9.573  -3.843  -9.728 1.00 . A A .  61 VAL H    1 1 
        5  8608 1 1  61 VAL HA   H  -9.202  -6.658  -9.044 1.00 . A A .  61 VAL HA   1 1 
        5  8609 1 1  61 VAL HB   H  -8.092  -4.732  -7.947 1.00 . A A .  61 VAL HB   1 1 
        5  8610 1 1  61 VAL HG11 H -10.612  -4.397  -6.184 1.00 . A A .  61 VAL HG11 1 1 
        5  8611 1 1  61 VAL HG12 H  -9.059  -3.551  -6.038 1.00 . A A .  61 VAL HG12 1 1 
        5  8612 1 1  61 VAL HG13 H -10.108  -3.251  -7.434 1.00 . A A .  61 VAL HG13 1 1 
        5  8613 1 1  61 VAL HG21 H  -7.931  -5.800  -5.724 1.00 . A A .  61 VAL HG21 1 1 
        5  8614 1 1  61 VAL HG22 H  -9.415  -6.740  -6.016 1.00 . A A .  61 VAL HG22 1 1 
        5  8615 1 1  61 VAL HG23 H  -7.967  -7.019  -7.012 1.00 . A A .  61 VAL HG23 1 1 
        5  8616 1 1  61 VAL N    N  -9.821  -4.830  -9.864 1.00 . A A .  61 VAL N    1 1 
        5  8617 1 1  61 VAL O    O -11.302  -7.613  -8.158 1.00 . A A .  61 VAL O    1 1 
        5  8618 1 1  62 ASP C    C -14.700  -5.561  -8.846 1.00 . A A .  62 ASP C    1 1 
        5  8619 1 1  62 ASP CA   C -13.613  -5.981  -7.793 1.00 . A A .  62 ASP CA   1 1 
        5  8620 1 1  62 ASP CB   C -13.677  -5.421  -6.359 1.00 . A A .  62 ASP CB   1 1 
        5  8621 1 1  62 ASP CG   C -14.858  -5.698  -5.450 1.00 . A A .  62 ASP CG   1 1 
        5  8622 1 1  62 ASP H    H -12.026  -4.585  -8.433 1.00 . A A .  62 ASP H    1 1 
        5  8623 1 1  62 ASP HA   H -13.663  -7.087  -7.736 1.00 . A A .  62 ASP HA   1 1 
        5  8624 1 1  62 ASP HB2  H -12.798  -5.818  -5.812 1.00 . A A .  62 ASP HB2  1 1 
        5  8625 1 1  62 ASP HB3  H -13.505  -4.332  -6.363 1.00 . A A .  62 ASP HB3  1 1 
        5  8626 1 1  62 ASP N    N -12.254  -5.568  -8.256 1.00 . A A .  62 ASP N    1 1 
        5  8627 1 1  62 ASP O    O -14.413  -5.173  -9.983 1.00 . A A .  62 ASP O    1 1 
        5  8628 1 1  62 ASP OD1  O -15.876  -6.298  -5.847 1.00 . A A .  62 ASP OD1  1 1 
        5  8629 1 1  62 ASP OD2  O -14.794  -5.251  -4.284 1.00 . A A .  62 ASP OD2  1 1 
        5  8630 1 1  63 ARG C    C -17.690  -5.092 -10.289 1.00 . A A .  63 ARG C    1 1 
        5  8631 1 1  63 ARG CA   C -17.001  -6.233  -9.492 1.00 . A A .  63 ARG CA   1 1 
        5  8632 1 1  63 ARG CB   C -17.930  -7.169  -8.681 1.00 . A A .  63 ARG CB   1 1 
        5  8633 1 1  63 ARG CD   C -20.020  -8.649  -8.553 1.00 . A A .  63 ARG CD   1 1 
        5  8634 1 1  63 ARG CG   C -18.975  -7.977  -9.473 1.00 . A A .  63 ARG CG   1 1 
        5  8635 1 1  63 ARG CZ   C -19.791  -9.957  -6.432 1.00 . A A .  63 ARG CZ   1 1 
        5  8636 1 1  63 ARG H    H -16.035  -6.050  -7.496 1.00 . A A .  63 ARG H    1 1 
        5  8637 1 1  63 ARG HA   H -16.494  -6.873 -10.245 1.00 . A A .  63 ARG HA   1 1 
        5  8638 1 1  63 ARG HB2  H -17.301  -7.891  -8.119 1.00 . A A .  63 ARG HB2  1 1 
        5  8639 1 1  63 ARG HB3  H -18.437  -6.578  -7.900 1.00 . A A .  63 ARG HB3  1 1 
        5  8640 1 1  63 ARG HD2  H -20.532  -7.856  -7.974 1.00 . A A .  63 ARG HD2  1 1 
        5  8641 1 1  63 ARG HD3  H -20.817  -9.109  -9.172 1.00 . A A .  63 ARG HD3  1 1 
        5  8642 1 1  63 ARG HE   H -18.556 -10.161  -7.966 1.00 . A A .  63 ARG HE   1 1 
        5  8643 1 1  63 ARG HG2  H -19.527  -7.315 -10.171 1.00 . A A .  63 ARG HG2  1 1 
        5  8644 1 1  63 ARG HG3  H -18.482  -8.727 -10.122 1.00 . A A .  63 ARG HG3  1 1 
        5  8645 1 1  63 ARG HH11 H -21.472  -8.809  -6.383 1.00 . A A .  63 ARG HH11 1 1 
        5  8646 1 1  63 ARG HH12 H -21.071  -9.821  -4.905 1.00 . A A .  63 ARG HH12 1 1 
        5  8647 1 1  63 ARG HH21 H -18.232 -11.167  -6.192 1.00 . A A .  63 ARG HH21 1 1 
        5  8648 1 1  63 ARG HH22 H -19.359 -10.949  -4.776 1.00 . A A .  63 ARG HH22 1 1 
        5  8649 1 1  63 ARG N    N -15.972  -5.790  -8.506 1.00 . A A .  63 ARG N    1 1 
        5  8650 1 1  63 ARG NE   N -19.411  -9.680  -7.676 1.00 . A A .  63 ARG NE   1 1 
        5  8651 1 1  63 ARG NH1  N -20.845  -9.459  -5.843 1.00 . A A .  63 ARG NH1  1 1 
        5  8652 1 1  63 ARG NH2  N -19.072 -10.795  -5.745 1.00 . A A .  63 ARG NH2  1 1 
        5  8653 1 1  63 ARG O    O -17.324  -4.883 -11.446 1.00 . A A .  63 ARG O    1 1 
        5  8654 1 1  64 LEU C    C -18.943  -2.143 -10.876 1.00 . A A .  64 LEU C    1 1 
        5  8655 1 1  64 LEU CA   C -19.601  -3.504 -10.523 1.00 . A A .  64 LEU CA   1 1 
        5  8656 1 1  64 LEU CB   C -20.944  -3.457  -9.755 1.00 . A A .  64 LEU CB   1 1 
        5  8657 1 1  64 LEU CD1  C -22.301  -1.729 -11.109 1.00 . A A .  64 LEU CD1  1 1 
        5  8658 1 1  64 LEU CD2  C -22.538  -4.195 -11.597 1.00 . A A .  64 LEU CD2  1 1 
        5  8659 1 1  64 LEU CG   C -22.236  -3.138 -10.528 1.00 . A A .  64 LEU CG   1 1 
        5  8660 1 1  64 LEU H    H -19.086  -4.850  -8.894 1.00 . A A .  64 LEU H    1 1 
        5  8661 1 1  64 LEU HA   H -19.786  -4.010 -11.492 1.00 . A A .  64 LEU HA   1 1 
        5  8662 1 1  64 LEU HB2  H -21.141  -4.445  -9.282 1.00 . A A .  64 LEU HB2  1 1 
        5  8663 1 1  64 LEU HB3  H -20.875  -2.771  -8.892 1.00 . A A .  64 LEU HB3  1 1 
        5  8664 1 1  64 LEU HD11 H -22.105  -0.956 -10.344 1.00 . A A .  64 LEU HD11 1 1 
        5  8665 1 1  64 LEU HD12 H -21.572  -1.567 -11.924 1.00 . A A .  64 LEU HD12 1 1 
        5  8666 1 1  64 LEU HD13 H -23.300  -1.514 -11.529 1.00 . A A .  64 LEU HD13 1 1 
        5  8667 1 1  64 LEU HD21 H -23.580  -4.118 -11.958 1.00 . A A .  64 LEU HD21 1 1 
        5  8668 1 1  64 LEU HD22 H -21.884  -4.107 -12.483 1.00 . A A .  64 LEU HD22 1 1 
        5  8669 1 1  64 LEU HD23 H -22.402  -5.217 -11.194 1.00 . A A .  64 LEU HD23 1 1 
        5  8670 1 1  64 LEU HG   H -23.040  -3.219  -9.764 1.00 . A A .  64 LEU HG   1 1 
        5  8671 1 1  64 LEU N    N -18.705  -4.400  -9.729 1.00 . A A .  64 LEU N    1 1 
        5  8672 1 1  64 LEU O    O -18.447  -2.001 -11.995 1.00 . A A .  64 LEU O    1 1 
        5  8673 1 1  65 ALA C    C -17.001   0.104  -8.943 1.00 . A A .  65 ALA C    1 1 
        5  8674 1 1  65 ALA CA   C -18.026   0.035 -10.108 1.00 . A A .  65 ALA CA   1 1 
        5  8675 1 1  65 ALA CB   C -18.943   1.253 -10.225 1.00 . A A .  65 ALA CB   1 1 
        5  8676 1 1  65 ALA H    H -19.417  -1.340  -9.091 1.00 . A A .  65 ALA H    1 1 
        5  8677 1 1  65 ALA HA   H -17.443  -0.013 -11.054 1.00 . A A .  65 ALA HA   1 1 
        5  8678 1 1  65 ALA HB1  H -19.595   1.387  -9.344 1.00 . A A .  65 ALA HB1  1 1 
        5  8679 1 1  65 ALA HB2  H -18.375   2.191 -10.357 1.00 . A A .  65 ALA HB2  1 1 
        5  8680 1 1  65 ALA HB3  H -19.596   1.147 -11.109 1.00 . A A .  65 ALA HB3  1 1 
        5  8681 1 1  65 ALA N    N -18.892  -1.166  -9.955 1.00 . A A .  65 ALA N    1 1 
        5  8682 1 1  65 ALA O    O -17.088   0.935  -8.032 1.00 . A A .  65 ALA O    1 1 
        5  8683 1 1  66 ARG C    C -13.632  -1.437  -8.414 1.00 . A A .  66 ARG C    1 1 
        5  8684 1 1  66 ARG CA   C -15.062  -1.058  -7.891 1.00 . A A .  66 ARG CA   1 1 
        5  8685 1 1  66 ARG CB   C -15.689  -2.080  -6.899 1.00 . A A .  66 ARG CB   1 1 
        5  8686 1 1  66 ARG CD   C -14.672  -1.319  -4.610 1.00 . A A .  66 ARG CD   1 1 
        5  8687 1 1  66 ARG CG   C -15.919  -1.561  -5.466 1.00 . A A .  66 ARG CG   1 1 
        5  8688 1 1  66 ARG CZ   C -12.941  -2.711  -3.474 1.00 . A A .  66 ARG CZ   1 1 
        5  8689 1 1  66 ARG H    H -16.192  -1.494  -9.756 1.00 . A A .  66 ARG H    1 1 
        5  8690 1 1  66 ARG HA   H -14.891  -0.105  -7.357 1.00 . A A .  66 ARG HA   1 1 
        5  8691 1 1  66 ARG HB2  H -16.675  -2.428  -7.267 1.00 . A A .  66 ARG HB2  1 1 
        5  8692 1 1  66 ARG HB3  H -15.120  -3.022  -6.871 1.00 . A A .  66 ARG HB3  1 1 
        5  8693 1 1  66 ARG HD2  H -13.929  -0.713  -5.162 1.00 . A A .  66 ARG HD2  1 1 
        5  8694 1 1  66 ARG HD3  H -14.956  -0.708  -3.732 1.00 . A A .  66 ARG HD3  1 1 
        5  8695 1 1  66 ARG HE   H -14.486  -3.520  -4.362 1.00 . A A .  66 ARG HE   1 1 
        5  8696 1 1  66 ARG HG2  H -16.510  -0.624  -5.513 1.00 . A A .  66 ARG HG2  1 1 
        5  8697 1 1  66 ARG HG3  H -16.586  -2.270  -4.937 1.00 . A A .  66 ARG HG3  1 1 
        5  8698 1 1  66 ARG HH11 H -12.609  -0.740  -3.098 1.00 . A A .  66 ARG HH11 1 1 
        5  8699 1 1  66 ARG HH12 H -11.350  -1.970  -2.540 1.00 . A A .  66 ARG HH12 1 1 
        5  8700 1 1  66 ARG HH21 H -13.133  -4.666  -3.617 1.00 . A A .  66 ARG HH21 1 1 
        5  8701 1 1  66 ARG HH22 H -11.606  -4.004  -2.779 1.00 . A A .  66 ARG HH22 1 1 
        5  8702 1 1  66 ARG N    N -16.026  -0.817  -9.001 1.00 . A A .  66 ARG N    1 1 
        5  8703 1 1  66 ARG NE   N -14.082  -2.588  -4.137 1.00 . A A .  66 ARG NE   1 1 
        5  8704 1 1  66 ARG NH1  N -12.225  -1.722  -3.008 1.00 . A A .  66 ARG NH1  1 1 
        5  8705 1 1  66 ARG NH2  N -12.513  -3.917  -3.264 1.00 . A A .  66 ARG NH2  1 1 
        5  8706 1 1  66 ARG O    O -13.029  -2.434  -8.007 1.00 . A A .  66 ARG O    1 1 
        5  8707 1 1  67 THR C    C -10.701   0.094  -8.905 1.00 . A A .  67 THR C    1 1 
        5  8708 1 1  67 THR CA   C -11.674  -0.743  -9.795 1.00 . A A .  67 THR CA   1 1 
        5  8709 1 1  67 THR CB   C -11.587  -0.304 -11.291 1.00 . A A .  67 THR CB   1 1 
        5  8710 1 1  67 THR CG2  C -12.534  -1.029 -12.243 1.00 . A A .  67 THR CG2  1 1 
        5  8711 1 1  67 THR H    H -13.684   0.142  -9.647 1.00 . A A .  67 THR H    1 1 
        5  8712 1 1  67 THR HA   H -11.365  -1.808  -9.750 1.00 . A A .  67 THR HA   1 1 
        5  8713 1 1  67 THR HB   H -10.550  -0.506 -11.625 1.00 . A A .  67 THR HB   1 1 
        5  8714 1 1  67 THR HG1  H -11.335   1.514 -10.714 1.00 . A A .  67 THR HG1  1 1 
        5  8715 1 1  67 THR HG21 H -13.591  -0.767 -12.054 1.00 . A A .  67 THR HG21 1 1 
        5  8716 1 1  67 THR HG22 H -12.323  -0.749 -13.290 1.00 . A A .  67 THR HG22 1 1 
        5  8717 1 1  67 THR HG23 H -12.464  -2.128 -12.168 1.00 . A A .  67 THR HG23 1 1 
        5  8718 1 1  67 THR N    N -13.056  -0.573  -9.267 1.00 . A A .  67 THR N    1 1 
        5  8719 1 1  67 THR O    O -10.410   1.260  -9.196 1.00 . A A .  67 THR O    1 1 
        5  8720 1 1  67 THR OG1  O -11.827   1.097 -11.439 1.00 . A A .  67 THR OG1  1 1 
        5  8721 1 1  68 GLU C    C  -8.861  -0.337  -5.696 1.00 . A A .  68 GLU C    1 1 
        5  8722 1 1  68 GLU CA   C  -9.984   0.326  -6.545 1.00 . A A .  68 GLU CA   1 1 
        5  8723 1 1  68 GLU CB   C -11.326   0.486  -5.794 1.00 . A A .  68 GLU CB   1 1 
        5  8724 1 1  68 GLU CD   C -12.686   1.597  -3.985 1.00 . A A .  68 GLU CD   1 1 
        5  8725 1 1  68 GLU CG   C -11.306   1.458  -4.601 1.00 . A A .  68 GLU CG   1 1 
        5  8726 1 1  68 GLU H    H -10.307  -1.494  -7.775 1.00 . A A .  68 GLU H    1 1 
        5  8727 1 1  68 GLU HA   H  -9.651   1.346  -6.831 1.00 . A A .  68 GLU HA   1 1 
        5  8728 1 1  68 GLU HB2  H -12.094   0.844  -6.511 1.00 . A A .  68 GLU HB2  1 1 
        5  8729 1 1  68 GLU HB3  H -11.678  -0.511  -5.467 1.00 . A A .  68 GLU HB3  1 1 
        5  8730 1 1  68 GLU HG2  H -10.613   1.122  -3.809 1.00 . A A .  68 GLU HG2  1 1 
        5  8731 1 1  68 GLU HG3  H -10.966   2.464  -4.899 1.00 . A A .  68 GLU HG3  1 1 
        5  8732 1 1  68 GLU N    N -10.266  -0.472  -7.775 1.00 . A A .  68 GLU N    1 1 
        5  8733 1 1  68 GLU O    O  -9.095  -1.143  -4.790 1.00 . A A .  68 GLU O    1 1 
        5  8734 1 1  68 GLU OE1  O -13.018   0.809  -3.079 1.00 . A A .  68 GLU OE1  1 1 
        5  8735 1 1  68 GLU OE2  O -13.474   2.439  -4.456 1.00 . A A .  68 GLU OE2  1 1 
        5  8736 1 1  69 ILE C    C  -5.352   0.741  -5.342 1.00 . A A .  69 ILE C    1 1 
        5  8737 1 1  69 ILE CA   C  -6.391  -0.428  -5.357 1.00 . A A .  69 ILE CA   1 1 
        5  8738 1 1  69 ILE CB   C  -5.879  -1.758  -6.003 1.00 . A A .  69 ILE CB   1 1 
        5  8739 1 1  69 ILE CD1  C  -5.069  -2.924  -3.861 1.00 . A A .  69 ILE CD1  1 1 
        5  8740 1 1  69 ILE CG1  C  -4.695  -2.401  -5.243 1.00 . A A .  69 ILE CG1  1 1 
        5  8741 1 1  69 ILE CG2  C  -5.464  -1.628  -7.481 1.00 . A A .  69 ILE CG2  1 1 
        5  8742 1 1  69 ILE H    H  -7.564   0.527  -6.923 1.00 . A A .  69 ILE H    1 1 
        5  8743 1 1  69 ILE HA   H  -6.663  -0.645  -4.308 1.00 . A A .  69 ILE HA   1 1 
        5  8744 1 1  69 ILE HB   H  -6.726  -2.479  -5.974 1.00 . A A .  69 ILE HB   1 1 
        5  8745 1 1  69 ILE HD11 H  -5.756  -3.788  -3.922 1.00 . A A .  69 ILE HD11 1 1 
        5  8746 1 1  69 ILE HD12 H  -4.180  -3.253  -3.293 1.00 . A A .  69 ILE HD12 1 1 
        5  8747 1 1  69 ILE HD13 H  -5.580  -2.151  -3.261 1.00 . A A .  69 ILE HD13 1 1 
        5  8748 1 1  69 ILE HG12 H  -4.295  -3.236  -5.847 1.00 . A A .  69 ILE HG12 1 1 
        5  8749 1 1  69 ILE HG13 H  -3.865  -1.673  -5.179 1.00 . A A .  69 ILE HG13 1 1 
        5  8750 1 1  69 ILE HG21 H  -5.266  -2.615  -7.939 1.00 . A A .  69 ILE HG21 1 1 
        5  8751 1 1  69 ILE HG22 H  -6.274  -1.164  -8.060 1.00 . A A .  69 ILE HG22 1 1 
        5  8752 1 1  69 ILE HG23 H  -4.562  -1.003  -7.617 1.00 . A A .  69 ILE HG23 1 1 
        5  8753 1 1  69 ILE N    N  -7.627   0.044  -6.022 1.00 . A A .  69 ILE N    1 1 
        5  8754 1 1  69 ILE O    O  -5.234   1.513  -6.296 1.00 . A A .  69 ILE O    1 1 
        5  8755 1 1  70 LYS C    C  -4.304   3.400  -3.963 1.00 . A A .  70 LYS C    1 1 
        5  8756 1 1  70 LYS CA   C  -3.649   1.971  -3.988 1.00 . A A .  70 LYS CA   1 1 
        5  8757 1 1  70 LYS CB   C  -2.387   1.933  -4.903 1.00 . A A .  70 LYS CB   1 1 
        5  8758 1 1  70 LYS CD   C  -0.170   0.778  -5.531 1.00 . A A .  70 LYS CD   1 1 
        5  8759 1 1  70 LYS CE   C  -0.227   0.401  -7.020 1.00 . A A .  70 LYS CE   1 1 
        5  8760 1 1  70 LYS CG   C  -1.489   0.703  -4.743 1.00 . A A .  70 LYS CG   1 1 
        5  8761 1 1  70 LYS H    H  -4.738   0.066  -3.596 1.00 . A A .  70 LYS H    1 1 
        5  8762 1 1  70 LYS HA   H  -3.280   1.833  -2.953 1.00 . A A .  70 LYS HA   1 1 
        5  8763 1 1  70 LYS HB2  H  -2.710   2.052  -5.951 1.00 . A A .  70 LYS HB2  1 1 
        5  8764 1 1  70 LYS HB3  H  -1.786   2.842  -4.693 1.00 . A A .  70 LYS HB3  1 1 
        5  8765 1 1  70 LYS HD2  H   0.338   1.750  -5.370 1.00 . A A .  70 LYS HD2  1 1 
        5  8766 1 1  70 LYS HD3  H   0.524   0.057  -5.055 1.00 . A A .  70 LYS HD3  1 1 
        5  8767 1 1  70 LYS HE2  H   0.767  -0.016  -7.299 1.00 . A A .  70 LYS HE2  1 1 
        5  8768 1 1  70 LYS HE3  H  -0.940  -0.437  -7.183 1.00 . A A .  70 LYS HE3  1 1 
        5  8769 1 1  70 LYS HG2  H  -1.230   0.588  -3.672 1.00 . A A .  70 LYS HG2  1 1 
