NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
447483 2kpw 16572 cing 4-filtered-FRED STAR entry full 1903


data_FRED_restraints_with_modified_coordinates_PDB_code_2kpw

# This FRED archive file contains, for PDB entry <2kpw>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, W Vranken, C Penkett, J Lin, CF Schulte, G Vuister, G Vriend,
# JL Markley, EL Ulrich. BioMagResBank database `NMR Restraints Grid` with
# curated sets of experimental NMR restraints for over 4,000 protein and nucleic
# acid PDB entries. (in preparation)




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.Sf_category          entry_information
    _Entry.ID                   1
    _Entry.Title                "Data for entry 1"
    _Entry.NMR_STAR_version     3.1.0.8
    _Entry.Experimental_method  NMR
    _Entry.Details              .

save_


save_assembly_2kpw
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2kpw
    _Assembly.Number_of_components  1
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "all free"
    _Assembly.Molecular_mass        13659.21

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $Lamin_B1 A . 1 1 
    stop_

save_


save_Lamin_B1
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "Lamin B1"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  MGHHHHHHSHMTGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTT
    _Entity.Number_of_monomers           122

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

         1 MET . 1 1 
         2 GLY . 1 1 
         3 HIS . 1 1 
         4 HIS . 1 1 
         5 HIS . 1 1 
         6 HIS . 1 1 
         7 HIS . 1 1 
         8 HIS . 1 1 
         9 SER . 1 1 
        10 HIS . 1 1 
        11 MET . 1 1 
        12 THR . 1 1 
        13 GLY . 1 1 
        14 ASN . 1 1 
        15 VAL . 1 1 
        16 CYS . 1 1 
        17 ILE . 1 1 
        18 GLU . 1 1 
        19 GLU . 1 1 
        20 ILE . 1 1 
        21 ASP . 1 1 
        22 VAL . 1 1 
        23 ASP . 1 1 
        24 GLY . 1 1 
        25 LYS . 1 1 
        26 PHE . 1 1 
        27 ILE . 1 1 
        28 ARG . 1 1 
        29 LEU . 1 1 
        30 LYS . 1 1 
        31 ASN . 1 1 
        32 THR . 1 1 
        33 SER . 1 1 
        34 GLU . 1 1 
        35 GLN . 1 1 
        36 ASP . 1 1 
        37 GLN . 1 1 
        38 PRO . 1 1 
        39 MET . 1 1 
        40 GLY . 1 1 
        41 GLY . 1 1 
        42 TRP . 1 1 
        43 GLU . 1 1 
        44 MET . 1 1 
        45 ILE . 1 1 
        46 ARG . 1 1 
        47 LYS . 1 1 
        48 ILE . 1 1 
        49 GLY . 1 1 
        50 ASP . 1 1 
        51 THR . 1 1 
        52 SER . 1 1 
        53 VAL . 1 1 
        54 SER . 1 1 
        55 TYR . 1 1 
        56 LYS . 1 1 
        57 TYR . 1 1 
        58 THR . 1 1 
        59 SER . 1 1 
        60 ARG . 1 1 
        61 TYR . 1 1 
        62 VAL . 1 1 
        63 LEU . 1 1 
        64 LYS . 1 1 
        65 ALA . 1 1 
        66 GLY . 1 1 
        67 GLN . 1 1 
        68 THR . 1 1 
        69 VAL . 1 1 
        70 THR . 1 1 
        71 ILE . 1 1 
        72 TRP . 1 1 
        73 ALA . 1 1 
        74 ALA . 1 1 
        75 ASN . 1 1 
        76 ALA . 1 1 
        77 GLY . 1 1 
        78 VAL . 1 1 
        79 THR . 1 1 
        80 ALA . 1 1 
        81 SER . 1 1 
        82 PRO . 1 1 
        83 PRO . 1 1 
        84 THR . 1 1 
        85 ASP . 1 1 
        86 LEU . 1 1 
        87 ILE . 1 1 
        88 TRP . 1 1 
        89 LYS . 1 1 
        90 ASN . 1 1 
        91 GLN . 1 1 
        92 ASN . 1 1 
        93 SER . 1 1 
        94 TRP . 1 1 
        95 GLY . 1 1 
        96 THR . 1 1 
        97 GLY . 1 1 
        98 GLU . 1 1 
        99 ASP . 1 1 
       100 VAL . 1 1 
       101 LYS . 1 1 
       102 VAL . 1 1 
       103 ILE . 1 1 
       104 LEU . 1 1 
       105 LYS . 1 1 
       106 ASN . 1 1 
       107 SER . 1 1 
       108 GLN . 1 1 
       109 GLY . 1 1 
       110 GLU . 1 1 
       111 GLU . 1 1 
       112 VAL . 1 1 
       113 ALA . 1 1 
       114 GLN . 1 1 
       115 ARG . 1 1 
       116 SER . 1 1 
       117 THR . 1 1 
       118 VAL . 1 1 
       119 PHE . 1 1 
       120 LYS . 1 1 
       121 THR . 1 1 
       122 THR . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       MET   1   1 1 1 
       GLY   2   2 1 1 
       HIS   3   3 1 1 
       HIS   4   4 1 1 
       HIS   5   5 1 1 
       HIS   6   6 1 1 
       HIS   7   7 1 1 
       HIS   8   8 1 1 
       SER   9   9 1 1 
       HIS  10  10 1 1 
       MET  11  11 1 1 
       THR  12  12 1 1 
       GLY  13  13 1 1 
       ASN  14  14 1 1 
       VAL  15  15 1 1 
       CYS  16  16 1 1 
       ILE  17  17 1 1 
       GLU  18  18 1 1 
       GLU  19  19 1 1 
       ILE  20  20 1 1 
       ASP  21  21 1 1 
       VAL  22  22 1 1 
       ASP  23  23 1 1 
       GLY  24  24 1 1 
       LYS  25  25 1 1 
       PHE  26  26 1 1 
       ILE  27  27 1 1 
       ARG  28  28 1 1 
       LEU  29  29 1 1 
       LYS  30  30 1 1 
       ASN  31  31 1 1 
       THR  32  32 1 1 
       SER  33  33 1 1 
       GLU  34  34 1 1 
       GLN  35  35 1 1 
       ASP  36  36 1 1 
       GLN  37  37 1 1 
       PRO  38  38 1 1 
       MET  39  39 1 1 
       GLY  40  40 1 1 
       GLY  41  41 1 1 
       TRP  42  42 1 1 
       GLU  43  43 1 1 
       MET  44  44 1 1 
       ILE  45  45 1 1 
       ARG  46  46 1 1 
       LYS  47  47 1 1 
       ILE  48  48 1 1 
       GLY  49  49 1 1 
       ASP  50  50 1 1 
       THR  51  51 1 1 
       SER  52  52 1 1 
       VAL  53  53 1 1 
       SER  54  54 1 1 
       TYR  55  55 1 1 
       LYS  56  56 1 1 
       TYR  57  57 1 1 
       THR  58  58 1 1 
       SER  59  59 1 1 
       ARG  60  60 1 1 
       TYR  61  61 1 1 
       VAL  62  62 1 1 
       LEU  63  63 1 1 
       LYS  64  64 1 1 
       ALA  65  65 1 1 
       GLY  66  66 1 1 
       GLN  67  67 1 1 
       THR  68  68 1 1 
       VAL  69  69 1 1 
       THR  70  70 1 1 
       ILE  71  71 1 1 
       TRP  72  72 1 1 
       ALA  73  73 1 1 
       ALA  74  74 1 1 
       ASN  75  75 1 1 
       ALA  76  76 1 1 
       GLY  77  77 1 1 
       VAL  78  78 1 1 
       THR  79  79 1 1 
       ALA  80  80 1 1 
       SER  81  81 1 1 
       PRO  82  82 1 1 
       PRO  83  83 1 1 
       THR  84  84 1 1 
       ASP  85  85 1 1 
       LEU  86  86 1 1 
       ILE  87  87 1 1 
       TRP  88  88 1 1 
       LYS  89  89 1 1 
       ASN  90  90 1 1 
       GLN  91  91 1 1 
       ASN  92  92 1 1 
       SER  93  93 1 1 
       TRP  94  94 1 1 
       GLY  95  95 1 1 
       THR  96  96 1 1 
       GLY  97  97 1 1 
       GLU  98  98 1 1 
       ASP  99  99 1 1 
       VAL 100 100 1 1 
       LYS 101 101 1 1 
       VAL 102 102 1 1 
       ILE 103 103 1 1 
       LEU 104 104 1 1 
       LYS 105 105 1 1 
       ASN 106 106 1 1 
       SER 107 107 1 1 
       GLN 108 108 1 1 
       GLY 109 109 1 1 
       GLU 110 110 1 1 
       GLU 111 111 1 1 
       VAL 112 112 1 1 
       ALA 113 113 1 1 
       GLN 114 114 1 1 
       ARG 115 115 1 1 
       SER 116 116 1 1 
       THR 117 117 1 1 
       VAL 118 118 1 1 
       PHE 119 119 1 1 
       LYS 120 120 1 1 
       THR 121 121 1 1 
       THR 122 122 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_2_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

          1 1 . . . 1 1 
          2 1 . . . 1 1 
          3 1 . . . 1 1 
          4 1 . . . 1 1 
          5 1 . . . 1 1 
          6 1 . . . 1 1 
          7 1 . . . 1 1 
          8 1 . . . 1 1 
          9 1 . . . 1 1 
         10 1 . . . 1 1 
         11 1 . . . 1 1 
         12 1 . . . 1 1 
         13 1 . . . 1 1 
         14 1 . . . 1 1 
         15 1 . . . 1 1 
         16 1 . . . 1 1 
         17 1 . . . 1 1 
         18 1 . . . 1 1 
         19 1 . . . 1 1 
         20 1 . . . 1 1 
         21 1 . . . 1 1 
         22 1 . . . 1 1 
         23 1 . . . 1 1 
         24 1 . . . 1 1 
         25 1 . . . 1 1 
         26 1 . . . 1 1 
         27 1 . . . 1 1 
         28 1 . . . 1 1 
         29 1 . . . 1 1 
         30 1 . . . 1 1 
         31 1 . . . 1 1 
         32 1 . . . 1 1 
         33 1 . . . 1 1 
         34 1 . . . 1 1 
         35 1 . . . 1 1 
         36 1 . . . 1 1 
         37 1 . . . 1 1 
         38 1 . . . 1 1 
         39 1 . . . 1 1 
         40 1 . . . 1 1 
         41 1 . . . 1 1 
         42 1 . . . 1 1 
         43 1 . . . 1 1 
         44 1 . . . 1 1 
         45 1 . . . 1 1 
         46 1 . . . 1 1 
         47 1 . . . 1 1 
         48 1 . . . 1 1 
         49 1 . . . 1 1 
         50 1 . . . 1 1 
         51 1 . . . 1 1 
         52 1 . . . 1 1 
         53 1 . . . 1 1 
         54 1 . . . 1 1 
         55 1 . . . 1 1 
         56 1 . . . 1 1 
         57 1 . . . 1 1 
         58 1 . . . 1 1 
         59 1 . . . 1 1 
         60 1 . . . 1 1 
         61 1 . . . 1 1 
         62 1 . . . 1 1 
         63 1 . . . 1 1 
         64 1 . . . 1 1 
         65 1 . . . 1 1 
         66 1 . . . 1 1 
         67 1 . . . 1 1 
         68 1 . . . 1 1 
         69 1 . . . 1 1 
         70 1 . . . 1 1 
         71 1 . . . 1 1 
         72 1 . . . 1 1 
         73 1 . . . 1 1 
         74 1 . . . 1 1 
         75 1 . . . 1 1 
         76 1 . . . 1 1 
         77 1 . . . 1 1 
         78 1 . . . 1 1 
         79 1 . . . 1 1 
         80 1 . . . 1 1 
         81 1 . . . 1 1 
         82 1 . . . 1 1 
         83 1 . . . 1 1 
         84 1 . . . 1 1 
         85 1 . . . 1 1 
         86 1 . . . 1 1 
         87 1 . . . 1 1 
         88 1 . . . 1 1 
         89 1 . . . 1 1 
         90 1 . . . 1 1 
         91 1 . . . 1 1 
         92 1 . . . 1 1 
         93 1 . . . 1 1 
         94 1 . . . 1 1 
         95 1 . . . 1 1 
         96 1 . . . 1 1 
         97 1 . . . 1 1 
         98 1 . . . 1 1 
         99 1 . . . 1 1 
        100 1 . . . 1 1 
        101 1 . . . 1 1 
        102 1 . . . 1 1 
        103 1 . . . 1 1 
        104 1 . . . 1 1 
        105 1 . . . 1 1 
        106 1 . . . 1 1 
        107 1 . . . 1 1 
        108 1 . . . 1 1 
        109 1 . . . 1 1 
        110 1 . . . 1 1 
        111 1 . . . 1 1 
        112 1 . . . 1 1 
        113 1 . . . 1 1 
        114 1 . . . 1 1 
        115 1 . . . 1 1 
        116 1 . . . 1 1 
        117 1 . . . 1 1 
        118 1 . . . 1 1 
        119 1 . . . 1 1 
        120 1 . . . 1 1 
        121 1 . . . 1 1 
        122 1 . . . 1 1 
        123 1 . . . 1 1 
        124 1 . . . 1 1 
        125 1 . . . 1 1 
        126 1 . . . 1 1 
        127 1 . . . 1 1 
        128 1 . . . 1 1 
        129 1 . . . 1 1 
        130 1 . . . 1 1 
        131 1 . . . 1 1 
        132 1 . . . 1 1 
        133 1 . . . 1 1 
        134 1 . . . 1 1 
        135 1 . . . 1 1 
        136 1 . . . 1 1 
        137 1 . . . 1 1 
        138 1 . . . 1 1 
        139 1 . . . 1 1 
        140 1 . . . 1 1 
        141 1 . . . 1 1 
        142 1 . . . 1 1 
        143 1 . . . 1 1 
        144 1 . . . 1 1 
        145 1 . . . 1 1 
        146 1 . . . 1 1 
        147 1 . . . 1 1 
        148 1 . . . 1 1 
        149 1 . . . 1 1 
        150 1 . . . 1 1 
        151 1 . . . 1 1 
        152 1 . . . 1 1 
        153 1 . . . 1 1 
        154 1 . . . 1 1 
        155 1 . . . 1 1 
        156 1 . . . 1 1 
        157 1 . . . 1 1 
        158 1 . . . 1 1 
        159 1 . . . 1 1 
        160 1 . . . 1 1 
        161 1 . . . 1 1 
        162 1 . . . 1 1 
        163 1 . . . 1 1 
        164 1 . . . 1 1 
        165 1 . . . 1 1 
        166 1 . . . 1 1 
        167 1 . . . 1 1 
        168 1 . . . 1 1 
        169 1 . . . 1 1 
        170 1 . . . 1 1 
        171 1 . . . 1 1 
        172 1 . . . 1 1 
        173 1 . . . 1 1 
        174 1 . . . 1 1 
        175 1 . . . 1 1 
        176 1 . . . 1 1 
        177 1 . . . 1 1 
        178 1 . . . 1 1 
        179 1 . . . 1 1 
        180 1 . . . 1 1 
        181 1 . . . 1 1 
        182 1 . . . 1 1 
        183 1 . . . 1 1 
        184 1 . . . 1 1 
        185 1 . . . 1 1 
        186 1 . . . 1 1 
        187 1 . . . 1 1 
        188 1 . . . 1 1 
        189 1 . . . 1 1 
        190 1 . . . 1 1 
        191 1 . . . 1 1 
        192 1 . . . 1 1 
        193 1 . . . 1 1 
        194 1 . . . 1 1 
        195 1 . . . 1 1 
        196 1 . . . 1 1 
        197 1 . . . 1 1 
        198 1 . . . 1 1 
        199 1 . . . 1 1 
        200 1 . . . 1 1 
        201 1 . . . 1 1 
        202 1 . . . 1 1 
        203 1 . . . 1 1 
        204 1 . . . 1 1 
        205 1 . . . 1 1 
        206 1 . . . 1 1 
        207 1 . . . 1 1 
        208 1 . . . 1 1 
        209 1 . . . 1 1 
        210 1 . . . 1 1 
        211 1 . . . 1 1 
        212 1 . . . 1 1 
        213 1 . . . 1 1 
        214 1 . . . 1 1 
        215 1 . . . 1 1 
        216 1 . . . 1 1 
        217 1 . . . 1 1 
        218 1 . . . 1 1 
        219 1 . . . 1 1 
        220 1 . . . 1 1 
        221 1 . . . 1 1 
        222 1 . . . 1 1 
        223 1 . . . 1 1 
        224 1 . . . 1 1 
        225 1 . . . 1 1 
        226 1 . . . 1 1 
        227 1 . . . 1 1 
        228 1 . . . 1 1 
        229 1 . . . 1 1 
        230 1 . . . 1 1 
        231 1 . . . 1 1 
        232 1 . . . 1 1 
        233 1 . . . 1 1 
        234 1 . . . 1 1 
        235 1 . . . 1 1 
        236 1 . . . 1 1 
        237 1 . . . 1 1 
        238 1 . . . 1 1 
        239 1 . . . 1 1 
        240 1 . . . 1 1 
        241 1 . . . 1 1 
        242 1 . . . 1 1 
        243 1 . . . 1 1 
        244 1 . . . 1 1 
        245 1 . . . 1 1 
        246 1 . . . 1 1 
        247 1 . . . 1 1 
        248 1 . . . 1 1 
        249 1 . . . 1 1 
        250 1 . . . 1 1 
        251 1 . . . 1 1 
        252 1 . . . 1 1 
        253 1 . . . 1 1 
        254 1 . . . 1 1 
        255 1 . . . 1 1 
        256 1 . . . 1 1 
        257 1 . . . 1 1 
        258 1 . . . 1 1 
        259 1 . . . 1 1 
        260 1 . . . 1 1 
        261 1 . . . 1 1 
        262 1 . . . 1 1 
        263 1 . . . 1 1 
        264 1 . . . 1 1 
        265 1 . . . 1 1 
        266 1 . . . 1 1 
        267 1 . . . 1 1 
        268 1 . . . 1 1 
        269 1 . . . 1 1 
        270 1 . . . 1 1 
        271 1 . . . 1 1 
        272 1 . . . 1 1 
        273 1 . . . 1 1 
        274 1 . . . 1 1 
        275 1 . . . 1 1 
        276 1 . . . 1 1 
        277 1 . . . 1 1 
        278 1 . . . 1 1 
        279 1 . . . 1 1 
        280 1 . . . 1 1 
        281 1 . . . 1 1 
        282 1 . . . 1 1 
        283 1 . . . 1 1 
        284 1 . . . 1 1 
        285 1 . . . 1 1 
        286 1 . . . 1 1 
        287 1 . . . 1 1 
        288 1 . . . 1 1 
        289 1 . . . 1 1 
        290 1 . . . 1 1 
        291 1 . . . 1 1 
        292 1 . . . 1 1 
        293 1 . . . 1 1 
        294 1 . . . 1 1 
        295 1 . . . 1 1 
        296 1 . . . 1 1 
        297 1 . . . 1 1 
        298 1 . . . 1 1 
        299 1 . . . 1 1 
        300 1 . . . 1 1 
        301 1 . . . 1 1 
        302 1 . . . 1 1 
        303 1 . . . 1 1 
        304 1 . . . 1 1 
        305 1 . . . 1 1 
        306 1 . . . 1 1 
        307 1 . . . 1 1 
        308 1 . . . 1 1 
        309 1 . . . 1 1 
        310 1 . . . 1 1 
        311 1 . . . 1 1 
        312 1 . . . 1 1 
        313 1 . . . 1 1 
        314 1 . . . 1 1 
        315 1 . . . 1 1 
        316 1 . . . 1 1 
        317 1 . . . 1 1 
        318 1 . . . 1 1 
        319 1 . . . 1 1 
        320 1 . . . 1 1 
        321 1 . . . 1 1 
        322 1 . . . 1 1 
        323 1 . . . 1 1 
        324 1 . . . 1 1 
        325 1 . . . 1 1 
        326 1 . . . 1 1 
        327 1 . . . 1 1 
        328 1 . . . 1 1 
        329 1 . . . 1 1 
        330 1 . . . 1 1 
        331 1 . . . 1 1 
        332 1 . . . 1 1 
        333 1 . . . 1 1 
        334 1 . . . 1 1 
        335 1 . . . 1 1 
        336 1 . . . 1 1 
        337 1 . . . 1 1 
        338 1 . . . 1 1 
        339 1 . . . 1 1 
        340 1 . . . 1 1 
        341 1 . . . 1 1 
        342 1 . . . 1 1 
        343 1 . . . 1 1 
        344 1 . . . 1 1 
        345 1 . . . 1 1 
        346 1 . . . 1 1 
        347 1 . . . 1 1 
        348 1 . . . 1 1 
        349 1 . . . 1 1 
        350 1 . . . 1 1 
        351 1 . . . 1 1 
        352 1 . . . 1 1 
        353 1 . . . 1 1 
        354 1 . . . 1 1 
        355 1 . . . 1 1 
        356 1 . . . 1 1 
        357 1 . . . 1 1 
        358 1 . . . 1 1 
        359 1 . . . 1 1 
        360 1 . . . 1 1 
        361 1 . . . 1 1 
        362 1 . . . 1 1 
        363 1 . . . 1 1 
        364 1 . . . 1 1 
        365 1 . . . 1 1 
        366 1 . . . 1 1 
        367 1 . . . 1 1 
        368 1 . . . 1 1 
        369 1 . . . 1 1 
        370 1 . . . 1 1 
        371 1 . . . 1 1 
        372 1 . . . 1 1 
        373 1 . . . 1 1 
        374 1 . . . 1 1 
        375 1 . . . 1 1 
        376 1 . . . 1 1 
        377 1 . . . 1 1 
        378 1 . . . 1 1 
        379 1 . . . 1 1 
        380 1 . . . 1 1 
        381 1 . . . 1 1 
        382 1 . . . 1 1 
        383 1 . . . 1 1 
        384 1 . . . 1 1 
        385 1 . . . 1 1 
        386 1 . . . 1 1 
        387 1 . . . 1 1 
        388 1 . . . 1 1 
        389 1 . . . 1 1 
        390 1 . . . 1 1 
        391 1 . . . 1 1 
        392 1 . . . 1 1 
        393 1 . . . 1 1 
        394 1 . . . 1 1 
        395 1 . . . 1 1 
        396 1 . . . 1 1 
        397 1 . . . 1 1 
        398 1 . . . 1 1 
        399 1 . . . 1 1 
        400 1 . . . 1 1 
        401 1 . . . 1 1 
        402 1 . . . 1 1 
        403 1 . . . 1 1 
        404 1 . . . 1 1 
        405 1 . . . 1 1 
        406 1 . . . 1 1 
        407 1 . . . 1 1 
        408 1 . . . 1 1 
        409 1 . . . 1 1 
        410 1 . . . 1 1 
        411 1 . . . 1 1 
        412 1 . . . 1 1 
        413 1 . . . 1 1 
        414 1 . . . 1 1 
        415 1 . . . 1 1 
        416 1 . . . 1 1 
        417 1 . . . 1 1 
        418 1 . . . 1 1 
        419 1 . . . 1 1 
        420 1 . . . 1 1 
        421 1 . . . 1 1 
        422 1 . . . 1 1 
        423 1 . . . 1 1 
        424 1 . . . 1 1 
        425 1 . . . 1 1 
        426 1 . . . 1 1 
        427 1 . . . 1 1 
        428 1 . . . 1 1 
        429 1 . . . 1 1 
        430 1 . . . 1 1 
        431 1 . . . 1 1 
        432 1 . . . 1 1 
        433 1 . . . 1 1 
        434 1 . . . 1 1 
        435 1 . . . 1 1 
        436 1 . . . 1 1 
        437 1 . . . 1 1 
        438 1 . . . 1 1 
        439 1 . . . 1 1 
        440 1 . . . 1 1 
        441 1 . . . 1 1 
        442 1 . . . 1 1 
        443 1 . . . 1 1 
        444 1 . . . 1 1 
        445 1 . . . 1 1 
        446 1 . . . 1 1 
        447 1 . . . 1 1 
        448 1 . . . 1 1 
        449 1 . . . 1 1 
        450 1 . . . 1 1 
        451 1 . . . 1 1 
        452 1 . . . 1 1 
        453 1 . . . 1 1 
        454 1 . . . 1 1 
        455 1 . . . 1 1 
        456 1 . . . 1 1 
        457 1 . . . 1 1 
        458 1 . . . 1 1 
        459 1 . . . 1 1 
        460 1 . . . 1 1 
        461 1 . . . 1 1 
        462 1 . . . 1 1 
        463 1 . . . 1 1 
        464 1 . . . 1 1 
        465 1 . . . 1 1 
        466 1 . . . 1 1 
        467 1 . . . 1 1 
        468 1 . . . 1 1 
        469 1 . . . 1 1 
        470 1 . . . 1 1 
        471 1 . . . 1 1 
        472 1 . . . 1 1 
        473 1 . . . 1 1 
        474 1 . . . 1 1 
        475 1 . . . 1 1 
        476 1 . . . 1 1 
        477 1 . . . 1 1 
        478 1 . . . 1 1 
        479 1 . . . 1 1 
        480 1 . . . 1 1 
        481 1 . . . 1 1 
        482 1 . . . 1 1 
        483 1 . . . 1 1 
        484 1 . . . 1 1 
        485 1 . . . 1 1 
        486 1 . . . 1 1 
        487 1 . . . 1 1 
        488 1 . . . 1 1 
        489 1 . . . 1 1 
        490 1 . . . 1 1 
        491 1 . . . 1 1 
        492 1 . . . 1 1 
        493 1 . . . 1 1 
        494 1 . . . 1 1 
        495 1 . . . 1 1 
        496 1 . . . 1 1 
        497 1 . . . 1 1 
        498 1 . . . 1 1 
        499 1 . . . 1 1 
        500 1 . . . 1 1 
        501 1 . . . 1 1 
        502 1 . . . 1 1 
        503 1 . . . 1 1 
        504 1 . . . 1 1 
        505 1 . . . 1 1 
        506 1 . . . 1 1 
        507 1 . . . 1 1 
        508 1 . . . 1 1 
        509 1 . . . 1 1 
        510 1 . . . 1 1 
        511 1 . . . 1 1 
        512 1 . . . 1 1 
        513 1 . . . 1 1 
        514 1 . . . 1 1 
        515 1 . . . 1 1 
        516 1 . . . 1 1 
        517 1 . . . 1 1 
        518 1 . . . 1 1 
        519 1 . . . 1 1 
        520 1 . . . 1 1 
        521 1 . . . 1 1 
        522 1 . . . 1 1 
        523 1 . . . 1 1 
        524 1 . . . 1 1 
        525 1 . . . 1 1 
        526 1 . . . 1 1 
        527 1 . . . 1 1 
        528 1 . . . 1 1 
        529 1 . . . 1 1 
        530 1 . . . 1 1 
        531 1 . . . 1 1 
        532 1 . . . 1 1 
        533 1 . . . 1 1 
        534 1 . . . 1 1 
        535 1 . . . 1 1 
        536 1 . . . 1 1 
        537 1 . . . 1 1 
        538 1 . . . 1 1 
        539 1 . . . 1 1 
        540 1 . . . 1 1 
        541 1 . . . 1 1 
        542 1 . . . 1 1 
        543 1 . . . 1 1 
        544 1 . . . 1 1 
        545 1 . . . 1 1 
        546 1 . . . 1 1 
        547 1 . . . 1 1 
        548 1 . . . 1 1 
        549 1 . . . 1 1 
        550 1 . . . 1 1 
        551 1 . . . 1 1 
        552 1 . . . 1 1 
        553 1 . . . 1 1 
        554 1 . . . 1 1 
        555 1 . . . 1 1 
        556 1 . . . 1 1 
        557 1 . . . 1 1 
        558 1 . . . 1 1 
        559 1 . . . 1 1 
        560 1 . . . 1 1 
        561 1 . . . 1 1 
        562 1 . . . 1 1 
        563 1 . . . 1 1 
        564 1 . . . 1 1 
        565 1 . . . 1 1 
        566 1 . . . 1 1 
        567 1 . . . 1 1 
        568 1 . . . 1 1 
        569 1 . . . 1 1 
        570 1 . . . 1 1 
        571 1 . . . 1 1 
        572 1 . . . 1 1 
        573 1 . . . 1 1 
        574 1 . . . 1 1 
        575 1 . . . 1 1 
        576 1 . . . 1 1 
        577 1 . . . 1 1 
        578 1 . . . 1 1 
        579 1 . . . 1 1 
        580 1 . . . 1 1 
        581 1 . . . 1 1 
        582 1 . . . 1 1 
        583 1 . . . 1 1 
        584 1 . . . 1 1 
        585 1 . . . 1 1 
        586 1 . . . 1 1 
        587 1 . . . 1 1 
        588 1 . . . 1 1 
        589 1 . . . 1 1 
        590 1 . . . 1 1 
        591 1 . . . 1 1 
        592 1 . . . 1 1 
        593 1 . . . 1 1 
        594 1 . . . 1 1 
        595 1 . . . 1 1 
        596 1 . . . 1 1 
        597 1 . . . 1 1 
        598 1 . . . 1 1 
        599 1 . . . 1 1 
        600 1 . . . 1 1 
        601 1 . . . 1 1 
        602 1 . . . 1 1 
        603 1 . . . 1 1 
        604 1 . . . 1 1 
        605 1 . . . 1 1 
        606 1 . . . 1 1 
        607 1 . . . 1 1 
        608 1 . . . 1 1 
        609 1 . . . 1 1 
        610 1 . . . 1 1 
        611 1 . . . 1 1 
        612 1 . . . 1 1 
        613 1 . . . 1 1 
        614 1 . . . 1 1 
        615 1 . . . 1 1 
        616 1 . . . 1 1 
        617 1 . . . 1 1 
        618 1 . . . 1 1 
        619 1 . . . 1 1 
        620 1 . . . 1 1 
        621 1 . . . 1 1 
        622 1 . . . 1 1 
        623 1 . . . 1 1 
        624 1 . . . 1 1 
        625 1 . . . 1 1 
        626 1 . . . 1 1 
        627 1 . . . 1 1 
        628 1 . . . 1 1 
        629 1 . . . 1 1 
        630 1 . . . 1 1 
        631 1 . . . 1 1 
        632 1 . . . 1 1 
        633 1 . . . 1 1 
        634 1 . . . 1 1 
        635 1 . . . 1 1 
        636 1 . . . 1 1 
        637 1 . . . 1 1 
        638 1 . . . 1 1 
        639 1 . . . 1 1 
        640 1 . . . 1 1 
        641 1 . . . 1 1 
        642 1 . . . 1 1 
        643 1 . . . 1 1 
        644 1 . . . 1 1 
        645 1 . . . 1 1 
        646 1 . . . 1 1 
        647 1 . . . 1 1 
        648 1 . . . 1 1 
        649 1 . . . 1 1 
        650 1 . . . 1 1 
        651 1 . . . 1 1 
        652 1 . . . 1 1 
        653 1 . . . 1 1 
        654 1 . . . 1 1 
        655 1 . . . 1 1 
        656 1 . . . 1 1 
        657 1 . . . 1 1 
        658 1 . . . 1 1 
        659 1 . . . 1 1 
        660 1 . . . 1 1 
        661 1 . . . 1 1 
        662 1 . . . 1 1 
        663 1 . . . 1 1 
        664 1 . . . 1 1 
        665 1 . . . 1 1 
        666 1 . . . 1 1 
        667 1 . . . 1 1 
        668 1 . . . 1 1 
        669 1 . . . 1 1 
        670 1 . . . 1 1 
        671 1 . . . 1 1 
        672 1 . . . 1 1 
        673 1 . . . 1 1 
        674 1 . . . 1 1 
        675 1 . . . 1 1 
        676 1 . . . 1 1 
        677 1 . . . 1 1 
        678 1 . . . 1 1 
        679 1 . . . 1 1 
        680 1 . . . 1 1 
        681 1 . . . 1 1 
        682 1 . . . 1 1 
        683 1 . . . 1 1 
        684 1 . . . 1 1 
        685 1 . . . 1 1 
        686 1 . . . 1 1 
        687 1 . . . 1 1 
        688 1 . . . 1 1 
        689 1 . . . 1 1 
        690 1 . . . 1 1 
        691 1 . . . 1 1 
        692 1 . . . 1 1 
        693 1 . . . 1 1 
        694 1 . . . 1 1 
        695 1 . . . 1 1 
        696 1 . . . 1 1 
        697 1 . . . 1 1 
        698 1 . . . 1 1 
        699 1 . . . 1 1 
        700 1 . . . 1 1 
        701 1 . . . 1 1 
        702 1 . . . 1 1 
        703 1 . . . 1 1 
        704 1 . . . 1 1 
        705 1 . . . 1 1 
        706 1 . . . 1 1 
        707 1 . . . 1 1 
        708 1 . . . 1 1 
        709 1 . . . 1 1 
        710 1 . . . 1 1 
        711 1 . . . 1 1 
        712 1 . . . 1 1 
        713 1 . . . 1 1 
        714 1 . . . 1 1 
        715 1 . . . 1 1 
        716 1 . . . 1 1 
        717 1 . . . 1 1 
        718 1 . . . 1 1 
        719 1 . . . 1 1 
        720 1 . . . 1 1 
        721 1 . . . 1 1 
        722 1 . . . 1 1 
        723 1 . . . 1 1 
        724 1 . . . 1 1 
        725 1 . . . 1 1 
        726 1 . . . 1 1 
        727 1 . . . 1 1 
        728 1 . . . 1 1 
        729 1 . . . 1 1 
        730 1 . . . 1 1 
        731 1 . . . 1 1 
        732 1 . . . 1 1 
        733 1 . . . 1 1 
        734 1 . . . 1 1 
        735 1 . . . 1 1 
        736 1 . . . 1 1 
        737 1 . . . 1 1 
        738 1 . . . 1 1 
        739 1 . . . 1 1 
        740 1 . . . 1 1 
        741 1 . . . 1 1 
        742 1 . . . 1 1 
        743 1 . . . 1 1 
        744 1 . . . 1 1 
        745 1 . . . 1 1 
        746 1 . . . 1 1 
        747 1 . . . 1 1 
        748 1 . . . 1 1 
        749 1 . . . 1 1 
        750 1 . . . 1 1 
        751 1 . . . 1 1 
        752 1 . . . 1 1 
        753 1 . . . 1 1 
        754 1 . . . 1 1 
        755 1 . . . 1 1 
        756 1 . . . 1 1 
        757 1 . . . 1 1 
        758 1 . . . 1 1 
        759 1 . . . 1 1 
        760 1 . . . 1 1 
        761 1 . . . 1 1 
        762 1 . . . 1 1 
        763 1 . . . 1 1 
        764 1 . . . 1 1 
        765 1 . . . 1 1 
        766 1 . . . 1 1 
        767 1 . . . 1 1 
        768 1 . . . 1 1 
        769 1 . . . 1 1 
        770 1 . . . 1 1 
        771 1 . . . 1 1 
        772 1 . . . 1 1 
        773 1 . . . 1 1 
        774 1 . . . 1 1 
        775 1 . . . 1 1 
        776 1 . . . 1 1 
        777 1 . . . 1 1 
        778 1 . . . 1 1 
        779 1 . . . 1 1 
        780 1 . . . 1 1 
        781 1 . . . 1 1 
        782 1 . . . 1 1 
        783 1 . . . 1 1 
        784 1 . . . 1 1 
        785 1 . . . 1 1 
        786 1 . . . 1 1 
        787 1 . . . 1 1 
        788 1 . . . 1 1 
        789 1 . . . 1 1 
        790 1 . . . 1 1 
        791 1 . . . 1 1 
        792 1 . . . 1 1 
        793 1 . . . 1 1 
        794 1 . . . 1 1 
        795 1 . . . 1 1 
        796 1 . . . 1 1 
        797 1 . . . 1 1 
        798 1 . . . 1 1 
        799 1 . . . 1 1 
        800 1 . . . 1 1 
        801 1 . . . 1 1 
        802 1 . . . 1 1 
        803 1 . . . 1 1 
        804 1 . . . 1 1 
        805 1 . . . 1 1 
        806 1 . . . 1 1 
        807 1 . . . 1 1 
        808 1 . . . 1 1 
        809 1 . . . 1 1 
        810 1 . . . 1 1 
        811 1 . . . 1 1 
        812 1 . . . 1 1 
        813 1 . . . 1 1 
        814 1 . . . 1 1 
        815 1 . . . 1 1 
        816 1 . . . 1 1 
        817 1 . . . 1 1 
        818 1 . . . 1 1 
        819 1 . . . 1 1 
        820 1 . . . 1 1 
        821 1 . . . 1 1 
        822 1 . . . 1 1 
        823 1 . . . 1 1 
        824 1 . . . 1 1 
        825 1 . . . 1 1 
        826 1 . . . 1 1 
        827 1 . . . 1 1 
        828 1 . . . 1 1 
        829 1 . . . 1 1 
        830 1 . . . 1 1 
        831 1 . . . 1 1 
        832 1 . . . 1 1 
        833 1 . . . 1 1 
        834 1 . . . 1 1 
        835 1 . . . 1 1 
        836 1 . . . 1 1 
        837 1 . . . 1 1 
        838 1 . . . 1 1 
        839 1 . . . 1 1 
        840 1 . . . 1 1 
        841 1 . . . 1 1 
        842 1 . . . 1 1 
        843 1 . . . 1 1 
        844 1 . . . 1 1 
        845 1 . . . 1 1 
        846 1 . . . 1 1 
        847 1 . . . 1 1 
        848 1 . . . 1 1 
        849 1 . . . 1 1 
        850 1 . . . 1 1 
        851 1 . . . 1 1 
        852 1 . . . 1 1 
        853 1 . . . 1 1 
        854 1 . . . 1 1 
        855 1 . . . 1 1 
        856 1 . . . 1 1 
        857 1 . . . 1 1 
        858 1 . . . 1 1 
        859 1 . . . 1 1 
        860 1 . . . 1 1 
        861 1 . . . 1 1 
        862 1 . . . 1 1 
        863 1 . . . 1 1 
        864 1 . . . 1 1 
        865 1 . . . 1 1 
        866 1 . . . 1 1 
        867 1 . . . 1 1 
        868 1 . . . 1 1 
        869 1 . . . 1 1 
        870 1 . . . 1 1 
        871 1 . . . 1 1 
        872 1 . . . 1 1 
        873 1 . . . 1 1 
        874 1 . . . 1 1 
        875 1 . . . 1 1 
        876 1 . . . 1 1 
        877 1 . . . 1 1 
        878 1 . . . 1 1 
        879 1 . . . 1 1 
        880 1 . . . 1 1 
        881 1 . . . 1 1 
        882 1 . . . 1 1 
        883 1 . . . 1 1 
        884 1 . . . 1 1 
        885 1 . . . 1 1 
        886 1 . . . 1 1 
        887 1 . . . 1 1 
        888 1 . . . 1 1 
        889 1 . . . 1 1 
        890 1 . . . 1 1 
        891 1 . . . 1 1 
        892 1 . . . 1 1 
        893 1 . . . 1 1 
        894 1 . . . 1 1 
        895 1 . . . 1 1 
        896 1 . . . 1 1 
        897 1 . . . 1 1 
        898 1 . . . 1 1 
        899 1 . . . 1 1 
        900 1 . . . 1 1 
        901 1 . . . 1 1 
        902 1 . . . 1 1 
        903 1 . . . 1 1 
        904 1 . . . 1 1 
        905 1 . . . 1 1 
        906 1 . . . 1 1 
        907 1 . . . 1 1 
        908 1 . . . 1 1 
        909 1 . . . 1 1 
        910 1 . . . 1 1 
        911 1 . . . 1 1 
        912 1 . . . 1 1 
        913 1 . . . 1 1 
        914 1 . . . 1 1 
        915 1 . . . 1 1 
        916 1 . . . 1 1 
        917 1 . . . 1 1 
        918 1 . . . 1 1 
        919 1 . . . 1 1 
        920 1 . . . 1 1 
        921 1 . . . 1 1 
        922 1 . . . 1 1 
        923 1 . . . 1 1 
        924 1 . . . 1 1 
        925 1 . . . 1 1 
        926 1 . . . 1 1 
        927 1 . . . 1 1 
        928 1 . . . 1 1 
        929 1 . . . 1 1 
        930 1 . . . 1 1 
        931 1 . . . 1 1 
        932 1 . . . 1 1 
        933 1 . . . 1 1 
        934 1 . . . 1 1 
        935 1 . . . 1 1 
        936 1 . . . 1 1 
        937 1 . . . 1 1 
        938 1 . . . 1 1 
        939 1 . . . 1 1 
        940 1 . . . 1 1 
        941 1 . . . 1 1 
        942 1 . . . 1 1 
        943 1 . . . 1 1 
        944 1 . . . 1 1 
        945 1 . . . 1 1 
        946 1 . . . 1 1 
        947 1 . . . 1 1 
        948 1 . . . 1 1 
        949 1 . . . 1 1 
        950 1 . . . 1 1 
        951 1 . . . 1 1 
        952 1 . . . 1 1 
        953 1 . . . 1 1 
        954 1 . . . 1 1 
        955 1 . . . 1 1 
        956 1 . . . 1 1 
        957 1 . . . 1 1 
        958 1 . . . 1 1 
        959 1 . . . 1 1 
        960 1 . . . 1 1 
        961 1 . . . 1 1 
        962 1 . . . 1 1 
        963 1 . . . 1 1 
        964 1 . . . 1 1 
        965 1 . . . 1 1 
        966 1 . . . 1 1 
        967 1 . . . 1 1 
        968 1 . . . 1 1 
        969 1 . . . 1 1 
        970 1 . . . 1 1 
        971 1 . . . 1 1 
        972 1 . . . 1 1 
        973 1 . . . 1 1 
        974 1 . . . 1 1 
        975 1 . . . 1 1 
        976 1 . . . 1 1 
        977 1 . . . 1 1 
        978 1 . . . 1 1 
        979 1 . . . 1 1 
        980 1 . . . 1 1 
        981 1 . . . 1 1 
        982 1 . . . 1 1 
        983 1 . . . 1 1 
        984 1 . . . 1 1 
        985 1 . . . 1 1 
        986 1 . . . 1 1 
        987 1 . . . 1 1 
        988 1 . . . 1 1 
        989 1 . . . 1 1 
        990 1 . . . 1 1 
        991 1 . . . 1 1 
        992 1 . . . 1 1 
        993 1 . . . 1 1 
        994 1 . . . 1 1 
        995 1 . . . 1 1 
        996 1 . . . 1 1 
        997 1 . . . 1 1 
        998 1 . . . 1 1 
        999 1 . . . 1 1 
       1000 1 . . . 1 1 
       1001 1 . . . 1 1 
       1002 1 . . . 1 1 
       1003 1 . . . 1 1 
       1004 1 . . . 1 1 
       1005 1 . . . 1 1 
       1006 1 . . . 1 1 
       1007 1 . . . 1 1 
       1008 1 . . . 1 1 
       1009 1 . . . 1 1 
       1010 1 . . . 1 1 
       1011 1 . . . 1 1 
       1012 1 . . . 1 1 
       1013 1 . . . 1 1 
       1014 1 . . . 1 1 
       1015 1 . . . 1 1 
       1016 1 . . . 1 1 
       1017 1 . . . 1 1 
       1018 1 . . . 1 1 
       1019 1 . . . 1 1 
       1020 1 . . . 1 1 
       1021 1 . . . 1 1 
       1022 1 . . . 1 1 
       1023 1 . . . 1 1 
       1024 1 . . . 1 1 
       1025 1 . . . 1 1 
       1026 1 . . . 1 1 
       1027 1 . . . 1 1 
       1028 1 . . . 1 1 
       1029 1 . . . 1 1 
       1030 1 . . . 1 1 
       1031 1 . . . 1 1 
       1032 1 . . . 1 1 
       1033 1 . . . 1 1 
       1034 1 . . . 1 1 
       1035 1 . . . 1 1 
       1036 1 . . . 1 1 
       1037 1 . . . 1 1 
       1038 1 . . . 1 1 
       1039 1 . . . 1 1 
       1040 1 . . . 1 1 
       1041 1 . . . 1 1 
       1042 1 . . . 1 1 
       1043 1 . . . 1 1 
       1044 1 . . . 1 1 
       1045 1 . . . 1 1 
       1046 1 . . . 1 1 
       1047 1 . . . 1 1 
       1048 1 . . . 1 1 
       1049 1 . . . 1 1 
       1050 1 . . . 1 1 
       1051 1 . . . 1 1 
       1052 1 . . . 1 1 
       1053 1 . . . 1 1 
       1054 1 . . . 1 1 
       1055 1 . . . 1 1 
       1056 1 . . . 1 1 
       1057 1 . . . 1 1 
       1058 1 . . . 1 1 
       1059 1 . . . 1 1 
       1060 1 . . . 1 1 
       1061 1 . . . 1 1 
       1062 1 . . . 1 1 
       1063 1 . . . 1 1 
       1064 1 . . . 1 1 
       1065 1 . . . 1 1 
       1066 1 . . . 1 1 
       1067 1 . . . 1 1 
       1068 1 . . . 1 1 
       1069 1 . . . 1 1 
       1070 1 . . . 1 1 
       1071 1 . . . 1 1 
       1072 1 . . . 1 1 
       1073 1 . . . 1 1 
       1074 1 . . . 1 1 
       1075 1 . . . 1 1 
       1076 1 . . . 1 1 
       1077 1 . . . 1 1 
       1078 1 . . . 1 1 
       1079 1 . . . 1 1 
       1080 1 . . . 1 1 
       1081 1 . . . 1 1 
       1082 1 . . . 1 1 
       1083 1 . . . 1 1 
       1084 1 . . . 1 1 
       1085 1 . . . 1 1 
       1086 1 . . . 1 1 
       1087 1 . . . 1 1 
       1088 1 . . . 1 1 
       1089 1 . . . 1 1 
       1090 1 . . . 1 1 
       1091 1 . . . 1 1 
       1092 1 . . . 1 1 
       1093 1 . . . 1 1 
       1094 1 . . . 1 1 
       1095 1 . . . 1 1 
       1096 1 . . . 1 1 
       1097 1 . . . 1 1 
       1098 1 . . . 1 1 
       1099 1 . . . 1 1 
       1100 1 . . . 1 1 
       1101 1 . . . 1 1 
       1102 1 . . . 1 1 
       1103 1 . . . 1 1 
       1104 1 . . . 1 1 
       1105 1 . . . 1 1 
       1106 1 . . . 1 1 
       1107 1 . . . 1 1 
       1108 1 . . . 1 1 
       1109 1 . . . 1 1 
       1110 1 . . . 1 1 
       1111 1 . . . 1 1 
       1112 1 . . . 1 1 
       1113 1 . . . 1 1 
       1114 1 . . . 1 1 
       1115 1 . . . 1 1 
       1116 1 . . . 1 1 
       1117 1 . . . 1 1 
       1118 1 . . . 1 1 
       1119 1 . . . 1 1 
       1120 1 . . . 1 1 
       1121 1 . . . 1 1 
       1122 1 . . . 1 1 
       1123 1 . . . 1 1 
       1124 1 . . . 1 1 
       1125 1 . . . 1 1 
       1126 1 . . . 1 1 
       1127 1 . . . 1 1 
       1128 1 . . . 1 1 
       1129 1 . . . 1 1 
       1130 1 . . . 1 1 
       1131 1 . . . 1 1 
       1132 1 . . . 1 1 
       1133 1 . . . 1 1 
       1134 1 . . . 1 1 
       1135 1 . . . 1 1 
       1136 1 . . . 1 1 
       1137 1 . . . 1 1 
       1138 1 . . . 1 1 
       1139 1 . . . 1 1 
       1140 1 . . . 1 1 
       1141 1 . . . 1 1 
       1142 1 . . . 1 1 
       1143 1 . . . 1 1 
       1144 1 . . . 1 1 
       1145 1 . . . 1 1 
       1146 1 . . . 1 1 
       1147 1 . . . 1 1 
       1148 1 . . . 1 1 
       1149 1 . . . 1 1 
       1150 1 . . . 1 1 
       1151 1 . . . 1 1 
       1152 1 . . . 1 1 
       1153 1 . . . 1 1 
       1154 1 . . . 1 1 
       1155 1 . . . 1 1 
       1156 1 . . . 1 1 
       1157 1 . . . 1 1 
       1158 1 . . . 1 1 
       1159 1 . . . 1 1 
       1160 1 . . . 1 1 
       1161 1 . . . 1 1 
       1162 1 . . . 1 1 
       1163 1 . . . 1 1 
       1164 1 . . . 1 1 
       1165 1 . . . 1 1 
       1166 1 . . . 1 1 
       1167 1 . . . 1 1 
       1168 1 . . . 1 1 
       1169 1 . . . 1 1 
       1170 1 . . . 1 1 
       1171 1 . . . 1 1 
       1172 1 . . . 1 1 
       1173 1 . . . 1 1 
       1174 1 . . . 1 1 
       1175 1 . . . 1 1 
       1176 1 . . . 1 1 
       1177 1 . . . 1 1 
       1178 1 . . . 1 1 
       1179 1 . . . 1 1 
       1180 1 . . . 1 1 
       1181 1 . . . 1 1 
       1182 1 . . . 1 1 
       1183 1 . . . 1 1 
       1184 1 . . . 1 1 
       1185 1 . . . 1 1 
       1186 1 . . . 1 1 
       1187 1 . . . 1 1 
       1188 1 . . . 1 1 
       1189 1 . . . 1 1 
       1190 1 . . . 1 1 
       1191 1 . . . 1 1 
       1192 1 . . . 1 1 
       1193 1 . . . 1 1 
       1194 1 . . . 1 1 
       1195 1 . . . 1 1 
       1196 1 . . . 1 1 
       1197 1 . . . 1 1 
       1198 1 . . . 1 1 
       1199 1 . . . 1 1 
       1200 1 . . . 1 1 
       1201 1 . . . 1 1 
       1202 1 . . . 1 1 
       1203 1 . . . 1 1 
       1204 1 . . . 1 1 
       1205 1 . . . 1 1 
       1206 1 . . . 1 1 
       1207 1 . . . 1 1 
       1208 1 . . . 1 1 
       1209 1 . . . 1 1 
       1210 1 . . . 1 1 
       1211 1 . . . 1 1 
       1212 1 . . . 1 1 
       1213 1 . . . 1 1 
       1214 1 . . . 1 1 
       1215 1 . . . 1 1 
       1216 1 . . . 1 1 
       1217 1 . . . 1 1 
       1218 1 . . . 1 1 
       1219 1 . . . 1 1 
       1220 1 . . . 1 1 
       1221 1 . . . 1 1 
       1222 1 . . . 1 1 
       1223 1 . . . 1 1 
       1224 1 . . . 1 1 
       1225 1 . . . 1 1 
       1226 1 . . . 1 1 
       1227 1 . . . 1 1 
       1228 1 . . . 1 1 
       1229 1 . . . 1 1 
       1230 1 . . . 1 1 
       1231 1 . . . 1 1 
       1232 1 . . . 1 1 
       1233 1 . . . 1 1 
       1234 1 . . . 1 1 
       1235 1 . . . 1 1 
       1236 1 . . . 1 1 
       1237 1 . . . 1 1 
       1238 1 . . . 1 1 
       1239 1 . . . 1 1 
       1240 1 . . . 1 1 
       1241 1 . . . 1 1 
       1242 1 . . . 1 1 
       1243 1 . . . 1 1 
       1244 1 . . . 1 1 
       1245 1 . . . 1 1 
       1246 1 . . . 1 1 
       1247 1 . . . 1 1 
       1248 1 . . . 1 1 
       1249 1 . . . 1 1 
       1250 1 . . . 1 1 
       1251 1 . . . 1 1 
       1252 1 . . . 1 1 
       1253 1 . . . 1 1 
       1254 1 . . . 1 1 
       1255 1 . . . 1 1 
       1256 1 . . . 1 1 
       1257 1 . . . 1 1 
       1258 1 . . . 1 1 
       1259 1 . . . 1 1 
       1260 1 . . . 1 1 
       1261 1 . . . 1 1 
       1262 1 . . . 1 1 
       1263 1 . . . 1 1 
       1264 1 . . . 1 1 
       1265 1 . . . 1 1 
       1266 1 . . . 1 1 
       1267 1 . . . 1 1 
       1268 1 . . . 1 1 
       1269 1 . . . 1 1 
       1270 1 . . . 1 1 
       1271 1 . . . 1 1 
       1272 1 . . . 1 1 
       1273 1 . . . 1 1 
       1274 1 . . . 1 1 
       1275 1 . . . 1 1 
       1276 1 . . . 1 1 
       1277 1 . . . 1 1 
       1278 1 . . . 1 1 
       1279 1 . . . 1 1 
       1280 1 . . . 1 1 
       1281 1 . . . 1 1 
       1282 1 . . . 1 1 
       1283 1 . . . 1 1 
       1284 1 . . . 1 1 
       1285 1 . . . 1 1 
       1286 1 . . . 1 1 
       1287 1 . . . 1 1 
       1288 1 . . . 1 1 
       1289 1 . . . 1 1 
       1290 1 . . . 1 1 
       1291 1 . . . 1 1 
       1292 1 . . . 1 1 
       1293 1 . . . 1 1 
       1294 1 . . . 1 1 
       1295 1 . . . 1 1 
       1296 1 . . . 1 1 
       1297 1 . . . 1 1 
       1298 1 . . . 1 1 
       1299 1 . . . 1 1 
       1300 1 . . . 1 1 
       1301 1 . . . 1 1 
       1302 1 . . . 1 1 
       1303 1 . . . 1 1 
       1304 1 . . . 1 1 
       1305 1 . . . 1 1 
       1306 1 . . . 1 1 
       1307 1 . . . 1 1 
       1308 1 . . . 1 1 
       1309 1 . . . 1 1 
       1310 1 . . . 1 1 
       1311 1 . . . 1 1 
       1312 1 . . . 1 1 
       1313 1 . . . 1 1 
       1314 1 . . . 1 1 
       1315 1 . . . 1 1 
       1316 1 . . . 1 1 
       1317 1 . . . 1 1 
       1318 1 . . . 1 1 
       1319 1 . . . 1 1 
       1320 1 . . . 1 1 
       1321 1 . . . 1 1 
       1322 1 . . . 1 1 
       1323 1 . . . 1 1 
       1324 1 . . . 1 1 
       1325 1 . . . 1 1 
       1326 1 . . . 1 1 
       1327 1 . . . 1 1 
       1328 1 . . . 1 1 
       1329 1 . . . 1 1 
       1330 1 . . . 1 1 
       1331 1 . . . 1 1 
       1332 1 . . . 1 1 
       1333 1 . . . 1 1 
       1334 1 . . . 1 1 
       1335 1 . . . 1 1 
       1336 1 . . . 1 1 
       1337 1 . . . 1 1 
       1338 1 . . . 1 1 
       1339 1 . . . 1 1 
       1340 1 . . . 1 1 
       1341 1 . . . 1 1 
       1342 1 . . . 1 1 
       1343 1 . . . 1 1 
       1344 1 . . . 1 1 
       1345 1 . . . 1 1 
       1346 1 . . . 1 1 
       1347 1 . . . 1 1 
       1348 1 . . . 1 1 
       1349 1 . . . 1 1 
       1350 1 . . . 1 1 
       1351 1 . . . 1 1 
       1352 1 . . . 1 1 
       1353 1 . . . 1 1 
       1354 1 . . . 1 1 
       1355 1 . . . 1 1 
       1356 1 . . . 1 1 
       1357 1 . . . 1 1 
       1358 1 . . . 1 1 
       1359 1 . . . 1 1 
       1360 1 . . . 1 1 
       1361 1 . . . 1 1 
       1362 1 . . . 1 1 
       1363 1 . . . 1 1 
       1364 1 . . . 1 1 
       1365 1 . . . 1 1 
       1366 1 . . . 1 1 
       1367 1 . . . 1 1 
       1368 1 . . . 1 1 
       1369 1 . . . 1 1 
       1370 1 . . . 1 1 
       1371 1 . . . 1 1 
       1372 1 . . . 1 1 
       1373 1 . . . 1 1 
       1374 1 . . . 1 1 
       1375 1 . . . 1 1 
       1376 1 . . . 1 1 
       1377 1 . . . 1 1 
       1378 1 . . . 1 1 
       1379 1 . . . 1 1 
       1380 1 . . . 1 1 
       1381 1 . . . 1 1 
       1382 1 . . . 1 1 
       1383 1 . . . 1 1 
       1384 1 . . . 1 1 
       1385 1 . . . 1 1 
       1386 1 . . . 1 1 
       1387 1 . . . 1 1 
       1388 1 . . . 1 1 
       1389 1 . . . 1 1 
       1390 1 . . . 1 1 
       1391 1 . . . 1 1 
       1392 1 . . . 1 1 
       1393 1 . . . 1 1 
       1394 1 . . . 1 1 
       1395 1 . . . 1 1 
       1396 1 . . . 1 1 
       1397 1 . . . 1 1 
       1398 1 . . . 1 1 
       1399 1 . . . 1 1 
       1400 1 . . . 1 1 
       1401 1 . . . 1 1 
       1402 1 . . . 1 1 
       1403 1 . . . 1 1 
       1404 1 . . . 1 1 
       1405 1 . . . 1 1 
       1406 1 . . . 1 1 
       1407 1 . . . 1 1 
       1408 1 . . . 1 1 
       1409 1 . . . 1 1 
       1410 1 . . . 1 1 
       1411 1 . . . 1 1 
       1412 1 . . . 1 1 
       1413 1 . . . 1 1 
       1414 1 . . . 1 1 
       1415 1 . . . 1 1 
       1416 1 . . . 1 1 
       1417 1 . . . 1 1 
       1418 1 . . . 1 1 
       1419 1 . . . 1 1 
       1420 1 . . . 1 1 
       1421 1 . . . 1 1 
       1422 1 . . . 1 1 
       1423 1 . . . 1 1 
       1424 1 . . . 1 1 
       1425 1 . . . 1 1 
       1426 1 . . . 1 1 
       1427 1 . . . 1 1 
       1428 1 . . . 1 1 
       1429 1 . . . 1 1 
       1430 1 . . . 1 1 
       1431 1 . . . 1 1 
       1432 1 . . . 1 1 
       1433 1 . . . 1 1 
       1434 1 . . . 1 1 
       1435 1 . . . 1 1 
       1436 1 . . . 1 1 
       1437 1 . . . 1 1 
       1438 1 . . . 1 1 
       1439 1 . . . 1 1 
       1440 1 . . . 1 1 
       1441 1 . . . 1 1 
       1442 1 . . . 1 1 
       1443 1 . . . 1 1 
       1444 1 . . . 1 1 
       1445 1 . . . 1 1 
       1446 1 . . . 1 1 
       1447 1 . . . 1 1 
       1448 1 . . . 1 1 
       1449 1 . . . 1 1 
       1450 1 . . . 1 1 
       1451 1 . . . 1 1 
       1452 1 . . . 1 1 
       1453 1 . . . 1 1 
       1454 1 . . . 1 1 
       1455 1 . . . 1 1 
       1456 1 . . . 1 1 
       1457 1 . . . 1 1 
       1458 1 . . . 1 1 
       1459 1 . . . 1 1 
       1460 1 . . . 1 1 
       1461 1 . . . 1 1 
       1462 1 . . . 1 1 
       1463 1 . . . 1 1 
       1464 1 . . . 1 1 
       1465 1 . . . 1 1 
       1466 1 . . . 1 1 
       1467 1 . . . 1 1 
       1468 1 . . . 1 1 
       1469 1 . . . 1 1 
       1470 1 . . . 1 1 
       1471 1 . . . 1 1 
       1472 1 . . . 1 1 
       1473 1 . . . 1 1 
       1474 1 . . . 1 1 
       1475 1 . . . 1 1 
       1476 1 . . . 1 1 
       1477 1 . . . 1 1 
       1478 1 . . . 1 1 
       1479 1 . . . 1 1 
       1480 1 . . . 1 1 
       1481 1 . . . 1 1 
       1482 1 . . . 1 1 
       1483 1 . . . 1 1 
       1484 1 . . . 1 1 
       1485 1 . . . 1 1 
       1486 1 . . . 1 1 
       1487 1 . . . 1 1 
       1488 1 . . . 1 1 
       1489 1 . . . 1 1 
       1490 1 . . . 1 1 
       1491 1 . . . 1 1 
       1492 1 . . . 1 1 
       1493 1 . . . 1 1 
       1494 1 . . . 1 1 
       1495 1 . . . 1 1 
       1496 1 . . . 1 1 
       1497 1 . . . 1 1 
       1498 1 . . . 1 1 
       1499 1 . . . 1 1 
       1500 1 . . . 1 1 
       1501 1 . . . 1 1 
       1502 1 . . . 1 1 
       1503 1 . . . 1 1 
       1504 1 . . . 1 1 
       1505 1 . . . 1 1 
       1506 1 . . . 1 1 
       1507 1 . . . 1 1 
       1508 1 . . . 1 1 
       1509 1 . . . 1 1 
       1510 1 . . . 1 1 
       1511 1 . . . 1 1 
       1512 1 . . . 1 1 
       1513 1 . . . 1 1 
       1514 1 . . . 1 1 
       1515 1 . . . 1 1 
       1516 1 . . . 1 1 
       1517 1 . . . 1 1 
       1518 1 . . . 1 1 
       1519 1 . . . 1 1 
       1520 1 . . . 1 1 
       1521 1 . . . 1 1 
       1522 1 . . . 1 1 
       1523 1 . . . 1 1 
       1524 1 . . . 1 1 
       1525 1 . . . 1 1 
       1526 1 . . . 1 1 
       1527 1 . . . 1 1 
       1528 1 . . . 1 1 
       1529 1 . . . 1 1 
       1530 1 . . . 1 1 
       1531 1 . . . 1 1 
       1532 1 . . . 1 1 
       1533 1 . . . 1 1 
       1534 1 . . . 1 1 
       1535 1 . . . 1 1 
       1536 1 . . . 1 1 
       1537 1 . . . 1 1 
       1538 1 . . . 1 1 
       1539 1 . . . 1 1 
       1540 1 . . . 1 1 
       1541 1 . . . 1 1 
       1542 1 . . . 1 1 
       1543 1 . . . 1 1 
       1544 1 . . . 1 1 
       1545 1 . . . 1 1 
       1546 1 . . . 1 1 
       1547 1 . . . 1 1 
       1548 1 . . . 1 1 
       1549 1 . . . 1 1 
       1550 1 . . . 1 1 
       1551 1 . . . 1 1 
       1552 1 . . . 1 1 
       1553 1 . . . 1 1 
       1554 1 . . . 1 1 
       1555 1 . . . 1 1 
       1556 1 . . . 1 1 
       1557 1 . . . 1 1 
       1558 1 . . . 1 1 
       1559 1 . . . 1 1 
       1560 1 . . . 1 1 
       1561 1 . . . 1 1 
       1562 1 . . . 1 1 
       1563 1 . . . 1 1 
       1564 1 . . . 1 1 
       1565 1 . . . 1 1 
       1566 1 . . . 1 1 
       1567 1 . . . 1 1 
       1568 1 . . . 1 1 
       1569 1 . . . 1 1 
       1570 1 . . . 1 1 
       1571 1 . . . 1 1 
       1572 1 . . . 1 1 
       1573 1 . . . 1 1 
       1574 1 . . . 1 1 
       1575 1 . . . 1 1 
       1576 1 . . . 1 1 
       1577 1 . . . 1 1 
       1578 1 . . . 1 1 
       1579 1 . . . 1 1 
       1580 1 . . . 1 1 
       1581 1 . . . 1 1 
       1582 1 . . . 1 1 
       1583 1 . . . 1 1 
       1584 1 . . . 1 1 
       1585 1 . . . 1 1 
       1586 1 . . . 1 1 
       1587 1 . . . 1 1 
       1588 1 . . . 1 1 
       1589 1 . . . 1 1 
       1590 1 . . . 1 1 
       1591 1 . . . 1 1 
       1592 1 . . . 1 1 
       1593 1 . . . 1 1 
       1594 1 . . . 1 1 
       1595 1 . . . 1 1 
       1596 1 . . . 1 1 
       1597 1 . . . 1 1 
       1598 1 . . . 1 1 
       1599 1 . . . 1 1 
       1600 1 . . . 1 1 
       1601 1 . . . 1 1 
       1602 1 . . . 1 1 
       1603 1 . . . 1 1 
       1604 1 . . . 1 1 
       1605 1 . . . 1 1 
       1606 1 . . . 1 1 
       1607 1 . . . 1 1 
       1608 1 . . . 1 1 
       1609 1 . . . 1 1 
       1610 1 . . . 1 1 
       1611 1 . . . 1 1 
       1612 1 . . . 1 1 
       1613 1 . . . 1 1 
       1614 1 . . . 1 1 
       1615 1 . . . 1 1 
       1616 1 . . . 1 1 
       1617 1 . . . 1 1 
       1618 1 . . . 1 1 
       1619 1 . . . 1 1 
       1620 1 . . . 1 1 
       1621 1 . . . 1 1 
       1622 1 . . . 1 1 
       1623 1 . . . 1 1 
       1624 1 . . . 1 1 
       1625 1 . . . 1 1 
       1626 1 . . . 1 1 
       1627 1 . . . 1 1 
       1628 1 . . . 1 1 
       1629 1 . . . 1 1 
       1630 1 . . . 1 1 
       1631 1 . . . 1 1 
       1632 1 . . . 1 1 
       1633 1 . . . 1 1 
       1634 1 . . . 1 1 
       1635 1 . . . 1 1 
       1636 1 . . . 1 1 
       1637 1 . . . 1 1 
       1638 1 . . . 1 1 
       1639 1 . . . 1 1 
       1640 1 . . . 1 1 
       1641 1 . . . 1 1 
       1642 1 . . . 1 1 
       1643 1 . . . 1 1 
       1644 1 . . . 1 1 
       1645 1 . . . 1 1 
       1646 1 . . . 1 1 
       1647 1 . . . 1 1 
       1648 1 . . . 1 1 
       1649 1 . . . 1 1 
       1650 1 . . . 1 1 
       1651 1 . . . 1 1 
       1652 1 . . . 1 1 
       1653 1 . . . 1 1 
       1654 1 . . . 1 1 
       1655 1 . . . 1 1 
       1656 1 . . . 1 1 
       1657 1 . . . 1 1 
       1658 1 . . . 1 1 
       1659 1 . . . 1 1 
       1660 1 . . . 1 1 
       1661 1 . . . 1 1 
       1662 1 . . . 1 1 
       1663 1 . . . 1 1 
       1664 1 . . . 1 1 
       1665 1 . . . 1 1 
       1666 1 . . . 1 1 
       1667 1 . . . 1 1 
       1668 1 . . . 1 1 
       1669 1 . . . 1 1 
       1670 1 . . . 1 1 
       1671 1 . . . 1 1 
       1672 1 . . . 1 1 
       1673 1 . . . 1 1 
       1674 1 . . . 1 1 
       1675 1 . . . 1 1 
       1676 1 . . . 1 1 
       1677 1 . . . 1 1 
       1678 1 . . . 1 1 
       1679 1 . . . 1 1 
       1680 1 . . . 1 1 
       1681 1 . . . 1 1 
       1682 1 . . . 1 1 
       1683 1 . . . 1 1 
       1684 1 . . . 1 1 
       1685 1 . . . 1 1 
       1686 1 . . . 1 1 
       1687 1 . . . 1 1 
       1688 1 . . . 1 1 
       1689 1 . . . 1 1 
       1690 1 . . . 1 1 
       1691 1 . . . 1 1 
       1692 1 . . . 1 1 
       1693 1 . . . 1 1 
       1694 1 . . . 1 1 
       1695 1 . . . 1 1 
       1696 1 . . . 1 1 
       1697 1 . . . 1 1 
       1698 1 . . . 1 1 
       1699 1 . . . 1 1 
       1700 1 . . . 1 1 
       1701 1 . . . 1 1 
       1702 1 . . . 1 1 
       1703 1 . . . 1 1 
       1704 1 . . . 1 1 
       1705 1 . . . 1 1 
       1706 1 . . . 1 1 
       1707 1 . . . 1 1 
       1708 1 . . . 1 1 
       1709 1 . . . 1 1 
       1710 1 . . . 1 1 
       1711 1 . . . 1 1 
       1712 1 . . . 1 1 
       1713 1 . . . 1 1 
       1714 1 . . . 1 1 
       1715 1 . . . 1 1 
       1716 1 . . . 1 1 
       1717 1 . . . 1 1 
       1718 1 . . . 1 1 
       1719 1 . . . 1 1 
       1720 1 . . . 1 1 
       1721 1 . . . 1 1 
       1722 1 . . . 1 1 
       1723 1 . . . 1 1 
       1724 1 . . . 1 1 
       1725 1 . . . 1 1 
       1726 1 . . . 1 1 
       1727 1 . . . 1 1 
       1728 1 . . . 1 1 
       1729 1 . . . 1 1 
       1730 1 . . . 1 1 
       1731 1 . . . 1 1 
       1732 1 . . . 1 1 
       1733 1 . . . 1 1 
       1734 1 . . . 1 1 
       1735 1 . . . 1 1 
       1736 1 . . . 1 1 
       1737 1 . . . 1 1 
       1738 1 . . . 1 1 
       1739 1 . . . 1 1 
       1740 1 . . . 1 1 
       1741 1 . . . 1 1 
       1742 1 . . . 1 1 
       1743 1 . . . 1 1 
       1744 1 . . . 1 1 
       1745 1 . . . 1 1 
       1746 1 . . . 1 1 
       1747 1 . . . 1 1 
       1748 1 . . . 1 1 
       1749 1 . . . 1 1 
       1750 1 . . . 1 1 
       1751 1 . . . 1 1 
       1752 1 . . . 1 1 
       1753 1 . . . 1 1 
       1754 1 . . . 1 1 
       1755 1 . . . 1 1 
       1756 1 . . . 1 1 
       1757 1 . . . 1 1 
       1758 1 . . . 1 1 
       1759 1 . . . 1 1 
       1760 1 . . . 1 1 
       1761 1 . . . 1 1 
       1762 1 . . . 1 1 
       1763 1 . . . 1 1 
       1764 1 . . . 1 1 
       1765 1 . . . 1 1 
       1766 1 . . . 1 1 
       1767 1 . . . 1 1 
       1768 1 . . . 1 1 
       1769 1 . . . 1 1 
       1770 1 . . . 1 1 
       1771 1 . . . 1 1 
       1772 1 . . . 1 1 
       1773 1 . . . 1 1 
       1774 1 . . . 1 1 
       1775 1 . . . 1 1 
       1776 1 . . . 1 1 
       1777 1 . . . 1 1 
       1778 1 . . . 1 1 
       1779 1 . . . 1 1 
       1780 1 . . . 1 1 
       1781 1 . . . 1 1 
       1782 1 . . . 1 1 
       1783 1 . . . 1 1 
       1784 1 . . . 1 1 
       1785 1 . . . 1 1 
       1786 1 . . . 1 1 
       1787 1 . . . 1 1 
       1788 1 . . . 1 1 
       1789 1 . . . 1 1 
       1790 1 . . . 1 1 
       1791 1 . . . 1 1 
       1792 1 . . . 1 1 
       1793 1 . . . 1 1 
       1794 1 . . . 1 1 
       1795 1 . . . 1 1 
       1796 1 . . . 1 1 
       1797 1 . . . 1 1 
       1798 1 . . . 1 1 
       1799 1 . . . 1 1 
       1800 1 . . . 1 1 
       1801 1 . . . 1 1 
       1802 1 . . . 1 1 
       1803 1 . . . 1 1 
       1804 1 . . . 1 1 
       1805 1 . . . 1 1 
       1806 1 . . . 1 1 
       1807 1 . . . 1 1 
       1808 1 . . . 1 1 
       1809 1 . . . 1 1 
       1810 1 . . . 1 1 
       1811 1 . . . 1 1 
       1812 1 . . . 1 1 
       1813 1 . . . 1 1 
       1814 1 . . . 1 1 
       1815 1 . . . 1 1 
       1816 1 . . . 1 1 
       1817 1 . . . 1 1 
       1818 1 . . . 1 1 
       1819 1 . . . 1 1 
       1820 1 . . . 1 1 
       1821 1 . . . 1 1 
       1822 1 . . . 1 1 
       1823 1 . . . 1 1 
       1824 1 . . . 1 1 
       1825 1 . . . 1 1 
       1826 1 . . . 1 1 
       1827 1 . . . 1 1 
       1828 1 . . . 1 1 
       1829 1 . . . 1 1 
       1830 1 . . . 1 1 
       1831 1 . . . 1 1 
       1832 1 . . . 1 1 
       1833 1 . . . 1 1 
       1834 1 . . . 1 1 
       1835 1 . . . 1 1 
       1836 1 . . . 1 1 
       1837 1 . . . 1 1 
       1838 1 . . . 1 1 
       1839 1 . . . 1 1 
       1840 1 . . . 1 1 
       1841 1 . . . 1 1 
       1842 1 . . . 1 1 
       1843 1 . . . 1 1 
       1844 1 . . . 1 1 
       1845 1 . . . 1 1 
       1846 1 . . . 1 1 
       1847 1 . . . 1 1 
       1848 1 . . . 1 1 
       1849 1 . . . 1 1 
       1850 1 . . . 1 1 
       1851 1 . . . 1 1 
       1852 1 . . . 1 1 
       1853 1 . . . 1 1 
       1854 1 . . . 1 1 
       1855 1 . . . 1 1 
       1856 1 . . . 1 1 
       1857 1 . . . 1 1 
       1858 1 . . . 1 1 
       1859 1 . . . 1 1 
       1860 1 . . . 1 1 
       1861 1 . . . 1 1 
       1862 1 . . . 1 1 
       1863 1 . . . 1 1 
       1864 1 . . . 1 1 
       1865 1 . . . 1 1 
       1866 1 . . . 1 1 
       1867 1 . . . 1 1 
       1868 1 . . . 1 1 
       1869 1 . . . 1 1 
       1870 1 . . . 1 1 
       1871 1 . . . 1 1 
       1872 1 . . . 1 1 
       1873 1 . . . 1 1 
       1874 1 . . . 1 1 
       1875 1 . . . 1 1 
       1876 1 . . . 1 1 
       1877 1 . . . 1 1 
       1878 1 . . . 1 1 
       1879 1 . . . 1 1 
       1880 1 . . . 1 1 
       1881 1 . . . 1 1 
       1882 1 . . . 1 1 
       1883 1 . . . 1 1 
       1884 1 . . . 1 1 
       1885 1 . . . 1 1 
       1886 1 . . . 1 1 
       1887 1 . . . 1 1 
       1888 1 . . . 1 1 
       1889 1 . . . 1 1 
       1890 1 . . . 1 1 
       1891 1 . . . 1 1 
       1892 1 . . . 1 1 
       1893 1 . . . 1 1 
       1894 1 . . . 1 1 