        5  8770 1 1  70 LYS HG3  H  -2.039  -0.223  -4.995 1.00 . A A .  70 LYS HG3  1 1 
        5  8771 1 1  70 LYS HZ1  H  -0.504   1.334  -8.899 1.00 . A A .  70 LYS HZ1  1 1 
        5  8772 1 1  70 LYS HZ2  H  -1.505   1.938  -7.767 1.00 . A A .  70 LYS HZ2  1 1 
        5  8773 1 1  70 LYS HZ3  H   0.107   2.357  -7.771 1.00 . A A .  70 LYS HZ3  1 1 
        5  8774 1 1  70 LYS N    N  -4.607   0.855  -4.234 1.00 . A A .  70 LYS N    1 1 
        5  8775 1 1  70 LYS NZ   N  -0.543   1.559  -7.898 1.00 . A A .  70 LYS NZ   1 1 
        5  8776 1 1  70 LYS O    O  -3.964   4.273  -4.770 1.00 . A A .  70 LYS O    1 1 
        5  8777 1 1  71 ASN C    C  -4.831   5.520  -1.434 1.00 . A A .  71 ASN C    1 1 
        5  8778 1 1  71 ASN CA   C  -5.644   5.025  -2.661 1.00 . A A .  71 ASN CA   1 1 
        5  8779 1 1  71 ASN CB   C  -7.166   5.006  -2.416 1.00 . A A .  71 ASN CB   1 1 
        5  8780 1 1  71 ASN CG   C  -7.795   6.388  -2.461 1.00 . A A .  71 ASN CG   1 1 
        5  8781 1 1  71 ASN H    H  -5.409   2.861  -2.365 1.00 . A A .  71 ASN H    1 1 
        5  8782 1 1  71 ASN HA   H  -5.448   5.701  -3.524 1.00 . A A .  71 ASN HA   1 1 
        5  8783 1 1  71 ASN HB2  H  -7.672   4.398  -3.183 1.00 . A A .  71 ASN HB2  1 1 
        5  8784 1 1  71 ASN HB3  H  -7.408   4.488  -1.472 1.00 . A A .  71 ASN HB3  1 1 
        5  8785 1 1  71 ASN HD21 H  -7.991   6.450  -0.460 1.00 . A A .  71 ASN HD21 1 1 
        5  8786 1 1  71 ASN HD22 H  -8.620   7.869  -1.476 1.00 . A A .  71 ASN HD22 1 1 
        5  8787 1 1  71 ASN N    N  -5.190   3.648  -2.988 1.00 . A A .  71 ASN N    1 1 
        5  8788 1 1  71 ASN ND2  N  -8.099   6.999  -1.344 1.00 . A A .  71 ASN ND2  1 1 
        5  8789 1 1  71 ASN O    O  -5.181   5.275  -0.279 1.00 . A A .  71 ASN O    1 1 
        5  8790 1 1  71 ASN OD1  O  -8.003   6.944  -3.534 1.00 . A A .  71 ASN OD1  1 1 
        5  8791 1 1  72 PHE C    C  -2.941   8.227  -0.580 1.00 . A A .  72 PHE C    1 1 
        5  8792 1 1  72 PHE CA   C  -2.809   6.691  -0.642 1.00 . A A .  72 PHE CA   1 1 
        5  8793 1 1  72 PHE CB   C  -1.410   6.136  -0.978 1.00 . A A .  72 PHE CB   1 1 
        5  8794 1 1  72 PHE CD1  C  -0.287   5.518   1.230 1.00 . A A .  72 PHE CD1  1 1 
        5  8795 1 1  72 PHE CD2  C   0.593   7.369  -0.034 1.00 . A A .  72 PHE CD2  1 1 
        5  8796 1 1  72 PHE CE1  C   0.692   5.714   2.202 1.00 . A A .  72 PHE CE1  1 1 
        5  8797 1 1  72 PHE CE2  C   1.602   7.540   0.915 1.00 . A A .  72 PHE CE2  1 1 
        5  8798 1 1  72 PHE CG   C  -0.356   6.354   0.107 1.00 . A A .  72 PHE CG   1 1 
        5  8799 1 1  72 PHE CZ   C   1.646   6.718   2.037 1.00 . A A .  72 PHE CZ   1 1 
        5  8800 1 1  72 PHE H    H  -3.527   6.328  -2.706 1.00 . A A .  72 PHE H    1 1 
        5  8801 1 1  72 PHE HA   H  -3.097   6.272   0.344 1.00 . A A .  72 PHE HA   1 1 
        5  8802 1 1  72 PHE HB2  H  -1.484   5.046  -1.166 1.00 . A A .  72 PHE HB2  1 1 
        5  8803 1 1  72 PHE HB3  H  -1.062   6.555  -1.939 1.00 . A A .  72 PHE HB3  1 1 
        5  8804 1 1  72 PHE HD1  H  -0.983   4.700   1.338 1.00 . A A .  72 PHE HD1  1 1 
        5  8805 1 1  72 PHE HD2  H   0.565   8.012  -0.903 1.00 . A A .  72 PHE HD2  1 1 
        5  8806 1 1  72 PHE HE1  H   0.720   5.070   3.072 1.00 . A A .  72 PHE HE1  1 1 
        5  8807 1 1  72 PHE HE2  H   2.371   8.277   0.730 1.00 . A A .  72 PHE HE2  1 1 
        5  8808 1 1  72 PHE HZ   H   2.431   6.843   2.773 1.00 . A A .  72 PHE HZ   1 1 
        5  8809 1 1  72 PHE N    N  -3.712   6.190  -1.707 1.00 . A A .  72 PHE N    1 1 
        5  8810 1 1  72 PHE O    O  -2.305   8.944  -1.358 1.00 . A A .  72 PHE O    1 1 
        5  8811 1 1  73 THR C    C  -2.946  10.794   1.383 1.00 . A A .  73 THR C    1 1 
        5  8812 1 1  73 THR CA   C  -4.043  10.187   0.473 1.00 . A A .  73 THR CA   1 1 
        5  8813 1 1  73 THR CB   C  -5.482  10.466   0.978 1.00 . A A .  73 THR CB   1 1 
        5  8814 1 1  73 THR CG2  C  -5.840  11.955   0.983 1.00 . A A .  73 THR CG2  1 1 
        5  8815 1 1  73 THR H    H  -4.040   8.067   1.091 1.00 . A A .  73 THR H    1 1 
        5  8816 1 1  73 THR HA   H  -4.003  10.645  -0.534 1.00 . A A .  73 THR HA   1 1 
        5  8817 1 1  73 THR HB   H  -5.614  10.045   1.996 1.00 . A A .  73 THR HB   1 1 
        5  8818 1 1  73 THR HG1  H  -6.004   9.014  -0.160 1.00 . A A .  73 THR HG1  1 1 
        5  8819 1 1  73 THR HG21 H  -6.873  12.108   1.344 1.00 . A A .  73 THR HG21 1 1 
        5  8820 1 1  73 THR HG22 H  -5.175  12.560   1.627 1.00 . A A .  73 THR HG22 1 1 
        5  8821 1 1  73 THR HG23 H  -5.787  12.397  -0.029 1.00 . A A .  73 THR HG23 1 1 
        5  8822 1 1  73 THR N    N  -3.804   8.724   0.330 1.00 . A A .  73 THR N    1 1 
        5  8823 1 1  73 THR O    O  -2.970  10.647   2.609 1.00 . A A .  73 THR O    1 1 
        5  8824 1 1  73 THR OG1  O  -6.417   9.844   0.100 1.00 . A A .  73 THR OG1  1 1 
        5  8825 1 1  74 VAL C    C  -0.504  13.421   1.063 1.00 . A A .  74 VAL C    1 1 
        5  8826 1 1  74 VAL CA   C  -0.739  11.930   1.411 1.00 . A A .  74 VAL CA   1 1 
        5  8827 1 1  74 VAL CB   C   0.477  11.003   1.116 1.00 . A A .  74 VAL CB   1 1 
        5  8828 1 1  74 VAL CG1  C   0.808  10.813  -0.363 1.00 . A A .  74 VAL CG1  1 1 
        5  8829 1 1  74 VAL CG2  C   1.770  11.486   1.810 1.00 . A A .  74 VAL CG2  1 1 
        5  8830 1 1  74 VAL H    H  -2.083  11.439  -0.285 1.00 . A A .  74 VAL H    1 1 
        5  8831 1 1  74 VAL HA   H  -0.898  11.848   2.505 1.00 . A A .  74 VAL HA   1 1 
        5  8832 1 1  74 VAL HB   H   0.216  10.005   1.527 1.00 . A A .  74 VAL HB   1 1 
        5  8833 1 1  74 VAL HG11 H   1.703  10.182  -0.499 1.00 . A A .  74 VAL HG11 1 1 
        5  8834 1 1  74 VAL HG12 H  -0.017  10.336  -0.923 1.00 . A A .  74 VAL HG12 1 1 
        5  8835 1 1  74 VAL HG13 H   1.010  11.777  -0.850 1.00 . A A .  74 VAL HG13 1 1 
        5  8836 1 1  74 VAL HG21 H   1.614  11.770   2.865 1.00 . A A .  74 VAL HG21 1 1 
        5  8837 1 1  74 VAL HG22 H   2.562  10.713   1.796 1.00 . A A .  74 VAL HG22 1 1 
        5  8838 1 1  74 VAL HG23 H   2.176  12.381   1.301 1.00 . A A .  74 VAL HG23 1 1 
        5  8839 1 1  74 VAL N    N  -1.970  11.439   0.742 1.00 . A A .  74 VAL N    1 1 
        5  8840 1 1  74 VAL O    O  -0.505  13.823  -0.103 1.00 . A A .  74 VAL O    1 1 
        5  8841 1 1  75 PHE C    C   1.390  16.074   1.818 1.00 . A A .  75 PHE C    1 1 
        5  8842 1 1  75 PHE CA   C  -0.103  15.685   1.981 1.00 . A A .  75 PHE CA   1 1 
        5  8843 1 1  75 PHE CB   C  -0.771  16.359   3.211 1.00 . A A .  75 PHE CB   1 1 
        5  8844 1 1  75 PHE CD1  C  -3.031  15.218   3.649 1.00 . A A .  75 PHE CD1  1 1 
        5  8845 1 1  75 PHE CD2  C  -3.025  17.338   2.492 1.00 . A A .  75 PHE CD2  1 1 
        5  8846 1 1  75 PHE CE1  C  -4.415  15.136   3.495 1.00 . A A .  75 PHE CE1  1 1 
        5  8847 1 1  75 PHE CE2  C  -4.410  17.255   2.336 1.00 . A A .  75 PHE CE2  1 1 
        5  8848 1 1  75 PHE CG   C  -2.315  16.317   3.142 1.00 . A A .  75 PHE CG   1 1 
        5  8849 1 1  75 PHE CZ   C  -5.102  16.154   2.837 1.00 . A A .  75 PHE CZ   1 1 
        5  8850 1 1  75 PHE H    H  -0.217  13.742   3.013 1.00 . A A .  75 PHE H    1 1 
        5  8851 1 1  75 PHE HA   H  -0.657  16.037   1.089 1.00 . A A .  75 PHE HA   1 1 
        5  8852 1 1  75 PHE HB2  H  -0.422  15.904   4.157 1.00 . A A .  75 PHE HB2  1 1 
        5  8853 1 1  75 PHE HB3  H  -0.452  17.418   3.280 1.00 . A A .  75 PHE HB3  1 1 
        5  8854 1 1  75 PHE HD1  H  -2.503  14.399   4.119 1.00 . A A .  75 PHE HD1  1 1 
        5  8855 1 1  75 PHE HD2  H  -2.497  18.185   2.073 1.00 . A A .  75 PHE HD2  1 1 
        5  8856 1 1  75 PHE HE1  H  -4.950  14.271   3.869 1.00 . A A .  75 PHE HE1  1 1 
        5  8857 1 1  75 PHE HE2  H  -4.942  18.040   1.813 1.00 . A A .  75 PHE HE2  1 1 
        5  8858 1 1  75 PHE HZ   H  -6.175  16.085   2.708 1.00 . A A .  75 PHE HZ   1 1 
        5  8859 1 1  75 PHE N    N  -0.260  14.221   2.100 1.00 . A A .  75 PHE N    1 1 
        5  8860 1 1  75 PHE O    O   2.272  15.568   2.520 1.00 . A A .  75 PHE O    1 1 
        5  8861 1 1  76 PHE C    C   2.937  19.037   0.361 1.00 . A A .  76 PHE C    1 1 
        5  8862 1 1  76 PHE CA   C   3.008  17.477   0.564 1.00 . A A .  76 PHE CA   1 1 
        5  8863 1 1  76 PHE CB   C   3.557  16.868  -0.755 1.00 . A A .  76 PHE CB   1 1 
        5  8864 1 1  76 PHE CD1  C   4.554  14.562  -0.187 1.00 . A A .  76 PHE CD1  1 1 
        5  8865 1 1  76 PHE CD2  C   2.742  14.698  -1.773 1.00 . A A .  76 PHE CD2  1 1 
        5  8866 1 1  76 PHE CE1  C   4.614  13.176  -0.376 1.00 . A A .  76 PHE CE1  1 1 
        5  8867 1 1  76 PHE CE2  C   2.844  13.328  -2.006 1.00 . A A .  76 PHE CE2  1 1 
        5  8868 1 1  76 PHE CG   C   3.610  15.340  -0.881 1.00 . A A .  76 PHE CG   1 1 
        5  8869 1 1  76 PHE CZ   C   3.768  12.566  -1.297 1.00 . A A .  76 PHE CZ   1 1 
        5  8870 1 1  76 PHE H    H   0.844  17.308   0.337 1.00 . A A .  76 PHE H    1 1 
        5  8871 1 1  76 PHE HA   H   3.704  17.262   1.399 1.00 . A A .  76 PHE HA   1 1 
        5  8872 1 1  76 PHE HB2  H   2.971  17.288  -1.598 1.00 . A A .  76 PHE HB2  1 1 
        5  8873 1 1  76 PHE HB3  H   4.579  17.263  -0.910 1.00 . A A .  76 PHE HB3  1 1 
        5  8874 1 1  76 PHE HD1  H   5.278  15.044   0.453 1.00 . A A .  76 PHE HD1  1 1 
        5  8875 1 1  76 PHE HD2  H   2.002  15.270  -2.317 1.00 . A A .  76 PHE HD2  1 1 
        5  8876 1 1  76 PHE HE1  H   5.337  12.563   0.156 1.00 . A A .  76 PHE HE1  1 1 
        5  8877 1 1  76 PHE HE2  H   2.203  12.863  -2.738 1.00 . A A .  76 PHE HE2  1 1 
        5  8878 1 1  76 PHE HZ   H   3.838  11.499  -1.465 1.00 . A A .  76 PHE HZ   1 1 
        5  8879 1 1  76 PHE N    N   1.650  16.978   0.872 1.00 . A A .  76 PHE N    1 1 
        5  8880 1 1  76 PHE O    O   1.966  19.544  -0.215 1.00 . A A .  76 PHE O    1 1 
        5  8881 1 1  77 GLU C    C   4.621  21.450  -1.034 1.00 . A A .  77 GLU C    1 1 
        5  8882 1 1  77 GLU CA   C   4.105  21.229   0.421 1.00 . A A .  77 GLU CA   1 1 
        5  8883 1 1  77 GLU CB   C   4.887  21.910   1.563 1.00 . A A .  77 GLU CB   1 1 
        5  8884 1 1  77 GLU CD   C   6.189  23.941   0.587 1.00 . A A .  77 GLU CD   1 1 
        5  8885 1 1  77 GLU CG   C   5.069  23.436   1.483 1.00 . A A .  77 GLU CG   1 1 
        5  8886 1 1  77 GLU H    H   4.763  19.236   1.182 1.00 . A A .  77 GLU H    1 1 
        5  8887 1 1  77 GLU HA   H   3.089  21.674   0.450 1.00 . A A .  77 GLU HA   1 1 
        5  8888 1 1  77 GLU HB2  H   4.336  21.704   2.504 1.00 . A A .  77 GLU HB2  1 1 
        5  8889 1 1  77 GLU HB3  H   5.868  21.429   1.715 1.00 . A A .  77 GLU HB3  1 1 
        5  8890 1 1  77 GLU HG2  H   4.134  23.942   1.186 1.00 . A A .  77 GLU HG2  1 1 
        5  8891 1 1  77 GLU HG3  H   5.298  23.820   2.492 1.00 . A A .  77 GLU HG3  1 1 
        5  8892 1 1  77 GLU N    N   3.985  19.769   0.765 1.00 . A A .  77 GLU N    1 1 
        5  8893 1 1  77 GLU O    O   3.872  21.946  -1.879 1.00 . A A .  77 GLU O    1 1 
        5  8894 1 1  77 GLU OE1  O   7.374  23.687   0.889 1.00 . A A .  77 GLU OE1  1 1 
        5  8895 1 1  77 GLU OE2  O   5.891  24.607  -0.425 1.00 . A A .  77 GLU OE2  1 1 
        5  8896 1 1  78 ASN C    C   7.316  19.856  -3.020 1.00 . A A .  78 ASN C    1 1 
        5  8897 1 1  78 ASN CA   C   6.470  21.129  -2.675 1.00 . A A .  78 ASN CA   1 1 
        5  8898 1 1  78 ASN CB   C   7.284  22.436  -2.853 1.00 . A A .  78 ASN CB   1 1 
        5  8899 1 1  78 ASN CG   C   6.571  23.482  -3.700 1.00 . A A .  78 ASN CG   1 1 
        5  8900 1 1  78 ASN H    H   6.400  20.814  -0.466 1.00 . A A .  78 ASN H    1 1 
        5  8901 1 1  78 ASN HA   H   5.645  21.101  -3.417 1.00 . A A .  78 ASN HA   1 1 
        5  8902 1 1  78 ASN HB2  H   7.592  22.858  -1.874 1.00 . A A .  78 ASN HB2  1 1 
        5  8903 1 1  78 ASN HB3  H   8.244  22.244  -3.367 1.00 . A A .  78 ASN HB3  1 1 
        5  8904 1 1  78 ASN HD21 H   6.211  24.647  -2.111 1.00 . A A .  78 ASN HD21 1 1 
        5  8905 1 1  78 ASN HD22 H   5.835  25.310  -3.805 1.00 . A A .  78 ASN HD22 1 1 
        5  8906 1 1  78 ASN N    N   5.868  21.049  -1.316 1.00 . A A .  78 ASN N    1 1 
        5  8907 1 1  78 ASN ND2  N   6.253  24.628  -3.156 1.00 . A A .  78 ASN ND2  1 1 
        5  8908 1 1  78 ASN O    O   7.085  19.233  -4.063 1.00 . A A .  78 ASN O    1 1 
        5  8909 1 1  78 ASN OD1  O   6.306  23.266  -4.880 1.00 . A A .  78 ASN OD1  1 1 
        5  8910 1 1  79 GLU C    C   8.574  17.239  -0.942 1.00 . A A .  79 GLU C    1 1 
        5  8911 1 1  79 GLU CA   C   8.924  18.149  -2.172 1.00 . A A .  79 GLU CA   1 1 
        5  8912 1 1  79 GLU CB   C  10.438  18.313  -2.452 1.00 . A A .  79 GLU CB   1 1 
        5  8913 1 1  79 GLU CD   C  11.805  17.302  -0.476 1.00 . A A .  79 GLU CD   1 1 
        5  8914 1 1  79 GLU CG   C  11.408  18.530  -1.282 1.00 . A A .  79 GLU CG   1 1 
        5  8915 1 1  79 GLU H    H   8.402  20.146  -1.379 1.00 . A A .  79 GLU H    1 1 
        5  8916 1 1  79 GLU HA   H   8.557  17.584  -3.050 1.00 . A A .  79 GLU HA   1 1 
        5  8917 1 1  79 GLU HB2  H  10.776  17.443  -3.045 1.00 . A A .  79 GLU HB2  1 1 
        5  8918 1 1  79 GLU HB3  H  10.579  19.144  -3.167 1.00 . A A .  79 GLU HB3  1 1 
        5  8919 1 1  79 GLU HG2  H  12.349  18.950  -1.674 1.00 . A A .  79 GLU HG2  1 1 
        5  8920 1 1  79 GLU HG3  H  11.021  19.290  -0.580 1.00 . A A .  79 GLU HG3  1 1 
        5  8921 1 1  79 GLU N    N   8.283  19.495  -2.166 1.00 . A A .  79 GLU N    1 1 
        5  8922 1 1  79 GLU O    O   8.620  16.015  -1.056 1.00 . A A .  79 GLU O    1 1 
        5  8923 1 1  79 GLU OE1  O  11.692  16.163  -0.978 1.00 . A A .  79 GLU OE1  1 1 
        5  8924 1 1  79 GLU OE2  O  12.253  17.473   0.675 1.00 . A A .  79 GLU OE2  1 1 
        5  8925 1 1  80 GLN C    C   7.108  16.720   2.169 1.00 . A A .  80 GLN C    1 1 
        5  8926 1 1  80 GLN CA   C   8.450  17.173   1.546 1.00 . A A .  80 GLN CA   1 1 
        5  8927 1 1  80 GLN CB   C   9.235  18.167   2.445 1.00 . A A .  80 GLN CB   1 1 
        5  8928 1 1  80 GLN CD   C   8.498  20.629   1.898 1.00 . A A .  80 GLN CD   1 1 
        5  8929 1 1  80 GLN CG   C   8.578  19.485   2.903 1.00 . A A .  80 GLN CG   1 1 
        5  8930 1 1  80 GLN H    H   8.104  18.833   0.188 1.00 . A A .  80 GLN H    1 1 
        5  8931 1 1  80 GLN HA   H   9.112  16.283   1.429 1.00 . A A .  80 GLN HA   1 1 