       1895 1 . . . 1 1 
       1896 1 . . . 1 1 
       1897 1 . . . 1 1 
       1898 1 . . . 1 1 
       1899 1 . . . 1 1 
       1900 1 . . . 1 1 
       1901 1 . . . 1 1 
       1902 1 . . . 1 1 
       1903 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

          1 1 1 1 1   7 HIS HA   A   7 . HA   1 1 
          1 1 2 1 1   8 HIS H    A   8 . HN   1 1 
          2 1 1 1 1   7 HIS QB   A   7 . HB*  1 1 
          2 1 2 1 1   8 HIS H    A   8 . HN   1 1 
          3 1 1 1 1   8 HIS H    A   8 . HN   1 1 
          3 1 2 1 1   9 SER H    A   9 . HN   1 1 
          4 1 1 1 1   8 HIS HA   A   8 . HA   1 1 
          4 1 2 1 1   9 SER H    A   9 . HN   1 1 
          5 1 1 1 1   8 HIS HB2  A   8 . HB2  1 1 
          5 1 2 1 1   9 SER H    A   9 . HN   1 1 
          6 1 1 1 1   8 HIS HB3  A   8 . HB1  1 1 
          6 1 2 1 1   9 SER H    A   9 . HN   1 1 
          7 1 1 1 1   9 SER H    A   9 . HN   1 1 
          7 1 2 1 1   9 SER QB   A   9 . HB*  1 1 
          8 1 1 1 1   9 SER H    A   9 . HN   1 1 
          8 1 2 1 1  10 HIS H    A  10 . HN   1 1 
          9 1 1 1 1   9 SER HA   A   9 . HA   1 1 
          9 1 2 1 1  10 HIS H    A  10 . HN   1 1 
         10 1 1 1 1   9 SER HB2  A   9 . HB2  1 1 
         10 1 2 1 1  10 HIS H    A  10 . HN   1 1 
         11 1 1 1 1   9 SER HB3  A   9 . HB1  1 1 
         11 1 2 1 1  10 HIS H    A  10 . HN   1 1 
         12 1 1 1 1  10 HIS H    A  10 . HN   1 1 
         12 1 2 1 1  10 HIS QB   A  10 . HB*  1 1 
         13 1 1 1 1  10 HIS H    A  10 . HN   1 1 
         13 1 2 1 1  11 MET H    A  11 . HN   1 1 
         14 1 1 1 1  10 HIS HA   A  10 . HA   1 1 
         14 1 2 1 1  11 MET H    A  11 . HN   1 1 
         15 1 1 1 1  10 HIS QB   A  10 . HB*  1 1 
         15 1 2 1 1  11 MET H    A  11 . HN   1 1 
         16 1 1 1 1  11 MET H    A  11 . HN   1 1 
         16 1 2 1 1  11 MET HB2  A  11 . HB2  1 1 
         17 1 1 1 1  11 MET H    A  11 . HN   1 1 
         17 1 2 1 1  11 MET HB3  A  11 . HB1  1 1 
         18 1 1 1 1  11 MET H    A  11 . HN   1 1 
         18 1 2 1 1  12 THR H    A  12 . HN   1 1 
         19 1 1 1 1  11 MET H    A  11 . HN   1 1 
         19 1 2 1 1  12 THR HA   A  12 . HA   1 1 
         20 1 1 1 1  11 MET HA   A  11 . HA   1 1 
         20 1 2 1 1  11 MET ME   A  11 . HE*  1 1 
         21 1 1 1 1  11 MET HA   A  11 . HA   1 1 
         21 1 2 1 1  12 THR H    A  12 . HN   1 1 
         22 1 1 1 1  11 MET HA   A  11 . HA   1 1 
         22 1 2 1 1  13 GLY H    A  13 . HN   1 1 
         23 1 1 1 1  11 MET HB2  A  11 . HB2  1 1 
         23 1 2 1 1  12 THR H    A  12 . HN   1 1 
         24 1 1 1 1  11 MET HB3  A  11 . HB1  1 1 
         24 1 2 1 1  12 THR H    A  12 . HN   1 1 
         25 1 1 1 1  12 THR H    A  12 . HN   1 1 
         25 1 2 1 1  12 THR HB   A  12 . HB   1 1 
         26 1 1 1 1  12 THR H    A  12 . HN   1 1 
         26 1 2 1 1  12 THR MG   A  12 . HG2* 1 1 
         27 1 1 1 1  12 THR H    A  12 . HN   1 1 
         27 1 2 1 1  13 GLY H    A  13 . HN   1 1 
         28 1 1 1 1  12 THR HA   A  12 . HA   1 1 
         28 1 2 1 1  12 THR HB   A  12 . HB   1 1 
         29 1 1 1 1  12 THR HA   A  12 . HA   1 1 
         29 1 2 1 1  12 THR MG   A  12 . HG2* 1 1 
         30 1 1 1 1  12 THR HA   A  12 . HA   1 1 
         30 1 2 1 1  13 GLY H    A  13 . HN   1 1 
         31 1 1 1 1  12 THR MG   A  12 . HG2* 1 1 
         31 1 2 1 1  13 GLY H    A  13 . HN   1 1 
         32 1 1 1 1  13 GLY HA2  A  13 . HA2  1 1 
         32 1 2 1 1  14 ASN H    A  14 . HN   1 1 
         33 1 1 1 1  13 GLY HA3  A  13 . HA1  1 1 
         33 1 2 1 1  14 ASN H    A  14 . HN   1 1 
         34 1 1 1 1  14 ASN H    A  14 . HN   1 1 
         34 1 2 1 1  14 ASN HB2  A  14 . HB2  1 1 
         35 1 1 1 1  14 ASN H    A  14 . HN   1 1 
         35 1 2 1 1  14 ASN QB   A  14 . HB*  1 1 
         36 1 1 1 1  14 ASN H    A  14 . HN   1 1 
         36 1 2 1 1  14 ASN HB3  A  14 . HB1  1 1 
         37 1 1 1 1  14 ASN H    A  14 . HN   1 1 
         37 1 2 1 1  14 ASN QD   A  14 . HD2* 1 1 
         38 1 1 1 1  14 ASN H    A  14 . HN   1 1 
         38 1 2 1 1  15 VAL H    A  15 . HN   1 1 
         39 1 1 1 1  14 ASN H    A  14 . HN   1 1 
         39 1 2 1 1  15 VAL HB   A  15 . HB   1 1 
         40 1 1 1 1  14 ASN H    A  14 . HN   1 1 
         40 1 2 1 1  15 VAL QG   A  15 . HG*  1 1 
         41 1 1 1 1  14 ASN HA   A  14 . HA   1 1 
         41 1 2 1 1  14 ASN QD   A  14 . HD2* 1 1 
         42 1 1 1 1  14 ASN QB   A  14 . HB*  1 1 
         42 1 2 1 1  15 VAL H    A  15 . HN   1 1 
         43 1 1 1 1  14 ASN QB   A  14 . HB*  1 1 
         43 1 2 1 1  33 SER H    A  33 . HN   1 1 
         44 1 1 1 1  14 ASN QB   A  14 . HB*  1 1 
         44 1 2 1 1  33 SER QB   A  33 . HB*  1 1 
         45 1 1 1 1  14 ASN HB2  A  14 . HB2  1 1 
         45 1 2 1 1  15 VAL H    A  15 . HN   1 1 
         46 1 1 1 1  14 ASN HB2  A  14 . HB2  1 1 
         46 1 2 1 1  33 SER HB2  A  33 . HB2  1 1 
         47 1 1 1 1  14 ASN HB2  A  14 . HB2  1 1 
         47 1 2 1 1  33 SER HB3  A  33 . HB1  1 1 
         48 1 1 1 1  14 ASN HB3  A  14 . HB1  1 1 
         48 1 2 1 1  15 VAL H    A  15 . HN   1 1 
         49 1 1 1 1  14 ASN HB3  A  14 . HB1  1 1 
         49 1 2 1 1  33 SER HB2  A  33 . HB2  1 1 
         50 1 1 1 1  14 ASN HB3  A  14 . HB1  1 1 
         50 1 2 1 1  33 SER HB3  A  33 . HB1  1 1 
         51 1 1 1 1  15 VAL H    A  15 . HN   1 1 
         51 1 2 1 1  15 VAL HB   A  15 . HB   1 1 
         52 1 1 1 1  15 VAL H    A  15 . HN   1 1 
         52 1 2 1 1  15 VAL MG1  A  15 . HG1* 1 1 
         53 1 1 1 1  15 VAL H    A  15 . HN   1 1 
         53 1 2 1 1  15 VAL QG   A  15 . HG*  1 1 
         54 1 1 1 1  15 VAL H    A  15 . HN   1 1 
         54 1 2 1 1  15 VAL MG2  A  15 . HG2* 1 1 
         55 1 1 1 1  15 VAL H    A  15 . HN   1 1 
         55 1 2 1 1  16 CYS H    A  16 . HN   1 1 
         56 1 1 1 1  15 VAL HA   A  15 . HA   1 1 
         56 1 2 1 1  15 VAL MG1  A  15 . HG1* 1 1 
         57 1 1 1 1  15 VAL HA   A  15 . HA   1 1 
         57 1 2 1 1  15 VAL MG2  A  15 . HG2* 1 1 
         58 1 1 1 1  15 VAL HA   A  15 . HA   1 1 
         58 1 2 1 1  16 CYS H    A  16 . HN   1 1 
         59 1 1 1 1  15 VAL HA   A  15 . HA   1 1 
         59 1 2 1 1  30 LYS H    A  30 . HN   1 1 
         60 1 1 1 1  15 VAL HA   A  15 . HA   1 1 
         60 1 2 1 1  31 ASN HA   A  31 . HA   1 1 
         61 1 1 1 1  15 VAL HB   A  15 . HB   1 1 
         61 1 2 1 1  42 TRP HH2  A  42 . HH2  1 1 
         62 1 1 1 1  15 VAL QG   A  15 . HG*  1 1 
         62 1 2 1 1  16 CYS H    A  16 . HN   1 1 
         63 1 1 1 1  15 VAL QG   A  15 . HG*  1 1 
         63 1 2 1 1  16 CYS HA   A  16 . HA   1 1 
         64 1 1 1 1  15 VAL QG   A  15 . HG*  1 1 
         64 1 2 1 1  16 CYS QB   A  16 . HB*  1 1 
         65 1 1 1 1  15 VAL QG   A  15 . HG*  1 1 
         65 1 2 1 1  29 LEU QB   A  29 . HB*  1 1 
         66 1 1 1 1  15 VAL QG   A  15 . HG*  1 1 
         66 1 2 1 1  29 LEU MD2  A  29 . HD2* 1 1 
         67 1 1 1 1  15 VAL QG   A  15 . HG*  1 1 
         67 1 2 1 1  29 LEU HG   A  29 . HG   1 1 
         68 1 1 1 1  15 VAL QG   A  15 . HG*  1 1 
         68 1 2 1 1  30 LYS H    A  30 . HN   1 1 
         69 1 1 1 1  15 VAL QG   A  15 . HG*  1 1 
         69 1 2 1 1  31 ASN H    A  31 . HN   1 1 
         70 1 1 1 1  15 VAL QG   A  15 . HG*  1 1 
         70 1 2 1 1  31 ASN HA   A  31 . HA   1 1 
         71 1 1 1 1  15 VAL QG   A  15 . HG*  1 1 
         71 1 2 1 1  31 ASN QB   A  31 . HB*  1 1 
         72 1 1 1 1  15 VAL QG   A  15 . HG*  1 1 
         72 1 2 1 1  31 ASN HD21 A  31 . HD21 1 1 
         73 1 1 1 1  15 VAL QG   A  15 . HG*  1 1 
         73 1 2 1 1  31 ASN HD22 A  31 . HD22 1 1 
         74 1 1 1 1  15 VAL QG   A  15 . HG*  1 1 
         74 1 2 1 1  42 TRP HH2  A  42 . HH2  1 1 
         75 1 1 1 1  15 VAL MG1  A  15 . HG1* 1 1 
         75 1 2 1 1  16 CYS H    A  16 . HN   1 1 
         76 1 1 1 1  15 VAL MG1  A  15 . HG1* 1 1 
         76 1 2 1 1  31 ASN HA   A  31 . HA   1 1 
         77 1 1 1 1  15 VAL MG2  A  15 . HG2* 1 1 
         77 1 2 1 1  16 CYS H    A  16 . HN   1 1 
         78 1 1 1 1  15 VAL MG2  A  15 . HG2* 1 1 
         78 1 2 1 1  31 ASN HA   A  31 . HA   1 1 
         79 1 1 1 1  15 VAL MG2  A  15 . HG2* 1 1 
         79 1 2 1 1  63 LEU HG   A  63 . HG   1 1 
         80 1 1 1 1  16 CYS H    A  16 . HN   1 1 
         80 1 2 1 1  16 CYS HB2  A  16 . HB2  1 1 
         81 1 1 1 1  16 CYS H    A  16 . HN   1 1 
         81 1 2 1 1  16 CYS QB   A  16 . HB*  1 1 
         82 1 1 1 1  16 CYS H    A  16 . HN   1 1 
         82 1 2 1 1  16 CYS HB3  A  16 . HB1  1 1 
         83 1 1 1 1  16 CYS H    A  16 . HN   1 1 
         83 1 2 1 1  17 ILE H    A  17 . HN   1 1 
         84 1 1 1 1  16 CYS H    A  16 . HN   1 1 
         84 1 2 1 1  29 LEU HG   A  29 . HG   1 1 
         85 1 1 1 1  16 CYS H    A  16 . HN   1 1 
         85 1 2 1 1  30 LYS H    A  30 . HN   1 1 
         86 1 1 1 1  16 CYS H    A  16 . HN   1 1 
         86 1 2 1 1  31 ASN HA   A  31 . HA   1 1 
         87 1 1 1 1  16 CYS H    A  16 . HN   1 1 
         87 1 2 1 1  32 THR H    A  32 . HN   1 1 
         88 1 1 1 1  16 CYS H    A  16 . HN   1 1 
         88 1 2 1 1  32 THR MG   A  32 . HG2* 1 1 
         89 1 1 1 1  16 CYS H    A  16 . HN   1 1 
         89 1 2 1 1 113 ALA MB   A 113 . HB*  1 1 
         90 1 1 1 1  16 CYS HA   A  16 . HA   1 1 
         90 1 2 1 1  17 ILE H    A  17 . HN   1 1 
         91 1 1 1 1  16 CYS HA   A  16 . HA   1 1 
         91 1 2 1 1 113 ALA MB   A 113 . HB*  1 1 
         92 1 1 1 1  16 CYS QB   A  16 . HB*  1 1 
         92 1 2 1 1  32 THR MG   A  32 . HG2* 1 1 
         93 1 1 1 1  16 CYS QB   A  16 . HB*  1 1 
         93 1 2 1 1 113 ALA MB   A 113 . HB*  1 1 
         94 1 1 1 1  16 CYS HB2  A  16 . HB2  1 1 
         94 1 2 1 1  17 ILE H    A  17 . HN   1 1 
         95 1 1 1 1  16 CYS HB2  A  16 . HB2  1 1 
         95 1 2 1 1 113 ALA MB   A 113 . HB*  1 1 
         96 1 1 1 1  16 CYS HB3  A  16 . HB1  1 1 
         96 1 2 1 1  17 ILE H    A  17 . HN   1 1 
         97 1 1 1 1  16 CYS HB3  A  16 . HB1  1 1 
         97 1 2 1 1 113 ALA MB   A 113 . HB*  1 1 
         98 1 1 1 1  17 ILE H    A  17 . HN   1 1 
         98 1 2 1 1  17 ILE HB   A  17 . HB   1 1 
         99 1 1 1 1  17 ILE H    A  17 . HN   1 1 
         99 1 2 1 1  17 ILE MD   A  17 . HD1* 1 1 
        100 1 1 1 1  17 ILE H    A  17 . HN   1 1 
        100 1 2 1 1  17 ILE QG   A  17 . HG1* 1 1 
        101 1 1 1 1  17 ILE H    A  17 . HN   1 1 
        101 1 2 1 1 113 ALA MB   A 113 . HB*  1 1 
        102 1 1 1 1  17 ILE HA   A  17 . HA   1 1 
        102 1 2 1 1  17 ILE MD   A  17 . HD1* 1 1 
        103 1 1 1 1  17 ILE HA   A  17 . HA   1 1 
        103 1 2 1 1  17 ILE QG   A  17 . HG1* 1 1 
        104 1 1 1 1  17 ILE HA   A  17 . HA   1 1 
        104 1 2 1 1  17 ILE MG   A  17 . HG2* 1 1 
        105 1 1 1 1  17 ILE HA   A  17 . HA   1 1 
        105 1 2 1 1  18 GLU H    A  18 . HN   1 1 
        106 1 1 1 1  17 ILE HA   A  17 . HA   1 1 
        106 1 2 1 1  19 GLU H    A  19 . HN   1 1 
        107 1 1 1 1  17 ILE HA   A  17 . HA   1 1 
        107 1 2 1 1  29 LEU HA   A  29 . HA   1 1 
        108 1 1 1 1  17 ILE HA   A  17 . HA   1 1 
        108 1 2 1 1  29 LEU MD1  A  29 . HD1* 1 1 
        109 1 1 1 1  17 ILE HA   A  17 . HA   1 1 
        109 1 2 1 1  29 LEU MD2  A  29 . HD2* 1 1 
        110 1 1 1 1  17 ILE HA   A  17 . HA   1 1 
        110 1 2 1 1  29 LEU HG   A  29 . HG   1 1 
        111 1 1 1 1  17 ILE HA   A  17 . HA   1 1 
        111 1 2 1 1  30 LYS H    A  30 . HN   1 1 
        112 1 1 1 1  17 ILE HB   A  17 . HB   1 1 
        112 1 2 1 1  17 ILE MD   A  17 . HD1* 1 1 
        113 1 1 1 1  17 ILE HB   A  17 . HB   1 1 
        113 1 2 1 1 115 ARG QB   A 115 . HB*  1 1 
        114 1 1 1 1  17 ILE HB   A  17 . HB   1 1 
        114 1 2 1 1 115 ARG HD2  A 115 . HD2  1 1 
        115 1 1 1 1  17 ILE HB   A  17 . HB   1 1 
        115 1 2 1 1 115 ARG HD3  A 115 . HD1  1 1 
        116 1 1 1 1  17 ILE MD   A  17 . HD1* 1 1 
        116 1 2 1 1 103 ILE HA   A 103 . HA   1 1 
        117 1 1 1 1  17 ILE MD   A  17 . HD1* 1 1 
        117 1 2 1 1 104 LEU H    A 104 . HN   1 1 
        118 1 1 1 1  17 ILE MD   A  17 . HD1* 1 1 
        118 1 2 1 1 104 LEU HB2  A 104 . HB2  1 1 
        119 1 1 1 1  17 ILE MD   A  17 . HD1* 1 1 
        119 1 2 1 1 104 LEU HB3  A 104 . HB1  1 1 
        120 1 1 1 1  17 ILE MD   A  17 . HD1* 1 1 
        120 1 2 1 1 104 LEU MD1  A 104 . HD1* 1 1 
        121 1 1 1 1  17 ILE MD   A  17 . HD1* 1 1 
        121 1 2 1 1 104 LEU HG   A 104 . HG   1 1 
        122 1 1 1 1  17 ILE MD   A  17 . HD1* 1 1 
        122 1 2 1 1 114 GLN HA   A 114 . HA   1 1 
        123 1 1 1 1  17 ILE MD   A  17 . HD1* 1 1 
        123 1 2 1 1 115 ARG H    A 115 . HN   1 1 
        124 1 1 1 1  17 ILE MD   A  17 . HD1* 1 1 
        124 1 2 1 1 115 ARG QB   A 115 . HB*  1 1 
        125 1 1 1 1  17 ILE MD   A  17 . HD1* 1 1 
        125 1 2 1 1 115 ARG QG   A 115 . HG*  1 1 
        126 1 1 1 1  17 ILE QG   A  17 . HG1* 1 1 
        126 1 2 1 1  29 LEU MD1  A  29 . HD1* 1 1 
        127 1 1 1 1  17 ILE QG   A  17 . HG1* 1 1 
        127 1 2 1 1 114 GLN HA   A 114 . HA   1 1 
        128 1 1 1 1  17 ILE HG12 A  17 . HG12 1 1 
        128 1 2 1 1 114 GLN HA   A 114 . HA   1 1 
        129 1 1 1 1  17 ILE HG13 A  17 . HG11 1 1 
        129 1 2 1 1 114 GLN HA   A 114 . HA   1 1 
        130 1 1 1 1  17 ILE MG   A  17 . HG2* 1 1 
        130 1 2 1 1  18 GLU H    A  18 . HN   1 1 
        131 1 1 1 1  17 ILE MG   A  17 . HG2* 1 1 
        131 1 2 1 1  19 GLU H    A  19 . HN   1 1 
        132 1 1 1 1  17 ILE MG   A  17 . HG2* 1 1 
        132 1 2 1 1  27 ILE MG   A  27 . HG2* 1 1 
        133 1 1 1 1  17 ILE MG   A  17 . HG2* 1 1 
        133 1 2 1 1  29 LEU HG   A  29 . HG   1 1 
        134 1 1 1 1  17 ILE MG   A  17 . HG2* 1 1 
        134 1 2 1 1 115 ARG HB2  A 115 . HB2  1 1 
        135 1 1 1 1  17 ILE MG   A  17 . HG2* 1 1 
        135 1 2 1 1 115 ARG QB   A 115 . HB*  1 1 
        136 1 1 1 1  17 ILE MG   A  17 . HG2* 1 1 
        136 1 2 1 1 115 ARG HB3  A 115 . HB1  1 1 
        137 1 1 1 1  17 ILE MG   A  17 . HG2* 1 1 
        137 1 2 1 1 115 ARG HD2  A 115 . HD2  1 1 
        138 1 1 1 1  17 ILE MG   A  17 . HG2* 1 1 
        138 1 2 1 1 115 ARG QD   A 115 . HD*  1 1 
        139 1 1 1 1  17 ILE MG   A  17 . HG2* 1 1 
        139 1 2 1 1 115 ARG HD3  A 115 . HD1  1 1 
        140 1 1 1 1  17 ILE MG   A  17 . HG2* 1 1 
        140 1 2 1 1 115 ARG QG   A 115 . HG*  1 1 
        141 1 1 1 1  18 GLU H    A  18 . HN   1 1 
        141 1 2 1 1  18 GLU HB2  A  18 . HB2  1 1 
        142 1 1 1 1  18 GLU H    A  18 . HN   1 1 
        142 1 2 1 1  18 GLU QB   A  18 . HB*  1 1 
        143 1 1 1 1  18 GLU H    A  18 . HN   1 1 
        143 1 2 1 1  18 GLU HB3  A  18 . HB1  1 1 
        144 1 1 1 1  18 GLU H    A  18 . HN   1 1 
        144 1 2 1 1  18 GLU HG2  A  18 . HG2  1 1 
        145 1 1 1 1  18 GLU H    A  18 . HN   1 1 
        145 1 2 1 1  18 GLU QG   A  18 . HG*  1 1 
        146 1 1 1 1  18 GLU H    A  18 . HN   1 1 
        146 1 2 1 1  18 GLU HG3  A  18 . HG1  1 1 
        147 1 1 1 1  18 GLU H    A  18 . HN   1 1 
        147 1 2 1 1  19 GLU H    A  19 . HN   1 1 
        148 1 1 1 1  18 GLU H    A  18 . HN   1 1 
        148 1 2 1 1  27 ILE MG   A  27 . HG2* 1 1 
        149 1 1 1 1  18 GLU H    A  18 . HN   1 1 
        149 1 2 1 1  29 LEU H    A  29 . HN   1 1 
        150 1 1 1 1  18 GLU H    A  18 . HN   1 1 
        150 1 2 1 1  29 LEU HA   A  29 . HA   1 1 
        151 1 1 1 1  18 GLU H    A  18 . HN   1 1 
        151 1 2 1 1  29 LEU QB   A  29 . HB*  1 1 
        152 1 1 1 1  18 GLU H    A  18 . HN   1 1 
        152 1 2 1 1  29 LEU MD1  A  29 . HD1* 1 1 
        153 1 1 1 1  18 GLU H    A  18 . HN   1 1 
        153 1 2 1 1  29 LEU MD2  A  29 . HD2* 1 1 
        154 1 1 1 1  18 GLU H    A  18 . HN   1 1 
        154 1 2 1 1  30 LYS H    A  30 . HN   1 1 
        155 1 1 1 1  18 GLU HA   A  18 . HA   1 1 
        155 1 2 1 1  18 GLU HG2  A  18 . HG2  1 1 
        156 1 1 1 1  18 GLU HA   A  18 . HA   1 1 
        156 1 2 1 1  18 GLU QG   A  18 . HG*  1 1 
        157 1 1 1 1  18 GLU HA   A  18 . HA   1 1 
        157 1 2 1 1  18 GLU HG3  A  18 . HG1  1 1 
        158 1 1 1 1  18 GLU QB   A  18 . HB*  1 1 
        158 1 2 1 1  19 GLU H    A  19 . HN   1 1 
        159 1 1 1 1  18 GLU QB   A  18 . HB*  1 1 
        159 1 2 1 1  28 ARG HG2  A  28 . HG2  1 1 
        160 1 1 1 1  18 GLU QB   A  18 . HB*  1 1 
        160 1 2 1 1  29 LEU H    A  29 . HN   1 1 
        161 1 1 1 1  18 GLU QB   A  18 . HB*  1 1 
        161 1 2 1 1  29 LEU HA   A  29 . HA   1 1 
        162 1 1 1 1  18 GLU QB   A  18 . HB*  1 1 
        162 1 2 1 1  30 LYS H    A  30 . HN   1 1 
        163 1 1 1 1  18 GLU HB2  A  18 . HB2  1 1 
        163 1 2 1 1  29 LEU HA   A  29 . HA   1 1 
        164 1 1 1 1  18 GLU HB3  A  18 . HB1  1 1 
        164 1 2 1 1  29 LEU HA   A  29 . HA   1 1 
        165 1 1 1 1  18 GLU QG   A  18 . HG*  1 1 
        165 1 2 1 1  19 GLU H    A  19 . HN   1 1 
        166 1 1 1 1  18 GLU QG   A  18 . HG*  1 1 
        166 1 2 1 1  30 LYS H    A  30 . HN   1 1 
        167 1 1 1 1  19 GLU H    A  19 . HN   1 1 
        167 1 2 1 1  19 GLU QB   A  19 . HB*  1 1 
        168 1 1 1 1  19 GLU H    A  19 . HN   1 1 
        168 1 2 1 1  19 GLU HG2  A  19 . HG2  1 1 
        169 1 1 1 1  19 GLU H    A  19 . HN   1 1 
        169 1 2 1 1  19 GLU QG   A  19 . HG*  1 1 
        170 1 1 1 1  19 GLU H    A  19 . HN   1 1 
        170 1 2 1 1  19 GLU HG3  A  19 . HG1  1 1 
        171 1 1 1 1  19 GLU H    A  19 . HN   1 1 
        171 1 2 1 1  20 ILE H    A  20 . HN   1 1 
        172 1 1 1 1  19 GLU H    A  19 . HN   1 1 
        172 1 2 1 1  27 ILE MG   A  27 . HG2* 1 1 
        173 1 1 1 1  19 GLU H    A  19 . HN   1 1 
        173 1 2 1 1  28 ARG H    A  28 . HN   1 1 
        174 1 1 1 1  19 GLU H    A  19 . HN   1 1 
        174 1 2 1 1  28 ARG HG2  A  28 . HG2  1 1 
        175 1 1 1 1  19 GLU HA   A  19 . HA   1 1 
        175 1 2 1 1  19 GLU HG2  A  19 . HG2  1 1 
        176 1 1 1 1  19 GLU HA   A  19 . HA   1 1 
        176 1 2 1 1  19 GLU QG   A  19 . HG*  1 1 
        177 1 1 1 1  19 GLU HA   A  19 . HA   1 1 
        177 1 2 1 1  19 GLU HG3  A  19 . HG1  1 1 
        178 1 1 1 1  19 GLU HA   A  19 . HA   1 1 
        178 1 2 1 1  20 ILE H    A  20 . HN   1 1 
        179 1 1 1 1  19 GLU HA   A  19 . HA   1 1 
        179 1 2 1 1  20 ILE MD   A  20 . HD1* 1 1 
        180 1 1 1 1  19 GLU QB   A  19 . HB*  1 1 
        180 1 2 1 1  20 ILE H    A  20 . HN   1 1 
        181 1 1 1 1  19 GLU HB2  A  19 . HB2  1 1 
        181 1 2 1 1  20 ILE H    A  20 . HN   1 1 
        182 1 1 1 1  19 GLU HB3  A  19 . HB1  1 1 
        182 1 2 1 1  20 ILE H    A  20 . HN   1 1 
        183 1 1 1 1  19 GLU QG   A  19 . HG*  1 1 
        183 1 2 1 1  20 ILE H    A  20 . HN   1 1 
        184 1 1 1 1  19 GLU HG2  A  19 . HG2  1 1 
        184 1 2 1 1  20 ILE H    A  20 . HN   1 1 
        185 1 1 1 1  19 GLU HG3  A  19 . HG1  1 1 
        185 1 2 1 1  20 ILE H    A  20 . HN   1 1 
        186 1 1 1 1  20 ILE H    A  20 . HN   1 1 
        186 1 2 1 1  20 ILE HB   A  20 . HB   1 1 
        187 1 1 1 1  20 ILE H    A  20 . HN   1 1 
        187 1 2 1 1  20 ILE MD   A  20 . HD1* 1 1 
        188 1 1 1 1  20 ILE H    A  20 . HN   1 1 
        188 1 2 1 1  20 ILE QG   A  20 . HG1* 1 1 
        189 1 1 1 1  20 ILE H    A  20 . HN   1 1 
        189 1 2 1 1  20 ILE MG   A  20 . HG2* 1 1 
        190 1 1 1 1  20 ILE H    A  20 . HN   1 1 
        190 1 2 1 1  21 ASP H    A  21 . HN   1 1 
        191 1 1 1 1  20 ILE H    A  20 . HN   1 1 
        191 1 2 1 1 117 THR MG   A 117 . HG2* 1 1 
        192 1 1 1 1  20 ILE HA   A  20 . HA   1 1 
        192 1 2 1 1  20 ILE MD   A  20 . HD1* 1 1 
        193 1 1 1 1  20 ILE HA   A  20 . HA   1 1 
        193 1 2 1 1  20 ILE QG   A  20 . HG1* 1 1 
        194 1 1 1 1  20 ILE HA   A  20 . HA   1 1 
        194 1 2 1 1  20 ILE MG   A  20 . HG2* 1 1 
        195 1 1 1 1  20 ILE HA   A  20 . HA   1 1 
        195 1 2 1 1  21 ASP H    A  21 . HN   1 1 
        196 1 1 1 1  20 ILE HA   A  20 . HA   1 1 
        196 1 2 1 1  27 ILE HA   A  27 . HA   1 1 
        197 1 1 1 1  20 ILE HA   A  20 . HA   1 1 
        197 1 2 1 1  28 ARG H    A  28 . HN   1 1 
        198 1 1 1 1  20 ILE HB   A  20 . HB   1 1 
        198 1 2 1 1  20 ILE MD   A  20 . HD1* 1 1 
        199 1 1 1 1  20 ILE HB   A  20 . HB   1 1 
        199 1 2 1 1  21 ASP H    A  21 . HN   1 1 
        200 1 1 1 1  20 ILE HB   A  20 . HB   1 1 
        200 1 2 1 1 117 THR MG   A 117 . HG2* 1 1 
        201 1 1 1 1  20 ILE MD   A  20 . HD1* 1 1 
        201 1 2 1 1  20 ILE MG   A  20 . HG2* 1 1 
        202 1 1 1 1  20 ILE MD   A  20 . HD1* 1 1 
        202 1 2 1 1 102 VAL H    A 102 . HN   1 1 
        203 1 1 1 1  20 ILE MD   A  20 . HD1* 1 1 
        203 1 2 1 1 102 VAL HB   A 102 . HB   1 1 
        204 1 1 1 1  20 ILE MD   A  20 . HD1* 1 1 
        204 1 2 1 1 102 VAL QG   A 102 . HG*  1 1 
        205 1 1 1 1  20 ILE MD   A  20 . HD1* 1 1 
        205 1 2 1 1 115 ARG HA   A 115 . HA   1 1 
        206 1 1 1 1  20 ILE MD   A  20 . HD1* 1 1 
        206 1 2 1 1 115 ARG QG   A 115 . HG*  1 1 
        207 1 1 1 1  20 ILE MD   A  20 . HD1* 1 1 
        207 1 2 1 1 116 SER HA   A 116 . HA   1 1 
        208 1 1 1 1  20 ILE MD   A  20 . HD1* 1 1 
        208 1 2 1 1 117 THR H    A 117 . HN   1 1 
        209 1 1 1 1  20 ILE MD   A  20 . HD1* 1 1 
        209 1 2 1 1 117 THR MG   A 117 . HG2* 1 1 
        210 1 1 1 1  20 ILE QG   A  20 . HG1* 1 1 
        210 1 2 1 1  20 ILE MG   A  20 . HG2* 1 1 
        211 1 1 1 1  20 ILE QG   A  20 . HG1* 1 1 
        211 1 2 1 1  21 ASP H    A  21 . HN   1 1 
        212 1 1 1 1  20 ILE MG   A  20 . HG2* 1 1 
        212 1 2 1 1  21 ASP H    A  21 . HN   1 1 
        213 1 1 1 1  20 ILE MG   A  20 . HG2* 1 1 
        213 1 2 1 1  21 ASP QB   A  21 . HB*  1 1 
        214 1 1 1 1  20 ILE MG   A  20 . HG2* 1 1 
        214 1 2 1 1  26 PHE H    A  26 . HN   1 1 
        215 1 1 1 1  20 ILE MG   A  20 . HG2* 1 1 
        215 1 2 1 1 117 THR HA   A 117 . HA   1 1 
        216 1 1 1 1  20 ILE MG   A  20 . HG2* 1 1 
        216 1 2 1 1 117 THR MG   A 117 . HG2* 1 1 
        217 1 1 1 1  21 ASP H    A  21 . HN   1 1 
        217 1 2 1 1  21 ASP HB2  A  21 . HB2  1 1 
        218 1 1 1 1  21 ASP H    A  21 . HN   1 1 
        218 1 2 1 1  21 ASP HB3  A  21 . HB1  1 1 
        219 1 1 1 1  21 ASP H    A  21 . HN   1 1 
        219 1 2 1 1  25 LYS H    A  25 . HN   1 1 
        220 1 1 1 1  21 ASP H    A  21 . HN   1 1 
        220 1 2 1 1  26 PHE H    A  26 . HN   1 1 
        221 1 1 1 1  21 ASP H    A  21 . HN   1 1 
        221 1 2 1 1  27 ILE HA   A  27 . HA   1 1 
        222 1 1 1 1  21 ASP HA   A  21 . HA   1 1 
        222 1 2 1 1  22 VAL H    A  22 . HN   1 1 
        223 1 1 1 1  21 ASP HA   A  21 . HA   1 1 
        223 1 2 1 1  22 VAL HB   A  22 . HB   1 1 
        224 1 1 1 1  21 ASP HA   A  21 . HA   1 1 
        224 1 2 1 1  22 VAL MG1  A  22 . HG1* 1 1 
        225 1 1 1 1  21 ASP HA   A  21 . HA   1 1 
        225 1 2 1 1  23 ASP H    A  23 . HN   1 1 
        226 1 1 1 1  21 ASP HA   A  21 . HA   1 1 
        226 1 2 1 1  24 GLY H    A  24 . HN   1 1 
        227 1 1 1 1  21 ASP QB   A  21 . HB*  1 1 
        227 1 2 1 1  24 GLY H    A  24 . HN   1 1 
        228 1 1 1 1  21 ASP QB   A  21 . HB*  1 1 
        228 1 2 1 1  25 LYS H    A  25 . HN   1 1 
        229 1 1 1 1  21 ASP QB   A  21 . HB*  1 1 
        229 1 2 1 1  25 LYS HA   A  25 . HA   1 1 
        230 1 1 1 1  21 ASP QB   A  21 . HB*  1 1 
        230 1 2 1 1  25 LYS QB   A  25 . HB*  1 1 
        231 1 1 1 1  21 ASP QB   A  21 . HB*  1 1 
        231 1 2 1 1  26 PHE H    A  26 . HN   1 1 
        232 1 1 1 1  21 ASP QB   A  21 . HB*  1 1 
        232 1 2 1 1  27 ILE HA   A  27 . HA   1 1 
        233 1 1 1 1  21 ASP HB2  A  21 . HB2  1 1 
        233 1 2 1 1  24 GLY H    A  24 . HN   1 1 
        234 1 1 1 1  21 ASP HB2  A  21 . HB2  1 1 
        234 1 2 1 1  25 LYS H    A  25 . HN   1 1 
        235 1 1 1 1  21 ASP HB2  A  21 . HB2  1 1 
        235 1 2 1 1  26 PHE H    A  26 . HN   1 1 
        236 1 1 1 1  21 ASP HB3  A  21 . HB1  1 1 
        236 1 2 1 1  24 GLY H    A  24 . HN   1 1 
        237 1 1 1 1  21 ASP HB3  A  21 . HB1  1 1 
        237 1 2 1 1  25 LYS H    A  25 . HN   1 1 
        238 1 1 1 1  21 ASP HB3  A  21 . HB1  1 1 
        238 1 2 1 1  26 PHE H    A  26 . HN   1 1 
        239 1 1 1 1  22 VAL H    A  22 . HN   1 1 
        239 1 2 1 1  22 VAL HB   A  22 . HB   1 1 
        240 1 1 1 1  22 VAL H    A  22 . HN   1 1 
        240 1 2 1 1  22 VAL MG1  A  22 . HG1* 1 1 
        241 1 1 1 1  22 VAL H    A  22 . HN   1 1 
        241 1 2 1 1  23 ASP H    A  23 . HN   1 1 
        242 1 1 1 1  22 VAL H    A  22 . HN   1 1 
        242 1 2 1 1  24 GLY H    A  24 . HN   1 1 
        243 1 1 1 1  22 VAL H    A  22 . HN   1 1 
        243 1 2 1 1  25 LYS H    A  25 . HN   1 1 
        244 1 1 1 1  22 VAL HA   A  22 . HA   1 1 
        244 1 2 1 1  22 VAL MG2  A  22 . HG2* 1 1 
        245 1 1 1 1  22 VAL HA   A  22 . HA   1 1 
        245 1 2 1 1  24 GLY H    A  24 . HN   1 1 
        246 1 1 1 1  22 VAL HB   A  22 . HB   1 1 
        246 1 2 1 1  23 ASP H    A  23 . HN   1 1 
        247 1 1 1 1  22 VAL MG1  A  22 . HG1* 1 1 
        247 1 2 1 1  23 ASP H    A  23 . HN   1 1 
        248 1 1 1 1  22 VAL MG1  A  22 . HG1* 1 1 
        248 1 2 1 1  23 ASP HA   A  23 . HA   1 1 
        249 1 1 1 1  22 VAL MG1  A  22 . HG1* 1 1 
        249 1 2 1 1  23 ASP QB   A  23 . HB*  1 1 
        250 1 1 1 1  22 VAL MG2  A  22 . HG2* 1 1 
        250 1 2 1 1  23 ASP HA   A  23 . HA   1 1 
        251 1 1 1 1  23 ASP H    A  23 . HN   1 1 
        251 1 2 1 1  23 ASP HB2  A  23 . HB2  1 1 
        252 1 1 1 1  23 ASP H    A  23 . HN   1 1 
        252 1 2 1 1  23 ASP QB   A  23 . HB*  1 1 
        253 1 1 1 1  23 ASP H    A  23 . HN   1 1 
        253 1 2 1 1  23 ASP HB3  A  23 . HB1  1 1 
        254 1 1 1 1  23 ASP H    A  23 . HN   1 1 
        254 1 2 1 1  24 GLY H    A  24 . HN   1 1 
        255 1 1 1 1  23 ASP H    A  23 . HN   1 1 
        255 1 2 1 1  25 LYS H    A  25 . HN   1 1 
        256 1 1 1 1  23 ASP QB   A  23 . HB*  1 1 
        256 1 2 1 1  24 GLY H    A  24 . HN   1 1 
        257 1 1 1 1  23 ASP QB   A  23 . HB*  1 1 
        257 1 2 1 1  25 LYS H    A  25 . HN   1 1 
        258 1 1 1 1  24 GLY H    A  24 . HN   1 1 
        258 1 2 1 1  25 LYS H    A  25 . HN   1 1 
        259 1 1 1 1  24 GLY H    A  24 . HN   1 1 
        259 1 2 1 1  25 LYS HG2  A  25 . HG2  1 1 
        260 1 1 1 1  24 GLY H    A  24 . HN   1 1 
        260 1 2 1 1  25 LYS HG3  A  25 . HG1  1 1 
        261 1 1 1 1  24 GLY H    A  24 . HN   1 1 
        261 1 2 1 1  26 PHE H    A  26 . HN   1 1 
        262 1 1 1 1  24 GLY H    A  24 . HN   1 1 
        262 1 2 1 1  94 TRP HE1  A  94 . HE1  1 1 
        263 1 1 1 1  24 GLY HA2  A  24 . HA2  1 1 
        263 1 2 1 1  94 TRP HE1  A  94 . HE1  1 1 
        264 1 1 1 1  24 GLY HA3  A  24 . HA1  1 1 
        264 1 2 1 1  94 TRP HD1  A  94 . HD1  1 1 
        265 1 1 1 1  24 GLY HA3  A  24 . HA1  1 1 
        265 1 2 1 1  94 TRP HE1  A  94 . HE1  1 1 
        266 1 1 1 1  24 GLY HA3  A  24 . HA1  1 1 
        266 1 2 1 1  95 GLY HA2  A  95 . HA2  1 1 
        267 1 1 1 1  24 GLY HA3  A  24 . HA1  1 1 
        267 1 2 1 1  95 GLY HA3  A  95 . HA1  1 1 
        268 1 1 1 1  25 LYS H    A  25 . HN   1 1 
        268 1 2 1 1  25 LYS QB   A  25 . HB*  1 1 
        269 1 1 1 1  25 LYS H    A  25 . HN   1 1 
        269 1 2 1 1  25 LYS HG2  A  25 . HG2  1 1 
        270 1 1 1 1  25 LYS H    A  25 . HN   1 1 
        270 1 2 1 1  25 LYS QG   A  25 . HG*  1 1 
        271 1 1 1 1  25 LYS H    A  25 . HN   1 1 
        271 1 2 1 1  25 LYS HG3  A  25 . HG1  1 1 
        272 1 1 1 1  25 LYS H    A  25 . HN   1 1 
        272 1 2 1 1  26 PHE H    A  26 . HN   1 1 
        273 1 1 1 1  25 LYS HA   A  25 . HA   1 1 
        273 1 2 1 1  25 LYS HD2  A  25 . HD2  1 1 
        274 1 1 1 1  25 LYS HA   A  25 . HA   1 1 
        274 1 2 1 1  25 LYS QD   A  25 . HD*  1 1 
        275 1 1 1 1  25 LYS HA   A  25 . HA   1 1 
        275 1 2 1 1  25 LYS HD3  A  25 . HD1  1 1 
        276 1 1 1 1  25 LYS HA   A  25 . HA   1 1 
        276 1 2 1 1  25 LYS HG2  A  25 . HG2  1 1 
        277 1 1 1 1  25 LYS HA   A  25 . HA   1 1 
        277 1 2 1 1  25 LYS QG   A  25 . HG*  1 1 
        278 1 1 1 1  25 LYS HA   A  25 . HA   1 1 
        278 1 2 1 1  25 LYS HG3  A  25 . HG1  1 1 
        279 1 1 1 1  25 LYS HA   A  25 . HA   1 1 
        279 1 2 1 1  26 PHE HB3  A  26 . HB1  1 1 
        280 1 1 1 1  25 LYS HA   A  25 . HA   1 1 
        280 1 2 1 1  73 ALA H    A  73 . HN   1 1 
        281 1 1 1 1  25 LYS HA   A  25 . HA   1 1 
        281 1 2 1 1  73 ALA MB   A  73 . HB*  1 1 
        282 1 1 1 1  25 LYS QB   A  25 . HB*  1 1 
        282 1 2 1 1  25 LYS QE   A  25 . HE*  1 1 
        283 1 1 1 1  25 LYS QB   A  25 . HB*  1 1 
        283 1 2 1 1  26 PHE H    A  26 . HN   1 1 
        284 1 1 1 1  25 LYS QB   A  25 . HB*  1 1 
        284 1 2 1 1  26 PHE HB3  A  26 . HB1  1 1 
        285 1 1 1 1  25 LYS QB   A  25 . HB*  1 1 
        285 1 2 1 1  26 PHE QD   A  26 . HD1  1 1 
        286 1 1 1 1  25 LYS HB2  A  25 . HB2  1 1 
        286 1 2 1 1  26 PHE QD   A  26 . HD1  1 1 
        287 1 1 1 1  25 LYS HB3  A  25 . HB1  1 1 
        287 1 2 1 1  26 PHE QD   A  26 . HD1  1 1 
        288 1 1 1 1  25 LYS QE   A  25 . HE*  1 1 
        288 1 2 1 1  25 LYS QG   A  25 . HG*  1 1 
        289 1 1 1 1  25 LYS QG   A  25 . HG*  1 1 
        289 1 2 1 1  26 PHE H    A  26 . HN   1 1 
        290 1 1 1 1  26 PHE H    A  26 . HN   1 1 
        290 1 2 1 1  27 ILE H    A  27 . HN   1 1 
        291 1 1 1 1  26 PHE HA   A  26 . HA   1 1 
        291 1 2 1 1  27 ILE H    A  27 . HN   1 1 
        292 1 1 1 1  26 PHE HA   A  26 . HA   1 1 
        292 1 2 1 1  70 THR MG   A  70 . HG2* 1 1 
        293 1 1 1 1  26 PHE HA   A  26 . HA   1 1 
        293 1 2 1 1  72 TRP HA   A  72 . HA   1 1 
        294 1 1 1 1  26 PHE HA   A  26 . HA   1 1 
        294 1 2 1 1  73 ALA H    A  73 . HN   1 1 
        295 1 1 1 1  26 PHE HA   A  26 . HA   1 1 
        295 1 2 1 1  73 ALA MB   A  73 . HB*  1 1 
        296 1 1 1 1  26 PHE HB2  A  26 . HB2  1 1 
        296 1 2 1 1  26 PHE HE2  A  26 . HE2  1 1 
        297 1 1 1 1  26 PHE HB2  A  26 . HB2  1 1 
        297 1 2 1 1  27 ILE H    A  27 . HN   1 1 
        298 1 1 1 1  26 PHE HB2  A  26 . HB2  1 1 
        298 1 2 1 1  70 THR MG   A  70 . HG2* 1 1 
        299 1 1 1 1  26 PHE HB2  A  26 . HB2  1 1 
        299 1 2 1 1  71 ILE H    A  71 . HN   1 1 
        300 1 1 1 1  26 PHE HB2  A  26 . HB2  1 1 
        300 1 2 1 1  72 TRP H    A  72 . HN   1 1 
        301 1 1 1 1  26 PHE HB2  A  26 . HB2  1 1 
        301 1 2 1 1  72 TRP HA   A  72 . HA   1 1 
        302 1 1 1 1  26 PHE HB2  A  26 . HB2  1 1 
        302 1 2 1 1  73 ALA H    A  73 . HN   1 1 
        303 1 1 1 1  26 PHE HB3  A  26 . HB1  1 1 
        303 1 2 1 1  27 ILE H    A  27 . HN   1 1 
        304 1 1 1 1  26 PHE HB3  A  26 . HB1  1 1 
        304 1 2 1 1  70 THR MG   A  70 . HG2* 1 1 
        305 1 1 1 1  26 PHE HB3  A  26 . HB1  1 1 
        305 1 2 1 1  72 TRP HA   A  72 . HA   1 1 
        306 1 1 1 1  26 PHE HB3  A  26 . HB1  1 1 
        306 1 2 1 1  72 TRP HE3  A  72 . HE3  1 1 
        307 1 1 1 1  26 PHE QD   A  26 . HD2  1 1 
        307 1 2 1 1  27 ILE H    A  27 . HN   1 1 
        308 1 1 1 1  26 PHE QD   A  26 . HD2  1 1 
        308 1 2 1 1  27 ILE HA   A  27 . HA   1 1 
        309 1 1 1 1  26 PHE QD   A  26 . HD2  1 1 
        309 1 2 1 1  28 ARG H    A  28 . HN   1 1 
        310 1 1 1 1  26 PHE QD   A  26 . HD2  1 1 
        310 1 2 1 1  70 THR MG   A  70 . HG2* 1 1 
        311 1 1 1 1  26 PHE HE2  A  26 . HE2  1 1 
        311 1 2 1 1  70 THR MG   A  70 . HG2* 1 1 
        312 1 1 1 1  27 ILE H    A  27 . HN   1 1 
        312 1 2 1 1  27 ILE HB   A  27 . HB   1 1 
        313 1 1 1 1  27 ILE H    A  27 . HN   1 1 
        313 1 2 1 1  27 ILE MD   A  27 . HD1* 1 1 
        314 1 1 1 1  27 ILE H    A  27 . HN   1 1 
        314 1 2 1 1  27 ILE QG   A  27 . HG1* 1 1 
        315 1 1 1 1  27 ILE H    A  27 . HN   1 1 
        315 1 2 1 1  27 ILE MG   A  27 . HG2* 1 1 
        316 1 1 1 1  27 ILE H    A  27 . HN   1 1 
        316 1 2 1 1  28 ARG H    A  28 . HN   1 1 
        317 1 1 1 1  27 ILE H    A  27 . HN   1 1 
        317 1 2 1 1  70 THR MG   A  70 . HG2* 1 1 
        318 1 1 1 1  27 ILE H    A  27 . HN   1 1 
        318 1 2 1 1  71 ILE H    A  71 . HN   1 1 
        319 1 1 1 1  27 ILE H    A  27 . HN   1 1 
        319 1 2 1 1  71 ILE HB   A  71 . HB   1 1 
        320 1 1 1 1  27 ILE H    A  27 . HN   1 1 
        320 1 2 1 1  72 TRP HA   A  72 . HA   1 1 
        321 1 1 1 1  27 ILE HA   A  27 . HA   1 1 
        321 1 2 1 1  27 ILE MD   A  27 . HD1* 1 1 
        322 1 1 1 1  27 ILE HA   A  27 . HA   1 1 
        322 1 2 1 1  27 ILE HG12 A  27 . HG12 1 1 
        323 1 1 1 1  27 ILE HA   A  27 . HA   1 1 
        323 1 2 1 1  27 ILE QG   A  27 . HG1* 1 1 
        324 1 1 1 1  27 ILE HA   A  27 . HA   1 1 
        324 1 2 1 1  27 ILE HG13 A  27 . HG11 1 1 
        325 1 1 1 1  27 ILE HA   A  27 . HA   1 1 
        325 1 2 1 1  27 ILE MG   A  27 . HG2* 1 1 
        326 1 1 1 1  27 ILE HA   A  27 . HA   1 1 
        326 1 2 1 1  28 ARG H    A  28 . HN   1 1 
        327 1 1 1 1  27 ILE HA   A  27 . HA   1 1 
        327 1 2 1 1  28 ARG HB2  A  28 . HB2  1 1 
        328 1 1 1 1  27 ILE HB   A  27 . HB   1 1 
        328 1 2 1 1  27 ILE MD   A  27 . HD1* 1 1 
        329 1 1 1 1  27 ILE HB   A  27 . HB   1 1 
        329 1 2 1 1  28 ARG H    A  28 . HN   1 1 
        330 1 1 1 1  27 ILE HB   A  27 . HB   1 1 
        330 1 2 1 1  71 ILE H    A  71 . HN   1 1 
        331 1 1 1 1  27 ILE MD   A  27 . HD1* 1 1 
        331 1 2 1 1  44 MET ME   A  44 . HE*  1 1 
        332 1 1 1 1  27 ILE MD   A  27 . HD1* 1 1 
        332 1 2 1 1  71 ILE HB   A  71 . HB   1 1 
        333 1 1 1 1  27 ILE MD   A  27 . HD1* 1 1 
        333 1 2 1 1  71 ILE MG   A  71 . HG2* 1 1 
        334 1 1 1 1  27 ILE MD   A  27 . HD1* 1 1 
        334 1 2 1 1  88 TRP HZ3  A  88 . HZ3  1 1 
        335 1 1 1 1  27 ILE MD   A  27 . HD1* 1 1 
        335 1 2 1 1  94 TRP HH2  A  94 . HH2  1 1 
        336 1 1 1 1  27 ILE MD   A  27 . HD1* 1 1 
        336 1 2 1 1  94 TRP HZ2  A  94 . HZ2  1 1 
        337 1 1 1 1  27 ILE QG   A  27 . HG1* 1 1 
        337 1 2 1 1  28 ARG H    A  28 . HN   1 1 
        338 1 1 1 1  27 ILE QG   A  27 . HG1* 1 1 
        338 1 2 1 1  94 TRP HE1  A  94 . HE1  1 1 
        339 1 1 1 1  27 ILE QG   A  27 . HG1* 1 1 
        339 1 2 1 1  94 TRP HZ2  A  94 . HZ2  1 1 
        340 1 1 1 1  27 ILE HG12 A  27 . HG12 1 1 
        340 1 2 1 1  94 TRP HZ2  A  94 . HZ2  1 1 
        341 1 1 1 1  27 ILE HG13 A  27 . HG11 1 1 
        341 1 2 1 1  94 TRP HZ2  A  94 . HZ2  1 1 
        342 1 1 1 1  27 ILE MG   A  27 . HG2* 1 1 
        342 1 2 1 1  28 ARG H    A  28 . HN   1 1 
        343 1 1 1 1  27 ILE MG   A  27 . HG2* 1 1 
        343 1 2 1 1  28 ARG HA   A  28 . HA   1 1 
        344 1 1 1 1  27 ILE MG   A  27 . HG2* 1 1 
        344 1 2 1 1  29 LEU HG   A  29 . HG   1 1 
        345 1 1 1 1  27 ILE MG   A  27 . HG2* 1 1 
        345 1 2 1 1  71 ILE HB   A  71 . HB   1 1 
        346 1 1 1 1  27 ILE MG   A  27 . HG2* 1 1 
        346 1 2 1 1  71 ILE HG13 A  71 . HG11 1 1 
        347 1 1 1 1  28 ARG H    A  28 . HN   1 1 
        347 1 2 1 1  28 ARG HB2  A  28 . HB2  1 1 
        348 1 1 1 1  28 ARG H    A  28 . HN   1 1 
        348 1 2 1 1  28 ARG HB3  A  28 . HB1  1 1 
        349 1 1 1 1  28 ARG H    A  28 . HN   1 1 
        349 1 2 1 1  28 ARG HG2  A  28 . HG2  1 1 
        350 1 1 1 1  28 ARG H    A  28 . HN   1 1 
        350 1 2 1 1  28 ARG HG3  A  28 . HG1  1 1 
        351 1 1 1 1  28 ARG H    A  28 . HN   1 1 
        351 1 2 1 1  29 LEU H    A  29 . HN   1 1 
        352 1 1 1 1  28 ARG H    A  28 . HN   1 1 
        352 1 2 1 1  29 LEU MD1  A  29 . HD1* 1 1 
        353 1 1 1 1  28 ARG H    A  28 . HN   1 1 
        353 1 2 1 1  71 ILE H    A  71 . HN   1 1 
        354 1 1 1 1  28 ARG HA   A  28 . HA   1 1 
        354 1 2 1 1  29 LEU H    A  29 . HN   1 1 
        355 1 1 1 1  28 ARG HA   A  28 . HA   1 1 
        355 1 2 1 1  29 LEU HA   A  29 . HA   1 1 
        356 1 1 1 1  28 ARG HA   A  28 . HA   1 1 
        356 1 2 1 1  29 LEU MD2  A  29 . HD2* 1 1 
        357 1 1 1 1  28 ARG HA   A  28 . HA   1 1 
        357 1 2 1 1  70 THR HA   A  70 . HA   1 1 
        358 1 1 1 1  28 ARG HA   A  28 . HA   1 1 
        358 1 2 1 1  70 THR MG   A  70 . HG2* 1 1 
        359 1 1 1 1  28 ARG HA   A  28 . HA   1 1 
        359 1 2 1 1  71 ILE H    A  71 . HN   1 1 
        360 1 1 1 1  28 ARG HB2  A  28 . HB2  1 1 
        360 1 2 1 1  28 ARG QD   A  28 . HD*  1 1 
        361 1 1 1 1  28 ARG HB2  A  28 . HB2  1 1 
        361 1 2 1 1  29 LEU H    A  29 . HN   1 1 
        362 1 1 1 1  28 ARG HB2  A  28 . HB2  1 1 
        362 1 2 1 1  71 ILE H    A  71 . HN   1 1 
        363 1 1 1 1  28 ARG HB3  A  28 . HB1  1 1 
        363 1 2 1 1  28 ARG QD   A  28 . HD*  1 1 
        364 1 1 1 1  28 ARG HB3  A  28 . HB1  1 1 
        364 1 2 1 1  70 THR MG   A  70 . HG2* 1 1 
        365 1 1 1 1  28 ARG QD   A  28 . HD*  1 1 
        365 1 2 1 1  68 THR HB   A  68 . HB   1 1 
        366 1 1 1 1  28 ARG QD   A  28 . HD*  1 1 
        366 1 2 1 1  68 THR MG   A  68 . HG2* 1 1 
        367 1 1 1 1  28 ARG HG2  A  28 . HG2  1 1 
        367 1 2 1 1  29 LEU H    A  29 . HN   1 1 
        368 1 1 1 1  28 ARG HG2  A  28 . HG2  1 1 
        368 1 2 1 1  69 VAL H    A  69 . HN   1 1 
        369 1 1 1 1  28 ARG HG3  A  28 . HG1  1 1 
        369 1 2 1 1  29 LEU H    A  29 . HN   1 1 
        370 1 1 1 1  28 ARG HG3  A  28 . HG1  1 1 
        370 1 2 1 1  69 VAL QG   A  69 . HG*  1 1 
        371 1 1 1 1  28 ARG HG3  A  28 . HG1  1 1 
        371 1 2 1 1  70 THR MG   A  70 . HG2* 1 1 
        372 1 1 1 1  29 LEU H    A  29 . HN   1 1 
        372 1 2 1 1  29 LEU QB   A  29 . HB*  1 1 
        373 1 1 1 1  29 LEU H    A  29 . HN   1 1 
        373 1 2 1 1  29 LEU MD1  A  29 . HD1* 1 1 
        374 1 1 1 1  29 LEU H    A  29 . HN   1 1 
        374 1 2 1 1  29 LEU MD2  A  29 . HD2* 1 1 
        375 1 1 1 1  29 LEU H    A  29 . HN   1 1 
        375 1 2 1 1  30 LYS H    A  30 . HN   1 1 
        376 1 1 1 1  29 LEU H    A  29 . HN   1 1 
        376 1 2 1 1  68 THR HA   A  68 . HA   1 1 
        377 1 1 1 1  29 LEU H    A  29 . HN   1 1 
        377 1 2 1 1  68 THR MG   A  68 . HG2* 1 1 
        378 1 1 1 1  29 LEU H    A  29 . HN   1 1 
        378 1 2 1 1  69 VAL H    A  69 . HN   1 1 
        379 1 1 1 1  29 LEU H    A  29 . HN   1 1 
        379 1 2 1 1  69 VAL QG   A  69 . HG*  1 1 
        380 1 1 1 1  29 LEU H    A  29 . HN   1 1 
        380 1 2 1 1  71 ILE H    A  71 . HN   1 1 
        381 1 1 1 1  29 LEU HA   A  29 . HA   1 1 
        381 1 2 1 1  29 LEU MD1  A  29 . HD1* 1 1 
        382 1 1 1 1  29 LEU HA   A  29 . HA   1 1 
        382 1 2 1 1  29 LEU MD2  A  29 . HD2* 1 1 
        383 1 1 1 1  29 LEU HA   A  29 . HA   1 1 
        383 1 2 1 1  29 LEU HG   A  29 . HG   1 1 
        384 1 1 1 1  29 LEU HA   A  29 . HA   1 1 
        384 1 2 1 1  30 LYS H    A  30 . HN   1 1 
        385 1 1 1 1  29 LEU QB   A  29 . HB*  1 1 
        385 1 2 1 1  30 LYS H    A  30 . HN   1 1 
        386 1 1 1 1  29 LEU QB   A  29 . HB*  1 1 
        386 1 2 1 1  68 THR HA   A  68 . HA   1 1 
        387 1 1 1 1  29 LEU QB   A  29 . HB*  1 1 
        387 1 2 1 1  69 VAL H    A  69 . HN   1 1 
        388 1 1 1 1  29 LEU QB   A  29 . HB*  1 1 
        388 1 2 1 1  69 VAL QG   A  69 . HG*  1 1 
        389 1 1 1 1  29 LEU HB2  A  29 . HB2  1 1 
        389 1 2 1 1  29 LEU MD2  A  29 . HD2* 1 1 
        390 1 1 1 1  29 LEU HB3  A  29 . HB1  1 1 
        390 1 2 1 1  29 LEU MD2  A  29 . HD2* 1 1 
        391 1 1 1 1  29 LEU MD1  A  29 . HD1* 1 1 
        391 1 2 1 1  30 LYS H    A  30 . HN   1 1 
        392 1 1 1 1  29 LEU MD2  A  29 . HD2* 1 1 
        392 1 2 1 1  69 VAL QG   A  69 . HG*  1 1 
        393 1 1 1 1  29 LEU MD2  A  29 . HD2* 1 1 
        393 1 2 1 1  71 ILE MD   A  71 . HD1* 1 1 
        394 1 1 1 1  29 LEU HG   A  29 . HG   1 1 
        394 1 2 1 1  30 LYS H    A  30 . HN   1 1 
        395 1 1 1 1  29 LEU HG   A  29 . HG   1 1 
        395 1 2 1 1  69 VAL QG   A  69 . HG*  1 1 
        396 1 1 1 1  30 LYS H    A  30 . HN   1 1 
        396 1 2 1 1  30 LYS QB   A  30 . HB*  1 1 
        397 1 1 1 1  30 LYS H    A  30 . HN   1 1 
        397 1 2 1 1  31 ASN H    A  31 . HN   1 1 
        398 1 1 1 1  30 LYS H    A  30 . HN   1 1 
        398 1 2 1 1  63 LEU QD   A  63 . HD*  1 1 
        399 1 1 1 1  30 LYS H    A  30 . HN   1 1 
        399 1 2 1 1  68 THR MG   A  68 . HG2* 1 1 
        400 1 1 1 1  30 LYS H    A  30 . HN   1 1 
        400 1 2 1 1  69 VAL H    A  69 . HN   1 1 
        401 1 1 1 1  30 LYS H    A  30 . HN   1 1 
        401 1 2 1 1  69 VAL QG   A  69 . HG*  1 1 
        402 1 1 1 1  30 LYS HA   A  30 . HA   1 1 
        402 1 2 1 1  30 LYS HG2  A  30 . HG2  1 1 
        403 1 1 1 1  30 LYS HA   A  30 . HA   1 1 
        403 1 2 1 1  31 ASN H    A  31 . HN   1 1 
        404 1 1 1 1  30 LYS HA   A  30 . HA   1 1 
        404 1 2 1 1  68 THR HA   A  68 . HA   1 1 
        405 1 1 1 1  30 LYS HA   A  30 . HA   1 1 
        405 1 2 1 1  68 THR MG   A  68 . HG2* 1 1 
        406 1 1 1 1  30 LYS QB   A  30 . HB*  1 1 
        406 1 2 1 1  30 LYS QD   A  30 . HD*  1 1 
        407 1 1 1 1  30 LYS QB   A  30 . HB*  1 1 
        407 1 2 1 1  31 ASN H    A  31 . HN   1 1 
        408 1 1 1 1  30 LYS QB   A  30 . HB*  1 1 
        408 1 2 1 1  68 THR HA   A  68 . HA   1 1 
        409 1 1 1 1  30 LYS QB   A  30 . HB*  1 1 
        409 1 2 1 1  68 THR MG   A  68 . HG2* 1 1 
        410 1 1 1 1  30 LYS HB2  A  30 . HB2  1 1 
        410 1 2 1 1  31 ASN H    A  31 . HN   1 1 
        411 1 1 1 1  30 LYS HB2  A  30 . HB2  1 1 
        411 1 2 1 1  68 THR MG   A  68 . HG2* 1 1 
        412 1 1 1 1  30 LYS HB3  A  30 . HB1  1 1 
        412 1 2 1 1  31 ASN H    A  31 . HN   1 1 
        413 1 1 1 1  30 LYS HB3  A  30 . HB1  1 1 
        413 1 2 1 1  68 THR MG   A  68 . HG2* 1 1 
        414 1 1 1 1  30 LYS QD   A  30 . HD*  1 1 
        414 1 2 1 1  68 THR MG   A  68 . HG2* 1 1 
        415 1 1 1 1  30 LYS HD2  A  30 . HD2  1 1 
        415 1 2 1 1  68 THR MG   A  68 . HG2* 1 1 
        416 1 1 1 1  30 LYS HD3  A  30 . HD1  1 1 
        416 1 2 1 1  68 THR MG   A  68 . HG2* 1 1 
        417 1 1 1 1  30 LYS QE   A  30 . HE*  1 1 
        417 1 2 1 1  30 LYS HG2  A  30 . HG2  1 1 
        418 1 1 1 1  30 LYS QE   A  30 . HE*  1 1 
        418 1 2 1 1  30 LYS HG3  A  30 . HG1  1 1 
        419 1 1 1 1  30 LYS QE   A  30 . HE*  1 1 
        419 1 2 1 1  68 THR MG   A  68 . HG2* 1 1 
        420 1 1 1 1  30 LYS HE2  A  30 . HE2  1 1 
        420 1 2 1 1  68 THR MG   A  68 . HG2* 1 1 
        421 1 1 1 1  30 LYS HE3  A  30 . HE1  1 1 
        421 1 2 1 1  68 THR MG   A  68 . HG2* 1 1 
        422 1 1 1 1  30 LYS HG2  A  30 . HG2  1 1 
        422 1 2 1 1  31 ASN H    A  31 . HN   1 1 
        423 1 1 1 1  30 LYS HG2  A  30 . HG2  1 1 
        423 1 2 1 1  31 ASN HA   A  31 . HA   1 1 
        424 1 1 1 1  30 LYS HG2  A  30 . HG2  1 1 
        424 1 2 1 1  32 THR H    A  32 . HN   1 1 
        425 1 1 1 1  30 LYS HG3  A  30 . HG1  1 1 
        425 1 2 1 1  31 ASN H    A  31 . HN   1 1 
        426 1 1 1 1  30 LYS HG3  A  30 . HG1  1 1 
        426 1 2 1 1  68 THR MG   A  68 . HG2* 1 1 
        427 1 1 1 1  31 ASN H    A  31 . HN   1 1 
        427 1 2 1 1  31 ASN HB2  A  31 . HB2  1 1 
        428 1 1 1 1  31 ASN H    A  31 . HN   1 1 
        428 1 2 1 1  31 ASN QB   A  31 . HB*  1 1 
        429 1 1 1 1  31 ASN H    A  31 . HN   1 1 
        429 1 2 1 1  31 ASN HB3  A  31 . HB1  1 1 
        430 1 1 1 1  31 ASN H    A  31 . HN   1 1 
        430 1 2 1 1  63 LEU QD   A  63 . HD*  1 1 
        431 1 1 1 1  31 ASN H    A  31 . HN   1 1 
        431 1 2 1 1  67 GLN H    A  67 . HN   1 1 
        432 1 1 1 1  31 ASN H    A  31 . HN   1 1 
        432 1 2 1 1  68 THR HA   A  68 . HA   1 1 
        433 1 1 1 1  31 ASN H    A  31 . HN   1 1 
        433 1 2 1 1  68 THR MG   A  68 . HG2* 1 1 
        434 1 1 1 1  31 ASN H    A  31 . HN   1 1 
        434 1 2 1 1  69 VAL H    A  69 . HN   1 1 
        435 1 1 1 1  31 ASN HA   A  31 . HA   1 1 
        435 1 2 1 1  32 THR H    A  32 . HN   1 1 
        436 1 1 1 1  31 ASN HA   A  31 . HA   1 1 
        436 1 2 1 1  33 SER H    A  33 . HN   1 1 
        437 1 1 1 1  31 ASN QB   A  31 . HB*  1 1 
        437 1 2 1 1  63 LEU QD   A  63 . HD*  1 1 
        438 1 1 1 1  31 ASN QB   A  31 . HB*  1 1 
        438 1 2 1 1  65 ALA HA   A  65 . HA   1 1 
        439 1 1 1 1  31 ASN QB   A  31 . HB*  1 1 
        439 1 2 1 1  66 GLY H    A  66 . HN   1 1 
        440 1 1 1 1  31 ASN QB   A  31 . HB*  1 1 
        440 1 2 1 1  67 GLN H    A  67 . HN   1 1 
        441 1 1 1 1  31 ASN HB2  A  31 . HB2  1 1 
        441 1 2 1 1  67 GLN H    A  67 . HN   1 1 
        442 1 1 1 1  31 ASN HB3  A  31 . HB1  1 1 
        442 1 2 1 1  67 GLN H    A  67 . HN   1 1 
        443 1 1 1 1  31 ASN HD21 A  31 . HD21 1 1 
        443 1 2 1 1  36 ASP HA   A  36 . HA   1 1 
        444 1 1 1 1  31 ASN HD21 A  31 . HD21 1 1 
        444 1 2 1 1  37 GLN H    A  37 . HN   1 1 
        445 1 1 1 1  31 ASN HD21 A  31 . HD21 1 1 
        445 1 2 1 1  37 GLN HA   A  37 . HA   1 1 
        446 1 1 1 1  31 ASN HD21 A  31 . HD21 1 1 
        446 1 2 1 1  37 GLN QB   A  37 . HB*  1 1 
        447 1 1 1 1  31 ASN HD21 A  31 . HD21 1 1 
        447 1 2 1 1  63 LEU QB   A  63 . HB*  1 1 
        448 1 1 1 1  31 ASN HD21 A  31 . HD21 1 1 
        448 1 2 1 1  64 LYS HA   A  64 . HA   1 1 
        449 1 1 1 1  31 ASN HD21 A  31 . HD21 1 1 
        449 1 2 1 1  65 ALA H    A  65 . HN   1 1 
        450 1 1 1 1  31 ASN HD21 A  31 . HD21 1 1 
        450 1 2 1 1  65 ALA HA   A  65 . HA   1 1 
        451 1 1 1 1  31 ASN HD21 A  31 . HD21 1 1 
        451 1 2 1 1  65 ALA MB   A  65 . HB*  1 1 
        452 1 1 1 1  31 ASN HD22 A  31 . HD22 1 1 
        452 1 2 1 1  35 GLN H    A  35 . HN   1 1 
        453 1 1 1 1  31 ASN HD22 A  31 . HD22 1 1 
        453 1 2 1 1  36 ASP HA   A  36 . HA   1 1 
        454 1 1 1 1  31 ASN HD22 A  31 . HD22 1 1 
        454 1 2 1 1  37 GLN HA   A  37 . HA   1 1 
        455 1 1 1 1  31 ASN HD22 A  31 . HD22 1 1 
        455 1 2 1 1  37 GLN QB   A  37 . HB*  1 1 
        456 1 1 1 1  31 ASN HD22 A  31 . HD22 1 1 
        456 1 2 1 1  37 GLN HG2  A  37 . HG2  1 1 
        457 1 1 1 1  31 ASN HD22 A  31 . HD22 1 1 
        457 1 2 1 1  37 GLN QG   A  37 . HG*  1 1 
        458 1 1 1 1  31 ASN HD22 A  31 . HD22 1 1 
        458 1 2 1 1  37 GLN HG3  A  37 . HG1  1 1 
        459 1 1 1 1  31 ASN HD22 A  31 . HD22 1 1 
        459 1 2 1 1  64 LYS HA   A  64 . HA   1 1 
        460 1 1 1 1  31 ASN HD22 A  31 . HD22 1 1 
        460 1 2 1 1  65 ALA H    A  65 . HN   1 1 
        461 1 1 1 1  31 ASN HD22 A  31 . HD22 1 1 
        461 1 2 1 1  65 ALA HA   A  65 . HA   1 1 
        462 1 1 1 1  31 ASN HD22 A  31 . HD22 1 1 
        462 1 2 1 1  65 ALA MB   A  65 . HB*  1 1 
        463 1 1 1 1  32 THR H    A  32 . HN   1 1 
        463 1 2 1 1  32 THR HB   A  32 . HB   1 1 
        464 1 1 1 1  32 THR H    A  32 . HN   1 1 
        464 1 2 1 1  32 THR MG   A  32 . HG2* 1 1 
        465 1 1 1 1  32 THR H    A  32 . HN   1 1 
        465 1 2 1 1  63 LEU QD   A  63 . HD*  1 1 
        466 1 1 1 1  32 THR HA   A  32 . HA   1 1 
        466 1 2 1 1  32 THR MG   A  32 . HG2* 1 1 
        467 1 1 1 1  32 THR HA   A  32 . HA   1 1 
        467 1 2 1 1  66 GLY H    A  66 . HN   1 1 
        468 1 1 1 1  32 THR HA   A  32 . HA   1 1 
        468 1 2 1 1  66 GLY HA2  A  66 . HA2  1 1 
        469 1 1 1 1  32 THR MG   A  32 . HG2* 1 1 
        469 1 2 1 1  33 SER H    A  33 . HN   1 1 
        470 1 1 1 1  33 SER H    A  33 . HN   1 1 
        470 1 2 1 1  33 SER HB2  A  33 . HB2  1 1 
        471 1 1 1 1  33 SER H    A  33 . HN   1 1 
        471 1 2 1 1  33 SER QB   A  33 . HB*  1 1 
        472 1 1 1 1  33 SER H    A  33 . HN   1 1 
        472 1 2 1 1  33 SER HB3  A  33 . HB1  1 1 
        473 1 1 1 1  33 SER H    A  33 . HN   1 1 
        473 1 2 1 1  34 GLU H    A  34 . HN   1 1 
        474 1 1 1 1  33 SER H    A  33 . HN   1 1 
        474 1 2 1 1  66 GLY H    A  66 . HN   1 1 
        475 1 1 1 1  33 SER HA   A  33 . HA   1 1 
        475 1 2 1 1  34 GLU H    A  34 . HN   1 1 
        476 1 1 1 1  33 SER QB   A  33 . HB*  1 1 
        476 1 2 1 1  34 GLU H    A  34 . HN   1 1 
        477 1 1 1 1  33 SER QB   A  33 . HB*  1 1 
        477 1 2 1 1  34 GLU HG3  A  34 . HG1  1 1 
        478 1 1 1 1  33 SER QB   A  33 . HB*  1 1 
        478 1 2 1 1  35 GLN H    A  35 . HN   1 1 
        479 1 1 1 1  33 SER HB2  A  33 . HB2  1 1 
        479 1 2 1 1  34 GLU H    A  34 . HN   1 1 
        480 1 1 1 1  33 SER HB3  A  33 . HB1  1 1 
        480 1 2 1 1  34 GLU H    A  34 . HN   1 1 
        481 1 1 1 1  34 GLU H    A  34 . HN   1 1 
        481 1 2 1 1  34 GLU HB2  A  34 . HB2  1 1 
        482 1 1 1 1  34 GLU H    A  34 . HN   1 1 
        482 1 2 1 1  34 GLU HB3  A  34 . HB1  1 1 
        483 1 1 1 1  34 GLU H    A  34 . HN   1 1 
        483 1 2 1 1  34 GLU HG2  A  34 . HG2  1 1 
        484 1 1 1 1  34 GLU H    A  34 . HN   1 1 
        484 1 2 1 1  34 GLU HG3  A  34 . HG1  1 1 
        485 1 1 1 1  34 GLU H    A  34 . HN   1 1 
        485 1 2 1 1  35 GLN H    A  35 . HN   1 1 
        486 1 1 1 1  34 GLU H    A  34 . HN   1 1 
        486 1 2 1 1  35 GLN HA   A  35 . HA   1 1 
        487 1 1 1 1  34 GLU H    A  34 . HN   1 1 
        487 1 2 1 1  65 ALA MB   A  65 . HB*  1 1 
        488 1 1 1 1  34 GLU HA   A  34 . HA   1 1 
        488 1 2 1 1  34 GLU HG2  A  34 . HG2  1 1 
        489 1 1 1 1  34 GLU HA   A  34 . HA   1 1 
        489 1 2 1 1  34 GLU HG3  A  34 . HG1  1 1 
        490 1 1 1 1  34 GLU HA   A  34 . HA   1 1 
        490 1 2 1 1  65 ALA MB   A  65 . HB*  1 1 
        491 1 1 1 1  34 GLU HB2  A  34 . HB2  1 1 
        491 1 2 1 1  35 GLN H    A  35 . HN   1 1 
        492 1 1 1 1  34 GLU HB3  A  34 . HB1  1 1 
        492 1 2 1 1  35 GLN H    A  35 . HN   1 1 
        493 1 1 1 1  34 GLU HB3  A  34 . HB1  1 1 
        493 1 2 1 1  65 ALA MB   A  65 . HB*  1 1 
        494 1 1 1 1  34 GLU HG3  A  34 . HG1  1 1 
        494 1 2 1 1  35 GLN H    A  35 . HN   1 1 
        495 1 1 1 1  35 GLN H    A  35 . HN   1 1 
        495 1 2 1 1  35 GLN HB2  A  35 . HB2  1 1 
        496 1 1 1 1  35 GLN H    A  35 . HN   1 1 
        496 1 2 1 1  35 GLN HB3  A  35 . HB1  1 1 
        497 1 1 1 1  35 GLN H    A  35 . HN   1 1 
        497 1 2 1 1  36 ASP H    A  36 . HN   1 1 
        498 1 1 1 1  35 GLN H    A  35 . HN   1 1 
        498 1 2 1 1  65 ALA HA   A  65 . HA   1 1 
        499 1 1 1 1  35 GLN H    A  35 . HN   1 1 
        499 1 2 1 1  65 ALA MB   A  65 . HB*  1 1 
        500 1 1 1 1  35 GLN HA   A  35 . HA   1 1 
        500 1 2 1 1  35 GLN HG2  A  35 . HG2  1 1 
        501 1 1 1 1  35 GLN HA   A  35 . HA   1 1 
        501 1 2 1 1  35 GLN HG3  A  35 . HG1  1 1 
        502 1 1 1 1  35 GLN HA   A  35 . HA   1 1 
        502 1 2 1 1  36 ASP H    A  36 . HN   1 1 
        503 1 1 1 1  35 GLN HA   A  35 . HA   1 1 
        503 1 2 1 1  65 ALA MB   A  65 . HB*  1 1 
        504 1 1 1 1  35 GLN QB   A  35 . HB*  1 1 
        504 1 2 1 1  36 ASP H    A  36 . HN   1 1 
        505 1 1 1 1  35 GLN QG   A  35 . HG*  1 1 
        505 1 2 1 1  36 ASP H    A  36 . HN   1 1 
        506 1 1 1 1  35 GLN QG   A  35 . HG*  1 1 
        506 1 2 1 1  65 ALA MB   A  65 . HB*  1 1 
        507 1 1 1 1  35 GLN HG2  A  35 . HG2  1 1 
        507 1 2 1 1  36 ASP H    A  36 . HN   1 1 
        508 1 1 1 1  35 GLN HG3  A  35 . HG1  1 1 
        508 1 2 1 1  36 ASP H    A  36 . HN   1 1 
        509 1 1 1 1  36 ASP H    A  36 . HN   1 1 
        509 1 2 1 1  36 ASP HB2  A  36 . HB2  1 1 
        510 1 1 1 1  36 ASP H    A  36 . HN   1 1 
        510 1 2 1 1  36 ASP HB3  A  36 . HB1  1 1 
        511 1 1 1 1  36 ASP H    A  36 . HN   1 1 
        511 1 2 1 1  37 GLN H    A  37 . HN   1 1 
        512 1 1 1 1  36 ASP H    A  36 . HN   1 1 
        512 1 2 1 1  62 VAL QG   A  62 . HG*  1 1 
        513 1 1 1 1  36 ASP H    A  36 . HN   1 1 
        513 1 2 1 1  64 LYS HA   A  64 . HA   1 1 
        514 1 1 1 1  36 ASP H    A  36 . HN   1 1 
        514 1 2 1 1  65 ALA H    A  65 . HN   1 1 
        515 1 1 1 1  36 ASP H    A  36 . HN   1 1 
        515 1 2 1 1  65 ALA MB   A  65 . HB*  1 1 
        516 1 1 1 1  36 ASP HA   A  36 . HA   1 1 
        516 1 2 1 1  37 GLN H    A  37 . HN   1 1 
        517 1 1 1 1  36 ASP HA   A  36 . HA   1 1 
        517 1 2 1 1  37 GLN HA   A  37 . HA   1 1 
        518 1 1 1 1  36 ASP HA   A  36 . HA   1 1 
        518 1 2 1 1  62 VAL QG   A  62 . HG*  1 1 
        519 1 1 1 1  36 ASP HA   A  36 . HA   1 1 
        519 1 2 1 1  64 LYS HA   A  64 . HA   1 1 
        520 1 1 1 1  36 ASP HA   A  36 . HA   1 1 
        520 1 2 1 1  65 ALA H    A  65 . HN   1 1 
        521 1 1 1 1  36 ASP HA   A  36 . HA   1 1 
        521 1 2 1 1  65 ALA HA   A  65 . HA   1 1 
        522 1 1 1 1  36 ASP HA   A  36 . HA   1 1 
        522 1 2 1 1  65 ALA MB   A  65 . HB*  1 1 
        523 1 1 1 1  36 ASP HB2  A  36 . HB2  1 1 
        523 1 2 1 1  37 GLN H    A  37 . HN   1 1 
        524 1 1 1 1  36 ASP HB2  A  36 . HB2  1 1 
        524 1 2 1 1  62 VAL HB   A  62 . HB   1 1 
        525 1 1 1 1  36 ASP HB2  A  36 . HB2  1 1 
        525 1 2 1 1  62 VAL QG   A  62 . HG*  1 1 
        526 1 1 1 1  36 ASP HB2  A  36 . HB2  1 1 
        526 1 2 1 1  64 LYS HA   A  64 . HA   1 1 
        527 1 1 1 1  36 ASP HB2  A  36 . HB2  1 1 
        527 1 2 1 1  64 LYS QD   A  64 . HD*  1 1 
        528 1 1 1 1  36 ASP HB3  A  36 . HB1  1 1 
        528 1 2 1 1  37 GLN H    A  37 . HN   1 1 
        529 1 1 1 1  36 ASP HB3  A  36 . HB1  1 1 
        529 1 2 1 1  62 VAL HB   A  62 . HB   1 1 
        530 1 1 1 1  36 ASP HB3  A  36 . HB1  1 1 
        530 1 2 1 1  62 VAL QG   A  62 . HG*  1 1 
        531 1 1 1 1  36 ASP HB3  A  36 . HB1  1 1 
        531 1 2 1 1  64 LYS HA   A  64 . HA   1 1 
        532 1 1 1 1  36 ASP HB3  A  36 . HB1  1 1 
        532 1 2 1 1  64 LYS QD   A  64 . HD*  1 1 
        533 1 1 1 1  36 ASP HB3  A  36 . HB1  1 1 