        5  8932 1 1  80 GLN HB2  H   9.516  17.624   3.367 1.00 . A A .  80 GLN HB2  1 1 
        5  8933 1 1  80 GLN HB3  H  10.212  18.382   1.967 1.00 . A A .  80 GLN HB3  1 1 
        5  8934 1 1  80 GLN HE21 H   9.087  21.926   3.280 1.00 . A A .  80 GLN HE21 1 1 
        5  8935 1 1  80 GLN HE22 H   8.418  22.568   1.690 1.00 . A A .  80 GLN HE22 1 1 
        5  8936 1 1  80 GLN HG2  H   7.558  19.293   3.283 1.00 . A A .  80 GLN HG2  1 1 
        5  8937 1 1  80 GLN HG3  H   9.141  19.811   3.801 1.00 . A A .  80 GLN HG3  1 1 
        5  8938 1 1  80 GLN N    N   8.277  17.815   0.225 1.00 . A A .  80 GLN N    1 1 
        5  8939 1 1  80 GLN NE2  N   8.848  21.828   2.292 1.00 . A A .  80 GLN NE2  1 1 
        5  8940 1 1  80 GLN O    O   6.061  17.340   1.947 1.00 . A A .  80 GLN O    1 1 
        5  8941 1 1  80 GLN OE1  O   8.035  20.499   0.766 1.00 . A A .  80 GLN OE1  1 1 
        5  8942 1 1  81 VAL C    C   5.321  15.517   4.712 1.00 . A A .  81 VAL C    1 1 
        5  8943 1 1  81 VAL CA   C   5.876  14.939   3.370 1.00 . A A .  81 VAL CA   1 1 
        5  8944 1 1  81 VAL CB   C   6.015  13.378   3.477 1.00 . A A .  81 VAL CB   1 1 
        5  8945 1 1  81 VAL CG1  C   4.632  12.713   3.312 1.00 . A A .  81 VAL CG1  1 1 
        5  8946 1 1  81 VAL CG2  C   6.996  12.708   2.505 1.00 . A A .  81 VAL CG2  1 1 
        5  8947 1 1  81 VAL H    H   8.055  15.256   3.186 1.00 . A A .  81 VAL H    1 1 
        5  8948 1 1  81 VAL HA   H   5.115  15.149   2.584 1.00 . A A .  81 VAL HA   1 1 
        5  8949 1 1  81 VAL HB   H   6.362  13.111   4.491 1.00 . A A .  81 VAL HB   1 1 
        5  8950 1 1  81 VAL HG11 H   3.940  13.002   4.126 1.00 . A A .  81 VAL HG11 1 1 
        5  8951 1 1  81 VAL HG12 H   4.151  12.999   2.364 1.00 . A A .  81 VAL HG12 1 1 
        5  8952 1 1  81 VAL HG13 H   4.698  11.610   3.327 1.00 . A A .  81 VAL HG13 1 1 
        5  8953 1 1  81 VAL HG21 H   6.893  11.607   2.490 1.00 . A A .  81 VAL HG21 1 1 
        5  8954 1 1  81 VAL HG22 H   6.908  13.073   1.470 1.00 . A A .  81 VAL HG22 1 1 
        5  8955 1 1  81 VAL HG23 H   8.038  12.903   2.801 1.00 . A A .  81 VAL HG23 1 1 
        5  8956 1 1  81 VAL N    N   7.129  15.629   2.950 1.00 . A A .  81 VAL N    1 1 
        5  8957 1 1  81 VAL O    O   6.043  15.664   5.702 1.00 . A A .  81 VAL O    1 1 
        5  8958 1 1  82 VAL C    C   2.607  15.287   6.686 1.00 . A A .  82 VAL C    1 1 
        5  8959 1 1  82 VAL CA   C   3.301  16.419   5.863 1.00 . A A .  82 VAL CA   1 1 
        5  8960 1 1  82 VAL CB   C   2.388  17.565   5.319 1.00 . A A .  82 VAL CB   1 1 
        5  8961 1 1  82 VAL CG1  C   1.476  18.200   6.384 1.00 . A A .  82 VAL CG1  1 1 
        5  8962 1 1  82 VAL CG2  C   3.218  18.714   4.677 1.00 . A A .  82 VAL CG2  1 1 
        5  8963 1 1  82 VAL H    H   3.539  15.655   3.807 1.00 . A A .  82 VAL H    1 1 
        5  8964 1 1  82 VAL HA   H   4.041  16.899   6.533 1.00 . A A .  82 VAL HA   1 1 
        5  8965 1 1  82 VAL HB   H   1.733  17.153   4.527 1.00 . A A .  82 VAL HB   1 1 
        5  8966 1 1  82 VAL HG11 H   0.766  17.474   6.819 1.00 . A A .  82 VAL HG11 1 1 
        5  8967 1 1  82 VAL HG12 H   2.048  18.633   7.226 1.00 . A A .  82 VAL HG12 1 1 
        5  8968 1 1  82 VAL HG13 H   0.865  19.014   5.953 1.00 . A A .  82 VAL HG13 1 1 
        5  8969 1 1  82 VAL HG21 H   2.638  19.263   3.911 1.00 . A A .  82 VAL HG21 1 1 
        5  8970 1 1  82 VAL HG22 H   3.588  19.445   5.420 1.00 . A A .  82 VAL HG22 1 1 
        5  8971 1 1  82 VAL HG23 H   4.116  18.343   4.152 1.00 . A A .  82 VAL HG23 1 1 
        5  8972 1 1  82 VAL N    N   4.016  15.797   4.713 1.00 . A A .  82 VAL N    1 1 
        5  8973 1 1  82 VAL O    O   3.056  15.013   7.800 1.00 . A A .  82 VAL O    1 1 
        5  8974 1 1  83 ARG C    C   0.286  12.469   5.676 1.00 . A A .  83 ARG C    1 1 
        5  8975 1 1  83 ARG CA   C   1.040  13.340   6.734 1.00 . A A .  83 ARG CA   1 1 
        5  8976 1 1  83 ARG CB   C   0.243  13.553   8.045 1.00 . A A .  83 ARG CB   1 1 
        5  8977 1 1  83 ARG CD   C  -2.316  13.612   7.381 1.00 . A A .  83 ARG CD   1 1 
        5  8978 1 1  83 ARG CG   C  -1.104  14.290   8.036 1.00 . A A .  83 ARG CG   1 1 
        5  8979 1 1  83 ARG CZ   C  -3.239  11.777   8.831 1.00 . A A .  83 ARG CZ   1 1 
        5  8980 1 1  83 ARG H    H   1.370  14.876   5.178 1.00 . A A .  83 ARG H    1 1 
        5  8981 1 1  83 ARG HA   H   1.929  12.742   7.029 1.00 . A A .  83 ARG HA   1 1 
        5  8982 1 1  83 ARG HB2  H   0.120  12.569   8.537 1.00 . A A .  83 ARG HB2  1 1 
        5  8983 1 1  83 ARG HB3  H   0.902  14.097   8.752 1.00 . A A .  83 ARG HB3  1 1 
        5  8984 1 1  83 ARG HD2  H  -3.222  14.232   7.533 1.00 . A A .  83 ARG HD2  1 1 
        5  8985 1 1  83 ARG HD3  H  -2.189  13.632   6.281 1.00 . A A .  83 ARG HD3  1 1 
        5  8986 1 1  83 ARG HE   H  -2.086  11.426   7.284 1.00 . A A .  83 ARG HE   1 1 
        5  8987 1 1  83 ARG HG2  H  -1.350  14.509   9.095 1.00 . A A .  83 ARG HG2  1 1 
        5  8988 1 1  83 ARG HG3  H  -0.970  15.291   7.578 1.00 . A A .  83 ARG HG3  1 1 
        5  8989 1 1  83 ARG HH11 H  -3.777  13.563   9.429 1.00 . A A .  83 ARG HH11 1 1 
        5  8990 1 1  83 ARG HH12 H  -4.389  12.159  10.433 1.00 . A A .  83 ARG HH12 1 1 
        5  8991 1 1  83 ARG HH21 H  -2.761   9.904   8.377 1.00 . A A .  83 ARG HH21 1 1 
        5  8992 1 1  83 ARG HH22 H  -3.816  10.163   9.851 1.00 . A A .  83 ARG HH22 1 1 
        5  8993 1 1  83 ARG N    N   1.566  14.611   6.149 1.00 . A A .  83 ARG N    1 1 
        5  8994 1 1  83 ARG NE   N  -2.537  12.199   7.789 1.00 . A A .  83 ARG NE   1 1 
        5  8995 1 1  83 ARG NH1  N  -3.875  12.571   9.652 1.00 . A A .  83 ARG NH1  1 1 
        5  8996 1 1  83 ARG NH2  N  -3.288  10.495   9.043 1.00 . A A .  83 ARG NH2  1 1 
        5  8997 1 1  83 ARG O    O  -0.226  12.984   4.678 1.00 . A A .  83 ARG O    1 1 
        5  8998 1 1  84 TRP C    C  -1.720   9.450   5.820 1.00 . A A .  84 TRP C    1 1 
        5  8999 1 1  84 TRP CA   C  -0.580  10.204   5.074 1.00 . A A .  84 TRP CA   1 1 
        5  9000 1 1  84 TRP CB   C   0.365   9.212   4.350 1.00 . A A .  84 TRP CB   1 1 
        5  9001 1 1  84 TRP CD1  C   1.170   7.020   5.643 1.00 . A A .  84 TRP CD1  1 1 
        5  9002 1 1  84 TRP CD2  C   2.600   8.733   5.642 1.00 . A A .  84 TRP CD2  1 1 
        5  9003 1 1  84 TRP CE2  C   3.141   7.660   6.385 1.00 . A A .  84 TRP CE2  1 1 
        5  9004 1 1  84 TRP CE3  C   3.388   9.903   5.397 1.00 . A A .  84 TRP CE3  1 1 
        5  9005 1 1  84 TRP CG   C   1.332   8.361   5.206 1.00 . A A .  84 TRP CG   1 1 
        5  9006 1 1  84 TRP CH2  C   5.190   8.919   6.695 1.00 . A A .  84 TRP CH2  1 1 
        5  9007 1 1  84 TRP CZ2  C   4.456   7.756   6.921 1.00 . A A .  84 TRP CZ2  1 1 
        5  9008 1 1  84 TRP CZ3  C   4.667   9.976   5.930 1.00 . A A .  84 TRP CZ3  1 1 
        5  9009 1 1  84 TRP H    H   0.746  10.811   6.715 1.00 . A A .  84 TRP H    1 1 
        5  9010 1 1  84 TRP HA   H  -1.084  10.773   4.274 1.00 . A A .  84 TRP HA   1 1 
        5  9011 1 1  84 TRP HB2  H  -0.230   8.538   3.707 1.00 . A A .  84 TRP HB2  1 1 
        5  9012 1 1  84 TRP HB3  H   0.989   9.775   3.642 1.00 . A A .  84 TRP HB3  1 1 
        5  9013 1 1  84 TRP HD1  H   0.370   6.352   5.348 1.00 . A A .  84 TRP HD1  1 1 
        5  9014 1 1  84 TRP HE1  H   2.559   5.631   6.635 1.00 . A A .  84 TRP HE1  1 1 
        5  9015 1 1  84 TRP HE3  H   3.012  10.693   4.764 1.00 . A A .  84 TRP HE3  1 1 
        5  9016 1 1  84 TRP HH2  H   6.191   9.018   7.084 1.00 . A A .  84 TRP HH2  1 1 
        5  9017 1 1  84 TRP HZ2  H   4.880   6.927   7.476 1.00 . A A .  84 TRP HZ2  1 1 
        5  9018 1 1  84 TRP HZ3  H   5.288  10.841   5.730 1.00 . A A .  84 TRP HZ3  1 1 
        5  9019 1 1  84 TRP N    N   0.176  11.155   5.935 1.00 . A A .  84 TRP N    1 1 
        5  9020 1 1  84 TRP NE1  N   2.271   6.594   6.399 1.00 . A A .  84 TRP NE1  1 1 
        5  9021 1 1  84 TRP O    O  -1.696   9.259   7.041 1.00 . A A .  84 TRP O    1 1 
        5  9022 1 1  85 GLU C    C  -3.460   6.844   4.058 1.00 . A A .  85 GLU C    1 1 
        5  9023 1 1  85 GLU CA   C  -3.434   7.732   5.351 1.00 . A A .  85 GLU CA   1 1 
        5  9024 1 1  85 GLU CB   C  -4.844   7.990   5.926 1.00 . A A .  85 GLU CB   1 1 
        5  9025 1 1  85 GLU CD   C  -5.350   5.638   6.996 1.00 . A A .  85 GLU CD   1 1 
        5  9026 1 1  85 GLU CG   C  -5.203   7.139   7.166 1.00 . A A .  85 GLU CG   1 1 
        5  9027 1 1  85 GLU H    H  -2.666   9.356   4.074 1.00 . A A .  85 GLU H    1 1 
        5  9028 1 1  85 GLU HA   H  -2.845   7.181   6.116 1.00 . A A .  85 GLU HA   1 1 
        5  9029 1 1  85 GLU HB2  H  -4.935   9.047   6.247 1.00 . A A .  85 GLU HB2  1 1 
        5  9030 1 1  85 GLU HB3  H  -5.623   7.877   5.146 1.00 . A A .  85 GLU HB3  1 1 
        5  9031 1 1  85 GLU HG2  H  -4.458   7.304   7.963 1.00 . A A .  85 GLU HG2  1 1 
        5  9032 1 1  85 GLU HG3  H  -6.154   7.521   7.577 1.00 . A A .  85 GLU HG3  1 1 
        5  9033 1 1  85 GLU N    N  -2.708   8.995   5.043 1.00 . A A .  85 GLU N    1 1 
        5  9034 1 1  85 GLU O    O  -3.633   7.325   2.931 1.00 . A A .  85 GLU O    1 1 
        5  9035 1 1  85 GLU OE1  O  -4.338   4.939   6.781 1.00 . A A .  85 GLU OE1  1 1 
        5  9036 1 1  85 GLU OE2  O  -6.475   5.122   7.164 1.00 . A A .  85 GLU OE2  1 1 
        5  9037 1 1  86 GLY C    C  -4.270   3.547   3.108 1.00 . A A .  86 GLY C    1 1 
        5  9038 1 1  86 GLY CA   C  -3.144   4.567   3.167 1.00 . A A .  86 GLY CA   1 1 
        5  9039 1 1  86 GLY H    H  -3.485   5.282   5.236 1.00 . A A .  86 GLY H    1 1 
        5  9040 1 1  86 GLY HA2  H  -3.039   5.059   2.186 1.00 . A A .  86 GLY HA2  1 1 
        5  9041 1 1  86 GLY HA3  H  -2.201   4.010   3.303 1.00 . A A .  86 GLY HA3  1 1 
        5  9042 1 1  86 GLY N    N  -3.250   5.543   4.262 1.00 . A A .  86 GLY N    1 1 
        5  9043 1 1  86 GLY O    O  -4.141   2.465   3.688 1.00 . A A .  86 GLY O    1 1 
        5  9044 1 1  87 ASP C    C  -6.057   2.067   0.737 1.00 . A A .  87 ASP C    1 1 
        5  9045 1 1  87 ASP CA   C  -6.400   2.872   2.034 1.00 . A A .  87 ASP CA   1 1 
        5  9046 1 1  87 ASP CB   C  -7.771   3.552   2.168 1.00 . A A .  87 ASP CB   1 1 
        5  9047 1 1  87 ASP CG   C  -8.262   4.518   1.119 1.00 . A A .  87 ASP CG   1 1 
        5  9048 1 1  87 ASP H    H  -5.296   4.768   1.882 1.00 . A A .  87 ASP H    1 1 
        5  9049 1 1  87 ASP HA   H  -6.431   2.137   2.867 1.00 . A A .  87 ASP HA   1 1 
        5  9050 1 1  87 ASP HB2  H  -8.545   2.776   2.277 1.00 . A A .  87 ASP HB2  1 1 
        5  9051 1 1  87 ASP HB3  H  -7.809   4.075   3.143 1.00 . A A .  87 ASP HB3  1 1 
        5  9052 1 1  87 ASP N    N  -5.329   3.854   2.352 1.00 . A A .  87 ASP N    1 1 
        5  9053 1 1  87 ASP O    O  -6.484   2.364  -0.381 1.00 . A A .  87 ASP O    1 1 
        5  9054 1 1  87 ASP OD1  O  -7.841   5.692   1.108 1.00 . A A .  87 ASP OD1  1 1 
        5  9055 1 1  87 ASP OD2  O  -9.125   4.120   0.307 1.00 . A A .  87 ASP OD2  1 1 
        5  9056 1 1  88 TYR C    C  -4.642  -1.111  -0.257 1.00 . A A .  88 TYR C    1 1 
        5  9057 1 1  88 TYR CA   C  -4.406   0.423  -0.170 1.00 . A A .  88 TYR CA   1 1 
        5  9058 1 1  88 TYR CB   C  -2.946   0.944  -0.134 1.00 . A A .  88 TYR CB   1 1 
        5  9059 1 1  88 TYR CD1  C  -2.406   0.190   2.327 1.00 . A A .  88 TYR CD1  1 1 
        5  9060 1 1  88 TYR CD2  C  -0.944   1.724   1.179 1.00 . A A .  88 TYR CD2  1 1 
        5  9061 1 1  88 TYR CE1  C  -1.623   0.302   3.476 1.00 . A A .  88 TYR CE1  1 1 
        5  9062 1 1  88 TYR CE2  C  -0.158   1.829   2.331 1.00 . A A .  88 TYR CE2  1 1 
        5  9063 1 1  88 TYR CG   C  -2.089   0.919   1.157 1.00 . A A .  88 TYR CG   1 1 
        5  9064 1 1  88 TYR CZ   C  -0.507   1.128   3.481 1.00 . A A .  88 TYR CZ   1 1 
        5  9065 1 1  88 TYR H    H  -4.887   1.011   1.900 1.00 . A A .  88 TYR H    1 1 
        5  9066 1 1  88 TYR HA   H  -4.797   0.788  -1.143 1.00 . A A .  88 TYR HA   1 1 
        5  9067 1 1  88 TYR HB2  H  -2.369   0.450  -0.940 1.00 . A A .  88 TYR HB2  1 1 
        5  9068 1 1  88 TYR HB3  H  -3.009   2.005  -0.462 1.00 . A A .  88 TYR HB3  1 1 
        5  9069 1 1  88 TYR HD1  H  -3.294  -0.424   2.397 1.00 . A A .  88 TYR HD1  1 1 
        5  9070 1 1  88 TYR HD2  H  -0.664   2.309   0.311 1.00 . A A .  88 TYR HD2  1 1 
        5  9071 1 1  88 TYR HE1  H  -1.922  -0.232   4.368 1.00 . A A .  88 TYR HE1  1 1 
        5  9072 1 1  88 TYR HE2  H   0.704   2.481   2.333 1.00 . A A .  88 TYR HE2  1 1 
        5  9073 1 1  88 TYR HH   H   0.906   0.584   4.661 1.00 . A A .  88 TYR HH   1 1 
        5  9074 1 1  88 TYR N    N  -5.198   1.050   0.922 1.00 . A A .  88 TYR N    1 1 
        5  9075 1 1  88 TYR O    O  -5.683  -1.521  -0.777 1.00 . A A .  88 TYR O    1 1 
        5  9076 1 1  88 TYR OH   O   0.221   1.278   4.622 1.00 . A A .  88 TYR OH   1 1 
        5  9077 1 1  89 PHE C    C  -4.104  -3.631   2.013 1.00 . A A .  89 PHE C    1 1 
        5  9078 1 1  89 PHE CA   C  -3.988  -3.400   0.466 1.00 . A A .  89 PHE CA   1 1 
        5  9079 1 1  89 PHE CB   C  -2.854  -4.221  -0.198 1.00 . A A .  89 PHE CB   1 1 
        5  9080 1 1  89 PHE CD1  C  -2.842  -6.574   0.821 1.00 . A A .  89 PHE CD1  1 1 
        5  9081 1 1  89 PHE CD2  C  -3.735  -6.296  -1.405 1.00 . A A .  89 PHE CD2  1 1 
        5  9082 1 1  89 PHE CE1  C  -3.119  -7.939   0.765 1.00 . A A .  89 PHE CE1  1 1 
        5  9083 1 1  89 PHE CE2  C  -4.012  -7.664  -1.462 1.00 . A A .  89 PHE CE2  1 1 
        5  9084 1 1  89 PHE CG   C  -3.146  -5.732  -0.263 1.00 . A A .  89 PHE CG   1 1 
        5  9085 1 1  89 PHE CZ   C  -3.703  -8.483  -0.377 1.00 . A A .  89 PHE CZ   1 1 
        5  9086 1 1  89 PHE H    H  -2.898  -1.489   0.622 1.00 . A A .  89 PHE H    1 1 
        5  9087 1 1  89 PHE HA   H  -4.937  -3.709  -0.019 1.00 . A A .  89 PHE HA   1 1 
        5  9088 1 1  89 PHE HB2  H  -2.683  -3.848  -1.228 1.00 . A A .  89 PHE HB2  1 1 
        5  9089 1 1  89 PHE HB3  H  -1.889  -4.048   0.318 1.00 . A A .  89 PHE HB3  1 1 
        5  9090 1 1  89 PHE HD1  H  -2.414  -6.165   1.726 1.00 . A A .  89 PHE HD1  1 1 
        5  9091 1 1  89 PHE HD2  H  -3.986  -5.675  -2.256 1.00 . A A .  89 PHE HD2  1 1 
        5  9092 1 1  89 PHE HE1  H  -2.886  -8.573   1.613 1.00 . A A .  89 PHE HE1  1 1 
        5  9093 1 1  89 PHE HE2  H  -4.468  -8.086  -2.349 1.00 . A A .  89 PHE HE2  1 1 