        533 1 2 1 1  65 ALA H    A  65 . HN   1 1 
        534 1 1 1 1  37 GLN H    A  37 . HN   1 1 
        534 1 2 1 1  37 GLN HB2  A  37 . HB2  1 1 
        535 1 1 1 1  37 GLN H    A  37 . HN   1 1 
        535 1 2 1 1  37 GLN QB   A  37 . HB*  1 1 
        536 1 1 1 1  37 GLN H    A  37 . HN   1 1 
        536 1 2 1 1  37 GLN HB3  A  37 . HB1  1 1 
        537 1 1 1 1  37 GLN H    A  37 . HN   1 1 
        537 1 2 1 1  62 VAL QG   A  62 . HG*  1 1 
        538 1 1 1 1  37 GLN H    A  37 . HN   1 1 
        538 1 2 1 1  63 LEU H    A  63 . HN   1 1 
        539 1 1 1 1  37 GLN H    A  37 . HN   1 1 
        539 1 2 1 1  63 LEU QB   A  63 . HB*  1 1 
        540 1 1 1 1  37 GLN H    A  37 . HN   1 1 
        540 1 2 1 1  64 LYS H    A  64 . HN   1 1 
        541 1 1 1 1  37 GLN H    A  37 . HN   1 1 
        541 1 2 1 1  64 LYS HA   A  64 . HA   1 1 
        542 1 1 1 1  37 GLN H    A  37 . HN   1 1 
        542 1 2 1 1  65 ALA H    A  65 . HN   1 1 
        543 1 1 1 1  37 GLN HA   A  37 . HA   1 1 
        543 1 2 1 1  37 GLN HE21 A  37 . HE21 1 1 
        544 1 1 1 1  37 GLN HA   A  37 . HA   1 1 
        544 1 2 1 1  37 GLN HE22 A  37 . HE22 1 1 
        545 1 1 1 1  37 GLN HA   A  37 . HA   1 1 
        545 1 2 1 1  38 PRO HD2  A  38 . HD2  1 1 
        546 1 1 1 1  37 GLN HA   A  37 . HA   1 1 
        546 1 2 1 1  38 PRO QD   A  38 . HD*  1 1 
        547 1 1 1 1  37 GLN HA   A  37 . HA   1 1 
        547 1 2 1 1  38 PRO HD3  A  38 . HD1  1 1 
        548 1 1 1 1  37 GLN HA   A  37 . HA   1 1 
        548 1 2 1 1  38 PRO QG   A  38 . HG*  1 1 
        549 1 1 1 1  37 GLN QB   A  37 . HB*  1 1 
        549 1 2 1 1  38 PRO QD   A  38 . HD*  1 1 
        550 1 1 1 1  37 GLN QE   A  37 . HE*  1 1 
        550 1 2 1 1  38 PRO QD   A  38 . HD*  1 1 
        551 1 1 1 1  37 GLN HE21 A  37 . HE21 1 1 
        551 1 2 1 1  38 PRO HD2  A  38 . HD2  1 1 
        552 1 1 1 1  37 GLN HE21 A  37 . HE21 1 1 
        552 1 2 1 1  38 PRO HD3  A  38 . HD1  1 1 
        553 1 1 1 1  37 GLN HE22 A  37 . HE22 1 1 
        553 1 2 1 1  38 PRO HD2  A  38 . HD2  1 1 
        554 1 1 1 1  37 GLN HE22 A  37 . HE22 1 1 
        554 1 2 1 1  38 PRO HD3  A  38 . HD1  1 1 
        555 1 1 1 1  38 PRO HA   A  38 . HA   1 1 
        555 1 2 1 1  39 MET H    A  39 . HN   1 1 
        556 1 1 1 1  38 PRO HA   A  38 . HA   1 1 
        556 1 2 1 1  40 GLY H    A  40 . HN   1 1 
        557 1 1 1 1  38 PRO HA   A  38 . HA   1 1 
        557 1 2 1 1  62 VAL H    A  62 . HN   1 1 
        558 1 1 1 1  38 PRO HA   A  38 . HA   1 1 
        558 1 2 1 1  62 VAL HA   A  62 . HA   1 1 
        559 1 1 1 1  38 PRO HA   A  38 . HA   1 1 
        559 1 2 1 1  62 VAL MG1  A  62 . HG1* 1 1 
        560 1 1 1 1  38 PRO HA   A  38 . HA   1 1 
        560 1 2 1 1  62 VAL QG   A  62 . HG*  1 1 
        561 1 1 1 1  38 PRO HA   A  38 . HA   1 1 
        561 1 2 1 1  62 VAL MG2  A  62 . HG2* 1 1 
        562 1 1 1 1  38 PRO HA   A  38 . HA   1 1 
        562 1 2 1 1  63 LEU H    A  63 . HN   1 1 
        563 1 1 1 1  38 PRO QB   A  38 . HB*  1 1 
        563 1 2 1 1  39 MET H    A  39 . HN   1 1 
        564 1 1 1 1  38 PRO QB   A  38 . HB*  1 1 
        564 1 2 1 1  40 GLY HA2  A  40 . HA2  1 1 
        565 1 1 1 1  38 PRO QB   A  38 . HB*  1 1 
        565 1 2 1 1  62 VAL QG   A  62 . HG*  1 1 
        566 1 1 1 1  38 PRO HB2  A  38 . HB2  1 1 
        566 1 2 1 1  39 MET H    A  39 . HN   1 1 
        567 1 1 1 1  38 PRO HB2  A  38 . HB2  1 1 
        567 1 2 1 1  40 GLY H    A  40 . HN   1 1 
        568 1 1 1 1  38 PRO HB2  A  38 . HB2  1 1 
        568 1 2 1 1  40 GLY HA2  A  40 . HA2  1 1 
        569 1 1 1 1  38 PRO HB3  A  38 . HB1  1 1 
        569 1 2 1 1  39 MET H    A  39 . HN   1 1 
        570 1 1 1 1  38 PRO HB3  A  38 . HB1  1 1 
        570 1 2 1 1  40 GLY H    A  40 . HN   1 1 
        571 1 1 1 1  38 PRO HB3  A  38 . HB1  1 1 
        571 1 2 1 1  40 GLY HA2  A  40 . HA2  1 1 
        572 1 1 1 1  38 PRO QG   A  38 . HG*  1 1 
        572 1 2 1 1  62 VAL QG   A  62 . HG*  1 1 
        573 1 1 1 1  39 MET H    A  39 . HN   1 1 
        573 1 2 1 1  39 MET HG3  A  39 . HG1  1 1 
        574 1 1 1 1  39 MET H    A  39 . HN   1 1 
        574 1 2 1 1  40 GLY H    A  40 . HN   1 1 
        575 1 1 1 1  39 MET H    A  39 . HN   1 1 
        575 1 2 1 1  62 VAL HA   A  62 . HA   1 1 
        576 1 1 1 1  39 MET H    A  39 . HN   1 1 
        576 1 2 1 1  62 VAL MG1  A  62 . HG1* 1 1 
        577 1 1 1 1  39 MET H    A  39 . HN   1 1 
        577 1 2 1 1  62 VAL QG   A  62 . HG*  1 1 
        578 1 1 1 1  39 MET H    A  39 . HN   1 1 
        578 1 2 1 1  62 VAL MG2  A  62 . HG2* 1 1 
        579 1 1 1 1  39 MET H    A  39 . HN   1 1 
        579 1 2 1 1  63 LEU H    A  63 . HN   1 1 
        580 1 1 1 1  39 MET HA   A  39 . HA   1 1 
        580 1 2 1 1  39 MET ME   A  39 . HE*  1 1 
        581 1 1 1 1  39 MET HA   A  39 . HA   1 1 
        581 1 2 1 1  39 MET HG2  A  39 . HG2  1 1 
        582 1 1 1 1  39 MET HA   A  39 . HA   1 1 
        582 1 2 1 1  39 MET HG3  A  39 . HG1  1 1 
        583 1 1 1 1  39 MET QB   A  39 . HB*  1 1 
        583 1 2 1 1  39 MET ME   A  39 . HE*  1 1 
        584 1 1 1 1  39 MET QB   A  39 . HB*  1 1 
        584 1 2 1 1  61 TYR QD   A  61 . HD1  1 1 
        585 1 1 1 1  39 MET QB   A  39 . HB*  1 1 
        585 1 2 1 1  61 TYR QE   A  61 . HE2  1 1 
        586 1 1 1 1  39 MET QB   A  39 . HB*  1 1 
        586 1 2 1 1  63 LEU H    A  63 . HN   1 1 
        587 1 1 1 1  39 MET ME   A  39 . HE*  1 1 
        587 1 2 1 1  39 MET HG2  A  39 . HG2  1 1 
        588 1 1 1 1  39 MET ME   A  39 . HE*  1 1 
        588 1 2 1 1  39 MET HG3  A  39 . HG1  1 1 
        589 1 1 1 1  39 MET ME   A  39 . HE*  1 1 
        589 1 2 1 1  42 TRP H    A  42 . HN   1 1 
        590 1 1 1 1  39 MET ME   A  39 . HE*  1 1 
        590 1 2 1 1  42 TRP QB   A  42 . HB*  1 1 
        591 1 1 1 1  39 MET ME   A  39 . HE*  1 1 
        591 1 2 1 1  57 TYR HD2  A  57 . HD1  1 1 
        592 1 1 1 1  39 MET HG2  A  39 . HG2  1 1 
        592 1 2 1 1  57 TYR HB2  A  57 . HB2  1 1 
        593 1 1 1 1  39 MET HG3  A  39 . HG1  1 1 
        593 1 2 1 1  40 GLY H    A  40 . HN   1 1 
        594 1 1 1 1  39 MET HG3  A  39 . HG1  1 1 
        594 1 2 1 1  57 TYR HB2  A  57 . HB2  1 1 
        595 1 1 1 1  40 GLY H    A  40 . HN   1 1 
        595 1 2 1 1  62 VAL QG   A  62 . HG*  1 1 
        596 1 1 1 1  40 GLY HA2  A  40 . HA2  1 1 
        596 1 2 1 1  41 GLY QA   A  41 . HA*  1 1 
        597 1 1 1 1  40 GLY HA3  A  40 . HA1  1 1 
        597 1 2 1 1  41 GLY H    A  41 . HN   1 1 
        598 1 1 1 1  40 GLY HA3  A  40 . HA1  1 1 
        598 1 2 1 1  41 GLY HA2  A  41 . HA2  1 1 
        599 1 1 1 1  40 GLY HA3  A  40 . HA1  1 1 
        599 1 2 1 1  41 GLY HA3  A  41 . HA1  1 1 
        600 1 1 1 1  40 GLY HA3  A  40 . HA1  1 1 
        600 1 2 1 1  42 TRP H    A  42 . HN   1 1 
        601 1 1 1 1  41 GLY H    A  41 . HN   1 1 
        601 1 2 1 1  42 TRP H    A  42 . HN   1 1 
        602 1 1 1 1  42 TRP H    A  42 . HN   1 1 
        602 1 2 1 1  42 TRP HB2  A  42 . HB2  1 1 
        603 1 1 1 1  42 TRP H    A  42 . HN   1 1 
        603 1 2 1 1  42 TRP QB   A  42 . HB*  1 1 
        604 1 1 1 1  42 TRP H    A  42 . HN   1 1 
        604 1 2 1 1  42 TRP HB3  A  42 . HB1  1 1 
        605 1 1 1 1  42 TRP H    A  42 . HN   1 1 
        605 1 2 1 1  42 TRP HD1  A  42 . HD1  1 1 
        606 1 1 1 1  42 TRP H    A  42 . HN   1 1 
        606 1 2 1 1  42 TRP HE1  A  42 . HE1  1 1 
        607 1 1 1 1  42 TRP H    A  42 . HN   1 1 
        607 1 2 1 1  43 GLU H    A  43 . HN   1 1 
        608 1 1 1 1  42 TRP H    A  42 . HN   1 1 
        608 1 2 1 1  57 TYR H    A  57 . HN   1 1 
        609 1 1 1 1  42 TRP H    A  42 . HN   1 1 
        609 1 2 1 1  57 TYR HB2  A  57 . HB2  1 1 
        610 1 1 1 1  42 TRP HA   A  42 . HA   1 1 
        610 1 2 1 1  42 TRP HD1  A  42 . HD1  1 1 
        611 1 1 1 1  42 TRP HA   A  42 . HA   1 1 
        611 1 2 1 1  43 GLU H    A  43 . HN   1 1 
        612 1 1 1 1  42 TRP HA   A  42 . HA   1 1 
        612 1 2 1 1 106 ASN HA   A 106 . HA   1 1 
        613 1 1 1 1  42 TRP HA   A  42 . HA   1 1 
        613 1 2 1 1 106 ASN QD   A 106 . HD2* 1 1 
        614 1 1 1 1  42 TRP HA   A  42 . HA   1 1 
        614 1 2 1 1 107 SER H    A 107 . HN   1 1 
        615 1 1 1 1  42 TRP HA   A  42 . HA   1 1 
        615 1 2 1 1 107 SER HA   A 107 . HA   1 1 
        616 1 1 1 1  42 TRP QB   A  42 . HB*  1 1 
        616 1 2 1 1  43 GLU H    A  43 . HN   1 1 
        617 1 1 1 1  42 TRP QB   A  42 . HB*  1 1 
        617 1 2 1 1  57 TYR HD1  A  57 . HD2  1 1 
        618 1 1 1 1  42 TRP HB2  A  42 . HB2  1 1 
        618 1 2 1 1  43 GLU H    A  43 . HN   1 1 
        619 1 1 1 1  42 TRP HB3  A  42 . HB1  1 1 
        619 1 2 1 1  43 GLU H    A  43 . HN   1 1 
        620 1 1 1 1  42 TRP HZ2  A  42 . HZ2  1 1 
        620 1 2 1 1 112 VAL QG   A 112 . HG*  1 1 
        621 1 1 1 1  43 GLU H    A  43 . HN   1 1 
        621 1 2 1 1  43 GLU HB2  A  43 . HB2  1 1 
        622 1 1 1 1  43 GLU H    A  43 . HN   1 1 
        622 1 2 1 1  43 GLU HB3  A  43 . HB1  1 1 
        623 1 1 1 1  43 GLU H    A  43 . HN   1 1 
        623 1 2 1 1 105 LYS H    A 105 . HN   1 1 
        624 1 1 1 1  43 GLU HA   A  43 . HA   1 1 
        624 1 2 1 1  43 GLU HG3  A  43 . HG1  1 1 
        625 1 1 1 1  43 GLU HA   A  43 . HA   1 1 
        625 1 2 1 1  44 MET H    A  44 . HN   1 1 
        626 1 1 1 1  43 GLU HA   A  43 . HA   1 1 
        626 1 2 1 1  55 TYR H    A  55 . HN   1 1 
        627 1 1 1 1  43 GLU HB2  A  43 . HB2  1 1 
        627 1 2 1 1  44 MET H    A  44 . HN   1 1 
        628 1 1 1 1  43 GLU HB2  A  43 . HB2  1 1 
        628 1 2 1 1 105 LYS H    A 105 . HN   1 1 
        629 1 1 1 1  43 GLU HB3  A  43 . HB1  1 1 
        629 1 2 1 1  45 ILE MD   A  45 . HD1* 1 1 
        630 1 1 1 1  43 GLU HB3  A  43 . HB1  1 1 
        630 1 2 1 1 105 LYS H    A 105 . HN   1 1 
        631 1 1 1 1  43 GLU HB3  A  43 . HB1  1 1 
        631 1 2 1 1 105 LYS HB2  A 105 . HB2  1 1 
        632 1 1 1 1  43 GLU HG2  A  43 . HG2  1 1 
        632 1 2 1 1  44 MET H    A  44 . HN   1 1 
        633 1 1 1 1  43 GLU HG2  A  43 . HG2  1 1 
        633 1 2 1 1  45 ILE MD   A  45 . HD1* 1 1 
        634 1 1 1 1  43 GLU HG2  A  43 . HG2  1 1 
        634 1 2 1 1  45 ILE HG12 A  45 . HG12 1 1 
        635 1 1 1 1  43 GLU HG2  A  43 . HG2  1 1 
        635 1 2 1 1  45 ILE HG13 A  45 . HG11 1 1 
        636 1 1 1 1  43 GLU HG2  A  43 . HG2  1 1 
        636 1 2 1 1  54 SER QB   A  54 . HB*  1 1 
        637 1 1 1 1  43 GLU HG2  A  43 . HG2  1 1 
        637 1 2 1 1  55 TYR H    A  55 . HN   1 1 
        638 1 1 1 1  43 GLU HG3  A  43 . HG1  1 1 
        638 1 2 1 1  44 MET H    A  44 . HN   1 1 
        639 1 1 1 1  43 GLU HG3  A  43 . HG1  1 1 
        639 1 2 1 1  45 ILE MD   A  45 . HD1* 1 1 
        640 1 1 1 1  43 GLU HG3  A  43 . HG1  1 1 
        640 1 2 1 1  45 ILE HG13 A  45 . HG11 1 1 
        641 1 1 1 1  43 GLU HG3  A  43 . HG1  1 1 
        641 1 2 1 1  54 SER QB   A  54 . HB*  1 1 
        642 1 1 1 1  43 GLU HG3  A  43 . HG1  1 1 
        642 1 2 1 1  55 TYR H    A  55 . HN   1 1 
        643 1 1 1 1  44 MET H    A  44 . HN   1 1 
        643 1 2 1 1  44 MET QB   A  44 . HB*  1 1 
        644 1 1 1 1  44 MET H    A  44 . HN   1 1 
        644 1 2 1 1  44 MET ME   A  44 . HE*  1 1 
        645 1 1 1 1  44 MET H    A  44 . HN   1 1 
        645 1 2 1 1  54 SER HA   A  54 . HA   1 1 
        646 1 1 1 1  44 MET H    A  44 . HN   1 1 
        646 1 2 1 1  54 SER QB   A  54 . HB*  1 1 
        647 1 1 1 1  44 MET H    A  44 . HN   1 1 
        647 1 2 1 1  55 TYR H    A  55 . HN   1 1 
        648 1 1 1 1  44 MET H    A  44 . HN   1 1 
        648 1 2 1 1  55 TYR HB3  A  55 . HB1  1 1 
        649 1 1 1 1  44 MET H    A  44 . HN   1 1 
        649 1 2 1 1  55 TYR HD2  A  55 . HD2  1 1 
        650 1 1 1 1  44 MET H    A  44 . HN   1 1 
        650 1 2 1 1  57 TYR HD1  A  57 . HD2  1 1 
        651 1 1 1 1  44 MET H    A  44 . HN   1 1 
        651 1 2 1 1  57 TYR QE   A  57 . HE2  1 1 
        652 1 1 1 1  44 MET HA   A  44 . HA   1 1 
        652 1 2 1 1  45 ILE H    A  45 . HN   1 1 
        653 1 1 1 1  44 MET HA   A  44 . HA   1 1 
        653 1 2 1 1  45 ILE MD   A  45 . HD1* 1 1 
        654 1 1 1 1  44 MET HA   A  44 . HA   1 1 
        654 1 2 1 1  45 ILE HG13 A  45 . HG11 1 1 
        655 1 1 1 1  44 MET HA   A  44 . HA   1 1 
        655 1 2 1 1  55 TYR H    A  55 . HN   1 1 
        656 1 1 1 1  44 MET HA   A  44 . HA   1 1 
        656 1 2 1 1  57 TYR QE   A  57 . HE2  1 1 
        657 1 1 1 1  44 MET HA   A  44 . HA   1 1 
        657 1 2 1 1 102 VAL QG   A 102 . HG*  1 1 
        658 1 1 1 1  44 MET HA   A  44 . HA   1 1 
        658 1 2 1 1 104 LEU MD2  A 104 . HD2* 1 1 
        659 1 1 1 1  44 MET HA   A  44 . HA   1 1 
        659 1 2 1 1 104 LEU HG   A 104 . HG   1 1 
        660 1 1 1 1  44 MET QB   A  44 . HB*  1 1 
        660 1 2 1 1  55 TYR H    A  55 . HN   1 1 
        661 1 1 1 1  44 MET QB   A  44 . HB*  1 1 
        661 1 2 1 1  55 TYR HB3  A  55 . HB1  1 1 
        662 1 1 1 1  44 MET QB   A  44 . HB*  1 1 
        662 1 2 1 1  55 TYR HD2  A  55 . HD2  1 1 
        663 1 1 1 1  44 MET QB   A  44 . HB*  1 1 
        663 1 2 1 1  57 TYR QE   A  57 . HE2  1 1 
        664 1 1 1 1  44 MET QB   A  44 . HB*  1 1 
        664 1 2 1 1 102 VAL QG   A 102 . HG*  1 1 
        665 1 1 1 1  44 MET QB   A  44 . HB*  1 1 
        665 1 2 1 1 104 LEU MD2  A 104 . HD2* 1 1 
        666 1 1 1 1  44 MET HB2  A  44 . HB2  1 1 
        666 1 2 1 1  44 MET ME   A  44 . HE*  1 1 
        667 1 1 1 1  44 MET HB2  A  44 . HB2  1 1 
        667 1 2 1 1  57 TYR QE   A  57 . HE2  1 1 
        668 1 1 1 1  44 MET HB2  A  44 . HB2  1 1 
        668 1 2 1 1 104 LEU MD2  A 104 . HD2* 1 1 
        669 1 1 1 1  44 MET HB3  A  44 . HB1  1 1 
        669 1 2 1 1  44 MET ME   A  44 . HE*  1 1 
        670 1 1 1 1  44 MET HB3  A  44 . HB1  1 1 
        670 1 2 1 1  57 TYR QE   A  57 . HE2  1 1 
        671 1 1 1 1  44 MET HB3  A  44 . HB1  1 1 
        671 1 2 1 1 104 LEU MD2  A 104 . HD2* 1 1 
        672 1 1 1 1  44 MET ME   A  44 . HE*  1 1 
        672 1 2 1 1  44 MET HG2  A  44 . HG2  1 1 
        673 1 1 1 1  44 MET ME   A  44 . HE*  1 1 
        673 1 2 1 1  44 MET HG3  A  44 . HG1  1 1 
        674 1 1 1 1  44 MET ME   A  44 . HE*  1 1 
        674 1 2 1 1  45 ILE H    A  45 . HN   1 1 
        675 1 1 1 1  44 MET ME   A  44 . HE*  1 1 
        675 1 2 1 1  55 TYR H    A  55 . HN   1 1 
        676 1 1 1 1  44 MET ME   A  44 . HE*  1 1 
        676 1 2 1 1  55 TYR HB3  A  55 . HB1  1 1 
        677 1 1 1 1  44 MET ME   A  44 . HE*  1 1 
        677 1 2 1 1  55 TYR HD2  A  55 . HD2  1 1 
        678 1 1 1 1  44 MET ME   A  44 . HE*  1 1 
        678 1 2 1 1  71 ILE HB   A  71 . HB   1 1 
        679 1 1 1 1  44 MET ME   A  44 . HE*  1 1 
        679 1 2 1 1  71 ILE MD   A  71 . HD1* 1 1 
        680 1 1 1 1  44 MET ME   A  44 . HE*  1 1 
        680 1 2 1 1  71 ILE HG13 A  71 . HG11 1 1 
        681 1 1 1 1  44 MET ME   A  44 . HE*  1 1 
        681 1 2 1 1  71 ILE MG   A  71 . HG2* 1 1 
        682 1 1 1 1  44 MET ME   A  44 . HE*  1 1 
        682 1 2 1 1  88 TRP HE3  A  88 . HE3  1 1 
        683 1 1 1 1  44 MET ME   A  44 . HE*  1 1 
        683 1 2 1 1  88 TRP HH2  A  88 . HH2  1 1 
        684 1 1 1 1  44 MET ME   A  44 . HE*  1 1 
        684 1 2 1 1  88 TRP HZ2  A  88 . HZ2  1 1 
        685 1 1 1 1  44 MET ME   A  44 . HE*  1 1 
        685 1 2 1 1  88 TRP HZ3  A  88 . HZ3  1 1 
        686 1 1 1 1  44 MET ME   A  44 . HE*  1 1 
        686 1 2 1 1 102 VAL QG   A 102 . HG*  1 1 
        687 1 1 1 1  44 MET HG2  A  44 . HG2  1 1 
        687 1 2 1 1  45 ILE H    A  45 . HN   1 1 
        688 1 1 1 1  44 MET HG2  A  44 . HG2  1 1 
        688 1 2 1 1 102 VAL QG   A 102 . HG*  1 1 
        689 1 1 1 1  44 MET HG2  A  44 . HG2  1 1 
        689 1 2 1 1 103 ILE H    A 103 . HN   1 1 
        690 1 1 1 1  44 MET HG2  A  44 . HG2  1 1 
        690 1 2 1 1 104 LEU MD2  A 104 . HD2* 1 1 
        691 1 1 1 1  44 MET HG2  A  44 . HG2  1 1 
        691 1 2 1 1 104 LEU HG   A 104 . HG   1 1 
        692 1 1 1 1  44 MET HG3  A  44 . HG1  1 1 
        692 1 2 1 1  45 ILE H    A  45 . HN   1 1 
        693 1 1 1 1  44 MET HG3  A  44 . HG1  1 1 
        693 1 2 1 1  57 TYR QE   A  57 . HE2  1 1 
        694 1 1 1 1  44 MET HG3  A  44 . HG1  1 1 
        694 1 2 1 1 102 VAL QG   A 102 . HG*  1 1 
        695 1 1 1 1  44 MET HG3  A  44 . HG1  1 1 
        695 1 2 1 1 103 ILE H    A 103 . HN   1 1 
        696 1 1 1 1  44 MET HG3  A  44 . HG1  1 1 
        696 1 2 1 1 104 LEU MD2  A 104 . HD2* 1 1 
        697 1 1 1 1  44 MET HG3  A  44 . HG1  1 1 
        697 1 2 1 1 104 LEU HG   A 104 . HG   1 1 
        698 1 1 1 1  45 ILE H    A  45 . HN   1 1 
        698 1 2 1 1  45 ILE HB   A  45 . HB   1 1 
        699 1 1 1 1  45 ILE H    A  45 . HN   1 1 
        699 1 2 1 1  45 ILE MD   A  45 . HD1* 1 1 
        700 1 1 1 1  45 ILE H    A  45 . HN   1 1 
        700 1 2 1 1  45 ILE HG12 A  45 . HG12 1 1 
        701 1 1 1 1  45 ILE H    A  45 . HN   1 1 
        701 1 2 1 1  45 ILE HG13 A  45 . HG11 1 1 
        702 1 1 1 1  45 ILE H    A  45 . HN   1 1 
        702 1 2 1 1  45 ILE MG   A  45 . HG2* 1 1 
        703 1 1 1 1  45 ILE H    A  45 . HN   1 1 
        703 1 2 1 1  46 ARG H    A  46 . HN   1 1 
        704 1 1 1 1  45 ILE H    A  45 . HN   1 1 
        704 1 2 1 1 102 VAL HA   A 102 . HA   1 1 
        705 1 1 1 1  45 ILE H    A  45 . HN   1 1 
        705 1 2 1 1 102 VAL QG   A 102 . HG*  1 1 
        706 1 1 1 1  45 ILE H    A  45 . HN   1 1 
        706 1 2 1 1 103 ILE H    A 103 . HN   1 1 
        707 1 1 1 1  45 ILE H    A  45 . HN   1 1 
        707 1 2 1 1 103 ILE HB   A 103 . HB   1 1 
        708 1 1 1 1  45 ILE H    A  45 . HN   1 1 
        708 1 2 1 1 103 ILE MG   A 103 . HG2* 1 1 
        709 1 1 1 1  45 ILE H    A  45 . HN   1 1 
        709 1 2 1 1 104 LEU H    A 104 . HN   1 1 
        710 1 1 1 1  45 ILE H    A  45 . HN   1 1 
        710 1 2 1 1 104 LEU HA   A 104 . HA   1 1 
        711 1 1 1 1  45 ILE H    A  45 . HN   1 1 
        711 1 2 1 1 104 LEU MD2  A 104 . HD2* 1 1 
        712 1 1 1 1  45 ILE HA   A  45 . HA   1 1 
        712 1 2 1 1  45 ILE MD   A  45 . HD1* 1 1 
        713 1 1 1 1  45 ILE HA   A  45 . HA   1 1 
        713 1 2 1 1  45 ILE HG12 A  45 . HG12 1 1 
        714 1 1 1 1  45 ILE HA   A  45 . HA   1 1 
        714 1 2 1 1  45 ILE HG13 A  45 . HG11 1 1 
        715 1 1 1 1  45 ILE HA   A  45 . HA   1 1 
        715 1 2 1 1  46 ARG H    A  46 . HN   1 1 
        716 1 1 1 1  45 ILE HA   A  45 . HA   1 1 
        716 1 2 1 1  53 VAL H    A  53 . HN   1 1 
        717 1 1 1 1  45 ILE HA   A  45 . HA   1 1 
        717 1 2 1 1  54 SER H    A  54 . HN   1 1 
        718 1 1 1 1  45 ILE HA   A  45 . HA   1 1 
        718 1 2 1 1  54 SER HA   A  54 . HA   1 1 
        719 1 1 1 1  45 ILE HA   A  45 . HA   1 1 
        719 1 2 1 1  54 SER HB2  A  54 . HB2  1 1 
        720 1 1 1 1  45 ILE HA   A  45 . HA   1 1 
        720 1 2 1 1  54 SER QB   A  54 . HB*  1 1 
        721 1 1 1 1  45 ILE HA   A  45 . HA   1 1 
        721 1 2 1 1  54 SER HB3  A  54 . HB1  1 1 
        722 1 1 1 1  45 ILE HA   A  45 . HA   1 1 
        722 1 2 1 1  55 TYR H    A  55 . HN   1 1 
        723 1 1 1 1  45 ILE HB   A  45 . HB   1 1 
        723 1 2 1 1  46 ARG H    A  46 . HN   1 1 
        724 1 1 1 1  45 ILE HB   A  45 . HB   1 1 
        724 1 2 1 1 103 ILE H    A 103 . HN   1 1 
        725 1 1 1 1  45 ILE MD   A  45 . HD1* 1 1 
        725 1 2 1 1  54 SER QB   A  54 . HB*  1 1 
        726 1 1 1 1  45 ILE MD   A  45 . HD1* 1 1 
        726 1 2 1 1 103 ILE HB   A 103 . HB   1 1 
        727 1 1 1 1  45 ILE MD   A  45 . HD1* 1 1 
        727 1 2 1 1 104 LEU HA   A 104 . HA   1 1 
        728 1 1 1 1  45 ILE MD   A  45 . HD1* 1 1 
        728 1 2 1 1 105 LYS H    A 105 . HN   1 1 
        729 1 1 1 1  45 ILE HG12 A  45 . HG12 1 1 
        729 1 2 1 1  45 ILE MG   A  45 . HG2* 1 1 
        730 1 1 1 1  45 ILE HG12 A  45 . HG12 1 1 
        730 1 2 1 1  46 ARG H    A  46 . HN   1 1 
        731 1 1 1 1  45 ILE HG12 A  45 . HG12 1 1 
        731 1 2 1 1  54 SER HB2  A  54 . HB2  1 1 
        732 1 1 1 1  45 ILE HG12 A  45 . HG12 1 1 
        732 1 2 1 1  54 SER QB   A  54 . HB*  1 1 
        733 1 1 1 1  45 ILE HG12 A  45 . HG12 1 1 
        733 1 2 1 1  54 SER HB3  A  54 . HB1  1 1 
        734 1 1 1 1  45 ILE HG13 A  45 . HG11 1 1 
        734 1 2 1 1  46 ARG H    A  46 . HN   1 1 
        735 1 1 1 1  45 ILE HG13 A  45 . HG11 1 1 
        735 1 2 1 1  54 SER HA   A  54 . HA   1 1 
        736 1 1 1 1  45 ILE HG13 A  45 . HG11 1 1 
        736 1 2 1 1  54 SER QB   A  54 . HB*  1 1 
        737 1 1 1 1  45 ILE MG   A  45 . HG2* 1 1 
        737 1 2 1 1  46 ARG H    A  46 . HN   1 1 
        738 1 1 1 1  45 ILE MG   A  45 . HG2* 1 1 
        738 1 2 1 1  46 ARG HA   A  46 . HA   1 1 
        739 1 1 1 1  45 ILE MG   A  45 . HG2* 1 1 
        739 1 2 1 1  47 LYS HD2  A  47 . HD2  1 1 
        740 1 1 1 1  45 ILE MG   A  45 . HG2* 1 1 
        740 1 2 1 1  47 LYS QD   A  47 . HD*  1 1 
        741 1 1 1 1  45 ILE MG   A  45 . HG2* 1 1 
        741 1 2 1 1  47 LYS HD3  A  47 . HD1  1 1 
        742 1 1 1 1  45 ILE MG   A  45 . HG2* 1 1 
        742 1 2 1 1  47 LYS HG2  A  47 . HG2  1 1 
        743 1 1 1 1  45 ILE MG   A  45 . HG2* 1 1 
        743 1 2 1 1  47 LYS QG   A  47 . HG*  1 1 
        744 1 1 1 1  45 ILE MG   A  45 . HG2* 1 1 
        744 1 2 1 1  47 LYS HG3  A  47 . HG1  1 1 
        745 1 1 1 1  45 ILE MG   A  45 . HG2* 1 1 
        745 1 2 1 1  52 SER HA   A  52 . HA   1 1 
        746 1 1 1 1  45 ILE MG   A  45 . HG2* 1 1 
        746 1 2 1 1  52 SER HB2  A  52 . HB2  1 1 
        747 1 1 1 1  45 ILE MG   A  45 . HG2* 1 1 
        747 1 2 1 1  53 VAL H    A  53 . HN   1 1 
        748 1 1 1 1  45 ILE MG   A  45 . HG2* 1 1 
        748 1 2 1 1  54 SER HA   A  54 . HA   1 1 
        749 1 1 1 1  45 ILE MG   A  45 . HG2* 1 1 
        749 1 2 1 1  54 SER QB   A  54 . HB*  1 1 
        750 1 1 1 1  45 ILE MG   A  45 . HG2* 1 1 
        750 1 2 1 1 103 ILE H    A 103 . HN   1 1 
        751 1 1 1 1  46 ARG H    A  46 . HN   1 1 
        751 1 2 1 1  46 ARG HB2  A  46 . HB2  1 1 
        752 1 1 1 1  46 ARG H    A  46 . HN   1 1 
        752 1 2 1 1  46 ARG QB   A  46 . HB*  1 1 
        753 1 1 1 1  46 ARG H    A  46 . HN   1 1 
        753 1 2 1 1  46 ARG HB3  A  46 . HB1  1 1 
        754 1 1 1 1  46 ARG H    A  46 . HN   1 1 
        754 1 2 1 1  47 LYS H    A  47 . HN   1 1 
        755 1 1 1 1  46 ARG H    A  46 . HN   1 1 
        755 1 2 1 1  47 LYS HA   A  47 . HA   1 1 
        756 1 1 1 1  46 ARG H    A  46 . HN   1 1 
        756 1 2 1 1  52 SER HA   A  52 . HA   1 1 
        757 1 1 1 1  46 ARG H    A  46 . HN   1 1 
        757 1 2 1 1  53 VAL H    A  53 . HN   1 1 
        758 1 1 1 1  46 ARG H    A  46 . HN   1 1 
        758 1 2 1 1  53 VAL MG1  A  53 . HG1* 1 1 
        759 1 1 1 1  46 ARG H    A  46 . HN   1 1 
        759 1 2 1 1  54 SER HA   A  54 . HA   1 1 
        760 1 1 1 1  46 ARG H    A  46 . HN   1 1 
        760 1 2 1 1  88 TRP HH2  A  88 . HH2  1 1 
        761 1 1 1 1  46 ARG H    A  46 . HN   1 1 
        761 1 2 1 1 103 ILE H    A 103 . HN   1 1 
        762 1 1 1 1  46 ARG HA   A  46 . HA   1 1 
        762 1 2 1 1  47 LYS H    A  47 . HN   1 1 
        763 1 1 1 1  46 ARG HA   A  46 . HA   1 1 
        763 1 2 1 1  47 LYS QG   A  47 . HG*  1 1 
        764 1 1 1 1  46 ARG HA   A  46 . HA   1 1 
        764 1 2 1 1 100 VAL MG2  A 100 . HG2* 1 1 
        765 1 1 1 1  46 ARG HA   A  46 . HA   1 1 
        765 1 2 1 1 102 VAL HA   A 102 . HA   1 1 
        766 1 1 1 1  46 ARG HA   A  46 . HA   1 1 
        766 1 2 1 1 102 VAL MG1  A 102 . HG1* 1 1 
        767 1 1 1 1  46 ARG HA   A  46 . HA   1 1 
        767 1 2 1 1 102 VAL QG   A 102 . HG*  1 1 
        768 1 1 1 1  46 ARG HA   A  46 . HA   1 1 
        768 1 2 1 1 102 VAL MG2  A 102 . HG2* 1 1 
        769 1 1 1 1  46 ARG HA   A  46 . HA   1 1 
        769 1 2 1 1 103 ILE H    A 103 . HN   1 1 
        770 1 1 1 1  46 ARG QB   A  46 . HB*  1 1 
        770 1 2 1 1  46 ARG HE   A  46 . HE   1 1 
        771 1 1 1 1  46 ARG QB   A  46 . HB*  1 1 
        771 1 2 1 1  47 LYS H    A  47 . HN   1 1 
        772 1 1 1 1  46 ARG QB   A  46 . HB*  1 1 
        772 1 2 1 1  53 VAL MG1  A  53 . HG1* 1 1 
        773 1 1 1 1  46 ARG QB   A  46 . HB*  1 1 
        773 1 2 1 1  88 TRP HZ2  A  88 . HZ2  1 1 
        774 1 1 1 1  46 ARG QB   A  46 . HB*  1 1 
        774 1 2 1 1  88 TRP HZ3  A  88 . HZ3  1 1 
        775 1 1 1 1  46 ARG QB   A  46 . HB*  1 1 
        775 1 2 1 1 100 VAL MG2  A 100 . HG2* 1 1 
        776 1 1 1 1  46 ARG QB   A  46 . HB*  1 1 
        776 1 2 1 1 102 VAL QG   A 102 . HG*  1 1 
        777 1 1 1 1  46 ARG HB2  A  46 . HB2  1 1 
        777 1 2 1 1  46 ARG HE   A  46 . HE   1 1 
        778 1 1 1 1  46 ARG HB2  A  46 . HB2  1 1 
        778 1 2 1 1  47 LYS H    A  47 . HN   1 1 
        779 1 1 1 1  46 ARG HB2  A  46 . HB2  1 1 
        779 1 2 1 1  53 VAL MG1  A  53 . HG1* 1 1 
        780 1 1 1 1  46 ARG HB2  A  46 . HB2  1 1 
        780 1 2 1 1  88 TRP HH2  A  88 . HH2  1 1 
        781 1 1 1 1  46 ARG HB3  A  46 . HB1  1 1 
        781 1 2 1 1  46 ARG HE   A  46 . HE   1 1 
        782 1 1 1 1  46 ARG HB3  A  46 . HB1  1 1 
        782 1 2 1 1  47 LYS H    A  47 . HN   1 1 
        783 1 1 1 1  46 ARG HB3  A  46 . HB1  1 1 
        783 1 2 1 1  53 VAL MG1  A  53 . HG1* 1 1 
        784 1 1 1 1  46 ARG HB3  A  46 . HB1  1 1 
        784 1 2 1 1  88 TRP HH2  A  88 . HH2  1 1 
        785 1 1 1 1  46 ARG HE   A  46 . HE   1 1 
        785 1 2 1 1 100 VAL HB   A 100 . HB   1 1 
        786 1 1 1 1  46 ARG HE   A  46 . HE   1 1 
        786 1 2 1 1 100 VAL MG2  A 100 . HG2* 1 1 
        787 1 1 1 1  46 ARG QG   A  46 . HG*  1 1 
        787 1 2 1 1  47 LYS H    A  47 . HN   1 1 
        788 1 1 1 1  46 ARG QG   A  46 . HG*  1 1 
        788 1 2 1 1  88 TRP HH2  A  88 . HH2  1 1 
        789 1 1 1 1  46 ARG QG   A  46 . HG*  1 1 
        789 1 2 1 1 100 VAL MG2  A 100 . HG2* 1 1 
        790 1 1 1 1  46 ARG QG   A  46 . HG*  1 1 
        790 1 2 1 1 102 VAL HA   A 102 . HA   1 1 
        791 1 1 1 1  47 LYS H    A  47 . HN   1 1 
        791 1 2 1 1  47 LYS HB2  A  47 . HB2  1 1 
        792 1 1 1 1  47 LYS H    A  47 . HN   1 1 
        792 1 2 1 1  47 LYS QB   A  47 . HB*  1 1 
        793 1 1 1 1  47 LYS H    A  47 . HN   1 1 
        793 1 2 1 1  47 LYS HB3  A  47 . HB1  1 1 
        794 1 1 1 1  47 LYS H    A  47 . HN   1 1 
        794 1 2 1 1  47 LYS QG   A  47 . HG*  1 1 
        795 1 1 1 1  47 LYS H    A  47 . HN   1 1 
        795 1 2 1 1  48 ILE H    A  48 . HN   1 1 
        796 1 1 1 1  47 LYS H    A  47 . HN   1 1 
        796 1 2 1 1 100 VAL MG2  A 100 . HG2* 1 1 
        797 1 1 1 1  47 LYS H    A  47 . HN   1 1 
        797 1 2 1 1 101 LYS H    A 101 . HN   1 1 
        798 1 1 1 1  47 LYS H    A  47 . HN   1 1 
        798 1 2 1 1 101 LYS QB   A 101 . HB*  1 1 
        799 1 1 1 1  47 LYS H    A  47 . HN   1 1 
        799 1 2 1 1 102 VAL H    A 102 . HN   1 1 
        800 1 1 1 1  47 LYS H    A  47 . HN   1 1 
        800 1 2 1 1 102 VAL HA   A 102 . HA   1 1 
        801 1 1 1 1  47 LYS H    A  47 . HN   1 1 
        801 1 2 1 1 103 ILE H    A 103 . HN   1 1 
        802 1 1 1 1  47 LYS HA   A  47 . HA   1 1 
        802 1 2 1 1  47 LYS QG   A  47 . HG*  1 1 
        803 1 1 1 1  47 LYS HA   A  47 . HA   1 1 
        803 1 2 1 1  48 ILE H    A  48 . HN   1 1 
        804 1 1 1 1  47 LYS HA   A  47 . HA   1 1 
        804 1 2 1 1  48 ILE MG   A  48 . HG2* 1 1 
        805 1 1 1 1  47 LYS HA   A  47 . HA   1 1 
        805 1 2 1 1  51 THR H    A  51 . HN   1 1 
        806 1 1 1 1  47 LYS HA   A  47 . HA   1 1 
        806 1 2 1 1  53 VAL H    A  53 . HN   1 1 
        807 1 1 1 1  47 LYS QB   A  47 . HB*  1 1 
        807 1 2 1 1  47 LYS QE   A  47 . HE*  1 1 
        808 1 1 1 1  47 LYS HB2  A  47 . HB2  1 1 
        808 1 2 1 1  48 ILE H    A  48 . HN   1 1 
        809 1 1 1 1  47 LYS HB3  A  47 . HB1  1 1 
        809 1 2 1 1  48 ILE H    A  48 . HN   1 1 
        810 1 1 1 1  47 LYS QE   A  47 . HE*  1 1 
        810 1 2 1 1  47 LYS QG   A  47 . HG*  1 1 
        811 1 1 1 1  47 LYS QG   A  47 . HG*  1 1 
        811 1 2 1 1  48 ILE H    A  48 . HN   1 1 
        812 1 1 1 1  47 LYS QG   A  47 . HG*  1 1 
        812 1 2 1 1  52 SER HA   A  52 . HA   1 1 
        813 1 1 1 1  47 LYS QG   A  47 . HG*  1 1 
        813 1 2 1 1  52 SER HB2  A  52 . HB2  1 1 
        814 1 1 1 1  47 LYS QG   A  47 . HG*  1 1 
        814 1 2 1 1  52 SER HB3  A  52 . HB1  1 1 
        815 1 1 1 1  47 LYS QG   A  47 . HG*  1 1 
        815 1 2 1 1  53 VAL H    A  53 . HN   1 1 
        816 1 1 1 1  48 ILE H    A  48 . HN   1 1 
        816 1 2 1 1  48 ILE HB   A  48 . HB   1 1 
        817 1 1 1 1  48 ILE H    A  48 . HN   1 1 
        817 1 2 1 1  48 ILE MD   A  48 . HD1* 1 1 
        818 1 1 1 1  48 ILE H    A  48 . HN   1 1 
        818 1 2 1 1  48 ILE HG12 A  48 . HG12 1 1 
        819 1 1 1 1  48 ILE H    A  48 . HN   1 1 
        819 1 2 1 1  48 ILE QG   A  48 . HG1* 1 1 
        820 1 1 1 1  48 ILE H    A  48 . HN   1 1 
        820 1 2 1 1  48 ILE HG13 A  48 . HG11 1 1 
        821 1 1 1 1  48 ILE H    A  48 . HN   1 1 
        821 1 2 1 1  48 ILE MG   A  48 . HG2* 1 1 
        822 1 1 1 1  48 ILE H    A  48 . HN   1 1 
        822 1 2 1 1  49 GLY H    A  49 . HN   1 1 
        823 1 1 1 1  48 ILE H    A  48 . HN   1 1 
        823 1 2 1 1  51 THR H    A  51 . HN   1 1 
        824 1 1 1 1  48 ILE H    A  48 . HN   1 1 
        824 1 2 1 1  51 THR MG   A  51 . HG2* 1 1 
        825 1 1 1 1  48 ILE H    A  48 . HN   1 1 
        825 1 2 1 1 100 VAL MG2  A 100 . HG2* 1 1 
        826 1 1 1 1  48 ILE HA   A  48 . HA   1 1 
        826 1 2 1 1  48 ILE MD   A  48 . HD1* 1 1 
        827 1 1 1 1  48 ILE HA   A  48 . HA   1 1 
        827 1 2 1 1  48 ILE HG12 A  48 . HG12 1 1 
        828 1 1 1 1  48 ILE HA   A  48 . HA   1 1 
        828 1 2 1 1  48 ILE QG   A  48 . HG1* 1 1 
        829 1 1 1 1  48 ILE HA   A  48 . HA   1 1 
        829 1 2 1 1  48 ILE HG13 A  48 . HG11 1 1 
        830 1 1 1 1  48 ILE HA   A  48 . HA   1 1 
        830 1 2 1 1  48 ILE MG   A  48 . HG2* 1 1 
        831 1 1 1 1  48 ILE HA   A  48 . HA   1 1 
        831 1 2 1 1  49 GLY H    A  49 . HN   1 1 
        832 1 1 1 1  48 ILE HA   A  48 . HA   1 1 
        832 1 2 1 1 100 VAL MG2  A 100 . HG2* 1 1 
        833 1 1 1 1  48 ILE HB   A  48 . HB   1 1 
        833 1 2 1 1  48 ILE MD   A  48 . HD1* 1 1 
        834 1 1 1 1  48 ILE HB   A  48 . HB   1 1 
        834 1 2 1 1  49 GLY H    A  49 . HN   1 1 
        835 1 1 1 1  48 ILE HB   A  48 . HB   1 1 
        835 1 2 1 1 100 VAL HA   A 100 . HA   1 1 
        836 1 1 1 1  48 ILE HB   A  48 . HB   1 1 
        836 1 2 1 1 100 VAL MG2  A 100 . HG2* 1 1 
        837 1 1 1 1  48 ILE MD   A  48 . HD1* 1 1 
        837 1 2 1 1  48 ILE MG   A  48 . HG2* 1 1 
        838 1 1 1 1  48 ILE MD   A  48 . HD1* 1 1 
        838 1 2 1 1  94 TRP HB2  A  94 . HB2  1 1 
        839 1 1 1 1  48 ILE MD   A  48 . HD1* 1 1 
        839 1 2 1 1  94 TRP HB3  A  94 . HB1  1 1 
        840 1 1 1 1  48 ILE MD   A  48 . HD1* 1 1 
        840 1 2 1 1  94 TRP HD1  A  94 . HD1  1 1 
        841 1 1 1 1  48 ILE MD   A  48 . HD1* 1 1 
        841 1 2 1 1  95 GLY H    A  95 . HN   1 1 
        842 1 1 1 1  48 ILE MD   A  48 . HD1* 1 1 
        842 1 2 1 1 100 VAL HA   A 100 . HA   1 1 
        843 1 1 1 1  48 ILE MD   A  48 . HD1* 1 1 
        843 1 2 1 1 100 VAL HB   A 100 . HB   1 1 
        844 1 1 1 1  48 ILE QG   A  48 . HG1* 1 1 
        844 1 2 1 1  48 ILE MG   A  48 . HG2* 1 1 
        845 1 1 1 1  48 ILE QG   A  48 . HG1* 1 1 
        845 1 2 1 1  49 GLY H    A  49 . HN   1 1 
        846 1 1 1 1  48 ILE QG   A  48 . HG1* 1 1 
        846 1 2 1 1 100 VAL HA   A 100 . HA   1 1 
        847 1 1 1 1  48 ILE QG   A  48 . HG1* 1 1 
        847 1 2 1 1 100 VAL MG2  A 100 . HG2* 1 1 
        848 1 1 1 1  48 ILE MG   A  48 . HG2* 1 1 
        848 1 2 1 1  49 GLY H    A  49 . HN   1 1 
        849 1 1 1 1  48 ILE MG   A  48 . HG2* 1 1 
        849 1 2 1 1  49 GLY QA   A  49 . HA*  1 1 
        850 1 1 1 1  48 ILE MG   A  48 . HG2* 1 1 
        850 1 2 1 1  50 ASP H    A  50 . HN   1 1 
        851 1 1 1 1  48 ILE MG   A  48 . HG2* 1 1 
        851 1 2 1 1  51 THR MG   A  51 . HG2* 1 1 
        852 1 1 1 1  48 ILE MG   A  48 . HG2* 1 1 
        852 1 2 1 1  94 TRP QB   A  94 . HB*  1 1 
        853 1 1 1 1  48 ILE MG   A  48 . HG2* 1 1 
        853 1 2 1 1 100 VAL HA   A 100 . HA   1 1 
        854 1 1 1 1  49 GLY H    A  49 . HN   1 1 
        854 1 2 1 1  50 ASP H    A  50 . HN   1 1 
        855 1 1 1 1  49 GLY QA   A  49 . HA*  1 1 
        855 1 2 1 1  50 ASP H    A  50 . HN   1 1 
        856 1 1 1 1  49 GLY QA   A  49 . HA*  1 1 
        856 1 2 1 1  51 THR H    A  51 . HN   1 1 
        857 1 1 1 1  50 ASP H    A  50 . HN   1 1 
        857 1 2 1 1  50 ASP HB2  A  50 . HB2  1 1 
        858 1 1 1 1  50 ASP H    A  50 . HN   1 1 
        858 1 2 1 1  50 ASP QB   A  50 . HB*  1 1 
        859 1 1 1 1  50 ASP H    A  50 . HN   1 1 
        859 1 2 1 1  50 ASP HB3  A  50 . HB1  1 1 
        860 1 1 1 1  50 ASP H    A  50 . HN   1 1 
        860 1 2 1 1  51 THR H    A  51 . HN   1 1 
        861 1 1 1 1  50 ASP H    A  50 . HN   1 1 
        861 1 2 1 1  51 THR HB   A  51 . HB   1 1 
        862 1 1 1 1  50 ASP H    A  50 . HN   1 1 
        862 1 2 1 1  51 THR MG   A  51 . HG2* 1 1 
        863 1 1 1 1  50 ASP HA   A  50 . HA   1 1 
        863 1 2 1 1  51 THR H    A  51 . HN   1 1 
        864 1 1 1 1  50 ASP HA   A  50 . HA   1 1 
        864 1 2 1 1  51 THR HA   A  51 . HA   1 1 
        865 1 1 1 1  50 ASP QB   A  50 . HB*  1 1 
        865 1 2 1 1  51 THR H    A  51 . HN   1 1 
        866 1 1 1 1  50 ASP HB2  A  50 . HB2  1 1 
        866 1 2 1 1  51 THR H    A  51 . HN   1 1 
        867 1 1 1 1  50 ASP HB3  A  50 . HB1  1 1 
        867 1 2 1 1  51 THR H    A  51 . HN   1 1 
        868 1 1 1 1  51 THR H    A  51 . HN   1 1 
        868 1 2 1 1  51 THR HB   A  51 . HB   1 1 
        869 1 1 1 1  51 THR H    A  51 . HN   1 1 
        869 1 2 1 1  51 THR MG   A  51 . HG2* 1 1 
        870 1 1 1 1  51 THR H    A  51 . HN   1 1 
        870 1 2 1 1  52 SER H    A  52 . HN   1 1 
        871 1 1 1 1  51 THR HA   A  51 . HA   1 1 
        871 1 2 1 1  51 THR MG   A  51 . HG2* 1 1 
        872 1 1 1 1  51 THR HA   A  51 . HA   1 1 
        872 1 2 1 1  52 SER H    A  52 . HN   1 1 
        873 1 1 1 1  51 THR HA   A  51 . HA   1 1 
        873 1 2 1 1  52 SER HB3  A  52 . HB1  1 1 
        874 1 1 1 1  51 THR HB   A  51 . HB   1 1 
        874 1 2 1 1  52 SER H    A  52 . HN   1 1 
        875 1 1 1 1  51 THR MG   A  51 . HG2* 1 1 
        875 1 2 1 1  52 SER H    A  52 . HN   1 1 
        876 1 1 1 1  51 THR MG   A  51 . HG2* 1 1 
        876 1 2 1 1  52 SER HA   A  52 . HA   1 1 
        877 1 1 1 1  51 THR MG   A  51 . HG2* 1 1 
        877 1 2 1 1  53 VAL H    A  53 . HN   1 1 
        878 1 1 1 1  52 SER H    A  52 . HN   1 1 
        878 1 2 1 1  52 SER HB3  A  52 . HB1  1 1 
        879 1 1 1 1  52 SER H    A  52 . HN   1 1 
        879 1 2 1 1  53 VAL H    A  53 . HN   1 1 
        880 1 1 1 1  52 SER HA   A  52 . HA   1 1 
        880 1 2 1 1  53 VAL H    A  53 . HN   1 1 
        881 1 1 1 1  52 SER HB2  A  52 . HB2  1 1 
        881 1 2 1 1  53 VAL H    A  53 . HN   1 1 
        882 1 1 1 1  52 SER HB2  A  52 . HB2  1 1 
        882 1 2 1 1  53 VAL HA   A  53 . HA   1 1 
        883 1 1 1 1  53 VAL H    A  53 . HN   1 1 
        883 1 2 1 1  53 VAL HB   A  53 . HB   1 1 
        884 1 1 1 1  53 VAL H    A  53 . HN   1 1 
        884 1 2 1 1  53 VAL MG1  A  53 . HG1* 1 1 
        885 1 1 1 1  53 VAL H    A  53 . HN   1 1 
        885 1 2 1 1  53 VAL MG2  A  53 . HG2* 1 1 
        886 1 1 1 1  53 VAL H    A  53 . HN   1 1 
        886 1 2 1 1  54 SER H    A  54 . HN   1 1 
        887 1 1 1 1  53 VAL HA   A  53 . HA   1 1 
        887 1 2 1 1  53 VAL MG1  A  53 . HG1* 1 1 
        888 1 1 1 1  53 VAL HA   A  53 . HA   1 1 
        888 1 2 1 1  54 SER H    A  54 . HN   1 1 
        889 1 1 1 1  53 VAL HA   A  53 . HA   1 1 
        889 1 2 1 1  54 SER QB   A  54 . HB*  1 1 
        890 1 1 1 1  53 VAL HB   A  53 . HB   1 1 
        890 1 2 1 1  54 SER H    A  54 . HN   1 1 
        891 1 1 1 1  53 VAL HB   A  53 . HB   1 1 
        891 1 2 1 1  88 TRP HZ2  A  88 . HZ2  1 1 
        892 1 1 1 1  53 VAL HB   A  53 . HB   1 1 
        892 1 2 1 1  91 GLN HE22 A  91 . HE22 1 1 
        893 1 1 1 1  53 VAL MG1  A  53 . HG1* 1 1 
        893 1 2 1 1  54 SER H    A  54 . HN   1 1 
        894 1 1 1 1  53 VAL MG1  A  53 . HG1* 1 1 
        894 1 2 1 1  54 SER HA   A  54 . HA   1 1 
        895 1 1 1 1  53 VAL MG1  A  53 . HG1* 1 1 
        895 1 2 1 1  88 TRP HE1  A  88 . HE1  1 1 
        896 1 1 1 1  53 VAL MG1  A  53 . HG1* 1 1 
        896 1 2 1 1  88 TRP HH2  A  88 . HH2  1 1 
        897 1 1 1 1  53 VAL MG1  A  53 . HG1* 1 1 
        897 1 2 1 1  88 TRP HZ2  A  88 . HZ2  1 1 
        898 1 1 1 1  53 VAL MG1  A  53 . HG1* 1 1 
        898 1 2 1 1  91 GLN QB   A  91 . HB*  1 1 
        899 1 1 1 1  53 VAL MG1  A  53 . HG1* 1 1 
        899 1 2 1 1  91 GLN HE21 A  91 . HE21 1 1 
        900 1 1 1 1  53 VAL MG1  A  53 . HG1* 1 1 
        900 1 2 1 1  91 GLN QE   A  91 . HE*  1 1 
        901 1 1 1 1  53 VAL MG1  A  53 . HG1* 1 1 
        901 1 2 1 1  91 GLN HE22 A  91 . HE22 1 1 
        902 1 1 1 1  53 VAL MG2  A  53 . HG2* 1 1 
        902 1 2 1 1  54 SER H    A  54 . HN   1 1 
        903 1 1 1 1  53 VAL MG2  A  53 . HG2* 1 1 
        903 1 2 1 1  54 SER HA   A  54 . HA   1 1 
        904 1 1 1 1  53 VAL MG2  A  53 . HG2* 1 1 
        904 1 2 1 1  54 SER QB   A  54 . HB*  1 1 
        905 1 1 1 1  53 VAL MG2  A  53 . HG2* 1 1 
        905 1 2 1 1  88 TRP HE1  A  88 . HE1  1 1 
        906 1 1 1 1  53 VAL MG2  A  53 . HG2* 1 1 
        906 1 2 1 1  88 TRP HH2  A  88 . HH2  1 1 
        907 1 1 1 1  53 VAL MG2  A  53 . HG2* 1 1 
        907 1 2 1 1  88 TRP HZ2  A  88 . HZ2  1 1 
        908 1 1 1 1  53 VAL MG2  A  53 . HG2* 1 1 
        908 1 2 1 1  91 GLN H    A  91 . HN   1 1 
        909 1 1 1 1  53 VAL MG2  A  53 . HG2* 1 1 
        909 1 2 1 1  91 GLN HB2  A  91 . HB2  1 1 
        910 1 1 1 1  53 VAL MG2  A  53 . HG2* 1 1 
        910 1 2 1 1  91 GLN QB   A  91 . HB*  1 1 
        911 1 1 1 1  53 VAL MG2  A  53 . HG2* 1 1 
        911 1 2 1 1  91 GLN HB3  A  91 . HB1  1 1 
        912 1 1 1 1  53 VAL MG2  A  53 . HG2* 1 1 
        912 1 2 1 1  91 GLN QG   A  91 . HG*  1 1 
        913 1 1 1 1  54 SER H    A  54 . HN   1 1 
        913 1 2 1 1  54 SER QB   A  54 . HB*  1 1 
        914 1 1 1 1  54 SER H    A  54 . HN   1 1 
        914 1 2 1 1  55 TYR H    A  55 . HN   1 1 
        915 1 1 1 1  54 SER H    A  54 . HN   1 1 
        915 1 2 1 1  88 TRP HZ2  A  88 . HZ2  1 1 
        916 1 1 1 1  54 SER HA   A  54 . HA   1 1 
        916 1 2 1 1  55 TYR H    A  55 . HN   1 1 
        917 1 1 1 1  54 SER HA   A  54 . HA   1 1 
        917 1 2 1 1  88 TRP HZ2  A  88 . HZ2  1 1 
        918 1 1 1 1  54 SER QB   A  54 . HB*  1 1 
        918 1 2 1 1  55 TYR H    A  55 . HN   1 1 
        919 1 1 1 1  55 TYR H    A  55 . HN   1 1 
        919 1 2 1 1  55 TYR HB2  A  55 . HB2  1 1 
        920 1 1 1 1  55 TYR H    A  55 . HN   1 1 
        920 1 2 1 1  55 TYR HB3  A  55 . HB1  1 1 
        921 1 1 1 1  55 TYR H    A  55 . HN   1 1 
        921 1 2 1 1  55 TYR HD2  A  55 . HD2  1 1 
        922 1 1 1 1  55 TYR H    A  55 . HN   1 1 
        922 1 2 1 1  56 LYS H    A  56 . HN   1 1 
        923 1 1 1 1  55 TYR H    A  55 . HN   1 1 
        923 1 2 1 1  88 TRP HE1  A  88 . HE1  1 1 
        924 1 1 1 1  55 TYR H    A  55 . HN   1 1 
        924 1 2 1 1  88 TRP HZ2  A  88 . HZ2  1 1 
        925 1 1 1 1  55 TYR HA   A  55 . HA   1 1 
        925 1 2 1 1  55 TYR HD1  A  55 . HD1  1 1 
        926 1 1 1 1  55 TYR HA   A  55 . HA   1 1 
        926 1 2 1 1  56 LYS H    A  56 . HN   1 1 
        927 1 1 1 1  55 TYR HA   A  55 . HA   1 1 
        927 1 2 1 1  88 TRP HE1  A  88 . HE1  1 1 
        928 1 1 1 1  55 TYR HB2  A  55 . HB2  1 1 
        928 1 2 1 1  55 TYR HD1  A  55 . HD1  1 1 
        929 1 1 1 1  55 TYR HB2  A  55 . HB2  1 1 
        929 1 2 1 1  56 LYS H    A  56 . HN   1 1 
        930 1 1 1 1  55 TYR HB2  A  55 . HB2  1 1 
        930 1 2 1 1  88 TRP HD1  A  88 . HD1  1 1 
        931 1 1 1 1  55 TYR HB2  A  55 . HB2  1 1 
        931 1 2 1 1  88 TRP HE1  A  88 . HE1  1 1 
        932 1 1 1 1  55 TYR HB2  A  55 . HB2  1 1 
        932 1 2 1 1  88 TRP HZ2  A  88 . HZ2  1 1 
        933 1 1 1 1  55 TYR HB3  A  55 . HB1  1 1 
        933 1 2 1 1  55 TYR HD2  A  55 . HD2  1 1 
        934 1 1 1 1  55 TYR HB3  A  55 . HB1  1 1 
        934 1 2 1 1  55 TYR HE2  A  55 . HE2  1 1 
        935 1 1 1 1  55 TYR HB3  A  55 . HB1  1 1 
        935 1 2 1 1  56 LYS H    A  56 . HN   1 1 
        936 1 1 1 1  55 TYR HB3  A  55 . HB1  1 1 
        936 1 2 1 1  88 TRP HE1  A  88 . HE1  1 1 
        937 1 1 1 1  55 TYR HB3  A  55 . HB1  1 1 
        937 1 2 1 1  88 TRP HZ2  A  88 . HZ2  1 1 
        938 1 1 1 1  55 TYR HD1  A  55 . HD1  1 1 
        938 1 2 1 1  56 LYS H    A  56 . HN   1 1 
        939 1 1 1 1  55 TYR HD1  A  55 . HD1  1 1 
        939 1 2 1 1  88 TRP HA   A  88 . HA   1 1 
        940 1 1 1 1  55 TYR HD1  A  55 . HD1  1 1 
        940 1 2 1 1  88 TRP HD1  A  88 . HD1  1 1 
        941 1 1 1 1  55 TYR HD1  A  55 . HD1  1 1 
        941 1 2 1 1  88 TRP HE1  A  88 . HE1  1 1 
        942 1 1 1 1  55 TYR HD1  A  55 . HD1  1 1 
        942 1 2 1 1  89 LYS H    A  89 . HN   1 1 
        943 1 1 1 1  55 TYR HD1  A  55 . HD1  1 1 
        943 1 2 1 1  90 ASN H    A  90 . HN   1 1 
        944 1 1 1 1  55 TYR HD2  A  55 . HD2  1 1 
        944 1 2 1 1  57 TYR H    A  57 . HN   1 1 
        945 1 1 1 1  55 TYR HD2  A  55 . HD2  1 1 
        945 1 2 1 1  57 TYR HA   A  57 . HA   1 1 
        946 1 1 1 1  55 TYR HD2  A  55 . HD2  1 1 
        946 1 2 1 1  57 TYR HD1  A  57 . HD2  1 1 
        947 1 1 1 1  55 TYR HD2  A  55 . HD2  1 1 
        947 1 2 1 1  57 TYR QE   A  57 . HE2  1 1 
        948 1 1 1 1  55 TYR HD2  A  55 . HD2  1 1 
        948 1 2 1 1  71 ILE MD   A  71 . HD1* 1 1 
        949 1 1 1 1  55 TYR HD2  A  55 . HD2  1 1 
        949 1 2 1 1  71 ILE MG   A  71 . HG2* 1 1 
        950 1 1 1 1  55 TYR HE1  A  55 . HE1  1 1 
        950 1 2 1 1  88 TRP HA   A  88 . HA   1 1 
        951 1 1 1 1  55 TYR HE1  A  55 . HE1  1 1 
        951 1 2 1 1  88 TRP HD1  A  88 . HD1  1 1 
        952 1 1 1 1  55 TYR HE1  A  55 . HE1  1 1 
        952 1 2 1 1  89 LYS H    A  89 . HN   1 1 
        953 1 1 1 1  55 TYR HE2  A  55 . HE2  1 1 
        953 1 2 1 1  57 TYR HA   A  57 . HA   1 1 
        954 1 1 1 1  55 TYR HE2  A  55 . HE2  1 1 
        954 1 2 1 1  57 TYR HD1  A  57 . HD2  1 1 
        955 1 1 1 1  55 TYR HE2  A  55 . HE2  1 1 
        955 1 2 1 1  57 TYR HD2  A  57 . HD1  1 1 
        956 1 1 1 1  55 TYR HE2  A  55 . HE2  1 1 
        956 1 2 1 1  58 THR H    A  58 . HN   1 1 
        957 1 1 1 1  55 TYR HE2  A  55 . HE2  1 1 
        957 1 2 1 1  71 ILE MD   A  71 . HD1* 1 1 
        958 1 1 1 1  55 TYR HE2  A  55 . HE2  1 1 
        958 1 2 1 1  71 ILE MG   A  71 . HG2* 1 1 
        959 1 1 1 1  55 TYR HE2  A  55 . HE2  1 1 
        959 1 2 1 1  86 LEU QD   A  86 . HD1* 1 1 
        960 1 1 1 1  56 LYS H    A  56 . HN   1 1 
        960 1 2 1 1  56 LYS HB2  A  56 . HB2  1 1 
        961 1 1 1 1  56 LYS H    A  56 . HN   1 1 
        961 1 2 1 1  56 LYS HB3  A  56 . HB1  1 1 
        962 1 1 1 1  56 LYS H    A  56 . HN   1 1 
        962 1 2 1 1  56 LYS QG   A  56 . HG*  1 1 
        963 1 1 1 1  56 LYS H    A  56 . HN   1 1 
        963 1 2 1 1  57 TYR H    A  57 . HN   1 1 
        964 1 1 1 1  56 LYS H    A  56 . HN   1 1 
        964 1 2 1 1  88 TRP HE1  A  88 . HE1  1 1 
        965 1 1 1 1  56 LYS HA   A  56 . HA   1 1 
        965 1 2 1 1  56 LYS HD2  A  56 . HD2  1 1 
        966 1 1 1 1  56 LYS HA   A  56 . HA   1 1 
        966 1 2 1 1  56 LYS QD   A  56 . HD*  1 1 
        967 1 1 1 1  56 LYS HA   A  56 . HA   1 1 
        967 1 2 1 1  56 LYS HD3  A  56 . HD1  1 1 
        968 1 1 1 1  56 LYS HA   A  56 . HA   1 1 
        968 1 2 1 1  57 TYR H    A  57 . HN   1 1 
        969 1 1 1 1  56 LYS QB   A  56 . HB*  1 1 
        969 1 2 1 1  57 TYR H    A  57 . HN   1 1 
        970 1 1 1 1  56 LYS HB2  A  56 . HB2  1 1 
        970 1 2 1 1  57 TYR H    A  57 . HN   1 1 
        971 1 1 1 1  56 LYS HB3  A  56 . HB1  1 1 
        971 1 2 1 1  57 TYR H    A  57 . HN   1 1 
        972 1 1 1 1  56 LYS QG   A  56 . HG*  1 1 
        972 1 2 1 1  57 TYR H    A  57 . HN   1 1 
        973 1 1 1 1  57 TYR H    A  57 . HN   1 1 
        973 1 2 1 1  57 TYR HB2  A  57 . HB2  1 1 
        974 1 1 1 1  57 TYR H    A  57 . HN   1 1 
        974 1 2 1 1  57 TYR HB3  A  57 . HB1  1 1 
        975 1 1 1 1  57 TYR H    A  57 . HN   1 1 
        975 1 2 1 1  57 TYR HD1  A  57 . HD2  1 1 
        976 1 1 1 1  57 TYR H    A  57 . HN   1 1 
        976 1 2 1 1  57 TYR QE   A  57 . HE2  1 1 
        977 1 1 1 1  57 TYR H    A  57 . HN   1 1 
        977 1 2 1 1  58 THR H    A  58 . HN   1 1 
        978 1 1 1 1  57 TYR HA   A  57 . HA   1 1 
        978 1 2 1 1  57 TYR HD1  A  57 . HD2  1 1 
        979 1 1 1 1  57 TYR HA   A  57 . HA   1 1 
        979 1 2 1 1  57 TYR HD2  A  57 . HD1  1 1 
        980 1 1 1 1  57 TYR HA   A  57 . HA   1 1 
        980 1 2 1 1  58 THR H    A  58 . HN   1 1 
        981 1 1 1 1  57 TYR HA   A  57 . HA   1 1 
        981 1 2 1 1  58 THR HA   A  58 . HA   1 1 
        982 1 1 1 1  57 TYR HA   A  57 . HA   1 1 
        982 1 2 1 1  58 THR MG   A  58 . HG2* 1 1 
        983 1 1 1 1  57 TYR HB2  A  57 . HB2  1 1 
        983 1 2 1 1  58 THR H    A  58 . HN   1 1 
        984 1 1 1 1  57 TYR HB3  A  57 . HB1  1 1 
        984 1 2 1 1  58 THR H    A  58 . HN   1 1 
        985 1 1 1 1  57 TYR HD2  A  57 . HD1  1 1 
        985 1 2 1 1  58 THR H    A  58 . HN   1 1 
        986 1 1 1 1  57 TYR HD2  A  57 . HD1  1 1 
        986 1 2 1 1  69 VAL QG   A  69 . HG*  1 1 
        987 1 1 1 1  57 TYR HD2  A  57 . HD1  1 1 
        987 1 2 1 1  86 LEU QD   A  86 . HD1* 1 1 
        988 1 1 1 1  57 TYR QE   A  57 . HE1  1 1 
        988 1 2 1 1  69 VAL MG1  A  69 . HG1* 1 1 
        989 1 1 1 1  57 TYR QE   A  57 . HE1  1 1 
        989 1 2 1 1  69 VAL QG   A  69 . HG*  1 1 
        990 1 1 1 1  57 TYR QE   A  57 . HE1  1 1 
        990 1 2 1 1  69 VAL MG2  A  69 . HG2* 1 1 
        991 1 1 1 1  57 TYR QE   A  57 . HE1  1 1 
        991 1 2 1 1  71 ILE MD   A  71 . HD1* 1 1 
        992 1 1 1 1  57 TYR QE   A  57 . HE1  1 1 
        992 1 2 1 1  86 LEU QD   A  86 . HD1* 1 1 
        993 1 1 1 1  57 TYR QE   A  57 . HE2  1 1 
        993 1 2 1 1 104 LEU MD2  A 104 . HD2* 1 1 
        994 1 1 1 1  58 THR H    A  58 . HN   1 1 
        994 1 2 1 1  58 THR HB   A  58 . HB   1 1 
        995 1 1 1 1  58 THR H    A  58 . HN   1 1 
        995 1 2 1 1  58 THR MG   A  58 . HG2* 1 1 
        996 1 1 1 1  58 THR H    A  58 . HN   1 1 
        996 1 2 1 1  59 SER H    A  59 . HN   1 1 
        997 1 1 1 1  58 THR H    A  58 . HN   1 1 
        997 1 2 1 1  60 ARG H    A  60 . HN   1 1 
        998 1 1 1 1  58 THR HA   A  58 . HA   1 1 
        998 1 2 1 1  58 THR MG   A  58 . HG2* 1 1 
        999 1 1 1 1  58 THR HA   A  58 . HA   1 1 
        999 1 2 1 1  59 SER H    A  59 . HN   1 1 
       1000 1 1 1 1  58 THR HA   A  58 . HA   1 1 
       1000 1 2 1 1  59 SER HA   A  59 . HA   1 1 
       1001 1 1 1 1  58 THR HA   A  58 . HA   1 1 
       1001 1 2 1 1  59 SER QB   A  59 . HB*  1 1 
       1002 1 1 1 1  58 THR HA   A  58 . HA   1 1 
       1002 1 2 1 1  60 ARG H    A  60 . HN   1 1 
       1003 1 1 1 1  58 THR HB   A  58 . HB   1 1 
       1003 1 2 1 1  59 SER H    A  59 . HN   1 1 
       1004 1 1 1 1  58 THR HB   A  58 . HB   1 1 
       1004 1 2 1 1  60 ARG H    A  60 . HN   1 1 
       1005 1 1 1 1  58 THR MG   A  58 . HG2* 1 1 
       1005 1 2 1 1  59 SER H    A  59 . HN   1 1 
       1006 1 1 1 1  58 THR MG   A  58 . HG2* 1 1 
       1006 1 2 1 1  59 SER HA   A  59 . HA   1 1 
       1007 1 1 1 1  58 THR MG   A  58 . HG2* 1 1 
       1007 1 2 1 1  60 ARG H    A  60 . HN   1 1 
       1008 1 1 1 1  58 THR MG   A  58 . HG2* 1 1 
       1008 1 2 1 1  60 ARG QD   A  60 . HD*  1 1 
       1009 1 1 1 1  58 THR MG   A  58 . HG2* 1 1 
       1009 1 2 1 1  61 TYR H    A  61 . HN   1 1 
       1010 1 1 1 1  59 SER H    A  59 . HN   1 1 
       1010 1 2 1 1  59 SER HB2  A  59 . HB2  1 1 
       1011 1 1 1 1  59 SER H    A  59 . HN   1 1 
       1011 1 2 1 1  59 SER QB   A  59 . HB*  1 1 
       1012 1 1 1 1  59 SER H    A  59 . HN   1 1 
       1012 1 2 1 1  59 SER HB3  A  59 . HB1  1 1 
       1013 1 1 1 1  59 SER H    A  59 . HN   1 1 
       1013 1 2 1 1  60 ARG H    A  60 . HN   1 1 
       1014 1 1 1 1  59 SER HA   A  59 . HA   1 1 
       1014 1 2 1 1  60 ARG H    A  60 . HN   1 1 
       1015 1 1 1 1  59 SER HA   A  59 . HA   1 1 
       1015 1 2 1 1  61 TYR H    A  61 . HN   1 1 
       1016 1 1 1 1  59 SER HB2  A  59 . HB2  1 1 
       1016 1 2 1 1  60 ARG H    A  60 . HN   1 1 
       1017 1 1 1 1  59 SER HB3  A  59 . HB1  1 1 
       1017 1 2 1 1  60 ARG H    A  60 . HN   1 1 
       1018 1 1 1 1  60 ARG H    A  60 . HN   1 1 
       1018 1 2 1 1  60 ARG HB2  A  60 . HB2  1 1 
       1019 1 1 1 1  60 ARG H    A  60 . HN   1 1 
       1019 1 2 1 1  60 ARG QB   A  60 . HB*  1 1 
       1020 1 1 1 1  60 ARG H    A  60 . HN   1 1 
       1020 1 2 1 1  60 ARG HB3  A  60 . HB1  1 1 
       1021 1 1 1 1  60 ARG H    A  60 . HN   1 1 
       1021 1 2 1 1  60 ARG QD   A  60 . HD*  1 1 
       1022 1 1 1 1  60 ARG H    A  60 . HN   1 1 
       1022 1 2 1 1  60 ARG HG2  A  60 . HG2  1 1 
       1023 1 1 1 1  60 ARG H    A  60 . HN   1 1 
       1023 1 2 1 1  60 ARG QG   A  60 . HG*  1 1 
       1024 1 1 1 1  60 ARG H    A  60 . HN   1 1 
       1024 1 2 1 1  60 ARG HG3  A  60 . HG1  1 1 
       1025 1 1 1 1  60 ARG H    A  60 . HN   1 1 
       1025 1 2 1 1  61 TYR H    A  61 . HN   1 1 
       1026 1 1 1 1  60 ARG H    A  60 . HN   1 1 
       1026 1 2 1 1  61 TYR QB   A  61 . HB*  1 1 
       1027 1 1 1 1  60 ARG HA   A  60 . HA   1 1 
       1027 1 2 1 1  60 ARG HG2  A  60 . HG2  1 1 
       1028 1 1 1 1  60 ARG HA   A  60 . HA   1 1 
       1028 1 2 1 1  60 ARG QG   A  60 . HG*  1 1 
       1029 1 1 1 1  60 ARG HA   A  60 . HA   1 1 
       1029 1 2 1 1  60 ARG HG3  A  60 . HG1  1 1 
       1030 1 1 1 1  60 ARG HA   A  60 . HA   1 1 
       1030 1 2 1 1  61 TYR H    A  61 . HN   1 1 
       1031 1 1 1 1  60 ARG QB   A  60 . HB*  1 1 
       1031 1 2 1 1  60 ARG QD   A  60 . HD*  1 1 
       1032 1 1 1 1  60 ARG QB   A  60 . HB*  1 1 
       1032 1 2 1 1  61 TYR H    A  61 . HN   1 1 
       1033 1 1 1 1  60 ARG HB2  A  60 . HB2  1 1 
       1033 1 2 1 1  61 TYR H    A  61 . HN   1 1 
       1034 1 1 1 1  60 ARG HB3  A  60 . HB1  1 1 
       1034 1 2 1 1  61 TYR H    A  61 . HN   1 1 
       1035 1 1 1 1  60 ARG QG   A  60 . HG*  1 1 
       1035 1 2 1 1  61 TYR H    A  61 . HN   1 1 
       1036 1 1 1 1  60 ARG QG   A  60 . HG*  1 1 
       1036 1 2 1 1  61 TYR HA   A  61 . HA   1 1 
       1037 1 1 1 1  60 ARG QG   A  60 . HG*  1 1 
       1037 1 2 1 1  61 TYR QD   A  61 . HD2  1 1 
       1038 1 1 1 1  61 TYR H    A  61 . HN   1 1 
       1038 1 2 1 1  61 TYR HB2  A  61 . HB2  1 1 
       1039 1 1 1 1  61 TYR H    A  61 . HN   1 1 
       1039 1 2 1 1  61 TYR QB   A  61 . HB*  1 1 
       1040 1 1 1 1  61 TYR H    A  61 . HN   1 1 
       1040 1 2 1 1  61 TYR HB3  A  61 . HB1  1 1 
       1041 1 1 1 1  61 TYR H    A  61 . HN   1 1 
       1041 1 2 1 1  61 TYR QD   A  61 . HD2  1 1 
       1042 1 1 1 1  61 TYR H    A  61 . HN   1 1 
       1042 1 2 1 1  62 VAL H    A  62 . HN   1 1 
       1043 1 1 1 1  61 TYR HA   A  61 . HA   1 1 
       1043 1 2 1 1  61 TYR QD   A  61 . HD1  1 1 
       1044 1 1 1 1  61 TYR HA   A  61 . HA   1 1 
       1044 1 2 1 1  62 VAL H    A  62 . HN   1 1 
       1045 1 1 1 1  61 TYR HA   A  61 . HA   1 1 
       1045 1 2 1 1  62 VAL HB   A  62 . HB   1 1 
       1046 1 1 1 1  61 TYR HA   A  61 . HA   1 1 
       1046 1 2 1 1  62 VAL QG   A  62 . HG*  1 1 
       1047 1 1 1 1  61 TYR HB2  A  61 . HB2  1 1 
       1047 1 2 1 1  62 VAL H    A  62 . HN   1 1 
       1048 1 1 1 1  61 TYR HB3  A  61 . HB1  1 1 
       1048 1 2 1 1  62 VAL H    A  62 . HN   1 1 
       1049 1 1 1 1  61 TYR QD   A  61 . HD1  1 1 
       1049 1 2 1 1  62 VAL H    A  62 . HN   1 1 
       1050 1 1 1 1  61 TYR QD   A  61 . HD1  1 1 
       1050 1 2 1 1  62 VAL HA   A  62 . HA   1 1 
       1051 1 1 1 1  61 TYR QD   A  61 . HD1  1 1 
       1051 1 2 1 1  62 VAL MG1  A  62 . HG1* 1 1 
       1052 1 1 1 1  61 TYR QD   A  61 . HD1  1 1 
       1052 1 2 1 1  62 VAL QG   A  62 . HG*  1 1 
       1053 1 1 1 1  61 TYR QD   A  61 . HD1  1 1 
       1053 1 2 1 1  62 VAL MG2  A  62 . HG2* 1 1 
       1054 1 1 1 1  61 TYR QD   A  61 . HD1  1 1 
       1054 1 2 1 1  63 LEU H    A  63 . HN   1 1 
       1055 1 1 1 1  61 TYR QD   A  61 . HD1  1 1 
       1055 1 2 1 1  63 LEU MD1  A  63 . HD1* 1 1 
       1056 1 1 1 1  61 TYR QD   A  61 . HD1  1 1 
       1056 1 2 1 1  63 LEU QD   A  63 . HD*  1 1 
       1057 1 1 1 1  61 TYR QD   A  61 . HD1  1 1 
       1057 1 2 1 1  63 LEU MD2  A  63 . HD2* 1 1 
       1058 1 1 1 1  61 TYR QD   A  61 . HD2  1 1 
       1058 1 2 1 1  86 LEU QD   A  86 . HD1* 1 1 
       1059 1 1 1 1  61 TYR QE   A  61 . HE1  1 1 
       1059 1 2 1 1  62 VAL H    A  62 . HN   1 1 
       1060 1 1 1 1  61 TYR QE   A  61 . HE1  1 1 
       1060 1 2 1 1  62 VAL HA   A  62 . HA   1 1 
       1061 1 1 1 1  61 TYR QE   A  61 . HE1  1 1 
       1061 1 2 1 1  63 LEU H    A  63 . HN   1 1 
       1062 1 1 1 1  61 TYR QE   A  61 . HE1  1 1 
       1062 1 2 1 1  63 LEU HA   A  63 . HA   1 1 
       1063 1 1 1 1  61 TYR QE   A  61 . HE1  1 1 
       1063 1 2 1 1  63 LEU QB   A  63 . HB*  1 1 
       1064 1 1 1 1  61 TYR QE   A  61 . HE1  1 1 
       1064 1 2 1 1  63 LEU MD1  A  63 . HD1* 1 1 
       1065 1 1 1 1  61 TYR QE   A  61 . HE1  1 1 
       1065 1 2 1 1  63 LEU QD   A  63 . HD*  1 1 
       1066 1 1 1 1  61 TYR QE   A  61 . HE1  1 1 
       1066 1 2 1 1  63 LEU MD2  A  63 . HD2* 1 1 
       1067 1 1 1 1  61 TYR QE   A  61 . HE2  1 1 
       1067 1 2 1 1  86 LEU QD   A  86 . HD2* 1 1 
       1068 1 1 1 1  62 VAL H    A  62 . HN   1 1 
       1068 1 2 1 1  62 VAL HB   A  62 . HB   1 1 
       1069 1 1 1 1  62 VAL H    A  62 . HN   1 1 
       1069 1 2 1 1  62 VAL MG1  A  62 . HG1* 1 1 
       1070 1 1 1 1  62 VAL H    A  62 . HN   1 1 
       1070 1 2 1 1  62 VAL QG   A  62 . HG*  1 1 
       1071 1 1 1 1  62 VAL H    A  62 . HN   1 1 
       1071 1 2 1 1  62 VAL MG2  A  62 . HG2* 1 1 
       1072 1 1 1 1  62 VAL H    A  62 . HN   1 1 
       1072 1 2 1 1  63 LEU H    A  63 . HN   1 1 
       1073 1 1 1 1  62 VAL HA   A  62 . HA   1 1 
       1073 1 2 1 1  62 VAL MG1  A  62 . HG1* 1 1 
       1074 1 1 1 1  62 VAL HA   A  62 . HA   1 1 
       1074 1 2 1 1  62 VAL QG   A  62 . HG*  1 1 
       1075 1 1 1 1  62 VAL HA   A  62 . HA   1 1 
       1075 1 2 1 1  62 VAL MG2  A  62 . HG2* 1 1 
       1076 1 1 1 1  62 VAL HA   A  62 . HA   1 1 
       1076 1 2 1 1  63 LEU H    A  63 . HN   1 1 
       1077 1 1 1 1  62 VAL HB   A  62 . HB   1 1 
       1077 1 2 1 1  63 LEU H    A  63 . HN   1 1 
       1078 1 1 1 1  62 VAL QG   A  62 . HG*  1 1 
       1078 1 2 1 1  63 LEU H    A  63 . HN   1 1 
       1079 1 1 1 1  62 VAL QG   A  62 . HG*  1 1 
       1079 1 2 1 1  63 LEU QB   A  63 . HB*  1 1 
       1080 1 1 1 1  62 VAL QG   A  62 . HG*  1 1 
       1080 1 2 1 1  64 LYS H    A  64 . HN   1 1 
       1081 1 1 1 1  62 VAL QG   A  62 . HG*  1 1 
       1081 1 2 1 1  64 LYS HA   A  64 . HA   1 1 
       1082 1 1 1 1  62 VAL QG   A  62 . HG*  1 1 
       1082 1 2 1 1  64 LYS QB   A  64 . HB*  1 1 
       1083 1 1 1 1  62 VAL QG   A  62 . HG*  1 1 
       1083 1 2 1 1  64 LYS QG   A  64 . HG*  1 1 
       1084 1 1 1 1  62 VAL QG   A  62 . HG*  1 1 
       1084 1 2 1 1  65 ALA H    A  65 . HN   1 1 
       1085 1 1 1 1  62 VAL MG1  A  62 . HG1* 1 1 
       1085 1 2 1 1  63 LEU H    A  63 . HN   1 1 
       1086 1 1 1 1  62 VAL MG2  A  62 . HG2* 1 1 
       1086 1 2 1 1  63 LEU H    A  63 . HN   1 1 
       1087 1 1 1 1  63 LEU H    A  63 . HN   1 1 
       1087 1 2 1 1  63 LEU HB2  A  63 . HB2  1 1 
       1088 1 1 1 1  63 LEU H    A  63 . HN   1 1 
       1088 1 2 1 1  63 LEU QB   A  63 . HB*  1 1 
       1089 1 1 1 1  63 LEU H    A  63 . HN   1 1 
       1089 1 2 1 1  63 LEU HB3  A  63 . HB1  1 1 
       1090 1 1 1 1  63 LEU H    A  63 . HN   1 1 
       1090 1 2 1 1  63 LEU QD   A  63 . HD*  1 1 
       1091 1 1 1 1  63 LEU H    A  63 . HN   1 1 
       1091 1 2 1 1  64 LYS H    A  64 . HN   1 1 
       1092 1 1 1 1  63 LEU HA   A  63 . HA   1 1 
       1092 1 2 1 1  63 LEU MD1  A  63 . HD1* 1 1 
       1093 1 1 1 1  63 LEU HA   A  63 . HA   1 1 
       1093 1 2 1 1  63 LEU QD   A  63 . HD*  1 1 
       1094 1 1 1 1  63 LEU HA   A  63 . HA   1 1 
       1094 1 2 1 1  63 LEU MD2  A  63 . HD2* 1 1 
       1095 1 1 1 1  63 LEU HA   A  63 . HA   1 1 
       1095 1 2 1 1  64 LYS H    A  64 . HN   1 1 
       1096 1 1 1 1  63 LEU HA   A  63 . HA   1 1 
       1096 1 2 1 1  67 GLN HB3  A  67 . HB1  1 1 
       1097 1 1 1 1  63 LEU QD   A  63 . HD*  1 1 
       1097 1 2 1 1  64 LYS H    A  64 . HN   1 1 
       1098 1 1 1 1  63 LEU QD   A  63 . HD*  1 1 
       1098 1 2 1 1  67 GLN H    A  67 . HN   1 1 
       1099 1 1 1 1  63 LEU QD   A  63 . HD*  1 1 
       1099 1 2 1 1  67 GLN HB2  A  67 . HB2  1 1 
       1100 1 1 1 1  63 LEU QD   A  63 . HD*  1 1 
       1100 1 2 1 1  67 GLN HB3  A  67 . HB1  1 1 
       1101 1 1 1 1  63 LEU QD   A  63 . HD*  1 1 
       1101 1 2 1 1  68 THR H    A  68 . HN   1 1 
       1102 1 1 1 1  63 LEU QD   A  63 . HD*  1 1 
       1102 1 2 1 1  68 THR HA   A  68 . HA   1 1 
       1103 1 1 1 1  63 LEU QD   A  63 . HD*  1 1 
       1103 1 2 1 1  69 VAL H    A  69 . HN   1 1 
       1104 1 1 1 1  63 LEU HG   A  63 . HG   1 1 
       1104 1 2 1 1  68 THR HA   A  68 . HA   1 1 
       1105 1 1 1 1  64 LYS H    A  64 . HN   1 1 
       1105 1 2 1 1  64 LYS HB2  A  64 . HB2  1 1 
       1106 1 1 1 1  64 LYS H    A  64 . HN   1 1 
       1106 1 2 1 1  64 LYS QB   A  64 . HB*  1 1 
       1107 1 1 1 1  64 LYS H    A  64 . HN   1 1 
       1107 1 2 1 1  64 LYS HB3  A  64 . HB1  1 1 
       1108 1 1 1 1  64 LYS H    A  64 . HN   1 1 
       1108 1 2 1 1  64 LYS HG2  A  64 . HG2  1 1 
       1109 1 1 1 1  64 LYS H    A  64 . HN   1 1 
       1109 1 2 1 1  64 LYS QG   A  64 . HG*  1 1 
       1110 1 1 1 1  64 LYS H    A  64 . HN   1 1 
       1110 1 2 1 1  64 LYS HG3  A  64 . HG1  1 1 
       1111 1 1 1 1  64 LYS H    A  64 . HN   1 1 
       1111 1 2 1 1  65 ALA H    A  65 . HN   1 1 
       1112 1 1 1 1  64 LYS H    A  64 . HN   1 1 
       1112 1 2 1 1  67 GLN H    A  67 . HN   1 1 
       1113 1 1 1 1  64 LYS H    A  64 . HN   1 1 
       1113 1 2 1 1  67 GLN HB2  A  67 . HB2  1 1 
       1114 1 1 1 1  64 LYS H    A  64 . HN   1 1 
       1114 1 2 1 1  67 GLN HB3  A  67 . HB1  1 1 
       1115 1 1 1 1  64 LYS HA   A  64 . HA   1 1 
       1115 1 2 1 1  64 LYS HD2  A  64 . HD2  1 1 
       1116 1 1 1 1  64 LYS HA   A  64 . HA   1 1 
       1116 1 2 1 1  64 LYS QD   A  64 . HD*  1 1 
       1117 1 1 1 1  64 LYS HA   A  64 . HA   1 1 
       1117 1 2 1 1  64 LYS HD3  A  64 . HD1  1 1 
       1118 1 1 1 1  64 LYS HA   A  64 . HA   1 1 
       1118 1 2 1 1  64 LYS HG2  A  64 . HG2  1 1 
       1119 1 1 1 1  64 LYS HA   A  64 . HA   1 1 
       1119 1 2 1 1  64 LYS QG   A  64 . HG*  1 1 
       1120 1 1 1 1  64 LYS HA   A  64 . HA   1 1 
       1120 1 2 1 1  64 LYS HG3  A  64 . HG1  1 1 
       1121 1 1 1 1  64 LYS HA   A  64 . HA   1 1 
       1121 1 2 1 1  65 ALA H    A  65 . HN   1 1 
       1122 1 1 1 1  64 LYS HA   A  64 . HA   1 1 
       1122 1 2 1 1  65 ALA HA   A  65 . HA   1 1 
       1123 1 1 1 1  64 LYS HA   A  64 . HA   1 1 
       1123 1 2 1 1  65 ALA MB   A  65 . HB*  1 1 
       1124 1 1 1 1  64 LYS QB   A  64 . HB*  1 1 
       1124 1 2 1 1  64 LYS QD   A  64 . HD*  1 1 
       1125 1 1 1 1  64 LYS QB   A  64 . HB*  1 1 
       1125 1 2 1 1  64 LYS QE   A  64 . HE*  1 1 
       1126 1 1 1 1  64 LYS QB   A  64 . HB*  1 1 
       1126 1 2 1 1  65 ALA H    A  65 . HN   1 1 
       1127 1 1 1 1  64 LYS QB   A  64 . HB*  1 1 
       1127 1 2 1 1  67 GLN HB3  A  67 . HB1  1 1 
       1128 1 1 1 1  64 LYS QB   A  64 . HB*  1 1 
       1128 1 2 1 1  67 GLN QG   A  67 . HG*  1 1 
       1129 1 1 1 1  64 LYS HB2  A  64 . HB2  1 1 
       1129 1 2 1 1  67 GLN HB2  A  67 . HB2  1 1 
       1130 1 1 1 1  64 LYS HB2  A  64 . HB2  1 1 
       1130 1 2 1 1  67 GLN HB3  A  67 . HB1  1 1 
       1131 1 1 1 1  64 LYS HB3  A  64 . HB1  1 1 
       1131 1 2 1 1  67 GLN HB2  A  67 . HB2  1 1 
       1132 1 1 1 1  64 LYS HB3  A  64 . HB1  1 1 
       1132 1 2 1 1  67 GLN HB3  A  67 . HB1  1 1 
       1133 1 1 1 1  64 LYS QD   A  64 . HD*  1 1 
       1133 1 2 1 1  65 ALA H    A  65 . HN   1 1 
       1134 1 1 1 1  64 LYS HG2  A  64 . HG2  1 1 
       1134 1 2 1 1  65 ALA H    A  65 . HN   1 1 
       1135 1 1 1 1  64 LYS HG3  A  64 . HG1  1 1 
       1135 1 2 1 1  65 ALA H    A  65 . HN   1 1 
       1136 1 1 1 1  65 ALA H    A  65 . HN   1 1 
       1136 1 2 1 1  65 ALA MB   A  65 . HB*  1 1 
       1137 1 1 1 1  65 ALA H    A  65 . HN   1 1 
       1137 1 2 1 1  66 GLY H    A  66 . HN   1 1 
       1138 1 1 1 1  65 ALA H    A  65 . HN   1 1 
       1138 1 2 1 1  67 GLN H    A  67 . HN   1 1 
       1139 1 1 1 1  65 ALA H    A  65 . HN   1 1 
       1139 1 2 1 1  67 GLN HB2  A  67 . HB2  1 1 
       1140 1 1 1 1  65 ALA HA   A  65 . HA   1 1 
       1140 1 2 1 1  66 GLY H    A  66 . HN   1 1 
       1141 1 1 1 1  65 ALA HA   A  65 . HA   1 1 
       1141 1 2 1 1  66 GLY HA2  A  66 . HA2  1 1 
       1142 1 1 1 1  65 ALA HA   A  65 . HA   1 1 
       1142 1 2 1 1  66 GLY HA3  A  66 . HA1  1 1 
       1143 1 1 1 1  65 ALA HA   A  65 . HA   1 1 
       1143 1 2 1 1  67 GLN H    A  67 . HN   1 1 
       1144 1 1 1 1  65 ALA HA   A  65 . HA   1 1 
       1144 1 2 1 1  67 GLN HB2  A  67 . HB2  1 1 
       1145 1 1 1 1  65 ALA MB   A  65 . HB*  1 1 
       1145 1 2 1 1  66 GLY H    A  66 . HN   1 1 
       1146 1 1 1 1  65 ALA MB   A  65 . HB*  1 1 
       1146 1 2 1 1  67 GLN H    A  67 . HN   1 1 
       1147 1 1 1 1  65 ALA MB   A  65 . HB*  1 1 
       1147 1 2 1 1  67 GLN HB2  A  67 . HB2  1 1 
       1148 1 1 1 1  66 GLY H    A  66 . HN   1 1 
       1148 1 2 1 1  67 GLN H    A  67 . HN   1 1 
       1149 1 1 1 1  66 GLY HA3  A  66 . HA1  1 1 
       1149 1 2 1 1  67 GLN HE21 A  67 . HE21 1 1 
       1150 1 1 1 1  67 GLN H    A  67 . HN   1 1 
       1150 1 2 1 1  67 GLN HB2  A  67 . HB2  1 1 
       1151 1 1 1 1  67 GLN H    A  67 . HN   1 1 
       1151 1 2 1 1  67 GLN HB3  A  67 . HB1  1 1 
       1152 1 1 1 1  67 GLN H    A  67 . HN   1 1 
       1152 1 2 1 1  67 GLN HE21 A  67 . HE21 1 1 
       1153 1 1 1 1  67 GLN H    A  67 . HN   1 1 
       1153 1 2 1 1  67 GLN HE22 A  67 . HE22 1 1 
       1154 1 1 1 1  67 GLN HA   A  67 . HA   1 1 
       1154 1 2 1 1  67 GLN HE21 A  67 . HE21 1 1 
       1155 1 1 1 1  67 GLN HA   A  67 . HA   1 1 
       1155 1 2 1 1  67 GLN HE22 A  67 . HE22 1 1 
       1156 1 1 1 1  67 GLN HA   A  67 . HA   1 1 
       1156 1 2 1 1  67 GLN QG   A  67 . HG*  1 1 
       1157 1 1 1 1  67 GLN HA   A  67 . HA   1 1 
       1157 1 2 1 1  68 THR H    A  68 . HN   1 1 
       1158 1 1 1 1  67 GLN HB2  A  67 . HB2  1 1 
       1158 1 2 1 1  67 GLN HE21 A  67 . HE21 1 1 
       1159 1 1 1 1  67 GLN HB2  A  67 . HB2  1 1 
       1159 1 2 1 1  67 GLN HE22 A  67 . HE22 1 1 
       1160 1 1 1 1  67 GLN HB2  A  67 . HB2  1 1 
       1160 1 2 1 1  68 THR H    A  68 . HN   1 1 
       1161 1 1 1 1  67 GLN HB3  A  67 . HB1  1 1 
       1161 1 2 1 1  68 THR H    A  68 . HN   1 1 
       1162 1 1 1 1  67 GLN QG   A  67 . HG*  1 1 
       1162 1 2 1 1  68 THR H    A  68 . HN   1 1 
       1163 1 1 1 1  68 THR H    A  68 . HN   1 1 
       1163 1 2 1 1  68 THR HB   A  68 . HB   1 1 
       1164 1 1 1 1  68 THR H    A  68 . HN   1 1 
       1164 1 2 1 1  68 THR MG   A  68 . HG2* 1 1 
       1165 1 1 1 1  68 THR H    A  68 . HN   1 1 
       1165 1 2 1 1  69 VAL H    A  69 . HN   1 1 
       1166 1 1 1 1  68 THR HA   A  68 . HA   1 1 
       1166 1 2 1 1  68 THR MG   A  68 . HG2* 1 1 
       1167 1 1 1 1  68 THR HA   A  68 . HA   1 1 
       1167 1 2 1 1  69 VAL H    A  69 . HN   1 1 
       1168 1 1 1 1  68 THR HB   A  68 . HB   1 1 
       1168 1 2 1 1  69 VAL H    A  69 . HN   1 1 
       1169 1 1 1 1  68 THR HB   A  68 . HB   1 1 
       1169 1 2 1 1  69 VAL QG   A  69 . HG*  1 1 
       1170 1 1 1 1  68 THR MG   A  68 . HG2* 1 1 
       1170 1 2 1 1  69 VAL H    A  69 . HN   1 1 
       1171 1 1 1 1  69 VAL H    A  69 . HN   1 1 
       1171 1 2 1 1  69 VAL HB   A  69 . HB   1 1 
       1172 1 1 1 1  69 VAL H    A  69 . HN   1 1 
       1172 1 2 1 1  69 VAL QG   A  69 . HG*  1 1 
       1173 1 1 1 1  69 VAL H    A  69 . HN   1 1 
       1173 1 2 1 1  70 THR H    A  70 . HN   1 1 
       1174 1 1 1 1  69 VAL HA   A  69 . HA   1 1 
       1174 1 2 1 1  70 THR H    A  70 . HN   1 1 
       1175 1 1 1 1  69 VAL HB   A  69 . HB   1 1 
       1175 1 2 1 1  70 THR H    A  70 . HN   1 1 
       1176 1 1 1 1  69 VAL QG   A  69 . HG*  1 1 
       1176 1 2 1 1  70 THR H    A  70 . HN   1 1 
       1177 1 1 1 1  69 VAL QG   A  69 . HG*  1 1 
       1177 1 2 1 1  70 THR HA   A  70 . HA   1 1 
       1178 1 1 1 1  69 VAL QG   A  69 . HG*  1 1 
       1178 1 2 1 1  70 THR HB   A  70 . HB   1 1 
       1179 1 1 1 1  69 VAL QG   A  69 . HG*  1 1 
       1179 1 2 1 1  71 ILE MD   A  71 . HD1* 1 1 
       1180 1 1 1 1  69 VAL QG   A  69 . HG*  1 1 
       1180 1 2 1 1  71 ILE HG13 A  71 . HG11 1 1 
       1181 1 1 1 1  69 VAL QG   A  69 . HG*  1 1 
       1181 1 2 1 1  85 ASP HA   A  85 . HA   1 1 
       1182 1 1 1 1  69 VAL QG   A  69 . HG*  1 1 
       1182 1 2 1 1  86 LEU H    A  86 . HN   1 1 
       1183 1 1 1 1  69 VAL QG   A  69 . HG*  1 1 
       1183 1 2 1 1  86 LEU HG   A  86 . HG   1 1 
       1184 1 1 1 1  69 VAL MG1  A  69 . HG1* 1 1 
       1184 1 2 1 1  70 THR HA   A  70 . HA   1 1 
       1185 1 1 1 1  69 VAL MG1  A  69 . HG1* 1 1 
       1185 1 2 1 1  71 ILE MD   A  71 . HD1* 1 1 
       1186 1 1 1 1  69 VAL MG2  A  69 . HG2* 1 1 
       1186 1 2 1 1  70 THR HA   A  70 . HA   1 1 
       1187 1 1 1 1  69 VAL MG2  A  69 . HG2* 1 1 
       1187 1 2 1 1  71 ILE MD   A  71 . HD1* 1 1 
       1188 1 1 1 1  70 THR H    A  70 . HN   1 1 
       1188 1 2 1 1  70 THR HB   A  70 . HB   1 1 
       1189 1 1 1 1  70 THR H    A  70 . HN   1 1 
       1189 1 2 1 1  70 THR MG   A  70 . HG2* 1 1 
       1190 1 1 1 1  70 THR H    A  70 . HN   1 1 
       1190 1 2 1 1  85 ASP HA   A  85 . HA   1 1 
       1191 1 1 1 1  70 THR H    A  70 . HN   1 1 
       1191 1 2 1 1  86 LEU H    A  86 . HN   1 1 
       1192 1 1 1 1  70 THR HA   A  70 . HA   1 1 
       1192 1 2 1 1  71 ILE H    A  71 . HN   1 1 
       1193 1 1 1 1  70 THR HB   A  70 . HB   1 1 
       1193 1 2 1 1  71 ILE H    A  71 . HN   1 1 
       1194 1 1 1 1  70 THR HB   A  70 . HB   1 1 
       1194 1 2 1 1  72 TRP HD1  A  72 . HD1  1 1 
       1195 1 1 1 1  70 THR HB   A  70 . HB   1 1 
       1195 1 2 1 1  72 TRP HE1  A  72 . HE1  1 1 
       1196 1 1 1 1  70 THR HB   A  70 . HB   1 1 
       1196 1 2 1 1  85 ASP HA   A  85 . HA   1 1 
       1197 1 1 1 1  70 THR HB   A  70 . HB   1 1 
       1197 1 2 1 1  85 ASP HB2  A  85 . HB2  1 1 
       1198 1 1 1 1  70 THR HB   A  70 . HB   1 1 
       1198 1 2 1 1  85 ASP HB3  A  85 . HB1  1 1 
       1199 1 1 1 1  70 THR HB   A  70 . HB   1 1 
       1199 1 2 1 1  86 LEU H    A  86 . HN   1 1 
       1200 1 1 1 1  70 THR MG   A  70 . HG2* 1 1 
       1200 1 2 1 1  71 ILE H    A  71 . HN   1 1 
       1201 1 1 1 1  70 THR MG   A  70 . HG2* 1 1 
       1201 1 2 1 1  72 TRP HD1  A  72 . HD1  1 1 
       1202 1 1 1 1  70 THR MG   A  70 . HG2* 1 1 
       1202 1 2 1 1  72 TRP HZ2  A  72 . HZ2  1 1 
       1203 1 1 1 1  71 ILE H    A  71 . HN   1 1 
       1203 1 2 1 1  71 ILE HB   A  71 . HB   1 1 
       1204 1 1 1 1  71 ILE H    A  71 . HN   1 1 
       1204 1 2 1 1  71 ILE MD   A  71 . HD1* 1 1 
       1205 1 1 1 1  71 ILE H    A  71 . HN   1 1 
       1205 1 2 1 1  71 ILE HG12 A  71 . HG12 1 1 
       1206 1 1 1 1  71 ILE H    A  71 . HN   1 1 
       1206 1 2 1 1  71 ILE HG13 A  71 . HG11 1 1 
       1207 1 1 1 1  71 ILE H    A  71 . HN   1 1 
       1207 1 2 1 1  71 ILE MG   A  71 . HG2* 1 1 
       1208 1 1 1 1  71 ILE H    A  71 . HN   1 1 
       1208 1 2 1 1  72 TRP H    A  72 . HN   1 1 
       1209 1 1 1 1  71 ILE HA   A  71 . HA   1 1 
       1209 1 2 1 1  71 ILE MD   A  71 . HD1* 1 1 
       1210 1 1 1 1  71 ILE HA   A  71 . HA   1 1 
       1210 1 2 1 1  72 TRP H    A  72 . HN   1 1 
       1211 1 1 1 1  71 ILE HA   A  71 . HA   1 1 
       1211 1 2 1 1  72 TRP HD1  A  72 . HD1  1 1 
       1212 1 1 1 1  71 ILE HA   A  71 . HA   1 1 
       1212 1 2 1 1  86 LEU H    A  86 . HN   1 1 
       1213 1 1 1 1  71 ILE HA   A  71 . HA   1 1 
       1213 1 2 1 1  86 LEU HB2  A  86 . HB2  1 1 
       1214 1 1 1 1  71 ILE HA   A  71 . HA   1 1 
       1214 1 2 1 1  86 LEU HB3  A  86 . HB1  1 1 
       1215 1 1 1 1  71 ILE HA   A  71 . HA   1 1 
       1215 1 2 1 1  86 LEU QD   A  86 . HD1* 1 1 
       1216 1 1 1 1  71 ILE HA   A  71 . HA   1 1 
       1216 1 2 1 1  88 TRP H    A  88 . HN   1 1 
       1217 1 1 1 1  71 ILE MD   A  71 . HD1* 1 1 
       1217 1 2 1 1  71 ILE MG   A  71 . HG2* 1 1 
       1218 1 1 1 1  71 ILE MD   A  71 . HD1* 1 1 
       1218 1 2 1 1  72 TRP H    A  72 . HN   1 1 
       1219 1 1 1 1  71 ILE MD   A  71 . HD1* 1 1 
       1219 1 2 1 1  86 LEU H    A  86 . HN   1 1 
       1220 1 1 1 1  71 ILE MD   A  71 . HD1* 1 1 
       1220 1 2 1 1  86 LEU HB2  A  86 . HB2  1 1 
       1221 1 1 1 1  71 ILE MD   A  71 . HD1* 1 1 
       1221 1 2 1 1  86 LEU HB3  A  86 . HB1  1 1 
       1222 1 1 1 1  71 ILE MD   A  71 . HD1* 1 1 
       1222 1 2 1 1  86 LEU QD   A  86 . HD1* 1 1 
       1223 1 1 1 1  71 ILE MG   A  71 . HG2* 1 1 
       1223 1 2 1 1  72 TRP H    A  72 . HN   1 1 
       1224 1 1 1 1  71 ILE MG   A  71 . HG2* 1 1 
       1224 1 2 1 1  88 TRP H    A  88 . HN   1 1 
       1225 1 1 1 1  71 ILE MG   A  71 . HG2* 1 1 
       1225 1 2 1 1  88 TRP HA   A  88 . HA   1 1 
       1226 1 1 1 1  71 ILE MG   A  71 . HG2* 1 1 
       1226 1 2 1 1  88 TRP HB2  A  88 . HB2  1 1 
       1227 1 1 1 1  71 ILE MG   A  71 . HG2* 1 1 
       1227 1 2 1 1  88 TRP HB3  A  88 . HB1  1 1 
       1228 1 1 1 1  71 ILE MG   A  71 . HG2* 1 1 
       1228 1 2 1 1  88 TRP HE3  A  88 . HE3  1 1 
       1229 1 1 1 1  72 TRP H    A  72 . HN   1 1 
       1229 1 2 1 1  72 TRP HB2  A  72 . HB2  1 1 
       1230 1 1 1 1  72 TRP H    A  72 . HN   1 1 
       1230 1 2 1 1  72 TRP QB   A  72 . HB*  1 1 
       1231 1 1 1 1  72 TRP H    A  72 . HN   1 1 
       1231 1 2 1 1  72 TRP HB3  A  72 . HB1  1 1 
       1232 1 1 1 1  72 TRP H    A  72 . HN   1 1 
       1232 1 2 1 1  72 TRP HD1  A  72 . HD1  1 1 
       1233 1 1 1 1  72 TRP H    A  72 . HN   1 1 
       1233 1 2 1 1  72 TRP HE1  A  72 . HE1  1 1 
       1234 1 1 1 1  72 TRP H    A  72 . HN   1 1 
       1234 1 2 1 1  73 ALA H    A  73 . HN   1 1 
       1235 1 1 1 1  72 TRP H    A  72 . HN   1 1 
       1235 1 2 1 1  86 LEU HB2  A  86 . HB2  1 1 
       1236 1 1 1 1  72 TRP H    A  72 . HN   1 1 
       1236 1 2 1 1  87 ILE MD   A  87 . HD1* 1 1 
       1237 1 1 1 1  72 TRP H    A  72 . HN   1 1 
       1237 1 2 1 1  88 TRP H    A  88 . HN   1 1 
       1238 1 1 1 1  72 TRP HA   A  72 . HA   1 1 
       1238 1 2 1 1  72 TRP HE3  A  72 . HE3  1 1 
       1239 1 1 1 1  72 TRP HA   A  72 . HA   1 1 
       1239 1 2 1 1  73 ALA H    A  73 . HN   1 1 
       1240 1 1 1 1  72 TRP HA   A  72 . HA   1 1 
       1240 1 2 1 1  73 ALA MB   A  73 . HB*  1 1 
       1241 1 1 1 1  72 TRP QB   A  72 . HB*  1 1 
       1241 1 2 1 1  73 ALA H    A  73 . HN   1 1 
       1242 1 1 1 1  72 TRP QB   A  72 . HB*  1 1 
       1242 1 2 1 1  87 ILE HA   A  87 . HA   1 1 
       1243 1 1 1 1  72 TRP QB   A  72 . HB*  1 1 
       1243 1 2 1 1  87 ILE MD   A  87 . HD1* 1 1 
       1244 1 1 1 1  72 TRP QB   A  72 . HB*  1 1 
       1244 1 2 1 1  88 TRP H    A  88 . HN   1 1 
       1245 1 1 1 1  72 TRP HB2  A  72 . HB2  1 1 
       1245 1 2 1 1  73 ALA H    A  73 . HN   1 1 
       1246 1 1 1 1  72 TRP HB2  A  72 . HB2  1 1 
       1246 1 2 1 1  76 ALA MB   A  76 . HB*  1 1 
       1247 1 1 1 1  72 TRP HB2  A  72 . HB2  1 1 
       1247 1 2 1 1  87 ILE HA   A  87 . HA   1 1 
       1248 1 1 1 1  72 TRP HB2  A  72 . HB2  1 1 
       1248 1 2 1 1  87 ILE MD   A  87 . HD1* 1 1 
       1249 1 1 1 1  72 TRP HB3  A  72 . HB1  1 1 
       1249 1 2 1 1  73 ALA H    A  73 . HN   1 1 
       1250 1 1 1 1  72 TRP HB3  A  72 . HB1  1 1 
       1250 1 2 1 1  76 ALA MB   A  76 . HB*  1 1 
       1251 1 1 1 1  72 TRP HB3  A  72 . HB1  1 1 
       1251 1 2 1 1  87 ILE HA   A  87 . HA   1 1 
       1252 1 1 1 1  72 TRP HB3  A  72 . HB1  1 1 
       1252 1 2 1 1  87 ILE MD   A  87 . HD1* 1 1 
       1253 1 1 1 1  72 TRP HD1  A  72 . HD1  1 1 
       1253 1 2 1 1  78 VAL QG   A  78 . HG*  1 1 
       1254 1 1 1 1  72 TRP HD1  A  72 . HD1  1 1 
       1254 1 2 1 1  85 ASP HA   A  85 . HA   1 1 
       1255 1 1 1 1  72 TRP HD1  A  72 . HD1  1 1 
       1255 1 2 1 1  85 ASP HB2  A  85 . HB2  1 1 
       1256 1 1 1 1  72 TRP HD1  A  72 . HD1  1 1 
       1256 1 2 1 1  85 ASP HB3  A  85 . HB1  1 1 
       1257 1 1 1 1  72 TRP HD1  A  72 . HD1  1 1 
       1257 1 2 1 1  86 LEU H    A  86 . HN   1 1 
       1258 1 1 1 1  72 TRP HD1  A  72 . HD1  1 1 
       1258 1 2 1 1  86 LEU HB2  A  86 . HB2  1 1 
       1259 1 1 1 1  72 TRP HD1  A  72 . HD1  1 1 
       1259 1 2 1 1  87 ILE HA   A  87 . HA   1 1 
       1260 1 1 1 1  72 TRP HD1  A  72 . HD1  1 1 
       1260 1 2 1 1  87 ILE MD   A  87 . HD1* 1 1 
       1261 1 1 1 1  72 TRP HD1  A  72 . HD1  1 1 
       1261 1 2 1 1  87 ILE HG13 A  87 . HG11 1 1 
       1262 1 1 1 1  72 TRP HE1  A  72 . HE1  1 1 
       1262 1 2 1 1  78 VAL QG   A  78 . HG*  1 1 
       1263 1 1 1 1  72 TRP HE1  A  72 . HE1  1 1 
       1263 1 2 1 1  85 ASP HA   A  85 . HA   1 1 
       1264 1 1 1 1  72 TRP HE1  A  72 . HE1  1 1 
       1264 1 2 1 1  85 ASP HB2  A  85 . HB2  1 1 
       1265 1 1 1 1  72 TRP HE1  A  72 . HE1  1 1 
       1265 1 2 1 1  85 ASP HB3  A  85 . HB1  1 1 
       1266 1 1 1 1  72 TRP HE1  A  72 . HE1  1 1 
       1266 1 2 1 1  86 LEU H    A  86 . HN   1 1 
       1267 1 1 1 1  72 TRP HE3  A  72 . HE3  1 1 
       1267 1 2 1 1  73 ALA H    A  73 . HN   1 1 
       1268 1 1 1 1  72 TRP HE3  A  72 . HE3  1 1 
       1268 1 2 1 1  73 ALA MB   A  73 . HB*  1 1 
       1269 1 1 1 1  72 TRP HE3  A  72 . HE3  1 1 
       1269 1 2 1 1  76 ALA MB   A  76 . HB*  1 1 
       1270 1 1 1 1  72 TRP HE3  A  72 . HE3  1 1 
       1270 1 2 1 1  78 VAL QG   A  78 . HG*  1 1 
       1271 1 1 1 1  72 TRP HH2  A  72 . HH2  1 1 
       1271 1 2 1 1  78 VAL QG   A  78 . HG*  1 1 
       1272 1 1 1 1  72 TRP HZ2  A  72 . HZ2  1 1 
       1272 1 2 1 1  78 VAL QG   A  78 . HG*  1 1 
       1273 1 1 1 1  72 TRP HZ3  A  72 . HZ3  1 1 
       1273 1 2 1 1  76 ALA MB   A  76 . HB*  1 1 
       1274 1 1 1 1  72 TRP HZ3  A  72 . HZ3  1 1 
       1274 1 2 1 1  78 VAL QG   A  78 . HG*  1 1 
       1275 1 1 1 1  73 ALA H    A  73 . HN   1 1 
       1275 1 2 1 1  73 ALA MB   A  73 . HB*  1 1 
       1276 1 1 1 1  73 ALA H    A  73 . HN   1 1 
       1276 1 2 1 1  76 ALA H    A  76 . HN   1 1 
       1277 1 1 1 1  73 ALA H    A  73 . HN   1 1 
       1277 1 2 1 1  76 ALA MB   A  76 . HB*  1 1 
       1278 1 1 1 1  73 ALA H    A  73 . HN   1 1 
       1278 1 2 1 1  88 TRP H    A  88 . HN   1 1 
       1279 1 1 1 1  73 ALA HA   A  73 . HA   1 1 
       1279 1 2 1 1  74 ALA H    A  74 . HN   1 1 
       1280 1 1 1 1  73 ALA HA   A  73 . HA   1 1 
       1280 1 2 1 1  75 ASN H    A  75 . HN   1 1 
       1281 1 1 1 1  73 ALA HA   A  73 . HA   1 1 
       1281 1 2 1 1  88 TRP H    A  88 . HN   1 1 
       1282 1 1 1 1  73 ALA HA   A  73 . HA   1 1 
       1282 1 2 1 1  88 TRP HB2  A  88 . HB2  1 1 
       1283 1 1 1 1  73 ALA HA   A  73 . HA   1 1 
       1283 1 2 1 1  88 TRP HB3  A  88 . HB1  1 1 
       1284 1 1 1 1  73 ALA HA   A  73 . HA   1 1 
       1284 1 2 1 1  94 TRP HZ3  A  94 . HZ3  1 1 
       1285 1 1 1 1  73 ALA MB   A  73 . HB*  1 1 
       1285 1 2 1 1  74 ALA H    A  74 . HN   1 1 
       1286 1 1 1 1  73 ALA MB   A  73 . HB*  1 1 
       1286 1 2 1 1  75 ASN H    A  75 . HN   1 1 
       1287 1 1 1 1  73 ALA MB   A  73 . HB*  1 1 
       1287 1 2 1 1  77 GLY H    A  77 . HN   1 1 
       1288 1 1 1 1  73 ALA MB   A  73 . HB*  1 1 
       1288 1 2 1 1  88 TRP HB3  A  88 . HB1  1 1 
       1289 1 1 1 1  73 ALA MB   A  73 . HB*  1 1 
       1289 1 2 1 1  92 ASN HA   A  92 . HA   1 1 
       1290 1 1 1 1  73 ALA MB   A  73 . HB*  1 1 
       1290 1 2 1 1  93 SER H    A  93 . HN   1 1 
       1291 1 1 1 1  73 ALA MB   A  73 . HB*  1 1 
       1291 1 2 1 1  93 SER HA   A  93 . HA   1 1 
       1292 1 1 1 1  73 ALA MB   A  73 . HB*  1 1 
       1292 1 2 1 1  93 SER QB   A  93 . HB*  1 1 
       1293 1 1 1 1  73 ALA MB   A  73 . HB*  1 1 
       1293 1 2 1 1  94 TRP H    A  94 . HN   1 1 
       1294 1 1 1 1  73 ALA MB   A  73 . HB*  1 1 
       1294 1 2 1 1  94 TRP HH2  A  94 . HH2  1 1 
       1295 1 1 1 1  73 ALA MB   A  73 . HB*  1 1 
       1295 1 2 1 1  94 TRP HZ3  A  94 . HZ3  1 1 
       1296 1 1 1 1  74 ALA H    A  74 . HN   1 1 
       1296 1 2 1 1  74 ALA MB   A  74 . HB*  1 1 
       1297 1 1 1 1  74 ALA H    A  74 . HN   1 1 
       1297 1 2 1 1  75 ASN H    A  75 . HN   1 1 
       1298 1 1 1 1  74 ALA H    A  74 . HN   1 1 
       1298 1 2 1 1  76 ALA H    A  76 . HN   1 1 
       1299 1 1 1 1  74 ALA H    A  74 . HN   1 1 
       1299 1 2 1 1  88 TRP H    A  88 . HN   1 1 
       1300 1 1 1 1  74 ALA H    A  74 . HN   1 1 
       1300 1 2 1 1  88 TRP HB3  A  88 . HB1  1 1 
       1301 1 1 1 1  74 ALA H    A  74 . HN   1 1 
       1301 1 2 1 1  91 GLN H    A  91 . HN   1 1 
       1302 1 1 1 1  74 ALA H    A  74 . HN   1 1 
       1302 1 2 1 1  92 ASN HA   A  92 . HA   1 1 
       1303 1 1 1 1  74 ALA HA   A  74 . HA   1 1 
       1303 1 2 1 1  76 ALA H    A  76 . HN   1 1 
       1304 1 1 1 1  74 ALA HA   A  74 . HA   1 1 
       1304 1 2 1 1  76 ALA MB   A  76 . HB*  1 1 
       1305 1 1 1 1  74 ALA HA   A  74 . HA   1 1 
       1305 1 2 1 1  87 ILE MG   A  87 . HG2* 1 1 
       1306 1 1 1 1  74 ALA MB   A  74 . HB*  1 1 
       1306 1 2 1 1  75 ASN H    A  75 . HN   1 1 
       1307 1 1 1 1  74 ALA MB   A  74 . HB*  1 1 
       1307 1 2 1 1  87 ILE MG   A  87 . HG2* 1 1 
       1308 1 1 1 1  74 ALA MB   A  74 . HB*  1 1 
       1308 1 2 1 1  89 LYS HA   A  89 . HA   1 1 
       1309 1 1 1 1  74 ALA MB   A  74 . HB*  1 1 
       1309 1 2 1 1  90 ASN H    A  90 . HN   1 1 
       1310 1 1 1 1  74 ALA MB   A  74 . HB*  1 1 
       1310 1 2 1 1  91 GLN H    A  91 . HN   1 1 
       1311 1 1 1 1  74 ALA MB   A  74 . HB*  1 1 
       1311 1 2 1 1  91 GLN HA   A  91 . HA   1 1 
       1312 1 1 1 1  74 ALA MB   A  74 . HB*  1 1 
       1312 1 2 1 1  92 ASN H    A  92 . HN   1 1 
       1313 1 1 1 1  74 ALA MB   A  74 . HB*  1 1 
       1313 1 2 1 1  92 ASN HA   A  92 . HA   1 1 
       1314 1 1 1 1  74 ALA MB   A  74 . HB*  1 1 
       1314 1 2 1 1  92 ASN HD21 A  92 . HD21 1 1 
       1315 1 1 1 1  74 ALA MB   A  74 . HB*  1 1 
       1315 1 2 1 1  92 ASN HD22 A  92 . HD22 1 1 
       1316 1 1 1 1  75 ASN H    A  75 . HN   1 1 
       1316 1 2 1 1  75 ASN HB2  A  75 . HB2  1 1 
       1317 1 1 1 1  75 ASN H    A  75 . HN   1 1 
       1317 1 2 1 1  75 ASN HB3  A  75 . HB1  1 1 
       1318 1 1 1 1  75 ASN H    A  75 . HN   1 1 
       1318 1 2 1 1  76 ALA H    A  76 . HN   1 1 
       1319 1 1 1 1  75 ASN H    A  75 . HN   1 1 
       1319 1 2 1 1  76 ALA MB   A  76 . HB*  1 1 
       1320 1 1 1 1  75 ASN H    A  75 . HN   1 1 
       1320 1 2 1 1  77 GLY H    A  77 . HN   1 1 
       1321 1 1 1 1  75 ASN H    A  75 . HN   1 1 
       1321 1 2 1 1  92 ASN HA   A  92 . HA   1 1 
       1322 1 1 1 1  75 ASN H    A  75 . HN   1 1 
       1322 1 2 1 1  93 SER H    A  93 . HN   1 1 
       1323 1 1 1 1  75 ASN HA   A  75 . HA   1 1 
       1323 1 2 1 1  77 GLY H    A  77 . HN   1 1 
       1324 1 1 1 1  75 ASN HB2  A  75 . HB2  1 1 
       1324 1 2 1 1  75 ASN HD22 A  75 . HD22 1 1 
       1325 1 1 1 1  75 ASN HB2  A  75 . HB2  1 1 
       1325 1 2 1 1  93 SER H    A  93 . HN   1 1 
       1326 1 1 1 1  75 ASN HB3  A  75 . HB1  1 1 
       1326 1 2 1 1  77 GLY H    A  77 . HN   1 1 
       1327 1 1 1 1  75 ASN QD   A  75 . HD2* 1 1 
       1327 1 2 1 1  92 ASN QB   A  92 . HB*  1 1 
       1328 1 1 1 1  76 ALA H    A  76 . HN   1 1 
       1328 1 2 1 1  76 ALA MB   A  76 . HB*  1 1 
       1329 1 1 1 1  76 ALA H    A  76 . HN   1 1 
       1329 1 2 1 1  77 GLY H    A  77 . HN   1 1 
       1330 1 1 1 1  76 ALA H    A  76 . HN   1 1 
       1330 1 2 1 1  77 GLY QA   A  77 . HA*  1 1 
       1331 1 1 1 1  76 ALA H    A  76 . HN   1 1 
       1331 1 2 1 1  78 VAL H    A  78 . HN   1 1 
       1332 1 1 1 1  76 ALA HA   A  76 . HA   1 1 
       1332 1 2 1 1  78 VAL H    A  78 . HN   1 1 
       1333 1 1 1 1  76 ALA MB   A  76 . HB*  1 1 
       1333 1 2 1 1  77 GLY H    A  77 . HN   1 1 
       1334 1 1 1 1  76 ALA MB   A  76 . HB*  1 1 
       1334 1 2 1 1  77 GLY QA   A  77 . HA*  1 1 
       1335 1 1 1 1  76 ALA MB   A  76 . HB*  1 1 
       1335 1 2 1 1  78 VAL H    A  78 . HN   1 1 
       1336 1 1 1 1  76 ALA MB   A  76 . HB*  1 1 
       1336 1 2 1 1  78 VAL HB   A  78 . HB   1 1 
       1337 1 1 1 1  76 ALA MB   A  76 . HB*  1 1 
       1337 1 2 1 1  78 VAL QG   A  78 . HG*  1 1 
       1338 1 1 1 1  77 GLY H    A  77 . HN   1 1 
       1338 1 2 1 1  78 VAL H    A  78 . HN   1 1 
       1339 1 1 1 1  77 GLY H    A  77 . HN   1 1 
       1339 1 2 1 1  78 VAL QG   A  78 . HG*  1 1 
       1340 1 1 1 1  77 GLY QA   A  77 . HA*  1 1 
       1340 1 2 1 1  78 VAL HA   A  78 . HA   1 1 
       1341 1 1 1 1  78 VAL H    A  78 . HN   1 1 
       1341 1 2 1 1  78 VAL HB   A  78 . HB   1 1 
       1342 1 1 1 1  78 VAL H    A  78 . HN   1 1 
       1342 1 2 1 1  78 VAL MG1  A  78 . HG1* 1 1 
       1343 1 1 1 1  78 VAL H    A  78 . HN   1 1 
       1343 1 2 1 1  78 VAL QG   A  78 . HG*  1 1 
       1344 1 1 1 1  78 VAL H    A  78 . HN   1 1 
       1344 1 2 1 1  78 VAL MG2  A  78 . HG2* 1 1 
       1345 1 1 1 1  78 VAL H    A  78 . HN   1 1 
       1345 1 2 1 1  79 THR H    A  79 . HN   1 1 
       1346 1 1 1 1  78 VAL H    A  78 . HN   1 1 
       1346 1 2 1 1  87 ILE MD   A  87 . HD1* 1 1 
       1347 1 1 1 1  78 VAL H    A  78 . HN   1 1 
       1347 1 2 1 1  87 ILE HG12 A  87 . HG12 1 1 
       1348 1 1 1 1  78 VAL HA   A  78 . HA   1 1 
       1348 1 2 1 1  78 VAL MG1  A  78 . HG1* 1 1 
       1349 1 1 1 1  78 VAL HA   A  78 . HA   1 1 
       1349 1 2 1 1  78 VAL MG2  A  78 . HG2* 1 1 
       1350 1 1 1 1  78 VAL HA   A  78 . HA   1 1 
       1350 1 2 1 1  79 THR H    A  79 . HN   1 1 
       1351 1 1 1 1  78 VAL HB   A  78 . HB   1 1 
       1351 1 2 1 1  79 THR H    A  79 . HN   1 1 
       1352 1 1 1 1  78 VAL QG   A  78 . HG*  1 1 
       1352 1 2 1 1  79 THR H    A  79 . HN   1 1 
       1353 1 1 1 1  78 VAL QG   A  78 . HG*  1 1 
       1353 1 2 1 1  87 ILE MD   A  87 . HD1* 1 1 
       1354 1 1 1 1  78 VAL MG1  A  78 . HG1* 1 1 
       1354 1 2 1 1  79 THR H    A  79 . HN   1 1 
       1355 1 1 1 1  78 VAL MG2  A  78 . HG2* 1 1 
       1355 1 2 1 1  79 THR H    A  79 . HN   1 1 
       1356 1 1 1 1  79 THR H    A  79 . HN   1 1 
       1356 1 2 1 1  79 THR HB   A  79 . HB   1 1 
       1357 1 1 1 1  79 THR H    A  79 . HN   1 1 
       1357 1 2 1 1  79 THR MG   A  79 . HG2* 1 1 
       1358 1 1 1 1  79 THR H    A  79 . HN   1 1 
       1358 1 2 1 1  80 ALA H    A  80 . HN   1 1 
       1359 1 1 1 1  79 THR HA   A  79 . HA   1 1 
       1359 1 2 1 1  79 THR MG   A  79 . HG2* 1 1 
       1360 1 1 1 1  79 THR HA   A  79 . HA   1 1 
       1360 1 2 1 1  80 ALA H    A  80 . HN   1 1 
       1361 1 1 1 1  79 THR HA   A  79 . HA   1 1 
       1361 1 2 1 1  80 ALA MB   A  80 . HB*  1 1 
       1362 1 1 1 1  79 THR HB   A  79 . HB   1 1 
       1362 1 2 1 1  80 ALA H    A  80 . HN   1 1 
       1363 1 1 1 1  79 THR MG   A  79 . HG2* 1 1 
       1363 1 2 1 1  80 ALA H    A  80 . HN   1 1 
       1364 1 1 1 1  80 ALA H    A  80 . HN   1 1 
       1364 1 2 1 1  80 ALA MB   A  80 . HB*  1 1 
       1365 1 1 1 1  80 ALA H    A  80 . HN   1 1 
       1365 1 2 1 1  81 SER H    A  81 . HN   1 1 
       1366 1 1 1 1  80 ALA HA   A  80 . HA   1 1 
       1366 1 2 1 1  81 SER H    A  81 . HN   1 1 
       1367 1 1 1 1  80 ALA HA   A  80 . HA   1 1 
       1367 1 2 1 1  87 ILE H    A  87 . HN   1 1 
       1368 1 1 1 1  80 ALA HA   A  80 . HA   1 1 
       1368 1 2 1 1  87 ILE MD   A  87 . HD1* 1 1 
       1369 1 1 1 1  80 ALA HA   A  80 . HA   1 1 
       1369 1 2 1 1  87 ILE HG12 A  87 . HG12 1 1 
       1370 1 1 1 1  80 ALA MB   A  80 . HB*  1 1 
       1370 1 2 1 1  81 SER H    A  81 . HN   1 1 
       1371 1 1 1 1  80 ALA MB   A  80 . HB*  1 1 
       1371 1 2 1 1  81 SER HA   A  81 . HA   1 1 
       1372 1 1 1 1  80 ALA MB   A  80 . HB*  1 1 
       1372 1 2 1 1  87 ILE HB   A  87 . HB   1 1 
       1373 1 1 1 1  80 ALA MB   A  80 . HB*  1 1 
       1373 1 2 1 1  87 ILE MD   A  87 . HD1* 1 1 
       1374 1 1 1 1  80 ALA MB   A  80 . HB*  1 1 
       1374 1 2 1 1  87 ILE HG12 A  87 . HG12 1 1 
       1375 1 1 1 1  80 ALA MB   A  80 . HB*  1 1 
       1375 1 2 1 1  87 ILE MG   A  87 . HG2* 1 1 
       1376 1 1 1 1  81 SER H    A  81 . HN   1 1 
       1376 1 2 1 1  81 SER HB2  A  81 . HB2  1 1 
       1377 1 1 1 1  81 SER H    A  81 . HN   1 1 
       1377 1 2 1 1  81 SER HB3  A  81 . HB1  1 1 
       1378 1 1 1 1  81 SER H    A  81 . HN   1 1 
       1378 1 2 1 1  82 PRO HD2  A  82 . HD2  1 1 
       1379 1 1 1 1  81 SER H    A  81 . HN   1 1 
       1379 1 2 1 1  82 PRO HD3  A  82 . HD1  1 1 
       1380 1 1 1 1  81 SER H    A  81 . HN   1 1 
       1380 1 2 1 1  87 ILE MD   A  87 . HD1* 1 1 
       1381 1 1 1 1  81 SER HA   A  81 . HA   1 1 
       1381 1 2 1 1  82 PRO HD2  A  82 . HD2  1 1 
       1382 1 1 1 1  81 SER HA   A  81 . HA   1 1 
       1382 1 2 1 1  82 PRO QD   A  82 . HD*  1 1 
       1383 1 1 1 1  81 SER HA   A  81 . HA   1 1 
       1383 1 2 1 1  82 PRO HD3  A  82 . HD1  1 1 
       1384 1 1 1 1  81 SER HA   A  81 . HA   1 1 
       1384 1 2 1 1  82 PRO QG   A  82 . HG*  1 1 
       1385 1 1 1 1  82 PRO HA   A  82 . HA   1 1 
       1385 1 2 1 1  83 PRO HA   A  83 . HA   1 1 
       1386 1 1 1 1  82 PRO HA   A  82 . HA   1 1 
       1386 1 2 1 1  84 THR H    A  84 . HN   1 1 
       1387 1 1 1 1  82 PRO HA   A  82 . HA   1 1 
       1387 1 2 1 1  85 ASP H    A  85 . HN   1 1 
       1388 1 1 1 1  82 PRO QB   A  82 . HB*  1 1 
       1388 1 2 1 1  83 PRO HD2  A  83 . HD2  1 1 
       1389 1 1 1 1  82 PRO QB   A  82 . HB*  1 1 
       1389 1 2 1 1  84 THR H    A  84 . HN   1 1 
       1390 1 1 1 1  82 PRO HB2  A  82 . HB2  1 1 
       1390 1 2 1 1  83 PRO HD2  A  83 . HD2  1 1 
       1391 1 1 1 1  82 PRO HB2  A  82 . HB2  1 1 
       1391 1 2 1 1  84 THR H    A  84 . HN   1 1 
       1392 1 1 1 1  82 PRO HB3  A  82 . HB1  1 1 
       1392 1 2 1 1  83 PRO HD2  A  83 . HD2  1 1 
       1393 1 1 1 1  82 PRO HB3  A  82 . HB1  1 1 
       1393 1 2 1 1  84 THR H    A  84 . HN   1 1 
       1394 1 1 1 1  82 PRO QG   A  82 . HG*  1 1 
       1394 1 2 1 1  87 ILE MD   A  87 . HD1* 1 1 
       1395 1 1 1 1  83 PRO HA   A  83 . HA   1 1 
       1395 1 2 1 1  84 THR MG   A  84 . HG2* 1 1 
       1396 1 1 1 1  83 PRO HB2  A  83 . HB2  1 1 
       1396 1 2 1 1  84 THR HA   A  84 . HA   1 1 
       1397 1 1 1 1  83 PRO HD3  A  83 . HD1  1 1 
       1397 1 2 1 1  84 THR H    A  84 . HN   1 1 
       1398 1 1 1 1  83 PRO QG   A  83 . HG*  1 1 
       1398 1 2 1 1  84 THR H    A  84 . HN   1 1 
       1399 1 1 1 1  84 THR H    A  84 . HN   1 1 
       1399 1 2 1 1  84 THR MG   A  84 . HG2* 1 1 
       1400 1 1 1 1  84 THR H    A  84 . HN   1 1 
       1400 1 2 1 1  85 ASP HB2  A  85 . HB2  1 1 
       1401 1 1 1 1  84 THR HA   A  84 . HA   1 1 
       1401 1 2 1 1  84 THR MG   A  84 . HG2* 1 1 
       1402 1 1 1 1  84 THR MG   A  84 . HG2* 1 1 
       1402 1 2 1 1  85 ASP H    A  85 . HN   1 1 
       1403 1 1 1 1  85 ASP H    A  85 . HN   1 1 
       1403 1 2 1 1  85 ASP HB2  A  85 . HB2  1 1 
       1404 1 1 1 1  85 ASP H    A  85 . HN   1 1 
       1404 1 2 1 1  85 ASP HB3  A  85 . HB1  1 1 
       1405 1 1 1 1  85 ASP H    A  85 . HN   1 1 
       1405 1 2 1 1  86 LEU H    A  86 . HN   1 1 
       1406 1 1 1 1  85 ASP H    A  85 . HN   1 1 
       1406 1 2 1 1  86 LEU QD   A  86 . HD2* 1 1 
       1407 1 1 1 1  85 ASP HA   A  85 . HA   1 1 
       1407 1 2 1 1  86 LEU H    A  86 . HN   1 1 
       1408 1 1 1 1  85 ASP HA   A  85 . HA   1 1 
       1408 1 2 1 1  86 LEU QD   A  86 . HD2* 1 1 
       1409 1 1 1 1  85 ASP HA   A  85 . HA   1 1 
       1409 1 2 1 1  86 LEU HG   A  86 . HG   1 1 
       1410 1 1 1 1  85 ASP HB2  A  85 . HB2  1 1 
       1410 1 2 1 1  86 LEU H    A  86 . HN   1 1 
       1411 1 1 1 1  85 ASP HB3  A  85 . HB1  1 1 
       1411 1 2 1 1  86 LEU H    A  86 . HN   1 1 
       1412 1 1 1 1  86 LEU H    A  86 . HN   1 1 
       1412 1 2 1 1  86 LEU HB2  A  86 . HB2  1 1 
       1413 1 1 1 1  86 LEU H    A  86 . HN   1 1 
       1413 1 2 1 1  86 LEU QD   A  86 . HD1* 1 1 
       1414 1 1 1 1  86 LEU H    A  86 . HN   1 1 
       1414 1 2 1 1  86 LEU HG   A  86 . HG   1 1 
       1415 1 1 1 1  86 LEU H    A  86 . HN   1 1 
       1415 1 2 1 1  87 ILE H    A  87 . HN   1 1 
       1416 1 1 1 1  86 LEU HA   A  86 . HA   1 1 
       1416 1 2 1 1  86 LEU QD   A  86 . HD1* 1 1 
       1417 1 1 1 1  86 LEU HA   A  86 . HA   1 1 
       1417 1 2 1 1  87 ILE H    A  87 . HN   1 1 
       1418 1 1 1 1  86 LEU HB2  A  86 . HB2  1 1 
       1418 1 2 1 1  87 ILE H    A  87 . HN   1 1 
       1419 1 1 1 1  86 LEU QD   A  86 . HD1* 1 1 
       1419 1 2 1 1  87 ILE H    A  87 . HN   1 1 
       1420 1 1 1 1  87 ILE H    A  87 . HN   1 1 
       1420 1 2 1 1  87 ILE HB   A  87 . HB   1 1 
       1421 1 1 1 1  87 ILE H    A  87 . HN   1 1 
       1421 1 2 1 1  87 ILE MD   A  87 . HD1* 1 1 
       1422 1 1 1 1  87 ILE H    A  87 . HN   1 1 
       1422 1 2 1 1  87 ILE HG12 A  87 . HG12 1 1 
       1423 1 1 1 1  87 ILE H    A  87 . HN   1 1 
       1423 1 2 1 1  87 ILE HG13 A  87 . HG11 1 1 
       1424 1 1 1 1  87 ILE H    A  87 . HN   1 1 
       1424 1 2 1 1  87 ILE MG   A  87 . HG2* 1 1 
       1425 1 1 1 1  87 ILE H    A  87 . HN   1 1 
       1425 1 2 1 1  88 TRP H    A  88 . HN   1 1 
       1426 1 1 1 1  87 ILE HA   A  87 . HA   1 1 
       1426 1 2 1 1  87 ILE MD   A  87 . HD1* 1 1 
       1427 1 1 1 1  87 ILE HA   A  87 . HA   1 1 
       1427 1 2 1 1  87 ILE HG13 A  87 . HG11 1 1 
       1428 1 1 1 1  87 ILE HA   A  87 . HA   1 1 
       1428 1 2 1 1  87 ILE MG   A  87 . HG2* 1 1 
       1429 1 1 1 1  87 ILE HA   A  87 . HA   1 1 
       1429 1 2 1 1  88 TRP H    A  88 . HN   1 1 
       1430 1 1 1 1  87 ILE HB   A  87 . HB   1 1 
       1430 1 2 1 1  88 TRP H    A  88 . HN   1 1 
       1431 1 1 1 1  87 ILE MD   A  87 . HD1* 1 1 
       1431 1 2 1 1  87 ILE MG   A  87 . HG2* 1 1 
       1432 1 1 1 1  87 ILE MD   A  87 . HD1* 1 1 
       1432 1 2 1 1  88 TRP H    A  88 . HN   1 1 
       1433 1 1 1 1  87 ILE HG12 A  87 . HG12 1 1 
       1433 1 2 1 1  87 ILE MG   A  87 . HG2* 1 1 
       1434 1 1 1 1  87 ILE HG12 A  87 . HG12 1 1 
       1434 1 2 1 1  88 TRP H    A  88 . HN   1 1 
       1435 1 1 1 1  87 ILE HG13 A  87 . HG11 1 1 
       1435 1 2 1 1  87 ILE MG   A  87 . HG2* 1 1 
       1436 1 1 1 1  87 ILE HG13 A  87 . HG11 1 1 
       1436 1 2 1 1  88 TRP H    A  88 . HN   1 1 
       1437 1 1 1 1  87 ILE MG   A  87 . HG2* 1 1 
       1437 1 2 1 1  88 TRP H    A  88 . HN   1 1 
       1438 1 1 1 1  87 ILE MG   A  87 . HG2* 1 1 
       1438 1 2 1 1  89 LYS H    A  89 . HN   1 1 
       1439 1 1 1 1  87 ILE MG   A  87 . HG2* 1 1 
       1439 1 2 1 1  89 LYS HA   A  89 . HA   1 1 
       1440 1 1 1 1  87 ILE MG   A  87 . HG2* 1 1 
       1440 1 2 1 1  89 LYS HG2  A  89 . HG2  1 1 
       1441 1 1 1 1  87 ILE MG   A  87 . HG2* 1 1 
       1441 1 2 1 1  89 LYS QG   A  89 . HG*  1 1 
       1442 1 1 1 1  87 ILE MG   A  87 . HG2* 1 1 
       1442 1 2 1 1  89 LYS HG3  A  89 . HG1  1 1 
       1443 1 1 1 1  87 ILE MG   A  87 . HG2* 1 1 
       1443 1 2 1 1  90 ASN H    A  90 . HN   1 1 
       1444 1 1 1 1  88 TRP H    A  88 . HN   1 1 
       1444 1 2 1 1  88 TRP HB2  A  88 . HB2  1 1 
       1445 1 1 1 1  88 TRP H    A  88 . HN   1 1 
       1445 1 2 1 1  88 TRP HB3  A  88 . HB1  1 1 
       1446 1 1 1 1  88 TRP H    A  88 . HN   1 1 
       1446 1 2 1 1  88 TRP HD1  A  88 . HD1  1 1 
       1447 1 1 1 1  88 TRP H    A  88 . HN   1 1 
       1447 1 2 1 1  88 TRP HE3  A  88 . HE3  1 1 
       1448 1 1 1 1  88 TRP H    A  88 . HN   1 1 
       1448 1 2 1 1  89 LYS H    A  89 . HN   1 1 
       1449 1 1 1 1  88 TRP HA   A  88 . HA   1 1 
       1449 1 2 1 1  88 TRP HD1  A  88 . HD1  1 1 
       1450 1 1 1 1  88 TRP HA   A  88 . HA   1 1 
       1450 1 2 1 1  88 TRP HE1  A  88 . HE1  1 1 
       1451 1 1 1 1  88 TRP HA   A  88 . HA   1 1 
       1451 1 2 1 1  89 LYS H    A  89 . HN   1 1 
       1452 1 1 1 1  88 TRP HB2  A  88 . HB2  1 1 
       1452 1 2 1 1  89 LYS H    A  89 . HN   1 1 
       1453 1 1 1 1  88 TRP HB3  A  88 . HB1  1 1 
       1453 1 2 1 1  88 TRP HE1  A  88 . HE1  1 1 
       1454 1 1 1 1  88 TRP HB3  A  88 . HB1  1 1 
       1454 1 2 1 1  89 LYS H    A  89 . HN   1 1 
       1455 1 1 1 1  88 TRP HD1  A  88 . HD1  1 1 
       1455 1 2 1 1  89 LYS H    A  89 . HN   1 1 
       1456 1 1 1 1  88 TRP HD1  A  88 . HD1  1 1 
       1456 1 2 1 1  89 LYS HA   A  89 . HA   1 1 
       1457 1 1 1 1  88 TRP HD1  A  88 . HD1  1 1 
       1457 1 2 1 1  90 ASN H    A  90 . HN   1 1 
       1458 1 1 1 1  88 TRP HD1  A  88 . HD1  1 1 
       1458 1 2 1 1  90 ASN QB   A  90 . HB*  1 1 
       1459 1 1 1 1  88 TRP HE1  A  88 . HE1  1 1 
       1459 1 2 1 1  89 LYS H    A  89 . HN   1 1 
       1460 1 1 1 1  88 TRP HE1  A  88 . HE1  1 1 
       1460 1 2 1 1  90 ASN H    A  90 . HN   1 1 
       1461 1 1 1 1  88 TRP HE1  A  88 . HE1  1 1 
       1461 1 2 1 1  90 ASN QB   A  90 . HB*  1 1 
       1462 1 1 1 1  88 TRP HE1  A  88 . HE1  1 1 
       1462 1 2 1 1  91 GLN H    A  91 . HN   1 1 
       1463 1 1 1 1  88 TRP HE1  A  88 . HE1  1 1 
       1463 1 2 1 1  91 GLN QB   A  91 . HB*  1 1 
       1464 1 1 1 1  89 LYS H    A  89 . HN   1 1 
       1464 1 2 1 1  89 LYS HB2  A  89 . HB2  1 1 
       1465 1 1 1 1  89 LYS H    A  89 . HN   1 1 
       1465 1 2 1 1  89 LYS QB   A  89 . HB*  1 1 
       1466 1 1 1 1  89 LYS H    A  89 . HN   1 1 
       1466 1 2 1 1  89 LYS HB3  A  89 . HB1  1 1 
       1467 1 1 1 1  89 LYS H    A  89 . HN   1 1 
       1467 1 2 1 1  89 LYS HG2  A  89 . HG2  1 1 
       1468 1 1 1 1  89 LYS H    A  89 . HN   1 1 
       1468 1 2 1 1  89 LYS QG   A  89 . HG*  1 1 
       1469 1 1 1 1  89 LYS H    A  89 . HN   1 1 
       1469 1 2 1 1  89 LYS HG3  A  89 . HG1  1 1 
       1470 1 1 1 1  89 LYS H    A  89 . HN   1 1 
       1470 1 2 1 1  90 ASN H    A  90 . HN   1 1 
       1471 1 1 1 1  89 LYS HA   A  89 . HA   1 1 
       1471 1 2 1 1  89 LYS HD2  A  89 . HD2  1 1 
       1472 1 1 1 1  89 LYS HA   A  89 . HA   1 1 
       1472 1 2 1 1  89 LYS HD3  A  89 . HD1  1 1 
       1473 1 1 1 1  89 LYS HA   A  89 . HA   1 1 
       1473 1 2 1 1  89 LYS HG2  A  89 . HG2  1 1 
       1474 1 1 1 1  89 LYS HA   A  89 . HA   1 1 
       1474 1 2 1 1  89 LYS QG   A  89 . HG*  1 1 
       1475 1 1 1 1  89 LYS HA   A  89 . HA   1 1 
       1475 1 2 1 1  89 LYS HG3  A  89 . HG1  1 1 
       1476 1 1 1 1  89 LYS HA   A  89 . HA   1 1 
       1476 1 2 1 1  90 ASN H    A  90 . HN   1 1 
       1477 1 1 1 1  89 LYS HA   A  89 . HA   1 1 
       1477 1 2 1 1  90 ASN HA   A  90 . HA   1 1 
       1478 1 1 1 1  89 LYS HA   A  89 . HA   1 1 
       1478 1 2 1 1  91 GLN H    A  91 . HN   1 1 
       1479 1 1 1 1  89 LYS QB   A  89 . HB*  1 1 
       1479 1 2 1 1  89 LYS QE   A  89 . HE*  1 1 
       1480 1 1 1 1  89 LYS QB   A  89 . HB*  1 1 
       1480 1 2 1 1  90 ASN H    A  90 . HN   1 1 
       1481 1 1 1 1  89 LYS HB2  A  89 . HB2  1 1 
       1481 1 2 1 1  90 ASN H    A  90 . HN   1 1 
       1482 1 1 1 1  89 LYS HB3  A  89 . HB1  1 1 
       1482 1 2 1 1  90 ASN H    A  90 . HN   1 1 
       1483 1 1 1 1  89 LYS QE   A  89 . HE*  1 1 
       1483 1 2 1 1  89 LYS QG   A  89 . HG*  1 1 
       1484 1 1 1 1  90 ASN H    A  90 . HN   1 1 
       1484 1 2 1 1  90 ASN QB   A  90 . HB*  1 1 
       1485 1 1 1 1  90 ASN H    A  90 . HN   1 1 
       1485 1 2 1 1  91 GLN H    A  91 . HN   1 1 
       1486 1 1 1 1  90 ASN H    A  90 . HN   1 1 
       1486 1 2 1 1  91 GLN QB   A  91 . HB*  1 1 
       1487 1 1 1 1  90 ASN QB   A  90 . HB*  1 1 
       1487 1 2 1 1  91 GLN H    A  91 . HN   1 1 
       1488 1 1 1 1  90 ASN HB2  A  90 . HB2  1 1 
       1488 1 2 1 1  91 GLN H    A  91 . HN   1 1 
       1489 1 1 1 1  90 ASN HB3  A  90 . HB1  1 1 
       1489 1 2 1 1  91 GLN H    A  91 . HN   1 1 
       1490 1 1 1 1  91 GLN H    A  91 . HN   1 1 
       1490 1 2 1 1  91 GLN HB2  A  91 . HB2  1 1 
       1491 1 1 1 1  91 GLN H    A  91 . HN   1 1 
       1491 1 2 1 1  91 GLN QB   A  91 . HB*  1 1 
       1492 1 1 1 1  91 GLN H    A  91 . HN   1 1 
       1492 1 2 1 1  91 GLN HB3  A  91 . HB1  1 1 
       1493 1 1 1 1  91 GLN H    A  91 . HN   1 1 
       1493 1 2 1 1  92 ASN H    A  92 . HN   1 1 
       1494 1 1 1 1  91 GLN HA   A  91 . HA   1 1 
       1494 1 2 1 1  91 GLN QE   A  91 . HE*  1 1 
       1495 1 1 1 1  91 GLN HA   A  91 . HA   1 1 
       1495 1 2 1 1  92 ASN H    A  92 . HN   1 1 
       1496 1 1 1 1  91 GLN HB2  A  91 . HB2  1 1 
       1496 1 2 1 1  92 ASN H    A  92 . HN   1 1 
       1497 1 1 1 1  91 GLN HB3  A  91 . HB1  1 1 
       1497 1 2 1 1  92 ASN H    A  92 . HN   1 1 
       1498 1 1 1 1  91 GLN QE   A  91 . HE*  1 1 
       1498 1 2 1 1  92 ASN H    A  92 . HN   1 1 
       1499 1 1 1 1  91 GLN QG   A  91 . HG*  1 1 
       1499 1 2 1 1  92 ASN H    A  92 . HN   1 1 
       1500 1 1 1 1  91 GLN HG2  A  91 . HG2  1 1 
       1500 1 2 1 1  92 ASN H    A  92 . HN   1 1 
       1501 1 1 1 1  91 GLN HG3  A  91 . HG1  1 1 
       1501 1 2 1 1  92 ASN H    A  92 . HN   1 1 
       1502 1 1 1 1  92 ASN H    A  92 . HN   1 1 
       1502 1 2 1 1  92 ASN HB2  A  92 . HB2  1 1 
       1503 1 1 1 1  92 ASN H    A  92 . HN   1 1 
       1503 1 2 1 1  92 ASN QB   A  92 . HB*  1 1 
       1504 1 1 1 1  92 ASN H    A  92 . HN   1 1 
       1504 1 2 1 1  92 ASN HB3  A  92 . HB1  1 1 
       1505 1 1 1 1  92 ASN H    A  92 . HN   1 1 
       1505 1 2 1 1  92 ASN QD   A  92 . HD2* 1 1 
       1506 1 1 1 1  92 ASN H    A  92 . HN   1 1 
       1506 1 2 1 1  93 SER H    A  93 . HN   1 1 
       1507 1 1 1 1  92 ASN HA   A  92 . HA   1 1 
       1507 1 2 1 1  93 SER H    A  93 . HN   1 1 
       1508 1 1 1 1  92 ASN HA   A  92 . HA   1 1 
       1508 1 2 1 1  93 SER HA   A  93 . HA   1 1 
       1509 1 1 1 1  92 ASN QB   A  92 . HB*  1 1 
       1509 1 2 1 1  93 SER H    A  93 . HN   1 1 
       1510 1 1 1 1  92 ASN HB2  A  92 . HB2  1 1 
       1510 1 2 1 1  93 SER H    A  93 . HN   1 1 
       1511 1 1 1 1  92 ASN HB3  A  92 . HB1  1 1 
       1511 1 2 1 1  93 SER H    A  93 . HN   1 1 
       1512 1 1 1 1  93 SER H    A  93 . HN   1 1 
       1512 1 2 1 1  93 SER HB2  A  93 . HB2  1 1 
       1513 1 1 1 1  93 SER H    A  93 . HN   1 1 
       1513 1 2 1 1  93 SER QB   A  93 . HB*  1 1 
       1514 1 1 1 1  93 SER H    A  93 . HN   1 1 
       1514 1 2 1 1  93 SER HB3  A  93 . HB1  1 1 
       1515 1 1 1 1  93 SER H    A  93 . HN   1 1 
       1515 1 2 1 1  94 TRP H    A  94 . HN   1 1 
       1516 1 1 1 1  93 SER HA   A  93 . HA   1 1 
       1516 1 2 1 1  94 TRP H    A  94 . HN   1 1 
       1517 1 1 1 1  93 SER QB   A  93 . HB*  1 1 
       1517 1 2 1 1  94 TRP H    A  94 . HN   1 1 
       1518 1 1 1 1  93 SER HB2  A  93 . HB2  1 1 
       1518 1 2 1 1  94 TRP H    A  94 . HN   1 1 
       1519 1 1 1 1  93 SER HB3  A  93 . HB1  1 1 
       1519 1 2 1 1  94 TRP H    A  94 . HN   1 1 
       1520 1 1 1 1  94 TRP H    A  94 . HN   1 1 
       1520 1 2 1 1  94 TRP QB   A  94 . HB*  1 1 
       1521 1 1 1 1  94 TRP H    A  94 . HN   1 1 
       1521 1 2 1 1  94 TRP HE3  A  94 . HE3  1 1 
       1522 1 1 1 1  94 TRP QB   A  94 . HB*  1 1 
       1522 1 2 1 1  95 GLY H    A  95 . HN   1 1 
       1523 1 1 1 1  94 TRP QB   A  94 . HB*  1 1 
       1523 1 2 1 1  95 GLY QA   A  95 . HA*  1 1 
       1524 1 1 1 1  94 TRP HB2  A  94 . HB2  1 1 
       1524 1 2 1 1  95 GLY H    A  95 . HN   1 1 
       1525 1 1 1 1  94 TRP HB3  A  94 . HB1  1 1 
       1525 1 2 1 1  95 GLY H    A  95 . HN   1 1 
       1526 1 1 1 1  94 TRP HD1  A  94 . HD1  1 1 
       1526 1 2 1 1  95 GLY H    A  95 . HN   1 1 
       1527 1 1 1 1  94 TRP HD1  A  94 . HD1  1 1 
       1527 1 2 1 1 100 VAL HB   A 100 . HB   1 1 
       1528 1 1 1 1  94 TRP HD1  A  94 . HD1  1 1 
       1528 1 2 1 1 100 VAL MG1  A 100 . HG1* 1 1 
       1529 1 1 1 1  94 TRP HD1  A  94 . HD1  1 1 
       1529 1 2 1 1 100 VAL MG2  A 100 . HG2* 1 1 
       1530 1 1 1 1  94 TRP HE1  A  94 . HE1  1 1 
       1530 1 2 1 1 100 VAL HB   A 100 . HB   1 1 
       1531 1 1 1 1  94 TRP HE1  A  94 . HE1  1 1 
       1531 1 2 1 1 100 VAL MG1  A 100 . HG1* 1 1 
       1532 1 1 1 1  94 TRP HE1  A  94 . HE1  1 1 
       1532 1 2 1 1 100 VAL MG2  A 100 . HG2* 1 1 
       1533 1 1 1 1  95 GLY H    A  95 . HN   1 1 
       1533 1 2 1 1  96 THR H    A  96 . HN   1 1 
       1534 1 1 1 1  95 GLY H    A  95 . HN   1 1 
       1534 1 2 1 1  96 THR HA   A  96 . HA   1 1 
       1535 1 1 1 1  95 GLY QA   A  95 . HA*  1 1 
       1535 1 2 1 1  96 THR H    A  96 . HN   1 1 
       1536 1 1 1 1  96 THR H    A  96 . HN   1 1 
       1536 1 2 1 1  96 THR HB   A  96 . HB   1 1 
       1537 1 1 1 1  96 THR H    A  96 . HN   1 1 
       1537 1 2 1 1  96 THR MG   A  96 . HG2* 1 1 
       1538 1 1 1 1  96 THR H    A  96 . HN   1 1 
       1538 1 2 1 1  97 GLY H    A  97 . HN   1 1 
       1539 1 1 1 1  96 THR HA   A  96 . HA   1 1 
       1539 1 2 1 1  96 THR MG   A  96 . HG2* 1 1 
       1540 1 1 1 1  96 THR HA   A  96 . HA   1 1 
       1540 1 2 1 1  97 GLY H    A  97 . HN   1 1 
       1541 1 1 1 1  96 THR HA   A  96 . HA   1 1 
       1541 1 2 1 1  98 GLU H    A  98 . HN   1 1 
       1542 1 1 1 1  96 THR HB   A  96 . HB   1 1 
       1542 1 2 1 1  97 GLY H    A  97 . HN   1 1 
       1543 1 1 1 1  96 THR MG   A  96 . HG2* 1 1 
       1543 1 2 1 1  97 GLY H    A  97 . HN   1 1 
       1544 1 1 1 1  96 THR MG   A  96 . HG2* 1 1 
       1544 1 2 1 1  98 GLU H    A  98 . HN   1 1 
       1545 1 1 1 1  97 GLY H    A  97 . HN   1 1 
       1545 1 2 1 1  98 GLU H    A  98 . HN   1 1 
       1546 1 1 1 1  97 GLY H    A  97 . HN   1 1 
       1546 1 2 1 1  98 GLU HB2  A  98 . HB2  1 1 
       1547 1 1 1 1  97 GLY H    A  97 . HN   1 1 
       1547 1 2 1 1  98 GLU QG   A  98 . HG*  1 1 
       1548 1 1 1 1  98 GLU H    A  98 . HN   1 1 
       1548 1 2 1 1  98 GLU HB2  A  98 . HB2  1 1 
       1549 1 1 1 1  98 GLU H    A  98 . HN   1 1 
       1549 1 2 1 1  98 GLU HB3  A  98 . HB1  1 1 
       1550 1 1 1 1  98 GLU H    A  98 . HN   1 1 
       1550 1 2 1 1  98 GLU HG2  A  98 . HG2  1 1 
       1551 1 1 1 1  98 GLU H    A  98 . HN   1 1 
       1551 1 2 1 1  98 GLU QG   A  98 . HG*  1 1 
       1552 1 1 1 1  98 GLU H    A  98 . HN   1 1 
       1552 1 2 1 1  98 GLU HG3  A  98 . HG1  1 1 
       1553 1 1 1 1  98 GLU H    A  98 . HN   1 1 
       1553 1 2 1 1  99 ASP H    A  99 . HN   1 1 
       1554 1 1 1 1  98 GLU HA   A  98 . HA   1 1 
       1554 1 2 1 1  98 GLU QG   A  98 . HG*  1 1 
       1555 1 1 1 1  98 GLU HA   A  98 . HA   1 1 
       1555 1 2 1 1  99 ASP H    A  99 . HN   1 1 
       1556 1 1 1 1  98 GLU HB2  A  98 . HB2  1 1 
       1556 1 2 1 1  99 ASP H    A  99 . HN   1 1 
       1557 1 1 1 1  98 GLU HB3  A  98 . HB1  1 1 
       1557 1 2 1 1  99 ASP H    A  99 . HN   1 1 
       1558 1 1 1 1  98 GLU HG2  A  98 . HG2  1 1 
       1558 1 2 1 1  99 ASP H    A  99 . HN   1 1 
       1559 1 1 1 1  98 GLU HG3  A  98 . HG1  1 1 
       1559 1 2 1 1  99 ASP H    A  99 . HN   1 1 
       1560 1 1 1 1  99 ASP H    A  99 . HN   1 1 
       1560 1 2 1 1  99 ASP QB   A  99 . HB*  1 1 
       1561 1 1 1 1  99 ASP H    A  99 . HN   1 1 
       1561 1 2 1 1 100 VAL H    A 100 . HN   1 1 
       1562 1 1 1 1  99 ASP HA   A  99 . HA   1 1 
       1562 1 2 1 1 100 VAL H    A 100 . HN   1 1 
       1563 1 1 1 1  99 ASP QB   A  99 . HB*  1 1 
       1563 1 2 1 1 100 VAL H    A 100 . HN   1 1 
       1564 1 1 1 1  99 ASP HB2  A  99 . HB2  1 1 
       1564 1 2 1 1 100 VAL H    A 100 . HN   1 1 
       1565 1 1 1 1  99 ASP HB3  A  99 . HB1  1 1 
       1565 1 2 1 1 100 VAL H    A 100 . HN   1 1 
       1566 1 1 1 1 100 VAL H    A 100 . HN   1 1 
       1566 1 2 1 1 100 VAL HB   A 100 . HB   1 1 
       1567 1 1 1 1 100 VAL H    A 100 . HN   1 1 
       1567 1 2 1 1 100 VAL MG1  A 100 . HG1* 1 1 
       1568 1 1 1 1 100 VAL H    A 100 . HN   1 1 
       1568 1 2 1 1 100 VAL MG2  A 100 . HG2* 1 1 
       1569 1 1 1 1 100 VAL H    A 100 . HN   1 1 
       1569 1 2 1 1 101 LYS H    A 101 . HN   1 1 
       1570 1 1 1 1 100 VAL H    A 100 . HN   1 1 
       1570 1 2 1 1 116 SER HA   A 116 . HA   1 1 
       1571 1 1 1 1 100 VAL H    A 100 . HN   1 1 
       1571 1 2 1 1 117 THR H    A 117 . HN   1 1 
       1572 1 1 1 1 100 VAL H    A 100 . HN   1 1 
       1572 1 2 1 1 117 THR MG   A 117 . HG2* 1 1 
       1573 1 1 1 1 100 VAL HA   A 100 . HA   1 1 
       1573 1 2 1 1 100 VAL MG1  A 100 . HG1* 1 1 
       1574 1 1 1 1 100 VAL HA   A 100 . HA   1 1 
       1574 1 2 1 1 100 VAL MG2  A 100 . HG2* 1 1 
       1575 1 1 1 1 100 VAL HA   A 100 . HA   1 1 
       1575 1 2 1 1 101 LYS H    A 101 . HN   1 1 
       1576 1 1 1 1 100 VAL HB   A 100 . HB   1 1 
       1576 1 2 1 1 101 LYS H    A 101 . HN   1 1 
       1577 1 1 1 1 100 VAL HB   A 100 . HB   1 1 
       1577 1 2 1 1 117 THR MG   A 117 . HG2* 1 1 
       1578 1 1 1 1 100 VAL MG1  A 100 . HG1* 1 1 
       1578 1 2 1 1 101 LYS H    A 101 . HN   1 1 
       1579 1 1 1 1 100 VAL MG1  A 100 . HG1* 1 1 
       1579 1 2 1 1 117 THR H    A 117 . HN   1 1 
       1580 1 1 1 1 100 VAL MG1  A 100 . HG1* 1 1 
       1580 1 2 1 1 117 THR MG   A 117 . HG2* 1 1 
       1581 1 1 1 1 100 VAL MG2  A 100 . HG2* 1 1 
       1581 1 2 1 1 101 LYS H    A 101 . HN   1 1 
       1582 1 1 1 1 100 VAL MG2  A 100 . HG2* 1 1 
       1582 1 2 1 1 101 LYS HA   A 101 . HA   1 1 
       1583 1 1 1 1 100 VAL MG2  A 100 . HG2* 1 1 
       1583 1 2 1 1 117 THR H    A 117 . HN   1 1 
       1584 1 1 1 1 100 VAL MG2  A 100 . HG2* 1 1 
       1584 1 2 1 1 117 THR HA   A 117 . HA   1 1 
       1585 1 1 1 1 101 LYS H    A 101 . HN   1 1 
       1585 1 2 1 1 101 LYS HB2  A 101 . HB2  1 1 
       1586 1 1 1 1 101 LYS H    A 101 . HN   1 1 
       1586 1 2 1 1 101 LYS QB   A 101 . HB*  1 1 
       1587 1 1 1 1 101 LYS H    A 101 . HN   1 1 
       1587 1 2 1 1 101 LYS HB3  A 101 . HB1  1 1 
       1588 1 1 1 1 101 LYS H    A 101 . HN   1 1 
       1588 1 2 1 1 101 LYS HG2  A 101 . HG2  1 1 
       1589 1 1 1 1 101 LYS H    A 101 . HN   1 1 
       1589 1 2 1 1 101 LYS HG3  A 101 . HG1  1 1 
       1590 1 1 1 1 101 LYS H    A 101 . HN   1 1 
       1590 1 2 1 1 102 VAL H    A 102 . HN   1 1 
       1591 1 1 1 1 101 LYS H    A 101 . HN   1 1 
       1591 1 2 1 1 116 SER HA   A 116 . HA   1 1 
       1592 1 1 1 1 101 LYS HA   A 101 . HA   1 1 
       1592 1 2 1 1 101 LYS QD   A 101 . HD*  1 1 
       1593 1 1 1 1 101 LYS HA   A 101 . HA   1 1 
       1593 1 2 1 1 101 LYS HG3  A 101 . HG1  1 1 
       1594 1 1 1 1 101 LYS HA   A 101 . HA   1 1 
       1594 1 2 1 1 102 VAL H    A 102 . HN   1 1 
       1595 1 1 1 1 101 LYS HA   A 101 . HA   1 1 
       1595 1 2 1 1 102 VAL QG   A 102 . HG*  1 1 
       1596 1 1 1 1 101 LYS HA   A 101 . HA   1 1 
       1596 1 2 1 1 115 ARG H    A 115 . HN   1 1 
       1597 1 1 1 1 101 LYS HA   A 101 . HA   1 1 
       1597 1 2 1 1 116 SER H    A 116 . HN   1 1 
       1598 1 1 1 1 101 LYS HA   A 101 . HA   1 1 
       1598 1 2 1 1 116 SER HA   A 116 . HA   1 1 
       1599 1 1 1 1 101 LYS HA   A 101 . HA   1 1 
       1599 1 2 1 1 116 SER HB2  A 116 . HB2  1 1 
       1600 1 1 1 1 101 LYS HA   A 101 . HA   1 1 
       1600 1 2 1 1 116 SER HB3  A 116 . HB1  1 1 
       1601 1 1 1 1 101 LYS HA   A 101 . HA   1 1 
       1601 1 2 1 1 117 THR H    A 117 . HN   1 1 
       1602 1 1 1 1 101 LYS QB   A 101 . HB*  1 1 
       1602 1 2 1 1 101 LYS QD   A 101 . HD*  1 1 
       1603 1 1 1 1 101 LYS QB   A 101 . HB*  1 1 
       1603 1 2 1 1 101 LYS QE   A 101 . HE*  1 1 