        5  9094 1 1  89 PHE HZ   H  -3.920  -9.543  -0.420 1.00 . A A .  89 PHE HZ   1 1 
        5  9095 1 1  89 PHE N    N  -3.719  -1.958   0.223 1.00 . A A .  89 PHE N    1 1 
        5  9096 1 1  89 PHE O    O  -3.059  -3.742   2.667 1.00 . A A .  89 PHE O    1 1 
        5  9097 1 1  90 PRO C    C  -5.359  -5.166   4.816 1.00 . A A .  90 PRO C    1 1 
        5  9098 1 1  90 PRO CA   C  -5.416  -3.767   4.144 1.00 . A A .  90 PRO CA   1 1 
        5  9099 1 1  90 PRO CB   C  -6.771  -3.039   4.346 1.00 . A A .  90 PRO CB   1 1 
        5  9100 1 1  90 PRO CD   C  -6.606  -3.439   1.986 1.00 . A A .  90 PRO CD   1 1 
        5  9101 1 1  90 PRO CG   C  -7.622  -3.494   3.138 1.00 . A A .  90 PRO CG   1 1 
        5  9102 1 1  90 PRO HA   H  -4.609  -3.161   4.595 1.00 . A A .  90 PRO HA   1 1 
        5  9103 1 1  90 PRO HB2  H  -7.247  -3.252   5.317 1.00 . A A .  90 PRO HB2  1 1 
        5  9104 1 1  90 PRO HB3  H  -6.607  -1.945   4.305 1.00 . A A .  90 PRO HB3  1 1 
        5  9105 1 1  90 PRO HD2  H  -6.830  -4.168   1.186 1.00 . A A .  90 PRO HD2  1 1 
        5  9106 1 1  90 PRO HD3  H  -6.600  -2.425   1.539 1.00 . A A .  90 PRO HD3  1 1 
        5  9107 1 1  90 PRO HG2  H  -7.984  -4.529   3.294 1.00 . A A .  90 PRO HG2  1 1 
        5  9108 1 1  90 PRO HG3  H  -8.500  -2.849   2.967 1.00 . A A .  90 PRO HG3  1 1 
        5  9109 1 1  90 PRO N    N  -5.307  -3.718   2.643 1.00 . A A .  90 PRO N    1 1 
        5  9110 1 1  90 PRO O    O  -6.196  -5.512   5.655 1.00 . A A .  90 PRO O    1 1 
        5  9111 1 1  91 SER C    C  -2.547  -7.638   4.981 1.00 . A A .  91 SER C    1 1 
        5  9112 1 1  91 SER CA   C  -4.045  -7.247   5.146 1.00 . A A .  91 SER CA   1 1 
        5  9113 1 1  91 SER CB   C  -5.012  -8.331   4.600 1.00 . A A .  91 SER CB   1 1 
        5  9114 1 1  91 SER H    H  -3.671  -5.454   3.856 1.00 . A A .  91 SER H    1 1 
        5  9115 1 1  91 SER HA   H  -4.244  -7.155   6.236 1.00 . A A .  91 SER HA   1 1 
        5  9116 1 1  91 SER HB2  H  -6.059  -7.977   4.679 1.00 . A A .  91 SER HB2  1 1 
        5  9117 1 1  91 SER HB3  H  -4.826  -8.515   3.524 1.00 . A A .  91 SER HB3  1 1 
        5  9118 1 1  91 SER HG   H  -5.455 -10.193   4.932 1.00 . A A .  91 SER HG   1 1 
        5  9119 1 1  91 SER N    N  -4.319  -5.940   4.490 1.00 . A A .  91 SER N    1 1 
        5  9120 1 1  91 SER O    O  -2.200  -8.500   4.168 1.00 . A A .  91 SER O    1 1 
        5  9121 1 1  91 SER OG   O  -4.877  -9.541   5.340 1.00 . A A .  91 SER OG   1 1 
        5  9122 1 1  92 GLN C    C   0.474  -6.349   6.838 1.00 . A A .  92 GLN C    1 1 
        5  9123 1 1  92 GLN CA   C  -0.212  -7.291   5.796 1.00 . A A .  92 GLN CA   1 1 
        5  9124 1 1  92 GLN CB   C   0.543  -7.317   4.436 1.00 . A A .  92 GLN CB   1 1 
        5  9125 1 1  92 GLN CD   C   1.301  -6.143   2.302 1.00 . A A .  92 GLN CD   1 1 
        5  9126 1 1  92 GLN CG   C   0.366  -6.109   3.502 1.00 . A A .  92 GLN CG   1 1 
        5  9127 1 1  92 GLN H    H  -2.098  -6.342   6.434 1.00 . A A .  92 GLN H    1 1 
        5  9128 1 1  92 GLN HA   H  -0.122  -8.327   6.187 1.00 . A A .  92 GLN HA   1 1 
        5  9129 1 1  92 GLN HB2  H   1.614  -7.486   4.657 1.00 . A A .  92 GLN HB2  1 1 
        5  9130 1 1  92 GLN HB3  H   0.240  -8.234   3.893 1.00 . A A .  92 GLN HB3  1 1 
        5  9131 1 1  92 GLN HE21 H  -0.219  -6.359   1.018 1.00 . A A .  92 GLN HE21 1 1 
        5  9132 1 1  92 GLN HE22 H   1.493  -6.214   0.351 1.00 . A A .  92 GLN HE22 1 1 
        5  9133 1 1  92 GLN HG2  H  -0.691  -6.033   3.189 1.00 . A A .  92 GLN HG2  1 1 
        5  9134 1 1  92 GLN HG3  H   0.553  -5.170   4.044 1.00 . A A .  92 GLN HG3  1 1 
        5  9135 1 1  92 GLN N    N  -1.665  -6.975   5.749 1.00 . A A .  92 GLN N    1 1 
        5  9136 1 1  92 GLN NE2  N   0.791  -6.215   1.097 1.00 . A A .  92 GLN NE2  1 1 
        5  9137 1 1  92 GLN O    O   0.891  -5.233   6.514 1.00 . A A .  92 GLN O    1 1 
        5  9138 1 1  92 GLN OE1  O   2.518  -6.080   2.436 1.00 . A A .  92 GLN OE1  1 1 
        5  9139 1 1  93 ASP C    C   1.638  -6.900  10.325 1.00 . A A .  93 ASP C    1 1 
        5  9140 1 1  93 ASP CA   C   1.075  -5.971   9.214 1.00 . A A .  93 ASP CA   1 1 
        5  9141 1 1  93 ASP CB   C   0.104  -4.872   9.692 1.00 . A A .  93 ASP CB   1 1 
        5  9142 1 1  93 ASP CG   C  -1.354  -5.174   9.966 1.00 . A A .  93 ASP CG   1 1 
        5  9143 1 1  93 ASP H    H   0.210  -7.741   8.268 1.00 . A A .  93 ASP H    1 1 
        5  9144 1 1  93 ASP HA   H   1.945  -5.403   8.824 1.00 . A A .  93 ASP HA   1 1 
        5  9145 1 1  93 ASP HB2  H   0.525  -4.386  10.589 1.00 . A A .  93 ASP HB2  1 1 
        5  9146 1 1  93 ASP HB3  H   0.105  -4.073   8.933 1.00 . A A .  93 ASP HB3  1 1 
        5  9147 1 1  93 ASP N    N   0.569  -6.800   8.093 1.00 . A A .  93 ASP N    1 1 
        5  9148 1 1  93 ASP O    O   0.941  -7.290  11.265 1.00 . A A .  93 ASP O    1 1 
        5  9149 1 1  93 ASP OD1  O  -2.109  -5.442   9.003 1.00 . A A .  93 ASP OD1  1 1 
        5  9150 1 1  93 ASP OD2  O  -1.779  -5.051  11.135 1.00 . A A .  93 ASP OD2  1 1 
        5  9151 1 1  94 GLU C    C   3.966  -7.634  12.585 1.00 . A A .  94 GLU C    1 1 
        5  9152 1 1  94 GLU CA   C   3.628  -8.168  11.154 1.00 . A A .  94 GLU CA   1 1 
        5  9153 1 1  94 GLU CB   C   4.848  -8.814  10.452 1.00 . A A .  94 GLU CB   1 1 
        5  9154 1 1  94 GLU CD   C   5.737  -7.080   8.747 1.00 . A A .  94 GLU CD   1 1 
        5  9155 1 1  94 GLU CG   C   6.002  -7.898   9.997 1.00 . A A .  94 GLU CG   1 1 
        5  9156 1 1  94 GLU H    H   3.451  -6.836   9.414 1.00 . A A .  94 GLU H    1 1 
        5  9157 1 1  94 GLU HA   H   2.927  -8.986  11.358 1.00 . A A .  94 GLU HA   1 1 
        5  9158 1 1  94 GLU HB2  H   5.270  -9.576  11.137 1.00 . A A .  94 GLU HB2  1 1 
        5  9159 1 1  94 GLU HB3  H   4.487  -9.409   9.589 1.00 . A A .  94 GLU HB3  1 1 
        5  9160 1 1  94 GLU HG2  H   6.315  -7.212  10.803 1.00 . A A .  94 GLU HG2  1 1 
        5  9161 1 1  94 GLU HG3  H   6.888  -8.524   9.790 1.00 . A A .  94 GLU HG3  1 1 
        5  9162 1 1  94 GLU N    N   2.923  -7.263  10.196 1.00 . A A .  94 GLU N    1 1 
        5  9163 1 1  94 GLU O    O   4.040  -8.397  13.550 1.00 . A A .  94 GLU O    1 1 
        5  9164 1 1  94 GLU OE1  O   5.195  -5.960   8.858 1.00 . A A .  94 GLU OE1  1 1 
        5  9165 1 1  94 GLU OE2  O   6.073  -7.543   7.638 1.00 . A A .  94 GLU OE2  1 1 
        5  9166 1 1  95 GLN C    C   2.536  -4.838  13.769 1.00 . A A .  95 GLN C    1 1 
        5  9167 1 1  95 GLN CA   C   3.917  -5.560  13.935 1.00 . A A .  95 GLN CA   1 1 
        5  9168 1 1  95 GLN CB   C   5.057  -4.535  14.148 1.00 . A A .  95 GLN CB   1 1 
        5  9169 1 1  95 GLN CD   C   7.565  -4.087  13.987 1.00 . A A .  95 GLN CD   1 1 
        5  9170 1 1  95 GLN CG   C   6.480  -5.128  14.230 1.00 . A A .  95 GLN CG   1 1 
        5  9171 1 1  95 GLN H    H   3.681  -5.994  11.791 1.00 . A A .  95 GLN H    1 1 
        5  9172 1 1  95 GLN HA   H   3.886  -6.239  14.814 1.00 . A A .  95 GLN HA   1 1 
        5  9173 1 1  95 GLN HB2  H   5.010  -3.776  13.345 1.00 . A A .  95 GLN HB2  1 1 
        5  9174 1 1  95 GLN HB3  H   4.852  -3.959  15.072 1.00 . A A .  95 GLN HB3  1 1 
        5  9175 1 1  95 GLN HE21 H   8.052  -4.055  15.923 1.00 . A A .  95 GLN HE21 1 1 
        5  9176 1 1  95 GLN HE22 H   8.993  -2.976  14.766 1.00 . A A .  95 GLN HE22 1 1 
        5  9177 1 1  95 GLN HG2  H   6.623  -5.657  15.191 1.00 . A A .  95 GLN HG2  1 1 
        5  9178 1 1  95 GLN HG3  H   6.622  -5.908  13.459 1.00 . A A .  95 GLN HG3  1 1 
        5  9179 1 1  95 GLN N    N   4.095  -6.315  12.673 1.00 . A A .  95 GLN N    1 1 
        5  9180 1 1  95 GLN NE2  N   8.276  -3.665  15.004 1.00 . A A .  95 GLN NE2  1 1 
        5  9181 1 1  95 GLN O    O   2.426  -3.860  13.024 1.00 . A A .  95 GLN O    1 1 
        5  9182 1 1  95 GLN OE1  O   7.783  -3.636  12.865 1.00 . A A .  95 GLN OE1  1 1 
        5  9183 1 1  96 LEU C    C  -0.302  -3.582  14.104 1.00 . A A .  96 LEU C    1 1 
        5  9184 1 1  96 LEU CA   C   0.067  -5.094  14.051 1.00 . A A .  96 LEU CA   1 1 
        5  9185 1 1  96 LEU CB   C  -0.805  -5.999  14.966 1.00 . A A .  96 LEU CB   1 1 
        5  9186 1 1  96 LEU CD1  C  -2.877  -7.458  15.032 1.00 . A A .  96 LEU CD1  1 1 
        5  9187 1 1  96 LEU CD2  C  -3.146  -4.998  15.293 1.00 . A A .  96 LEU CD2  1 1 
        5  9188 1 1  96 LEU CG   C  -2.310  -6.087  14.608 1.00 . A A .  96 LEU CG   1 1 
        5  9189 1 1  96 LEU H    H   1.747  -6.329  14.757 1.00 . A A .  96 LEU H    1 1 
        5  9190 1 1  96 LEU HA   H  -0.081  -5.473  13.016 1.00 . A A .  96 LEU HA   1 1 
        5  9191 1 1  96 LEU HB2  H  -0.382  -7.024  14.896 1.00 . A A .  96 LEU HB2  1 1 
        5  9192 1 1  96 LEU HB3  H  -0.676  -5.716  16.028 1.00 . A A .  96 LEU HB3  1 1 
        5  9193 1 1  96 LEU HD11 H  -3.947  -7.552  14.769 1.00 . A A .  96 LEU HD11 1 1 
        5  9194 1 1  96 LEU HD12 H  -2.357  -8.290  14.521 1.00 . A A .  96 LEU HD12 1 1 
        5  9195 1 1  96 LEU HD13 H  -2.787  -7.632  16.120 1.00 . A A .  96 LEU HD13 1 1 
        5  9196 1 1  96 LEU HD21 H  -2.855  -3.981  14.980 1.00 . A A .  96 LEU HD21 1 1 
        5  9197 1 1  96 LEU HD22 H  -4.219  -5.094  15.046 1.00 . A A .  96 LEU HD22 1 1 
        5  9198 1 1  96 LEU HD23 H  -3.061  -5.029  16.394 1.00 . A A .  96 LEU HD23 1 1 
        5  9199 1 1  96 LEU HG   H  -2.440  -6.004  13.507 1.00 . A A .  96 LEU HG   1 1 
        5  9200 1 1  96 LEU N    N   1.493  -5.406  14.393 1.00 . A A .  96 LEU N    1 1 
        5  9201 1 1  96 LEU O    O  -0.143  -2.917  15.132 1.00 . A A .  96 LEU O    1 1 
        5  9202 1 1  97 ALA C    C  -2.466  -1.247  12.813 1.00 . A A .  97 ALA C    1 1 
        5  9203 1 1  97 ALA CA   C  -0.964  -1.609  12.739 1.00 . A A .  97 ALA CA   1 1 
        5  9204 1 1  97 ALA CB   C  -0.201  -1.330  11.432 1.00 . A A .  97 ALA CB   1 1 
        5  9205 1 1  97 ALA H    H  -1.020  -3.759  12.244 1.00 . A A .  97 ALA H    1 1 
        5  9206 1 1  97 ALA HA   H  -0.484  -1.006  13.523 1.00 . A A .  97 ALA HA   1 1 
        5  9207 1 1  97 ALA HB1  H  -0.619  -1.872  10.564 1.00 . A A .  97 ALA HB1  1 1 
        5  9208 1 1  97 ALA HB2  H  -0.187  -0.260  11.160 1.00 . A A .  97 ALA HB2  1 1 
        5  9209 1 1  97 ALA HB3  H   0.860  -1.630  11.529 1.00 . A A .  97 ALA HB3  1 1 
        5  9210 1 1  97 ALA N    N  -0.749  -3.059  12.957 1.00 . A A .  97 ALA N    1 1 
        5  9211 1 1  97 ALA O    O  -3.207  -1.793  13.639 1.00 . A A .  97 ALA O    1 1 
        5  9212 1 1  98 LYS C    C  -5.092  -1.278  11.029 1.00 . A A .  98 LYS C    1 1 
        5  9213 1 1  98 LYS CA   C  -4.411  -0.092  11.791 1.00 . A A .  98 LYS CA   1 1 
        5  9214 1 1  98 LYS CB   C  -4.580   1.285  11.102 1.00 . A A .  98 LYS CB   1 1 
        5  9215 1 1  98 LYS CD   C  -6.133   3.143  10.298 1.00 . A A .  98 LYS CD   1 1 
        5  9216 1 1  98 LYS CE   C  -7.598   3.557  10.081 1.00 . A A .  98 LYS CE   1 1 
        5  9217 1 1  98 LYS CG   C  -6.040   1.761  10.974 1.00 . A A .  98 LYS CG   1 1 
        5  9218 1 1  98 LYS H    H  -2.212   0.309  11.600 1.00 . A A .  98 LYS H    1 1 
        5  9219 1 1  98 LYS HA   H  -4.877  -0.017  12.796 1.00 . A A .  98 LYS HA   1 1 
        5  9220 1 1  98 LYS HB2  H  -3.996   2.040  11.670 1.00 . A A .  98 LYS HB2  1 1 
        5  9221 1 1  98 LYS HB3  H  -4.099   1.255  10.104 1.00 . A A .  98 LYS HB3  1 1 
        5  9222 1 1  98 LYS HD2  H  -5.595   3.889  10.918 1.00 . A A .  98 LYS HD2  1 1 
        5  9223 1 1  98 LYS HD3  H  -5.592   3.121   9.329 1.00 . A A .  98 LYS HD3  1 1 
        5  9224 1 1  98 LYS HE2  H  -8.111   2.802   9.444 1.00 . A A .  98 LYS HE2  1 1 
        5  9225 1 1  98 LYS HE3  H  -8.145   3.550  11.050 1.00 . A A .  98 LYS HE3  1 1 
        5  9226 1 1  98 LYS HG2  H  -6.622   1.018  10.391 1.00 . A A .  98 LYS HG2  1 1 
        5  9227 1 1  98 LYS HG3  H  -6.511   1.794  11.977 1.00 . A A .  98 LYS HG3  1 1 
        5  9228 1 1  98 LYS HZ1  H  -7.153   4.934   8.492 1.00 . A A .  98 LYS HZ1  1 1 
        5  9229 1 1  98 LYS HZ2  H  -8.597   5.249   9.250 1.00 . A A .  98 LYS HZ2  1 1 
        5  9230 1 1  98 LYS HZ3  H  -7.171   5.624   9.994 1.00 . A A .  98 LYS HZ3  1 1 
        5  9231 1 1  98 LYS N    N  -2.948  -0.325  11.968 1.00 . A A .  98 LYS N    1 1 
        5  9232 1 1  98 LYS NZ   N  -7.652   4.901   9.448 1.00 . A A .  98 LYS NZ   1 1 
        5  9233 1 1  98 LYS O    O  -5.361  -1.208   9.825 1.00 . A A .  98 LYS O    1 1 
        5  9234 1 1  99 ALA C    C  -7.445  -3.596  10.964 1.00 . A A .  99 ALA C    1 1 
        5  9235 1 1  99 ALA CA   C  -5.906  -3.620  11.207 1.00 . A A .  99 ALA CA   1 1 
        5  9236 1 1  99 ALA CB   C  -5.440  -4.742  12.145 1.00 . A A .  99 ALA CB   1 1 
        5  9237 1 1  99 ALA H    H  -4.876  -2.335  12.676 1.00 . A A .  99 ALA H    1 1 
        5  9238 1 1  99 ALA HA   H  -5.404  -3.814  10.235 1.00 . A A .  99 ALA HA   1 1 
        5  9239 1 1  99 ALA HB1  H  -5.851  -4.646  13.167 1.00 . A A .  99 ALA HB1  1 1 
        5  9240 1 1  99 ALA HB2  H  -5.739  -5.738  11.771 1.00 . A A .  99 ALA HB2  1 1 
        5  9241 1 1  99 ALA HB3  H  -4.335  -4.762  12.227 1.00 . A A .  99 ALA HB3  1 1 
        5  9242 1 1  99 ALA N    N  -5.387  -2.354  11.780 1.00 . A A .  99 ALA N    1 1 
        5  9243 1 1  99 ALA O    O  -8.250  -4.190  11.687 1.00 . A A .  99 ALA O    1 1 
        5  9244 1 1 100 ALA C    C  -9.357  -2.583   7.958 1.00 . A A . 100 ALA C    1 1 
        5  9245 1 1 100 ALA CA   C  -9.216  -2.607   9.519 1.00 . A A . 100 ALA CA   1 1 
        5  9246 1 1 100 ALA CB   C  -9.585  -1.236  10.114 1.00 . A A . 100 ALA CB   1 1 
        5  9247 1 1 100 ALA H    H  -7.039  -2.311   9.524 1.00 . A A . 100 ALA H    1 1 
        5  9248 1 1 100 ALA HA   H  -9.885  -3.389   9.928 1.00 . A A . 100 ALA HA   1 1 
        5  9249 1 1 100 ALA HB1  H -10.610  -0.922   9.848 1.00 . A A . 100 ALA HB1  1 1 
        5  9250 1 1 100 ALA HB2  H  -9.533  -1.251  11.219 1.00 . A A . 100 ALA HB2  1 1 
        5  9251 1 1 100 ALA HB3  H  -8.895  -0.444   9.765 1.00 . A A . 100 ALA HB3  1 1 
        5  9252 1 1 100 ALA N    N  -7.815  -2.870   9.907 1.00 . A A . 100 ALA N    1 1 
        5  9253 1 1 100 ALA O    O  -8.371  -2.257   7.283 1.00 . A A . 100 ALA O    1 1 
        5  9254 1 1 101 PRO C    C -10.627  -1.561   5.093 1.00 . A A . 101 PRO C    1 1 
        5  9255 1 1 101 PRO CA   C -10.651  -2.932   5.829 1.00 . A A . 101 PRO CA   1 1 