       1604 1 1 1 1 101 LYS QB   A 101 . HB*  1 1 
       1604 1 2 1 1 102 VAL H    A 102 . HN   1 1 
       1605 1 1 1 1 101 LYS HB2  A 101 . HB2  1 1 
       1605 1 2 1 1 102 VAL H    A 102 . HN   1 1 
       1606 1 1 1 1 101 LYS HB3  A 101 . HB1  1 1 
       1606 1 2 1 1 102 VAL H    A 102 . HN   1 1 
       1607 1 1 1 1 101 LYS QD   A 101 . HD*  1 1 
       1607 1 2 1 1 103 ILE MD   A 103 . HD1* 1 1 
       1608 1 1 1 1 101 LYS QD   A 101 . HD*  1 1 
       1608 1 2 1 1 116 SER HB2  A 116 . HB2  1 1 
       1609 1 1 1 1 101 LYS QD   A 101 . HD*  1 1 
       1609 1 2 1 1 116 SER HB3  A 116 . HB1  1 1 
       1610 1 1 1 1 101 LYS HG2  A 101 . HG2  1 1 
       1610 1 2 1 1 102 VAL H    A 102 . HN   1 1 
       1611 1 1 1 1 101 LYS HG2  A 101 . HG2  1 1 
       1611 1 2 1 1 103 ILE MD   A 103 . HD1* 1 1 
       1612 1 1 1 1 101 LYS HG2  A 101 . HG2  1 1 
       1612 1 2 1 1 103 ILE HG12 A 103 . HG12 1 1 
       1613 1 1 1 1 101 LYS HG2  A 101 . HG2  1 1 
       1613 1 2 1 1 103 ILE HG13 A 103 . HG11 1 1 
       1614 1 1 1 1 101 LYS HG3  A 101 . HG1  1 1 
       1614 1 2 1 1 102 VAL H    A 102 . HN   1 1 
       1615 1 1 1 1 102 VAL H    A 102 . HN   1 1 
       1615 1 2 1 1 102 VAL HB   A 102 . HB   1 1 
       1616 1 1 1 1 102 VAL H    A 102 . HN   1 1 
       1616 1 2 1 1 102 VAL QG   A 102 . HG*  1 1 
       1617 1 1 1 1 102 VAL H    A 102 . HN   1 1 
       1617 1 2 1 1 103 ILE H    A 103 . HN   1 1 
       1618 1 1 1 1 102 VAL H    A 102 . HN   1 1 
       1618 1 2 1 1 103 ILE MD   A 103 . HD1* 1 1 
       1619 1 1 1 1 102 VAL H    A 102 . HN   1 1 
       1619 1 2 1 1 103 ILE HG12 A 103 . HG12 1 1 
       1620 1 1 1 1 102 VAL H    A 102 . HN   1 1 
       1620 1 2 1 1 115 ARG H    A 115 . HN   1 1 
       1621 1 1 1 1 102 VAL H    A 102 . HN   1 1 
       1621 1 2 1 1 116 SER H    A 116 . HN   1 1 
       1622 1 1 1 1 102 VAL H    A 102 . HN   1 1 
       1622 1 2 1 1 116 SER HA   A 116 . HA   1 1 
       1623 1 1 1 1 102 VAL H    A 102 . HN   1 1 
       1623 1 2 1 1 116 SER HB2  A 116 . HB2  1 1 
       1624 1 1 1 1 102 VAL H    A 102 . HN   1 1 
       1624 1 2 1 1 116 SER HB3  A 116 . HB1  1 1 
       1625 1 1 1 1 102 VAL H    A 102 . HN   1 1 
       1625 1 2 1 1 117 THR H    A 117 . HN   1 1 
       1626 1 1 1 1 102 VAL HA   A 102 . HA   1 1 
       1626 1 2 1 1 103 ILE H    A 103 . HN   1 1 
       1627 1 1 1 1 102 VAL HA   A 102 . HA   1 1 
       1627 1 2 1 1 103 ILE HB   A 103 . HB   1 1 
       1628 1 1 1 1 102 VAL HA   A 102 . HA   1 1 
       1628 1 2 1 1 103 ILE MD   A 103 . HD1* 1 1 
       1629 1 1 1 1 102 VAL HA   A 102 . HA   1 1 
       1629 1 2 1 1 103 ILE HG12 A 103 . HG12 1 1 
       1630 1 1 1 1 102 VAL HB   A 102 . HB   1 1 
       1630 1 2 1 1 103 ILE H    A 103 . HN   1 1 
       1631 1 1 1 1 102 VAL HB   A 102 . HB   1 1 
       1631 1 2 1 1 115 ARG H    A 115 . HN   1 1 
       1632 1 1 1 1 102 VAL QG   A 102 . HG*  1 1 
       1632 1 2 1 1 103 ILE H    A 103 . HN   1 1 
       1633 1 1 1 1 102 VAL QG   A 102 . HG*  1 1 
       1633 1 2 1 1 114 GLN H    A 114 . HN   1 1 
       1634 1 1 1 1 102 VAL QG   A 102 . HG*  1 1 
       1634 1 2 1 1 114 GLN HA   A 114 . HA   1 1 
       1635 1 1 1 1 102 VAL QG   A 102 . HG*  1 1 
       1635 1 2 1 1 115 ARG H    A 115 . HN   1 1 
       1636 1 1 1 1 102 VAL QG   A 102 . HG*  1 1 
       1636 1 2 1 1 116 SER HA   A 116 . HA   1 1 
       1637 1 1 1 1 102 VAL QG   A 102 . HG*  1 1 
       1637 1 2 1 1 116 SER HB3  A 116 . HB1  1 1 
       1638 1 1 1 1 103 ILE H    A 103 . HN   1 1 
       1638 1 2 1 1 103 ILE HB   A 103 . HB   1 1 
       1639 1 1 1 1 103 ILE H    A 103 . HN   1 1 
       1639 1 2 1 1 103 ILE MD   A 103 . HD1* 1 1 
       1640 1 1 1 1 103 ILE H    A 103 . HN   1 1 
       1640 1 2 1 1 103 ILE HG12 A 103 . HG12 1 1 
       1641 1 1 1 1 103 ILE H    A 103 . HN   1 1 
       1641 1 2 1 1 103 ILE HG13 A 103 . HG11 1 1 
       1642 1 1 1 1 103 ILE HA   A 103 . HA   1 1 
       1642 1 2 1 1 103 ILE MD   A 103 . HD1* 1 1 
       1643 1 1 1 1 103 ILE HA   A 103 . HA   1 1 
       1643 1 2 1 1 103 ILE HG12 A 103 . HG12 1 1 
       1644 1 1 1 1 103 ILE HA   A 103 . HA   1 1 
       1644 1 2 1 1 103 ILE HG13 A 103 . HG11 1 1 
       1645 1 1 1 1 103 ILE HA   A 103 . HA   1 1 
       1645 1 2 1 1 103 ILE MG   A 103 . HG2* 1 1 
       1646 1 1 1 1 103 ILE HA   A 103 . HA   1 1 
       1646 1 2 1 1 104 LEU H    A 104 . HN   1 1 
       1647 1 1 1 1 103 ILE HA   A 103 . HA   1 1 
       1647 1 2 1 1 114 GLN HA   A 114 . HA   1 1 
       1648 1 1 1 1 103 ILE HA   A 103 . HA   1 1 
       1648 1 2 1 1 114 GLN QB   A 114 . HB*  1 1 
       1649 1 1 1 1 103 ILE HB   A 103 . HB   1 1 
       1649 1 2 1 1 104 LEU HA   A 104 . HA   1 1 
       1650 1 1 1 1 103 ILE MD   A 103 . HD1* 1 1 
       1650 1 2 1 1 103 ILE MG   A 103 . HG2* 1 1 
       1651 1 1 1 1 103 ILE MD   A 103 . HD1* 1 1 
       1651 1 2 1 1 114 GLN HA   A 114 . HA   1 1 
       1652 1 1 1 1 103 ILE MD   A 103 . HD1* 1 1 
       1652 1 2 1 1 114 GLN QB   A 114 . HB*  1 1 
       1653 1 1 1 1 103 ILE MD   A 103 . HD1* 1 1 
       1653 1 2 1 1 114 GLN QE   A 114 . HE*  1 1 
       1654 1 1 1 1 103 ILE MD   A 103 . HD1* 1 1 
       1654 1 2 1 1 115 ARG H    A 115 . HN   1 1 
       1655 1 1 1 1 103 ILE HG12 A 103 . HG12 1 1 
       1655 1 2 1 1 103 ILE MG   A 103 . HG2* 1 1 
       1656 1 1 1 1 103 ILE MG   A 103 . HG2* 1 1 
       1656 1 2 1 1 104 LEU H    A 104 . HN   1 1 
       1657 1 1 1 1 103 ILE MG   A 103 . HG2* 1 1 
       1657 1 2 1 1 104 LEU HA   A 104 . HA   1 1 
       1658 1 1 1 1 103 ILE MG   A 103 . HG2* 1 1 
       1658 1 2 1 1 105 LYS H    A 105 . HN   1 1 
       1659 1 1 1 1 103 ILE MG   A 103 . HG2* 1 1 
       1659 1 2 1 1 105 LYS HE2  A 105 . HE2  1 1 
       1660 1 1 1 1 103 ILE MG   A 103 . HG2* 1 1 
       1660 1 2 1 1 105 LYS QE   A 105 . HE*  1 1 
       1661 1 1 1 1 103 ILE MG   A 103 . HG2* 1 1 
       1661 1 2 1 1 105 LYS HE3  A 105 . HE1  1 1 
       1662 1 1 1 1 103 ILE MG   A 103 . HG2* 1 1 
       1662 1 2 1 1 105 LYS HG3  A 105 . HG1  1 1 
       1663 1 1 1 1 103 ILE MG   A 103 . HG2* 1 1 
       1663 1 2 1 1 111 GLU QB   A 111 . HB*  1 1 
       1664 1 1 1 1 103 ILE MG   A 103 . HG2* 1 1 
       1664 1 2 1 1 114 GLN H    A 114 . HN   1 1 
       1665 1 1 1 1 103 ILE MG   A 103 . HG2* 1 1 
       1665 1 2 1 1 114 GLN HA   A 114 . HA   1 1 
       1666 1 1 1 1 103 ILE MG   A 103 . HG2* 1 1 
       1666 1 2 1 1 114 GLN HB2  A 114 . HB2  1 1 
       1667 1 1 1 1 103 ILE MG   A 103 . HG2* 1 1 
       1667 1 2 1 1 114 GLN QB   A 114 . HB*  1 1 
       1668 1 1 1 1 103 ILE MG   A 103 . HG2* 1 1 
       1668 1 2 1 1 114 GLN HB3  A 114 . HB1  1 1 
       1669 1 1 1 1 103 ILE MG   A 103 . HG2* 1 1 
       1669 1 2 1 1 114 GLN QE   A 114 . HE*  1 1 
       1670 1 1 1 1 103 ILE MG   A 103 . HG2* 1 1 
       1670 1 2 1 1 114 GLN HG2  A 114 . HG2  1 1 
       1671 1 1 1 1 104 LEU H    A 104 . HN   1 1 
       1671 1 2 1 1 104 LEU HB2  A 104 . HB2  1 1 
       1672 1 1 1 1 104 LEU H    A 104 . HN   1 1 
       1672 1 2 1 1 104 LEU MD1  A 104 . HD1* 1 1 
       1673 1 1 1 1 104 LEU H    A 104 . HN   1 1 
       1673 1 2 1 1 104 LEU MD2  A 104 . HD2* 1 1 
       1674 1 1 1 1 104 LEU H    A 104 . HN   1 1 
       1674 1 2 1 1 104 LEU HG   A 104 . HG   1 1 
       1675 1 1 1 1 104 LEU H    A 104 . HN   1 1 
       1675 1 2 1 1 105 LYS H    A 105 . HN   1 1 
       1676 1 1 1 1 104 LEU H    A 104 . HN   1 1 
       1676 1 2 1 1 113 ALA H    A 113 . HN   1 1 
       1677 1 1 1 1 104 LEU H    A 104 . HN   1 1 
       1677 1 2 1 1 114 GLN HA   A 114 . HA   1 1 
       1678 1 1 1 1 104 LEU H    A 104 . HN   1 1 
       1678 1 2 1 1 114 GLN QB   A 114 . HB*  1 1 
       1679 1 1 1 1 104 LEU H    A 104 . HN   1 1 
       1679 1 2 1 1 114 GLN HG2  A 114 . HG2  1 1 
       1680 1 1 1 1 104 LEU HA   A 104 . HA   1 1 
       1680 1 2 1 1 104 LEU MD2  A 104 . HD2* 1 1 
       1681 1 1 1 1 104 LEU HA   A 104 . HA   1 1 
       1681 1 2 1 1 105 LYS H    A 105 . HN   1 1 
       1682 1 1 1 1 104 LEU HA   A 104 . HA   1 1 
       1682 1 2 1 1 105 LYS HA   A 105 . HA   1 1 
       1683 1 1 1 1 104 LEU HA   A 104 . HA   1 1 
       1683 1 2 1 1 113 ALA H    A 113 . HN   1 1 
       1684 1 1 1 1 104 LEU HB2  A 104 . HB2  1 1 
       1684 1 2 1 1 105 LYS H    A 105 . HN   1 1 
       1685 1 1 1 1 104 LEU HB2  A 104 . HB2  1 1 
       1685 1 2 1 1 105 LYS HA   A 105 . HA   1 1 
       1686 1 1 1 1 104 LEU HB2  A 104 . HB2  1 1 
       1686 1 2 1 1 112 VAL H    A 112 . HN   1 1 
       1687 1 1 1 1 104 LEU HB2  A 104 . HB2  1 1 
       1687 1 2 1 1 112 VAL MG1  A 112 . HG1* 1 1 
       1688 1 1 1 1 104 LEU HB2  A 104 . HB2  1 1 
       1688 1 2 1 1 112 VAL QG   A 112 . HG*  1 1 
       1689 1 1 1 1 104 LEU HB2  A 104 . HB2  1 1 
       1689 1 2 1 1 112 VAL MG2  A 112 . HG2* 1 1 
       1690 1 1 1 1 104 LEU HB2  A 104 . HB2  1 1 
       1690 1 2 1 1 113 ALA H    A 113 . HN   1 1 
       1691 1 1 1 1 104 LEU HB2  A 104 . HB2  1 1 
       1691 1 2 1 1 113 ALA MB   A 113 . HB*  1 1 
       1692 1 1 1 1 104 LEU HB3  A 104 . HB1  1 1 
       1692 1 2 1 1 105 LYS H    A 105 . HN   1 1 
       1693 1 1 1 1 104 LEU HB3  A 104 . HB1  1 1 
       1693 1 2 1 1 112 VAL H    A 112 . HN   1 1 
       1694 1 1 1 1 104 LEU HB3  A 104 . HB1  1 1 
       1694 1 2 1 1 112 VAL MG1  A 112 . HG1* 1 1 
       1695 1 1 1 1 104 LEU HB3  A 104 . HB1  1 1 
       1695 1 2 1 1 112 VAL QG   A 112 . HG*  1 1 
       1696 1 1 1 1 104 LEU HB3  A 104 . HB1  1 1 
       1696 1 2 1 1 112 VAL MG2  A 112 . HG2* 1 1 
       1697 1 1 1 1 104 LEU HB3  A 104 . HB1  1 1 
       1697 1 2 1 1 113 ALA H    A 113 . HN   1 1 
       1698 1 1 1 1 104 LEU HB3  A 104 . HB1  1 1 
       1698 1 2 1 1 113 ALA MB   A 113 . HB*  1 1 
       1699 1 1 1 1 104 LEU MD1  A 104 . HD1* 1 1 
       1699 1 2 1 1 113 ALA H    A 113 . HN   1 1 
       1700 1 1 1 1 104 LEU MD1  A 104 . HD1* 1 1 
       1700 1 2 1 1 113 ALA MB   A 113 . HB*  1 1 
       1701 1 1 1 1 104 LEU HG   A 104 . HG   1 1 
       1701 1 2 1 1 113 ALA H    A 113 . HN   1 1 
       1702 1 1 1 1 104 LEU HG   A 104 . HG   1 1 
       1702 1 2 1 1 113 ALA MB   A 113 . HB*  1 1 
       1703 1 1 1 1 104 LEU HG   A 104 . HG   1 1 
       1703 1 2 1 1 114 GLN HA   A 114 . HA   1 1 
       1704 1 1 1 1 105 LYS H    A 105 . HN   1 1 
       1704 1 2 1 1 105 LYS HB2  A 105 . HB2  1 1 
       1705 1 1 1 1 105 LYS H    A 105 . HN   1 1 
       1705 1 2 1 1 105 LYS HB3  A 105 . HB1  1 1 
       1706 1 1 1 1 105 LYS H    A 105 . HN   1 1 
       1706 1 2 1 1 105 LYS QD   A 105 . HD*  1 1 
       1707 1 1 1 1 105 LYS H    A 105 . HN   1 1 
       1707 1 2 1 1 105 LYS HG3  A 105 . HG1  1 1 
       1708 1 1 1 1 105 LYS H    A 105 . HN   1 1 
       1708 1 2 1 1 106 ASN H    A 106 . HN   1 1 
       1709 1 1 1 1 105 LYS HA   A 105 . HA   1 1 
       1709 1 2 1 1 105 LYS HG2  A 105 . HG2  1 1 
       1710 1 1 1 1 105 LYS HA   A 105 . HA   1 1 
       1710 1 2 1 1 106 ASN H    A 106 . HN   1 1 
       1711 1 1 1 1 105 LYS HA   A 105 . HA   1 1 
       1711 1 2 1 1 110 GLU H    A 110 . HN   1 1 
       1712 1 1 1 1 105 LYS HA   A 105 . HA   1 1 
       1712 1 2 1 1 111 GLU H    A 111 . HN   1 1 
       1713 1 1 1 1 105 LYS HA   A 105 . HA   1 1 
       1713 1 2 1 1 111 GLU HA   A 111 . HA   1 1 
       1714 1 1 1 1 105 LYS HA   A 105 . HA   1 1 
       1714 1 2 1 1 111 GLU QB   A 111 . HB*  1 1 
       1715 1 1 1 1 105 LYS HA   A 105 . HA   1 1 
       1715 1 2 1 1 111 GLU QG   A 111 . HG*  1 1 
       1716 1 1 1 1 105 LYS HA   A 105 . HA   1 1 
       1716 1 2 1 1 112 VAL H    A 112 . HN   1 1 
       1717 1 1 1 1 105 LYS HA   A 105 . HA   1 1 
       1717 1 2 1 1 112 VAL QG   A 112 . HG*  1 1 
       1718 1 1 1 1 105 LYS HA   A 105 . HA   1 1 
       1718 1 2 1 1 113 ALA H    A 113 . HN   1 1 
       1719 1 1 1 1 105 LYS HB2  A 105 . HB2  1 1 
       1719 1 2 1 1 105 LYS QD   A 105 . HD*  1 1 
       1720 1 1 1 1 105 LYS HB2  A 105 . HB2  1 1 
       1720 1 2 1 1 106 ASN H    A 106 . HN   1 1 
       1721 1 1 1 1 105 LYS HB3  A 105 . HB1  1 1 
       1721 1 2 1 1 106 ASN H    A 106 . HN   1 1 
       1722 1 1 1 1 105 LYS HB3  A 105 . HB1  1 1 
       1722 1 2 1 1 109 GLY H    A 109 . HN   1 1 
       1723 1 1 1 1 105 LYS HB3  A 105 . HB1  1 1 
       1723 1 2 1 1 109 GLY HA2  A 109 . HA2  1 1 
       1724 1 1 1 1 105 LYS HB3  A 105 . HB1  1 1 
       1724 1 2 1 1 109 GLY QA   A 109 . HA*  1 1 
       1725 1 1 1 1 105 LYS HB3  A 105 . HB1  1 1 
       1725 1 2 1 1 109 GLY HA3  A 109 . HA1  1 1 
       1726 1 1 1 1 105 LYS HB3  A 105 . HB1  1 1 
       1726 1 2 1 1 110 GLU H    A 110 . HN   1 1 
       1727 1 1 1 1 105 LYS HE2  A 105 . HE2  1 1 
       1727 1 2 1 1 105 LYS HG2  A 105 . HG2  1 1 
       1728 1 1 1 1 105 LYS HE3  A 105 . HE1  1 1 
       1728 1 2 1 1 105 LYS HG2  A 105 . HG2  1 1 
       1729 1 1 1 1 105 LYS HG2  A 105 . HG2  1 1 
       1729 1 2 1 1 111 GLU H    A 111 . HN   1 1 
       1730 1 1 1 1 105 LYS HG2  A 105 . HG2  1 1 
       1730 1 2 1 1 111 GLU HA   A 111 . HA   1 1 
       1731 1 1 1 1 105 LYS HG2  A 105 . HG2  1 1 
       1731 1 2 1 1 111 GLU QB   A 111 . HB*  1 1 
       1732 1 1 1 1 105 LYS HG3  A 105 . HG1  1 1 
       1732 1 2 1 1 106 ASN H    A 106 . HN   1 1 
       1733 1 1 1 1 105 LYS HG3  A 105 . HG1  1 1 
       1733 1 2 1 1 111 GLU HA   A 111 . HA   1 1 
       1734 1 1 1 1 106 ASN H    A 106 . HN   1 1 
       1734 1 2 1 1 106 ASN HB2  A 106 . HB2  1 1 
       1735 1 1 1 1 106 ASN H    A 106 . HN   1 1 
       1735 1 2 1 1 106 ASN HD21 A 106 . HD21 1 1 
       1736 1 1 1 1 106 ASN H    A 106 . HN   1 1 
       1736 1 2 1 1 106 ASN QD   A 106 . HD2* 1 1 
       1737 1 1 1 1 106 ASN H    A 106 . HN   1 1 
       1737 1 2 1 1 106 ASN HD22 A 106 . HD22 1 1 
       1738 1 1 1 1 106 ASN H    A 106 . HN   1 1 
       1738 1 2 1 1 107 SER H    A 107 . HN   1 1 
       1739 1 1 1 1 106 ASN H    A 106 . HN   1 1 
       1739 1 2 1 1 110 GLU H    A 110 . HN   1 1 
       1740 1 1 1 1 106 ASN H    A 106 . HN   1 1 
       1740 1 2 1 1 111 GLU H    A 111 . HN   1 1 
       1741 1 1 1 1 106 ASN H    A 106 . HN   1 1 
       1741 1 2 1 1 111 GLU HA   A 111 . HA   1 1 
       1742 1 1 1 1 106 ASN H    A 106 . HN   1 1 
       1742 1 2 1 1 112 VAL H    A 112 . HN   1 1 
       1743 1 1 1 1 106 ASN H    A 106 . HN   1 1 
       1743 1 2 1 1 112 VAL QG   A 112 . HG*  1 1 
       1744 1 1 1 1 106 ASN H    A 106 . HN   1 1 
       1744 1 2 1 1 112 VAL MG2  A 112 . HG2* 1 1 
       1745 1 1 1 1 106 ASN HA   A 106 . HA   1 1 
       1745 1 2 1 1 106 ASN HD21 A 106 . HD21 1 1 
       1746 1 1 1 1 106 ASN HA   A 106 . HA   1 1 
       1746 1 2 1 1 106 ASN HD22 A 106 . HD22 1 1 
       1747 1 1 1 1 106 ASN HA   A 106 . HA   1 1 
       1747 1 2 1 1 107 SER H    A 107 . HN   1 1 
       1748 1 1 1 1 106 ASN HA   A 106 . HA   1 1 
       1748 1 2 1 1 112 VAL QG   A 112 . HG*  1 1 
       1749 1 1 1 1 106 ASN HB2  A 106 . HB2  1 1 
       1749 1 2 1 1 107 SER H    A 107 . HN   1 1 
       1750 1 1 1 1 106 ASN HB2  A 106 . HB2  1 1 
       1750 1 2 1 1 108 GLN H    A 108 . HN   1 1 
       1751 1 1 1 1 106 ASN HB2  A 106 . HB2  1 1 
       1751 1 2 1 1 109 GLY H    A 109 . HN   1 1 
       1752 1 1 1 1 106 ASN HB2  A 106 . HB2  1 1 
       1752 1 2 1 1 110 GLU H    A 110 . HN   1 1 
       1753 1 1 1 1 106 ASN HB3  A 106 . HB1  1 1 
       1753 1 2 1 1 107 SER H    A 107 . HN   1 1 
       1754 1 1 1 1 106 ASN HB3  A 106 . HB1  1 1 
       1754 1 2 1 1 108 GLN H    A 108 . HN   1 1 
       1755 1 1 1 1 106 ASN HB3  A 106 . HB1  1 1 
       1755 1 2 1 1 112 VAL QG   A 112 . HG*  1 1 
       1756 1 1 1 1 107 SER H    A 107 . HN   1 1 
       1756 1 2 1 1 107 SER QB   A 107 . HB*  1 1 
       1757 1 1 1 1 107 SER H    A 107 . HN   1 1 
       1757 1 2 1 1 108 GLN H    A 108 . HN   1 1 
       1758 1 1 1 1 107 SER H    A 107 . HN   1 1 
       1758 1 2 1 1 108 GLN HB2  A 108 . HB2  1 1 
       1759 1 1 1 1 107 SER H    A 107 . HN   1 1 
       1759 1 2 1 1 108 GLN QG   A 108 . HG*  1 1 
       1760 1 1 1 1 107 SER H    A 107 . HN   1 1 
       1760 1 2 1 1 109 GLY H    A 109 . HN   1 1 
       1761 1 1 1 1 107 SER HA   A 107 . HA   1 1 
       1761 1 2 1 1 108 GLN HA   A 108 . HA   1 1 
       1762 1 1 1 1 107 SER QB   A 107 . HB*  1 1 
       1762 1 2 1 1 108 GLN H    A 108 . HN   1 1 
       1763 1 1 1 1 107 SER HB2  A 107 . HB2  1 1 
       1763 1 2 1 1 108 GLN H    A 108 . HN   1 1 
       1764 1 1 1 1 107 SER HB3  A 107 . HB1  1 1 
       1764 1 2 1 1 108 GLN H    A 108 . HN   1 1 
       1765 1 1 1 1 108 GLN H    A 108 . HN   1 1 
       1765 1 2 1 1 108 GLN HB2  A 108 . HB2  1 1 
       1766 1 1 1 1 108 GLN H    A 108 . HN   1 1 
       1766 1 2 1 1 108 GLN HB3  A 108 . HB1  1 1 
       1767 1 1 1 1 108 GLN H    A 108 . HN   1 1 
       1767 1 2 1 1 108 GLN QG   A 108 . HG*  1 1 
       1768 1 1 1 1 108 GLN H    A 108 . HN   1 1 
       1768 1 2 1 1 109 GLY H    A 109 . HN   1 1 
       1769 1 1 1 1 108 GLN H    A 108 . HN   1 1 
       1769 1 2 1 1 109 GLY QA   A 109 . HA*  1 1 
       1770 1 1 1 1 108 GLN H    A 108 . HN   1 1 
       1770 1 2 1 1 110 GLU H    A 110 . HN   1 1 
       1771 1 1 1 1 108 GLN H    A 108 . HN   1 1 
       1771 1 2 1 1 110 GLU HB3  A 110 . HB1  1 1 
       1772 1 1 1 1 108 GLN HA   A 108 . HA   1 1 
       1772 1 2 1 1 108 GLN HE22 A 108 . HE22 1 1 
       1773 1 1 1 1 108 GLN HA   A 108 . HA   1 1 
       1773 1 2 1 1 108 GLN QG   A 108 . HG*  1 1 
       1774 1 1 1 1 108 GLN HA   A 108 . HA   1 1 
       1774 1 2 1 1 110 GLU H    A 110 . HN   1 1 
       1775 1 1 1 1 108 GLN HB2  A 108 . HB2  1 1 
       1775 1 2 1 1 109 GLY H    A 109 . HN   1 1 
       1776 1 1 1 1 108 GLN HB2  A 108 . HB2  1 1 
       1776 1 2 1 1 110 GLU H    A 110 . HN   1 1 
       1777 1 1 1 1 108 GLN HB3  A 108 . HB1  1 1 
       1777 1 2 1 1 109 GLY H    A 109 . HN   1 1 
       1778 1 1 1 1 108 GLN HB3  A 108 . HB1  1 1 
       1778 1 2 1 1 110 GLU H    A 110 . HN   1 1 
       1779 1 1 1 1 109 GLY H    A 109 . HN   1 1 
       1779 1 2 1 1 110 GLU H    A 110 . HN   1 1 
       1780 1 1 1 1 109 GLY H    A 109 . HN   1 1 
       1780 1 2 1 1 110 GLU HB3  A 110 . HB1  1 1 
       1781 1 1 1 1 109 GLY H    A 109 . HN   1 1 
       1781 1 2 1 1 110 GLU HG2  A 110 . HG2  1 1 
       1782 1 1 1 1 110 GLU H    A 110 . HN   1 1 
       1782 1 2 1 1 110 GLU HB3  A 110 . HB1  1 1 
       1783 1 1 1 1 110 GLU H    A 110 . HN   1 1 
       1783 1 2 1 1 110 GLU HG2  A 110 . HG2  1 1 
       1784 1 1 1 1 110 GLU H    A 110 . HN   1 1 
       1784 1 2 1 1 111 GLU H    A 111 . HN   1 1 
       1785 1 1 1 1 110 GLU HA   A 110 . HA   1 1 
       1785 1 2 1 1 110 GLU HG2  A 110 . HG2  1 1 
       1786 1 1 1 1 110 GLU HA   A 110 . HA   1 1 
       1786 1 2 1 1 111 GLU H    A 111 . HN   1 1 
       1787 1 1 1 1 110 GLU HA   A 110 . HA   1 1 
       1787 1 2 1 1 111 GLU QB   A 111 . HB*  1 1 
       1788 1 1 1 1 110 GLU HB2  A 110 . HB2  1 1 
       1788 1 2 1 1 111 GLU H    A 111 . HN   1 1 
       1789 1 1 1 1 110 GLU HG3  A 110 . HG1  1 1 
       1789 1 2 1 1 111 GLU H    A 111 . HN   1 1 
       1790 1 1 1 1 111 GLU H    A 111 . HN   1 1 
       1790 1 2 1 1 111 GLU HB2  A 111 . HB2  1 1 
       1791 1 1 1 1 111 GLU H    A 111 . HN   1 1 
       1791 1 2 1 1 111 GLU QB   A 111 . HB*  1 1 
       1792 1 1 1 1 111 GLU H    A 111 . HN   1 1 
       1792 1 2 1 1 111 GLU HB3  A 111 . HB1  1 1 
       1793 1 1 1 1 111 GLU H    A 111 . HN   1 1 
       1793 1 2 1 1 112 VAL H    A 112 . HN   1 1 
       1794 1 1 1 1 111 GLU HA   A 111 . HA   1 1 
       1794 1 2 1 1 111 GLU QG   A 111 . HG*  1 1 
       1795 1 1 1 1 111 GLU HA   A 111 . HA   1 1 
       1795 1 2 1 1 112 VAL H    A 112 . HN   1 1 
       1796 1 1 1 1 111 GLU HA   A 111 . HA   1 1 
       1796 1 2 1 1 112 VAL QG   A 112 . HG*  1 1 
       1797 1 1 1 1 111 GLU QG   A 111 . HG*  1 1 
       1797 1 2 1 1 112 VAL H    A 112 . HN   1 1 
       1798 1 1 1 1 112 VAL H    A 112 . HN   1 1 
       1798 1 2 1 1 112 VAL HB   A 112 . HB   1 1 
       1799 1 1 1 1 112 VAL H    A 112 . HN   1 1 
       1799 1 2 1 1 112 VAL MG1  A 112 . HG1* 1 1 
       1800 1 1 1 1 112 VAL H    A 112 . HN   1 1 
       1800 1 2 1 1 112 VAL QG   A 112 . HG*  1 1 
       1801 1 1 1 1 112 VAL H    A 112 . HN   1 1 
       1801 1 2 1 1 112 VAL MG2  A 112 . HG2* 1 1 
       1802 1 1 1 1 112 VAL H    A 112 . HN   1 1 
       1802 1 2 1 1 113 ALA H    A 113 . HN   1 1 
       1803 1 1 1 1 112 VAL H    A 112 . HN   1 1 
       1803 1 2 1 1 113 ALA MB   A 113 . HB*  1 1 
       1804 1 1 1 1 112 VAL HA   A 112 . HA   1 1 
       1804 1 2 1 1 112 VAL MG1  A 112 . HG1* 1 1 
       1805 1 1 1 1 112 VAL HA   A 112 . HA   1 1 
       1805 1 2 1 1 112 VAL QG   A 112 . HG*  1 1 
       1806 1 1 1 1 112 VAL HA   A 112 . HA   1 1 
       1806 1 2 1 1 112 VAL MG2  A 112 . HG2* 1 1 
       1807 1 1 1 1 112 VAL HB   A 112 . HB   1 1 
       1807 1 2 1 1 113 ALA H    A 113 . HN   1 1 
       1808 1 1 1 1 112 VAL HB   A 112 . HB   1 1 
       1808 1 2 1 1 113 ALA MB   A 113 . HB*  1 1 
       1809 1 1 1 1 112 VAL QG   A 112 . HG*  1 1 
       1809 1 2 1 1 113 ALA H    A 113 . HN   1 1 
       1810 1 1 1 1 112 VAL MG1  A 112 . HG1* 1 1 
       1810 1 2 1 1 113 ALA H    A 113 . HN   1 1 
       1811 1 1 1 1 112 VAL MG1  A 112 . HG1* 1 1 
       1811 1 2 1 1 113 ALA MB   A 113 . HB*  1 1 
       1812 1 1 1 1 112 VAL MG2  A 112 . HG2* 1 1 
       1812 1 2 1 1 113 ALA H    A 113 . HN   1 1 
       1813 1 1 1 1 112 VAL MG2  A 112 . HG2* 1 1 
       1813 1 2 1 1 113 ALA MB   A 113 . HB*  1 1 
       1814 1 1 1 1 113 ALA H    A 113 . HN   1 1 
       1814 1 2 1 1 113 ALA MB   A 113 . HB*  1 1 
       1815 1 1 1 1 113 ALA H    A 113 . HN   1 1 
       1815 1 2 1 1 114 GLN H    A 114 . HN   1 1 
       1816 1 1 1 1 113 ALA H    A 113 . HN   1 1 
       1816 1 2 1 1 114 GLN HA   A 114 . HA   1 1 
       1817 1 1 1 1 113 ALA H    A 113 . HN   1 1 
       1817 1 2 1 1 114 GLN HG2  A 114 . HG2  1 1 
       1818 1 1 1 1 113 ALA HA   A 113 . HA   1 1 
       1818 1 2 1 1 114 GLN H    A 114 . HN   1 1 
       1819 1 1 1 1 113 ALA MB   A 113 . HB*  1 1 
       1819 1 2 1 1 114 GLN H    A 114 . HN   1 1 
       1820 1 1 1 1 114 GLN H    A 114 . HN   1 1 
       1820 1 2 1 1 114 GLN QB   A 114 . HB*  1 1 
       1821 1 1 1 1 114 GLN H    A 114 . HN   1 1 
       1821 1 2 1 1 114 GLN HG2  A 114 . HG2  1 1 
       1822 1 1 1 1 114 GLN H    A 114 . HN   1 1 
       1822 1 2 1 1 114 GLN HG3  A 114 . HG1  1 1 
       1823 1 1 1 1 114 GLN H    A 114 . HN   1 1 
       1823 1 2 1 1 115 ARG H    A 115 . HN   1 1 
       1824 1 1 1 1 114 GLN HA   A 114 . HA   1 1 
       1824 1 2 1 1 114 GLN HG3  A 114 . HG1  1 1 
       1825 1 1 1 1 114 GLN HA   A 114 . HA   1 1 
       1825 1 2 1 1 115 ARG H    A 115 . HN   1 1 
       1826 1 1 1 1 114 GLN HB2  A 114 . HB2  1 1 
       1826 1 2 1 1 115 ARG H    A 115 . HN   1 1 
       1827 1 1 1 1 114 GLN HB3  A 114 . HB1  1 1 
       1827 1 2 1 1 115 ARG H    A 115 . HN   1 1 
       1828 1 1 1 1 114 GLN HG3  A 114 . HG1  1 1 
       1828 1 2 1 1 115 ARG H    A 115 . HN   1 1 
       1829 1 1 1 1 115 ARG H    A 115 . HN   1 1 
       1829 1 2 1 1 115 ARG HB2  A 115 . HB2  1 1 
       1830 1 1 1 1 115 ARG H    A 115 . HN   1 1 
       1830 1 2 1 1 115 ARG QB   A 115 . HB*  1 1 
       1831 1 1 1 1 115 ARG H    A 115 . HN   1 1 
       1831 1 2 1 1 115 ARG HB3  A 115 . HB1  1 1 
       1832 1 1 1 1 115 ARG H    A 115 . HN   1 1 
       1832 1 2 1 1 116 SER H    A 116 . HN   1 1 
       1833 1 1 1 1 115 ARG H    A 115 . HN   1 1 
       1833 1 2 1 1 116 SER HA   A 116 . HA   1 1 
       1834 1 1 1 1 115 ARG HA   A 115 . HA   1 1 
       1834 1 2 1 1 115 ARG HG2  A 115 . HG2  1 1 
       1835 1 1 1 1 115 ARG HA   A 115 . HA   1 1 
       1835 1 2 1 1 115 ARG QG   A 115 . HG*  1 1 
       1836 1 1 1 1 115 ARG HA   A 115 . HA   1 1 
       1836 1 2 1 1 115 ARG HG3  A 115 . HG1  1 1 
       1837 1 1 1 1 115 ARG HA   A 115 . HA   1 1 
       1837 1 2 1 1 116 SER H    A 116 . HN   1 1 
       1838 1 1 1 1 115 ARG HA   A 115 . HA   1 1 
       1838 1 2 1 1 116 SER HB3  A 116 . HB1  1 1 
       1839 1 1 1 1 115 ARG QB   A 115 . HB*  1 1 
       1839 1 2 1 1 115 ARG QD   A 115 . HD*  1 1 
       1840 1 1 1 1 115 ARG HB2  A 115 . HB2  1 1 
       1840 1 2 1 1 116 SER H    A 116 . HN   1 1 
       1841 1 1 1 1 115 ARG HB3  A 115 . HB1  1 1 
       1841 1 2 1 1 116 SER H    A 116 . HN   1 1 
       1842 1 1 1 1 115 ARG QD   A 115 . HD*  1 1 
       1842 1 2 1 1 116 SER H    A 116 . HN   1 1 
       1843 1 1 1 1 115 ARG HG2  A 115 . HG2  1 1 
       1843 1 2 1 1 116 SER H    A 116 . HN   1 1 
       1844 1 1 1 1 115 ARG HG3  A 115 . HG1  1 1 
       1844 1 2 1 1 116 SER H    A 116 . HN   1 1 
       1845 1 1 1 1 116 SER H    A 116 . HN   1 1 
       1845 1 2 1 1 116 SER HB2  A 116 . HB2  1 1 
       1846 1 1 1 1 116 SER H    A 116 . HN   1 1 
       1846 1 2 1 1 116 SER HB3  A 116 . HB1  1 1 
       1847 1 1 1 1 116 SER H    A 116 . HN   1 1 
       1847 1 2 1 1 117 THR H    A 117 . HN   1 1 
       1848 1 1 1 1 116 SER HA   A 116 . HA   1 1 
       1848 1 2 1 1 117 THR H    A 117 . HN   1 1 
       1849 1 1 1 1 116 SER HA   A 116 . HA   1 1 
       1849 1 2 1 1 117 THR MG   A 117 . HG2* 1 1 
       1850 1 1 1 1 116 SER HB2  A 116 . HB2  1 1 
       1850 1 2 1 1 117 THR H    A 117 . HN   1 1 
       1851 1 1 1 1 117 THR H    A 117 . HN   1 1 
       1851 1 2 1 1 117 THR HB   A 117 . HB   1 1 
       1852 1 1 1 1 117 THR H    A 117 . HN   1 1 
       1852 1 2 1 1 117 THR MG   A 117 . HG2* 1 1 
       1853 1 1 1 1 117 THR H    A 117 . HN   1 1 
       1853 1 2 1 1 118 VAL H    A 118 . HN   1 1 
       1854 1 1 1 1 117 THR HA   A 117 . HA   1 1 
       1854 1 2 1 1 117 THR MG   A 117 . HG2* 1 1 
       1855 1 1 1 1 117 THR HA   A 117 . HA   1 1 
       1855 1 2 1 1 118 VAL H    A 118 . HN   1 1 
       1856 1 1 1 1 117 THR HA   A 117 . HA   1 1 
       1856 1 2 1 1 118 VAL HB   A 118 . HB   1 1 
       1857 1 1 1 1 117 THR HB   A 117 . HB   1 1 
       1857 1 2 1 1 118 VAL H    A 118 . HN   1 1 
       1858 1 1 1 1 117 THR MG   A 117 . HG2* 1 1 
       1858 1 2 1 1 118 VAL H    A 118 . HN   1 1 
       1859 1 1 1 1 118 VAL H    A 118 . HN   1 1 
       1859 1 2 1 1 118 VAL HB   A 118 . HB   1 1 
       1860 1 1 1 1 118 VAL H    A 118 . HN   1 1 
       1860 1 2 1 1 118 VAL MG1  A 118 . HG1* 1 1 
       1861 1 1 1 1 118 VAL H    A 118 . HN   1 1 
       1861 1 2 1 1 118 VAL QG   A 118 . HG*  1 1 
       1862 1 1 1 1 118 VAL H    A 118 . HN   1 1 
       1862 1 2 1 1 118 VAL MG2  A 118 . HG2* 1 1 
       1863 1 1 1 1 118 VAL H    A 118 . HN   1 1 
       1863 1 2 1 1 119 PHE H    A 119 . HN   1 1 
       1864 1 1 1 1 118 VAL HA   A 118 . HA   1 1 
       1864 1 2 1 1 118 VAL MG1  A 118 . HG1* 1 1 
       1865 1 1 1 1 118 VAL HA   A 118 . HA   1 1 
       1865 1 2 1 1 118 VAL QG   A 118 . HG*  1 1 
       1866 1 1 1 1 118 VAL HA   A 118 . HA   1 1 
       1866 1 2 1 1 118 VAL MG2  A 118 . HG2* 1 1 
       1867 1 1 1 1 118 VAL HA   A 118 . HA   1 1 
       1867 1 2 1 1 119 PHE H    A 119 . HN   1 1 
       1868 1 1 1 1 118 VAL HA   A 118 . HA   1 1 
       1868 1 2 1 1 119 PHE HA   A 119 . HA   1 1 
       1869 1 1 1 1 118 VAL HA   A 118 . HA   1 1 
       1869 1 2 1 1 119 PHE QB   A 119 . HB*  1 1 
       1870 1 1 1 1 118 VAL HB   A 118 . HB   1 1 
       1870 1 2 1 1 119 PHE H    A 119 . HN   1 1 
       1871 1 1 1 1 118 VAL QG   A 118 . HG*  1 1 
       1871 1 2 1 1 119 PHE H    A 119 . HN   1 1 
       1872 1 1 1 1 118 VAL MG1  A 118 . HG1* 1 1 
       1872 1 2 1 1 119 PHE H    A 119 . HN   1 1 
       1873 1 1 1 1 118 VAL MG2  A 118 . HG2* 1 1 
       1873 1 2 1 1 119 PHE H    A 119 . HN   1 1 
       1874 1 1 1 1 119 PHE H    A 119 . HN   1 1 
       1874 1 2 1 1 119 PHE HB2  A 119 . HB2  1 1 
       1875 1 1 1 1 119 PHE H    A 119 . HN   1 1 
       1875 1 2 1 1 119 PHE QB   A 119 . HB*  1 1 
       1876 1 1 1 1 119 PHE H    A 119 . HN   1 1 
       1876 1 2 1 1 119 PHE HB3  A 119 . HB1  1 1 
       1877 1 1 1 1 119 PHE H    A 119 . HN   1 1 
       1877 1 2 1 1 119 PHE HD1  A 119 . HD1  1 1 
       1878 1 1 1 1 119 PHE H    A 119 . HN   1 1 
       1878 1 2 1 1 119 PHE HD2  A 119 . HD2  1 1 
       1879 1 1 1 1 119 PHE H    A 119 . HN   1 1 
       1879 1 2 1 1 120 LYS H    A 120 . HN   1 1 
       1880 1 1 1 1 119 PHE HA   A 119 . HA   1 1 
       1880 1 2 1 1 120 LYS H    A 120 . HN   1 1 
       1881 1 1 1 1 119 PHE QB   A 119 . HB*  1 1 
       1881 1 2 1 1 120 LYS H    A 120 . HN   1 1 
       1882 1 1 1 1 119 PHE HB2  A 119 . HB2  1 1 
       1882 1 2 1 1 120 LYS H    A 120 . HN   1 1 
       1883 1 1 1 1 119 PHE HB3  A 119 . HB1  1 1 
       1883 1 2 1 1 120 LYS H    A 120 . HN   1 1 
       1884 1 1 1 1 120 LYS H    A 120 . HN   1 1 
       1884 1 2 1 1 120 LYS HB2  A 120 . HB2  1 1 
       1885 1 1 1 1 120 LYS H    A 120 . HN   1 1 
       1885 1 2 1 1 120 LYS QB   A 120 . HB*  1 1 
       1886 1 1 1 1 120 LYS H    A 120 . HN   1 1 
       1886 1 2 1 1 120 LYS HB3  A 120 . HB1  1 1 
       1887 1 1 1 1 120 LYS H    A 120 . HN   1 1 
       1887 1 2 1 1 120 LYS QG   A 120 . HG*  1 1 
       1888 1 1 1 1 120 LYS HA   A 120 . HA   1 1 
       1888 1 2 1 1 120 LYS HD2  A 120 . HD2  1 1 
       1889 1 1 1 1 120 LYS HA   A 120 . HA   1 1 
       1889 1 2 1 1 120 LYS QD   A 120 . HD*  1 1 
       1890 1 1 1 1 120 LYS HA   A 120 . HA   1 1 
       1890 1 2 1 1 120 LYS HD3  A 120 . HD1  1 1 
       1891 1 1 1 1 120 LYS HA   A 120 . HA   1 1 
       1891 1 2 1 1 121 THR H    A 121 . HN   1 1 
       1892 1 1 1 1 120 LYS QB   A 120 . HB*  1 1 
       1892 1 2 1 1 121 THR H    A 121 . HN   1 1 
       1893 1 1 1 1 120 LYS HB2  A 120 . HB2  1 1 
       1893 1 2 1 1 121 THR H    A 121 . HN   1 1 
       1894 1 1 1 1 120 LYS HB3  A 120 . HB1  1 1 
       1894 1 2 1 1 121 THR H    A 121 . HN   1 1 
       1895 1 1 1 1 120 LYS QG   A 120 . HG*  1 1 
       1895 1 2 1 1 121 THR H    A 121 . HN   1 1 
       1896 1 1 1 1 120 LYS HG2  A 120 . HG2  1 1 
       1896 1 2 1 1 121 THR H    A 121 . HN   1 1 
       1897 1 1 1 1 120 LYS HG3  A 120 . HG1  1 1 
       1897 1 2 1 1 121 THR H    A 121 . HN   1 1 
       1898 1 1 1 1 121 THR H    A 121 . HN   1 1 
       1898 1 2 1 1 121 THR HB   A 121 . HB   1 1 
       1899 1 1 1 1 121 THR H    A 121 . HN   1 1 
       1899 1 2 1 1 121 THR MG   A 121 . HG2* 1 1 
       1900 1 1 1 1 121 THR H    A 121 . HN   1 1 
       1900 1 2 1 1 122 THR H    A 122 . HN   1 1 
       1901 1 1 1 1 121 THR HA   A 121 . HA   1 1 
       1901 1 2 1 1 122 THR H    A 122 . HN   1 1 
       1902 1 1 1 1 121 THR HB   A 121 . HB   1 1 
       1902 1 2 1 1 122 THR H    A 122 . HN   1 1 
       1903 1 1 1 1 121 THR MG   A 121 . HG2* 1 1 
       1903 1 2 1 1 122 THR H    A 122 . HN   1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

          1 1 . . . . . 3.22 0.64 4.83 1 1 
          2 1 . . . . . 4.24 0.85 6.36 1 1 
          3 1 . . . . . 4.64 0.93 6.96 1 1 
          4 1 . . . . . 2.81 0.56 4.21 1 1 
          5 1 . . . . . 5.26 1.05 7.89 1 1 
          6 1 . . . . . 5.26 1.05 7.89 1 1 
          7 1 . . . . . 3.62 0.72 5.43 1 1 
          8 1 . . . . . 4.77 0.95 7.15 1 1 
          9 1 . . . . . 3.15 0.63 4.73 1 1 
         10 1 . . . . . 5.16 1.03 7.74 1 1 
         11 1 . . . . . 5.16 1.03 7.74 1 1 
         12 1 . . . . . 3.41 0.68 5.12 1 1 
         13 1 . . . . . 4.47 0.89  6.7 1 1 
         14 1 . . . . . 2.77 0.55 4.15 1 1 
         15 1 . . . . . 4.26 0.85 6.39 1 1 
         16 1 . . . . . 3.24 0.65 4.86 1 1 
         17 1 . . . . . 4.08 0.82 6.12 1 1 
         18 1 . . . . . 4.55 0.91 6.83 1 1 
         19 1 . . . . . 5.29 1.06 7.93 1 1 
         20 1 . . . . . 4.26 0.85 6.39 1 1 
         21 1 . . . . .  2.7 0.54 4.05 1 1 
         22 1 . . . . .  4.3 0.86 6.45 1 1 
         23 1 . . . . . 4.44 0.89 6.66 1 1 
         24 1 . . . . . 3.92 0.78 5.88 1 1 
         25 1 . . . . . 3.87 0.77  5.8 1 1 
         26 1 . . . . . 3.12 0.62 4.68 1 1 
         27 1 . . . . . 3.53 0.71 5.29 1 1 
         28 1 . . . . . 2.85 0.57 4.27 1 1 
         29 1 . . . . . 3.36 0.67 5.04 1 1 
         30 1 . . . . . 3.51  0.7 5.26 1 1 
         31 1 . . . . . 4.25 0.85 6.37 1 1 
         32 1 . . . . . 3.26 0.65 4.89 1 1 
         33 1 . . . . . 3.26 0.65 4.89 1 1 
         34 1 . . . . . 4.04 0.81 6.06 1 1 
         35 1 . . . . . 3.46 0.69 5.19 1 1 
         36 1 . . . . . 4.04 0.81 6.06 1 1 
         37 1 . . . . .  4.7 0.94 7.05 1 1 
         38 1 . . . . . 3.58 0.72 5.37 1 1 
         39 1 . . . . . 4.56 0.91 6.84 1 1 
         40 1 . . . . . 3.96 0.79 5.94 1 1 
         41 1 . . . . . 3.74 0.75 5.61 1 1 
         42 1 . . . . . 4.13 0.83  6.2 1 1 
         43 1 . . . . . 5.25 1.05 7.87 1 1 
         44 1 . . . . . 3.63 0.73 5.45 1 1 
         45 1 . . . . . 4.78 0.96 7.17 1 1 
         46 1 . . . . . 5.06 1.01 7.59 1 1 
         47 1 . . . . . 5.06 1.01 7.59 1 1 
         48 1 . . . . . 4.78 0.96 7.17 1 1 
         49 1 . . . . . 5.06 1.01 7.59 1 1 
         50 1 . . . . . 5.06 1.01 7.59 1 1 
         51 1 . . . . . 3.65 0.73 5.48 1 1 
         52 1 . . . . . 4.03 0.81 6.05 1 1 
         53 1 . . . . . 3.05 0.61 4.57 1 1 
         54 1 . . . . . 4.03 0.81 6.05 1 1 
         55 1 . . . . . 4.61 0.92 6.92 1 1 
         56 1 . . . . . 3.55 0.71 5.32 1 1 
         57 1 . . . . . 3.55 0.71 5.32 1 1 
         58 1 . . . . . 2.96 0.59 4.44 1 1 
         59 1 . . . . . 5.06 1.01 7.59 1 1 
         60 1 . . . . . 3.74 0.75 5.61 1 1 
         61 1 . . . . . 4.31 0.86 6.46 1 1 
         62 1 . . . . .  3.2 0.64  4.8 1 1 
         63 1 . . . . . 3.88 0.78 5.82 1 1 
         64 1 . . . . . 4.84 0.97 7.26 1 1 
         65 1 . . . . . 3.67 0.73 5.51 1 1 
         66 1 . . . . .  3.2 0.64  4.8 1 1 
         67 1 . . . . . 4.15 0.83 6.23 1 1 
         68 1 . . . . . 3.57 0.71 5.35 1 1 
         69 1 . . . . . 4.73 0.95  7.1 1 1 
         70 1 . . . . . 3.49  0.7 5.24 1 1 
         71 1 . . . . . 3.92 0.78 5.88 1 1 
         72 1 . . . . .  4.6 0.92  6.9 1 1 
         73 1 . . . . . 4.54 0.91 6.81 1 1 
         74 1 . . . . . 4.18 0.84 6.27 1 1 
         75 1 . . . . . 4.17 0.83 6.26 1 1 
         76 1 . . . . . 3.98  0.8 5.97 1 1 
         77 1 . . . . . 4.17 0.83 6.26 1 1 
         78 1 . . . . . 3.98  0.8 5.97 1 1 
         79 1 . . . . . 4.41 0.88 6.61 1 1 
         80 1 . . . . . 3.98  0.8 5.97 1 1 
         81 1 . . . . . 3.49  0.7 5.24 1 1 
         82 1 . . . . . 3.98  0.8 5.97 1 1 
         83 1 . . . . . 4.62 0.92 6.93 1 1 
         84 1 . . . . . 5.15 1.03 7.73 1 1 
         85 1 . . . . . 3.81 0.76 5.71 1 1 
         86 1 . . . . . 3.74 0.75 5.61 1 1 
         87 1 . . . . . 4.57 0.91 6.86 1 1 
         88 1 . . . . . 4.79 0.96 7.18 1 1 
         89 1 . . . . . 5.23 1.05 7.85 1 1 
         90 1 . . . . . 3.09 0.62 4.63 1 1 
         91 1 . . . . . 3.52  0.7 5.28 1 1 
         92 1 . . . . .  4.7 0.94 7.05 1 1 
         93 1 . . . . .  4.0  0.8  6.0 1 1 
         94 1 . . . . . 4.03 0.81 6.05 1 1 
         95 1 . . . . . 4.61 0.92 6.92 1 1 
         96 1 . . . . . 4.03 0.81 6.05 1 1 
         97 1 . . . . . 4.61 0.92 6.92 1 1 
         98 1 . . . . . 3.36 0.67 5.04 1 1 
         99 1 . . . . . 3.63 0.73 5.45 1 1 
        100 1 . . . . . 3.61 0.72 5.41 1 1 
        101 1 . . . . .  3.6 0.72  5.4 1 1 
        102 1 . . . . . 4.37 0.87 6.55 1 1 
        103 1 . . . . . 3.72 0.74 5.58 1 1 
        104 1 . . . . . 3.32 0.66 4.98 1 1 
        105 1 . . . . . 3.23 0.65 4.85 1 1 
        106 1 . . . . . 4.39 0.88 6.58 1 1 
        107 1 . . . . . 3.83 0.77 5.74 1 1 
        108 1 . . . . . 3.46 0.69 5.19 1 1 
        109 1 . . . . . 4.44 0.89 6.66 1 1 
        110 1 . . . . .  3.6 0.72  5.4 1 1 
        111 1 . . . . . 4.53 0.91  6.8 1 1 
        112 1 . . . . . 3.46 0.69 5.19 1 1 
        113 1 . . . . . 4.46 0.89 6.69 1 1 
        114 1 . . . . .  4.7 0.94 7.05 1 1 
        115 1 . . . . .  4.7 0.94 7.05 1 1 
        116 1 . . . . . 4.38 0.88 6.57 1 1 
        117 1 . . . . . 4.04 0.81 6.06 1 1 
        118 1 . . . . . 4.33 0.87 6.49 1 1 
        119 1 . . . . . 5.36 1.07 8.04 1 1 
        120 1 . . . . . 3.73 0.75  5.6 1 1 
        121 1 . . . . .  3.4 0.68  5.1 1 1 
        122 1 . . . . . 3.46 0.69 5.19 1 1 
        123 1 . . . . . 3.33 0.67 4.99 1 1 
        124 1 . . . . . 3.44 0.69 5.16 1 1 
        125 1 . . . . . 5.83 1.17 8.74 1 1 
        126 1 . . . . . 2.96 0.59 4.44 1 1 
        127 1 . . . . . 4.53 0.91  6.8 1 1 
        128 1 . . . . . 5.22 1.04 7.83 1 1 
        129 1 . . . . . 5.22 1.04 7.83 1 1 
        130 1 . . . . . 3.61 0.72 5.41 1 1 
        131 1 . . . . . 3.57 0.71 5.35 1 1 
        132 1 . . . . .  3.1 0.62 4.65 1 1 
        133 1 . . . . . 4.11 0.82 6.17 1 1 
        134 1 . . . . . 4.34 0.87 6.51 1 1 
        135 1 . . . . . 3.68 0.74 5.52 1 1 
        136 1 . . . . . 4.34 0.87 6.51 1 1 
        137 1 . . . . . 4.25 0.85 6.37 1 1 
        138 1 . . . . .  3.6 0.72  5.4 1 1 
        139 1 . . . . . 4.25 0.85 6.37 1 1 
        140 1 . . . . . 5.19 1.04 7.79 1 1 
        141 1 . . . . . 3.86 0.77 5.79 1 1 
        142 1 . . . . . 3.26 0.65 4.89 1 1 
        143 1 . . . . . 3.86 0.77 5.79 1 1 
        144 1 . . . . . 5.16 1.03 7.74 1 1 
        145 1 . . . . . 4.42 0.88 6.63 1 1 
        146 1 . . . . . 5.16 1.03 7.74 1 1 
        147 1 . . . . . 3.22 0.64 4.83 1 1 
        148 1 . . . . . 5.16 1.03 7.74 1 1 
        149 1 . . . . . 5.46 1.09 8.19 1 1 
        150 1 . . . . . 3.44 0.69 5.16 1 1 
        151 1 . . . . . 4.02  0.8 6.03 1 1 
        152 1 . . . . . 3.55 0.71 5.32 1 1 
        153 1 . . . . . 4.21 0.84 6.32 1 1 
        154 1 . . . . . 3.99  0.8 5.99 1 1 
        155 1 . . . . . 4.02  0.8 6.03 1 1 
        156 1 . . . . . 3.44 0.69 5.16 1 1 
        157 1 . . . . . 4.02  0.8 6.03 1 1 
        158 1 . . . . . 3.19 0.64 4.79 1 1 
        159 1 . . . . . 4.14 0.83 6.21 1 1 
        160 1 . . . . . 4.49  0.9 6.73 1 1 
        161 1 . . . . . 4.49  0.9 6.73 1 1 
        162 1 . . . . . 3.94 0.79 5.91 1 1 
        163 1 . . . . . 5.18 1.04 7.77 1 1 
        164 1 . . . . . 5.18 1.04 7.77 1 1 
        165 1 . . . . . 4.09 0.82 6.14 1 1 
        166 1 . . . . . 4.98  1.0 7.47 1 1 
        167 1 . . . . . 3.53 0.71 5.29 1 1 
        168 1 . . . . . 5.02  1.0 7.53 1 1 
        169 1 . . . . . 4.41 0.88 6.61 1 1 
        170 1 . . . . . 5.02  1.0 7.53 1 1 
        171 1 . . . . . 4.39 0.88 6.58 1 1 
        172 1 . . . . . 4.23 0.85 6.35 1 1 
        173 1 . . . . . 4.49  0.9 6.73 1 1 
        174 1 . . . . . 4.73 0.95  7.1 1 1 
        175 1 . . . . . 4.01  0.8 6.02 1 1 
        176 1 . . . . . 3.43 0.69 5.15 1 1 
        177 1 . . . . . 4.01  0.8 6.02 1 1 
        178 1 . . . . . 2.89 0.58 4.34 1 1 
        179 1 . . . . .  5.1 1.02 7.65 1 1 
        180 1 . . . . . 3.73 0.75  5.6 1 1 
        181 1 . . . . . 4.34 0.87 6.51 1 1 
        182 1 . . . . . 4.34 0.87 6.51 1 1 
        183 1 . . . . . 3.34 0.67 5.01 1 1 
        184 1 . . . . . 3.84 0.77 5.76 1 1 
        185 1 . . . . . 3.84 0.77 5.76 1 1 
        186 1 . . . . . 3.42 0.68 5.13 1 1 
        187 1 . . . . . 4.31 0.86 6.46 1 1 
        188 1 . . . . . 3.59 0.72 5.38 1 1 
        189 1 . . . . . 3.92 0.78 5.88 1 1 
        190 1 . . . . .  5.0  1.0  7.5 1 1 
        191 1 . . . . . 5.64 1.13 8.46 1 1 
        192 1 . . . . . 4.17 0.83 6.26 1 1 
        193 1 . . . . . 3.68 0.74 5.52 1 1 
        194 1 . . . . .  3.1 0.62 4.65 1 1 
        195 1 . . . . . 3.21 0.64 4.82 1 1 
        196 1 . . . . . 3.91 0.78 5.87 1 1 
        197 1 . . . . . 4.22 0.84 6.33 1 1 
        198 1 . . . . . 3.35 0.67 5.02 1 1 
        199 1 . . . . . 4.61 0.92 6.92 1 1 
        200 1 . . . . .  3.6 0.72  5.4 1 1 
        201 1 . . . . . 2.88 0.58 4.32 1 1 
        202 1 . . . . . 4.07 0.81 6.11 1 1 
        203 1 . . . . . 3.53 0.71 5.29 1 1 
        204 1 . . . . . 3.08 0.62 4.62 1 1 
        205 1 . . . . . 5.44 1.09 8.16 1 1 
        206 1 . . . . . 4.06 0.81 6.09 1 1 
        207 1 . . . . .  3.9 0.78 5.85 1 1 
        208 1 . . . . . 3.95 0.79 5.93 1 1 
        209 1 . . . . . 3.37 0.67 5.05 1 1 
        210 1 . . . . . 3.08 0.62 4.62 1 1 
        211 1 . . . . . 4.51  0.9 6.77 1 1 
        212 1 . . . . . 3.61 0.72 5.41 1 1 
        213 1 . . . . . 4.05 0.81 6.08 1 1 
        214 1 . . . . . 4.96 0.99 7.44 1 1 
        215 1 . . . . . 4.72 0.94 7.08 1 1 
        216 1 . . . . . 3.31 0.66 4.96 1 1 
        217 1 . . . . . 3.53 0.71 5.29 1 1 
        218 1 . . . . . 3.53 0.71 5.29 1 1 
        219 1 . . . . . 5.04 1.01 7.56 1 1 
        220 1 . . . . .  4.0  0.8  6.0 1 1 
        221 1 . . . . . 4.03 0.81 6.05 1 1 
        222 1 . . . . . 2.86 0.57 4.29 1 1 
        223 1 . . . . . 4.81 0.96 7.21 1 1 
        224 1 . . . . . 3.92 0.78 5.88 1 1 
        225 1 . . . . . 4.07 0.81 6.11 1 1 
        226 1 . . . . . 4.58 0.92 6.87 1 1 
        227 1 . . . . . 3.73 0.75  5.6 1 1 
        228 1 . . . . . 3.33 0.67 4.99 1 1 
        229 1 . . . . . 5.27 1.05  7.9 1 1 
        230 1 . . . . . 4.24 0.85 6.36 1 1 
        231 1 . . . . . 2.91 0.58 4.37 1 1 
        232 1 . . . . . 5.37 1.07 8.05 1 1 
        233 1 . . . . . 4.49  0.9 6.73 1 1 
        234 1 . . . . . 3.92 0.78 5.88 1 1 
        235 1 . . . . . 3.37 0.67 5.05 1 1 
        236 1 . . . . . 4.49  0.9 6.73 1 1 
        237 1 . . . . . 3.92 0.78 5.88 1 1 
        238 1 . . . . . 3.37 0.67 5.05 1 1 
        239 1 . . . . . 3.27 0.65  4.9 1 1 
        240 1 . . . . . 2.83 0.57 4.24 1 1 
        241 1 . . . . . 3.37 0.67 5.05 1 1 
        242 1 . . . . . 4.56 0.91 6.84 1 1 
        243 1 . . . . . 5.83 1.17 8.74 1 1 
        244 1 . . . . . 2.94 0.59 4.41 1 1 
        245 1 . . . . .  5.0  1.0  7.5 1 1 
        246 1 . . . . . 4.18 0.84 6.27 1 1 
        247 1 . . . . . 3.06 0.61 4.59 1 1 
        248 1 . . . . . 3.94 0.79 5.91 1 1 
        249 1 . . . . . 4.13 0.83  6.2 1 1 
        250 1 . . . . . 4.35 0.87 6.52 1 1 
        251 1 . . . . . 3.48  0.7 5.22 1 1 
        252 1 . . . . . 2.93 0.59  4.4 1 1 
        253 1 . . . . . 3.48  0.7 5.22 1 1 
        254 1 . . . . . 3.34 0.67 5.01 1 1 
        255 1 . . . . . 4.51  0.9 6.77 1 1 
        256 1 . . . . . 4.09 0.82 6.14 1 1 
        257 1 . . . . . 4.51  0.9 6.77 1 1 
        258 1 . . . . . 3.78 0.76 5.67 1 1 
        259 1 . . . . .  5.9 1.18 8.85 1 1 
        260 1 . . . . .  5.9 1.18 8.85 1 1 
        261 1 . . . . . 4.38 0.88 6.57 1 1 
        262 1 . . . . . 4.78 0.96 7.17 1 1 
        263 1 . . . . . 4.23 0.85 6.35 1 1 
        264 1 . . . . . 4.08 0.82 6.12 1 1 
        265 1 . . . . . 4.04 0.81 6.06 1 1 
        266 1 . . . . .  6.2 1.24  9.3 1 1 
        267 1 . . . . .  6.2 1.24  9.3 1 1 
        268 1 . . . . . 3.38 0.68 5.07 1 1 
        269 1 . . . . . 4.09 0.82 6.14 1 1 
        270 1 . . . . . 3.48  0.7 5.22 1 1 
        271 1 . . . . . 4.09 0.82 6.14 1 1 
        272 1 . . . . . 3.31 0.66 4.96 1 1 
        273 1 . . . . .  5.4 1.08  8.1 1 1 
        274 1 . . . . . 4.65 0.93 6.98 1 1 
        275 1 . . . . .  5.4 1.08  8.1 1 1 
        276 1 . . . . . 4.14 0.83 6.21 1 1 
        277 1 . . . . . 3.59 0.72 5.38 1 1 
        278 1 . . . . . 4.14 0.83 6.21 1 1 
        279 1 . . . . . 5.94 1.19 8.91 1 1 
        280 1 . . . . .  5.5  1.1 8.25 1 1 
        281 1 . . . . .  4.1 0.82 6.15 1 1 
        282 1 . . . . . 4.12 0.82 6.18 1 1 
        283 1 . . . . . 3.86 0.77 5.79 1 1 
        284 1 . . . . . 4.76 0.95 7.14 1 1 
        285 1 . . . . . 3.94 0.79 5.91 1 1 
        286 1 . . . . . 4.52  0.9 6.78 1 1 
        287 1 . . . . . 4.52  0.9 6.78 1 1 
        288 1 . . . . . 3.32 0.66 4.98 1 1 
        289 1 . . . . . 4.56 0.91 6.84 1 1 
        290 1 . . . . . 4.39 0.88 6.58 1 1 
        291 1 . . . . . 3.27 0.65  4.9 1 1 
        292 1 . . . . . 4.89 0.98 7.33 1 1 
        293 1 . . . . . 4.06 0.81 6.09 1 1 
        294 1 . . . . . 4.25 0.85 6.37 1 1 
        295 1 . . . . . 4.49  0.9 6.73 1 1 
        296 1 . . . . . 4.84 0.97 7.26 1 1 
        297 1 . . . . . 3.85 0.77 5.77 1 1 
        298 1 . . . . . 4.03 0.81 6.05 1 1 
        299 1 . . . . . 4.61 0.92 6.92 1 1 
        300 1 . . . . .  4.6 0.92  6.9 1 1 
        301 1 . . . . . 4.95 0.99 7.42 1 1 
        302 1 . . . . . 4.93 0.99 7.39 1 1 
        303 1 . . . . . 4.44 0.89 6.66 1 1 
        304 1 . . . . . 3.94 0.79 5.91 1 1 
        305 1 . . . . . 4.25 0.85 6.37 1 1 
        306 1 . . . . . 5.28 1.06 7.92 1 1 
        307 1 . . . . . 4.19 0.84 6.29 1 1 
        308 1 . . . . . 4.24 0.85 6.36 1 1 
        309 1 . . . . . 4.16 0.83 6.24 1 1 
        310 1 . . . . . 3.74 0.75 5.61 1 1 
        311 1 . . . . . 4.43 0.89 6.64 1 1 
        312 1 . . . . . 3.73 0.75  5.6 1 1 
        313 1 . . . . . 4.28 0.86 6.42 1 1 
        314 1 . . . . . 4.18 0.84 6.27 1 1 
        315 1 . . . . . 3.98  0.8 5.97 1 1 
        316 1 . . . . . 4.46 0.89 6.69 1 1 
        317 1 . . . . .  4.7 0.94 7.05 1 1 
        318 1 . . . . . 3.63 0.73 5.45 1 1 
        319 1 . . . . . 4.06 0.81 6.09 1 1 
        320 1 . . . . . 4.45 0.89 6.67 1 1 
        321 1 . . . . .  4.4 0.88  6.6 1 1 
        322 1 . . . . . 4.06 0.81 6.09 1 1 
        323 1 . . . . . 3.53 0.71 5.29 1 1 
        324 1 . . . . . 4.06 0.81 6.09 1 1 
        325 1 . . . . .  3.5  0.7 5.25 1 1 
        326 1 . . . . . 3.12 0.62 4.68 1 1 
        327 1 . . . . . 5.87 1.17  8.8 1 1 
        328 1 . . . . . 3.36 0.67 5.04 1 1 
        329 1 . . . . . 4.86 0.97 7.29 1 1 
        330 1 . . . . . 4.33 0.87 6.49 1 1 
        331 1 . . . . . 2.98  0.6 4.47 1 1 
        332 1 . . . . .  4.0  0.8  6.0 1 1 
        333 1 . . . . . 4.14 0.83 6.21 1 1 
        334 1 . . . . . 4.23 0.85 6.35 1 1 
        335 1 . . . . .  3.8 0.76  5.7 1 1 
        336 1 . . . . . 3.46 0.69 5.19 1 1 
        337 1 . . . . .  5.0  1.0  7.5 1 1 
        338 1 . . . . . 5.46 1.09 8.19 1 1 
        339 1 . . . . . 3.65 0.73 5.48 1 1 
        340 1 . . . . . 4.24 0.85 6.36 1 1 
        341 1 . . . . . 4.24 0.85 6.36 1 1 
        342 1 . . . . . 3.34 0.67 5.01 1 1 
        343 1 . . . . . 4.42 0.88 6.63 1 1 
        344 1 . . . . . 5.21 1.04 7.82 1 1 
        345 1 . . . . . 4.88 0.98 7.32 1 1 
        346 1 . . . . . 4.21 0.84 6.32 1 1 
        347 1 . . . . . 3.56 0.71 5.34 1 1 
        348 1 . . . . . 3.73 0.75  5.6 1 1 
        349 1 . . . . . 4.81 0.96 7.21 1 1 
        350 1 . . . . . 4.79 0.96 7.18 1 1 
        351 1 . . . . . 4.53 0.91  6.8 1 1 
        352 1 . . . . . 4.77 0.95 7.15 1 1 
        353 1 . . . . . 4.89 0.98 7.33 1 1 
        354 1 . . . . . 3.14 0.63 4.71 1 1 
        355 1 . . . . . 4.95 0.99 7.42 1 1 
        356 1 . . . . . 5.05 1.01 7.58 1 1 
        357 1 . . . . . 3.71 0.74 5.57 1 1 
        358 1 . . . . .  4.3 0.86 6.45 1 1 
        359 1 . . . . . 3.88 0.78 5.82 1 1 
        360 1 . . . . . 3.59 0.72 5.38 1 1 
        361 1 . . . . . 4.88 0.98 7.32 1 1 
        362 1 . . . . . 4.62 0.92 6.93 1 1 
        363 1 . . . . . 3.65 0.73 5.48 1 1 
        364 1 . . . . . 4.89 0.98 7.33 1 1 
        365 1 . . . . .  4.3 0.86 6.45 1 1 
        366 1 . . . . . 3.44 0.69 5.16 1 1 
        367 1 . . . . . 3.89 0.78 5.84 1 1 
        368 1 . . . . . 5.04 1.01 7.56 1 1 
        369 1 . . . . . 3.57 0.71 5.35 1 1 
        370 1 . . . . . 5.57 1.11 8.36 1 1 
        371 1 . . . . . 5.28 1.06 7.92 1 1 
        372 1 . . . . . 3.55 0.71 5.32 1 1 
        373 1 . . . . .  3.6 0.72  5.4 1 1 
        374 1 . . . . . 4.18 0.84 6.27 1 1 
        375 1 . . . . . 4.48  0.9 6.72 1 1 
        376 1 . . . . . 4.92 0.98 7.38 1 1 
        377 1 . . . . . 5.06 1.01 7.59 1 1 
        378 1 . . . . . 3.78 0.76 5.67 1 1 
        379 1 . . . . . 3.56 0.71 5.34 1 1 
        380 1 . . . . . 4.83 0.97 7.24 1 1 
        381 1 . . . . . 3.47 0.69 5.21 1 1 
        382 1 . . . . . 4.07 0.81 6.11 1 1 
        383 1 . . . . . 3.98  0.8 5.97 1 1 
        384 1 . . . . . 3.06 0.61 4.59 1 1 
        385 1 . . . . . 3.29 0.66 4.93 1 1 
        386 1 . . . . . 4.88 0.98 7.32 1 1 
        387 1 . . . . . 4.36 0.87 6.54 1 1 
        388 1 . . . . .  3.3 0.66 4.95 1 1 
        389 1 . . . . . 3.47 0.69 5.21 1 1 
        390 1 . . . . . 3.47 0.69 5.21 1 1 
        391 1 . . . . . 3.99  0.8 5.99 1 1 
        392 1 . . . . . 3.04 0.61 4.56 1 1 
        393 1 . . . . . 4.48  0.9 6.72 1 1 
        394 1 . . . . . 3.73 0.75  5.6 1 1 
        395 1 . . . . . 5.88 1.18 8.82 1 1 
        396 1 . . . . . 3.59 0.72 5.38 1 1 
        397 1 . . . . . 4.51  0.9 6.77 1 1 
        398 1 . . . . . 4.93 0.99 7.39 1 1 
        399 1 . . . . . 4.64 0.93 6.96 1 1 
        400 1 . . . . . 4.73 0.95  7.1 1 1 
        401 1 . . . . . 4.37 0.87 6.55 1 1 
        402 1 . . . . . 3.84 0.77 5.76 1 1 
        403 1 . . . . . 3.18 0.64 4.77 1 1 
        404 1 . . . . . 3.54 0.71 5.31 1 1 
        405 1 . . . . . 3.83 0.77 5.74 1 1 
        406 1 . . . . . 3.18 0.64 4.77 1 1 
        407 1 . . . . . 3.73 0.75  5.6 1 1 
        408 1 . . . . . 5.46 1.09 8.19 1 1 
        409 1 . . . . . 3.38 0.68 5.07 1 1 
        410 1 . . . . .  4.3 0.86 6.45 1 1 
        411 1 . . . . . 4.21 0.84 6.32 1 1 
        412 1 . . . . .  4.3 0.86 6.45 1 1 
        413 1 . . . . . 4.21 0.84 6.32 1 1 
        414 1 . . . . . 3.64 0.73 5.46 1 1 
        415 1 . . . . . 4.25 0.85 6.37 1 1 
        416 1 . . . . . 4.25 0.85 6.37 1 1 
        417 1 . . . . . 3.65 0.73 5.48 1 1 
        418 1 . . . . . 3.71 0.74 5.57 1 1 
        419 1 . . . . . 4.42 0.88 6.63 1 1 
        420 1 . . . . . 5.18 1.04 7.77 1 1 
        421 1 . . . . . 5.18 1.04 7.77 1 1 
        422 1 . . . . . 3.62 0.72 5.43 1 1 
        423 1 . . . . . 4.65 0.93 6.98 1 1 
        424 1 . . . . . 3.97 0.79 5.96 1 1 
        425 1 . . . . . 3.71 0.74 5.57 1 1 
        426 1 . . . . . 3.91 0.78 5.87 1 1 
        427 1 . . . . . 3.72 0.74 5.58 1 1 
        428 1 . . . . . 3.26 0.65 4.89 1 1 
        429 1 . . . . . 3.72 0.74 5.58 1 1 
        430 1 . . . . . 4.17 0.83 6.26 1 1 
        431 1 . . . . . 4.38 0.88 6.57 1 1 
        432 1 . . . . . 4.37 0.87 6.55 1 1 
        433 1 . . . . .  4.1 0.82 6.15 1 1 
        434 1 . . . . . 5.77 1.15 8.65 1 1 
        435 1 . . . . . 3.02  0.6 4.53 1 1 
        436 1 . . . . . 4.27 0.85  6.4 1 1 
        437 1 . . . . . 4.16 0.83 6.24 1 1 
        438 1 . . . . . 5.25 1.05 7.87 1 1 
        439 1 . . . . . 3.92 0.78 5.88 1 1 
        440 1 . . . . . 4.09 0.82 6.14 1 1 
        441 1 . . . . . 4.88 0.98 7.32 1 1 
        442 1 . . . . . 4.88 0.98 7.32 1 1 
        443 1 . . . . . 4.14 0.83 6.21 1 1 
        444 1 . . . . . 3.74 0.75 5.61 1 1 
        445 1 . . . . . 5.73 1.15  8.6 1 1 
        446 1 . . . . . 4.45 0.89 6.67 1 1 
        447 1 . . . . . 4.97 0.99 7.45 1 1 
        448 1 . . . . . 4.88 0.98 7.32 1 1 
        449 1 . . . . . 4.64 0.93 6.96 1 1 
        450 1 . . . . .  4.2 0.84  6.3 1 1 
        451 1 . . . . . 4.65 0.93 6.98 1 1 
        452 1 . . . . . 5.38 1.08 8.07 1 1 
        453 1 . . . . . 4.33 0.87 6.49 1 1 
        454 1 . . . . . 4.83 0.97 7.24 1 1 
        455 1 . . . . . 4.53 0.91  6.8 1 1 
        456 1 . . . . .  4.6 0.92  6.9 1 1 
        457 1 . . . . . 4.03 0.81 6.05 1 1 
        458 1 . . . . .  4.6 0.92  6.9 1 1 
        459 1 . . . . . 5.19 1.04 7.79 1 1 
        460 1 . . . . . 5.95 1.19 8.92 1 1 
        461 1 . . . . . 4.16 0.83 6.24 1 1 
        462 1 . . . . . 4.84 0.97 7.26 1 1 
        463 1 . . . . .  4.0  0.8  6.0 1 1 
        464 1 . . . . .  3.3 0.66 4.95 1 1 
        465 1 . . . . . 6.11 1.22 9.17 1 1 
        466 1 . . . . . 3.33 0.67 4.99 1 1 
        467 1 . . . . . 4.46 0.89 6.69 1 1 
        468 1 . . . . . 4.35 0.87 6.52 1 1 
        469 1 . . . . . 4.36 0.87 6.54 1 1 
        470 1 . . . . . 3.83 0.77 5.74 1 1 
        471 1 . . . . . 3.29 0.66 4.93 1 1 
        472 1 . . . . . 3.83 0.77 5.74 1 1 
        473 1 . . . . . 4.64 0.93 6.96 1 1 
        474 1 . . . . . 4.49  0.9 6.73 1 1 
        475 1 . . . . . 3.11 0.62 4.66 1 1 
        476 1 . . . . . 3.11 0.62 4.66 1 1 
        477 1 . . . . . 4.28 0.86 6.42 1 1 
        478 1 . . . . . 3.69 0.74 5.54 1 1 
        479 1 . . . . . 3.73 0.75  5.6 1 1 
        480 1 . . . . . 3.73 0.75  5.6 1 1 
        481 1 . . . . . 3.23 0.65 4.85 1 1 
        482 1 . . . . . 3.94 0.79 5.91 1 1 
        483 1 . . . . . 3.81 0.76 5.71 1 1 
        484 1 . . . . . 3.25 0.65 4.87 1 1 
        485 1 . . . . .  3.3 0.66 4.95 1 1 
        486 1 . . . . . 5.05 1.01 7.58 1 1 
        487 1 . . . . . 4.42 0.88 6.63 1 1 
        488 1 . . . . . 3.57 0.71 5.35 1 1 
        489 1 . . . . . 3.47 0.69 5.21 1 1 
        490 1 . . . . . 3.18 0.64 4.77 1 1 
        491 1 . . . . . 3.55 0.71 5.32 1 1 
        492 1 . . . . . 4.56 0.91 6.84 1 1 
        493 1 . . . . . 5.23 1.05 7.85 1 1 
        494 1 . . . . .  4.9 0.98 7.35 1 1 
        495 1 . . . . . 3.65 0.73 5.48 1 1 
        496 1 . . . . . 3.65 0.73 5.48 1 1 
        497 1 . . . . . 4.93 0.99 7.39 1 1 
        498 1 . . . . . 4.84 0.97 7.26 1 1 
        499 1 . . . . . 3.75 0.75 5.63 1 1 
        500 1 . . . . . 3.96 0.79 5.94 1 1 
        501 1 . . . . . 3.96 0.79 5.94 1 1 
        502 1 . . . . . 2.78 0.56 4.17 1 1 
        503 1 . . . . . 3.85 0.77 5.77 1 1 
        504 1 . . . . . 3.33 0.67 4.99 1 1 
        505 1 . . . . . 3.69 0.74 5.54 1 1 
        506 1 . . . . . 5.74 1.15 8.61 1 1 
        507 1 . . . . . 4.22 0.84 6.33 1 1 
        508 1 . . . . . 4.22 0.84 6.33 1 1 
        509 1 . . . . . 3.32 0.66 4.98 1 1 
        510 1 . . . . . 3.77 0.75 5.65 1 1 
        511 1 . . . . . 4.69 0.94 7.04 1 1 
        512 1 . . . . . 5.63 1.13 8.45 1 1 
        513 1 . . . . . 4.53 0.91  6.8 1 1 
        514 1 . . . . . 4.32 0.86 6.48 1 1 
        515 1 . . . . . 3.78 0.76 5.67 1 1 
        516 1 . . . . .  3.2 0.64  4.8 1 1 
        517 1 . . . . . 4.48  0.9 6.72 1 1 
        518 1 . . . . . 4.23 0.85 6.35 1 1 
        519 1 . . . . . 3.79 0.76 5.68 1 1 
        520 1 . . . . . 3.35 0.67 5.02 1 1 
        521 1 . . . . .  4.2 0.84  6.3 1 1 
        522 1 . . . . . 3.77 0.75 5.65 1 1 
        523 1 . . . . . 4.11 0.82 6.17 1 1 
        524 1 . . . . .  6.2 1.24  9.3 1 1 
        525 1 . . . . . 3.71 0.74 5.57 1 1 
        526 1 . . . . . 4.65 0.93 6.98 1 1 
        527 1 . . . . .  6.0  1.2  9.0 1 1 
        528 1 . . . . . 3.85 0.77 5.77 1 1 
        529 1 . . . . . 5.75 1.15 8.63 1 1 
        530 1 . . . . . 3.55 0.71 5.32 1 1 
        531 1 . . . . . 4.44 0.89 6.66 1 1 
        532 1 . . . . .  6.0  1.2  9.0 1 1 
        533 1 . . . . . 4.66 0.93 6.99 1 1 
        534 1 . . . . .  3.9 0.78 5.85 1 1 
        535 1 . . . . . 3.41 0.68 5.12 1 1 
        536 1 . . . . .  3.9 0.78 5.85 1 1 
        537 1 . . . . .  3.9 0.78 5.85 1 1 
        538 1 . . . . . 4.61 0.92 6.92 1 1 
        539 1 . . . . . 4.66 0.93 6.99 1 1 
        540 1 . . . . . 5.27 1.05  7.9 1 1 
        541 1 . . . . . 3.88 0.78 5.82 1 1 
        542 1 . . . . .  4.9 0.98 7.35 1 1 
        543 1 . . . . . 4.53 0.91  6.8 1 1 
        544 1 . . . . . 4.53 0.91  6.8 1 1 