        5  9256 1 1 101 PRO CB   C -11.965  -3.743   5.656 1.00 . A A . 101 PRO CB   1 1 
        5  9257 1 1 101 PRO CD   C -11.757  -3.319   8.026 1.00 . A A . 101 PRO CD   1 1 
        5  9258 1 1 101 PRO CG   C -12.806  -3.386   6.903 1.00 . A A . 101 PRO CG   1 1 
        5  9259 1 1 101 PRO HA   H  -9.824  -3.553   5.429 1.00 . A A . 101 PRO HA   1 1 
        5  9260 1 1 101 PRO HB2  H -12.495  -3.539   4.708 1.00 . A A . 101 PRO HB2  1 1 
        5  9261 1 1 101 PRO HB3  H -11.725  -4.825   5.662 1.00 . A A . 101 PRO HB3  1 1 
        5  9262 1 1 101 PRO HD2  H -12.058  -2.628   8.836 1.00 . A A . 101 PRO HD2  1 1 
        5  9263 1 1 101 PRO HD3  H -11.593  -4.320   8.472 1.00 . A A . 101 PRO HD3  1 1 
        5  9264 1 1 101 PRO HG2  H -13.283  -2.396   6.764 1.00 . A A . 101 PRO HG2  1 1 
        5  9265 1 1 101 PRO HG3  H -13.606  -4.120   7.106 1.00 . A A . 101 PRO HG3  1 1 
        5  9266 1 1 101 PRO N    N -10.533  -2.867   7.329 1.00 . A A . 101 PRO N    1 1 
        5  9267 1 1 101 PRO O    O -11.619  -1.094   4.526 1.00 . A A . 101 PRO O    1 1 
        5  9268 1 1 102 LYS C    C  -8.759   0.114   2.894 1.00 . A A . 102 LYS C    1 1 
        5  9269 1 1 102 LYS CA   C  -9.168   0.321   4.382 1.00 . A A . 102 LYS CA   1 1 
        5  9270 1 1 102 LYS CB   C  -8.220   1.217   5.227 1.00 . A A . 102 LYS CB   1 1 
        5  9271 1 1 102 LYS CD   C  -5.967   1.809   6.267 1.00 . A A . 102 LYS CD   1 1 
        5  9272 1 1 102 LYS CE   C  -4.586   1.284   6.713 1.00 . A A . 102 LYS CE   1 1 
        5  9273 1 1 102 LYS CG   C  -6.815   0.704   5.591 1.00 . A A . 102 LYS CG   1 1 
        5  9274 1 1 102 LYS H    H  -8.777  -1.383   5.745 1.00 . A A . 102 LYS H    1 1 
        5  9275 1 1 102 LYS HA   H -10.109   0.911   4.379 1.00 . A A . 102 LYS HA   1 1 
        5  9276 1 1 102 LYS HB2  H  -8.134   2.191   4.707 1.00 . A A . 102 LYS HB2  1 1 
        5  9277 1 1 102 LYS HB3  H  -8.760   1.465   6.164 1.00 . A A . 102 LYS HB3  1 1 
        5  9278 1 1 102 LYS HD2  H  -5.857   2.654   5.556 1.00 . A A . 102 LYS HD2  1 1 
        5  9279 1 1 102 LYS HD3  H  -6.501   2.238   7.136 1.00 . A A . 102 LYS HD3  1 1 
        5  9280 1 1 102 LYS HE2  H  -4.698   0.657   7.627 1.00 . A A . 102 LYS HE2  1 1 
        5  9281 1 1 102 LYS HE3  H  -4.176   0.587   5.949 1.00 . A A . 102 LYS HE3  1 1 
        5  9282 1 1 102 LYS HG2  H  -6.887  -0.183   6.253 1.00 . A A . 102 LYS HG2  1 1 
        5  9283 1 1 102 LYS HG3  H  -6.284   0.357   4.683 1.00 . A A . 102 LYS HG3  1 1 
        5  9284 1 1 102 LYS HZ1  H  -3.040   2.373   7.828 1.00 . A A . 102 LYS HZ1  1 1 
        5  9285 1 1 102 LYS HZ2  H  -2.931   2.478   6.178 1.00 . A A . 102 LYS HZ2  1 1 
        5  9286 1 1 102 LYS HZ3  H  -4.054   3.374   6.935 1.00 . A A . 102 LYS HZ3  1 1 
        5  9287 1 1 102 LYS N    N  -9.433  -0.958   5.068 1.00 . A A . 102 LYS N    1 1 
        5  9288 1 1 102 LYS NZ   N  -3.624   2.404   6.930 1.00 . A A . 102 LYS NZ   1 1 
        5  9289 1 1 102 LYS O    O  -7.588  -0.070   2.561 1.00 . A A . 102 LYS O    1 1 
        5  9290 1 1 103 GLN C    C -10.954   0.997   0.039 1.00 . A A . 103 GLN C    1 1 
        5  9291 1 1 103 GLN CA   C  -9.577   0.486   0.563 1.00 . A A . 103 GLN CA   1 1 
        5  9292 1 1 103 GLN CB   C  -8.956  -0.628  -0.307 1.00 . A A . 103 GLN CB   1 1 
        5  9293 1 1 103 GLN CD   C  -9.163  -3.002  -1.315 1.00 . A A . 103 GLN CD   1 1 
        5  9294 1 1 103 GLN CG   C  -9.547  -2.040  -0.201 1.00 . A A . 103 GLN CG   1 1 
        5  9295 1 1 103 GLN H    H -10.688   0.184   2.446 1.00 . A A . 103 GLN H    1 1 
        5  9296 1 1 103 GLN HA   H  -8.867   1.337   0.484 1.00 . A A . 103 GLN HA   1 1 
        5  9297 1 1 103 GLN HB2  H  -8.967  -0.274  -1.358 1.00 . A A . 103 GLN HB2  1 1 
        5  9298 1 1 103 GLN HB3  H  -7.880  -0.667  -0.048 1.00 . A A . 103 GLN HB3  1 1 
        5  9299 1 1 103 GLN HE21 H  -7.217  -2.655  -1.098 1.00 . A A . 103 GLN HE21 1 1 
        5  9300 1 1 103 GLN HE22 H  -7.763  -3.887  -2.346 1.00 . A A . 103 GLN HE22 1 1 
        5  9301 1 1 103 GLN HG2  H  -9.275  -2.490   0.769 1.00 . A A . 103 GLN HG2  1 1 
        5  9302 1 1 103 GLN HG3  H -10.651  -1.993  -0.169 1.00 . A A . 103 GLN HG3  1 1 
        5  9303 1 1 103 GLN N    N  -9.759   0.167   2.008 1.00 . A A . 103 GLN N    1 1 
        5  9304 1 1 103 GLN NE2  N  -7.902  -3.301  -1.519 1.00 . A A . 103 GLN NE2  1 1 
        5  9305 1 1 103 GLN O    O -11.850   0.203  -0.262 1.00 . A A . 103 GLN O    1 1 
        5  9306 1 1 103 GLN OE1  O -10.019  -3.524  -2.023 1.00 . A A . 103 GLN OE1  1 1 
        5  9307 1 1 104 PHE C    C -12.671   4.446  -0.208 1.00 . A A . 104 PHE C    1 1 
        5  9308 1 1 104 PHE CA   C -12.512   2.928   0.136 1.00 . A A . 104 PHE CA   1 1 
        5  9309 1 1 104 PHE CB   C -13.251   2.575   1.465 1.00 . A A . 104 PHE CB   1 1 
        5  9310 1 1 104 PHE CD1  C -11.579   3.784   3.076 1.00 . A A . 104 PHE CD1  1 1 
        5  9311 1 1 104 PHE CD2  C -13.021   2.048   3.922 1.00 . A A . 104 PHE CD2  1 1 
        5  9312 1 1 104 PHE CE1  C -11.036   3.957   4.351 1.00 . A A . 104 PHE CE1  1 1 
        5  9313 1 1 104 PHE CE2  C -12.485   2.227   5.201 1.00 . A A . 104 PHE CE2  1 1 
        5  9314 1 1 104 PHE CG   C -12.583   2.820   2.838 1.00 . A A . 104 PHE CG   1 1 
        5  9315 1 1 104 PHE CZ   C -11.495   3.182   5.411 1.00 . A A . 104 PHE CZ   1 1 
        5  9316 1 1 104 PHE H    H -10.297   2.895   0.237 1.00 . A A . 104 PHE H    1 1 
        5  9317 1 1 104 PHE HA   H -13.096   2.455  -0.674 1.00 . A A . 104 PHE HA   1 1 
        5  9318 1 1 104 PHE HB2  H -14.239   3.076   1.473 1.00 . A A . 104 PHE HB2  1 1 
        5  9319 1 1 104 PHE HB3  H -13.513   1.500   1.393 1.00 . A A . 104 PHE HB3  1 1 
        5  9320 1 1 104 PHE HD1  H -11.195   4.404   2.277 1.00 . A A . 104 PHE HD1  1 1 
        5  9321 1 1 104 PHE HD2  H -13.787   1.293   3.786 1.00 . A A . 104 PHE HD2  1 1 
        5  9322 1 1 104 PHE HE1  H -10.259   4.696   4.502 1.00 . A A . 104 PHE HE1  1 1 
        5  9323 1 1 104 PHE HE2  H -12.836   1.610   6.019 1.00 . A A . 104 PHE HE2  1 1 
        5  9324 1 1 104 PHE HZ   H -11.075   3.316   6.400 1.00 . A A . 104 PHE HZ   1 1 
        5  9325 1 1 104 PHE N    N -11.154   2.323   0.070 1.00 . A A . 104 PHE N    1 1 
        5  9326 1 1 104 PHE O    O -13.813   4.870  -0.411 1.00 . A A . 104 PHE O    1 1 
        5  9327 1 1 105 GLY C    C -11.939   7.166  -1.989 1.00 . A A . 105 GLY C    1 1 
        5  9328 1 1 105 GLY CA   C -11.728   6.725  -0.526 1.00 . A A . 105 GLY CA   1 1 
        5  9329 1 1 105 GLY H    H -10.692   4.783  -0.122 1.00 . A A . 105 GLY H    1 1 
        5  9330 1 1 105 GLY HA2  H -12.533   7.154   0.101 1.00 . A A . 105 GLY HA2  1 1 
        5  9331 1 1 105 GLY HA3  H -10.806   7.209  -0.155 1.00 . A A . 105 GLY HA3  1 1 
        5  9332 1 1 105 GLY N    N -11.604   5.259  -0.287 1.00 . A A . 105 GLY N    1 1 
        5  9333 1 1 105 GLY O    O -11.123   7.892  -2.558 1.00 . A A . 105 GLY O    1 1 
        5  9334 1 1 106 ARG C    C -14.790   6.178  -4.196 1.00 . A A . 106 ARG C    1 1 
        5  9335 1 1 106 ARG CA   C -13.316   6.704  -4.037 1.00 . A A . 106 ARG CA   1 1 
        5  9336 1 1 106 ARG CB   C -12.282   5.796  -4.746 1.00 . A A . 106 ARG CB   1 1 
        5  9337 1 1 106 ARG CD   C -13.344   5.332  -7.131 1.00 . A A . 106 ARG CD   1 1 
        5  9338 1 1 106 ARG CG   C -12.178   5.835  -6.278 1.00 . A A . 106 ARG CG   1 1 
        5  9339 1 1 106 ARG CZ   C -14.905   3.391  -7.103 1.00 . A A . 106 ARG CZ   1 1 
        5  9340 1 1 106 ARG H    H -13.524   6.021  -1.948 1.00 . A A . 106 ARG H    1 1 
        5  9341 1 1 106 ARG HA   H -13.241   7.746  -4.405 1.00 . A A . 106 ARG HA   1 1 
        5  9342 1 1 106 ARG HB2  H -11.267   6.071  -4.391 1.00 . A A . 106 ARG HB2  1 1 
        5  9343 1 1 106 ARG HB3  H -12.398   4.754  -4.388 1.00 . A A . 106 ARG HB3  1 1 
        5  9344 1 1 106 ARG HD2  H -14.165   6.072  -7.109 1.00 . A A . 106 ARG HD2  1 1 
        5  9345 1 1 106 ARG HD3  H -13.011   5.284  -8.188 1.00 . A A . 106 ARG HD3  1 1 
        5  9346 1 1 106 ARG HE   H -13.477   3.563  -5.798 1.00 . A A . 106 ARG HE   1 1 
        5  9347 1 1 106 ARG HG2  H -11.913   6.862  -6.598 1.00 . A A . 106 ARG HG2  1 1 
        5  9348 1 1 106 ARG HG3  H -11.281   5.243  -6.548 1.00 . A A . 106 ARG HG3  1 1 
        5  9349 1 1 106 ARG HH11 H -15.353   4.673  -8.516 1.00 . A A . 106 ARG HH11 1 1 
        5  9350 1 1 106 ARG HH12 H -16.486   3.246  -8.285 1.00 . A A . 106 ARG HH12 1 1 
        5  9351 1 1 106 ARG HH21 H -14.701   2.196  -5.566 1.00 . A A . 106 ARG HH21 1 1 
        5  9352 1 1 106 ARG HH22 H -16.104   1.835  -6.766 1.00 . A A . 106 ARG HH22 1 1 
        5  9353 1 1 106 ARG N    N -13.046   6.694  -2.569 1.00 . A A . 106 ARG N    1 1 
        5  9354 1 1 106 ARG NE   N -13.818   4.007  -6.681 1.00 . A A . 106 ARG NE   1 1 
        5  9355 1 1 106 ARG NH1  N -15.612   3.756  -8.140 1.00 . A A . 106 ARG NH1  1 1 
        5  9356 1 1 106 ARG NH2  N -15.287   2.360  -6.422 1.00 . A A . 106 ARG NH2  1 1 
        5  9357 1 1 106 ARG O    O -15.133   5.151  -3.606 1.00 . A A . 106 ARG O    1 1 
        5  9358 1 1 107 ASN C    C -17.668   5.178  -4.988 1.00 . A A . 107 ASN C    1 1 
        5  9359 1 1 107 ASN CA   C -17.119   6.645  -5.047 1.00 . A A . 107 ASN CA   1 1 
        5  9360 1 1 107 ASN CB   C -17.712   7.467  -6.228 1.00 . A A . 107 ASN CB   1 1 
        5  9361 1 1 107 ASN CG   C -17.425   7.004  -7.652 1.00 . A A . 107 ASN CG   1 1 
        5  9362 1 1 107 ASN H    H -15.208   7.680  -5.444 1.00 . A A . 107 ASN H    1 1 
        5  9363 1 1 107 ASN HA   H -17.523   7.176  -4.157 1.00 . A A . 107 ASN HA   1 1 
        5  9364 1 1 107 ASN HB2  H -18.804   7.544  -6.060 1.00 . A A . 107 ASN HB2  1 1 
        5  9365 1 1 107 ASN HB3  H -17.365   8.514  -6.143 1.00 . A A . 107 ASN HB3  1 1 
        5  9366 1 1 107 ASN HD21 H -19.371   7.044  -8.110 1.00 . A A . 107 ASN HD21 1 1 
        5  9367 1 1 107 ASN HD22 H -18.168   6.596  -9.427 1.00 . A A . 107 ASN HD22 1 1 
        5  9368 1 1 107 ASN N    N -15.638   6.877  -4.976 1.00 . A A . 107 ASN N    1 1 
        5  9369 1 1 107 ASN ND2  N -18.436   6.834  -8.469 1.00 . A A . 107 ASN ND2  1 1 
        5  9370 1 1 107 ASN O    O -17.711   4.453  -5.985 1.00 . A A . 107 ASN O    1 1 
        5  9371 1 1 107 ASN OD1  O -16.291   6.801  -8.072 1.00 . A A . 107 ASN OD1  1 1 
        5  9372 1 1 108 LEU C    C -19.391   2.568  -3.774 1.00 . A A . 108 LEU C    1 1 
        5  9373 1 1 108 LEU CA   C -18.056   3.288  -3.432 1.00 . A A . 108 LEU CA   1 1 
        5  9374 1 1 108 LEU CB   C -17.656   3.229  -1.930 1.00 . A A . 108 LEU CB   1 1 
        5  9375 1 1 108 LEU CD1  C -15.987   1.303  -1.932 1.00 . A A . 108 LEU CD1  1 1 
        5  9376 1 1 108 LEU CD2  C -17.188   1.921   0.168 1.00 . A A . 108 LEU CD2  1 1 
        5  9377 1 1 108 LEU CG   C -17.308   1.832  -1.366 1.00 . A A . 108 LEU CG   1 1 
        5  9378 1 1 108 LEU H    H -17.836   5.422  -3.043 1.00 . A A . 108 LEU H    1 1 
        5  9379 1 1 108 LEU HA   H -17.241   2.792  -4.001 1.00 . A A . 108 LEU HA   1 1 
        5  9380 1 1 108 LEU HB2  H -16.781   3.891  -1.752 1.00 . A A . 108 LEU HB2  1 1 
        5  9381 1 1 108 LEU HB3  H -18.477   3.670  -1.327 1.00 . A A . 108 LEU HB3  1 1 
        5  9382 1 1 108 LEU HD11 H -16.025   1.159  -3.024 1.00 . A A . 108 LEU HD11 1 1 
        5  9383 1 1 108 LEU HD12 H -15.141   1.990  -1.746 1.00 . A A . 108 LEU HD12 1 1 
        5  9384 1 1 108 LEU HD13 H -15.705   0.328  -1.496 1.00 . A A . 108 LEU HD13 1 1 
        5  9385 1 1 108 LEU HD21 H -16.406   2.635   0.484 1.00 . A A . 108 LEU HD21 1 1 
        5  9386 1 1 108 LEU HD22 H -18.136   2.248   0.634 1.00 . A A . 108 LEU HD22 1 1 
        5  9387 1 1 108 LEU HD23 H -16.936   0.942   0.616 1.00 . A A . 108 LEU HD23 1 1 
        5  9388 1 1 108 LEU HG   H -18.120   1.113  -1.600 1.00 . A A . 108 LEU HG   1 1 
        5  9389 1 1 108 LEU N    N -18.051   4.741  -3.778 1.00 . A A . 108 LEU N    1 1 
        5  9390 1 1 108 LEU O    O -20.220   2.292  -2.902 1.00 . A A . 108 LEU O    1 1 
        5  9391 1 1 109 ALA C    C -20.541   0.167  -6.099 1.00 . A A . 109 ALA C    1 1 
        5  9392 1 1 109 ALA CA   C -20.806   1.607  -5.568 1.00 . A A . 109 ALA CA   1 1 
        5  9393 1 1 109 ALA CB   C -21.358   2.511  -6.672 1.00 . A A . 109 ALA CB   1 1 
        5  9394 1 1 109 ALA H    H -18.945   2.761  -5.691 1.00 . A A . 109 ALA H    1 1 
        5  9395 1 1 109 ALA HA   H -21.587   1.580  -4.777 1.00 . A A . 109 ALA HA   1 1 
        5  9396 1 1 109 ALA HB1  H -20.729   2.440  -7.569 1.00 . A A . 109 ALA HB1  1 1 
        5  9397 1 1 109 ALA HB2  H -22.379   2.208  -6.966 1.00 . A A . 109 ALA HB2  1 1 
        5  9398 1 1 109 ALA HB3  H -21.398   3.572  -6.362 1.00 . A A . 109 ALA HB3  1 1 
        5  9399 1 1 109 ALA N    N -19.568   2.240  -5.064 1.00 . A A . 109 ALA N    1 1 
        5  9400 1 1 109 ALA O    O -20.098  -0.066  -7.229 1.00 . A A . 109 ALA O    1 1 
        5  9401 1 1 110 ARG C    C -21.867  -3.028  -4.702 1.00 . A A . 110 ARG C    1 1 
        5  9402 1 1 110 ARG CA   C -20.849  -2.239  -5.582 1.00 . A A . 110 ARG CA   1 1 
        5  9403 1 1 110 ARG CB   C -19.404  -2.800  -5.513 1.00 . A A . 110 ARG CB   1 1 
        5  9404 1 1 110 ARG CD   C -19.334  -5.407  -5.363 1.00 . A A . 110 ARG CD   1 1 
        5  9405 1 1 110 ARG CG   C -19.173  -4.150  -6.225 1.00 . A A . 110 ARG CG   1 1 
        5  9406 1 1 110 ARG CZ   C -18.081  -5.547  -3.205 1.00 . A A . 110 ARG CZ   1 1 
        5  9407 1 1 110 ARG H    H -21.238  -0.382  -4.385 1.00 . A A . 110 ARG H    1 1 
        5  9408 1 1 110 ARG HA   H -21.189  -2.312  -6.637 1.00 . A A . 110 ARG HA   1 1 
        5  9409 1 1 110 ARG HB2  H -18.744  -2.069  -6.023 1.00 . A A . 110 ARG HB2  1 1 
        5  9410 1 1 110 ARG HB3  H -19.038  -2.820  -4.469 1.00 . A A . 110 ARG HB3  1 1 
        5  9411 1 1 110 ARG HD2  H -20.274  -5.371  -4.798 1.00 . A A . 110 ARG HD2  1 1 
        5  9412 1 1 110 ARG HD3  H -19.484  -6.283  -6.022 1.00 . A A . 110 ARG HD3  1 1 
        5  9413 1 1 110 ARG HE   H -17.203  -5.841  -4.973 1.00 . A A . 110 ARG HE   1 1 
        5  9414 1 1 110 ARG HG2  H -19.860  -4.235  -7.089 1.00 . A A . 110 ARG HG2  1 1 
        5  9415 1 1 110 ARG HG3  H -18.164  -4.149  -6.684 1.00 . A A . 110 ARG HG3  1 1 
        5  9416 1 1 110 ARG HH11 H -20.043  -5.484  -2.904 1.00 . A A . 110 ARG HH11 1 1 
        5  9417 1 1 110 ARG HH12 H -18.975  -5.353  -1.422 1.00 . A A . 110 ARG HH12 1 1 
        5  9418 1 1 110 ARG HH21 H -16.091  -5.564  -3.318 1.00 . A A . 110 ARG HH21 1 1 
        5  9419 1 1 110 ARG HH22 H -16.846  -5.484  -1.639 1.00 . A A . 110 ARG HH22 1 1 
        5  9420 1 1 110 ARG N    N -20.849  -0.794  -5.235 1.00 . A A . 110 ARG N    1 1 
        5  9421 1 1 110 ARG NE   N -18.138  -5.644  -4.526 1.00 . A A . 110 ARG NE   1 1 
        5  9422 1 1 110 ARG NH1  N -19.130  -5.429  -2.427 1.00 . A A . 110 ARG NH1  1 1 
        5  9423 1 1 110 ARG NH2  N -16.906  -5.576  -2.652 1.00 . A A . 110 ARG NH2  1 1 
        5  9424 1 1 110 ARG O    O -22.017  -2.800  -3.499 1.00 . A A . 110 ARG O    1 1 
        5  9425 1 1 111 ASP C    C -23.024  -5.718  -3.451 1.00 . A A . 111 ASP C    1 1 
        5  9426 1 1 111 ASP CA   C -23.462  -4.961  -4.745 1.00 . A A . 111 ASP CA   1 1 
        5  9427 1 1 111 ASP CB   C -23.891  -5.937  -5.885 1.00 . A A . 111 ASP CB   1 1 
        5  9428 1 1 111 ASP CG   C -22.804  -6.668  -6.681 1.00 . A A . 111 ASP CG   1 1 
        5  9429 1 1 111 ASP H    H -22.167  -4.207  -6.288 1.00 . A A . 111 ASP H    1 1 
        5  9430 1 1 111 ASP HA   H -24.379  -4.380  -4.510 1.00 . A A . 111 ASP HA   1 1 
        5  9431 1 1 111 ASP HB2  H -24.601  -6.685  -5.486 1.00 . A A . 111 ASP HB2  1 1 
        5  9432 1 1 111 ASP HB3  H -24.491  -5.364  -6.617 1.00 . A A . 111 ASP HB3  1 1 
        5  9433 1 1 111 ASP N    N -22.525  -3.987  -5.349 1.00 . A A . 111 ASP N    1 1 
        5  9434 1 1 111 ASP O    O -21.863  -6.091  -3.250 1.00 . A A . 111 ASP O    1 1 
        5  9435 1 1 111 ASP OD1  O -21.923  -6.000  -7.266 1.00 . A A . 111 ASP OD1  1 1 
        5  9436 1 1 111 ASP OD2  O -22.819  -7.915  -6.743 1.00 . A A . 111 ASP OD2  1 1 
        5  9437 1 1 112 LYS C    C -24.315  -8.217  -1.571 1.00 . A A . 112 LYS C    1 1 
        5  9438 1 1 112 LYS CA   C -23.825  -6.757  -1.326 1.00 . A A . 112 LYS CA   1 1 
        5  9439 1 1 112 LYS CB   C -24.556  -5.984  -0.203 1.00 . A A . 112 LYS CB   1 1 
        5  9440 1 1 112 LYS CD   C -24.728  -7.634   1.792 1.00 . A A . 112 LYS CD   1 1 
        5  9441 1 1 112 LYS CE   C -24.501  -7.860   3.300 1.00 . A A . 112 LYS CE   1 1 
        5  9442 1 1 112 LYS CG   C -24.168  -6.312   1.253 1.00 . A A . 112 LYS CG   1 1 
        5  9443 1 1 112 LYS H    H -24.928  -5.872  -3.016 1.00 . A A . 112 LYS H    1 1 
        5  9444 1 1 112 LYS HA   H -22.749  -6.789  -1.068 1.00 . A A . 112 LYS HA   1 1 
        5  9445 1 1 112 LYS HB2  H -24.334  -4.901  -0.328 1.00 . A A . 112 LYS HB2  1 1 
        5  9446 1 1 112 LYS HB3  H -25.655  -6.050  -0.333 1.00 . A A . 112 LYS HB3  1 1 
        5  9447 1 1 112 LYS HD2  H -25.803  -7.738   1.540 1.00 . A A . 112 LYS HD2  1 1 
        5  9448 1 1 112 LYS HD3  H -24.245  -8.473   1.250 1.00 . A A . 112 LYS HD3  1 1 
        5  9449 1 1 112 LYS HE2  H -24.656  -8.942   3.515 1.00 . A A . 112 LYS HE2  1 1 
        5  9450 1 1 112 LYS HE3  H -23.434  -7.676   3.558 1.00 . A A . 112 LYS HE3  1 1 
        5  9451 1 1 112 LYS HG2  H -23.066  -6.279   1.366 1.00 . A A . 112 LYS HG2  1 1 
        5  9452 1 1 112 LYS HG3  H -24.536  -5.467   1.869 1.00 . A A . 112 LYS HG3  1 1 
        5  9453 1 1 112 LYS HZ1  H -25.291  -6.022   3.984 1.00 . A A . 112 LYS HZ1  1 1 
        5  9454 1 1 112 LYS HZ2  H -26.411  -7.213   3.926 1.00 . A A . 112 LYS HZ2  1 1 
        5  9455 1 1 112 LYS HZ3  H -25.310  -7.184   5.147 1.00 . A A . 112 LYS HZ3  1 1 
        5  9456 1 1 112 LYS N    N -24.011  -5.966  -2.580 1.00 . A A . 112 LYS N    1 1 
        5  9457 1 1 112 LYS NZ   N -25.420  -7.031   4.135 1.00 . A A . 112 LYS NZ   1 1 
        5  9458 1 1 112 LYS O    O -25.383  -8.639  -1.123 1.00 . A A . 112 LYS O    1 1 
        5  9459 1 1 113 LYS C    C -22.787 -11.223  -3.105 1.00 . A A . 113 LYS C    1 1 
        5  9460 1 1 113 LYS CA   C -23.962 -10.205  -3.020 1.00 . A A . 113 LYS CA   1 1 
        5  9461 1 1 113 LYS CB   C -24.465  -9.792  -4.430 1.00 . A A . 113 LYS CB   1 1 
        5  9462 1 1 113 LYS CD   C -25.343 -10.367  -6.722 1.00 . A A . 113 LYS CD   1 1 
        5  9463 1 1 113 LYS CE   C -26.086 -11.370  -7.613 1.00 . A A . 113 LYS CE   1 1 
        5  9464 1 1 113 LYS CG   C -25.125 -10.892  -5.284 1.00 . A A . 113 LYS CG   1 1 
        5  9465 1 1 113 LYS H    H -22.855  -8.304  -2.826 1.00 . A A . 113 LYS H    1 1 
        5  9466 1 1 113 LYS HA   H -24.805 -10.651  -2.451 1.00 . A A . 113 LYS HA   1 1 
        5  9467 1 1 113 LYS HB2  H -25.197  -8.963  -4.324 1.00 . A A . 113 LYS HB2  1 1 
        5  9468 1 1 113 LYS HB3  H -23.621  -9.344  -4.987 1.00 . A A . 113 LYS HB3  1 1 
        5  9469 1 1 113 LYS HD2  H -25.898  -9.406  -6.685 1.00 . A A . 113 LYS HD2  1 1 
        5  9470 1 1 113 LYS HD3  H -24.353 -10.112  -7.157 1.00 . A A . 113 LYS HD3  1 1 
        5  9471 1 1 113 LYS HE2  H -25.598 -12.369  -7.568 1.00 . A A . 113 LYS HE2  1 1 
        5  9472 1 1 113 LYS HE3  H -27.119 -11.529  -7.229 1.00 . A A . 113 LYS HE3  1 1 
        5  9473 1 1 113 LYS HG2  H -24.496 -11.803  -5.315 1.00 . A A . 113 LYS HG2  1 1 
        5  9474 1 1 113 LYS HG3  H -26.086 -11.197  -4.823 1.00 . A A . 113 LYS HG3  1 1 
        5  9475 1 1 113 LYS HZ1  H -26.667 -11.399  -9.666 1.00 . A A . 113 LYS HZ1  1 1 
        5  9476 1 1 113 LYS HZ2  H -26.420  -9.880  -9.073 1.00 . A A . 113 LYS HZ2  1 1 
        5  9477 1 1 113 LYS HZ3  H -25.132 -10.845  -9.417 1.00 . A A . 113 LYS HZ3  1 1 
        5  9478 1 1 113 LYS N    N -23.514  -8.945  -2.364 1.00 . A A . 113 LYS N    1 1 
        5  9479 1 1 113 LYS NZ   N -26.095 -10.853  -9.009 1.00 . A A . 113 LYS NZ   1 1 
        5  9480 1 1 113 LYS O    O -21.700 -10.903  -3.607 1.00 . A A . 113 LYS O    1 1 
        5  9481 1 1 114 LYS C    C -22.357 -14.209  -4.396 1.00 . A A . 114 LYS C    1 1 
        5  9482 1 1 114 LYS CA   C -22.101 -13.607  -2.979 1.00 . A A . 114 LYS CA   1 1 
        5  9483 1 1 114 LYS CB   C -22.249 -14.637  -1.826 1.00 . A A . 114 LYS CB   1 1 
        5  9484 1 1 114 LYS CD   C -21.420 -16.784  -0.726 1.00 . A A . 114 LYS CD   1 1 
        5  9485 1 1 114 LYS CE   C -20.342 -17.882  -0.631 1.00 . A A . 114 LYS CE   1 1 
        5  9486 1 1 114 LYS CG   C -21.180 -15.757  -1.847 1.00 . A A . 114 LYS CG   1 1 
        5  9487 1 1 114 LYS H    H -23.985 -12.641  -2.350 1.00 . A A . 114 LYS H    1 1 
        5  9488 1 1 114 LYS HA   H -21.055 -13.234  -2.940 1.00 . A A . 114 LYS HA   1 1 
        5  9489 1 1 114 LYS HB2  H -22.183 -14.104  -0.855 1.00 . A A . 114 LYS HB2  1 1 
        5  9490 1 1 114 LYS HB3  H -23.263 -15.085  -1.850 1.00 . A A . 114 LYS HB3  1 1 
        5  9491 1 1 114 LYS HD2  H -21.451 -16.254   0.249 1.00 . A A . 114 LYS HD2  1 1 
        5  9492 1 1 114 LYS HD3  H -22.425 -17.241  -0.829 1.00 . A A . 114 LYS HD3  1 1 
        5  9493 1 1 114 LYS HE2  H -19.328 -17.425  -0.602 1.00 . A A . 114 LYS HE2  1 1 
        5  9494 1 1 114 LYS HE3  H -20.440 -18.394   0.352 1.00 . A A . 114 LYS HE3  1 1 
        5  9495 1 1 114 LYS HG2  H -21.186 -16.270  -2.829 1.00 . A A . 114 LYS HG2  1 1 
        5  9496 1 1 114 LYS HG3  H -20.171 -15.310  -1.748 1.00 . A A . 114 LYS HG3  1 1 
        5  9497 1 1 114 LYS HZ1  H -20.381 -18.507  -2.693 1.00 . A A . 114 LYS HZ1  1 1 
        5  9498 1 1 114 LYS HZ2  H -19.642 -19.615  -1.710 1.00 . A A . 114 LYS HZ2  1 1 
        5  9499 1 1 114 LYS HZ3  H -21.284 -19.464  -1.741 1.00 . A A . 114 LYS HZ3  1 1 
        5  9500 1 1 114 LYS N    N -23.040 -12.481  -2.710 1.00 . A A . 114 LYS N    1 1 
        5  9501 1 1 114 LYS NZ   N -20.430 -18.887  -1.726 1.00 . A A . 114 LYS NZ   1 1 
        5  9502 1 1 114 LYS O    O -22.982 -15.263  -4.546 1.00 . A A . 114 LYS O    1 1 
        5  9503 1 1 115 GLN C    C -20.806 -15.096  -7.185 1.00 . A A . 115 GLN C    1 1 
        5  9504 1 1 115 GLN CA   C -21.922 -14.049  -6.841 1.00 . A A . 115 GLN CA   1 1 
        5  9505 1 1 115 GLN CB   C -21.946 -12.797  -7.753 1.00 . A A . 115 GLN CB   1 1 
        5  9506 1 1 115 GLN CD   C -22.534 -11.810 -10.035 1.00 . A A . 115 GLN CD   1 1 
        5  9507 1 1 115 GLN CG   C -22.408 -13.078  -9.200 1.00 . A A . 115 GLN CG   1 1 
        5  9508 1 1 115 GLN H    H -21.529 -12.596  -5.205 1.00 . A A . 115 GLN H    1 1 
        5  9509 1 1 115 GLN HA   H -22.901 -14.555  -6.961 1.00 . A A . 115 GLN HA   1 1 
        5  9510 1 1 115 GLN HB2  H -22.628 -12.037  -7.317 1.00 . A A . 115 GLN HB2  1 1 
        5  9511 1 1 115 GLN HB3  H -20.946 -12.321  -7.770 1.00 . A A . 115 GLN HB3  1 1 
        5  9512 1 1 115 GLN HE21 H -20.800 -12.172 -10.952 1.00 . A A . 115 GLN HE21 1 1 
        5  9513 1 1 115 GLN HE22 H -21.760 -10.687 -11.456 1.00 . A A . 115 GLN HE22 1 1 
        5  9514 1 1 115 GLN HG2  H -21.731 -13.803  -9.693 1.00 . A A . 115 GLN HG2  1 1 
        5  9515 1 1 115 GLN HG3  H -23.395 -13.575  -9.194 1.00 . A A . 115 GLN HG3  1 1 
        5  9516 1 1 115 GLN N    N -21.824 -13.547  -5.437 1.00 . A A . 115 GLN N    1 1 
        5  9517 1 1 115 GLN NE2  N -21.567 -11.500 -10.863 1.00 . A A . 115 GLN NE2  1 1 
        5  9518 1 1 115 GLN O    O -19.956 -14.886  -8.053 1.00 . A A . 115 GLN O    1 1 
        5  9519 1 1 115 GLN OE1  O -23.522 -11.084  -9.956 1.00 . A A . 115 GLN OE1  1 1 
        5  9520 1 1 116 ARG C    C -20.463 -18.476  -5.681 1.00 . A A . 116 ARG C    1 1 
        5  9521 1 1 116 ARG CA   C -19.863 -17.341  -6.573 1.00 . A A . 116 ARG CA   1 1 
        5  9522 1 1 116 ARG CB   C -18.442 -16.924  -6.110 1.00 . A A . 116 ARG CB   1 1 
        5  9523 1 1 116 ARG CD   C -17.001 -19.099  -6.004 1.00 . A A . 116 ARG CD   1 1 
        5  9524 1 1 116 ARG CG   C -17.281 -17.756  -6.688 1.00 . A A . 116 ARG CG   1 1 
        5  9525 1 1 116 ARG CZ   C -15.133 -20.756  -6.245 1.00 . A A . 116 ARG CZ   1 1 
        5  9526 1 1 116 ARG H    H -21.602 -16.235  -5.771 1.00 . A A . 116 ARG H    1 1 
        5  9527 1 1 116 ARG HA   H -19.831 -17.665  -7.633 1.00 . A A . 116 ARG HA   1 1 
        5  9528 1 1 116 ARG HB2  H -18.248 -15.884  -6.443 1.00 . A A . 116 ARG HB2  1 1 
        5  9529 1 1 116 ARG HB3  H -18.378 -16.859  -5.007 1.00 . A A . 116 ARG HB3  1 1 
        5  9530 1 1 116 ARG HD2  H -16.795 -18.941  -4.924 1.00 . A A . 116 ARG HD2  1 1 
        5  9531 1 1 116 ARG HD3  H -17.876 -19.777  -6.055 1.00 . A A . 116 ARG HD3  1 1 
        5  9532 1 1 116 ARG HE   H -15.463 -19.312  -7.551 1.00 . A A . 116 ARG HE   1 1 
        5  9533 1 1 116 ARG HG2  H -17.432 -17.889  -7.778 1.00 . A A . 116 ARG HG2  1 1 
        5  9534 1 1 116 ARG HG3  H -16.369 -17.126  -6.607 1.00 . A A . 116 ARG HG3  1 1 
        5  9535 1 1 116 ARG HH11 H -16.277 -21.163  -4.615 1.00 . A A . 116 ARG HH11 1 1 
        5  9536 1 1 116 ARG HH12 H -14.799 -22.213  -4.916 1.00 . A A . 116 ARG HH12 1 1 
        5  9537 1 1 116 ARG HH21 H -13.878 -20.588  -7.778 1.00 . A A . 116 ARG HH21 1 1 
        5  9538 1 1 116 ARG HH22 H -13.564 -21.924  -6.587 1.00 . A A . 116 ARG HH22 1 1 
        5  9539 1 1 116 ARG N    N -20.840 -16.226  -6.464 1.00 . A A . 116 ARG N    1 1 
        5  9540 1 1 116 ARG NE   N -15.832 -19.714  -6.686 1.00 . A A . 116 ARG NE   1 1 
        5  9541 1 1 116 ARG NH1  N -15.412 -21.440  -5.166 1.00 . A A . 116 ARG NH1  1 1 
        5  9542 1 1 116 ARG NH2  N -14.095 -21.125  -6.937 1.00 . A A . 116 ARG NH2  1 1 
        5  9543 1 1 116 ARG O    O -20.471 -18.349  -4.451 1.00 . A A . 116 ARG O    1 1 
        5  9544 1 1 117 GLY C    C -21.336 -21.183  -4.318 1.00 . A A . 117 GLY C    1 1 
        5  9545 1 1 117 GLY CA   C -21.842 -20.558  -5.628 1.00 . A A . 117 GLY CA   1 1 
        5  9546 1 1 117 GLY H    H -21.021 -19.413  -7.331 1.00 . A A . 117 GLY H    1 1 
        5  9547 1 1 117 GLY HA2  H -22.835 -20.117  -5.425 1.00 . A A . 117 GLY HA2  1 1 
        5  9548 1 1 117 GLY HA3  H -22.052 -21.377  -6.341 1.00 . A A . 117 GLY HA3  1 1 
        5  9549 1 1 117 GLY N    N -21.000 -19.534  -6.313 1.00 . A A . 117 GLY N    1 1 
        5  9550 1 1 117 GLY O    O -21.886 -20.898  -3.250 1.00 . A A . 117 GLY O    1 1 
        5  9551 1 1 118 ARG C    C -18.435 -21.325  -2.862 1.00 . A A . 118 ARG C    1 1 
        5  9552 1 1 118 ARG CA   C -19.483 -22.415  -3.235 1.00 . A A . 118 ARG CA   1 1 
        5  9553 1 1 118 ARG CB   C -18.864 -23.799  -3.544 1.00 . A A . 118 ARG CB   1 1 
        5  9554 1 1 118 ARG CD   C -17.668 -25.880  -2.573 1.00 . A A . 118 ARG CD   1 1 
        5  9555 1 1 118 ARG CG   C -18.203 -24.462  -2.316 1.00 . A A . 118 ARG CG   1 1 
        5  9556 1 1 118 ARG CZ   C -18.642 -28.171  -2.826 1.00 . A A . 118 ARG CZ   1 1 
        5  9557 1 1 118 ARG H    H -19.890 -22.012  -5.368 1.00 . A A . 118 ARG H    1 1 
        5  9558 1 1 118 ARG HA   H -20.170 -22.543  -2.372 1.00 . A A . 118 ARG HA   1 1 
        5  9559 1 1 118 ARG HB2  H -19.664 -24.464  -3.928 1.00 . A A . 118 ARG HB2  1 1 
        5  9560 1 1 118 ARG HB3  H -18.129 -23.715  -4.367 1.00 . A A . 118 ARG HB3  1 1 
        5  9561 1 1 118 ARG HD2  H -17.038 -25.891  -3.487 1.00 . A A . 118 ARG HD2  1 1 
        5  9562 1 1 118 ARG HD3  H -17.001 -26.153  -1.728 1.00 . A A . 118 ARG HD3  1 1 
        5  9563 1 1 118 ARG HE   H -19.752 -26.534  -2.651 1.00 . A A . 118 ARG HE   1 1 
        5  9564 1 1 118 ARG HG2  H -17.358 -23.826  -1.983 1.00 . A A . 118 ARG HG2  1 1 
        5  9565 1 1 118 ARG HG3  H -18.899 -24.465  -1.454 1.00 . A A . 118 ARG HG3  1 1 
        5  9566 1 1 118 ARG HH11 H -16.679 -28.152  -2.822 1.00 . A A . 118 ARG HH11 1 1 
        5  9567 1 1 118 ARG HH12 H -17.466 -29.792  -3.007 1.00 . A A . 118 ARG HH12 1 1 
        5  9568 1 1 118 ARG HH21 H -20.614 -28.410  -2.850 1.00 . A A . 118 ARG HH21 1 1 
        5  9569 1 1 118 ARG HH22 H -19.595 -29.906  -3.021 1.00 . A A . 118 ARG HH22 1 1 
        5  9570 1 1 118 ARG N    N -20.270 -21.980  -4.419 1.00 . A A . 118 ARG N    1 1 
        5  9571 1 1 118 ARG NE   N -18.781 -26.858  -2.678 1.00 . A A . 118 ARG NE   1 1 
        5  9572 1 1 118 ARG NH1  N -17.483 -28.777  -2.895 1.00 . A A . 118 ARG NH1  1 1 
        5  9573 1 1 118 ARG NH2  N -19.718 -28.897  -2.909 1.00 . A A . 118 ARG NH2  1 1 
        5  9574 1 1 118 ARG O    O -18.576 -20.702  -1.786 1.00 . A A . 118 ARG O    1 1 
        5  9575 1 1 118 ARG OXT  O -17.503 -21.051  -3.650 1.00 . A A . 118 ARG OXT  1 1 
        6  9576 1 1   1 MET C    C  30.396 -16.356   1.462 1.00 . A A .   1 MET C    1 1 
        6  9577 1 1   1 MET CA   C  29.392 -15.702   0.457 1.00 . A A .   1 MET CA   1 1 
        6  9578 1 1   1 MET CB   C  29.062 -16.425  -0.864 1.00 . A A .   1 MET CB   1 1 
        6  9579 1 1   1 MET CE   C  31.601 -15.889  -4.087 1.00 . A A .   1 MET CE   1 1 
        6  9580 1 1   1 MET CG   C  30.181 -16.703  -1.873 1.00 . A A .   1 MET CG   1 1 