        545 1 . . . . . 3.61 0.72 5.41 1 1 
        546 1 . . . . . 3.02  0.6 4.53 1 1 
        547 1 . . . . . 3.61 0.72 5.41 1 1 
        548 1 . . . . . 4.46 0.89 6.69 1 1 
        549 1 . . . . . 4.11 0.82 6.17 1 1 
        550 1 . . . . . 3.47 0.69 5.21 1 1 
        551 1 . . . . .  4.7 0.94 7.05 1 1 
        552 1 . . . . .  4.7 0.94 7.05 1 1 
        553 1 . . . . .  4.7 0.94 7.05 1 1 
        554 1 . . . . .  4.7 0.94 7.05 1 1 
        555 1 . . . . . 3.16 0.63 4.74 1 1 
        556 1 . . . . . 4.46 0.89 6.69 1 1 
        557 1 . . . . . 5.26 1.05 7.89 1 1 
        558 1 . . . . . 3.72 0.74 5.58 1 1 
        559 1 . . . . . 3.95 0.79 5.93 1 1 
        560 1 . . . . . 3.16 0.63 4.74 1 1 
        561 1 . . . . . 3.95 0.79 5.93 1 1 
        562 1 . . . . . 3.84 0.77 5.76 1 1 
        563 1 . . . . . 3.69 0.74 5.54 1 1 
        564 1 . . . . . 4.51  0.9 6.77 1 1 
        565 1 . . . . . 3.41 0.68 5.12 1 1 
        566 1 . . . . . 4.31 0.86 6.46 1 1 
        567 1 . . . . . 4.37 0.87 6.55 1 1 
        568 1 . . . . . 5.15 1.03 7.73 1 1 
        569 1 . . . . . 4.31 0.86 6.46 1 1 
        570 1 . . . . . 4.37 0.87 6.55 1 1 
        571 1 . . . . . 5.15 1.03 7.73 1 1 
        572 1 . . . . . 4.82 0.96 7.23 1 1 
        573 1 . . . . . 4.78 0.96 7.17 1 1 
        574 1 . . . . . 3.29 0.66 4.93 1 1 
        575 1 . . . . . 3.51  0.7 5.26 1 1 
        576 1 . . . . . 5.21 1.04 7.82 1 1 
        577 1 . . . . . 3.67 0.73 5.51 1 1 
        578 1 . . . . . 5.21 1.04 7.82 1 1 
        579 1 . . . . . 4.77 0.95 7.15 1 1 
        580 1 . . . . . 4.21 0.84 6.32 1 1 
        581 1 . . . . . 4.09 0.82 6.14 1 1 
        582 1 . . . . .  3.9 0.78 5.85 1 1 
        583 1 . . . . . 3.63 0.73 5.45 1 1 
        584 1 . . . . . 5.83 1.17 6.95 1 1 
        585 1 . . . . . 4.56 0.91 6.84 1 1 
        586 1 . . . . . 4.73 0.95  7.1 1 1 
        587 1 . . . . . 3.65 0.73 5.48 1 1 
        588 1 . . . . . 3.77 0.75 5.65 1 1 
        589 1 . . . . . 5.41 1.08 8.11 1 1 
        590 1 . . . . . 3.91 0.78 5.87 1 1 
        591 1 . . . . . 4.39 0.88 6.58 1 1 
        592 1 . . . . . 4.32 0.86 6.48 1 1 
        593 1 . . . . . 4.96 0.99 7.44 1 1 
        594 1 . . . . . 4.74 0.95 7.11 1 1 
        595 1 . . . . . 4.71 0.94 7.07 1 1 
        596 1 . . . . . 4.64 0.93 6.96 1 1 
        597 1 . . . . . 3.28 0.66 4.92 1 1 
        598 1 . . . . . 4.76 0.95 7.14 1 1 
        599 1 . . . . . 4.76 0.95 7.14 1 1 
        600 1 . . . . . 4.46 0.89 6.69 1 1 
        601 1 . . . . .  3.5  0.7 5.25 1 1 
        602 1 . . . . . 3.63 0.73 5.45 1 1 
        603 1 . . . . . 3.16 0.63 4.74 1 1 
        604 1 . . . . . 3.63 0.73 5.45 1 1 
        605 1 . . . . . 3.31 0.66 4.96 1 1 
        606 1 . . . . . 4.78 0.96 7.17 1 1 
        607 1 . . . . . 4.69 0.94 7.04 1 1 
        608 1 . . . . . 4.96 0.99 7.44 1 1 
        609 1 . . . . . 3.92 0.78 5.88 1 1 
        610 1 . . . . . 3.75 0.75 5.63 1 1 
        611 1 . . . . . 3.29 0.66 4.93 1 1 
        612 1 . . . . . 4.13 0.83  6.2 1 1 
        613 1 . . . . . 5.12 1.02 7.68 1 1 
        614 1 . . . . . 4.32 0.86 6.48 1 1 
        615 1 . . . . . 4.92 0.98 7.38 1 1 
        616 1 . . . . . 3.32 0.66 4.98 1 1 
        617 1 . . . . . 5.47 1.09  8.2 1 1 
        618 1 . . . . . 4.14 0.83 6.21 1 1 
        619 1 . . . . . 4.14 0.83 6.21 1 1 
        620 1 . . . . . 4.45 0.89 6.67 1 1 
        621 1 . . . . . 3.58 0.72 5.37 1 1 
        622 1 . . . . . 3.67 0.73 5.51 1 1 
        623 1 . . . . . 3.63 0.73 5.45 1 1 
        624 1 . . . . . 4.08 0.82 6.12 1 1 
        625 1 . . . . . 2.96 0.59 4.44 1 1 
        626 1 . . . . . 4.98  1.0 7.47 1 1 
        627 1 . . . . . 4.94 0.99 7.41 1 1 
        628 1 . . . . . 5.47 1.09  8.2 1 1 
        629 1 . . . . .  3.7 0.74 5.55 1 1 
        630 1 . . . . .  4.1 0.82 6.15 1 1 
        631 1 . . . . . 4.09 0.82 6.14 1 1 
        632 1 . . . . . 3.98  0.8 5.97 1 1 
        633 1 . . . . . 5.07 1.01 7.61 1 1 
        634 1 . . . . . 4.18 0.84 6.27 1 1 
        635 1 . . . . . 3.89 0.78 5.84 1 1 
        636 1 . . . . . 4.34 0.87 6.51 1 1 
        637 1 . . . . .  4.9 0.98 7.35 1 1 
        638 1 . . . . . 4.32 0.86 6.48 1 1 
        639 1 . . . . . 5.95 1.19 8.92 1 1 
        640 1 . . . . . 4.42 0.88 6.63 1 1 
        641 1 . . . . .  4.1 0.82 6.15 1 1 
        642 1 . . . . . 5.17 1.03 7.76 1 1 
        643 1 . . . . . 3.39 0.68 5.09 1 1 
        644 1 . . . . . 5.26 1.05 7.89 1 1 
        645 1 . . . . . 5.09 1.02 7.64 1 1 
        646 1 . . . . . 5.15 1.03 7.73 1 1 
        647 1 . . . . . 3.72 0.74 5.58 1 1 
        648 1 . . . . . 4.72 0.94 7.08 1 1 
        649 1 . . . . . 4.78 0.96 7.17 1 1 
        650 1 . . . . . 4.77 0.95 7.15 1 1 
        651 1 . . . . .  4.2 0.84  6.3 1 1 
        652 1 . . . . . 3.09 0.62 4.63 1 1 
        653 1 . . . . . 4.32 0.86 6.48 1 1 
        654 1 . . . . . 5.19 1.04 7.79 1 1 
        655 1 . . . . . 5.45 1.09 8.17 1 1 
        656 1 . . . . .  4.7 0.94 7.05 1 1 
        657 1 . . . . . 4.62 0.92 6.93 1 1 
        658 1 . . . . . 3.71 0.74 5.57 1 1 
        659 1 . . . . . 5.18 1.04 7.77 1 1 
        660 1 . . . . . 4.24 0.85 6.36 1 1 
        661 1 . . . . . 4.49  0.9 6.73 1 1 
        662 1 . . . . . 3.94 0.79 5.91 1 1 
        663 1 . . . . . 3.31 0.66 4.96 1 1 
        664 1 . . . . . 4.52  0.9 6.78 1 1 
        665 1 . . . . . 3.44 0.69 5.16 1 1 
        666 1 . . . . . 3.67 0.73 5.51 1 1 
        667 1 . . . . . 3.85 0.77 5.77 1 1 
        668 1 . . . . . 3.99  0.8 5.99 1 1 
        669 1 . . . . . 3.67 0.73 5.51 1 1 
        670 1 . . . . . 3.85 0.77 5.77 1 1 
        671 1 . . . . . 3.99  0.8 5.99 1 1 
        672 1 . . . . . 3.79 0.76 5.68 1 1 
        673 1 . . . . . 3.42 0.68 5.13 1 1 
        674 1 . . . . . 5.79 1.16 8.68 1 1 
        675 1 . . . . . 4.55 0.91 6.83 1 1 
        676 1 . . . . . 3.26 0.65 4.89 1 1 
        677 1 . . . . . 3.74 0.75 5.61 1 1 
        678 1 . . . . . 4.26 0.85 6.39 1 1 
        679 1 . . . . . 3.85 0.77 5.77 1 1 
        680 1 . . . . . 3.66 0.73 5.49 1 1 
        681 1 . . . . . 3.38 0.68 5.07 1 1 
        682 1 . . . . . 4.32 0.86 6.48 1 1 
        683 1 . . . . . 4.35 0.87 6.52 1 1 
        684 1 . . . . . 4.68 0.94 7.02 1 1 
        685 1 . . . . . 3.88 0.78 5.82 1 1 
        686 1 . . . . . 4.67 0.93 7.01 1 1 
        687 1 . . . . . 4.07 0.81 6.11 1 1 
        688 1 . . . . . 3.83 0.77 5.74 1 1 
        689 1 . . . . . 5.54 1.11 8.31 1 1 
        690 1 . . . . . 4.21 0.84 6.32 1 1 
        691 1 . . . . . 6.17 1.23 9.26 1 1 
        692 1 . . . . . 4.12 0.82 6.18 1 1 
        693 1 . . . . . 4.59 0.92 6.89 1 1 
        694 1 . . . . . 3.84 0.77 5.76 1 1 
        695 1 . . . . . 4.82 0.96 7.23 1 1 
        696 1 . . . . .  4.3 0.86 6.45 1 1 
        697 1 . . . . . 4.54 0.91 6.81 1 1 
        698 1 . . . . . 3.43 0.69 5.15 1 1 
        699 1 . . . . . 3.59 0.72 5.38 1 1 
        700 1 . . . . . 4.67 0.93 7.01 1 1 
        701 1 . . . . . 3.77 0.75 5.65 1 1 
        702 1 . . . . . 4.04 0.81 6.06 1 1 
        703 1 . . . . . 4.55 0.91 6.83 1 1 
        704 1 . . . . . 5.31 1.06 7.96 1 1 
        705 1 . . . . . 3.76 0.75 5.64 1 1 
        706 1 . . . . . 3.74 0.75 5.61 1 1 
        707 1 . . . . . 4.42 0.88 6.63 1 1 
        708 1 . . . . . 5.19 1.04 7.79 1 1 
        709 1 . . . . .  5.1 1.02 7.65 1 1 
        710 1 . . . . . 3.86 0.77 5.79 1 1 
        711 1 . . . . . 3.38 0.68 5.07 1 1 
        712 1 . . . . . 3.79 0.76 5.68 1 1 
        713 1 . . . . . 3.43 0.69 5.15 1 1 
        714 1 . . . . . 3.89 0.78 5.84 1 1 
        715 1 . . . . . 3.12 0.62 4.68 1 1 
        716 1 . . . . . 4.97 0.99 7.45 1 1 
        717 1 . . . . .  5.0  1.0  7.5 1 1 
        718 1 . . . . . 3.76 0.75 5.64 1 1 
        719 1 . . . . . 4.66 0.93 6.99 1 1 
        720 1 . . . . . 3.96 0.79 5.94 1 1 
        721 1 . . . . . 4.66 0.93 6.99 1 1 
        722 1 . . . . . 4.06 0.81 6.09 1 1 
        723 1 . . . . . 4.53 0.91  6.8 1 1 
        724 1 . . . . . 4.28 0.86 6.42 1 1 
        725 1 . . . . . 4.51  0.9 6.77 1 1 
        726 1 . . . . . 3.61 0.72 5.41 1 1 
        727 1 . . . . . 4.67 0.93 7.01 1 1 
        728 1 . . . . . 4.19 0.84 6.29 1 1 
        729 1 . . . . . 3.37 0.67 5.05 1 1 
        730 1 . . . . . 5.18 1.04 7.77 1 1 
        731 1 . . . . . 5.22 1.04 7.83 1 1 
        732 1 . . . . . 4.55 0.91 6.83 1 1 
        733 1 . . . . . 5.22 1.04 7.83 1 1 
        734 1 . . . . .  4.8 0.96  7.2 1 1 
        735 1 . . . . . 4.51  0.9 6.77 1 1 
        736 1 . . . . . 4.43 0.89 6.64 1 1 
        737 1 . . . . . 3.22 0.64 4.83 1 1 
        738 1 . . . . . 4.42 0.88 6.63 1 1 
        739 1 . . . . . 5.35 1.07 8.02 1 1 
        740 1 . . . . . 4.62 0.92 6.93 1 1 
        741 1 . . . . . 5.35 1.07 8.02 1 1 
        742 1 . . . . . 4.39 0.88 6.58 1 1 
        743 1 . . . . . 3.76 0.75 5.64 1 1 
        744 1 . . . . . 4.39 0.88 6.58 1 1 
        745 1 . . . . . 4.05 0.81 6.08 1 1 
        746 1 . . . . . 3.49  0.7 5.24 1 1 
        747 1 . . . . . 4.01  0.8 6.02 1 1 
        748 1 . . . . .  4.2 0.84  6.3 1 1 
        749 1 . . . . . 5.13 1.03  7.7 1 1 
        750 1 . . . . . 4.13 0.83  6.2 1 1 
        751 1 . . . . . 3.82 0.76 5.73 1 1 
        752 1 . . . . . 3.35 0.67 5.02 1 1 
        753 1 . . . . . 3.82 0.76 5.73 1 1 
        754 1 . . . . . 4.62 0.92 6.93 1 1 
        755 1 . . . . . 5.35 1.07 8.02 1 1 
        756 1 . . . . . 5.64 1.13 8.46 1 1 
        757 1 . . . . . 3.72 0.74 5.58 1 1 
        758 1 . . . . . 3.95 0.79 5.93 1 1 
        759 1 . . . . . 3.94 0.79 5.91 1 1 
        760 1 . . . . . 4.25 0.85 6.37 1 1 
        761 1 . . . . . 5.18 1.04 7.77 1 1 
        762 1 . . . . . 3.14 0.63 4.71 1 1 
        763 1 . . . . . 4.55 0.91 6.83 1 1 
        764 1 . . . . . 4.72 0.94 7.08 1 1 
        765 1 . . . . . 3.86 0.77 5.79 1 1 
        766 1 . . . . . 4.21 0.84 6.32 1 1 
        767 1 . . . . . 3.47 0.69 5.21 1 1 
        768 1 . . . . . 4.21 0.84 6.32 1 1 
        769 1 . . . . . 4.21 0.84 6.32 1 1 
        770 1 . . . . . 4.42 0.88 6.63 1 1 
        771 1 . . . . . 4.12 0.82 6.18 1 1 
        772 1 . . . . . 3.51  0.7 5.26 1 1 
        773 1 . . . . . 5.12 1.02 7.68 1 1 
        774 1 . . . . .  5.0  1.0  7.5 1 1 
        775 1 . . . . . 4.88 0.98 7.32 1 1 
        776 1 . . . . . 4.07 0.81 6.11 1 1 
        777 1 . . . . . 5.15 1.03 7.73 1 1 
        778 1 . . . . . 4.74 0.95 7.11 1 1 
        779 1 . . . . . 4.09 0.82 6.14 1 1 
        780 1 . . . . . 3.78 0.76 5.67 1 1 
        781 1 . . . . . 5.15 1.03 7.73 1 1 
        782 1 . . . . . 4.74 0.95 7.11 1 1 
        783 1 . . . . . 4.09 0.82 6.14 1 1 
        784 1 . . . . . 3.78 0.76 5.67 1 1 
        785 1 . . . . . 5.87 1.17  8.8 1 1 
        786 1 . . . . . 4.47 0.89  6.7 1 1 
        787 1 . . . . . 4.38 0.88 6.57 1 1 
        788 1 . . . . .  4.2 0.84  6.3 1 1 
        789 1 . . . . . 3.88 0.78 5.82 1 1 
        790 1 . . . . . 4.84 0.97 7.26 1 1 
        791 1 . . . . . 3.92 0.78 5.88 1 1 
        792 1 . . . . . 3.32 0.66 4.98 1 1 
        793 1 . . . . . 3.92 0.78 5.88 1 1 
        794 1 . . . . . 3.96 0.79 5.94 1 1 
        795 1 . . . . . 4.57 0.91 6.86 1 1 
        796 1 . . . . . 4.09 0.82 6.14 1 1 
        797 1 . . . . .  3.9 0.78 5.85 1 1 
        798 1 . . . . . 4.52  0.9 6.78 1 1 
        799 1 . . . . .  5.1 1.02 7.65 1 1 
        800 1 . . . . . 4.11 0.82 6.17 1 1 
        801 1 . . . . . 4.86 0.97 7.29 1 1 
        802 1 . . . . . 3.65 0.73 5.48 1 1 
        803 1 . . . . . 2.95 0.59 4.43 1 1 
        804 1 . . . . . 4.63 0.93 6.95 1 1 
        805 1 . . . . . 5.19 1.04 7.79 1 1 
        806 1 . . . . . 4.41 0.88 6.61 1 1 
        807 1 . . . . . 4.26 0.85 6.39 1 1 
        808 1 . . . . . 4.08 0.82 6.12 1 1 
        809 1 . . . . . 4.08 0.82 6.12 1 1 
        810 1 . . . . . 3.26 0.65 4.89 1 1 
        811 1 . . . . . 4.86 0.97 7.29 1 1 
        812 1 . . . . . 4.39 0.88 6.58 1 1 
        813 1 . . . . .  4.4 0.88  6.6 1 1 
        814 1 . . . . . 4.86 0.97 7.29 1 1 
        815 1 . . . . . 4.86 0.97 7.29 1 1 
        816 1 . . . . . 4.18 0.84 6.27 1 1 
        817 1 . . . . . 5.06 1.01 7.59 1 1 
        818 1 . . . . . 5.12 1.02 7.68 1 1 
        819 1 . . . . . 4.49  0.9 6.73 1 1 
        820 1 . . . . . 5.12 1.02 7.68 1 1 
        821 1 . . . . . 3.93 0.79  5.9 1 1 
        822 1 . . . . . 4.67 0.93 7.01 1 1 
        823 1 . . . . . 4.23 0.85 6.35 1 1 
        824 1 . . . . . 5.19 1.04 7.79 1 1 
        825 1 . . . . . 6.01  1.2 9.02 1 1 
        826 1 . . . . . 4.26 0.85 6.39 1 1 
        827 1 . . . . . 4.16 0.83 6.24 1 1 
        828 1 . . . . . 3.58 0.72 5.37 1 1 
        829 1 . . . . . 4.16 0.83 6.24 1 1 
        830 1 . . . . . 3.36 0.67 5.04 1 1 
        831 1 . . . . . 3.56 0.71 5.34 1 1 
        832 1 . . . . . 4.62 0.92 6.93 1 1 
        833 1 . . . . . 3.34 0.67 5.01 1 1 
        834 1 . . . . . 4.47 0.89  6.7 1 1 
        835 1 . . . . . 4.36 0.87 6.54 1 1 
        836 1 . . . . . 3.94 0.79 5.91 1 1 
        837 1 . . . . .  2.9 0.58 4.35 1 1 
        838 1 . . . . . 4.34 0.87 6.51 1 1 
        839 1 . . . . . 4.34 0.87 6.51 1 1 
        840 1 . . . . . 4.23 0.85 6.35 1 1 
        841 1 . . . . . 4.94 0.99 7.41 1 1 
        842 1 . . . . .  4.4 0.88  6.6 1 1 
        843 1 . . . . . 3.78 0.76 5.67 1 1 
        844 1 . . . . . 3.14 0.63 4.71 1 1 
        845 1 . . . . . 4.53 0.91  6.8 1 1 
        846 1 . . . . .  4.5  0.9 6.75 1 1 
        847 1 . . . . . 5.38 1.08 8.07 1 1 
        848 1 . . . . . 3.83 0.77 5.74 1 1 
        849 1 . . . . . 4.15 0.83 6.23 1 1 
        850 1 . . . . . 5.28 1.06 7.92 1 1 
        851 1 . . . . . 4.42 0.88 6.63 1 1 
        852 1 . . . . .  6.0  1.2  9.0 1 1 
        853 1 . . . . . 4.44 0.89 6.66 1 1 
        854 1 . . . . . 4.37 0.87 6.55 1 1 
        855 1 . . . . . 3.01  0.6 4.51 1 1 
        856 1 . . . . . 4.09 0.82 6.14 1 1 
        857 1 . . . . .  3.8 0.76  5.7 1 1 
        858 1 . . . . . 3.19 0.64 4.79 1 1 
        859 1 . . . . .  3.8 0.76  5.7 1 1 
        860 1 . . . . . 3.16 0.63 4.74 1 1 
        861 1 . . . . . 5.42 1.08 8.13 1 1 
        862 1 . . . . . 4.17 0.83 6.26 1 1 
        863 1 . . . . . 3.15 0.63 4.73 1 1 
        864 1 . . . . . 4.58 0.92 6.87 1 1 
        865 1 . . . . . 4.04 0.81 6.06 1 1 
        866 1 . . . . . 4.61 0.92 6.92 1 1 
        867 1 . . . . . 4.61 0.92 6.92 1 1 
        868 1 . . . . . 3.63 0.73 5.45 1 1 
        869 1 . . . . . 3.24 0.65 4.86 1 1 
        870 1 . . . . . 4.48  0.9 6.72 1 1 
        871 1 . . . . . 3.29 0.66 4.93 1 1 
        872 1 . . . . . 2.71 0.54 4.07 1 1 
        873 1 . . . . . 4.48  0.9 6.72 1 1 
        874 1 . . . . . 3.73 0.75  5.6 1 1 
        875 1 . . . . . 3.34 0.67 5.01 1 1 
        876 1 . . . . . 5.11 1.02 7.67 1 1 
        877 1 . . . . . 5.44 1.09 8.16 1 1 
        878 1 . . . . . 3.51  0.7 5.26 1 1 
        879 1 . . . . . 4.36 0.87 6.54 1 1 
        880 1 . . . . . 2.94 0.59 4.41 1 1 
        881 1 . . . . . 3.77 0.75 5.65 1 1 
        882 1 . . . . . 5.54 1.11 8.31 1 1 
        883 1 . . . . .  3.7 0.74 5.55 1 1 
        884 1 . . . . . 3.53 0.71 5.29 1 1 
        885 1 . . . . .  4.0  0.8  6.0 1 1 
        886 1 . . . . . 4.59 0.92 6.89 1 1 
        887 1 . . . . . 3.24 0.65 4.86 1 1 
        888 1 . . . . . 2.79 0.56 4.18 1 1 
        889 1 . . . . . 4.27 0.85  6.4 1 1 
        890 1 . . . . . 4.16 0.83 6.24 1 1 
        891 1 . . . . . 5.02  1.0 7.53 1 1 
        892 1 . . . . . 4.83 0.97 7.24 1 1 
        893 1 . . . . . 3.63 0.73 5.45 1 1 
        894 1 . . . . . 3.86 0.77 5.79 1 1 
        895 1 . . . . . 4.62 0.92 6.93 1 1 
        896 1 . . . . . 3.79 0.76 5.68 1 1 
        897 1 . . . . . 3.49  0.7 5.24 1 1 
        898 1 . . . . . 3.63 0.73 5.45 1 1 
        899 1 . . . . . 3.78 0.76 5.67 1 1 
        900 1 . . . . . 3.27 0.65  4.9 1 1 
        901 1 . . . . . 3.78 0.76 5.67 1 1 
        902 1 . . . . . 3.69 0.74 5.54 1 1 
        903 1 . . . . . 4.13 0.83  6.2 1 1 
        904 1 . . . . . 5.85 1.17 8.77 1 1 
        905 1 . . . . . 3.75 0.75 5.63 1 1 
        906 1 . . . . . 4.17 0.83 6.26 1 1 
        907 1 . . . . . 3.46 0.69 5.19 1 1 
        908 1 . . . . . 5.15 1.03 7.73 1 1 
        909 1 . . . . . 3.87 0.77  5.8 1 1 
        910 1 . . . . . 3.22 0.64 4.83 1 1 
        911 1 . . . . . 3.87 0.77  5.8 1 1 
        912 1 . . . . . 4.39 0.88 6.58 1 1 
        913 1 . . . . . 3.12 0.62 4.68 1 1 
        914 1 . . . . . 4.52  0.9 6.78 1 1 
        915 1 . . . . . 4.65 0.93 6.98 1 1 
        916 1 . . . . . 2.99  0.6 4.49 1 1 
        917 1 . . . . . 4.33 0.87 6.49 1 1 
        918 1 . . . . . 3.56 0.71 5.34 1 1 
        919 1 . . . . . 3.75 0.75 5.63 1 1 
        920 1 . . . . . 3.71 0.74 5.57 1 1 
        921 1 . . . . . 4.85 0.97 7.27 1 1 
        922 1 . . . . . 4.56 0.91 6.84 1 1 
        923 1 . . . . .  5.4 1.08  8.1 1 1 
        924 1 . . . . . 4.41 0.88 6.61 1 1 
        925 1 . . . . . 3.74 0.75 5.61 1 1 
        926 1 . . . . . 2.87 0.57  4.3 1 1 
        927 1 . . . . . 3.75 0.75 5.63 1 1 
        928 1 . . . . . 3.51  0.7 5.26 1 1 
        929 1 . . . . . 4.54 0.91 6.81 1 1 
        930 1 . . . . . 4.41 0.88 6.61 1 1 
        931 1 . . . . .  4.5  0.9 6.75 1 1 
        932 1 . . . . . 5.06 1.01 7.59 1 1 
        933 1 . . . . . 3.41 0.68 5.12 1 1 
        934 1 . . . . . 4.87 0.97  7.3 1 1 
        935 1 . . . . . 4.28 0.86 6.42 1 1 
        936 1 . . . . . 4.46 0.89 6.69 1 1 
        937 1 . . . . . 5.19 1.04 7.79 1 1 
        938 1 . . . . . 4.01  0.8 6.02 1 1 
        939 1 . . . . . 4.51  0.9 6.77 1 1 
        940 1 . . . . . 3.69 0.74 5.54 1 1 
        941 1 . . . . .  3.9 0.78 5.85 1 1 
        942 1 . . . . . 4.67 0.93 7.01 1 1 
        943 1 . . . . . 4.52  0.9 6.78 1 1 
        944 1 . . . . . 4.91 0.98 7.36 1 1 
        945 1 . . . . .  4.5  0.9 6.75 1 1 
        946 1 . . . . . 4.32 0.86 6.48 1 1 
        947 1 . . . . . 3.87 0.77  5.8 1 1 
        948 1 . . . . . 4.51  0.9 6.77 1 1 
        949 1 . . . . . 4.24 0.85 6.36 1 1 
        950 1 . . . . . 3.54 0.71 5.31 1 1 
        951 1 . . . . . 4.42 0.88 6.63 1 1 
        952 1 . . . . . 4.11 0.82 6.17 1 1 
        953 1 . . . . . 3.71 0.74 5.57 1 1 
        954 1 . . . . . 4.86 0.97 7.29 1 1 
        955 1 . . . . . 4.68 0.94 7.02 1 1 
        956 1 . . . . . 4.82 0.96 7.23 1 1 
        957 1 . . . . .  4.1 0.82 6.15 1 1 
        958 1 . . . . . 4.34 0.87 6.51 1 1 
        959 1 . . . . . 4.12 0.82 6.18 1 1 
        960 1 . . . . . 3.29 0.66 4.93 1 1 
        961 1 . . . . . 3.29 0.66 4.93 1 1 
        962 1 . . . . . 4.32 0.86 6.48 1 1 
        963 1 . . . . . 4.47 0.89  6.7 1 1 
        964 1 . . . . . 4.98  1.0 7.47 1 1 
        965 1 . . . . . 5.45 1.09 8.17 1 1 
        966 1 . . . . . 4.65 0.93 6.98 1 1 
        967 1 . . . . . 5.45 1.09 8.17 1 1 
        968 1 . . . . . 3.13 0.63  4.7 1 1 
        969 1 . . . . . 4.08 0.82 6.12 1 1 
        970 1 . . . . .  4.7 0.94 7.05 1 1 
        971 1 . . . . .  4.7 0.94 7.05 1 1 
        972 1 . . . . . 4.06 0.81 6.09 1 1 
        973 1 . . . . . 4.12 0.82 6.18 1 1 
        974 1 . . . . . 3.68 0.74 5.52 1 1 
        975 1 . . . . . 3.39 0.68 5.09 1 1 
        976 1 . . . . . 4.67 0.93 7.01 1 1 
        977 1 . . . . . 5.15 1.03 7.73 1 1 
        978 1 . . . . . 4.81 0.96 7.21 1 1 
        979 1 . . . . . 4.62 0.92 6.93 1 1 
        980 1 . . . . . 2.98  0.6 4.47 1 1 
        981 1 . . . . . 4.78 0.96 7.17 1 1 
        982 1 . . . . . 5.27 1.05  7.9 1 1 
        983 1 . . . . . 3.95 0.79 5.93 1 1 
        984 1 . . . . .  4.1 0.82 6.15 1 1 
        985 1 . . . . . 4.33 0.87 6.49 1 1 
        986 1 . . . . . 5.35 1.07 8.02 1 1 
        987 1 . . . . . 4.49 0.98 6.73 1 1 
        988 1 . . . . . 4.46 0.89 6.69 1 1 
        989 1 . . . . . 3.77 0.75 5.65 1 1 
        990 1 . . . . . 4.46 0.89 6.69 1 1 
        991 1 . . . . . 3.75 0.75 5.63 1 1 
        992 1 . . . . . 3.71 0.74 5.57 1 1 
        993 1 . . . . . 3.73 0.75  5.6 1 1 
        994 1 . . . . . 3.82 0.76 5.73 1 1 
        995 1 . . . . . 3.19 0.64 4.79 1 1 
        996 1 . . . . . 4.71 0.94 7.07 1 1 
        997 1 . . . . . 5.71 1.14 8.57 1 1 
        998 1 . . . . . 3.22 0.64 4.83 1 1 
        999 1 . . . . . 2.83 0.57 4.24 1 1 
       1000 1 . . . . . 5.35 1.07 8.02 1 1 
       1001 1 . . . . . 5.33 1.07 7.99 1 1 
       1002 1 . . . . . 4.74 0.95 7.11 1 1 
       1003 1 . . . . . 3.89 0.78 5.84 1 1 
       1004 1 . . . . . 4.91 0.98 7.36 1 1 
       1005 1 . . . . . 3.48  0.7 5.22 1 1 
       1006 1 . . . . .  5.6 1.12  8.4 1 1 
       1007 1 . . . . . 4.01  0.8 6.02 1 1 
       1008 1 . . . . .  4.2 0.84  6.3 1 1 
       1009 1 . . . . . 3.99  0.8 5.99 1 1 
       1010 1 . . . . . 3.44 0.69 5.16 1 1 
       1011 1 . . . . . 2.97 0.59 4.46 1 1 
       1012 1 . . . . . 3.44 0.69 5.16 1 1 
       1013 1 . . . . . 3.68 0.74 5.52 1 1 
       1014 1 . . . . . 3.51  0.7 5.26 1 1 
       1015 1 . . . . .  5.0  1.0  7.5 1 1 
       1016 1 . . . . . 5.35 1.07 8.02 1 1 
       1017 1 . . . . . 5.35 1.07 8.02 1 1 
       1018 1 . . . . . 3.99  0.8 5.99 1 1 
       1019 1 . . . . . 3.28 0.66 4.92 1 1 
       1020 1 . . . . . 3.99  0.8 5.99 1 1 
       1021 1 . . . . . 4.76 0.95 7.14 1 1 
       1022 1 . . . . . 4.03 0.81 6.05 1 1 
       1023 1 . . . . . 3.26 0.65 4.89 1 1 
       1024 1 . . . . . 4.03 0.81 6.05 1 1 
       1025 1 . . . . . 3.21 0.64 4.82 1 1 
       1026 1 . . . . .  5.4 1.08  8.1 1 1 
       1027 1 . . . . . 4.04 0.81 6.06 1 1 
       1028 1 . . . . . 3.45 0.69 5.18 1 1 
       1029 1 . . . . . 4.04 0.81 6.06 1 1 
       1030 1 . . . . . 3.56 0.71 5.34 1 1 
       1031 1 . . . . . 3.26 0.65 4.89 1 1 
       1032 1 . . . . . 3.86 0.77 5.79 1 1 
       1033 1 . . . . . 4.43 0.89 6.64 1 1 
       1034 1 . . . . . 4.43 0.89 6.64 1 1 
       1035 1 . . . . . 4.32 0.86 6.48 1 1 
       1036 1 . . . . . 5.42 1.08 8.13 1 1 
       1037 1 . . . . . 4.62 0.92 6.93 1 1 
       1038 1 . . . . . 3.74 0.75 5.61 1 1 
       1039 1 . . . . . 3.06 0.61 4.59 1 1 
       1040 1 . . . . . 3.74 0.75 5.61 1 1 
       1041 1 . . . . . 3.91 0.78 5.87 1 1 
       1042 1 . . . . . 4.67 0.93 7.01 1 1 
       1043 1 . . . . . 4.05 0.81 6.08 1 1 
       1044 1 . . . . . 2.79 0.56 4.18 1 1 
       1045 1 . . . . .  6.1 1.22 9.15 1 1 
       1046 1 . . . . . 4.46 0.89 6.69 1 1 
       1047 1 . . . . . 4.53 0.91  6.8 1 1 
       1048 1 . . . . . 4.53 0.91  6.8 1 1 
       1049 1 . . . . . 3.87 0.77  5.8 1 1 
       1050 1 . . . . . 4.66 0.93 6.99 1 1 
       1051 1 . . . . . 4.97 0.99 7.45 1 1 
       1052 1 . . . . . 4.34 0.87 6.51 1 1 
       1053 1 . . . . . 4.97 0.99 7.45 1 1 
       1054 1 . . . . . 4.56 0.91 6.84 1 1 
       1055 1 . . . . .  6.2 1.24  9.3 1 1 
       1056 1 . . . . .  5.2 1.04  7.8 1 1 
       1057 1 . . . . .  6.2 1.24  9.3 1 1 
       1058 1 . . . . . 4.27 0.85  6.4 1 1 
       1059 1 . . . . . 4.82 0.96 7.23 1 1 
       1060 1 . . . . . 4.47 0.89  6.7 1 1 
       1061 1 . . . . . 4.31 0.86 6.46 1 1 
       1062 1 . . . . . 3.92 0.78 5.88 1 1 
       1063 1 . . . . . 3.75 0.75 5.63 1 1 
       1064 1 . . . . . 4.59 0.92 6.89 1 1 
       1065 1 . . . . . 3.63 0.73 5.45 1 1 
       1066 1 . . . . . 4.59 0.92 6.89 1 1 
       1067 1 . . . . . 4.02  0.8 5.46 1 1 
       1068 1 . . . . . 4.01  0.8 6.02 1 1 
       1069 1 . . . . . 3.91 0.78 5.87 1 1 
       1070 1 . . . . . 3.19 0.64 4.79 1 1 
       1071 1 . . . . . 3.91 0.78 5.87 1 1 
       1072 1 . . . . . 4.41 0.88 6.61 1 1 
       1073 1 . . . . .  3.5  0.7 5.25 1 1 
       1074 1 . . . . . 3.05 0.61 4.57 1 1 
       1075 1 . . . . .  3.5  0.7 5.25 1 1 
       1076 1 . . . . . 3.04 0.61 4.56 1 1 
       1077 1 . . . . . 5.12 1.02 7.68 1 1 
       1078 1 . . . . . 3.56 0.71 5.34 1 1 
       1079 1 . . . . . 5.13 1.03  7.7 1 1 
       1080 1 . . . . . 4.38 0.88 6.57 1 1 
       1081 1 . . . . . 3.97 0.79 5.96 1 1 
       1082 1 . . . . . 5.67 1.13 8.51 1 1 
       1083 1 . . . . . 3.98  0.8 5.97 1 1 
       1084 1 . . . . . 5.76 1.15 8.64 1 1 
       1085 1 . . . . . 4.14 0.83 6.21 1 1 
       1086 1 . . . . . 4.14 0.83 6.21 1 1 
       1087 1 . . . . . 3.64 0.73 5.46 1 1 
       1088 1 . . . . . 3.19 0.64 4.79 1 1 
       1089 1 . . . . . 3.64 0.73 5.46 1 1 
       1090 1 . . . . . 3.99  0.8 5.99 1 1 
       1091 1 . . . . . 4.57 0.91 6.86 1 1 
       1092 1 . . . . .  3.8 0.76  5.7 1 1 
       1093 1 . . . . . 3.32 0.66 4.98 1 1 
       1094 1 . . . . .  3.8 0.76  5.7 1 1 
       1095 1 . . . . . 3.08 0.62 4.62 1 1 
       1096 1 . . . . . 4.46 0.89 6.69 1 1 
       1097 1 . . . . . 3.87 0.77  5.8 1 1 
       1098 1 . . . . . 4.18 0.84 6.27 1 1 
       1099 1 . . . . . 3.89 0.78 5.84 1 1 
       1100 1 . . . . . 4.12 0.82 6.18 1 1 
       1101 1 . . . . . 4.22 0.84 6.33 1 1 
       1102 1 . . . . . 3.59 0.72 5.38 1 1 
       1103 1 . . . . . 4.43 0.89 6.64 1 1 
       1104 1 . . . . . 5.66 1.13 8.49 1 1 
       1105 1 . . . . . 3.65 0.73 5.48 1 1 
       1106 1 . . . . . 2.91 0.58 4.37 1 1 
       1107 1 . . . . . 3.65 0.73 5.48 1 1 
       1108 1 . . . . . 4.52  0.9 6.78 1 1 
       1109 1 . . . . . 3.78 0.76 5.67 1 1 
       1110 1 . . . . . 4.52  0.9 6.78 1 1 
       1111 1 . . . . . 4.57 0.91 6.86 1 1 
       1112 1 . . . . . 5.72 1.14 8.58 1 1 
       1113 1 . . . . .  4.0  0.8  6.0 1 1 
       1114 1 . . . . .  4.2 0.84  6.3 1 1 
       1115 1 . . . . . 5.22 1.04 7.83 1 1 
       1116 1 . . . . . 4.47 0.89  6.7 1 1 
       1117 1 . . . . . 5.22 1.04 7.83 1 1 
       1118 1 . . . . .  4.2 0.84  6.3 1 1 
       1119 1 . . . . . 3.57 0.71 5.35 1 1 
       1120 1 . . . . .  4.2 0.84  6.3 1 1 
       1121 1 . . . . . 3.05 0.61 4.57 1 1 
       1122 1 . . . . . 4.44 0.89 6.66 1 1 
       1123 1 . . . . . 4.33 0.87 6.49 1 1 
       1124 1 . . . . . 3.25 0.65 4.87 1 1 
       1125 1 . . . . . 4.23 0.85 6.35 1 1 
       1126 1 . . . . . 3.34 0.67 5.01 1 1 
       1127 1 . . . . . 3.87 0.77  5.8 1 1 
       1128 1 . . . . . 4.88 0.98 7.32 1 1 
       1129 1 . . . . . 4.15 0.83 6.23 1 1 
       1130 1 . . . . . 4.56 0.91 6.84 1 1 
       1131 1 . . . . . 4.15 0.83 6.23 1 1 
       1132 1 . . . . . 4.56 0.91 6.84 1 1 
       1133 1 . . . . .  4.5  0.9 6.75 1 1 
       1134 1 . . . . . 4.51  0.9 6.77 1 1 
       1135 1 . . . . . 4.51  0.9 6.77 1 1 
       1136 1 . . . . . 2.95 0.59 4.43 1 1 
       1137 1 . . . . . 4.61 0.92 6.92 1 1 
       1138 1 . . . . .  4.5  0.9 6.75 1 1 
       1139 1 . . . . . 4.65 0.93 6.98 1 1 
       1140 1 . . . . . 3.05 0.61 4.57 1 1 
       1141 1 . . . . . 4.83 0.97 7.24 1 1 
       1142 1 . . . . . 5.19 1.04 7.79 1 1 
       1143 1 . . . . . 3.97 0.79 5.96 1 1 
       1144 1 . . . . .  5.7 1.14 8.55 1 1 
       1145 1 . . . . . 3.51  0.7 5.26 1 1 
       1146 1 . . . . . 4.29 0.86 6.43 1 1 
       1147 1 . . . . . 5.97 1.19 8.95 1 1 
       1148 1 . . . . . 3.42 0.68 5.13 1 1 
       1149 1 . . . . . 5.22 1.04 7.83 1 1 
       1150 1 . . . . . 3.14 0.63 4.71 1 1 
       1151 1 . . . . . 3.23 0.65 4.85 1 1 
       1152 1 . . . . . 4.24 0.85 6.36 1 1 
       1153 1 . . . . . 5.48  1.1 8.22 1 1 
       1154 1 . . . . . 3.99  0.8 5.99 1 1 
       1155 1 . . . . . 4.54 0.91 6.81 1 1 
       1156 1 . . . . . 3.74 0.75 5.61 1 1 
       1157 1 . . . . . 2.89 0.58 4.34 1 1 
       1158 1 . . . . . 3.65 0.73 5.48 1 1 
       1159 1 . . . . . 4.05 0.81 6.08 1 1 
       1160 1 . . . . . 4.12 0.82 6.18 1 1 
       1161 1 . . . . . 3.64 0.73 5.46 1 1 
       1162 1 . . . . . 3.92 0.78 5.88 1 1 
       1163 1 . . . . . 4.05 0.81 6.08 1 1 
       1164 1 . . . . . 3.65 0.73 5.48 1 1 
       1165 1 . . . . . 4.58 0.92 6.87 1 1 
       1166 1 . . . . .  3.4 0.68  5.1 1 1 
       1167 1 . . . . . 3.09 0.62 4.63 1 1 
       1168 1 . . . . . 3.52  0.7 5.28 1 1 
       1169 1 . . . . . 4.79 0.96 7.18 1 1 
       1170 1 . . . . .  3.7 0.74 5.55 1 1 
       1171 1 . . . . . 4.09 0.82 6.14 1 1 
       1172 1 . . . . . 3.11 0.62 4.66 1 1 
       1173 1 . . . . . 4.48  0.9 6.72 1 1 
       1174 1 . . . . . 2.99  0.6 4.49 1 1 
       1175 1 . . . . . 3.97 0.79 5.96 1 1 
       1176 1 . . . . . 3.13 0.63  4.7 1 1 
       1177 1 . . . . . 4.28 0.86 6.42 1 1 
       1178 1 . . . . .  5.2 1.04  7.8 1 1 
       1179 1 . . . . . 3.13 0.63  4.7 1 1 
       1180 1 . . . . . 4.71 0.94 7.07 1 1 
       1181 1 . . . . . 4.31 0.86 6.46 1 1 
       1182 1 . . . . . 4.66 0.93 6.99 1 1 
       1183 1 . . . . .  4.4 0.88  6.6 1 1 
       1184 1 . . . . . 4.99  1.0 7.48 1 1 
       1185 1 . . . . . 3.58 0.72 5.37 1 1 
       1186 1 . . . . . 4.99  1.0 7.48 1 1 
       1187 1 . . . . . 3.58 0.72 5.37 1 1 
       1188 1 . . . . . 3.62 0.72 5.43 1 1 
       1189 1 . . . . . 4.12 0.82 6.18 1 1 
       1190 1 . . . . . 3.83 0.77 5.74 1 1 
       1191 1 . . . . . 4.37 0.87 6.55 1 1 
       1192 1 . . . . . 3.25 0.65 4.87 1 1 
       1193 1 . . . . . 4.58 0.92 6.87 1 1 
       1194 1 . . . . . 4.35 0.87 6.52 1 1 
       1195 1 . . . . . 3.61 0.72 5.41 1 1 
       1196 1 . . . . . 4.33 0.87 6.49 1 1 
       1197 1 . . . . . 4.33 0.87 6.49 1 1 
       1198 1 . . . . . 4.29 0.86 6.43 1 1 
       1199 1 . . . . . 4.61 0.92 6.92 1 1 
       1200 1 . . . . . 3.54 0.71 5.31 1 1 
       1201 1 . . . . . 4.35 0.87 6.52 1 1 
       1202 1 . . . . . 4.03 0.81 6.05 1 1 
       1203 1 . . . . . 3.45 0.69 5.18 1 1 
       1204 1 . . . . . 3.83 0.77 5.74 1 1 
       1205 1 . . . . . 3.87 0.77  5.8 1 1 
       1206 1 . . . . . 4.17 0.83 6.26 1 1 
       1207 1 . . . . . 4.11 0.82 6.17 1 1 
       1208 1 . . . . . 4.28 0.86 6.42 1 1 
       1209 1 . . . . . 3.52  0.7 5.28 1 1 
       1210 1 . . . . . 3.11 0.62 4.66 1 1 
       1211 1 . . . . . 4.48  0.9 6.72 1 1 
       1212 1 . . . . . 4.04 0.81 6.06 1 1 
       1213 1 . . . . . 4.93 0.99 7.39 1 1 
       1214 1 . . . . . 5.31 1.06 7.96 1 1 
       1215 1 . . . . .  4.4 0.88  6.6 1 1 
       1216 1 . . . . . 5.43 1.09 8.14 1 1 
       1217 1 . . . . . 3.37 0.67 5.05 1 1 
       1218 1 . . . . . 4.37 0.87 6.55 1 1 
       1219 1 . . . . . 4.43 0.89 6.64 1 1 
       1220 1 . . . . . 4.61 0.92 6.92 1 1 
       1221 1 . . . . . 4.12 0.82 6.18 1 1 
       1222 1 . . . . . 3.53 0.82 5.29 1 1 
       1223 1 . . . . . 3.73 0.75  5.6 1 1 
       1224 1 . . . . . 4.07 0.81 6.11 1 1 
       1225 1 . . . . . 4.29 0.86 6.43 1 1 
       1226 1 . . . . .  3.6 0.72  5.4 1 1 
       1227 1 . . . . . 4.54 0.91 6.81 1 1 
       1228 1 . . . . . 3.79 0.76 5.68 1 1 
       1229 1 . . . . . 3.88 0.78 5.82 1 1 
       1230 1 . . . . . 3.36 0.67 5.04 1 1 
       1231 1 . . . . . 3.88 0.78 5.82 1 1 
       1232 1 . . . . . 3.54 0.71 5.31 1 1 
       1233 1 . . . . . 4.91 0.98 7.36 1 1 
       1234 1 . . . . . 4.89 0.98 7.33 1 1 
       1235 1 . . . . . 4.26 0.85 6.39 1 1 
       1236 1 . . . . . 4.07 0.81 6.11 1 1 
       1237 1 . . . . . 4.51  0.9 6.77 1 1 
       1238 1 . . . . . 4.23 0.85 6.35 1 1 
       1239 1 . . . . . 3.17 0.63 4.76 1 1 
       1240 1 . . . . . 4.33 0.87 6.49 1 1 
       1241 1 . . . . . 3.68 0.74 5.52 1 1 
       1242 1 . . . . . 4.25 0.85 6.37 1 1 
       1243 1 . . . . .  3.3 0.66 4.95 1 1 
       1244 1 . . . . . 4.73 0.95  7.1 1 1 
       1245 1 . . . . . 4.28 0.86 6.42 1 1 
       1246 1 . . . . . 4.02  0.8 6.03 1 1 
       1247 1 . . . . . 4.83 0.97 7.24 1 1 
       1248 1 . . . . . 3.79 0.76 5.68 1 1 
       1249 1 . . . . . 4.28 0.86 6.42 1 1 
       1250 1 . . . . . 4.02  0.8 6.03 1 1 
       1251 1 . . . . . 4.83 0.97 7.24 1 1 
       1252 1 . . . . . 3.79 0.76 5.68 1 1 
       1253 1 . . . . . 4.59 0.92 6.89 1 1 
       1254 1 . . . . . 4.56 0.91 6.84 1 1 
       1255 1 . . . . . 3.74 0.75 5.61 1 1 
       1256 1 . . . . . 4.09 0.82 6.14 1 1 
       1257 1 . . . . . 3.87 0.77  5.8 1 1 
       1258 1 . . . . . 5.09 1.02 7.64 1 1 
       1259 1 . . . . . 4.53 0.91  6.8 1 1 
       1260 1 . . . . . 3.79 0.76 5.68 1 1 
       1261 1 . . . . . 4.92 0.98 7.38 1 1 
       1262 1 . . . . . 5.02  1.0 7.53 1 1 
       1263 1 . . . . . 4.68 0.94 7.02 1 1 
       1264 1 . . . . . 3.89 0.78 5.84 1 1 
       1265 1 . . . . . 4.01  0.8 6.02 1 1 
       1266 1 . . . . . 5.14 1.03 7.71 1 1 
       1267 1 . . . . . 4.17 0.83 6.26 1 1 
       1268 1 . . . . . 4.92 0.98 7.38 1 1 
       1269 1 . . . . . 3.25 0.65 4.87 1 1 
       1270 1 . . . . . 4.25 0.85 6.37 1 1 
       1271 1 . . . . . 4.32 0.86 6.48 1 1 
       1272 1 . . . . . 4.32 0.86 6.48 1 1 
       1273 1 . . . . . 4.15 0.83 6.23 1 1 
       1274 1 . . . . . 4.34 0.87 6.51 1 1 
       1275 1 . . . . . 3.16 0.63 4.74 1 1 
       1276 1 . . . . . 4.76 0.95 7.14 1 1 
       1277 1 . . . . . 3.69 0.74 5.54 1 1 
       1278 1 . . . . . 5.21 1.04 7.82 1 1 
       1279 1 . . . . . 3.32 0.66 4.98 1 1 
       1280 1 . . . . . 4.47 0.89  6.7 1 1 
       1281 1 . . . . . 4.71 0.94 7.07 1 1 
       1282 1 . . . . . 4.69 0.94 7.04 1 1 
       1283 1 . . . . . 4.52  0.9 6.78 1 1 
       1284 1 . . . . .  6.2 1.24  9.3 1 1 
       1285 1 . . . . . 3.01  0.6 4.51 1 1 
       1286 1 . . . . . 3.12 0.62 4.68 1 1 
       1287 1 . . . . . 5.94 1.19 8.91 1 1 
       1288 1 . . . . . 4.25 0.85 6.37 1 1 
       1289 1 . . . . . 3.84 0.77 5.76 1 1 
       1290 1 . . . . . 3.51  0.7 5.26 1 1 
       1291 1 . . . . . 3.31 0.66 4.96 1 1 
       1292 1 . . . . . 3.67 0.73 5.51 1 1 
       1293 1 . . . . . 4.57 0.91 6.86 1 1 
       1294 1 . . . . . 4.22 0.84 6.33 1 1 
       1295 1 . . . . . 4.41 0.88 6.61 1 1 
       1296 1 . . . . . 3.14 0.63 4.71 1 1 
       1297 1 . . . . . 3.58 0.72 5.37 1 1 
       1298 1 . . . . . 5.12 1.02 7.68 1 1 
       1299 1 . . . . . 5.65 1.13 8.48 1 1 
       1300 1 . . . . . 5.17 1.03 7.76 1 1 
       1301 1 . . . . .  5.1 1.02 7.65 1 1 
       1302 1 . . . . . 4.43 0.89 6.64 1 1 
       1303 1 . . . . . 4.59 0.92 6.89 1 1 
       1304 1 . . . . . 5.34 1.07 8.01 1 1 
       1305 1 . . . . . 3.11 0.62 4.66 1 1 
       1306 1 . . . . . 3.63 0.73 5.45 1 1 
       1307 1 . . . . . 3.96 0.79 5.94 1 1 
       1308 1 . . . . . 3.73 0.75  5.6 1 1 
       1309 1 . . . . . 4.19 0.84 6.29 1 1 
       1310 1 . . . . . 3.35 0.67 5.02 1 1 
       1311 1 . . . . . 4.49  0.9 6.73 1 1 
       1312 1 . . . . . 4.29 0.86 6.43 1 1 
       1313 1 . . . . . 3.74 0.75 5.61 1 1 
       1314 1 . . . . . 5.08 1.02 7.62 1 1 
       1315 1 . . . . . 5.08 1.02 7.62 1 1 
       1316 1 . . . . . 3.84 0.77 5.76 1 1 
       1317 1 . . . . . 4.18 0.84 6.27 1 1 
       1318 1 . . . . . 3.33 0.67 4.99 1 1 
       1319 1 . . . . .  4.2 0.84  6.3 1 1 
       1320 1 . . . . . 5.08 1.02 7.62 1 1 
       1321 1 . . . . . 4.42 0.88 6.63 1 1 
       1322 1 . . . . . 4.27 0.85  6.4 1 1 
       1323 1 . . . . . 4.18 0.84 6.27 1 1 
       1324 1 . . . . . 4.03 0.81 6.05 1 1 
       1325 1 . . . . . 4.42 0.88 6.63 1 1 
       1326 1 . . . . . 5.13 1.03  7.7 1 1 
       1327 1 . . . . . 3.85 0.77 5.77 1 1 
       1328 1 . . . . . 2.93 0.59  4.4 1 1 
       1329 1 . . . . . 3.37 0.67 5.05 1 1 
       1330 1 . . . . . 4.81 0.96 7.21 1 1 
       1331 1 . . . . . 4.39 0.88 6.58 1 1 
       1332 1 . . . . . 4.75 0.95 7.13 1 1 
       1333 1 . . . . . 3.67 0.73 5.51 1 1 
       1334 1 . . . . .  4.4 0.88  6.6 1 1 
       1335 1 . . . . . 3.56 0.71 5.34 1 1 
       1336 1 . . . . . 4.88 0.98 7.32 1 1 
       1337 1 . . . . . 3.62 0.72 5.43 1 1 
       1338 1 . . . . . 3.11 0.62 4.66 1 1 
       1339 1 . . . . . 4.66 0.93 6.99 1 1 
       1340 1 . . . . . 4.42 0.88 6.63 1 1 
       1341 1 . . . . . 3.73 0.75  5.6 1 1 
       1342 1 . . . . . 3.89 0.78 5.84 1 1 
       1343 1 . . . . . 3.04 0.61 4.56 1 1 
       1344 1 . . . . . 3.89 0.78 5.84 1 1 
       1345 1 . . . . . 4.77 0.95 7.15 1 1 
       1346 1 . . . . . 4.85 0.97 7.27 1 1 
       1347 1 . . . . . 5.52  1.1 8.28 1 1 
       1348 1 . . . . . 3.35 0.67 5.02 1 1 
       1349 1 . . . . . 3.35 0.67 5.02 1 1 
       1350 1 . . . . . 2.69 0.54 4.04 1 1 
       1351 1 . . . . . 3.27 0.65  4.9 1 1 
       1352 1 . . . . . 3.01  0.6 4.51 1 1 
       1353 1 . . . . . 3.94 0.79 5.91 1 1 
       1354 1 . . . . . 4.09 0.82 6.14 1 1 
       1355 1 . . . . . 4.09 0.82 6.14 1 1 
       1356 1 . . . . . 3.45 0.69 5.18 1 1 
       1357 1 . . . . . 3.61 0.72 5.41 1 1 
       1358 1 . . . . . 4.65 0.93 6.98 1 1 
       1359 1 . . . . . 3.32 0.66 4.98 1 1 
       1360 1 . . . . . 2.75 0.55 4.13 1 1 
       1361 1 . . . . . 4.17 0.83 6.26 1 1 
       1362 1 . . . . . 3.64 0.73 5.46 1 1 
       1363 1 . . . . . 3.27 0.65  4.9 1 1 
       1364 1 . . . . . 2.78 0.56 4.17 1 1 
       1365 1 . . . . . 4.58 0.92 6.87 1 1 
       1366 1 . . . . . 3.19 0.64 4.79 1 1 
       1367 1 . . . . . 5.83 1.17 8.74 1 1 
       1368 1 . . . . . 3.79 0.76 5.68 1 1 
       1369 1 . . . . . 4.31 0.86 6.46 1 1 
       1370 1 . . . . . 3.63 0.73 5.45 1 1 
       1371 1 . . . . .  4.8 0.96  7.2 1 1 
       1372 1 . . . . . 4.65 0.93 6.98 1 1 
       1373 1 . . . . . 4.83 0.97 7.24 1 1 
       1374 1 . . . . . 4.42 0.88 6.63 1 1 
       1375 1 . . . . . 4.23 0.85 6.35 1 1 
       1376 1 . . . . . 3.97 0.79 5.96 1 1 
       1377 1 . . . . . 3.97 0.79 5.96 1 1 
       1378 1 . . . . . 3.94 0.79 5.91 1 1 
       1379 1 . . . . . 3.94 0.79 5.91 1 1 
       1380 1 . . . . . 4.59 0.92 6.89 1 1 
       1381 1 . . . . . 3.34 0.67 5.01 1 1 
       1382 1 . . . . . 2.92 0.58 4.38 1 1 
       1383 1 . . . . . 3.34 0.67 5.01 1 1 
       1384 1 . . . . . 4.34 0.87 6.51 1 1 
       1385 1 . . . . . 4.62 0.92 6.93 1 1 
       1386 1 . . . . .  4.0  0.8  6.0 1 1 
       1387 1 . . . . . 4.39 0.88 6.58 1 1 
       1388 1 . . . . . 4.03 0.81 6.05 1 1 
       1389 1 . . . . . 3.84 0.77 5.76 1 1 
       1390 1 . . . . . 4.74 0.95 7.11 1 1 
       1391 1 . . . . . 4.52  0.9 6.78 1 1 
       1392 1 . . . . . 4.74 0.95 7.11 1 1 
       1393 1 . . . . . 4.52  0.9 6.78 1 1 
       1394 1 . . . . . 3.85 0.77 5.77 1 1 
       1395 1 . . . . . 4.97 0.99 7.45 1 1 
       1396 1 . . . . . 4.37 0.87 6.55 1 1 
       1397 1 . . . . . 4.02  0.8 6.03 1 1 
       1398 1 . . . . . 3.83 0.77 5.74 1 1 
       1399 1 . . . . . 3.09 0.62 4.63 1 1 
       1400 1 . . . . . 4.98  1.0 7.47 1 1 
       1401 1 . . . . . 3.33 0.67 4.99 1 1 
       1402 1 . . . . . 3.77 0.75 5.65 1 1 
       1403 1 . . . . . 3.84 0.77 5.76 1 1 
       1404 1 . . . . . 4.05 0.81 6.08 1 1 
       1405 1 . . . . . 4.41 0.88 6.61 1 1 
       1406 1 . . . . . 4.49  0.9 6.73 1 1 
       1407 1 . . . . . 3.12 0.62 4.68 1 1 
       1408 1 . . . . .  4.9 0.98 7.35 1 1 
       1409 1 . . . . . 4.56 0.91 6.84 1 1 
       1410 1 . . . . . 4.32 0.86 6.48 1 1 
       1411 1 . . . . . 4.64 0.93 6.96 1 1 
       1412 1 . . . . . 3.46 0.69 5.19 1 1 
       1413 1 . . . . . 4.63 0.93 6.23 1 1 
       1414 1 . . . . . 4.32 0.86 6.48 1 1 
       1415 1 . . . . . 4.57 0.91 6.86 1 1 
       1416 1 . . . . . 4.04 0.81 4.43 1 1 
       1417 1 . . . . . 3.07 0.61  4.6 1 1 
       1418 1 . . . . .  4.5  0.9 6.75 1 1 
       1419 1 . . . . . 5.25 1.05 5.51 1 1 
       1420 1 . . . . . 3.17 0.63 4.76 1 1 
       1421 1 . . . . . 3.85 0.77 5.77 1 1 
       1422 1 . . . . . 4.62 0.92 6.93 1 1 
       1423 1 . . . . . 4.34 0.87 6.51 1 1 
       1424 1 . . . . . 3.64 0.73 5.46 1 1 
       1425 1 . . . . . 4.65 0.93 6.98 1 1 
       1426 1 . . . . . 3.36 0.67 5.04 1 1 
       1427 1 . . . . . 2.62 0.52 3.93 1 1 
       1428 1 . . . . . 3.51  0.7 5.26 1 1 
       1429 1 . . . . . 2.95 0.59 4.43 1 1 
       1430 1 . . . . .  4.5  0.9 6.75 1 1 
       1431 1 . . . . .  3.4 0.68  5.1 1 1 
       1432 1 . . . . . 4.28 0.86 6.42 1 1 
       1433 1 . . . . . 3.46 0.69 5.19 1 1 
       1434 1 . . . . . 5.04 1.01 7.56 1 1 
       1435 1 . . . . .  3.4 0.68  5.1 1 1 
       1436 1 . . . . . 4.49  0.9 6.73 1 1 
       1437 1 . . . . .  3.4 0.68  5.1 1 1 
       1438 1 . . . . . 3.97 0.79 5.96 1 1 
       1439 1 . . . . . 3.74 0.75 5.61 1 1 
       1440 1 . . . . . 3.88 0.78 5.82 1 1 
       1441 1 . . . . . 3.36 0.67 5.04 1 1 
       1442 1 . . . . . 3.88 0.78 5.82 1 1 
       1443 1 . . . . . 5.45 1.09 8.17 1 1 
       1444 1 . . . . .  3.7 0.74 5.55 1 1 
       1445 1 . . . . . 3.72 0.74 5.58 1 1 
       1446 1 . . . . .  5.3 1.06 7.95 1 1 
       1447 1 . . . . . 5.05 1.01 7.58 1 1 
       1448 1 . . . . . 4.52  0.9 6.78 1 1 
       1449 1 . . . . . 3.41 0.68 5.12 1 1 
       1450 1 . . . . . 4.86 0.97 7.29 1 1 
       1451 1 . . . . . 3.05 0.61 4.57 1 1 
       1452 1 . . . . . 4.65 0.93 6.98 1 1 
       1453 1 . . . . . 5.16 1.03 7.74 1 1 
       1454 1 . . . . . 5.35 1.07 8.02 1 1 
       1455 1 . . . . . 3.55 0.71 5.32 1 1 
       1456 1 . . . . . 4.52  0.9 6.78 1 1 
       1457 1 . . . . . 3.96 0.79 5.94 1 1 
       1458 1 . . . . . 4.99  1.0 7.48 1 1 
       1459 1 . . . . .  5.3 1.06 7.95 1 1 
       1460 1 . . . . . 4.43 0.89 6.64 1 1 
       1461 1 . . . . . 5.01  1.0 7.52 1 1 
       1462 1 . . . . . 4.47 0.89  6.7 1 1 
       1463 1 . . . . . 4.63 0.93 6.95 1 1 
       1464 1 . . . . . 3.61 0.72 5.41 1 1 
       1465 1 . . . . . 2.92 0.58 4.38 1 1 
       1466 1 . . . . . 3.61 0.72 5.41 1 1 
       1467 1 . . . . . 3.96 0.79 5.94 1 1 
       1468 1 . . . . . 3.34 0.67 5.01 1 1 
       1469 1 . . . . . 3.96 0.79 5.94 1 1 
       1470 1 . . . . .  4.0  0.8  6.0 1 1 
       1471 1 . . . . . 5.04 1.01 7.56 1 1 
       1472 1 . . . . . 5.04 1.01 7.56 1 1 
       1473 1 . . . . . 4.24 0.85 6.36 1 1 
       1474 1 . . . . . 3.67 0.73 5.51 1 1 
       1475 1 . . . . . 4.24 0.85 6.36 1 1 
       1476 1 . . . . .  3.0  0.6  4.5 1 1 
       1477 1 . . . . .  4.5  0.9 6.75 1 1 
       1478 1 . . . . . 3.98  0.8 5.97 1 1 
       1479 1 . . . . . 4.25 0.85 6.37 1 1 
       1480 1 . . . . . 3.84 0.77 5.76 1 1 
       1481 1 . . . . . 4.39 0.88 6.58 1 1 
       1482 1 . . . . . 4.39 0.88 6.58 1 1 
       1483 1 . . . . .  3.3 0.66 4.95 1 1 
       1484 1 . . . . . 3.51  0.7 5.26 1 1 
       1485 1 . . . . . 3.48  0.7 5.22 1 1 
       1486 1 . . . . . 5.55 1.11 8.33 1 1 
       1487 1 . . . . . 4.19 0.84 6.29 1 1 
       1488 1 . . . . . 4.91 0.98 7.36 1 1 
       1489 1 . . . . . 4.91 0.98 7.36 1 1 
       1490 1 . . . . . 3.76 0.75 5.64 1 1 
       1491 1 . . . . . 3.24 0.65 4.86 1 1 
       1492 1 . . . . . 3.76 0.75 5.64 1 1 
       1493 1 . . . . . 4.34 0.87 6.51 1 1 
       1494 1 . . . . . 5.26 1.05 7.89 1 1 
       1495 1 . . . . .  2.9 0.58 4.35 1 1 
       1496 1 . . . . . 4.35 0.87 6.52 1 1 
       1497 1 . . . . . 4.35 0.87 6.52 1 1 
       1498 1 . . . . .  5.1 1.02 7.65 1 1 
       1499 1 . . . . . 3.58 0.72 5.37 1 1 
       1500 1 . . . . . 4.26 0.85 6.39 1 1 
       1501 1 . . . . . 4.26 0.85 6.39 1 1 
       1502 1 . . . . .  3.7 0.74 5.55 1 1 
       1503 1 . . . . . 3.13 0.63  4.7 1 1 
       1504 1 . . . . .  3.7 0.74 5.55 1 1 
       1505 1 . . . . . 3.88 0.78 5.82 1 1 
       1506 1 . . . . . 4.69 0.94 7.04 1 1 
       1507 1 . . . . . 3.48  0.7 5.22 1 1 
       1508 1 . . . . . 5.12 1.02 7.68 1 1 
       1509 1 . . . . . 3.53 0.71 5.29 1 1 
       1510 1 . . . . . 4.25 0.85 6.37 1 1 
       1511 1 . . . . . 4.25 0.85 6.37 1 1 
       1512 1 . . . . . 4.13 0.83  6.2 1 1 
       1513 1 . . . . . 3.51  0.7 5.26 1 1 
       1514 1 . . . . . 4.13 0.83  6.2 1 1 
       1515 1 . . . . . 4.89 0.98 7.33 1 1 
       1516 1 . . . . . 3.15 0.63 4.73 1 1 
       1517 1 . . . . . 3.47 0.69 5.21 1 1 
       1518 1 . . . . . 4.02  0.8 6.03 1 1 
       1519 1 . . . . . 4.02  0.8 6.03 1 1 
       1520 1 . . . . . 3.53 0.71 5.29 1 1 
       1521 1 . . . . . 5.07 1.01 7.61 1 1 
       1522 1 . . . . . 3.38 0.68 5.07 1 1 
       1523 1 . . . . . 4.49  0.9 6.73 1 1 
       1524 1 . . . . . 3.93 0.79  5.9 1 1 
       1525 1 . . . . . 3.93 0.79  5.9 1 1 
       1526 1 . . . . . 4.66 0.93 6.99 1 1 
       1527 1 . . . . . 4.43 0.89 6.64 1 1 
       1528 1 . . . . . 3.84 0.77 5.76 1 1 
       1529 1 . . . . . 4.74 0.95 7.11 1 1 
       1530 1 . . . . . 5.16 1.03 7.74 1 1 
       1531 1 . . . . . 3.66 0.73 5.49 1 1 
       1532 1 . . . . . 4.19 0.84 6.29 1 1 
       1533 1 . . . . . 3.95 0.79 5.93 1 1 
       1534 1 . . . . . 5.09 1.02 7.64 1 1 
       1535 1 . . . . . 2.89 0.58 4.34 1 1 
       1536 1 . . . . . 3.67 0.73 5.51 1 1 
       1537 1 . . . . .  3.2 0.64  4.8 1 1 
       1538 1 . . . . . 3.64 0.73 5.46 1 1 
       1539 1 . . . . . 3.22 0.64 4.83 1 1 
       1540 1 . . . . . 3.49  0.7 5.24 1 1 
       1541 1 . . . . . 5.21 1.04 7.82 1 1 
       1542 1 . . . . . 4.28 0.86 6.42 1 1 
       1543 1 . . . . . 3.65 0.73 5.48 1 1 
       1544 1 . . . . . 4.43 0.89 6.64 1 1 
       1545 1 . . . . . 3.32 0.66 4.98 1 1 
       1546 1 . . . . . 5.11 1.02 7.67 1 1 
       1547 1 . . . . . 4.99  1.0 7.48 1 1 
       1548 1 . . . . . 3.25 0.65 4.87 1 1 
       1549 1 . . . . . 3.75 0.75 5.63 1 1 
       1550 1 . . . . .  4.1 0.82 6.15 1 1 
       1551 1 . . . . . 3.29 0.66 4.93 1 1 
       1552 1 . . . . .  4.1 0.82 6.15 1 1 
       1553 1 . . . . . 4.59 0.92 6.89 1 1 
       1554 1 . . . . . 3.32 0.66 4.98 1 1 
       1555 1 . . . . . 3.12 0.62 4.68 1 1 
       1556 1 . . . . .  3.8 0.76  5.7 1 1 
       1557 1 . . . . . 3.45 0.69 5.18 1 1 
       1558 1 . . . . . 4.61 0.92 6.92 1 1 
       1559 1 . . . . . 4.61 0.92 6.92 1 1 
       1560 1 . . . . . 3.16 0.63 4.74 1 1 
       1561 1 . . . . . 4.59 0.92 6.89 1 1 
       1562 1 . . . . . 2.94 0.59 4.41 1 1 
       1563 1 . . . . . 3.75 0.75 5.63 1 1 
       1564 1 . . . . . 4.43 0.89 6.64 1 1 
       1565 1 . . . . . 4.43 0.89 6.64 1 1 
       1566 1 . . . . . 3.47 0.69 5.21 1 1 
       1567 1 . . . . . 3.42 0.68 5.13 1 1 
       1568 1 . . . . . 3.89 0.78 5.84 1 1 
       1569 1 . . . . . 4.54 0.91 6.81 1 1 
       1570 1 . . . . . 5.45 1.09 8.17 1 1 
       1571 1 . . . . . 3.85 0.77 5.77 1 1 
       1572 1 . . . . . 3.76 0.75 5.64 1 1 
       1573 1 . . . . . 3.48  0.7 5.22 1 1 
       1574 1 . . . . . 3.52  0.7 5.28 1 1 
       1575 1 . . . . . 2.98  0.6 4.47 1 1 
       1576 1 . . . . . 4.36 0.87 6.54 1 1 
       1577 1 . . . . . 4.25 0.85 6.37 1 1 
       1578 1 . . . . . 4.17 0.83 6.26 1 1 
       1579 1 . . . . . 4.22 0.84 6.33 1 1 
       1580 1 . . . . . 3.77 0.75 5.65 1 1 
       1581 1 . . . . . 3.33 0.67 4.99 1 1 
       1582 1 . . . . . 4.96 0.99 7.44 1 1 
       1583 1 . . . . . 5.07 1.01 7.61 1 1 
       1584 1 . . . . .  6.2 1.24  9.3 1 1 
       1585 1 . . . . . 3.89 0.78 5.84 1 1 
       1586 1 . . . . .  3.4 0.68  5.1 1 1 
       1587 1 . . . . . 3.89 0.78 5.84 1 1 
       1588 1 . . . . . 4.73 0.95  7.1 1 1 
       1589 1 . . . . . 4.82 0.96 7.23 1 1 
       1590 1 . . . . .  4.6 0.92  6.9 1 1 
       1591 1 . . . . . 5.04 1.01 7.56 1 1 
       1592 1 . . . . . 4.41 0.88 6.61 1 1 
       1593 1 . . . . . 3.83 0.77 5.74 1 1 
       1594 1 . . . . . 3.03 0.61 4.54 1 1 
       1595 1 . . . . . 4.48  0.9 6.72 1 1 
       1596 1 . . . . . 5.08 1.02 7.62 1 1 
       1597 1 . . . . .  5.0  1.0  7.5 1 1 
       1598 1 . . . . . 3.38 0.68 5.07 1 1 
       1599 1 . . . . . 4.22 0.84 6.33 1 1 
       1600 1 . . . . . 4.43 0.89 6.64 1 1 
       1601 1 . . . . . 3.97 0.79 5.96 1 1 
       1602 1 . . . . . 3.02  0.6 4.53 1 1 
       1603 1 . . . . . 4.33 0.87 6.49 1 1 
       1604 1 . . . . . 4.17 0.83 6.26 1 1 
       1605 1 . . . . . 4.85 0.97 7.27 1 1 
       1606 1 . . . . . 4.85 0.97 7.27 1 1 
       1607 1 . . . . . 3.41 0.68 5.12 1 1 
       1608 1 . . . . .  4.4 0.88  6.6 1 1 
       1609 1 . . . . . 4.31 0.86 6.46 1 1 
       1610 1 . . . . . 4.01  0.8 6.02 1 1 
       1611 1 . . . . . 4.02  0.8 6.03 1 1 
       1612 1 . . . . . 4.25 0.85 6.37 1 1 
       1613 1 . . . . . 4.13 0.83  6.2 1 1 
       1614 1 . . . . . 3.86 0.77 5.79 1 1 
       1615 1 . . . . . 3.45 0.69 5.18 1 1 
       1616 1 . . . . . 3.33 0.67 4.99 1 1 
       1617 1 . . . . . 5.43 1.09 8.14 1 1 
       1618 1 . . . . . 4.42 0.88 6.63 1 1 
       1619 1 . . . . .  4.6 0.92  6.9 1 1 
       1620 1 . . . . . 3.65 0.73 5.48 1 1 
       1621 1 . . . . . 5.36 1.07 8.04 1 1 
       1622 1 . . . . . 3.84 0.77 5.76 1 1 
       1623 1 . . . . . 5.64 1.13 8.46 1 1 
       1624 1 . . . . . 4.94 0.99 7.41 1 1 
       1625 1 . . . . . 5.46 1.09 8.19 1 1 
       1626 1 . . . . . 2.93 0.59  4.4 1 1 
       1627 1 . . . . . 5.36 1.07 8.04 1 1 
       1628 1 . . . . . 4.65 0.93 6.98 1 1 
       1629 1 . . . . . 4.49  0.9 6.73 1 1 
       1630 1 . . . . . 4.32 0.86 6.48 1 1 
       1631 1 . . . . . 4.74 0.95 7.11 1 1 
       1632 1 . . . . . 3.05 0.61 4.57 1 1 
       1633 1 . . . . . 6.11 1.22 9.17 1 1 
       1634 1 . . . . . 4.52  0.9 6.78 1 1 
       1635 1 . . . . . 4.68 0.94 7.02 1 1 
       1636 1 . . . . . 4.23 0.85 6.35 1 1 
       1637 1 . . . . . 5.37 1.07 8.05 1 1 
       1638 1 . . . . . 3.51  0.7 5.26 1 1 
       1639 1 . . . . . 4.23 0.85 6.35 1 1 
       1640 1 . . . . . 4.08 0.82 6.12 1 1 
       1641 1 . . . . . 4.28 0.86 6.42 1 1 
       1642 1 . . . . . 4.31 0.86 6.46 1 1 
       1643 1 . . . . . 4.03 0.81 6.05 1 1 
       1644 1 . . . . . 4.01  0.8 6.02 1 1 
       1645 1 . . . . . 3.53 0.71 5.29 1 1 
       1646 1 . . . . . 3.19 0.64 4.79 1 1 
       1647 1 . . . . . 3.78 0.76 5.67 1 1 
       1648 1 . . . . .  3.9 0.78 5.85 1 1 
       1649 1 . . . . . 5.76 1.15 8.64 1 1 
       1650 1 . . . . . 3.07 0.61  4.6 1 1 
       1651 1 . . . . . 4.77 0.95 7.15 1 1 
       1652 1 . . . . .  4.3 0.86 6.45 1 1 
       1653 1 . . . . . 4.18 0.84 6.27 1 1 
       1654 1 . . . . . 4.56 0.91 6.84 1 1 
       1655 1 . . . . . 3.32 0.66 4.98 1 1 
       1656 1 . . . . .  3.3 0.66 4.95 1 1 
       1657 1 . . . . . 4.69 0.94 7.04 1 1 
       1658 1 . . . . . 5.55 1.11 8.33 1 1 
       1659 1 . . . . . 4.66 0.93 6.99 1 1 
       1660 1 . . . . . 3.89 0.78 5.84 1 1 
       1661 1 . . . . . 4.66 0.93 6.99 1 1 
       1662 1 . . . . . 3.55 0.71 5.32 1 1 
       1663 1 . . . . . 4.68 0.94 7.02 1 1 
       1664 1 . . . . .  6.2 1.24  9.3 1 1 
       1665 1 . . . . . 5.08 1.02 7.62 1 1 
       1666 1 . . . . . 4.69 0.94 7.04 1 1 
       1667 1 . . . . . 3.87 0.77  5.8 1 1 
       1668 1 . . . . . 4.69 0.94 7.04 1 1 
       1669 1 . . . . . 4.51  0.9 6.77 1 1 
       1670 1 . . . . . 3.68 0.74 5.52 1 1 
       1671 1 . . . . . 3.45 0.69 5.18 1 1 
       1672 1 . . . . . 4.72 0.94 7.08 1 1 
       1673 1 . . . . . 3.47 0.69 5.21 1 1 
       1674 1 . . . . . 3.69 0.74 5.54 1 1 
       1675 1 . . . . . 4.66 0.93 6.99 1 1 
       1676 1 . . . . . 3.74 0.75 5.61 1 1 
       1677 1 . . . . . 4.12 0.82 6.18 1 1 
       1678 1 . . . . . 4.44 0.89 6.66 1 1 
       1679 1 . . . . . 4.42 0.88 6.63 1 1 
       1680 1 . . . . . 3.36 0.67 5.04 1 1 
       1681 1 . . . . . 3.04 0.61 4.56 1 1 
       1682 1 . . . . . 4.64 0.93 6.96 1 1 
       1683 1 . . . . . 5.55 1.11 8.33 1 1 
       1684 1 . . . . . 4.68 0.94 7.02 1 1 
       1685 1 . . . . . 5.29 1.06 7.93 1 1 
       1686 1 . . . . . 3.87 0.77  5.8 1 1 
       1687 1 . . . . . 4.73 0.95  7.1 1 1 
       1688 1 . . . . . 3.23 0.65 4.85 1 1 
       1689 1 . . . . . 4.73 0.95  7.1 1 1 
       1690 1 . . . . .  4.9 0.98 7.35 1 1 
       1691 1 . . . . . 3.51  0.7 5.26 1 1 
       1692 1 . . . . . 3.36 0.67 5.04 1 1 
       1693 1 . . . . . 4.95 0.99 7.42 1 1 
       1694 1 . . . . . 4.83 0.97 7.24 1 1 
       1695 1 . . . . . 3.88 0.78 5.82 1 1 
       1696 1 . . . . . 4.83 0.97 7.24 1 1 
       1697 1 . . . . . 4.41 0.88 6.61 1 1 
       1698 1 . . . . . 4.41 0.88 6.61 1 1 
       1699 1 . . . . . 4.71 0.94 7.07 1 1 
       1700 1 . . . . . 3.11 0.62 4.66 1 1 
       1701 1 . . . . . 4.45 0.89 6.67 1 1 
       1702 1 . . . . . 3.44 0.69 5.16 1 1 
       1703 1 . . . . . 4.82 0.96 7.23 1 1 
       1704 1 . . . . . 3.62 0.72 5.43 1 1 
       1705 1 . . . . . 3.79 0.76 5.68 1 1 
       1706 1 . . . . . 4.43 0.89 6.64 1 1 
       1707 1 . . . . . 3.97 0.79 5.96 1 1 
       1708 1 . . . . . 4.44 0.89 6.66 1 1 
       1709 1 . . . . . 3.87 0.77  5.8 1 1 
       1710 1 . . . . . 3.01  0.6 4.51 1 1 
       1711 1 . . . . . 4.95 0.99 7.42 1 1 
       1712 1 . . . . .  4.8 0.96  7.2 1 1 
       1713 1 . . . . . 3.79 0.76 5.68 1 1 
       1714 1 . . . . . 5.83 1.17 8.74 1 1 
       1715 1 . . . . . 5.69 1.14 8.54 1 1 
       1716 1 . . . . . 3.75 0.75 5.63 1 1 
       1717 1 . . . . . 3.87 0.77  5.8 1 1 
       1718 1 . . . . . 4.94 0.99 7.41 1 1 
       1719 1 . . . . . 3.51  0.7 5.26 1 1 
       1720 1 . . . . .  4.5  0.9 6.75 1 1 
       1721 1 . . . . . 3.91 0.78 5.87 1 1 
       1722 1 . . . . . 4.29 0.86 6.43 1 1 
       1723 1 . . . . . 4.85 0.97 7.27 1 1 
       1724 1 . . . . . 4.03 0.81 6.05 1 1 
       1725 1 . . . . . 4.85 0.97 7.27 1 1 
       1726 1 . . . . . 4.32 0.86 6.48 1 1 
       1727 1 . . . . . 4.17 0.83 6.26 1 1 
       1728 1 . . . . . 4.17 0.83 6.26 1 1 
       1729 1 . . . . . 4.16 0.83 6.24 1 1 
       1730 1 . . . . . 3.81 0.76 5.71 1 1 
       1731 1 . . . . . 4.85 0.97 7.27 1 1 
       1732 1 . . . . . 4.51  0.9 6.77 1 1 
       1733 1 . . . . . 4.44 0.89 6.66 1 1 
       1734 1 . . . . . 4.06 0.81 6.09 1 1 
       1735 1 . . . . . 4.94 0.99 7.41 1 1 
       1736 1 . . . . .  4.2 0.84  6.3 1 1 
       1737 1 . . . . . 4.94 0.99 7.41 1 1 
       1738 1 . . . . . 4.79 0.96 7.18 1 1 
       1739 1 . . . . . 3.75 0.75 5.63 1 1 
       1740 1 . . . . . 5.18 1.04 7.77 1 1 
       1741 1 . . . . . 4.08 0.82 6.12 1 1 
       1742 1 . . . . . 4.42 0.88 6.63 1 1 
       1743 1 . . . . . 3.46 0.69 5.19 1 1 
       1744 1 . . . . . 4.43 0.89 6.64 1 1 
       1745 1 . . . . . 4.44 0.89 6.66 1 1 
       1746 1 . . . . . 4.44 0.89 6.66 1 1 
       1747 1 . . . . . 3.09 0.62 4.63 1 1 
       1748 1 . . . . . 3.86 0.77 5.79 1 1 
       1749 1 . . . . . 3.49  0.7 5.24 1 1 
       1750 1 . . . . . 3.95 0.79 5.93 1 1 
       1751 1 . . . . . 4.86 0.97 7.29 1 1 
       1752 1 . . . . . 4.72 0.94 7.08 1 1 
       1753 1 . . . . . 3.49  0.7 5.24 1 1 
       1754 1 . . . . . 4.58 0.92 6.87 1 1 
       1755 1 . . . . .  5.2 1.04  7.8 1 1 
       1756 1 . . . . . 3.62 0.72 5.43 1 1 
       1757 1 . . . . . 3.37 0.67 5.05 1 1 
       1758 1 . . . . . 4.92 0.98 7.38 1 1 
       1759 1 . . . . . 4.66 0.93 6.99 1 1 
       1760 1 . . . . .  4.7 0.94 7.05 1 1 
       1761 1 . . . . . 5.38 1.08 8.07 1 1 
       1762 1 . . . . . 3.96 0.79 5.94 1 1 
       1763 1 . . . . . 4.64 0.93 6.96 1 1 
       1764 1 . . . . . 4.64 0.93 6.96 1 1 
       1765 1 . . . . . 3.17 0.63 4.76 1 1 
       1766 1 . . . . . 3.86 0.77 5.79 1 1 
       1767 1 . . . . . 3.16 0.63 4.74 1 1 
       1768 1 . . . . . 3.01  0.6 4.51 1 1 
       1769 1 . . . . . 4.73 0.95  7.1 1 1 
       1770 1 . . . . . 3.52  0.7 5.28 1 1 
       1771 1 . . . . . 5.32 1.06 7.98 1 1 
       1772 1 . . . . .  6.2 1.24  9.3 1 1 
       1773 1 . . . . . 3.32 0.66 4.98 1 1 
       1774 1 . . . . .  4.6 0.92  6.9 1 1 
       1775 1 . . . . . 4.07 0.81 6.11 1 1 
       1776 1 . . . . . 3.91 0.78 5.87 1 1 
       1777 1 . . . . . 4.57 0.91 6.86 1 1 
       1778 1 . . . . . 4.32 0.86 6.48 1 1 
       1779 1 . . . . . 3.15 0.63 4.73 1 1 
       1780 1 . . . . . 5.36 1.07 8.04 1 1 
       1781 1 . . . . . 4.46 0.89 6.69 1 1 
       1782 1 . . . . . 3.02  0.6 4.53 1 1 
       1783 1 . . . . . 3.16 0.63 4.74 1 1 
       1784 1 . . . . . 4.54 0.91 6.81 1 1 
       1785 1 . . . . . 4.16 0.83 6.24 1 1 