        6  9581 1 1   1 MET H1   H  30.758 -14.228  -0.183 1.00 . A A .   1 MET H1   1 1 
        6  9582 1 1   1 MET H2   H  29.190 -13.788  -0.497 1.00 . A A .   1 MET H2   1 1 
        6  9583 1 1   1 MET H3   H  29.807 -13.725   1.043 1.00 . A A .   1 MET H3   1 1 
        6  9584 1 1   1 MET HA   H  28.439 -15.686   1.029 1.00 . A A .   1 MET HA   1 1 
        6  9585 1 1   1 MET HB2  H  28.578 -17.394  -0.622 1.00 . A A .   1 MET HB2  1 1 
        6  9586 1 1   1 MET HB3  H  28.254 -15.869  -1.384 1.00 . A A .   1 MET HB3  1 1 
        6  9587 1 1   1 MET HE1  H  32.099 -15.095  -4.672 1.00 . A A .   1 MET HE1  1 1 
        6  9588 1 1   1 MET HE2  H  32.369 -16.630  -3.799 1.00 . A A .   1 MET HE2  1 1 
        6  9589 1 1   1 MET HE3  H  30.874 -16.391  -4.752 1.00 . A A .   1 MET HE3  1 1 
        6  9590 1 1   1 MET HG2  H  31.038 -17.249  -1.439 1.00 . A A .   1 MET HG2  1 1 
        6  9591 1 1   1 MET HG3  H  29.775 -17.360  -2.669 1.00 . A A .   1 MET HG3  1 1 
        6  9592 1 1   1 MET N    N  29.786 -14.290   0.187 1.00 . A A .   1 MET N    1 1 
        6  9593 1 1   1 MET O    O  30.810 -15.680   2.408 1.00 . A A .   1 MET O    1 1 
        6  9594 1 1   1 MET SD   S  30.784 -15.195  -2.642 1.00 . A A .   1 MET SD   1 1 
        6  9595 1 1   2 ALA C    C  33.244 -17.951   1.615 1.00 . A A .   2 ALA C    1 1 
        6  9596 1 1   2 ALA CA   C  31.814 -18.277   2.137 1.00 . A A .   2 ALA CA   1 1 
        6  9597 1 1   2 ALA CB   C  31.538 -19.789   2.114 1.00 . A A .   2 ALA CB   1 1 
        6  9598 1 1   2 ALA H    H  30.428 -18.091   0.452 1.00 . A A .   2 ALA H    1 1 
        6  9599 1 1   2 ALA HA   H  31.703 -17.946   3.191 1.00 . A A .   2 ALA HA   1 1 
        6  9600 1 1   2 ALA HB1  H  30.529 -20.026   2.499 1.00 . A A .   2 ALA HB1  1 1 
        6  9601 1 1   2 ALA HB2  H  31.615 -20.222   1.099 1.00 . A A .   2 ALA HB2  1 1 
        6  9602 1 1   2 ALA HB3  H  32.253 -20.342   2.750 1.00 . A A .   2 ALA HB3  1 1 
        6  9603 1 1   2 ALA N    N  30.768 -17.634   1.303 1.00 . A A .   2 ALA N    1 1 
        6  9604 1 1   2 ALA O    O  33.580 -18.240   0.461 1.00 . A A .   2 ALA O    1 1 
        6  9605 1 1   3 GLY C    C  35.476 -15.499   1.357 1.00 . A A .   3 GLY C    1 1 
        6  9606 1 1   3 GLY CA   C  35.423 -16.865   2.060 1.00 . A A .   3 GLY CA   1 1 
        6  9607 1 1   3 GLY H    H  33.629 -17.038   3.346 1.00 . A A .   3 GLY H    1 1 
        6  9608 1 1   3 GLY HA2  H  36.047 -16.802   2.971 1.00 . A A .   3 GLY HA2  1 1 
        6  9609 1 1   3 GLY HA3  H  35.924 -17.630   1.435 1.00 . A A .   3 GLY HA3  1 1 
        6  9610 1 1   3 GLY N    N  34.062 -17.305   2.457 1.00 . A A .   3 GLY N    1 1 
        6  9611 1 1   3 GLY O    O  35.921 -14.512   1.945 1.00 . A A .   3 GLY O    1 1 
        6  9612 1 1   4 SER C    C  33.564 -13.422  -0.177 1.00 . A A .   4 SER C    1 1 
        6  9613 1 1   4 SER CA   C  34.836 -14.185  -0.644 1.00 . A A .   4 SER CA   1 1 
        6  9614 1 1   4 SER CB   C  34.791 -14.527  -2.152 1.00 . A A .   4 SER CB   1 1 
        6  9615 1 1   4 SER H    H  34.541 -16.328  -0.174 1.00 . A A .   4 SER H    1 1 
        6  9616 1 1   4 SER HA   H  35.739 -13.554  -0.497 1.00 . A A .   4 SER HA   1 1 
        6  9617 1 1   4 SER HB2  H  35.704 -15.089  -2.433 1.00 . A A .   4 SER HB2  1 1 
        6  9618 1 1   4 SER HB3  H  33.934 -15.187  -2.385 1.00 . A A .   4 SER HB3  1 1 
        6  9619 1 1   4 SER HG   H  34.838 -13.591  -3.856 1.00 . A A .   4 SER HG   1 1 
        6  9620 1 1   4 SER N    N  35.004 -15.454   0.104 1.00 . A A .   4 SER N    1 1 
        6  9621 1 1   4 SER O    O  32.430 -13.836  -0.450 1.00 . A A .   4 SER O    1 1 
        6  9622 1 1   4 SER OG   O  34.713 -13.338  -2.936 1.00 . A A .   4 SER OG   1 1 
        6  9623 1 1   5 GLY C    C  31.712 -10.684   0.429 1.00 . A A .   5 GLY C    1 1 
        6  9624 1 1   5 GLY CA   C  32.676 -11.581   1.235 1.00 . A A .   5 GLY CA   1 1 
        6  9625 1 1   5 GLY H    H  34.759 -12.214   0.821 1.00 . A A .   5 GLY H    1 1 
        6  9626 1 1   5 GLY HA2  H  32.062 -12.294   1.816 1.00 . A A .   5 GLY HA2  1 1 
        6  9627 1 1   5 GLY HA3  H  33.136 -10.938   2.007 1.00 . A A .   5 GLY HA3  1 1 
        6  9628 1 1   5 GLY N    N  33.773 -12.312   0.548 1.00 . A A .   5 GLY N    1 1 
        6  9629 1 1   5 GLY O    O  31.256  -9.663   0.944 1.00 . A A .   5 GLY O    1 1 
        6  9630 1 1   6 ILE C    C  28.851 -11.173  -1.057 1.00 . A A .   6 ILE C    1 1 
        6  9631 1 1   6 ILE CA   C  30.184 -10.540  -1.537 1.00 . A A .   6 ILE CA   1 1 
        6  9632 1 1   6 ILE CB   C  30.450 -10.565  -3.074 1.00 . A A .   6 ILE CB   1 1 
        6  9633 1 1   6 ILE CD1  C  29.150  -8.392  -3.665 1.00 . A A .   6 ILE CD1  1 1 
        6  9634 1 1   6 ILE CG1  C  29.347  -9.884  -3.929 1.00 . A A .   6 ILE CG1  1 1 
        6  9635 1 1   6 ILE CG2  C  30.725 -11.962  -3.659 1.00 . A A .   6 ILE CG2  1 1 
        6  9636 1 1   6 ILE H    H  31.792 -11.992  -1.035 1.00 . A A .   6 ILE H    1 1 
        6  9637 1 1   6 ILE HA   H  30.170  -9.461  -1.313 1.00 . A A .   6 ILE HA   1 1 
        6  9638 1 1   6 ILE HB   H  31.384  -9.980  -3.232 1.00 . A A .   6 ILE HB   1 1 
        6  9639 1 1   6 ILE HD11 H  30.088  -7.817  -3.781 1.00 . A A .   6 ILE HD11 1 1 
        6  9640 1 1   6 ILE HD12 H  28.423  -7.962  -4.379 1.00 . A A .   6 ILE HD12 1 1 
        6  9641 1 1   6 ILE HD13 H  28.756  -8.182  -2.655 1.00 . A A .   6 ILE HD13 1 1 
        6  9642 1 1   6 ILE HG12 H  29.602 -10.001  -5.002 1.00 . A A .   6 ILE HG12 1 1 
        6  9643 1 1   6 ILE HG13 H  28.379 -10.410  -3.810 1.00 . A A .   6 ILE HG13 1 1 
        6  9644 1 1   6 ILE HG21 H  31.047 -11.905  -4.715 1.00 . A A .   6 ILE HG21 1 1 
        6  9645 1 1   6 ILE HG22 H  31.543 -12.445  -3.101 1.00 . A A .   6 ILE HG22 1 1 
        6  9646 1 1   6 ILE HG23 H  29.849 -12.632  -3.613 1.00 . A A .   6 ILE HG23 1 1 
        6  9647 1 1   6 ILE N    N  31.313 -11.127  -0.767 1.00 . A A .   6 ILE N    1 1 
        6  9648 1 1   6 ILE O    O  28.506 -12.311  -1.402 1.00 . A A .   6 ILE O    1 1 
        6  9649 1 1   7 ILE C    C  25.625 -10.666  -0.533 1.00 . A A .   7 ILE C    1 1 
        6  9650 1 1   7 ILE CA   C  26.850 -10.897   0.405 1.00 . A A .   7 ILE CA   1 1 
        6  9651 1 1   7 ILE CB   C  26.731 -10.362   1.869 1.00 . A A .   7 ILE CB   1 1 
        6  9652 1 1   7 ILE CD1  C  25.580 -12.482   2.861 1.00 . A A .   7 ILE CD1  1 1 
        6  9653 1 1   7 ILE CG1  C  25.545 -10.966   2.675 1.00 . A A .   7 ILE CG1  1 1 
        6  9654 1 1   7 ILE CG2  C  26.656  -8.823   2.005 1.00 . A A .   7 ILE CG2  1 1 
        6  9655 1 1   7 ILE H    H  28.668  -9.638   0.169 1.00 . A A .   7 ILE H    1 1 
        6  9656 1 1   7 ILE HA   H  26.933 -11.997   0.533 1.00 . A A .   7 ILE HA   1 1 
        6  9657 1 1   7 ILE HB   H  27.660 -10.675   2.396 1.00 . A A .   7 ILE HB   1 1 
        6  9658 1 1   7 ILE HD11 H  24.771 -12.811   3.537 1.00 . A A .   7 ILE HD11 1 1 
        6  9659 1 1   7 ILE HD12 H  25.437 -13.032   1.913 1.00 . A A .   7 ILE HD12 1 1 
        6  9660 1 1   7 ILE HD13 H  26.530 -12.828   3.309 1.00 . A A .   7 ILE HD13 1 1 
        6  9661 1 1   7 ILE HG12 H  25.532 -10.504   3.683 1.00 . A A .   7 ILE HG12 1 1 
        6  9662 1 1   7 ILE HG13 H  24.582 -10.671   2.214 1.00 . A A .   7 ILE HG13 1 1 
        6  9663 1 1   7 ILE HG21 H  26.690  -8.513   3.066 1.00 . A A .   7 ILE HG21 1 1 
        6  9664 1 1   7 ILE HG22 H  27.501  -8.313   1.509 1.00 . A A .   7 ILE HG22 1 1 
        6  9665 1 1   7 ILE HG23 H  25.731  -8.399   1.573 1.00 . A A .   7 ILE HG23 1 1 
        6  9666 1 1   7 ILE N    N  28.137 -10.436  -0.198 1.00 . A A .   7 ILE N    1 1 
        6  9667 1 1   7 ILE O    O  24.786  -9.786  -0.326 1.00 . A A .   7 ILE O    1 1 
        6  9668 1 1   8 TYR C    C  23.124 -12.273  -1.833 1.00 . A A .   8 TYR C    1 1 
        6  9669 1 1   8 TYR CA   C  24.354 -11.565  -2.475 1.00 . A A .   8 TYR CA   1 1 
        6  9670 1 1   8 TYR CB   C  24.755 -12.124  -3.864 1.00 . A A .   8 TYR CB   1 1 
        6  9671 1 1   8 TYR CD1  C  24.727 -14.687  -3.971 1.00 . A A .   8 TYR CD1  1 1 
        6  9672 1 1   8 TYR CD2  C  26.857 -13.554  -4.023 1.00 . A A .   8 TYR CD2  1 1 
        6  9673 1 1   8 TYR CE1  C  25.382 -15.920  -4.045 1.00 . A A .   8 TYR CE1  1 1 
        6  9674 1 1   8 TYR CE2  C  27.509 -14.785  -4.105 1.00 . A A .   8 TYR CE2  1 1 
        6  9675 1 1   8 TYR CG   C  25.458 -13.488  -3.947 1.00 . A A .   8 TYR CG   1 1 
        6  9676 1 1   8 TYR CZ   C  26.773 -15.968  -4.110 1.00 . A A .   8 TYR CZ   1 1 
        6  9677 1 1   8 TYR H    H  26.345 -12.115  -1.689 1.00 . A A .   8 TYR H    1 1 
        6  9678 1 1   8 TYR HA   H  24.077 -10.510  -2.694 1.00 . A A .   8 TYR HA   1 1 
        6  9679 1 1   8 TYR HB2  H  23.857 -12.143  -4.512 1.00 . A A .   8 TYR HB2  1 1 
        6  9680 1 1   8 TYR HB3  H  25.396 -11.362  -4.353 1.00 . A A .   8 TYR HB3  1 1 
        6  9681 1 1   8 TYR HD1  H  23.645 -14.668  -3.918 1.00 . A A .   8 TYR HD1  1 1 
        6  9682 1 1   8 TYR HD2  H  27.447 -12.647  -4.022 1.00 . A A .   8 TYR HD2  1 1 
        6  9683 1 1   8 TYR HE1  H  24.796 -16.830  -4.050 1.00 . A A .   8 TYR HE1  1 1 
        6  9684 1 1   8 TYR HE2  H  28.587 -14.823  -4.176 1.00 . A A .   8 TYR HE2  1 1 
        6  9685 1 1   8 TYR HH   H  26.771 -17.861  -4.298 1.00 . A A .   8 TYR HH   1 1 
        6  9686 1 1   8 TYR N    N  25.513 -11.530  -1.551 1.00 . A A .   8 TYR N    1 1 
        6  9687 1 1   8 TYR O    O  23.147 -13.473  -1.548 1.00 . A A .   8 TYR O    1 1 
        6  9688 1 1   8 TYR OH   O  27.420 -17.164  -4.176 1.00 . A A .   8 TYR OH   1 1 
        6  9689 1 1   9 LYS C    C  19.619 -11.145  -1.316 1.00 . A A .   9 LYS C    1 1 
        6  9690 1 1   9 LYS CA   C  20.850 -11.988  -0.875 1.00 . A A .   9 LYS CA   1 1 
        6  9691 1 1   9 LYS CB   C  21.029 -12.041   0.669 1.00 . A A .   9 LYS CB   1 1 
        6  9692 1 1   9 LYS CD   C  21.532 -10.859   2.910 1.00 . A A .   9 LYS CD   1 1 
        6  9693 1 1   9 LYS CE   C  20.193 -10.984   3.652 1.00 . A A .   9 LYS CE   1 1 
        6  9694 1 1   9 LYS CG   C  21.384 -10.725   1.383 1.00 . A A .   9 LYS CG   1 1 
        6  9695 1 1   9 LYS H    H  22.187 -10.505  -1.799 1.00 . A A .   9 LYS H    1 1 
        6  9696 1 1   9 LYS HA   H  20.674 -13.040  -1.191 1.00 . A A .   9 LYS HA   1 1 
        6  9697 1 1   9 LYS HB2  H  20.106 -12.480   1.094 1.00 . A A .   9 LYS HB2  1 1 
        6  9698 1 1   9 LYS HB3  H  21.817 -12.793   0.881 1.00 . A A .   9 LYS HB3  1 1 
        6  9699 1 1   9 LYS HD2  H  22.206 -11.709   3.142 1.00 . A A .   9 LYS HD2  1 1 
        6  9700 1 1   9 LYS HD3  H  22.076  -9.958   3.263 1.00 . A A .   9 LYS HD3  1 1 
        6  9701 1 1   9 LYS HE2  H  19.530 -10.130   3.382 1.00 . A A .   9 LYS HE2  1 1 
        6  9702 1 1   9 LYS HE3  H  19.645 -11.890   3.314 1.00 . A A .   9 LYS HE3  1 1 
        6  9703 1 1   9 LYS HG2  H  22.348 -10.350   0.977 1.00 . A A .   9 LYS HG2  1 1 
        6  9704 1 1   9 LYS HG3  H  20.658  -9.926   1.138 1.00 . A A .   9 LYS HG3  1 1 
        6  9705 1 1   9 LYS HZ1  H  19.578 -11.109   5.682 1.00 . A A .   9 LYS HZ1  1 1 
        6  9706 1 1   9 LYS HZ2  H  21.033 -11.819   5.397 1.00 . A A .   9 LYS HZ2  1 1 
        6  9707 1 1   9 LYS HZ3  H  20.920 -10.186   5.464 1.00 . A A .   9 LYS HZ3  1 1 
        6  9708 1 1   9 LYS N    N  22.065 -11.498  -1.571 1.00 . A A .   9 LYS N    1 1 
        6  9709 1 1   9 LYS NZ   N  20.437 -11.027   5.121 1.00 . A A .   9 LYS NZ   1 1 
        6  9710 1 1   9 LYS O    O  19.620  -9.917  -1.184 1.00 . A A .   9 LYS O    1 1 
        6  9711 1 1  10 GLN C    C  16.321 -10.865  -1.206 1.00 . A A .  10 GLN C    1 1 
        6  9712 1 1  10 GLN CA   C  17.366 -11.099  -2.345 1.00 . A A .  10 GLN CA   1 1 
        6  9713 1 1  10 GLN CB   C  16.793 -11.949  -3.510 1.00 . A A .  10 GLN CB   1 1 
        6  9714 1 1  10 GLN CD   C  15.110 -12.101  -5.439 1.00 . A A .  10 GLN CD   1 1 
        6  9715 1 1  10 GLN CG   C  15.626 -11.278  -4.267 1.00 . A A .  10 GLN CG   1 1 
        6  9716 1 1  10 GLN H    H  18.673 -12.820  -1.901 1.00 . A A .  10 GLN H    1 1 
        6  9717 1 1  10 GLN HA   H  17.687 -10.136  -2.789 1.00 . A A .  10 GLN HA   1 1 
        6  9718 1 1  10 GLN HB2  H  17.608 -12.152  -4.237 1.00 . A A .  10 GLN HB2  1 1 
        6  9719 1 1  10 GLN HB3  H  16.476 -12.942  -3.132 1.00 . A A .  10 GLN HB3  1 1 
        6  9720 1 1  10 GLN HE21 H  13.900 -13.156  -4.249 1.00 . A A .  10 GLN HE21 1 1 
        6  9721 1 1  10 GLN HE22 H  13.907 -13.527  -6.053 1.00 . A A .  10 GLN HE22 1 1 
        6  9722 1 1  10 GLN HG2  H  14.789 -11.040  -3.582 1.00 . A A .  10 GLN HG2  1 1 
        6  9723 1 1  10 GLN HG3  H  15.951 -10.298  -4.665 1.00 . A A .  10 GLN HG3  1 1 
        6  9724 1 1  10 GLN N    N  18.575 -11.802  -1.841 1.00 . A A .  10 GLN N    1 1 
        6  9725 1 1  10 GLN NE2  N  14.177 -12.997  -5.220 1.00 . A A .  10 GLN NE2  1 1 
        6  9726 1 1  10 GLN O    O  15.827 -11.862  -0.664 1.00 . A A .  10 GLN O    1 1 
        6  9727 1 1  10 GLN OE1  O  15.539 -11.945  -6.577 1.00 . A A .  10 GLN OE1  1 1 
        6  9728 1 1  11 PRO C    C  13.422  -9.593  -0.283 1.00 . A A .  11 PRO C    1 1 
        6  9729 1 1  11 PRO CA   C  14.874  -9.401   0.229 1.00 . A A .  11 PRO CA   1 1 
        6  9730 1 1  11 PRO CB   C  15.218  -7.960   0.694 1.00 . A A .  11 PRO CB   1 1 
        6  9731 1 1  11 PRO CD   C  16.507  -8.357  -1.327 1.00 . A A .  11 PRO CD   1 1 
        6  9732 1 1  11 PRO CG   C  15.731  -7.256  -0.583 1.00 . A A .  11 PRO CG   1 1 
        6  9733 1 1  11 PRO HA   H  15.052 -10.087   1.082 1.00 . A A .  11 PRO HA   1 1 
        6  9734 1 1  11 PRO HB2  H  14.366  -7.432   1.160 1.00 . A A .  11 PRO HB2  1 1 
        6  9735 1 1  11 PRO HB3  H  16.025  -8.006   1.451 1.00 . A A .  11 PRO HB3  1 1 
        6  9736 1 1  11 PRO HD2  H  16.403  -8.251  -2.423 1.00 . A A .  11 PRO HD2  1 1 
        6  9737 1 1  11 PRO HD3  H  17.586  -8.319  -1.079 1.00 . A A .  11 PRO HD3  1 1 
        6  9738 1 1  11 PRO HG2  H  14.869  -6.920  -1.193 1.00 . A A .  11 PRO HG2  1 1 
        6  9739 1 1  11 PRO HG3  H  16.349  -6.367  -0.365 1.00 . A A .  11 PRO HG3  1 1 
        6  9740 1 1  11 PRO N    N  15.910  -9.619  -0.835 1.00 . A A .  11 PRO N    1 1 
        6  9741 1 1  11 PRO O    O  12.693  -8.637  -0.565 1.00 . A A .  11 PRO O    1 1 
        6  9742 1 1  12 ILE C    C  10.530 -11.235   0.058 1.00 . A A .  12 ILE C    1 1 