       1786 1 . . . . . 2.77 0.55 4.15 1 1 
       1787 1 . . . . . 4.59 0.92 6.89 1 1 
       1788 1 . . . . . 3.42 0.68 5.13 1 1 
       1789 1 . . . . . 4.35 0.87 6.52 1 1 
       1790 1 . . . . . 3.16 0.63 4.74 1 1 
       1791 1 . . . . . 2.75 0.55 4.13 1 1 
       1792 1 . . . . . 3.16 0.63 4.74 1 1 
       1793 1 . . . . . 4.72 0.94 7.08 1 1 
       1794 1 . . . . . 3.55 0.71 5.32 1 1 
       1795 1 . . . . . 3.15 0.63 4.73 1 1 
       1796 1 . . . . . 3.92 0.78 5.88 1 1 
       1797 1 . . . . . 4.05 0.81 6.08 1 1 
       1798 1 . . . . . 3.94 0.79 5.91 1 1 
       1799 1 . . . . .  4.0  0.8  6.0 1 1 
       1800 1 . . . . . 3.09 0.62 4.63 1 1 
       1801 1 . . . . .  4.0  0.8  6.0 1 1 
       1802 1 . . . . . 2.93 0.59  4.4 1 1 
       1803 1 . . . . . 5.48  1.1 8.22 1 1 
       1804 1 . . . . . 3.46 0.69 5.19 1 1 
       1805 1 . . . . .  2.9 0.58 4.35 1 1 
       1806 1 . . . . . 3.46 0.69 5.19 1 1 
       1807 1 . . . . . 4.98  1.0 7.47 1 1 
       1808 1 . . . . . 3.96 0.79 5.94 1 1 
       1809 1 . . . . . 3.31 0.66 4.96 1 1 
       1810 1 . . . . . 4.64 0.93 6.96 1 1 
       1811 1 . . . . .  3.9 0.78 5.85 1 1 
       1812 1 . . . . . 4.64 0.93 6.96 1 1 
       1813 1 . . . . .  3.9 0.78 5.85 1 1 
       1814 1 . . . . . 3.33 0.67 4.99 1 1 
       1815 1 . . . . . 4.37 0.87 6.55 1 1 
       1816 1 . . . . . 5.97 1.19 8.95 1 1 
       1817 1 . . . . . 4.47 0.89  6.7 1 1 
       1818 1 . . . . . 2.75 0.55 4.13 1 1 
       1819 1 . . . . . 3.06 0.61 4.59 1 1 
       1820 1 . . . . . 3.63 0.73 5.45 1 1 
       1821 1 . . . . . 4.18 0.84 6.27 1 1 
       1822 1 . . . . . 3.59 0.72 5.38 1 1 
       1823 1 . . . . . 4.59 0.92 6.89 1 1 
       1824 1 . . . . . 4.21 0.84 6.32 1 1 
       1825 1 . . . . . 2.93 0.59  4.4 1 1 
       1826 1 . . . . . 3.68 0.74 5.52 1 1 
       1827 1 . . . . . 3.68 0.74 5.52 1 1 
       1828 1 . . . . . 4.94 0.99 7.41 1 1 
       1829 1 . . . . . 4.15 0.83 6.23 1 1 
       1830 1 . . . . . 3.53 0.71 5.29 1 1 
       1831 1 . . . . . 4.15 0.83 6.23 1 1 
       1832 1 . . . . . 4.43 0.89 6.64 1 1 
       1833 1 . . . . .  4.9 0.98 7.35 1 1 
       1834 1 . . . . . 3.92 0.78 5.88 1 1 
       1835 1 . . . . .  3.4 0.68  5.1 1 1 
       1836 1 . . . . . 3.92 0.78 5.88 1 1 
       1837 1 . . . . . 2.86 0.57 4.29 1 1 
       1838 1 . . . . . 4.71 0.94 7.07 1 1 
       1839 1 . . . . . 3.15 0.63 4.73 1 1 
       1840 1 . . . . . 4.09 0.82 6.14 1 1 
       1841 1 . . . . . 4.09 0.82 6.14 1 1 
       1842 1 . . . . . 5.66 1.13 8.49 1 1 
       1843 1 . . . . . 3.53 0.71 5.29 1 1 
       1844 1 . . . . . 3.53 0.71 5.29 1 1 
       1845 1 . . . . . 4.05 0.81 6.08 1 1 
       1846 1 . . . . . 3.45 0.69 5.18 1 1 
       1847 1 . . . . . 4.62 0.92 6.93 1 1 
       1848 1 . . . . . 2.99  0.6 4.49 1 1 
       1849 1 . . . . .  4.2 0.84  6.3 1 1 
       1850 1 . . . . . 3.45 0.69 5.18 1 1 
       1851 1 . . . . . 3.77 0.75 5.65 1 1 
       1852 1 . . . . . 3.35 0.67 5.02 1 1 
       1853 1 . . . . . 4.66 0.93 6.99 1 1 
       1854 1 . . . . . 3.23 0.65 4.85 1 1 
       1855 1 . . . . . 2.81 0.56 4.21 1 1 
       1856 1 . . . . . 5.08 1.02 7.62 1 1 
       1857 1 . . . . . 3.38 0.68 5.07 1 1 
       1858 1 . . . . . 4.17 0.83 6.26 1 1 
       1859 1 . . . . . 3.09 0.62 4.63 1 1 
       1860 1 . . . . . 4.37 0.87 6.55 1 1 
       1861 1 . . . . . 3.52  0.7 5.28 1 1 
       1862 1 . . . . . 4.37 0.87 6.55 1 1 
       1863 1 . . . . . 5.35 1.07 8.02 1 1 
       1864 1 . . . . .  3.4 0.68  5.1 1 1 
       1865 1 . . . . . 2.94 0.59 4.41 1 1 
       1866 1 . . . . .  3.4 0.68  5.1 1 1 
       1867 1 . . . . . 2.65 0.53 3.98 1 1 
       1868 1 . . . . . 4.68 0.94 7.02 1 1 
       1869 1 . . . . . 4.93 0.99 7.39 1 1 
       1870 1 . . . . . 4.16 0.83 6.24 1 1 
       1871 1 . . . . . 3.82 0.76 5.73 1 1 
       1872 1 . . . . . 4.45 0.89 6.67 1 1 
       1873 1 . . . . . 4.45 0.89 6.67 1 1 
       1874 1 . . . . . 3.76 0.75 5.64 1 1 
       1875 1 . . . . . 3.21 0.64 4.82 1 1 
       1876 1 . . . . . 3.76 0.75 5.64 1 1 
       1877 1 . . . . . 4.24 0.85 6.36 1 1 
       1878 1 . . . . .  4.6 0.92  6.9 1 1 
       1879 1 . . . . . 4.01  0.8 6.02 1 1 
       1880 1 . . . . . 2.72 0.54 4.08 1 1 
       1881 1 . . . . . 4.04 0.81 6.06 1 1 
       1882 1 . . . . . 4.82 0.96 7.23 1 1 
       1883 1 . . . . . 4.82 0.96 7.23 1 1 
       1884 1 . . . . . 3.74 0.75 5.61 1 1 
       1885 1 . . . . . 3.04 0.61 4.56 1 1 
       1886 1 . . . . . 3.74 0.75 5.61 1 1 
       1887 1 . . . . . 4.71 0.94 7.07 1 1 
       1888 1 . . . . .  5.4 1.08  8.1 1 1 
       1889 1 . . . . . 4.63 0.93 6.95 1 1 
       1890 1 . . . . .  5.4 1.08  8.1 1 1 
       1891 1 . . . . . 3.11 0.62 4.66 1 1 
       1892 1 . . . . . 3.58 0.72 5.37 1 1 
       1893 1 . . . . . 4.16 0.83 6.24 1 1 
       1894 1 . . . . . 4.16 0.83 6.24 1 1 
       1895 1 . . . . . 4.59 0.92 6.89 1 1 
       1896 1 . . . . .  5.4 1.08  8.1 1 1 
       1897 1 . . . . .  5.4 1.08  8.1 1 1 
       1898 1 . . . . . 3.86 0.77 5.79 1 1 
       1899 1 . . . . . 4.05 0.81 6.08 1 1 
       1900 1 . . . . .  3.9 0.78 5.85 1 1 
       1901 1 . . . . . 3.05 0.61 4.57 1 1 
       1902 1 . . . . . 4.63 0.93 6.95 1 1 
       1903 1 . . . . . 4.52  0.9 6.78 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1   1 MET C    C -25.905   0.686 -20.842 1.00 . A A .   1 MET C    1 1 
        1     2 1 1   1 MET CA   C -27.197   1.475 -21.117 1.00 . A A .   1 MET CA   1 1 
        1     3 1 1   1 MET CB   C -27.091   2.914 -20.592 1.00 . A A .   1 MET CB   1 1 
        1     4 1 1   1 MET CE   C -24.895   6.246 -21.832 1.00 . A A .   1 MET CE   1 1 
        1     5 1 1   1 MET CG   C -26.113   3.797 -21.356 1.00 . A A .   1 MET CG   1 1 
        1     6 1 1   1 MET H1   H -28.189   0.700 -19.451 1.00 . A A .   1 MET H1   1 1 
        1     7 1 1   1 MET H2   H -28.482  -0.156 -20.883 1.00 . A A .   1 MET H2   1 1 
        1     8 1 1   1 MET H3   H -29.221   1.341 -20.626 1.00 . A A .   1 MET H3   1 1 
        1     9 1 1   1 MET HA   H -27.371   1.495 -22.184 1.00 . A A .   1 MET HA   1 1 
        1    10 1 1   1 MET HB2  H -28.067   3.375 -20.645 1.00 . A A .   1 MET HB2  1 1 
        1    11 1 1   1 MET HB3  H -26.778   2.883 -19.556 1.00 . A A .   1 MET HB3  1 1 
        1    12 1 1   1 MET HE1  H -25.320   6.217 -22.825 1.00 . A A .   1 MET HE1  1 1 
        1    13 1 1   1 MET HE2  H -23.954   5.720 -21.828 1.00 . A A .   1 MET HE2  1 1 
        1    14 1 1   1 MET HE3  H -24.733   7.273 -21.539 1.00 . A A .   1 MET HE3  1 1 
        1    15 1 1   1 MET HG2  H -25.129   3.351 -21.309 1.00 . A A .   1 MET HG2  1 1 
        1    16 1 1   1 MET HG3  H -26.430   3.860 -22.388 1.00 . A A .   1 MET HG3  1 1 
        1    17 1 1   1 MET N    N -28.352   0.794 -20.475 1.00 . A A .   1 MET N    1 1 
        1    18 1 1   1 MET O    O -25.005   1.146 -20.134 1.00 . A A .   1 MET O    1 1 
        1    19 1 1   1 MET SD   S -26.025   5.466 -20.678 1.00 . A A .   1 MET SD   1 1 
        1    20 1 1   2 GLY C    C -23.543  -1.348 -22.025 1.00 . A A .   2 GLY C    1 1 
        1    21 1 1   2 GLY CA   C -24.740  -1.430 -21.083 1.00 . A A .   2 GLY CA   1 1 
        1    22 1 1   2 GLY H    H -26.516  -0.787 -22.051 1.00 . A A .   2 GLY H    1 1 
        1    23 1 1   2 GLY HA2  H -24.399  -1.226 -20.078 1.00 . A A .   2 GLY HA2  1 1 
        1    24 1 1   2 GLY HA3  H -25.127  -2.440 -21.110 1.00 . A A .   2 GLY HA3  1 1 
        1    25 1 1   2 GLY N    N -25.828  -0.516 -21.406 1.00 . A A .   2 GLY N    1 1 
        1    26 1 1   2 GLY O    O -23.493  -2.045 -23.037 1.00 . A A .   2 GLY O    1 1 
        1    27 1 1   3 HIS C    C -20.185  -1.203 -21.675 1.00 . A A .   3 HIS C    1 1 
        1    28 1 1   3 HIS CA   C -21.298  -0.443 -22.425 1.00 . A A .   3 HIS CA   1 1 
        1    29 1 1   3 HIS CB   C -20.887   1.018 -22.676 1.00 . A A .   3 HIS CB   1 1 
        1    30 1 1   3 HIS CD2  C -19.892   2.064 -20.514 1.00 . A A .   3 HIS CD2  1 1 
        1    31 1 1   3 HIS CE1  C -21.611   3.293 -19.938 1.00 . A A .   3 HIS CE1  1 1 
        1    32 1 1   3 HIS CG   C -20.859   1.870 -21.442 1.00 . A A .   3 HIS CG   1 1 
        1    33 1 1   3 HIS H    H -22.722   0.120 -20.943 1.00 . A A .   3 HIS H    1 1 
        1    34 1 1   3 HIS HA   H -21.449  -0.927 -23.382 1.00 . A A .   3 HIS HA   1 1 
        1    35 1 1   3 HIS HB2  H -19.898   1.038 -23.110 1.00 . A A .   3 HIS HB2  1 1 
        1    36 1 1   3 HIS HB3  H -21.583   1.464 -23.371 1.00 . A A .   3 HIS HB3  1 1 
        1    37 1 1   3 HIS HD1  H -22.775   2.751 -21.532 1.00 . A A .   3 HIS HD1  1 1 
        1    38 1 1   3 HIS HD2  H -18.913   1.605 -20.504 1.00 . A A .   3 HIS HD2  1 1 
        1    39 1 1   3 HIS HE1  H -22.252   3.980 -19.405 1.00 . A A .   3 HIS HE1  1 1 
        1    40 1 1   3 HIS HE2  H -19.838   3.445 -18.937 1.00 . A A .   3 HIS HE2  1 1 
        1    41 1 1   3 HIS N    N -22.572  -0.498 -21.688 1.00 . A A .   3 HIS N    1 1 
        1    42 1 1   3 HIS ND1  N -21.921   2.655 -21.049 1.00 . A A .   3 HIS ND1  1 1 
        1    43 1 1   3 HIS NE2  N -20.385   2.953 -19.589 1.00 . A A .   3 HIS NE2  1 1 
        1    44 1 1   3 HIS O    O -18.999  -1.013 -21.941 1.00 . A A .   3 HIS O    1 1 
        1    45 1 1   4 HIS C    C -20.394  -3.942 -19.127 1.00 . A A .   4 HIS C    1 1 
        1    46 1 1   4 HIS CA   C -19.643  -2.879 -19.953 1.00 . A A .   4 HIS CA   1 1 
        1    47 1 1   4 HIS CB   C -18.795  -1.978 -19.039 1.00 . A A .   4 HIS CB   1 1 
        1    48 1 1   4 HIS CD2  C -20.780  -0.615 -18.038 1.00 . A A .   4 HIS CD2  1 1 
        1    49 1 1   4 HIS CE1  C -19.969  -0.323 -16.026 1.00 . A A .   4 HIS CE1  1 1 
        1    50 1 1   4 HIS CG   C -19.571  -1.230 -17.992 1.00 . A A .   4 HIS CG   1 1 
        1    51 1 1   4 HIS H    H -21.548  -2.194 -20.597 1.00 . A A .   4 HIS H    1 1 
        1    52 1 1   4 HIS HA   H -18.989  -3.387 -20.648 1.00 . A A .   4 HIS HA   1 1 
        1    53 1 1   4 HIS HB2  H -18.063  -2.585 -18.532 1.00 . A A .   4 HIS HB2  1 1 
        1    54 1 1   4 HIS HB3  H -18.279  -1.248 -19.651 1.00 . A A .   4 HIS HB3  1 1 
        1    55 1 1   4 HIS HD1  H -18.236  -1.350 -16.365 1.00 . A A .   4 HIS HD1  1 1 
        1    56 1 1   4 HIS HD2  H -21.448  -0.576 -18.887 1.00 . A A .   4 HIS HD2  1 1 
        1    57 1 1   4 HIS HE1  H -19.862  -0.018 -14.995 1.00 . A A .   4 HIS HE1  1 1 
        1    58 1 1   4 HIS HE2  H -21.712   0.581 -16.588 1.00 . A A .   4 HIS HE2  1 1 
        1    59 1 1   4 HIS N    N -20.587  -2.074 -20.745 1.00 . A A .   4 HIS N    1 1 
        1    60 1 1   4 HIS ND1  N -19.095  -1.025 -16.715 1.00 . A A .   4 HIS ND1  1 1 
        1    61 1 1   4 HIS NE2  N -20.999  -0.059 -16.802 1.00 . A A .   4 HIS NE2  1 1 
        1    62 1 1   4 HIS O    O -21.528  -3.714 -18.702 1.00 . A A .   4 HIS O    1 1 
        1    63 1 1   5 HIS C    C -20.337  -6.110 -16.692 1.00 . A A .   5 HIS C    1 1 
        1    64 1 1   5 HIS CA   C -20.422  -6.225 -18.225 1.00 . A A .   5 HIS CA   1 1 
        1    65 1 1   5 HIS CB   C -19.798  -7.552 -18.694 1.00 . A A .   5 HIS CB   1 1 
        1    66 1 1   5 HIS CD2  C -21.659  -9.321 -19.080 1.00 . A A .   5 HIS CD2  1 1 
        1    67 1 1   5 HIS CE1  C -21.331 -10.540 -17.295 1.00 . A A .   5 HIS CE1  1 1 
        1    68 1 1   5 HIS CG   C -20.637  -8.761 -18.390 1.00 . A A .   5 HIS CG   1 1 
        1    69 1 1   5 HIS H    H -18.819  -5.183 -19.169 1.00 . A A .   5 HIS H    1 1 
        1    70 1 1   5 HIS HA   H -21.464  -6.210 -18.515 1.00 . A A .   5 HIS HA   1 1 
        1    71 1 1   5 HIS HB2  H -19.653  -7.515 -19.764 1.00 . A A .   5 HIS HB2  1 1 
        1    72 1 1   5 HIS HB3  H -18.839  -7.681 -18.213 1.00 . A A .   5 HIS HB3  1 1 
        1    73 1 1   5 HIS HD1  H -19.796  -9.411 -16.564 1.00 . A A .   5 HIS HD1  1 1 
        1    74 1 1   5 HIS HD2  H -22.073  -8.967 -20.014 1.00 . A A .   5 HIS HD2  1 1 
        1    75 1 1   5 HIS HE1  H -21.425 -11.314 -16.547 1.00 . A A .   5 HIS HE1  1 1 
        1    76 1 1   5 HIS HE2  H -22.642 -11.137 -18.738 1.00 . A A .   5 HIS HE2  1 1 
        1    77 1 1   5 HIS N    N -19.757  -5.092 -18.894 1.00 . A A .   5 HIS N    1 1 
        1    78 1 1   5 HIS ND1  N -20.460  -9.552 -17.274 1.00 . A A .   5 HIS ND1  1 1 
        1    79 1 1   5 HIS NE2  N -22.070 -10.425 -18.377 1.00 . A A .   5 HIS NE2  1 1 
        1    80 1 1   5 HIS O    O -19.464  -5.428 -16.156 1.00 . A A .   5 HIS O    1 1 
        1    81 1 1   6 HIS C    C -20.776  -8.077 -13.921 1.00 . A A .   6 HIS C    1 1 
        1    82 1 1   6 HIS CA   C -21.284  -6.753 -14.521 1.00 . A A .   6 HIS CA   1 1 
        1    83 1 1   6 HIS CB   C -22.712  -6.477 -14.039 1.00 . A A .   6 HIS CB   1 1 
        1    84 1 1   6 HIS CD2  C -23.461  -4.000 -14.225 1.00 . A A .   6 HIS CD2  1 1 
        1    85 1 1   6 HIS CE1  C -24.352  -4.086 -16.225 1.00 . A A .   6 HIS CE1  1 1 
        1    86 1 1   6 HIS CG   C -23.330  -5.269 -14.673 1.00 . A A .   6 HIS CG   1 1 
        1    87 1 1   6 HIS H    H -21.927  -7.311 -16.468 1.00 . A A .   6 HIS H    1 1 
        1    88 1 1   6 HIS HA   H -20.640  -5.950 -14.186 1.00 . A A .   6 HIS HA   1 1 
        1    89 1 1   6 HIS HB2  H -23.336  -7.329 -14.270 1.00 . A A .   6 HIS HB2  1 1 
        1    90 1 1   6 HIS HB3  H -22.704  -6.325 -12.969 1.00 . A A .   6 HIS HB3  1 1 
        1    91 1 1   6 HIS HD1  H -23.964  -6.068 -16.521 1.00 . A A .   6 HIS HD1  1 1 
        1    92 1 1   6 HIS HD2  H -23.124  -3.618 -13.274 1.00 . A A .   6 HIS HD2  1 1 
        1    93 1 1   6 HIS HE1  H -24.848  -3.806 -17.143 1.00 . A A .   6 HIS HE1  1 1 
        1    94 1 1   6 HIS HE2  H -24.425  -2.365 -15.124 1.00 . A A .   6 HIS HE2  1 1 
        1    95 1 1   6 HIS N    N -21.252  -6.782 -15.990 1.00 . A A .   6 HIS N    1 1 
        1    96 1 1   6 HIS ND1  N -23.901  -5.288 -15.928 1.00 . A A .   6 HIS ND1  1 1 
        1    97 1 1   6 HIS NE2  N -24.100  -3.287 -15.210 1.00 . A A .   6 HIS NE2  1 1 
        1    98 1 1   6 HIS O    O -20.690  -9.090 -14.616 1.00 . A A .   6 HIS O    1 1 
        1    99 1 1   7 HIS C    C -19.991  -9.042 -10.408 1.00 . A A .   7 HIS C    1 1 
        1   100 1 1   7 HIS CA   C -19.985  -9.266 -11.930 1.00 . A A .   7 HIS CA   1 1 
        1   101 1 1   7 HIS CB   C -18.579  -9.664 -12.407 1.00 . A A .   7 HIS CB   1 1 
        1   102 1 1   7 HIS CD2  C -18.615 -12.233 -11.983 1.00 . A A .   7 HIS CD2  1 1 
        1   103 1 1   7 HIS CE1  C -16.802 -12.375 -10.761 1.00 . A A .   7 HIS CE1  1 1 
        1   104 1 1   7 HIS CG   C -18.105 -10.979 -11.861 1.00 . A A .   7 HIS CG   1 1 
        1   105 1 1   7 HIS H    H -20.495  -7.212 -12.139 1.00 . A A .   7 HIS H    1 1 
        1   106 1 1   7 HIS HA   H -20.676 -10.065 -12.164 1.00 . A A .   7 HIS HA   1 1 
        1   107 1 1   7 HIS HB2  H -18.578  -9.736 -13.484 1.00 . A A .   7 HIS HB2  1 1 
        1   108 1 1   7 HIS HB3  H -17.872  -8.903 -12.104 1.00 . A A .   7 HIS HB3  1 1 
        1   109 1 1   7 HIS HD1  H -16.367 -10.380 -10.828 1.00 . A A .   7 HIS HD1  1 1 
        1   110 1 1   7 HIS HD2  H -19.507 -12.514 -12.526 1.00 . A A .   7 HIS HD2  1 1 
        1   111 1 1   7 HIS HE1  H -15.997 -12.770 -10.162 1.00 . A A .   7 HIS HE1  1 1 
        1   112 1 1   7 HIS HE2  H -17.943 -14.032 -11.131 1.00 . A A .   7 HIS HE2  1 1 
        1   113 1 1   7 HIS N    N -20.440  -8.059 -12.632 1.00 . A A .   7 HIS N    1 1 
        1   114 1 1   7 HIS ND1  N -16.971 -11.110 -11.090 1.00 . A A .   7 HIS ND1  1 1 
        1   115 1 1   7 HIS NE2  N -17.784 -13.076 -11.289 1.00 . A A .   7 HIS NE2  1 1 
        1   116 1 1   7 HIS O    O -19.258  -8.196  -9.892 1.00 . A A .   7 HIS O    1 1 
        1   117 1 1   8 HIS C    C -19.875 -10.383  -7.458 1.00 . A A .   8 HIS C    1 1 
        1   118 1 1   8 HIS CA   C -20.971  -9.638  -8.241 1.00 . A A .   8 HIS CA   1 1 
        1   119 1 1   8 HIS CB   C -22.355 -10.131  -7.794 1.00 . A A .   8 HIS CB   1 1 
        1   120 1 1   8 HIS CD2  C -24.234  -9.765  -9.557 1.00 . A A .   8 HIS CD2  1 1 
        1   121 1 1   8 HIS CE1  C -24.980  -7.841  -8.825 1.00 . A A .   8 HIS CE1  1 1 
        1   122 1 1   8 HIS CG   C -23.492  -9.425  -8.474 1.00 . A A .   8 HIS CG   1 1 
        1   123 1 1   8 HIS H    H -21.325 -10.512 -10.148 1.00 . A A .   8 HIS H    1 1 
        1   124 1 1   8 HIS HA   H -20.894  -8.582  -8.022 1.00 . A A .   8 HIS HA   1 1 
        1   125 1 1   8 HIS HB2  H -22.442 -11.186  -8.008 1.00 . A A .   8 HIS HB2  1 1 
        1   126 1 1   8 HIS HB3  H -22.458  -9.976  -6.727 1.00 . A A .   8 HIS HB3  1 1 
        1   127 1 1   8 HIS HD1  H -23.660  -7.701  -7.276 1.00 . A A .   8 HIS HD1  1 1 
        1   128 1 1   8 HIS HD2  H -24.124 -10.658 -10.158 1.00 . A A .   8 HIS HD2  1 1 
        1   129 1 1   8 HIS HE1  H -25.556  -6.934  -8.722 1.00 . A A .   8 HIS HE1  1 1 
        1   130 1 1   8 HIS HE2  H -25.927  -8.812 -10.350 1.00 . A A .   8 HIS HE2  1 1 
        1   131 1 1   8 HIS N    N -20.816  -9.807  -9.693 1.00 . A A .   8 HIS N    1 1 
        1   132 1 1   8 HIS ND1  N -23.987  -8.215  -8.044 1.00 . A A .   8 HIS ND1  1 1 
        1   133 1 1   8 HIS NE2  N -25.150  -8.761  -9.751 1.00 . A A .   8 HIS NE2  1 1 
        1   134 1 1   8 HIS O    O -19.832 -11.613  -7.448 1.00 . A A .   8 HIS O    1 1 
        1   135 1 1   9 SER C    C -17.455  -9.169  -4.923 1.00 . A A .   9 SER C    1 1 
        1   136 1 1   9 SER CA   C -17.922 -10.189  -5.971 1.00 . A A .   9 SER CA   1 1 
        1   137 1 1   9 SER CB   C -16.717 -10.630  -6.821 1.00 . A A .   9 SER CB   1 1 
        1   138 1 1   9 SER H    H -19.051  -8.648  -6.905 1.00 . A A .   9 SER H    1 1 
        1   139 1 1   9 SER HA   H -18.325 -11.051  -5.458 1.00 . A A .   9 SER HA   1 1 
        1   140 1 1   9 SER HB2  H -16.369  -9.795  -7.411 1.00 . A A .   9 SER HB2  1 1 
        1   141 1 1   9 SER HB3  H -15.921 -10.962  -6.169 1.00 . A A .   9 SER HB3  1 1 
        1   142 1 1   9 SER HG   H -17.742 -12.241  -7.296 1.00 . A A .   9 SER HG   1 1 
        1   143 1 1   9 SER N    N -18.990  -9.622  -6.813 1.00 . A A .   9 SER N    1 1 
        1   144 1 1   9 SER O    O -17.444  -7.965  -5.181 1.00 . A A .   9 SER O    1 1 
        1   145 1 1   9 SER OG   O -17.052 -11.696  -7.702 1.00 . A A .   9 SER OG   1 1 
        1   146 1 1  10 HIS C    C -15.072  -8.441  -2.896 1.00 . A A .  10 HIS C    1 1 
        1   147 1 1  10 HIS CA   C -16.556  -8.771  -2.684 1.00 . A A .  10 HIS CA   1 1 
        1   148 1 1  10 HIS CB   C -16.749  -9.407  -1.298 1.00 . A A .  10 HIS CB   1 1 
        1   149 1 1  10 HIS CD2  C -19.130 -10.414  -1.039 1.00 . A A .  10 HIS CD2  1 1 
        1   150 1 1  10 HIS CE1  C -20.013  -8.815   0.166 1.00 . A A .  10 HIS CE1  1 1 
        1   151 1 1  10 HIS CG   C -18.175  -9.472  -0.848 1.00 . A A .  10 HIS CG   1 1 
        1   152 1 1  10 HIS H    H -17.108 -10.618  -3.585 1.00 . A A .  10 HIS H    1 1 
        1   153 1 1  10 HIS HA   H -17.121  -7.849  -2.723 1.00 . A A .  10 HIS HA   1 1 
        1   154 1 1  10 HIS HB2  H -16.361 -10.414  -1.314 1.00 . A A .  10 HIS HB2  1 1 
        1   155 1 1  10 HIS HB3  H -16.198  -8.830  -0.566 1.00 . A A .  10 HIS HB3  1 1 
        1   156 1 1  10 HIS HD1  H -18.331  -7.657   0.214 1.00 . A A .  10 HIS HD1  1 1 
        1   157 1 1  10 HIS HD2  H -19.021 -11.336  -1.594 1.00 . A A .  10 HIS HD2  1 1 
        1   158 1 1  10 HIS HE1  H -20.715  -8.227   0.739 1.00 . A A .  10 HIS HE1  1 1 
        1   159 1 1  10 HIS HE2  H -21.158 -10.367  -0.501 1.00 . A A .  10 HIS HE2  1 1 
        1   160 1 1  10 HIS N    N -17.065  -9.651  -3.744 1.00 . A A .  10 HIS N    1 1 
        1   161 1 1  10 HIS ND1  N -18.765  -8.485  -0.090 1.00 . A A .  10 HIS ND1  1 1 
        1   162 1 1  10 HIS NE2  N -20.261  -9.978  -0.397 1.00 . A A .  10 HIS NE2  1 1 
        1   163 1 1  10 HIS O    O -14.197  -9.105  -2.341 1.00 . A A .  10 HIS O    1 1 
        1   164 1 1  11 MET C    C -12.873  -6.212  -2.743 1.00 . A A .  11 MET C    1 1 
        1   165 1 1  11 MET CA   C -13.414  -6.988  -3.952 1.00 . A A .  11 MET CA   1 1 
        1   166 1 1  11 MET CB   C -13.333  -6.137  -5.226 1.00 . A A .  11 MET CB   1 1 
        1   167 1 1  11 MET CE   C -13.498  -8.984  -8.283 1.00 . A A .  11 MET CE   1 1 
        1   168 1 1  11 MET CG   C -13.760  -6.883  -6.482 1.00 . A A .  11 MET CG   1 1 
        1   169 1 1  11 MET H    H -15.529  -6.966  -4.170 1.00 . A A .  11 MET H    1 1 
        1   170 1 1  11 MET HA   H -12.809  -7.875  -4.088 1.00 . A A .  11 MET HA   1 1 
        1   171 1 1  11 MET HB2  H -13.972  -5.272  -5.110 1.00 . A A .  11 MET HB2  1 1 
        1   172 1 1  11 MET HB3  H -12.313  -5.804  -5.359 1.00 . A A .  11 MET HB3  1 1 
        1   173 1 1  11 MET HE1  H -13.343  -8.248  -9.059 1.00 . A A .  11 MET HE1  1 1 
        1   174 1 1  11 MET HE2  H -14.557  -9.154  -8.155 1.00 . A A .  11 MET HE2  1 1 
        1   175 1 1  11 MET HE3  H -13.015  -9.910  -8.563 1.00 . A A .  11 MET HE3  1 1 
        1   176 1 1  11 MET HG2  H -14.803  -7.151  -6.392 1.00 . A A .  11 MET HG2  1 1 
        1   177 1 1  11 MET HG3  H -13.629  -6.234  -7.335 1.00 . A A .  11 MET HG3  1 1 
        1   178 1 1  11 MET N    N -14.794  -7.426  -3.713 1.00 . A A .  11 MET N    1 1 
        1   179 1 1  11 MET O    O -12.745  -4.984  -2.767 1.00 . A A .  11 MET O    1 1 
        1   180 1 1  11 MET SD   S -12.798  -8.386  -6.746 1.00 . A A .  11 MET SD   1 1 
        1   181 1 1  12 THR C    C -11.465  -7.401   0.489 1.00 . A A .  12 THR C    1 1 
        1   182 1 1  12 THR CA   C -12.133  -6.355  -0.412 1.00 . A A .  12 THR CA   1 1 
        1   183 1 1  12 THR CB   C -13.309  -5.696   0.358 1.00 . A A .  12 THR CB   1 1 
        1   184 1 1  12 THR CG2  C -14.389  -6.722   0.704 1.00 . A A .  12 THR CG2  1 1 
        1   185 1 1  12 THR H    H -12.650  -7.927  -1.741 1.00 . A A .  12 THR H    1 1 
        1   186 1 1  12 THR HA   H -11.409  -5.586  -0.646 1.00 . A A .  12 THR HA   1 1 
        1   187 1 1  12 THR HB   H -13.748  -4.934  -0.273 1.00 . A A .  12 THR HB   1 1 
        1   188 1 1  12 THR HG1  H -13.560  -4.639   2.012 1.00 . A A .  12 THR HG1  1 1 
        1   189 1 1  12 THR HG21 H -14.765  -7.169  -0.205 1.00 . A A .  12 THR HG21 1 1 
        1   190 1 1  12 THR HG22 H -15.199  -6.235   1.226 1.00 . A A .  12 THR HG22 1 1 
        1   191 1 1  12 THR HG23 H -13.968  -7.492   1.335 1.00 . A A .  12 THR HG23 1 1 
        1   192 1 1  12 THR N    N -12.578  -6.948  -1.676 1.00 . A A .  12 THR N    1 1 
        1   193 1 1  12 THR O    O -11.514  -8.602   0.211 1.00 . A A .  12 THR O    1 1 
        1   194 1 1  12 THR OG1  O -12.827  -5.078   1.562 1.00 . A A .  12 THR OG1  1 1 
        1   195 1 1  13 GLY C    C  -9.642  -7.198   3.744 1.00 . A A .  13 GLY C    1 1 
        1   196 1 1  13 GLY CA   C -10.158  -7.860   2.473 1.00 . A A .  13 GLY CA   1 1 
        1   197 1 1  13 GLY H    H -10.892  -5.988   1.786 1.00 . A A .  13 GLY H    1 1 
        1   198 1 1  13 GLY HA2  H -10.832  -8.658   2.751 1.00 . A A .  13 GLY HA2  1 1 
        1   199 1 1  13 GLY HA3  H  -9.319  -8.288   1.942 1.00 . A A .  13 GLY HA3  1 1 
        1   200 1 1  13 GLY N    N -10.857  -6.947   1.580 1.00 . A A .  13 GLY N    1 1 
        1   201 1 1  13 GLY O    O  -9.623  -5.972   3.857 1.00 . A A .  13 GLY O    1 1 
        1   202 1 1  14 ASN C    C  -7.199  -7.153   5.827 1.00 . A A .  14 ASN C    1 1 
        1   203 1 1  14 ASN CA   C  -8.685  -7.515   5.977 1.00 . A A .  14 ASN CA   1 1 
        1   204 1 1  14 ASN CB   C  -8.888  -8.569   7.080 1.00 . A A .  14 ASN CB   1 1 
        1   205 1 1  14 ASN CG   C  -8.759  -8.028   8.504 1.00 . A A .  14 ASN CG   1 1 
        1   206 1 1  14 ASN H    H  -9.238  -8.983   4.549 1.00 . A A .  14 ASN H    1 1 
        1   207 1 1  14 ASN HA   H  -9.237  -6.621   6.238 1.00 . A A .  14 ASN HA   1 1 
        1   208 1 1  14 ASN HB2  H  -9.875  -8.997   6.976 1.00 . A A .  14 ASN HB2  1 1 
        1   209 1 1  14 ASN HB3  H  -8.156  -9.355   6.949 1.00 . A A .  14 ASN HB3  1 1 
        1   210 1 1  14 ASN HD21 H  -7.311  -6.770   7.998 1.00 . A A .  14 ASN HD21 1 1 
        1   211 1 1  14 ASN HD22 H  -7.784  -6.751   9.653 1.00 . A A .  14 ASN HD22 1 1 
        1   212 1 1  14 ASN N    N  -9.212  -8.017   4.704 1.00 . A A .  14 ASN N    1 1 
        1   213 1 1  14 ASN ND2  N  -7.863  -7.087   8.737 1.00 . A A .  14 ASN ND2  1 1 
        1   214 1 1  14 ASN O    O  -6.320  -7.801   6.404 1.00 . A A .  14 ASN O    1 1 
        1   215 1 1  14 ASN OD1  O  -9.458  -8.478   9.403 1.00 . A A .  14 ASN OD1  1 1 
        1   216 1 1  15 VAL C    C  -5.205  -4.459   5.680 1.00 . A A .  15 VAL C    1 1 
        1   217 1 1  15 VAL CA   C  -5.563  -5.663   4.792 1.00 . A A .  15 VAL CA   1 1 
        1   218 1 1  15 VAL CB   C  -5.353  -5.297   3.297 1.00 . A A .  15 VAL CB   1 1 
        1   219 1 1  15 VAL CG1  C  -6.293  -4.176   2.861 1.00 . A A .  15 VAL CG1  1 1 
        1   220 1 1  15 VAL CG2  C  -3.895  -4.927   3.026 1.00 . A A .  15 VAL CG2  1 1 
        1   221 1 1  15 VAL H    H  -7.678  -5.647   4.608 1.00 . A A .  15 VAL H    1 1 
        1   222 1 1  15 VAL HA   H  -4.893  -6.480   5.032 1.00 . A A .  15 VAL HA   1 1 
        1   223 1 1  15 VAL HB   H  -5.589  -6.172   2.705 1.00 . A A .  15 VAL HB   1 1 
        1   224 1 1  15 VAL HG11 H  -6.145  -3.968   1.811 1.00 . A A .  15 VAL HG11 1 1 
        1   225 1 1  15 VAL HG12 H  -6.087  -3.284   3.437 1.00 . A A .  15 VAL HG12 1 1 
        1   226 1 1  15 VAL HG13 H  -7.316  -4.481   3.025 1.00 . A A .  15 VAL HG13 1 1 
        1   227 1 1  15 VAL HG21 H  -3.618  -4.075   3.632 1.00 . A A .  15 VAL HG21 1 1 
        1   228 1 1  15 VAL HG22 H  -3.774  -4.679   1.980 1.00 . A A .  15 VAL HG22 1 1 
        1   229 1 1  15 VAL HG23 H  -3.259  -5.764   3.273 1.00 . A A .  15 VAL HG23 1 1 
        1   230 1 1  15 VAL N    N  -6.932  -6.120   5.039 1.00 . A A .  15 VAL N    1 1 
        1   231 1 1  15 VAL O    O  -5.996  -3.525   5.839 1.00 . A A .  15 VAL O    1 1 
        1   232 1 1  16 CYS C    C  -2.133  -2.949   6.697 1.00 . A A .  16 CYS C    1 1 
        1   233 1 1  16 CYS CA   C  -3.529  -3.413   7.132 1.00 . A A .  16 CYS CA   1 1 
        1   234 1 1  16 CYS CB   C  -3.487  -3.877   8.597 1.00 . A A .  16 CYS CB   1 1 
        1   235 1 1  16 CYS H    H  -3.442  -5.280   6.127 1.00 . A A .  16 CYS H    1 1 
        1   236 1 1  16 CYS HA   H  -4.213  -2.581   7.046 1.00 . A A .  16 CYS HA   1 1 
        1   237 1 1  16 CYS HB2  H  -2.817  -4.719   8.682 1.00 . A A .  16 CYS HB2  1 1 
        1   238 1 1  16 CYS HB3  H  -3.123  -3.069   9.214 1.00 . A A .  16 CYS HB3  1 1 
        1   239 1 1  16 CYS HG   H  -5.897  -3.339   9.229 1.00 . A A .  16 CYS HG   1 1 
        1   240 1 1  16 CYS N    N  -4.013  -4.497   6.268 1.00 . A A .  16 CYS N    1 1 
        1   241 1 1  16 CYS O    O  -1.319  -3.747   6.234 1.00 . A A .  16 CYS O    1 1 
        1   242 1 1  16 CYS SG   S  -5.092  -4.393   9.257 1.00 . A A .  16 CYS SG   1 1 
        1   243 1 1  17 ILE C    C   0.492  -1.512   7.565 1.00 . A A .  17 ILE C    1 1 
        1   244 1 1  17 ILE CA   C  -0.548  -1.099   6.511 1.00 . A A .  17 ILE CA   1 1 
        1   245 1 1  17 ILE CB   C  -0.603   0.449   6.426 1.00 . A A .  17 ILE CB   1 1 
        1   246 1 1  17 ILE CD1  C  -1.947   2.390   5.441 1.00 . A A .  17 ILE CD1  1 1 
        1   247 1 1  17 ILE CG1  C  -1.713   0.895   5.459 1.00 . A A .  17 ILE CG1  1 1 
        1   248 1 1  17 ILE CG2  C   0.751   1.014   5.988 1.00 . A A .  17 ILE CG2  1 1 
        1   249 1 1  17 ILE H    H  -2.567  -1.057   7.168 1.00 . A A .  17 ILE H    1 1 
        1   250 1 1  17 ILE HA   H  -0.248  -1.486   5.545 1.00 . A A .  17 ILE HA   1 1 
        1   251 1 1  17 ILE HB   H  -0.821   0.832   7.414 1.00 . A A .  17 ILE HB   1 1 
        1   252 1 1  17 ILE HD11 H  -1.040   2.895   5.142 1.00 . A A .  17 ILE HD11 1 1 
        1   253 1 1  17 ILE HD12 H  -2.237   2.724   6.427 1.00 . A A .  17 ILE HD12 1 1 
        1   254 1 1  17 ILE HD13 H  -2.734   2.623   4.737 1.00 . A A .  17 ILE HD13 1 1 
        1   255 1 1  17 ILE HG12 H  -1.452   0.591   4.456 1.00 . A A .  17 ILE HG12 1 1 
        1   256 1 1  17 ILE HG13 H  -2.641   0.418   5.740 1.00 . A A .  17 ILE HG13 1 1 
        1   257 1 1  17 ILE HG21 H   1.517   0.692   6.678 1.00 . A A .  17 ILE HG21 1 1 
        1   258 1 1  17 ILE HG22 H   0.707   2.094   5.981 1.00 . A A .  17 ILE HG22 1 1 
        1   259 1 1  17 ILE HG23 H   0.988   0.658   4.995 1.00 . A A .  17 ILE HG23 1 1 
        1   260 1 1  17 ILE N    N  -1.865  -1.655   6.839 1.00 . A A .  17 ILE N    1 1 
        1   261 1 1  17 ILE O    O   0.560  -0.919   8.643 1.00 . A A .  17 ILE O    1 1 
        1   262 1 1  18 GLU C    C   3.343  -1.966   8.513 1.00 . A A .  18 GLU C    1 1 
        1   263 1 1  18 GLU CA   C   2.297  -3.040   8.198 1.00 . A A .  18 GLU CA   1 1 
        1   264 1 1  18 GLU CB   C   3.018  -4.278   7.639 1.00 . A A .  18 GLU CB   1 1 
        1   265 1 1  18 GLU CD   C   5.052  -5.801   7.924 1.00 . A A .  18 GLU CD   1 1 
        1   266 1 1  18 GLU CG   C   4.090  -4.828   8.587 1.00 . A A .  18 GLU CG   1 1 
        1   267 1 1  18 GLU H    H   1.189  -2.969   6.382 1.00 . A A .  18 GLU H    1 1 
        1   268 1 1  18 GLU HA   H   1.790  -3.314   9.114 1.00 . A A .  18 GLU HA   1 1 
        1   269 1 1  18 GLU HB2  H   2.288  -5.055   7.458 1.00 . A A .  18 GLU HB2  1 1 
        1   270 1 1  18 GLU HB3  H   3.491  -4.016   6.704 1.00 . A A .  18 GLU HB3  1 1 
        1   271 1 1  18 GLU HG2  H   4.663  -3.999   8.980 1.00 . A A .  18 GLU HG2  1 1 
        1   272 1 1  18 GLU HG3  H   3.598  -5.333   9.407 1.00 . A A .  18 GLU HG3  1 1 
        1   273 1 1  18 GLU N    N   1.285  -2.539   7.257 1.00 . A A .  18 GLU N    1 1 
        1   274 1 1  18 GLU O    O   3.556  -1.606   9.673 1.00 . A A .  18 GLU O    1 1 
        1   275 1 1  18 GLU OE1  O   6.049  -5.339   7.322 1.00 . A A .  18 GLU OE1  1 1 
        1   276 1 1  18 GLU OE2  O   4.835  -7.030   8.025 1.00 . A A .  18 GLU OE2  1 1 
        1   277 1 1  19 GLU C    C   5.411   0.201   6.297 1.00 . A A .  19 GLU C    1 1 
        1   278 1 1  19 GLU CA   C   5.086  -0.506   7.622 1.00 . A A .  19 GLU CA   1 1 
        1   279 1 1  19 GLU CB   C   6.325  -1.245   8.148 1.00 . A A .  19 GLU CB   1 1 
        1   280 1 1  19 GLU CD   C   8.764  -1.171   8.809 1.00 . A A .  19 GLU CD   1 1 
        1   281 1 1  19 GLU CG   C   7.582  -0.387   8.260 1.00 . A A .  19 GLU CG   1 1 
        1   282 1 1  19 GLU H    H   3.727  -1.741   6.565 1.00 . A A .  19 GLU H    1 1 
        1   283 1 1  19 GLU HA   H   4.784   0.235   8.350 1.00 . A A .  19 GLU HA   1 1 
        1   284 1 1  19 GLU HB2  H   6.100  -1.638   9.131 1.00 . A A .  19 GLU HB2  1 1 
        1   285 1 1  19 GLU HB3  H   6.539  -2.073   7.486 1.00 . A A .  19 GLU HB3  1 1 
        1   286 1 1  19 GLU HG2  H   7.839  -0.014   7.279 1.00 . A A .  19 GLU HG2  1 1 
        1   287 1 1  19 GLU HG3  H   7.376   0.446   8.920 1.00 . A A .  19 GLU HG3  1 1 
        1   288 1 1  19 GLU N    N   3.990  -1.460   7.467 1.00 . A A .  19 GLU N    1 1 
        1   289 1 1  19 GLU O    O   5.326  -0.396   5.221 1.00 . A A .  19 GLU O    1 1 
        1   290 1 1  19 GLU OE1  O   9.175  -2.159   8.165 1.00 . A A .  19 GLU OE1  1 1 
        1   291 1 1  19 GLU OE2  O   9.274  -0.814   9.894 1.00 . A A .  19 GLU OE2  1 1 
        1   292 1 1  20 ILE C    C   7.733   2.376   5.217 1.00 . A A .  20 ILE C    1 1 
        1   293 1 1  20 ILE CA   C   6.204   2.244   5.212 1.00 . A A .  20 ILE CA   1 1 
        1   294 1 1  20 ILE CB   C   5.564   3.654   5.193 1.00 . A A .  20 ILE CB   1 1 
        1   295 1 1  20 ILE CD1  C   3.337   4.887   5.451 1.00 . A A .  20 ILE CD1  1 1 
        1   296 1 1  20 ILE CG1  C   4.034   3.549   5.319 1.00 . A A .  20 ILE CG1  1 1 
        1   297 1 1  20 ILE CG2  C   5.951   4.398   3.913 1.00 . A A .  20 ILE CG2  1 1 
        1   298 1 1  20 ILE H    H   5.735   1.923   7.254 1.00 . A A .  20 ILE H    1 1 
        1   299 1 1  20 ILE HA   H   5.895   1.712   4.321 1.00 . A A .  20 ILE HA   1 1 
        1   300 1 1  20 ILE HB   H   5.950   4.213   6.035 1.00 . A A .  20 ILE HB   1 1 
        1   301 1 1  20 ILE HD11 H   3.540   5.487   4.576 1.00 . A A .  20 ILE HD11 1 1 
        1   302 1 1  20 ILE HD12 H   3.701   5.399   6.330 1.00 . A A .  20 ILE HD12 1 1 
        1   303 1 1  20 ILE HD13 H   2.272   4.731   5.542 1.00 . A A .  20 ILE HD13 1 1 
        1   304 1 1  20 ILE HG12 H   3.636   3.057   4.443 1.00 . A A .  20 ILE HG12 1 1 
        1   305 1 1  20 ILE HG13 H   3.790   2.962   6.194 1.00 . A A .  20 ILE HG13 1 1 
        1   306 1 1  20 ILE HG21 H   5.590   3.851   3.054 1.00 . A A .  20 ILE HG21 1 1 
        1   307 1 1  20 ILE HG22 H   7.027   4.484   3.857 1.00 . A A .  20 ILE HG22 1 1 
        1   308 1 1  20 ILE HG23 H   5.515   5.385   3.921 1.00 . A A .  20 ILE HG23 1 1 
        1   309 1 1  20 ILE N    N   5.765   1.479   6.381 1.00 . A A .  20 ILE N    1 1 
        1   310 1 1  20 ILE O    O   8.335   2.602   6.268 1.00 . A A .  20 ILE O    1 1 
        1   311 1 1  21 ASP C    C  10.416   3.580   4.494 1.00 . A A .  21 ASP C    1 1 
        1   312 1 1  21 ASP CA   C   9.819   2.269   3.943 1.00 . A A .  21 ASP CA   1 1 
        1   313 1 1  21 ASP CB   C  10.242   2.071   2.489 1.00 . A A .  21 ASP CB   1 1 
        1   314 1 1  21 ASP CG   C  11.742   2.179   2.316 1.00 . A A .  21 ASP CG   1 1 
        1   315 1 1  21 ASP H    H   7.823   2.110   3.234 1.00 . A A .  21 ASP H    1 1 
        1   316 1 1  21 ASP HA   H  10.204   1.444   4.529 1.00 . A A .  21 ASP HA   1 1 
        1   317 1 1  21 ASP HB2  H   9.928   1.090   2.157 1.00 . A A .  21 ASP HB2  1 1 
        1   318 1 1  21 ASP HB3  H   9.766   2.824   1.873 1.00 . A A .  21 ASP HB3  1 1 
        1   319 1 1  21 ASP N    N   8.355   2.236   4.048 1.00 . A A .  21 ASP N    1 1 
        1   320 1 1  21 ASP O    O   9.928   4.672   4.197 1.00 . A A .  21 ASP O    1 1 
        1   321 1 1  21 ASP OD1  O  12.466   1.278   2.780 1.00 . A A .  21 ASP OD1  1 1 
        1   322 1 1  21 ASP OD2  O  12.199   3.175   1.732 1.00 . A A .  21 ASP OD2  1 1 
        1   323 1 1  22 VAL C    C  12.837   5.544   4.937 1.00 . A A .  22 VAL C    1 1 
        1   324 1 1  22 VAL CA   C  12.126   4.604   5.934 1.00 . A A .  22 VAL CA   1 1 
        1   325 1 1  22 VAL CB   C  13.140   4.133   7.009 1.00 . A A .  22 VAL CB   1 1 
        1   326 1 1  22 VAL CG1  C  14.289   3.355   6.371 1.00 . A A .  22 VAL CG1  1 1 
        1   327 1 1  22 VAL CG2  C  13.664   5.316   7.826 1.00 . A A .  22 VAL CG2  1 1 
        1   328 1 1  22 VAL H    H  11.871   2.560   5.412 1.00 . A A .  22 VAL H    1 1 
        1   329 1 1  22 VAL HA   H  11.346   5.163   6.436 1.00 . A A .  22 VAL HA   1 1 
        1   330 1 1  22 VAL HB   H  12.622   3.464   7.685 1.00 . A A .  22 VAL HB   1 1 
        1   331 1 1  22 VAL HG11 H  14.818   3.995   5.680 1.00 . A A .  22 VAL HG11 1 1 
        1   332 1 1  22 VAL HG12 H  13.896   2.501   5.838 1.00 . A A .  22 VAL HG12 1 1 
        1   333 1 1  22 VAL HG13 H  14.969   3.015   7.140 1.00 . A A .  22 VAL HG13 1 1 
        1   334 1 1  22 VAL HG21 H  14.383   4.965   8.554 1.00 . A A .  22 VAL HG21 1 1 
        1   335 1 1  22 VAL HG22 H  12.842   5.795   8.338 1.00 . A A .  22 VAL HG22 1 1 
        1   336 1 1  22 VAL HG23 H  14.140   6.028   7.167 1.00 . A A .  22 VAL HG23 1 1 
        1   337 1 1  22 VAL N    N  11.492   3.454   5.273 1.00 . A A .  22 VAL N    1 1 
        1   338 1 1  22 VAL O    O  13.000   6.738   5.201 1.00 . A A .  22 VAL O    1 1 
        1   339 1 1  23 ASP C    C  12.865   6.494   1.858 1.00 . A A .  23 ASP C    1 1 
        1   340 1 1  23 ASP CA   C  13.919   5.824   2.765 1.00 . A A .  23 ASP CA   1 1 
        1   341 1 1  23 ASP CB   C  14.880   4.950   1.945 1.00 . A A .  23 ASP CB   1 1 
        1   342 1 1  23 ASP CG   C  15.860   5.763   1.114 1.00 . A A .  23 ASP CG   1 1 
        1   343 1 1  23 ASP H    H  13.129   4.050   3.633 1.00 . A A .  23 ASP H    1 1 
        1   344 1 1  23 ASP HA   H  14.487   6.596   3.267 1.00 . A A .  23 ASP HA   1 1 
        1   345 1 1  23 ASP HB2  H  15.446   4.322   2.619 1.00 . A A .  23 ASP HB2  1 1 
        1   346 1 1  23 ASP HB3  H  14.304   4.321   1.280 1.00 . A A .  23 ASP HB3  1 1 
        1   347 1 1  23 ASP N    N  13.262   5.010   3.795 1.00 . A A .  23 ASP N    1 1 
        1   348 1 1  23 ASP O    O  13.107   7.550   1.266 1.00 . A A .  23 ASP O    1 1 
        1   349 1 1  23 ASP OD1  O  16.831   6.300   1.691 1.00 . A A .  23 ASP OD1  1 1 
        1   350 1 1  23 ASP OD2  O  15.684   5.854  -0.119 1.00 . A A .  23 ASP OD2  1 1 
        1   351 1 1  24 GLY C    C  10.472   5.741  -0.393 1.00 . A A .  24 GLY C    1 1 
        1   352 1 1  24 GLY CA   C  10.597   6.419   0.967 1.00 . A A .  24 GLY CA   1 1 
        1   353 1 1  24 GLY H    H  11.558   5.035   2.262 1.00 . A A .  24 GLY H    1 1 
        1   354 1 1  24 GLY HA2  H   9.671   6.284   1.505 1.00 . A A .  24 GLY HA2  1 1 
        1   355 1 1  24 GLY HA3  H  10.759   7.477   0.817 1.00 . A A .  24 GLY HA3  1 1 
        1   356 1 1  24 GLY N    N  11.687   5.879   1.774 1.00 . A A .  24 GLY N    1 1 
        1   357 1 1  24 GLY O    O  10.052   6.368  -1.368 1.00 . A A .  24 GLY O    1 1 
        1   358 1 1  25 LYS C    C   9.451   2.979  -1.903 1.00 . A A .  25 LYS C    1 1 
        1   359 1 1  25 LYS CA   C  10.797   3.689  -1.698 1.00 . A A .  25 LYS CA   1 1 
        1   360 1 1  25 LYS CB   C  11.910   2.634  -1.694 1.00 . A A .  25 LYS CB   1 1 
        1   361 1 1  25 LYS CD   C  14.361   2.105  -1.461 1.00 . A A .  25 LYS CD   1 1 
        1   362 1 1  25 LYS CE   C  15.761   2.677  -1.284 1.00 . A A .  25 LYS CE   1 1 
        1   363 1 1  25 LYS CG   C  13.303   3.202  -1.469 1.00 . A A .  25 LYS CG   1 1 
        1   364 1 1  25 LYS H    H  11.163   4.028   0.365 1.00 . A A .  25 LYS H    1 1 
        1   365 1 1  25 LYS HA   H  10.965   4.368  -2.520 1.00 . A A .  25 LYS HA   1 1 
        1   366 1 1  25 LYS HB2  H  11.709   1.919  -0.909 1.00 . A A .  25 LYS HB2  1 1 
        1   367 1 1  25 LYS HB3  H  11.905   2.119  -2.646 1.00 . A A .  25 LYS HB3  1 1 
        1   368 1 1  25 LYS HD2  H  14.156   1.425  -0.646 1.00 . A A .  25 LYS HD2  1 1 
        1   369 1 1  25 LYS HD3  H  14.317   1.567  -2.400 1.00 . A A .  25 LYS HD3  1 1 
        1   370 1 1  25 LYS HE2  H  15.824   3.147  -0.313 1.00 . A A .  25 LYS HE2  1 1 
        1   371 1 1  25 LYS HE3  H  16.477   1.871  -1.341 1.00 . A A .  25 LYS HE3  1 1 
        1   372 1 1  25 LYS HG2  H  13.528   3.902  -2.262 1.00 . A A .  25 LYS HG2  1 1 
        1   373 1 1  25 LYS HG3  H  13.323   3.717  -0.518 1.00 . A A .  25 LYS HG3  1 1 
        1   374 1 1  25 LYS HZ1  H  15.496   4.539  -2.195 1.00 . A A .  25 LYS HZ1  1 1 
        1   375 1 1  25 LYS HZ2  H  15.897   3.297  -3.274 1.00 . A A .  25 LYS HZ2  1 1 
        1   376 1 1  25 LYS HZ3  H  17.085   3.957  -2.270 1.00 . A A .  25 LYS HZ3  1 1 
        1   377 1 1  25 LYS N    N  10.837   4.463  -0.452 1.00 . A A .  25 LYS N    1 1 
        1   378 1 1  25 LYS NZ   N  16.082   3.687  -2.328 1.00 . A A .  25 LYS NZ   1 1 
        1   379 1 1  25 LYS O    O   8.889   3.001  -2.999 1.00 . A A .  25 LYS O    1 1 
        1   380 1 1  26 PHE C    C   6.798   1.533   0.204 1.00 . A A .  26 PHE C    1 1 
        1   381 1 1  26 PHE CA   C   7.768   1.460  -0.989 1.00 . A A .  26 PHE CA   1 1 
        1   382 1 1  26 PHE CB   C   8.228   0.006  -1.193 1.00 . A A .  26 PHE CB   1 1 
        1   383 1 1  26 PHE CD1  C   8.453  -1.069   1.087 1.00 . A A .  26 PHE CD1  1 1 
        1   384 1 1  26 PHE CD2  C  10.445  -0.583  -0.139 1.00 . A A .  26 PHE CD2  1 1 
        1   385 1 1  26 PHE CE1  C   9.212  -1.591   2.117 1.00 . A A .  26 PHE CE1  1 1 
        1   386 1 1  26 PHE CE2  C  11.206  -1.108   0.889 1.00 . A A .  26 PHE CE2  1 1 
        1   387 1 1  26 PHE CG   C   9.059  -0.557  -0.057 1.00 . A A .  26 PHE CG   1 1 
        1   388 1 1  26 PHE CZ   C  10.589  -1.611   2.018 1.00 . A A .  26 PHE CZ   1 1 
        1   389 1 1  26 PHE H    H   9.352   2.451   0.029 1.00 . A A .  26 PHE H    1 1 
        1   390 1 1  26 PHE HA   H   7.232   1.773  -1.875 1.00 . A A .  26 PHE HA   1 1 
        1   391 1 1  26 PHE HB2  H   7.357  -0.625  -1.311 1.00 . A A .  26 PHE HB2  1 1 
        1   392 1 1  26 PHE HB3  H   8.820  -0.050  -2.097 1.00 . A A .  26 PHE HB3  1 1 
        1   393 1 1  26 PHE HD1  H   7.375  -1.055   1.169 1.00 . A A .  26 PHE HD1  1 1 
        1   394 1 1  26 PHE HD2  H  10.931  -0.190  -1.020 1.00 . A A .  26 PHE HD2  1 1 
        1   395 1 1  26 PHE HE1  H   8.728  -1.984   2.999 1.00 . A A .  26 PHE HE1  1 1 
        1   396 1 1  26 PHE HE2  H  12.285  -1.122   0.811 1.00 . A A .  26 PHE HE2  1 1 
        1   397 1 1  26 PHE HZ   H  11.183  -2.021   2.823 1.00 . A A .  26 PHE HZ   1 1 
        1   398 1 1  26 PHE N    N   8.940   2.335  -0.850 1.00 . A A .  26 PHE N    1 1 
        1   399 1 1  26 PHE O    O   7.149   1.982   1.297 1.00 . A A .  26 PHE O    1 1 
        1   400 1 1  27 ILE C    C   4.140  -0.540   1.152 1.00 . A A .  27 ILE C    1 1 
        1   401 1 1  27 ILE CA   C   4.538   0.939   1.001 1.00 . A A .  27 ILE CA   1 1 
        1   402 1 1  27 ILE CB   C   3.270   1.759   0.642 1.00 . A A .  27 ILE CB   1 1 
        1   403 1 1  27 ILE CD1  C   2.481   4.064  -0.145 1.00 . A A .  27 ILE CD1  1 1 
        1   404 1 1  27 ILE CG1  C   3.633   3.228   0.377 1.00 . A A .  27 ILE CG1  1 1 
        1   405 1 1  27 ILE CG2  C   2.228   1.655   1.754 1.00 . A A .  27 ILE CG2  1 1 
        1   406 1 1  27 ILE H    H   5.338   0.827  -0.959 1.00 . A A .  27 ILE H    1 1 
        1   407 1 1  27 ILE HA   H   4.937   1.303   1.939 1.00 . A A .  27 ILE HA   1 1 
        1   408 1 1  27 ILE HB   H   2.842   1.334  -0.256 1.00 . A A .  27 ILE HB   1 1 
        1   409 1 1  27 ILE HD11 H   2.136   3.659  -1.086 1.00 . A A .  27 ILE HD11 1 1 
        1   410 1 1  27 ILE HD12 H   2.814   5.081  -0.293 1.00 . A A .  27 ILE HD12 1 1 
        1   411 1 1  27 ILE HD13 H   1.672   4.051   0.571 1.00 . A A .  27 ILE HD13 1 1 
        1   412 1 1  27 ILE HG12 H   3.978   3.680   1.296 1.00 . A A .  27 ILE HG12 1 1 
        1   413 1 1  27 ILE HG13 H   4.429   3.267  -0.355 1.00 . A A .  27 ILE HG13 1 1 
        1   414 1 1  27 ILE HG21 H   2.645   2.033   2.677 1.00 . A A .  27 ILE HG21 1 1 
        1   415 1 1  27 ILE HG22 H   1.942   0.621   1.888 1.00 . A A .  27 ILE HG22 1 1 
        1   416 1 1  27 ILE HG23 H   1.356   2.237   1.489 1.00 . A A .  27 ILE HG23 1 1 
        1   417 1 1  27 ILE N    N   5.567   1.077  -0.039 1.00 . A A .  27 ILE N    1 1 
        1   418 1 1  27 ILE O    O   3.738  -1.174   0.179 1.00 . A A .  27 ILE O    1 1 
        1   419 1 1  28 ARG C    C   2.601  -2.757   3.242 1.00 . A A .  28 ARG C    1 1 
        1   420 1 1  28 ARG CA   C   3.963  -2.520   2.562 1.00 . A A .  28 ARG CA   1 1 
        1   421 1 1  28 ARG CB   C   5.090  -3.188   3.361 1.00 . A A .  28 ARG CB   1 1 
        1   422 1 1  28 ARG CD   C   6.121  -5.435   3.897 1.00 . A A .  28 ARG CD   1 1 
        1   423 1 1  28 ARG CG   C   4.826  -4.659   3.684 1.00 . A A .  28 ARG CG   1 1 
        1   424 1 1  28 ARG CZ   C   8.074  -6.075   2.563 1.00 . A A .  28 ARG CZ   1 1 
        1   425 1 1  28 ARG H    H   4.530  -0.545   3.120 1.00 . A A .  28 ARG H    1 1 
        1   426 1 1  28 ARG HA   H   3.929  -2.982   1.584 1.00 . A A .  28 ARG HA   1 1 
        1   427 1 1  28 ARG HB2  H   6.005  -3.125   2.787 1.00 . A A .  28 ARG HB2  1 1 
        1   428 1 1  28 ARG HB3  H   5.224  -2.654   4.291 1.00 . A A .  28 ARG HB3  1 1 
        1   429 1 1  28 ARG HD2  H   6.721  -4.924   4.638 1.00 . A A .  28 ARG HD2  1 1 
        1   430 1 1  28 ARG HD3  H   5.878  -6.426   4.251 1.00 . A A .  28 ARG HD3  1 1 
        1   431 1 1  28 ARG HE   H   6.469  -5.214   1.840 1.00 . A A .  28 ARG HE   1 1 
        1   432 1 1  28 ARG HG2  H   4.231  -4.719   4.586 1.00 . A A .  28 ARG HG2  1 1 
        1   433 1 1  28 ARG HG3  H   4.280  -5.107   2.864 1.00 . A A .  28 ARG HG3  1 1 
        1   434 1 1  28 ARG HH11 H   8.252  -6.477   4.505 1.00 . A A .  28 ARG HH11 1 1 
        1   435 1 1  28 ARG HH12 H   9.599  -6.925   3.520 1.00 . A A .  28 ARG HH12 1 1 
        1   436 1 1  28 ARG HH21 H   8.167  -5.809   0.596 1.00 . A A .  28 ARG HH21 1 1 
        1   437 1 1  28 ARG HH22 H   9.537  -6.579   1.317 1.00 . A A .  28 ARG HH22 1 1 
        1   438 1 1  28 ARG N    N   4.252  -1.095   2.357 1.00 . A A .  28 ARG N    1 1 
        1   439 1 1  28 ARG NE   N   6.887  -5.547   2.657 1.00 . A A .  28 ARG NE   1 1 
        1   440 1 1  28 ARG NH1  N   8.688  -6.528   3.609 1.00 . A A .  28 ARG NH1  1 1 
        1   441 1 1  28 ARG NH2  N   8.641  -6.154   1.404 1.00 . A A .  28 ARG NH2  1 1 
        1   442 1 1  28 ARG O    O   2.412  -2.460   4.426 1.00 . A A .  28 ARG O    1 1 
        1   443 1 1  29 LEU C    C   0.392  -5.159   3.466 1.00 . A A .  29 LEU C    1 1 
        1   444 1 1  29 LEU CA   C   0.349  -3.697   2.985 1.00 . A A .  29 LEU CA   1 1 
        1   445 1 1  29 LEU CB   C  -0.737  -3.529   1.905 1.00 . A A .  29 LEU CB   1 1 
        1   446 1 1  29 LEU CD1  C   0.140  -1.466   0.709 1.00 . A A .  29 LEU CD1  1 1 
        1   447 1 1  29 LEU CD2  C  -2.305  -2.034   0.604 1.00 . A A .  29 LEU CD2  1 1 
        1   448 1 1  29 LEU CG   C  -1.040  -2.080   1.460 1.00 . A A .  29 LEU CG   1 1 
        1   449 1 1  29 LEU H    H   1.854  -3.428   1.515 1.00 . A A .  29 LEU H    1 1 
        1   450 1 1  29 LEU HA   H   0.112  -3.059   3.826 1.00 . A A .  29 LEU HA   1 1 
        1   451 1 1  29 LEU HB2  H  -0.433  -4.091   1.033 1.00 . A A .  29 LEU HB2  1 1 
        1   452 1 1  29 LEU HB3  H  -1.653  -3.962   2.283 1.00 . A A .  29 LEU HB3  1 1 
        1   453 1 1  29 LEU HD11 H   1.000  -1.426   1.363 1.00 . A A .  29 LEU HD11 1 1 
        1   454 1 1  29 LEU HD12 H  -0.115  -0.465   0.392 1.00 . A A .  29 LEU HD12 1 1 
        1   455 1 1  29 LEU HD13 H   0.375  -2.069  -0.155 1.00 . A A .  29 LEU HD13 1 1 
        1   456 1 1  29 LEU HD21 H  -3.133  -2.448   1.162 1.00 . A A .  29 LEU HD21 1 1 
        1   457 1 1  29 LEU HD22 H  -2.156  -2.609  -0.299 1.00 . A A .  29 LEU HD22 1 1 
        1   458 1 1  29 LEU HD23 H  -2.527  -1.009   0.346 1.00 . A A .  29 LEU HD23 1 1 
        1   459 1 1  29 LEU HG   H  -1.216  -1.475   2.339 1.00 . A A .  29 LEU HG   1 1 
        1   460 1 1  29 LEU N    N   1.660  -3.295   2.468 1.00 . A A .  29 LEU N    1 1 
        1   461 1 1  29 LEU O    O   1.223  -5.947   3.010 1.00 . A A .  29 LEU O    1 1 
        1   462 1 1  30 LYS C    C  -1.874  -7.420   5.248 1.00 . A A .  30 LYS C    1 1 
        1   463 1 1  30 LYS CA   C  -0.463  -6.853   5.005 1.00 . A A .  30 LYS CA   1 1 
        1   464 1 1  30 LYS CB   C   0.298  -6.734   6.330 1.00 . A A .  30 LYS CB   1 1 
        1   465 1 1  30 LYS CD   C   1.528  -7.825   8.218 1.00 . A A .  30 LYS CD   1 1 
        1   466 1 1  30 LYS CE   C   2.097  -9.119   8.779 1.00 . A A .  30 LYS CE   1 1 
        1   467 1 1  30 LYS CG   C   0.648  -8.059   6.994 1.00 . A A .  30 LYS CG   1 1 
        1   468 1 1  30 LYS H    H  -1.204  -4.891   4.642 1.00 . A A .  30 LYS H    1 1 
        1   469 1 1  30 LYS HA   H   0.077  -7.522   4.347 1.00 . A A .  30 LYS HA   1 1 
        1   470 1 1  30 LYS HB2  H   1.219  -6.199   6.151 1.00 . A A .  30 LYS HB2  1 1 
        1   471 1 1  30 LYS HB3  H  -0.303  -6.160   7.023 1.00 . A A .  30 LYS HB3  1 1 
        1   472 1 1  30 LYS HD2  H   2.349  -7.181   7.938 1.00 . A A .  30 LYS HD2  1 1 
        1   473 1 1  30 LYS HD3  H   0.937  -7.340   8.982 1.00 . A A .  30 LYS HD3  1 1 
        1   474 1 1  30 LYS HE2  H   1.285  -9.736   9.136 1.00 . A A .  30 LYS HE2  1 1 
        1   475 1 1  30 LYS HE3  H   2.625  -9.638   7.992 1.00 . A A .  30 LYS HE3  1 1 
        1   476 1 1  30 LYS HG2  H  -0.263  -8.553   7.301 1.00 . A A .  30 LYS HG2  1 1 
        1   477 1 1  30 LYS HG3  H   1.180  -8.681   6.286 1.00 . A A .  30 LYS HG3  1 1 
        1   478 1 1  30 LYS HZ1  H   2.532  -8.407  10.692 1.00 . A A .  30 LYS HZ1  1 1 
        1   479 1 1  30 LYS HZ2  H   3.805  -8.229   9.589 1.00 . A A .  30 LYS HZ2  1 1 
        1   480 1 1  30 LYS HZ3  H   3.447  -9.750  10.235 1.00 . A A .  30 LYS HZ3  1 1 
        1   481 1 1  30 LYS N    N  -0.507  -5.526   4.375 1.00 . A A .  30 LYS N    1 1 
        1   482 1 1  30 LYS NZ   N   3.035  -8.859   9.901 1.00 . A A .  30 LYS NZ   1 1 
        1   483 1 1  30 LYS O    O  -2.618  -6.916   6.089 1.00 . A A .  30 LYS O    1 1 
        1   484 1 1  31 ASN C    C  -3.566 -10.166   5.755 1.00 . A A .  31 ASN C    1 1 
        1   485 1 1  31 ASN CA   C  -3.563  -9.094   4.653 1.00 . A A .  31 ASN CA   1 1 
        1   486 1 1  31 ASN CB   C  -4.018  -9.702   3.320 1.00 . A A .  31 ASN CB   1 1 
        1   487 1 1  31 ASN CG   C  -5.366 -10.399   3.430 1.00 . A A .  31 ASN CG   1 1 
        1   488 1 1  31 ASN H    H  -1.607  -8.836   3.852 1.00 . A A .  31 ASN H    1 1 
        1   489 1 1  31 ASN HA   H  -4.264  -8.315   4.932 1.00 . A A .  31 ASN HA   1 1 
        1   490 1 1  31 ASN HB2  H  -4.098  -8.917   2.581 1.00 . A A .  31 ASN HB2  1 1 
        1   491 1 1  31 ASN HB3  H  -3.285 -10.424   2.991 1.00 . A A .  31 ASN HB3  1 1 
        1   492 1 1  31 ASN HD21 H  -4.479 -12.143   3.733 1.00 . A A .  31 ASN HD21 1 1 
        1   493 1 1  31 ASN HD22 H  -6.209 -12.163   3.727 1.00 . A A .  31 ASN HD22 1 1 
        1   494 1 1  31 ASN N    N  -2.239  -8.470   4.509 1.00 . A A .  31 ASN N    1 1 
        1   495 1 1  31 ASN ND2  N  -5.348 -11.698   3.653 1.00 . A A .  31 ASN ND2  1 1 
        1   496 1 1  31 ASN O    O  -3.037 -11.265   5.574 1.00 . A A .  31 ASN O    1 1 
        1   497 1 1  31 ASN OD1  O  -6.414  -9.775   3.306 1.00 . A A .  31 ASN OD1  1 1 
        1   498 1 1  32 THR C    C  -5.647 -11.309   8.268 1.00 . A A .  32 THR C    1 1 
        1   499 1 1  32 THR CA   C  -4.227 -10.750   8.050 1.00 . A A .  32 THR CA   1 1 
        1   500 1 1  32 THR CB   C  -3.737 -10.029   9.338 1.00 . A A .  32 THR CB   1 1 
        1   501 1 1  32 THR CG2  C  -4.597  -8.805   9.658 1.00 . A A .  32 THR CG2  1 1 
        1   502 1 1  32 THR H    H  -4.615  -8.962   6.956 1.00 . A A .  32 THR H    1 1 
        1   503 1 1  32 THR HA   H  -3.558 -11.579   7.853 1.00 . A A .  32 THR HA   1 1 
        1   504 1 1  32 THR HB   H  -2.722  -9.693   9.168 1.00 . A A .  32 THR HB   1 1 
        1   505 1 1  32 THR HG1  H  -4.620 -11.307  10.574 1.00 . A A .  32 THR HG1  1 1 
        1   506 1 1  32 THR HG21 H  -5.622  -9.112   9.810 1.00 . A A .  32 THR HG21 1 1 
        1   507 1 1  32 THR HG22 H  -4.549  -8.104   8.836 1.00 . A A .  32 THR HG22 1 1 
        1   508 1 1  32 THR HG23 H  -4.226  -8.331  10.555 1.00 . A A .  32 THR HG23 1 1 
        1   509 1 1  32 THR N    N  -4.179  -9.840   6.891 1.00 . A A .  32 THR N    1 1 
        1   510 1 1  32 THR O    O  -6.115 -11.449   9.399 1.00 . A A .  32 THR O    1 1 
        1   511 1 1  32 THR OG1  O  -3.735 -10.932  10.459 1.00 . A A .  32 THR OG1  1 1 
        1   512 1 1  33 SER C    C  -7.776 -13.657   7.536 1.00 . A A .  33 SER C    1 1 
        1   513 1 1  33 SER CA   C  -7.701 -12.153   7.227 1.00 . A A .  33 SER CA   1 1 
        1   514 1 1  33 SER CB   C  -8.405 -11.887   5.894 1.00 . A A .  33 SER CB   1 1 
        1   515 1 1  33 SER H    H  -5.874 -11.579   6.302 1.00 . A A .  33 SER H    1 1 
        1   516 1 1  33 SER HA   H  -8.219 -11.614   8.006 1.00 . A A .  33 SER HA   1 1 
        1   517 1 1  33 SER HB2  H  -9.422 -12.250   5.944 1.00 . A A .  33 SER HB2  1 1 
        1   518 1 1  33 SER HB3  H  -8.410 -10.825   5.697 1.00 . A A .  33 SER HB3  1 1 
        1   519 1 1  33 SER HG   H  -8.379 -12.805   4.157 1.00 . A A .  33 SER HG   1 1 
        1   520 1 1  33 SER N    N  -6.317 -11.655   7.174 1.00 . A A .  33 SER N    1 1 
        1   521 1 1  33 SER O    O  -6.758 -14.342   7.647 1.00 . A A .  33 SER O    1 1 
        1   522 1 1  33 SER OG   O  -7.737 -12.544   4.830 1.00 . A A .  33 SER OG   1 1 
        1   523 1 1  34 GLU C    C  -9.395 -16.376   6.590 1.00 . A A .  34 GLU C    1 1 
        1   524 1 1  34 GLU CA   C  -9.246 -15.592   7.907 1.00 . A A .  34 GLU CA   1 1 
        1   525 1 1  34 GLU CB   C -10.524 -15.768   8.731 1.00 . A A .  34 GLU CB   1 1 
        1   526 1 1  34 GLU CD   C -11.842 -15.168  10.789 1.00 . A A .  34 GLU CD   1 1 
        1   527 1 1  34 GLU CG   C -10.503 -15.069  10.081 1.00 . A A .  34 GLU CG   1 1 
        1   528 1 1  34 GLU H    H  -9.774 -13.555   7.626 1.00 . A A .  34 GLU H    1 1 
        1   529 1 1  34 GLU HA   H  -8.410 -15.992   8.465 1.00 . A A .  34 GLU HA   1 1 
        1   530 1 1  34 GLU HB2  H -11.357 -15.374   8.164 1.00 . A A .  34 GLU HB2  1 1 
        1   531 1 1  34 GLU HB3  H -10.688 -16.824   8.901 1.00 . A A .  34 GLU HB3  1 1 
        1   532 1 1  34 GLU HG2  H  -9.744 -15.528  10.701 1.00 . A A .  34 GLU HG2  1 1 
        1   533 1 1  34 GLU HG3  H -10.261 -14.025   9.932 1.00 . A A .  34 GLU HG3  1 1 
        1   534 1 1  34 GLU N    N  -9.004 -14.161   7.670 1.00 . A A .  34 GLU N    1 1 
        1   535 1 1  34 GLU O    O  -9.464 -17.606   6.595 1.00 . A A .  34 GLU O    1 1 
        1   536 1 1  34 GLU OE1  O -12.126 -16.228  11.385 1.00 . A A .  34 GLU OE1  1 1 
        1   537 1 1  34 GLU OE2  O -12.627 -14.197  10.726 1.00 . A A .  34 GLU OE2  1 1 
        1   538 1 1  35 GLN C    C  -9.028 -15.530   3.025 1.00 . A A .  35 GLN C    1 1 
        1   539 1 1  35 GLN CA   C  -9.730 -16.281   4.167 1.00 . A A .  35 GLN CA   1 1 
        1   540 1 1  35 GLN CB   C -11.254 -16.295   3.946 1.00 . A A .  35 GLN CB   1 1 
        1   541 1 1  35 GLN CD   C -13.220 -16.962   2.507 1.00 . A A .  35 GLN CD   1 1 
        1   542 1 1  35 GLN CG   C -11.707 -16.941   2.641 1.00 . A A .  35 GLN CG   1 1 
        1   543 1 1  35 GLN H    H  -9.270 -14.701   5.507 1.00 . A A .  35 GLN H    1 1 
        1   544 1 1  35 GLN HA   H  -9.368 -17.300   4.191 1.00 . A A .  35 GLN HA   1 1 
        1   545 1 1  35 GLN HB2  H -11.716 -16.833   4.763 1.00 . A A .  35 GLN HB2  1 1 
        1   546 1 1  35 GLN HB3  H -11.613 -15.275   3.958 1.00 . A A .  35 GLN HB3  1 1 
        1   547 1 1  35 GLN HE21 H -13.310 -18.726   3.400 1.00 . A A .  35 GLN HE21 1 1 
        1   548 1 1  35 GLN HE22 H -14.824 -18.045   2.914 1.00 . A A .  35 GLN HE22 1 1 