        6  9743 1 1  12 ILE CA   C  11.683 -11.235  -0.988 1.00 . A A .  12 ILE CA   1 1 
        6  9744 1 1  12 ILE CB   C  11.853 -12.513  -1.870 1.00 . A A .  12 ILE CB   1 1 
        6  9745 1 1  12 ILE CD1  C  10.273 -11.812  -3.815 1.00 . A A .  12 ILE CD1  1 1 
        6  9746 1 1  12 ILE CG1  C  10.620 -12.854  -2.751 1.00 . A A .  12 ILE CG1  1 1 
        6  9747 1 1  12 ILE CG2  C  12.261 -13.792  -1.102 1.00 . A A .  12 ILE CG2  1 1 
        6  9748 1 1  12 ILE H    H  13.772 -11.542  -0.292 1.00 . A A .  12 ILE H    1 1 
        6  9749 1 1  12 ILE HA   H  11.424 -10.439  -1.718 1.00 . A A .  12 ILE HA   1 1 
        6  9750 1 1  12 ILE HB   H  12.686 -12.290  -2.571 1.00 . A A .  12 ILE HB   1 1 
        6  9751 1 1  12 ILE HD11 H  11.129 -11.586  -4.477 1.00 . A A .  12 ILE HD11 1 1 
        6  9752 1 1  12 ILE HD12 H   9.454 -12.175  -4.463 1.00 . A A .  12 ILE HD12 1 1 
        6  9753 1 1  12 ILE HD13 H   9.926 -10.856  -3.384 1.00 . A A .  12 ILE HD13 1 1 
        6  9754 1 1  12 ILE HG12 H  10.806 -13.813  -3.276 1.00 . A A .  12 ILE HG12 1 1 
        6  9755 1 1  12 ILE HG13 H   9.731 -13.049  -2.119 1.00 . A A .  12 ILE HG13 1 1 
        6  9756 1 1  12 ILE HG21 H  12.472 -14.627  -1.796 1.00 . A A .  12 ILE HG21 1 1 
        6  9757 1 1  12 ILE HG22 H  13.178 -13.650  -0.503 1.00 . A A .  12 ILE HG22 1 1 
        6  9758 1 1  12 ILE HG23 H  11.476 -14.141  -0.407 1.00 . A A .  12 ILE HG23 1 1 
        6  9759 1 1  12 ILE N    N  13.007 -10.864  -0.397 1.00 . A A .  12 ILE N    1 1 
        6  9760 1 1  12 ILE O    O   9.971 -12.270   0.433 1.00 . A A .  12 ILE O    1 1 
        6  9761 1 1  13 TYR C    C   8.458  -8.349   1.111 1.00 . A A .  13 TYR C    1 1 
        6  9762 1 1  13 TYR CA   C   8.979  -9.792   1.362 1.00 . A A .  13 TYR CA   1 1 
        6  9763 1 1  13 TYR CB   C   9.326 -10.063   2.847 1.00 . A A .  13 TYR CB   1 1 
        6  9764 1 1  13 TYR CD1  C   7.064 -10.950   3.691 1.00 . A A .  13 TYR CD1  1 1 
        6  9765 1 1  13 TYR CD2  C   8.040  -9.046   4.808 1.00 . A A .  13 TYR CD2  1 1 
        6  9766 1 1  13 TYR CE1  C   5.962 -10.890   4.548 1.00 . A A .  13 TYR CE1  1 1 
        6  9767 1 1  13 TYR CE2  C   6.941  -8.993   5.669 1.00 . A A .  13 TYR CE2  1 1 
        6  9768 1 1  13 TYR CG   C   8.116 -10.022   3.804 1.00 . A A .  13 TYR CG   1 1 
        6  9769 1 1  13 TYR CZ   C   5.902  -9.913   5.538 1.00 . A A .  13 TYR CZ   1 1 
        6  9770 1 1  13 TYR H    H  10.723  -9.255   0.127 1.00 . A A .  13 TYR H    1 1 
        6  9771 1 1  13 TYR HA   H   8.195 -10.508   1.055 1.00 . A A .  13 TYR HA   1 1 
        6  9772 1 1  13 TYR HB2  H   9.787 -11.067   2.935 1.00 . A A .  13 TYR HB2  1 1 
        6  9773 1 1  13 TYR HB3  H  10.118  -9.364   3.181 1.00 . A A .  13 TYR HB3  1 1 
        6  9774 1 1  13 TYR HD1  H   7.091 -11.716   2.924 1.00 . A A .  13 TYR HD1  1 1 
        6  9775 1 1  13 TYR HD2  H   8.835  -8.319   4.927 1.00 . A A .  13 TYR HD2  1 1 
        6  9776 1 1  13 TYR HE1  H   5.155 -11.603   4.436 1.00 . A A .  13 TYR HE1  1 1 
        6  9777 1 1  13 TYR HE2  H   6.896  -8.238   6.443 1.00 . A A .  13 TYR HE2  1 1 
        6  9778 1 1  13 TYR HH   H   4.011 -10.217   5.962 1.00 . A A .  13 TYR HH   1 1 
        6  9779 1 1  13 TYR N    N  10.152 -10.027   0.494 1.00 . A A .  13 TYR N    1 1 
        6  9780 1 1  13 TYR O    O   9.217  -7.373   1.131 1.00 . A A .  13 TYR O    1 1 
        6  9781 1 1  13 TYR OH   O   4.838  -9.849   6.389 1.00 . A A .  13 TYR OH   1 1 
        6  9782 1 1  14 GLN C    C   6.562  -5.801   1.812 1.00 . A A .  14 GLN C    1 1 
        6  9783 1 1  14 GLN CA   C   6.480  -6.902   0.704 1.00 . A A .  14 GLN CA   1 1 
        6  9784 1 1  14 GLN CB   C   5.049  -7.133   0.177 1.00 . A A .  14 GLN CB   1 1 
        6  9785 1 1  14 GLN CD   C   4.006  -8.442   2.195 1.00 . A A .  14 GLN CD   1 1 
        6  9786 1 1  14 GLN CG   C   3.908  -7.331   1.179 1.00 . A A .  14 GLN CG   1 1 
        6  9787 1 1  14 GLN H    H   6.632  -9.110   0.884 1.00 . A A .  14 GLN H    1 1 
        6  9788 1 1  14 GLN HA   H   7.011  -6.470  -0.166 1.00 . A A .  14 GLN HA   1 1 
        6  9789 1 1  14 GLN HB2  H   4.769  -6.251  -0.436 1.00 . A A .  14 GLN HB2  1 1 
        6  9790 1 1  14 GLN HB3  H   5.067  -7.960  -0.554 1.00 . A A .  14 GLN HB3  1 1 
        6  9791 1 1  14 GLN HE21 H   3.756  -9.799   0.791 1.00 . A A .  14 GLN HE21 1 1 
        6  9792 1 1  14 GLN HE22 H   3.670 -10.346   2.537 1.00 . A A .  14 GLN HE22 1 1 
        6  9793 1 1  14 GLN HG2  H   3.772  -6.391   1.740 1.00 . A A .  14 GLN HG2  1 1 
        6  9794 1 1  14 GLN HG3  H   2.964  -7.431   0.615 1.00 . A A .  14 GLN HG3  1 1 
        6  9795 1 1  14 GLN N    N   7.138  -8.220   0.934 1.00 . A A .  14 GLN N    1 1 
        6  9796 1 1  14 GLN NE2  N   3.964  -9.685   1.786 1.00 . A A .  14 GLN NE2  1 1 
        6  9797 1 1  14 GLN O    O   6.269  -4.643   1.518 1.00 . A A .  14 GLN O    1 1 
        6  9798 1 1  14 GLN OE1  O   4.053  -8.192   3.394 1.00 . A A .  14 GLN OE1  1 1 
        6  9799 1 1  15 GLY C    C   8.591  -4.082   3.551 1.00 . A A .  15 GLY C    1 1 
        6  9800 1 1  15 GLY CA   C   7.562  -5.146   3.997 1.00 . A A .  15 GLY CA   1 1 
        6  9801 1 1  15 GLY H    H   7.205  -7.148   3.079 1.00 . A A .  15 GLY H    1 1 
        6  9802 1 1  15 GLY HA2  H   6.713  -4.600   4.438 1.00 . A A .  15 GLY HA2  1 1 
        6  9803 1 1  15 GLY HA3  H   8.021  -5.695   4.837 1.00 . A A .  15 GLY HA3  1 1 
        6  9804 1 1  15 GLY N    N   7.030  -6.136   3.026 1.00 . A A .  15 GLY N    1 1 
        6  9805 1 1  15 GLY O    O   8.623  -3.003   4.141 1.00 . A A .  15 GLY O    1 1 
        6  9806 1 1  16 ASN C    C   9.331  -2.175   1.118 1.00 . A A .  16 ASN C    1 1 
        6  9807 1 1  16 ASN CA   C  10.170  -3.326   1.794 1.00 . A A .  16 ASN CA   1 1 
        6  9808 1 1  16 ASN CB   C  11.093  -4.006   0.747 1.00 . A A .  16 ASN CB   1 1 
        6  9809 1 1  16 ASN CG   C  12.252  -4.802   1.335 1.00 . A A .  16 ASN CG   1 1 
        6  9810 1 1  16 ASN H    H   9.311  -5.330   2.188 1.00 . A A .  16 ASN H    1 1 
        6  9811 1 1  16 ASN HA   H  10.810  -2.821   2.541 1.00 . A A .  16 ASN HA   1 1 
        6  9812 1 1  16 ASN HB2  H  10.503  -4.683   0.100 1.00 . A A .  16 ASN HB2  1 1 
        6  9813 1 1  16 ASN HB3  H  11.498  -3.249   0.046 1.00 . A A .  16 ASN HB3  1 1 
        6  9814 1 1  16 ASN HD21 H  13.435  -3.189   1.328 1.00 . A A .  16 ASN HD21 1 1 
        6  9815 1 1  16 ASN HD22 H  14.110  -4.777   1.973 1.00 . A A .  16 ASN HD22 1 1 
        6  9816 1 1  16 ASN N    N   9.390  -4.361   2.517 1.00 . A A .  16 ASN N    1 1 
        6  9817 1 1  16 ASN ND2  N  13.394  -4.189   1.539 1.00 . A A .  16 ASN ND2  1 1 
        6  9818 1 1  16 ASN O    O   9.746  -1.019   1.218 1.00 . A A .  16 ASN O    1 1 
        6  9819 1 1  16 ASN OD1  O  12.149  -5.988   1.625 1.00 . A A .  16 ASN OD1  1 1 
        6  9820 1 1  17 LEU C    C   5.921  -1.406   0.406 1.00 . A A .  17 LEU C    1 1 
        6  9821 1 1  17 LEU CA   C   7.340  -1.482  -0.221 1.00 . A A .  17 LEU CA   1 1 
        6  9822 1 1  17 LEU CB   C   7.480  -1.625  -1.749 1.00 . A A .  17 LEU CB   1 1 
        6  9823 1 1  17 LEU CD1  C   7.391  -2.654  -4.013 1.00 . A A .  17 LEU CD1  1 1 
        6  9824 1 1  17 LEU CD2  C   7.119  -4.179  -2.067 1.00 . A A .  17 LEU CD2  1 1 
        6  9825 1 1  17 LEU CG   C   6.848  -2.763  -2.568 1.00 . A A .  17 LEU CG   1 1 
        6  9826 1 1  17 LEU H    H   8.013  -3.482   0.353 1.00 . A A .  17 LEU H    1 1 
        6  9827 1 1  17 LEU HA   H   7.764  -0.471  -0.031 1.00 . A A .  17 LEU HA   1 1 
        6  9828 1 1  17 LEU HB2  H   7.092  -0.687  -2.181 1.00 . A A .  17 LEU HB2  1 1 
        6  9829 1 1  17 LEU HB3  H   8.569  -1.580  -1.963 1.00 . A A .  17 LEU HB3  1 1 
        6  9830 1 1  17 LEU HD11 H   7.213  -1.652  -4.446 1.00 . A A .  17 LEU HD11 1 1 
        6  9831 1 1  17 LEU HD12 H   8.481  -2.839  -4.044 1.00 . A A .  17 LEU HD12 1 1 
        6  9832 1 1  17 LEU HD13 H   6.912  -3.386  -4.689 1.00 . A A .  17 LEU HD13 1 1 
        6  9833 1 1  17 LEU HD21 H   8.199  -4.402  -1.986 1.00 . A A .  17 LEU HD21 1 1 
        6  9834 1 1  17 LEU HD22 H   6.673  -4.361  -1.075 1.00 . A A .  17 LEU HD22 1 1 
        6  9835 1 1  17 LEU HD23 H   6.680  -4.934  -2.745 1.00 . A A .  17 LEU HD23 1 1 
        6  9836 1 1  17 LEU HG   H   5.752  -2.606  -2.627 1.00 . A A .  17 LEU HG   1 1 
        6  9837 1 1  17 LEU N    N   8.208  -2.484   0.445 1.00 . A A .  17 LEU N    1 1 
        6  9838 1 1  17 LEU O    O   5.698  -0.549   1.264 1.00 . A A .  17 LEU O    1 1 
        6  9839 1 1  18 ILE C    C   3.115  -3.184   1.443 1.00 . A A .  18 ILE C    1 1 
        6  9840 1 1  18 ILE CA   C   3.531  -2.127   0.385 1.00 . A A .  18 ILE CA   1 1 
        6  9841 1 1  18 ILE CB   C   2.661  -2.109  -0.930 1.00 . A A .  18 ILE CB   1 1 
        6  9842 1 1  18 ILE CD1  C   1.988   0.396  -0.798 1.00 . A A .  18 ILE CD1  1 1 
        6  9843 1 1  18 ILE CG1  C   2.737  -0.688  -1.570 1.00 . A A .  18 ILE CG1  1 1 
        6  9844 1 1  18 ILE CG2  C   1.177  -2.521  -0.803 1.00 . A A .  18 ILE CG2  1 1 
        6  9845 1 1  18 ILE H    H   5.242  -2.820  -0.815 1.00 . A A .  18 ILE H    1 1 
        6  9846 1 1  18 ILE HA   H   3.392  -1.119   0.843 1.00 . A A .  18 ILE HA   1 1 
        6  9847 1 1  18 ILE HB   H   3.104  -2.817  -1.664 1.00 . A A .  18 ILE HB   1 1 
        6  9848 1 1  18 ILE HD11 H   0.921   0.406  -1.069 1.00 . A A .  18 ILE HD11 1 1 
        6  9849 1 1  18 ILE HD12 H   1.989   0.274   0.292 1.00 . A A .  18 ILE HD12 1 1 
        6  9850 1 1  18 ILE HD13 H   2.414   1.389  -0.985 1.00 . A A .  18 ILE HD13 1 1 
        6  9851 1 1  18 ILE HG12 H   3.799  -0.394  -1.687 1.00 . A A .  18 ILE HG12 1 1 
        6  9852 1 1  18 ILE HG13 H   2.356  -0.735  -2.605 1.00 . A A .  18 ILE HG13 1 1 
        6  9853 1 1  18 ILE HG21 H   1.056  -3.595  -0.579 1.00 . A A .  18 ILE HG21 1 1 
        6  9854 1 1  18 ILE HG22 H   0.652  -1.962  -0.006 1.00 . A A .  18 ILE HG22 1 1 
        6  9855 1 1  18 ILE HG23 H   0.627  -2.339  -1.745 1.00 . A A .  18 ILE HG23 1 1 
        6  9856 1 1  18 ILE N    N   4.965  -2.258  -0.007 1.00 . A A .  18 ILE N    1 1 
        6  9857 1 1  18 ILE O    O   2.715  -4.306   1.128 1.00 . A A .  18 ILE O    1 1 
        6  9858 1 1  19 LYS C    C   1.848  -2.098   4.722 1.00 . A A .  19 LYS C    1 1 
        6  9859 1 1  19 LYS CA   C   2.128  -3.259   3.719 1.00 . A A .  19 LYS CA   1 1 
        6  9860 1 1  19 LYS CB   C   2.577  -4.582   4.393 1.00 . A A .  19 LYS CB   1 1 
        6  9861 1 1  19 LYS CD   C   4.374  -5.821   5.823 1.00 . A A .  19 LYS CD   1 1 
        6  9862 1 1  19 LYS CE   C   3.495  -6.796   6.620 1.00 . A A .  19 LYS CE   1 1 
        6  9863 1 1  19 LYS CG   C   3.759  -4.495   5.363 1.00 . A A .  19 LYS CG   1 1 
        6  9864 1 1  19 LYS H    H   3.574  -1.858   2.840 1.00 . A A .  19 LYS H    1 1 
        6  9865 1 1  19 LYS HA   H   1.177  -3.484   3.190 1.00 . A A .  19 LYS HA   1 1 
        6  9866 1 1  19 LYS HB2  H   1.695  -5.002   4.914 1.00 . A A .  19 LYS HB2  1 1 
        6  9867 1 1  19 LYS HB3  H   2.797  -5.311   3.588 1.00 . A A .  19 LYS HB3  1 1 
        6  9868 1 1  19 LYS HD2  H   4.850  -6.334   4.963 1.00 . A A .  19 LYS HD2  1 1 
        6  9869 1 1  19 LYS HD3  H   5.242  -5.554   6.462 1.00 . A A .  19 LYS HD3  1 1 
        6  9870 1 1  19 LYS HE2  H   4.168  -7.448   7.222 1.00 . A A .  19 LYS HE2  1 1 
        6  9871 1 1  19 LYS HE3  H   2.861  -6.271   7.364 1.00 . A A .  19 LYS HE3  1 1 
        6  9872 1 1  19 LYS HG2  H   4.566  -3.915   4.871 1.00 . A A .  19 LYS HG2  1 1 
        6  9873 1 1  19 LYS HG3  H   3.482  -3.885   6.243 1.00 . A A .  19 LYS HG3  1 1 
        6  9874 1 1  19 LYS HZ1  H   3.164  -7.737   4.771 1.00 . A A .  19 LYS HZ1  1 1 
        6  9875 1 1  19 LYS HZ2  H   2.615  -8.660   5.944 1.00 . A A .  19 LYS HZ2  1 1 
        6  9876 1 1  19 LYS HZ3  H   1.718  -7.337   5.506 1.00 . A A .  19 LYS HZ3  1 1 
        6  9877 1 1  19 LYS N    N   3.096  -2.756   2.707 1.00 . A A .  19 LYS N    1 1 
        6  9878 1 1  19 LYS NZ   N   2.695  -7.642   5.698 1.00 . A A .  19 LYS NZ   1 1 
        6  9879 1 1  19 LYS O    O   2.788  -1.432   5.160 1.00 . A A .  19 LYS O    1 1 
        6  9880 1 1  20 GLN C    C   0.981  -0.509   7.336 1.00 . A A .  20 GLN C    1 1 
        6  9881 1 1  20 GLN CA   C   0.211  -0.701   5.992 1.00 . A A .  20 GLN CA   1 1 
        6  9882 1 1  20 GLN CB   C  -1.320  -0.762   6.167 1.00 . A A .  20 GLN CB   1 1 
        6  9883 1 1  20 GLN CD   C  -3.516   0.294   6.862 1.00 . A A .  20 GLN CD   1 1 
        6  9884 1 1  20 GLN CG   C  -1.995   0.453   6.839 1.00 . A A .  20 GLN CG   1 1 
        6  9885 1 1  20 GLN H    H  -0.114  -2.339   4.520 1.00 . A A .  20 GLN H    1 1 
        6  9886 1 1  20 GLN HA   H   0.425   0.210   5.395 1.00 . A A .  20 GLN HA   1 1 
        6  9887 1 1  20 GLN HB2  H  -1.767  -0.846   5.157 1.00 . A A .  20 GLN HB2  1 1 
        6  9888 1 1  20 GLN HB3  H  -1.600  -1.692   6.702 1.00 . A A .  20 GLN HB3  1 1 
        6  9889 1 1  20 GLN HE21 H  -3.702   1.685   5.457 1.00 . A A .  20 GLN HE21 1 1 
        6  9890 1 1  20 GLN HE22 H  -5.162   0.666   5.841 1.00 . A A .  20 GLN HE22 1 1 
        6  9891 1 1  20 GLN HG2  H  -1.646   0.581   7.879 1.00 . A A .  20 GLN HG2  1 1 
        6  9892 1 1  20 GLN HG3  H  -1.700   1.389   6.325 1.00 . A A .  20 GLN HG3  1 1 
        6  9893 1 1  20 GLN N    N   0.588  -1.866   5.113 1.00 . A A .  20 GLN N    1 1 
        6  9894 1 1  20 GLN NE2  N  -4.226   1.034   6.049 1.00 . A A .  20 GLN NE2  1 1 
        6  9895 1 1  20 GLN O    O   1.204   0.640   7.720 1.00 . A A .  20 GLN O    1 1 
        6  9896 1 1  20 GLN OE1  O  -4.073  -0.534   7.580 1.00 . A A .  20 GLN OE1  1 1 
        6  9897 1 1  21 ASN C    C   3.834  -0.873   8.621 1.00 . A A .  21 ASN C    1 1 
        6  9898 1 1  21 ASN CA   C   2.463  -1.473   9.084 1.00 . A A .  21 ASN CA   1 1 
        6  9899 1 1  21 ASN CB   C   2.607  -2.864   9.746 1.00 . A A .  21 ASN CB   1 1 
        6  9900 1 1  21 ASN CG   C   3.407  -2.873  11.045 1.00 . A A .  21 ASN CG   1 1 
        6  9901 1 1  21 ASN H    H   1.199  -2.473   7.555 1.00 . A A .  21 ASN H    1 1 
        6  9902 1 1  21 ASN HA   H   2.061  -0.761   9.837 1.00 . A A .  21 ASN HA   1 1 
        6  9903 1 1  21 ASN HB2  H   1.606  -3.260   9.997 1.00 . A A .  21 ASN HB2  1 1 
        6  9904 1 1  21 ASN HB3  H   3.019  -3.599   9.030 1.00 . A A .  21 ASN HB3  1 1 
        6  9905 1 1  21