        1   549 1 1  35 GLN HG2  H -11.292 -16.385   1.812 1.00 . A A .  35 GLN HG2  1 1 
        1   550 1 1  35 GLN HG3  H -11.340 -17.958   2.608 1.00 . A A .  35 GLN HG3  1 1 
        1   551 1 1  35 GLN N    N  -9.442 -15.664   5.468 1.00 . A A .  35 GLN N    1 1 
        1   552 1 1  35 GLN NE2  N -13.846 -18.016   2.987 1.00 . A A .  35 GLN NE2  1 1 
        1   553 1 1  35 GLN O    O  -8.688 -14.355   3.158 1.00 . A A .  35 GLN O    1 1 
        1   554 1 1  35 GLN OE1  O -13.825 -16.029   1.986 1.00 . A A .  35 GLN OE1  1 1 
        1   555 1 1  36 ASP C    C  -9.008 -14.484   0.148 1.00 . A A .  36 ASP C    1 1 
        1   556 1 1  36 ASP CA   C  -8.156 -15.630   0.736 1.00 . A A .  36 ASP CA   1 1 
        1   557 1 1  36 ASP CB   C  -7.925 -16.722  -0.314 1.00 . A A .  36 ASP CB   1 1 
        1   558 1 1  36 ASP CG   C  -7.199 -17.923   0.264 1.00 . A A .  36 ASP CG   1 1 
        1   559 1 1  36 ASP H    H  -9.070 -17.165   1.876 1.00 . A A .  36 ASP H    1 1 
        1   560 1 1  36 ASP HA   H  -7.199 -15.233   1.047 1.00 . A A .  36 ASP HA   1 1 
        1   561 1 1  36 ASP HB2  H  -8.880 -17.052  -0.700 1.00 . A A .  36 ASP HB2  1 1 
        1   562 1 1  36 ASP HB3  H  -7.335 -16.319  -1.125 1.00 . A A .  36 ASP HB3  1 1 
        1   563 1 1  36 ASP N    N  -8.801 -16.222   1.912 1.00 . A A .  36 ASP N    1 1 
        1   564 1 1  36 ASP O    O -10.083 -14.714  -0.407 1.00 . A A .  36 ASP O    1 1 
        1   565 1 1  36 ASP OD1  O  -7.828 -18.690   1.027 1.00 . A A .  36 ASP OD1  1 1 
        1   566 1 1  36 ASP OD2  O  -6.001 -18.111  -0.038 1.00 . A A .  36 ASP OD2  1 1 
        1   567 1 1  37 GLN C    C  -8.949 -11.615  -1.567 1.00 . A A .  37 GLN C    1 1 
        1   568 1 1  37 GLN CA   C  -9.272 -12.058  -0.126 1.00 . A A .  37 GLN CA   1 1 
        1   569 1 1  37 GLN CB   C  -8.962 -10.906   0.836 1.00 . A A .  37 GLN CB   1 1 
        1   570 1 1  37 GLN CD   C -10.673 -11.570   2.617 1.00 . A A .  37 GLN CD   1 1 
        1   571 1 1  37 GLN CG   C  -9.219 -11.234   2.307 1.00 . A A .  37 GLN CG   1 1 
        1   572 1 1  37 GLN H    H  -7.622 -13.139   0.663 1.00 . A A .  37 GLN H    1 1 
        1   573 1 1  37 GLN HA   H -10.323 -12.292  -0.057 1.00 . A A .  37 GLN HA   1 1 
        1   574 1 1  37 GLN HB2  H  -7.919 -10.633   0.729 1.00 . A A .  37 GLN HB2  1 1 
        1   575 1 1  37 GLN HB3  H  -9.573 -10.056   0.567 1.00 . A A .  37 GLN HB3  1 1 
        1   576 1 1  37 GLN HE21 H -11.325 -10.342   1.198 1.00 . A A .  37 GLN HE21 1 1 
        1   577 1 1  37 GLN HE22 H -12.538 -11.189   2.085 1.00 . A A .  37 GLN HE22 1 1 
        1   578 1 1  37 GLN HG2  H  -8.609 -12.084   2.582 1.00 . A A .  37 GLN HG2  1 1 
        1   579 1 1  37 GLN HG3  H  -8.928 -10.383   2.907 1.00 . A A .  37 GLN HG3  1 1 
        1   580 1 1  37 GLN N    N  -8.517 -13.252   0.279 1.00 . A A .  37 GLN N    1 1 
        1   581 1 1  37 GLN NE2  N -11.604 -10.971   1.894 1.00 . A A .  37 GLN NE2  1 1 
        1   582 1 1  37 GLN O    O  -7.784 -11.448  -1.933 1.00 . A A .  37 GLN O    1 1 
        1   583 1 1  37 GLN OE1  O -10.960 -12.348   3.519 1.00 . A A .  37 GLN OE1  1 1 
        1   584 1 1  38 PRO C    C  -9.618  -9.354  -3.800 1.00 . A A .  38 PRO C    1 1 
        1   585 1 1  38 PRO CA   C  -9.801 -10.885  -3.767 1.00 . A A .  38 PRO CA   1 1 
        1   586 1 1  38 PRO CB   C -11.098 -11.303  -4.466 1.00 . A A .  38 PRO CB   1 1 
        1   587 1 1  38 PRO CD   C -11.408 -11.666  -2.102 1.00 . A A .  38 PRO CD   1 1 
        1   588 1 1  38 PRO CG   C -12.128 -11.310  -3.382 1.00 . A A .  38 PRO CG   1 1 
        1   589 1 1  38 PRO HA   H  -8.958 -11.356  -4.258 1.00 . A A .  38 PRO HA   1 1 
        1   590 1 1  38 PRO HB2  H -11.343 -10.592  -5.243 1.00 . A A .  38 PRO HB2  1 1 
        1   591 1 1  38 PRO HB3  H -10.976 -12.286  -4.901 1.00 . A A .  38 PRO HB3  1 1 
        1   592 1 1  38 PRO HD2  H -11.749 -11.036  -1.291 1.00 . A A .  38 PRO HD2  1 1 
        1   593 1 1  38 PRO HD3  H -11.564 -12.707  -1.857 1.00 . A A .  38 PRO HD3  1 1 
        1   594 1 1  38 PRO HG2  H -12.576 -10.329  -3.297 1.00 . A A .  38 PRO HG2  1 1 
        1   595 1 1  38 PRO HG3  H -12.887 -12.048  -3.601 1.00 . A A .  38 PRO HG3  1 1 
        1   596 1 1  38 PRO N    N  -9.984 -11.405  -2.406 1.00 . A A .  38 PRO N    1 1 
        1   597 1 1  38 PRO O    O -10.494  -8.601  -3.371 1.00 . A A .  38 PRO O    1 1 
        1   598 1 1  39 MET C    C  -9.152  -6.744  -5.349 1.00 . A A .  39 MET C    1 1 
        1   599 1 1  39 MET CA   C  -8.168  -7.468  -4.413 1.00 . A A .  39 MET CA   1 1 
        1   600 1 1  39 MET CB   C  -6.726  -7.273  -4.910 1.00 . A A .  39 MET CB   1 1 
        1   601 1 1  39 MET CE   C  -5.431  -5.272  -2.728 1.00 . A A .  39 MET CE   1 1 
        1   602 1 1  39 MET CG   C  -6.379  -5.834  -5.280 1.00 . A A .  39 MET CG   1 1 
        1   603 1 1  39 MET H    H  -7.796  -9.551  -4.601 1.00 . A A .  39 MET H    1 1 
        1   604 1 1  39 MET HA   H  -8.254  -7.040  -3.424 1.00 . A A .  39 MET HA   1 1 
        1   605 1 1  39 MET HB2  H  -6.044  -7.592  -4.135 1.00 . A A .  39 MET HB2  1 1 
        1   606 1 1  39 MET HB3  H  -6.574  -7.891  -5.784 1.00 . A A .  39 MET HB3  1 1 
        1   607 1 1  39 MET HE1  H  -4.441  -5.239  -3.161 1.00 . A A .  39 MET HE1  1 1 
        1   608 1 1  39 MET HE2  H  -5.672  -6.289  -2.457 1.00 . A A .  39 MET HE2  1 1 
        1   609 1 1  39 MET HE3  H  -5.458  -4.648  -1.847 1.00 . A A .  39 MET HE3  1 1 
        1   610 1 1  39 MET HG2  H  -5.342  -5.794  -5.582 1.00 . A A .  39 MET HG2  1 1 
        1   611 1 1  39 MET HG3  H  -7.003  -5.530  -6.109 1.00 . A A .  39 MET HG3  1 1 
        1   612 1 1  39 MET N    N  -8.466  -8.904  -4.303 1.00 . A A .  39 MET N    1 1 
        1   613 1 1  39 MET O    O  -9.761  -5.743  -4.976 1.00 . A A .  39 MET O    1 1 
        1   614 1 1  39 MET SD   S  -6.623  -4.672  -3.921 1.00 . A A .  39 MET SD   1 1 
        1   615 1 1  40 GLY C    C  -9.577  -5.351  -8.138 1.00 . A A .  40 GLY C    1 1 
        1   616 1 1  40 GLY CA   C -10.173  -6.622  -7.544 1.00 . A A .  40 GLY CA   1 1 
        1   617 1 1  40 GLY H    H  -8.823  -8.078  -6.800 1.00 . A A .  40 GLY H    1 1 
        1   618 1 1  40 GLY HA2  H -10.361  -7.322  -8.344 1.00 . A A .  40 GLY HA2  1 1 
        1   619 1 1  40 GLY HA3  H -11.113  -6.380  -7.070 1.00 . A A .  40 GLY HA3  1 1 
        1   620 1 1  40 GLY N    N  -9.298  -7.258  -6.567 1.00 . A A .  40 GLY N    1 1 
        1   621 1 1  40 GLY O    O  -9.004  -5.379  -9.231 1.00 . A A .  40 GLY O    1 1 
        1   622 1 1  41 GLY C    C  -9.311  -1.819  -6.912 1.00 . A A .  41 GLY C    1 1 
        1   623 1 1  41 GLY CA   C  -9.182  -2.967  -7.914 1.00 . A A .  41 GLY CA   1 1 
        1   624 1 1  41 GLY H    H -10.166  -4.275  -6.550 1.00 . A A .  41 GLY H    1 1 
        1   625 1 1  41 GLY HA2  H  -8.139  -3.097  -8.157 1.00 . A A .  41 GLY HA2  1 1 
        1   626 1 1  41 GLY HA3  H  -9.717  -2.702  -8.817 1.00 . A A .  41 GLY HA3  1 1 
        1   627 1 1  41 GLY N    N  -9.707  -4.236  -7.421 1.00 . A A .  41 GLY N    1 1 
        1   628 1 1  41 GLY O    O  -9.948  -0.804  -7.202 1.00 . A A .  41 GLY O    1 1 
        1   629 1 1  42 TRP C    C  -7.962   0.353  -5.204 1.00 . A A .  42 TRP C    1 1 
        1   630 1 1  42 TRP CA   C  -8.681  -0.915  -4.715 1.00 . A A .  42 TRP CA   1 1 
        1   631 1 1  42 TRP CB   C  -7.981  -1.419  -3.445 1.00 . A A .  42 TRP CB   1 1 
        1   632 1 1  42 TRP CD1  C  -9.641  -3.344  -3.046 1.00 . A A .  42 TRP CD1  1 1 
        1   633 1 1  42 TRP CD2  C  -8.859  -2.387  -1.181 1.00 . A A .  42 TRP CD2  1 1 
        1   634 1 1  42 TRP CE2  C  -9.746  -3.413  -0.818 1.00 . A A .  42 TRP CE2  1 1 
        1   635 1 1  42 TRP CE3  C  -8.239  -1.641  -0.172 1.00 . A A .  42 TRP CE3  1 1 
        1   636 1 1  42 TRP CG   C  -8.805  -2.355  -2.610 1.00 . A A .  42 TRP CG   1 1 
        1   637 1 1  42 TRP CH2  C  -9.410  -2.970   1.477 1.00 . A A .  42 TRP CH2  1 1 
        1   638 1 1  42 TRP CZ2  C -10.028  -3.713   0.512 1.00 . A A .  42 TRP CZ2  1 1 
        1   639 1 1  42 TRP CZ3  C  -8.522  -1.941   1.145 1.00 . A A .  42 TRP CZ3  1 1 
        1   640 1 1  42 TRP H    H  -8.258  -2.827  -5.545 1.00 . A A .  42 TRP H    1 1 
        1   641 1 1  42 TRP HA   H  -9.705  -0.664  -4.475 1.00 . A A .  42 TRP HA   1 1 
        1   642 1 1  42 TRP HB2  H  -7.077  -1.938  -3.725 1.00 . A A .  42 TRP HB2  1 1 
        1   643 1 1  42 TRP HB3  H  -7.720  -0.568  -2.827 1.00 . A A .  42 TRP HB3  1 1 
        1   644 1 1  42 TRP HD1  H  -9.821  -3.575  -4.087 1.00 . A A .  42 TRP HD1  1 1 
        1   645 1 1  42 TRP HE1  H -10.849  -4.726  -2.031 1.00 . A A .  42 TRP HE1  1 1 
        1   646 1 1  42 TRP HE3  H  -7.551  -0.843  -0.411 1.00 . A A .  42 TRP HE3  1 1 
        1   647 1 1  42 TRP HH2  H  -9.604  -3.170   2.520 1.00 . A A .  42 TRP HH2  1 1 
        1   648 1 1  42 TRP HZ2  H -10.710  -4.505   0.785 1.00 . A A .  42 TRP HZ2  1 1 
        1   649 1 1  42 TRP HZ3  H  -8.054  -1.374   1.937 1.00 . A A .  42 TRP HZ3  1 1 
        1   650 1 1  42 TRP N    N  -8.700  -1.975  -5.738 1.00 . A A .  42 TRP N    1 1 
        1   651 1 1  42 TRP NE1  N -10.213  -3.981  -1.974 1.00 . A A .  42 TRP NE1  1 1 
        1   652 1 1  42 TRP O    O  -7.308   0.356  -6.251 1.00 . A A .  42 TRP O    1 1 
        1   653 1 1  43 GLU C    C  -6.623   3.173  -3.452 1.00 . A A .  43 GLU C    1 1 
        1   654 1 1  43 GLU CA   C  -7.349   2.667  -4.708 1.00 . A A .  43 GLU CA   1 1 
        1   655 1 1  43 GLU CB   C  -8.295   3.751  -5.243 1.00 . A A .  43 GLU CB   1 1 
        1   656 1 1  43 GLU CD   C  -8.496   6.070  -6.277 1.00 . A A .  43 GLU CD   1 1 
        1   657 1 1  43 GLU CG   C  -7.561   4.983  -5.771 1.00 . A A .  43 GLU CG   1 1 
        1   658 1 1  43 GLU H    H  -8.661   1.385  -3.637 1.00 . A A .  43 GLU H    1 1 
        1   659 1 1  43 GLU HA   H  -6.608   2.448  -5.467 1.00 . A A .  43 GLU HA   1 1 
        1   660 1 1  43 GLU HB2  H  -8.884   3.334  -6.047 1.00 . A A .  43 GLU HB2  1 1 
        1   661 1 1  43 GLU HB3  H  -8.958   4.064  -4.446 1.00 . A A .  43 GLU HB3  1 1 
        1   662 1 1  43 GLU HG2  H  -6.951   5.391  -4.977 1.00 . A A .  43 GLU HG2  1 1 
        1   663 1 1  43 GLU HG3  H  -6.919   4.677  -6.587 1.00 . A A .  43 GLU HG3  1 1 
        1   664 1 1  43 GLU N    N  -8.075   1.427  -4.425 1.00 . A A .  43 GLU N    1 1 
        1   665 1 1  43 GLU O    O  -7.251   3.546  -2.458 1.00 . A A .  43 GLU O    1 1 
        1   666 1 1  43 GLU OE1  O  -9.327   5.783  -7.161 1.00 . A A .  43 GLU OE1  1 1 
        1   667 1 1  43 GLU OE2  O  -8.385   7.226  -5.815 1.00 . A A .  43 GLU OE2  1 1 
        1   668 1 1  44 MET C    C  -4.052   5.104  -2.584 1.00 . A A .  44 MET C    1 1 
        1   669 1 1  44 MET CA   C  -4.466   3.635  -2.389 1.00 . A A .  44 MET CA   1 1 
        1   670 1 1  44 MET CB   C  -3.217   2.752  -2.259 1.00 . A A .  44 MET CB   1 1 
        1   671 1 1  44 MET CE   C  -0.109   2.359  -2.683 1.00 . A A .  44 MET CE   1 1 
        1   672 1 1  44 MET CG   C  -2.265   3.187  -1.153 1.00 . A A .  44 MET CG   1 1 
        1   673 1 1  44 MET H    H  -4.856   2.835  -4.314 1.00 . A A .  44 MET H    1 1 
        1   674 1 1  44 MET HA   H  -5.046   3.552  -1.480 1.00 . A A .  44 MET HA   1 1 
        1   675 1 1  44 MET HB2  H  -3.527   1.737  -2.058 1.00 . A A .  44 MET HB2  1 1 
        1   676 1 1  44 MET HB3  H  -2.677   2.771  -3.196 1.00 . A A .  44 MET HB3  1 1 
        1   677 1 1  44 MET HE1  H   0.118   3.402  -2.847 1.00 . A A .  44 MET HE1  1 1 
        1   678 1 1  44 MET HE2  H  -0.825   2.027  -3.419 1.00 . A A .  44 MET HE2  1 1 
        1   679 1 1  44 MET HE3  H   0.796   1.774  -2.774 1.00 . A A .  44 MET HE3  1 1 
        1   680 1 1  44 MET HG2  H  -1.951   4.203  -1.343 1.00 . A A .  44 MET HG2  1 1 
        1   681 1 1  44 MET HG3  H  -2.789   3.146  -0.208 1.00 . A A .  44 MET HG3  1 1 
        1   682 1 1  44 MET N    N  -5.295   3.166  -3.503 1.00 . A A .  44 MET N    1 1 
        1   683 1 1  44 MET O    O  -3.295   5.428  -3.500 1.00 . A A .  44 MET O    1 1 
        1   684 1 1  44 MET SD   S  -0.797   2.146  -1.042 1.00 . A A .  44 MET SD   1 1 
        1   685 1 1  45 ILE C    C  -2.976   7.718  -0.931 1.00 . A A .  45 ILE C    1 1 
        1   686 1 1  45 ILE CA   C  -4.211   7.414  -1.794 1.00 . A A .  45 ILE CA   1 1 
        1   687 1 1  45 ILE CB   C  -5.390   8.325  -1.333 1.00 . A A .  45 ILE CB   1 1 
        1   688 1 1  45 ILE CD1  C  -7.299   6.853  -2.244 1.00 . A A .  45 ILE CD1  1 1 
        1   689 1 1  45 ILE CG1  C  -6.607   8.202  -2.278 1.00 . A A .  45 ILE CG1  1 1 
        1   690 1 1  45 ILE CG2  C  -4.938   9.785  -1.240 1.00 . A A .  45 ILE CG2  1 1 
        1   691 1 1  45 ILE H    H  -5.166   5.677  -1.024 1.00 . A A .  45 ILE H    1 1 
        1   692 1 1  45 ILE HA   H  -3.983   7.654  -2.827 1.00 . A A .  45 ILE HA   1 1 
        1   693 1 1  45 ILE HB   H  -5.683   8.009  -0.343 1.00 . A A .  45 ILE HB   1 1 
        1   694 1 1  45 ILE HD11 H  -7.654   6.655  -1.244 1.00 . A A .  45 ILE HD11 1 1 
        1   695 1 1  45 ILE HD12 H  -6.604   6.083  -2.540 1.00 . A A .  45 ILE HD12 1 1 
        1   696 1 1  45 ILE HD13 H  -8.138   6.862  -2.926 1.00 . A A .  45 ILE HD13 1 1 
        1   697 1 1  45 ILE HG12 H  -7.341   8.947  -2.006 1.00 . A A .  45 ILE HG12 1 1 
        1   698 1 1  45 ILE HG13 H  -6.284   8.382  -3.293 1.00 . A A .  45 ILE HG13 1 1 
        1   699 1 1  45 ILE HG21 H  -5.771  10.404  -0.938 1.00 . A A .  45 ILE HG21 1 1 
        1   700 1 1  45 ILE HG22 H  -4.575  10.115  -2.203 1.00 . A A .  45 ILE HG22 1 1 
        1   701 1 1  45 ILE HG23 H  -4.145   9.873  -0.510 1.00 . A A .  45 ILE HG23 1 1 
        1   702 1 1  45 ILE N    N  -4.553   5.988  -1.724 1.00 . A A .  45 ILE N    1 1 
        1   703 1 1  45 ILE O    O  -3.039   7.669   0.297 1.00 . A A .  45 ILE O    1 1 
        1   704 1 1  46 ARG C    C  -0.419   9.842  -0.679 1.00 . A A .  46 ARG C    1 1 
        1   705 1 1  46 ARG CA   C  -0.612   8.327  -0.857 1.00 . A A .  46 ARG CA   1 1 
        1   706 1 1  46 ARG CB   C   0.606   7.741  -1.588 1.00 . A A .  46 ARG CB   1 1 
        1   707 1 1  46 ARG CD   C   3.142   7.499  -1.598 1.00 . A A .  46 ARG CD   1 1 
        1   708 1 1  46 ARG CG   C   1.900   7.862  -0.784 1.00 . A A .  46 ARG CG   1 1 
        1   709 1 1  46 ARG CZ   C   3.761   9.691  -2.521 1.00 . A A .  46 ARG CZ   1 1 
        1   710 1 1  46 ARG H    H  -1.855   8.045  -2.555 1.00 . A A .  46 ARG H    1 1 
        1   711 1 1  46 ARG HA   H  -0.678   7.871   0.124 1.00 . A A .  46 ARG HA   1 1 
        1   712 1 1  46 ARG HB2  H   0.424   6.696  -1.790 1.00 . A A .  46 ARG HB2  1 1 
        1   713 1 1  46 ARG HB3  H   0.738   8.263  -2.526 1.00 . A A .  46 ARG HB3  1 1 
        1   714 1 1  46 ARG HD2  H   3.999   7.487  -0.938 1.00 . A A .  46 ARG HD2  1 1 
        1   715 1 1  46 ARG HD3  H   3.005   6.513  -2.018 1.00 . A A .  46 ARG HD3  1 1 
        1   716 1 1  46 ARG HE   H   3.302   8.112  -3.602 1.00 . A A .  46 ARG HE   1 1 
        1   717 1 1  46 ARG HG2  H   2.002   8.880  -0.442 1.00 . A A .  46 ARG HG2  1 1 
        1   718 1 1  46 ARG HG3  H   1.839   7.203   0.071 1.00 . A A .  46 ARG HG3  1 1 
        1   719 1 1  46 ARG HH11 H   3.745   9.632  -0.531 1.00 . A A .  46 ARG HH11 1 1 
        1   720 1 1  46 ARG HH12 H   4.189  11.143  -1.230 1.00 . A A .  46 ARG HH12 1 1 
        1   721 1 1  46 ARG HH21 H   3.884  10.047  -4.467 1.00 . A A .  46 ARG HH21 1 1 
        1   722 1 1  46 ARG HH22 H   4.265  11.383  -3.441 1.00 . A A .  46 ARG HH22 1 1 
        1   723 1 1  46 ARG N    N  -1.852   8.023  -1.576 1.00 . A A .  46 ARG N    1 1 
        1   724 1 1  46 ARG NE   N   3.396   8.444  -2.685 1.00 . A A .  46 ARG NE   1 1 
        1   725 1 1  46 ARG NH1  N   3.909  10.195  -1.333 1.00 . A A .  46 ARG NH1  1 1 
        1   726 1 1  46 ARG NH2  N   3.986  10.432  -3.553 1.00 . A A .  46 ARG NH2  1 1 
        1   727 1 1  46 ARG O    O  -0.070  10.557  -1.625 1.00 . A A .  46 ARG O    1 1 
        1   728 1 1  47 LYS C    C   1.027  11.856   1.476 1.00 . A A .  47 LYS C    1 1 
        1   729 1 1  47 LYS CA   C  -0.380  11.726   0.878 1.00 . A A .  47 LYS CA   1 1 
        1   730 1 1  47 LYS CB   C  -1.428  12.258   1.865 1.00 . A A .  47 LYS CB   1 1 
        1   731 1 1  47 LYS CD   C  -3.869  12.807   2.250 1.00 . A A .  47 LYS CD   1 1 
        1   732 1 1  47 LYS CE   C  -3.840  14.285   1.865 1.00 . A A .  47 LYS CE   1 1 
        1   733 1 1  47 LYS CG   C  -2.871  11.988   1.436 1.00 . A A .  47 LYS CG   1 1 
        1   734 1 1  47 LYS H    H  -1.035   9.734   1.219 1.00 . A A .  47 LYS H    1 1 
        1   735 1 1  47 LYS HA   H  -0.425  12.309  -0.031 1.00 . A A .  47 LYS HA   1 1 
        1   736 1 1  47 LYS HB2  H  -1.268  11.794   2.828 1.00 . A A .  47 LYS HB2  1 1 
        1   737 1 1  47 LYS HB3  H  -1.299  13.327   1.966 1.00 . A A .  47 LYS HB3  1 1 
        1   738 1 1  47 LYS HD2  H  -4.862  12.422   2.071 1.00 . A A .  47 LYS HD2  1 1 
        1   739 1 1  47 LYS HD3  H  -3.630  12.711   3.300 1.00 . A A .  47 LYS HD3  1 1 
        1   740 1 1  47 LYS HE2  H  -4.432  14.843   2.579 1.00 . A A .  47 LYS HE2  1 1 
        1   741 1 1  47 LYS HE3  H  -2.817  14.637   1.898 1.00 . A A .  47 LYS HE3  1 1 
        1   742 1 1  47 LYS HG2  H  -2.980  12.240   0.390 1.00 . A A .  47 LYS HG2  1 1 
        1   743 1 1  47 LYS HG3  H  -3.085  10.936   1.576 1.00 . A A .  47 LYS HG3  1 1 
        1   744 1 1  47 LYS HZ1  H  -5.378  14.185   0.450 1.00 . A A .  47 LYS HZ1  1 1 
        1   745 1 1  47 LYS HZ2  H  -3.832  14.000  -0.211 1.00 . A A .  47 LYS HZ2  1 1 
        1   746 1 1  47 LYS HZ3  H  -4.369  15.528   0.267 1.00 . A A .  47 LYS HZ3  1 1 
        1   747 1 1  47 LYS N    N  -0.659  10.328   0.534 1.00 . A A .  47 LYS N    1 1 
        1   748 1 1  47 LYS NZ   N  -4.390  14.516   0.499 1.00 . A A .  47 LYS NZ   1 1 
        1   749 1 1  47 LYS O    O   1.641  10.856   1.841 1.00 . A A .  47 LYS O    1 1 
        1   750 1 1  48 ILE C    C   3.160  14.762   2.482 1.00 . A A .  48 ILE C    1 1 
        1   751 1 1  48 ILE CA   C   2.903  13.293   2.089 1.00 . A A .  48 ILE CA   1 1 
        1   752 1 1  48 ILE CB   C   3.970  12.822   1.056 1.00 . A A .  48 ILE CB   1 1 
        1   753 1 1  48 ILE CD1  C   6.493  12.637   0.651 1.00 . A A .  48 ILE CD1  1 1 
        1   754 1 1  48 ILE CG1  C   5.389  13.097   1.582 1.00 . A A .  48 ILE CG1  1 1 
        1   755 1 1  48 ILE CG2  C   3.752  13.481  -0.309 1.00 . A A .  48 ILE CG2  1 1 
        1   756 1 1  48 ILE H    H   0.993  13.853   1.322 1.00 . A A .  48 ILE H    1 1 
        1   757 1 1  48 ILE HA   H   3.014  12.682   2.977 1.00 . A A .  48 ILE HA   1 1 
        1   758 1 1  48 ILE HB   H   3.852  11.755   0.925 1.00 . A A .  48 ILE HB   1 1 
        1   759 1 1  48 ILE HD11 H   6.378  11.583   0.449 1.00 . A A .  48 ILE HD11 1 1 
        1   760 1 1  48 ILE HD12 H   7.451  12.812   1.116 1.00 . A A .  48 ILE HD12 1 1 
        1   761 1 1  48 ILE HD13 H   6.437  13.191  -0.276 1.00 . A A .  48 ILE HD13 1 1 
        1   762 1 1  48 ILE HG12 H   5.511  14.159   1.734 1.00 . A A .  48 ILE HG12 1 1 
        1   763 1 1  48 ILE HG13 H   5.519  12.587   2.526 1.00 . A A .  48 ILE HG13 1 1 
        1   764 1 1  48 ILE HG21 H   3.821  14.555  -0.206 1.00 . A A .  48 ILE HG21 1 1 
        1   765 1 1  48 ILE HG22 H   2.774  13.219  -0.686 1.00 . A A .  48 ILE HG22 1 1 
        1   766 1 1  48 ILE HG23 H   4.507  13.137  -1.003 1.00 . A A .  48 ILE HG23 1 1 
        1   767 1 1  48 ILE N    N   1.540  13.080   1.578 1.00 . A A .  48 ILE N    1 1 
        1   768 1 1  48 ILE O    O   3.567  15.051   3.610 1.00 . A A .  48 ILE O    1 1 
        1   769 1 1  49 GLY C    C   2.680  17.982   0.669 1.00 . A A .  49 GLY C    1 1 
        1   770 1 1  49 GLY CA   C   3.162  17.095   1.809 1.00 . A A .  49 GLY CA   1 1 
        1   771 1 1  49 GLY H    H   2.547  15.403   0.692 1.00 . A A .  49 GLY H    1 1 
        1   772 1 1  49 GLY HA2  H   2.652  17.384   2.718 1.00 . A A .  49 GLY HA2  1 1 
        1   773 1 1  49 GLY HA3  H   4.224  17.244   1.944 1.00 . A A .  49 GLY HA3  1 1 
        1   774 1 1  49 GLY N    N   2.910  15.682   1.556 1.00 . A A .  49 GLY N    1 1 
        1   775 1 1  49 GLY O    O   3.022  17.740  -0.493 1.00 . A A .  49 GLY O    1 1 
        1   776 1 1  50 ASP C    C   0.225  19.222  -0.846 1.00 . A A .  50 ASP C    1 1 
        1   777 1 1  50 ASP CA   C   1.294  19.917   0.018 1.00 . A A .  50 ASP CA   1 1 
        1   778 1 1  50 ASP CB   C   2.374  20.546  -0.876 1.00 . A A .  50 ASP CB   1 1 
        1   779 1 1  50 ASP CG   C   1.784  21.510  -1.887 1.00 . A A .  50 ASP CG   1 1 
        1   780 1 1  50 ASP H    H   1.690  19.148   1.954 1.00 . A A .  50 ASP H    1 1 
        1   781 1 1  50 ASP HA   H   0.810  20.707   0.575 1.00 . A A .  50 ASP HA   1 1 
        1   782 1 1  50 ASP HB2  H   3.076  21.085  -0.256 1.00 . A A .  50 ASP HB2  1 1 
        1   783 1 1  50 ASP HB3  H   2.898  19.763  -1.408 1.00 . A A .  50 ASP HB3  1 1 
        1   784 1 1  50 ASP N    N   1.886  19.001   1.004 1.00 . A A .  50 ASP N    1 1 
        1   785 1 1  50 ASP O    O  -0.964  19.523  -0.738 1.00 . A A .  50 ASP O    1 1 
        1   786 1 1  50 ASP OD1  O   1.380  22.621  -1.484 1.00 . A A .  50 ASP OD1  1 1 
        1   787 1 1  50 ASP OD2  O   1.695  21.156  -3.081 1.00 . A A .  50 ASP OD2  1 1 
        1   788 1 1  51 THR C    C  -0.258  16.072  -2.290 1.00 . A A .  51 THR C    1 1 
        1   789 1 1  51 THR CA   C  -0.248  17.577  -2.606 1.00 . A A .  51 THR CA   1 1 
        1   790 1 1  51 THR CB   C   0.146  17.793  -4.090 1.00 . A A .  51 THR CB   1 1 
        1   791 1 1  51 THR CG2  C   1.539  17.236  -4.383 1.00 . A A .  51 THR CG2  1 1 
        1   792 1 1  51 THR H    H   1.622  18.107  -1.742 1.00 . A A .  51 THR H    1 1 
        1   793 1 1  51 THR HA   H  -1.247  17.968  -2.462 1.00 . A A .  51 THR HA   1 1 
        1   794 1 1  51 THR HB   H   0.153  18.856  -4.289 1.00 . A A .  51 THR HB   1 1 
        1   795 1 1  51 THR HG1  H  -1.333  17.853  -5.398 1.00 . A A .  51 THR HG1  1 1 
        1   796 1 1  51 THR HG21 H   1.777  17.387  -5.427 1.00 . A A .  51 THR HG21 1 1 
        1   797 1 1  51 THR HG22 H   1.560  16.178  -4.161 1.00 . A A .  51 THR HG22 1 1 
        1   798 1 1  51 THR HG23 H   2.269  17.746  -3.772 1.00 . A A .  51 THR HG23 1 1 
        1   799 1 1  51 THR N    N   0.660  18.305  -1.708 1.00 . A A .  51 THR N    1 1 
        1   800 1 1  51 THR O    O   0.343  15.630  -1.307 1.00 . A A .  51 THR O    1 1 
        1   801 1 1  51 THR OG1  O  -0.815  17.171  -4.956 1.00 . A A .  51 THR OG1  1 1 
        1   802 1 1  52 SER C    C  -1.531  13.121  -4.186 1.00 . A A .  52 SER C    1 1 
        1   803 1 1  52 SER CA   C  -1.039  13.834  -2.921 1.00 . A A .  52 SER CA   1 1 
        1   804 1 1  52 SER CB   C  -1.960  13.500  -1.737 1.00 . A A .  52 SER CB   1 1 
        1   805 1 1  52 SER H    H  -1.407  15.695  -3.887 1.00 . A A .  52 SER H    1 1 
        1   806 1 1  52 SER HA   H  -0.044  13.476  -2.695 1.00 . A A .  52 SER HA   1 1 
        1   807 1 1  52 SER HB2  H  -2.088  12.430  -1.676 1.00 . A A .  52 SER HB2  1 1 
        1   808 1 1  52 SER HB3  H  -1.507  13.856  -0.823 1.00 . A A .  52 SER HB3  1 1 
        1   809 1 1  52 SER HG   H  -3.385  14.362  -2.790 1.00 . A A .  52 SER HG   1 1 
        1   810 1 1  52 SER N    N  -0.950  15.289  -3.116 1.00 . A A .  52 SER N    1 1 
        1   811 1 1  52 SER O    O  -2.194  13.721  -5.032 1.00 . A A .  52 SER O    1 1 
        1   812 1 1  52 SER OG   O  -3.242  14.101  -1.870 1.00 . A A .  52 SER OG   1 1 
        1   813 1 1  53 VAL C    C  -2.057   9.642  -5.100 1.00 . A A .  53 VAL C    1 1 
        1   814 1 1  53 VAL CA   C  -1.560  11.046  -5.490 1.00 . A A .  53 VAL CA   1 1 
        1   815 1 1  53 VAL CB   C  -0.338  10.927  -6.442 1.00 . A A .  53 VAL CB   1 1 
        1   816 1 1  53 VAL CG1  C   0.852  10.292  -5.722 1.00 . A A .  53 VAL CG1  1 1 
        1   817 1 1  53 VAL CG2  C  -0.698  10.145  -7.708 1.00 . A A .  53 VAL CG2  1 1 
        1   818 1 1  53 VAL H    H  -0.730  11.395  -3.568 1.00 . A A .  53 VAL H    1 1 
        1   819 1 1  53 VAL HA   H  -2.352  11.563  -6.018 1.00 . A A .  53 VAL HA   1 1 
        1   820 1 1  53 VAL HB   H  -0.049  11.926  -6.739 1.00 . A A .  53 VAL HB   1 1 
        1   821 1 1  53 VAL HG11 H   1.115  10.892  -4.863 1.00 . A A .  53 VAL HG11 1 1 
        1   822 1 1  53 VAL HG12 H   1.696  10.241  -6.393 1.00 . A A .  53 VAL HG12 1 1 
        1   823 1 1  53 VAL HG13 H   0.590   9.294  -5.396 1.00 . A A .  53 VAL HG13 1 1 
        1   824 1 1  53 VAL HG21 H   0.157  10.109  -8.369 1.00 . A A .  53 VAL HG21 1 1 
        1   825 1 1  53 VAL HG22 H  -1.519  10.634  -8.213 1.00 . A A .  53 VAL HG22 1 1 
        1   826 1 1  53 VAL HG23 H  -0.988   9.138  -7.445 1.00 . A A .  53 VAL HG23 1 1 
        1   827 1 1  53 VAL N    N  -1.212  11.834  -4.302 1.00 . A A .  53 VAL N    1 1 
        1   828 1 1  53 VAL O    O  -1.612   9.071  -4.105 1.00 . A A .  53 VAL O    1 1 
        1   829 1 1  54 SER C    C  -3.159   6.731  -6.661 1.00 . A A .  54 SER C    1 1 
        1   830 1 1  54 SER CA   C  -3.557   7.766  -5.600 1.00 . A A .  54 SER CA   1 1 
        1   831 1 1  54 SER CB   C  -5.087   7.850  -5.513 1.00 . A A .  54 SER CB   1 1 
        1   832 1 1  54 SER H    H  -3.292   9.585  -6.672 1.00 . A A .  54 SER H    1 1 
        1   833 1 1  54 SER HA   H  -3.175   7.439  -4.642 1.00 . A A .  54 SER HA   1 1 
        1   834 1 1  54 SER HB2  H  -5.485   6.878  -5.265 1.00 . A A .  54 SER HB2  1 1 
        1   835 1 1  54 SER HB3  H  -5.362   8.556  -4.742 1.00 . A A .  54 SER HB3  1 1 
        1   836 1 1  54 SER HG   H  -6.573   7.949  -6.794 1.00 . A A .  54 SER HG   1 1 
        1   837 1 1  54 SER N    N  -2.984   9.094  -5.883 1.00 . A A .  54 SER N    1 1 
        1   838 1 1  54 SER O    O  -2.736   7.081  -7.764 1.00 . A A .  54 SER O    1 1 
        1   839 1 1  54 SER OG   O  -5.661   8.273  -6.742 1.00 . A A .  54 SER OG   1 1 
        1   840 1 1  55 TYR C    C  -4.047   3.254  -7.201 1.00 . A A .  55 TYR C    1 1 
        1   841 1 1  55 TYR CA   C  -2.975   4.352  -7.239 1.00 . A A .  55 TYR CA   1 1 
        1   842 1 1  55 TYR CB   C  -1.610   3.749  -6.887 1.00 . A A .  55 TYR CB   1 1 
        1   843 1 1  55 TYR CD1  C  -0.884   2.886  -9.150 1.00 . A A .  55 TYR CD1  1 1 
        1   844 1 1  55 TYR CD2  C  -1.060   1.318  -7.358 1.00 . A A .  55 TYR CD2  1 1 
        1   845 1 1  55 TYR CE1  C  -0.488   1.875 -10.001 1.00 . A A .  55 TYR CE1  1 1 
        1   846 1 1  55 TYR CE2  C  -0.664   0.300  -8.206 1.00 . A A .  55 TYR CE2  1 1 
        1   847 1 1  55 TYR CG   C  -1.178   2.629  -7.815 1.00 . A A .  55 TYR CG   1 1 
        1   848 1 1  55 TYR CZ   C  -0.379   0.585  -9.527 1.00 . A A .  55 TYR CZ   1 1 
        1   849 1 1  55 TYR H    H  -3.617   5.233  -5.416 1.00 . A A .  55 TYR H    1 1 
        1   850 1 1  55 TYR HA   H  -2.930   4.760  -8.241 1.00 . A A .  55 TYR HA   1 1 
        1   851 1 1  55 TYR HB2  H  -0.860   4.524  -6.934 1.00 . A A .  55 TYR HB2  1 1 
        1   852 1 1  55 TYR HB3  H  -1.647   3.355  -5.881 1.00 . A A .  55 TYR HB3  1 1 
        1   853 1 1  55 TYR HD1  H  -0.971   3.897  -9.522 1.00 . A A .  55 TYR HD1  1 1 
        1   854 1 1  55 TYR HD2  H  -1.285   1.099  -6.323 1.00 . A A .  55 TYR HD2  1 1 
        1   855 1 1  55 TYR HE1  H  -0.265   2.098 -11.035 1.00 . A A .  55 TYR HE1  1 1 
        1   856 1 1  55 TYR HE2  H  -0.581  -0.711  -7.833 1.00 . A A .  55 TYR HE2  1 1 
        1   857 1 1  55 TYR HH   H  -0.528  -1.199 -10.234 1.00 . A A .  55 TYR HH   1 1 
        1   858 1 1  55 TYR N    N  -3.297   5.449  -6.317 1.00 . A A .  55 TYR N    1 1 
        1   859 1 1  55 TYR O    O  -4.418   2.774  -6.131 1.00 . A A .  55 TYR O    1 1 
        1   860 1 1  55 TYR OH   O   0.021  -0.422 -10.378 1.00 . A A .  55 TYR OH   1 1 
        1   861 1 1  56 LYS C    C  -4.897   0.426  -8.769 1.00 . A A .  56 LYS C    1 1 
        1   862 1 1  56 LYS CA   C  -5.539   1.794  -8.471 1.00 . A A .  56 LYS CA   1 1 
        1   863 1 1  56 LYS CB   C  -6.574   2.142  -9.552 1.00 . A A .  56 LYS CB   1 1 
        1   864 1 1  56 LYS CD   C  -8.627   1.431 -10.849 1.00 . A A .  56 LYS CD   1 1 
        1   865 1 1  56 LYS CE   C  -9.454   0.234 -11.294 1.00 . A A .  56 LYS CE   1 1 
        1   866 1 1  56 LYS CG   C  -7.588   1.031  -9.808 1.00 . A A .  56 LYS CG   1 1 
        1   867 1 1  56 LYS H    H  -4.195   3.272  -9.196 1.00 . A A .  56 LYS H    1 1 
        1   868 1 1  56 LYS HA   H  -6.046   1.733  -7.517 1.00 . A A .  56 LYS HA   1 1 
        1   869 1 1  56 LYS HB2  H  -7.113   3.029  -9.246 1.00 . A A .  56 LYS HB2  1 1 
        1   870 1 1  56 LYS HB3  H  -6.056   2.351 -10.480 1.00 . A A .  56 LYS HB3  1 1 
        1   871 1 1  56 LYS HD2  H  -9.285   2.173 -10.419 1.00 . A A .  56 LYS HD2  1 1 
        1   872 1 1  56 LYS HD3  H  -8.124   1.851 -11.709 1.00 . A A .  56 LYS HD3  1 1 
        1   873 1 1  56 LYS HE2  H  -9.935  -0.201 -10.429 1.00 . A A .  56 LYS HE2  1 1 
        1   874 1 1  56 LYS HE3  H -10.206   0.570 -11.993 1.00 . A A .  56 LYS HE3  1 1 
        1   875 1 1  56 LYS HG2  H  -7.064   0.156 -10.161 1.00 . A A .  56 LYS HG2  1 1 
        1   876 1 1  56 LYS HG3  H  -8.094   0.799  -8.879 1.00 . A A .  56 LYS HG3  1 1 
        1   877 1 1  56 LYS HZ1  H  -7.870  -1.132 -11.298 1.00 . A A .  56 LYS HZ1  1 1 
        1   878 1 1  56 LYS HZ2  H  -8.155  -0.409 -12.802 1.00 . A A .  56 LYS HZ2  1 1 
        1   879 1 1  56 LYS HZ3  H  -9.193  -1.616 -12.231 1.00 . A A .  56 LYS HZ3  1 1 
        1   880 1 1  56 LYS N    N  -4.529   2.852  -8.374 1.00 . A A .  56 LYS N    1 1 
        1   881 1 1  56 LYS NZ   N  -8.610  -0.803 -11.949 1.00 . A A .  56 LYS NZ   1 1 
        1   882 1 1  56 LYS O    O  -3.902   0.332  -9.492 1.00 . A A .  56 LYS O    1 1 
        1   883 1 1  57 TYR C    C  -5.681  -2.718  -9.549 1.00 . A A .  57 TYR C    1 1 
        1   884 1 1  57 TYR CA   C  -4.971  -1.996  -8.387 1.00 . A A .  57 TYR CA   1 1 
        1   885 1 1  57 TYR CB   C  -5.140  -2.796  -7.088 1.00 . A A .  57 TYR CB   1 1 
        1   886 1 1  57 TYR CD1  C  -4.658  -1.162  -5.213 1.00 . A A .  57 TYR CD1  1 1 
        1   887 1 1  57 TYR CD2  C  -3.103  -2.928  -5.591 1.00 . A A .  57 TYR CD2  1 1 
        1   888 1 1  57 TYR CE1  C  -3.881  -0.696  -4.169 1.00 . A A .  57 TYR CE1  1 1 
        1   889 1 1  57 TYR CE2  C  -2.323  -2.470  -4.549 1.00 . A A .  57 TYR CE2  1 1 
        1   890 1 1  57 TYR CG   C  -4.284  -2.286  -5.942 1.00 . A A .  57 TYR CG   1 1 
        1   891 1 1  57 TYR CZ   C  -2.714  -1.353  -3.841 1.00 . A A .  57 TYR CZ   1 1 
        1   892 1 1  57 TYR H    H  -6.262  -0.487  -7.630 1.00 . A A .  57 TYR H    1 1 
        1   893 1 1  57 TYR HA   H  -3.915  -1.929  -8.618 1.00 . A A .  57 TYR HA   1 1 
        1   894 1 1  57 TYR HB2  H  -6.174  -2.751  -6.775 1.00 . A A .  57 TYR HB2  1 1 
        1   895 1 1  57 TYR HB3  H  -4.871  -3.829  -7.270 1.00 . A A .  57 TYR HB3  1 1 
        1   896 1 1  57 TYR HD1  H  -5.573  -0.650  -5.472 1.00 . A A .  57 TYR HD1  1 1 
        1   897 1 1  57 TYR HD2  H  -2.796  -3.803  -6.147 1.00 . A A .  57 TYR HD2  1 1 
        1   898 1 1  57 TYR HE1  H  -4.191   0.180  -3.617 1.00 . A A .  57 TYR HE1  1 1 
        1   899 1 1  57 TYR HE2  H  -1.409  -2.985  -4.293 1.00 . A A .  57 TYR HE2  1 1 
        1   900 1 1  57 TYR HH   H  -2.490  -0.640  -2.066 1.00 . A A .  57 TYR HH   1 1 
        1   901 1 1  57 TYR N    N  -5.474  -0.629  -8.200 1.00 . A A .  57 TYR N    1 1 
        1   902 1 1  57 TYR O    O  -6.570  -2.159 -10.202 1.00 . A A .  57 TYR O    1 1 
        1   903 1 1  57 TYR OH   O  -1.931  -0.892  -2.806 1.00 . A A .  57 TYR OH   1 1 
        1   904 1 1  58 THR C    C  -6.098  -6.239 -10.413 1.00 . A A .  58 THR C    1 1 
        1   905 1 1  58 THR CA   C  -5.867  -4.790 -10.872 1.00 . A A .  58 THR CA   1 1 
        1   906 1 1  58 THR CB   C  -4.965  -4.807 -12.133 1.00 . A A .  58 THR CB   1 1 
        1   907 1 1  58 THR CG2  C  -3.549  -5.266 -11.793 1.00 . A A .  58 THR CG2  1 1 
        1   908 1 1  58 THR H    H  -4.582  -4.359  -9.231 1.00 . A A .  58 THR H    1 1 
        1   909 1 1  58 THR HA   H  -6.821  -4.357 -11.143 1.00 . A A .  58 THR HA   1 1 
        1   910 1 1  58 THR HB   H  -4.913  -3.802 -12.530 1.00 . A A .  58 THR HB   1 1 
        1   911 1 1  58 THR HG1  H  -4.851  -5.866 -13.805 1.00 . A A .  58 THR HG1  1 1 
        1   912 1 1  58 THR HG21 H  -3.583  -6.260 -11.369 1.00 . A A .  58 THR HG21 1 1 
        1   913 1 1  58 THR HG22 H  -3.110  -4.586 -11.077 1.00 . A A .  58 THR HG22 1 1 
        1   914 1 1  58 THR HG23 H  -2.947  -5.280 -12.691 1.00 . A A .  58 THR HG23 1 1 
        1   915 1 1  58 THR N    N  -5.283  -3.969  -9.793 1.00 . A A .  58 THR N    1 1 
        1   916 1 1  58 THR O    O  -5.431  -6.731  -9.500 1.00 . A A .  58 THR O    1 1 
        1   917 1 1  58 THR OG1  O  -5.526  -5.673 -13.138 1.00 . A A .  58 THR OG1  1 1 
        1   918 1 1  59 SER C    C  -6.407  -9.318 -11.314 1.00 . A A .  59 SER C    1 1 
        1   919 1 1  59 SER CA   C  -7.384  -8.305 -10.697 1.00 . A A .  59 SER CA   1 1 
        1   920 1 1  59 SER CB   C  -8.819  -8.631 -11.147 1.00 . A A .  59 SER CB   1 1 
        1   921 1 1  59 SER H    H  -7.495  -6.501 -11.818 1.00 . A A .  59 SER H    1 1 
        1   922 1 1  59 SER HA   H  -7.334  -8.385  -9.618 1.00 . A A .  59 SER HA   1 1 
        1   923 1 1  59 SER HB2  H  -8.881  -8.563 -12.224 1.00 . A A .  59 SER HB2  1 1 
        1   924 1 1  59 SER HB3  H  -9.069  -9.636 -10.839 1.00 . A A .  59 SER HB3  1 1 
        1   925 1 1  59 SER HG   H  -9.327  -6.900 -10.359 1.00 . A A .  59 SER HG   1 1 
        1   926 1 1  59 SER N    N  -7.035  -6.926 -11.065 1.00 . A A .  59 SER N    1 1 
        1   927 1 1  59 SER O    O  -6.633  -9.817 -12.419 1.00 . A A .  59 SER O    1 1 
        1   928 1 1  59 SER OG   O  -9.765  -7.731 -10.582 1.00 . A A .  59 SER OG   1 1 
        1   929 1 1  60 ARG C    C  -3.739 -11.431  -9.936 1.00 . A A .  60 ARG C    1 1 
        1   930 1 1  60 ARG CA   C  -4.322 -10.587 -11.088 1.00 . A A .  60 ARG CA   1 1 
        1   931 1 1  60 ARG CB   C  -3.184  -9.885 -11.850 1.00 . A A .  60 ARG CB   1 1 
        1   932 1 1  60 ARG CD   C  -1.190  -8.324 -11.782 1.00 . A A .  60 ARG CD   1 1 
        1   933 1 1  60 ARG CG   C  -2.293  -9.005 -10.975 1.00 . A A .  60 ARG CG   1 1 
        1   934 1 1  60 ARG CZ   C   0.876  -9.080 -12.870 1.00 . A A .  60 ARG CZ   1 1 
        1   935 1 1  60 ARG H    H  -5.135  -9.110  -9.781 1.00 . A A .  60 ARG H    1 1 
        1   936 1 1  60 ARG HA   H  -4.832 -11.255 -11.769 1.00 . A A .  60 ARG HA   1 1 
        1   937 1 1  60 ARG HB2  H  -2.562 -10.637 -12.315 1.00 . A A .  60 ARG HB2  1 1 
        1   938 1 1  60 ARG HB3  H  -3.616  -9.266 -12.623 1.00 . A A .  60 ARG HB3  1 1 
        1   939 1 1  60 ARG HD2  H  -1.646  -7.642 -12.485 1.00 . A A .  60 ARG HD2  1 1 
        1   940 1 1  60 ARG HD3  H  -0.558  -7.766 -11.104 1.00 . A A .  60 ARG HD3  1 1 
        1   941 1 1  60 ARG HE   H  -0.781 -10.132 -12.776 1.00 . A A .  60 ARG HE   1 1 
        1   942 1 1  60 ARG HG2  H  -2.902  -8.245 -10.506 1.00 . A A .  60 ARG HG2  1 1 
        1   943 1 1  60 ARG HG3  H  -1.838  -9.619 -10.211 1.00 . A A .  60 ARG HG3  1 1 
        1   944 1 1  60 ARG HH11 H   0.994  -7.261 -12.069 1.00 . A A .  60 ARG HH11 1 1 
        1   945 1 1  60 ARG HH12 H   2.439  -7.850 -12.818 1.00 . A A .  60 ARG HH12 1 1 
        1   946 1 1  60 ARG HH21 H   1.041 -10.839 -13.779 1.00 . A A .  60 ARG HH21 1 1 
        1   947 1 1  60 ARG HH22 H   2.457  -9.843 -13.812 1.00 . A A .  60 ARG HH22 1 1 
        1   948 1 1  60 ARG N    N  -5.306  -9.596 -10.614 1.00 . A A .  60 ARG N    1 1 
        1   949 1 1  60 ARG NE   N  -0.367  -9.285 -12.521 1.00 . A A .  60 ARG NE   1 1 
        1   950 1 1  60 ARG NH1  N   1.481  -7.977 -12.568 1.00 . A A .  60 ARG NH1  1 1 
        1   951 1 1  60 ARG NH2  N   1.508  -9.991 -13.537 1.00 . A A .  60 ARG NH2  1 1 
        1   952 1 1  60 ARG O    O  -2.816 -12.221 -10.145 1.00 . A A .  60 ARG O    1 1 
        1   953 1 1  61 TYR C    C  -4.778 -11.979  -6.390 1.00 . A A .  61 TYR C    1 1 
        1   954 1 1  61 TYR CA   C  -3.771 -11.998  -7.552 1.00 . A A .  61 TYR CA   1 1 
        1   955 1 1  61 TYR CB   C  -2.436 -11.388  -7.091 1.00 . A A .  61 TYR CB   1 1 
        1   956 1 1  61 TYR CD1  C  -2.768  -8.898  -7.447 1.00 . A A .  61 TYR CD1  1 1 
        1   957 1 1  61 TYR CD2  C  -2.437  -9.676  -5.216 1.00 . A A .  61 TYR CD2  1 1 
        1   958 1 1  61 TYR CE1  C  -2.878  -7.601  -6.983 1.00 . A A .  61 TYR CE1  1 1 
        1   959 1 1  61 TYR CE2  C  -2.546  -8.381  -4.747 1.00 . A A .  61 TYR CE2  1 1 
        1   960 1 1  61 TYR CG   C  -2.548  -9.960  -6.575 1.00 . A A .  61 TYR CG   1 1 
        1   961 1 1  61 TYR CZ   C  -2.764  -7.349  -5.633 1.00 . A A .  61 TYR CZ   1 1 
        1   962 1 1  61 TYR H    H  -5.053 -10.685  -8.622 1.00 . A A .  61 TYR H    1 1 
        1   963 1 1  61 TYR HA   H  -3.602 -13.025  -7.844 1.00 . A A .  61 TYR HA   1 1 
        1   964 1 1  61 TYR HB2  H  -2.025 -11.998  -6.298 1.00 . A A .  61 TYR HB2  1 1 
        1   965 1 1  61 TYR HB3  H  -1.744 -11.387  -7.923 1.00 . A A .  61 TYR HB3  1 1 
        1   966 1 1  61 TYR HD1  H  -2.858  -9.097  -8.503 1.00 . A A .  61 TYR HD1  1 1 
        1   967 1 1  61 TYR HD2  H  -2.266 -10.486  -4.521 1.00 . A A .  61 TYR HD2  1 1 
        1   968 1 1  61 TYR HE1  H  -3.051  -6.791  -7.678 1.00 . A A .  61 TYR HE1  1 1 
        1   969 1 1  61 TYR HE2  H  -2.457  -8.181  -3.689 1.00 . A A .  61 TYR HE2  1 1 
        1   970 1 1  61 TYR HH   H  -2.149  -5.877  -4.561 1.00 . A A .  61 TYR HH   1 1 
        1   971 1 1  61 TYR N    N  -4.286 -11.280  -8.728 1.00 . A A .  61 TYR N    1 1 
        1   972 1 1  61 TYR O    O  -5.539 -11.022  -6.225 1.00 . A A .  61 TYR O    1 1 
        1   973 1 1  61 TYR OH   O  -2.873  -6.060  -5.167 1.00 . A A .  61 TYR OH   1 1 
        1   974 1 1  62 VAL C    C  -4.766 -13.094  -3.115 1.00 . A A .  62 VAL C    1 1 
        1   975 1 1  62 VAL CA   C  -5.622 -13.132  -4.396 1.00 . A A .  62 VAL CA   1 1 
        1   976 1 1  62 VAL CB   C  -6.475 -14.427  -4.411 1.00 . A A .  62 VAL CB   1 1 
        1   977 1 1  62 VAL CG1  C  -7.354 -14.524  -3.165 1.00 . A A .  62 VAL CG1  1 1 
        1   978 1 1  62 VAL CG2  C  -7.328 -14.499  -5.677 1.00 . A A .  62 VAL CG2  1 1 
        1   979 1 1  62 VAL H    H  -4.195 -13.800  -5.818 1.00 . A A .  62 VAL H    1 1 
        1   980 1 1  62 VAL HA   H  -6.294 -12.283  -4.394 1.00 . A A .  62 VAL HA   1 1 
        1   981 1 1  62 VAL HB   H  -5.803 -15.275  -4.412 1.00 . A A .  62 VAL HB   1 1 
        1   982 1 1  62 VAL HG11 H  -6.732 -14.513  -2.280 1.00 . A A .  62 VAL HG11 1 1 
        1   983 1 1  62 VAL HG12 H  -7.920 -15.444  -3.193 1.00 . A A .  62 VAL HG12 1 1 
        1   984 1 1  62 VAL HG13 H  -8.034 -13.684  -3.135 1.00 . A A .  62 VAL HG13 1 1 
        1   985 1 1  62 VAL HG21 H  -7.914 -15.408  -5.671 1.00 . A A .  62 VAL HG21 1 1 
        1   986 1 1  62 VAL HG22 H  -6.685 -14.493  -6.547 1.00 . A A .  62 VAL HG22 1 1 
        1   987 1 1  62 VAL HG23 H  -7.990 -13.647  -5.716 1.00 . A A .  62 VAL HG23 1 1 
        1   988 1 1  62 VAL N    N  -4.776 -13.044  -5.593 1.00 . A A .  62 VAL N    1 1 
        1   989 1 1  62 VAL O    O  -3.778 -13.824  -2.993 1.00 . A A .  62 VAL O    1 1 
        1   990 1 1  63 LEU C    C  -4.693 -13.213   0.076 1.00 . A A .  63 LEU C    1 1 
        1   991 1 1  63 LEU CA   C  -4.407 -12.072  -0.913 1.00 . A A .  63 LEU CA   1 1 
        1   992 1 1  63 LEU CB   C  -4.756 -10.725  -0.265 1.00 . A A .  63 LEU CB   1 1 
        1   993 1 1  63 LEU CD1  C  -4.810  -8.207  -0.366 1.00 . A A .  63 LEU CD1  1 1 
        1   994 1 1  63 LEU CD2  C  -2.820  -9.453  -1.268 1.00 . A A .  63 LEU CD2  1 1 
        1   995 1 1  63 LEU CG   C  -4.337  -9.480  -1.064 1.00 . A A .  63 LEU CG   1 1 
        1   996 1 1  63 LEU H    H  -5.971 -11.719  -2.303 1.00 . A A .  63 LEU H    1 1 
        1   997 1 1  63 LEU HA   H  -3.351 -12.078  -1.152 1.00 . A A .  63 LEU HA   1 1 
        1   998 1 1  63 LEU HB2  H  -5.829 -10.691  -0.120 1.00 . A A .  63 LEU HB2  1 1 
        1   999 1 1  63 LEU HB3  H  -4.281 -10.680   0.705 1.00 . A A .  63 LEU HB3  1 1 
        1  1000 1 1  63 LEU HD11 H  -4.342  -8.130   0.607 1.00 . A A .  63 LEU HD11 1 1 
        1  1001 1 1  63 LEU HD12 H  -5.883  -8.240  -0.244 1.00 . A A .  63 LEU HD12 1 1 
        1  1002 1 1  63 LEU HD13 H  -4.544  -7.348  -0.962 1.00 . A A .  63 LEU HD13 1 1 
        1  1003 1 1  63 LEU HD21 H  -2.511 -10.340  -1.801 1.00 . A A .  63 LEU HD21 1 1 
        1  1004 1 1  63 LEU HD22 H  -2.325  -9.418  -0.308 1.00 . A A .  63 LEU HD22 1 1 
        1  1005 1 1  63 LEU HD23 H  -2.549  -8.577  -1.843 1.00 . A A .  63 LEU HD23 1 1 
        1  1006 1 1  63 LEU HG   H  -4.803  -9.515  -2.039 1.00 . A A .  63 LEU HG   1 1 
        1  1007 1 1  63 LEU N    N  -5.153 -12.242  -2.166 1.00 . A A .  63 LEU N    1 1 
        1  1008 1 1  63 LEU O    O  -5.768 -13.284   0.669 1.00 . A A .  63 LEU O    1 1 
        1  1009 1 1  64 LYS C    C  -3.729 -14.739   2.645 1.00 . A A .  64 LYS C    1 1 
        1  1010 1 1  64 LYS CA   C  -3.842 -15.219   1.186 1.00 . A A .  64 LYS CA   1 1 
        1  1011 1 1  64 LYS CB   C  -2.755 -16.263   0.895 1.00 . A A .  64 LYS CB   1 1 
        1  1012 1 1  64 LYS CD   C  -1.676 -17.826  -0.771 1.00 . A A .  64 LYS CD   1 1 
        1  1013 1 1  64 LYS CE   C  -1.745 -18.432  -2.168 1.00 . A A .  64 LYS CE   1 1 
        1  1014 1 1  64 LYS CG   C  -2.807 -16.831  -0.522 1.00 . A A .  64 LYS CG   1 1 
        1  1015 1 1  64 LYS H    H  -2.905 -14.017  -0.289 1.00 . A A .  64 LYS H    1 1 
        1  1016 1 1  64 LYS HA   H  -4.813 -15.673   1.044 1.00 . A A .  64 LYS HA   1 1 
        1  1017 1 1  64 LYS HB2  H  -1.786 -15.805   1.040 1.00 . A A .  64 LYS HB2  1 1 
        1  1018 1 1  64 LYS HB3  H  -2.863 -17.082   1.591 1.00 . A A .  64 LYS HB3  1 1 
        1  1019 1 1  64 LYS HD2  H  -0.731 -17.316  -0.658 1.00 . A A .  64 LYS HD2  1 1 
        1  1020 1 1  64 LYS HD3  H  -1.744 -18.621  -0.040 1.00 . A A .  64 LYS HD3  1 1 
        1  1021 1 1  64 LYS HE2  H  -2.683 -18.960  -2.276 1.00 . A A .  64 LYS HE2  1 1 
        1  1022 1 1  64 LYS HE3  H  -1.697 -17.636  -2.897 1.00 . A A .  64 LYS HE3  1 1 
        1  1023 1 1  64 LYS HG2  H  -3.754 -17.335  -0.661 1.00 . A A .  64 LYS HG2  1 1 
        1  1024 1 1  64 LYS HG3  H  -2.723 -16.019  -1.230 1.00 . A A .  64 LYS HG3  1 1 
        1  1025 1 1  64 LYS HZ1  H  -0.692 -19.758  -3.388 1.00 . A A .  64 LYS HZ1  1 1 
        1  1026 1 1  64 LYS HZ2  H  -0.677 -20.180  -1.749 1.00 . A A .  64 LYS HZ2  1 1 
        1  1027 1 1  64 LYS HZ3  H   0.284 -18.905  -2.308 1.00 . A A .  64 LYS HZ3  1 1 
        1  1028 1 1  64 LYS N    N  -3.722 -14.104   0.242 1.00 . A A .  64 LYS N    1 1 
        1  1029 1 1  64 LYS NZ   N  -0.632 -19.384  -2.420 1.00 . A A .  64 LYS NZ   1 1 
        1  1030 1 1  64 LYS O    O  -3.285 -13.619   2.917 1.00 . A A .  64 LYS O    1 1 
        1  1031 1 1  65 ALA C    C  -2.540 -15.142   5.428 1.00 . A A .  65 ALA C    1 1 
        1  1032 1 1  65 ALA CA   C  -4.013 -15.278   5.010 1.00 . A A .  65 ALA CA   1 1 
        1  1033 1 1  65 ALA CB   C  -4.713 -16.345   5.841 1.00 . A A .  65 ALA CB   1 1 
        1  1034 1 1  65 ALA H    H  -4.518 -16.450   3.313 1.00 . A A .  65 ALA H    1 1 
        1  1035 1 1  65 ALA HA   H  -4.515 -14.334   5.185 1.00 . A A .  65 ALA HA   1 1 
        1  1036 1 1  65 ALA HB1  H  -4.215 -17.295   5.701 1.00 . A A .  65 ALA HB1  1 1 
        1  1037 1 1  65 ALA HB2  H  -5.743 -16.431   5.527 1.00 . A A .  65 ALA HB2  1 1 
        1  1038 1 1  65 ALA HB3  H  -4.679 -16.072   6.885 1.00 . A A .  65 ALA HB3  1 1 
        1  1039 1 1  65 ALA N    N  -4.130 -15.592   3.583 1.00 . A A .  65 ALA N    1 1 
        1  1040 1 1  65 ALA O    O  -1.780 -16.117   5.399 1.00 . A A .  65 ALA O    1 1 
        1  1041 1 1  66 GLY C    C   0.111 -13.191   5.008 1.00 . A A .  66 GLY C    1 1 
        1  1042 1 1  66 GLY CA   C  -0.754 -13.664   6.177 1.00 . A A .  66 GLY CA   1 1 
        1  1043 1 1  66 GLY H    H  -2.793 -13.197   5.815 1.00 . A A .  66 GLY H    1 1 
        1  1044 1 1  66 GLY HA2  H  -0.748 -12.899   6.941 1.00 . A A .  66 GLY HA2  1 1 
        1  1045 1 1  66 GLY HA3  H  -0.322 -14.565   6.586 1.00 . A A .  66 GLY HA3  1 1 
        1  1046 1 1  66 GLY N    N  -2.139 -13.926   5.794 1.00 . A A .  66 GLY N    1 1 
        1  1047 1 1  66 GLY O    O   1.330 -13.072   5.138 1.00 . A A .  66 GLY O    1 1 
        1  1048 1 1  67 GLN C    C   0.439 -10.963   2.648 1.00 . A A .  67 GLN C    1 1 
        1  1049 1 1  67 GLN CA   C   0.203 -12.484   2.665 1.00 . A A .  67 GLN CA   1 1 
        1  1050 1 1  67 GLN CB   C  -0.579 -12.908   1.411 1.00 . A A .  67 GLN CB   1 1 
        1  1051 1 1  67 GLN CD   C   1.483 -13.149  -0.060 1.00 . A A .  67 GLN CD   1 1 
        1  1052 1 1  67 GLN CG   C   0.093 -12.548   0.085 1.00 . A A .  67 GLN CG   1 1 
        1  1053 1 1  67 GLN H    H  -1.495 -12.998   3.835 1.00 . A A .  67 GLN H    1 1 
        1  1054 1 1  67 GLN HA   H   1.162 -12.983   2.661 1.00 . A A .  67 GLN HA   1 1 
        1  1055 1 1  67 GLN HB2  H  -0.718 -13.979   1.437 1.00 . A A .  67 GLN HB2  1 1 
        1  1056 1 1  67 GLN HB3  H  -1.551 -12.433   1.436 1.00 . A A .  67 GLN HB3  1 1 
        1  1057 1 1  67 GLN HE21 H   2.319 -11.471   0.581 1.00 . A A .  67 GLN HE21 1 1 
        1  1058 1 1  67 GLN HE22 H   3.402 -12.757   0.193 1.00 . A A .  67 GLN HE22 1 1 
        1  1059 1 1  67 GLN HG2  H  -0.522 -12.912  -0.726 1.00 . A A .  67 GLN HG2  1 1 
        1  1060 1 1  67 GLN HG3  H   0.172 -11.472   0.016 1.00 . A A .  67 GLN HG3  1 1 
        1  1061 1 1  67 GLN N    N  -0.519 -12.912   3.870 1.00 . A A .  67 GLN N    1 1 
        1  1062 1 1  67 GLN NE2  N   2.503 -12.382   0.272 1.00 . A A .  67 GLN NE2  1 1 
        1  1063 1 1  67 GLN O    O  -0.502 -10.170   2.727 1.00 . A A .  67 GLN O    1 1 
        1  1064 1 1  67 GLN OE1  O   1.643 -14.282  -0.503 1.00 . A A .  67 GLN OE1  1 1 
        1  1065 1 1  68 THR C    C   2.217  -8.727   0.969 1.00 . A A .  68 THR C    1 1 
        1  1066 1 1  68 THR CA   C   2.070  -9.143   2.437 1.00 . A A .  68 THR CA   1 1 
        1  1067 1 1  68 THR CB   C   3.404  -8.832   3.158 1.00 . A A .  68 THR CB   1 1 
        1  1068 1 1  68 THR CG2  C   3.313  -9.152   4.647 1.00 . A A .  68 THR CG2  1 1 
        1  1069 1 1  68 THR H    H   2.422 -11.236   2.582 1.00 . A A .  68 THR H    1 1 
        1  1070 1 1  68 THR HA   H   1.289  -8.552   2.895 1.00 . A A .  68 THR HA   1 1 
        1  1071 1 1  68 THR HB   H   3.620  -7.778   3.044 1.00 . A A .  68 THR HB   1 1 
        1  1072 1 1  68 THR HG1  H   5.034  -9.006   2.041 1.00 . A A .  68 THR HG1  1 1 
        1  1073 1 1  68 THR HG21 H   2.529  -8.561   5.096 1.00 . A A .  68 THR HG21 1 1 
        1  1074 1 1  68 THR HG22 H   4.255  -8.923   5.122 1.00 . A A .  68 THR HG22 1 1 
        1  1075 1 1  68 THR HG23 H   3.091 -10.202   4.777 1.00 . A A .  68 THR HG23 1 1 
        1  1076 1 1  68 THR N    N   1.707 -10.563   2.556 1.00 . A A .  68 THR N    1 1 
        1  1077 1 1  68 THR O    O   2.570  -9.542   0.116 1.00 . A A .  68 THR O    1 1 
        1  1078 1 1  68 THR OG1  O   4.472  -9.594   2.570 1.00 . A A .  68 THR OG1  1 1 
        1  1079 1 1  69 VAL C    C   2.813  -5.536  -0.626 1.00 . A A .  69 VAL C    1 1 
        1  1080 1 1  69 VAL CA   C   2.129  -6.915  -0.674 1.00 . A A .  69 VAL CA   1 1 
        1  1081 1 1  69 VAL CB   C   0.782  -6.824  -1.444 1.00 . A A .  69 VAL CB   1 1 
        1  1082 1 1  69 VAL CG1  C  -0.244  -5.985  -0.682 1.00 . A A .  69 VAL CG1  1 1 
        1  1083 1 1  69 VAL CG2  C   0.999  -6.275  -2.854 1.00 . A A .  69 VAL CG2  1 1 
        1  1084 1 1  69 VAL H    H   1.620  -6.868   1.388 1.00 . A A .  69 VAL H    1 1 
        1  1085 1 1  69 VAL HA   H   2.776  -7.598  -1.215 1.00 . A A .  69 VAL HA   1 1 
        1  1086 1 1  69 VAL HB   H   0.385  -7.827  -1.536 1.00 . A A .  69 VAL HB   1 1 
        1  1087 1 1  69 VAL HG11 H   0.129  -4.979  -0.560 1.00 . A A .  69 VAL HG11 1 1 
        1  1088 1 1  69 VAL HG12 H  -0.416  -6.422   0.291 1.00 . A A .  69 VAL HG12 1 1 
        1  1089 1 1  69 VAL HG13 H  -1.172  -5.960  -1.234 1.00 . A A .  69 VAL HG13 1 1 
        1  1090 1 1  69 VAL HG21 H   0.053  -6.229  -3.376 1.00 . A A .  69 VAL HG21 1 1 
        1  1091 1 1  69 VAL HG22 H   1.675  -6.923  -3.394 1.00 . A A .  69 VAL HG22 1 1 
        1  1092 1 1  69 VAL HG23 H   1.425  -5.284  -2.796 1.00 . A A .  69 VAL HG23 1 1 
        1  1093 1 1  69 VAL N    N   1.948  -7.458   0.677 1.00 . A A .  69 VAL N    1 1 
        1  1094 1 1  69 VAL O    O   2.350  -4.614   0.052 1.00 . A A .  69 VAL O    1 1 
        1  1095 1 1  70 THR C    C   4.544  -3.356  -2.591 1.00 . A A .  70 THR C    1 1 
        1  1096 1 1  70 THR CA   C   4.742  -4.191  -1.319 1.00 . A A .  70 THR CA   1 1 
        1  1097 1 1  70 THR CB   C   6.244  -4.538  -1.189 1.00 . A A .  70 THR CB   1 1 
        1  1098 1 1  70 THR CG2  C   7.090  -3.285  -1.030 1.00 . A A .  70 THR CG2  1 1 
        1  1099 1 1  70 THR H    H   4.225  -6.170  -1.888 1.00 . A A .  70 THR H    1 1 
        1  1100 1 1  70 THR HA   H   4.454  -3.601  -0.458 1.00 . A A .  70 THR HA   1 1 
        1  1101 1 1  70 THR HB   H   6.556  -5.052  -2.088 1.00 . A A .  70 THR HB   1 1 
        1  1102 1 1  70 THR HG1  H   6.208  -6.313  -0.310 1.00 . A A .  70 THR HG1  1 1 
        1  1103 1 1  70 THR HG21 H   6.769  -2.739  -0.154 1.00 . A A .  70 THR HG21 1 1 
        1  1104 1 1  70 THR HG22 H   6.977  -2.659  -1.905 1.00 . A A .  70 THR HG22 1 1 
        1  1105 1 1  70 THR HG23 H   8.129  -3.561  -0.919 1.00 . A A .  70 THR HG23 1 1 
        1  1106 1 1  70 THR N    N   3.928  -5.412  -1.337 1.00 . A A .  70 THR N    1 1 
        1  1107 1 1  70 THR O    O   4.669  -3.866  -3.703 1.00 . A A .  70 THR O    1 1 
        1  1108 1 1  70 THR OG1  O   6.460  -5.407  -0.065 1.00 . A A .  70 THR OG1  1 1 
        1  1109 1 1  71 ILE C    C   5.369  -0.308  -3.741 1.00 . A A .  71 ILE C    1 1 
        1  1110 1 1  71 ILE CA   C   4.095  -1.152  -3.555 1.00 . A A .  71 ILE CA   1 1 
        1  1111 1 1  71 ILE CB   C   2.879  -0.209  -3.366 1.00 . A A .  71 ILE CB   1 1 
        1  1112 1 1  71 ILE CD1  C   1.234  -1.965  -4.251 1.00 . A A .  71 ILE CD1  1 1 
        1  1113 1 1  71 ILE CG1  C   1.593  -1.021  -3.120 1.00 . A A .  71 ILE CG1  1 1 
        1  1114 1 1  71 ILE CG2  C   2.712   0.706  -4.582 1.00 . A A .  71 ILE CG2  1 1 
        1  1115 1 1  71 ILE H    H   4.078  -1.739  -1.519 1.00 . A A .  71 ILE H    1 1 
        1  1116 1 1  71 ILE HA   H   3.933  -1.740  -4.451 1.00 . A A .  71 ILE HA   1 1 
        1  1117 1 1  71 ILE HB   H   3.069   0.415  -2.503 1.00 . A A .  71 ILE HB   1 1 
        1  1118 1 1  71 ILE HD11 H   0.315  -2.479  -4.011 1.00 . A A .  71 ILE HD11 1 1 
        1  1119 1 1  71 ILE HD12 H   2.024  -2.687  -4.386 1.00 . A A .  71 ILE HD12 1 1 
        1  1120 1 1  71 ILE HD13 H   1.100  -1.402  -5.164 1.00 . A A .  71 ILE HD13 1 1 
        1  1121 1 1  71 ILE HG12 H   1.712  -1.613  -2.224 1.00 . A A .  71 ILE HG12 1 1 
        1  1122 1 1  71 ILE HG13 H   0.765  -0.338  -2.983 1.00 . A A .  71 ILE HG13 1 1 
        1  1123 1 1  71 ILE HG21 H   1.863   1.355  -4.431 1.00 . A A .  71 ILE HG21 1 1 
        1  1124 1 1  71 ILE HG22 H   2.553   0.107  -5.468 1.00 . A A .  71 ILE HG22 1 1 
        1  1125 1 1  71 ILE HG23 H   3.604   1.305  -4.709 1.00 . A A .  71 ILE HG23 1 1 
        1  1126 1 1  71 ILE N    N   4.233  -2.073  -2.424 1.00 . A A .  71 ILE N    1 1 
        1  1127 1 1  71 ILE O    O   5.589   0.669  -3.022 1.00 . A A .  71 ILE O    1 1 
        1  1128 1 1  72 TRP C    C   7.203   1.196  -5.942 1.00 . A A .  72 TRP C    1 1 
        1  1129 1 1  72 TRP CA   C   7.460   0.016  -4.990 1.00 . A A .  72 TRP CA   1 1 
        1  1130 1 1  72 TRP CB   C   8.487  -0.932  -5.627 1.00 . A A .  72 TRP CB   1 1 
        1  1131 1 1  72 TRP CD1  C   8.350  -3.214  -4.453 1.00 . A A .  72 TRP CD1  1 1 
        1  1132 1 1  72 TRP CD2  C  10.194  -2.039  -3.972 1.00 . A A .  72 TRP CD2  1 1 
        1  1133 1 1  72 TRP CE2  C  10.245  -3.257  -3.273 1.00 . A A .  72 TRP CE2  1 1 
        1  1134 1 1  72 TRP CE3  C  11.251  -1.133  -3.826 1.00 . A A .  72 TRP CE3  1 1 
        1  1135 1 1  72 TRP CG   C   8.971  -2.026  -4.718 1.00 . A A .  72 TRP CG   1 1 
        1  1136 1 1  72 TRP CH2  C  12.332  -2.695  -2.321 1.00 . A A .  72 TRP CH2  1 1 
        1  1137 1 1  72 TRP CZ2  C  11.311  -3.597  -2.444 1.00 . A A .  72 TRP CZ2  1 1 
        1  1138 1 1  72 TRP CZ3  C  12.309  -1.471  -3.004 1.00 . A A .  72 TRP CZ3  1 1 
        1  1139 1 1  72 TRP H    H   5.995  -1.513  -5.207 1.00 . A A .  72 TRP H    1 1 
        1  1140 1 1  72 TRP HA   H   7.861   0.395  -4.060 1.00 . A A .  72 TRP HA   1 1 
        1  1141 1 1  72 TRP HB2  H   8.042  -1.398  -6.493 1.00 . A A .  72 TRP HB2  1 1 
        1  1142 1 1  72 TRP HB3  H   9.346  -0.355  -5.942 1.00 . A A .  72 TRP HB3  1 1 
        1  1143 1 1  72 TRP HD1  H   7.397  -3.511  -4.866 1.00 . A A .  72 TRP HD1  1 1 
        1  1144 1 1  72 TRP HE1  H   8.878  -4.848  -3.236 1.00 . A A .  72 TRP HE1  1 1 
        1  1145 1 1  72 TRP HE3  H  11.250  -0.186  -4.347 1.00 . A A .  72 TRP HE3  1 1 
        1  1146 1 1  72 TRP HH2  H  13.178  -2.918  -1.689 1.00 . A A .  72 TRP HH2  1 1 
        1  1147 1 1  72 TRP HZ2  H  11.343  -4.537  -1.912 1.00 . A A .  72 TRP HZ2  1 1 
        1  1148 1 1  72 TRP HZ3  H  13.134  -0.784  -2.882 1.00 . A A .  72 TRP HZ3  1 1 
        1  1149 1 1  72 TRP N    N   6.214  -0.708  -4.691 1.00 . A A .  72 TRP N    1 1 
        1  1150 1 1  72 TRP NE1  N   9.109  -3.957  -3.581 1.00 . A A .  72 TRP NE1  1 1 
        1  1151 1 1  72 TRP O    O   6.754   1.002  -7.071 1.00 . A A .  72 TRP O    1 1 
        1  1152 1 1  73 ALA C    C   8.263   3.767  -7.469 1.00 . A A .  73 ALA C    1 1 
        1  1153 1 1  73 ALA CA   C   7.256   3.612  -6.311 1.00 . A A .  73 ALA CA   1 1 
        1  1154 1 1  73 ALA CB   C   7.256   4.858  -5.432 1.00 . A A .  73 ALA CB   1 1 
        1  1155 1 1  73 ALA H    H   7.909   2.514  -4.610 1.00 . A A .  73 ALA H    1 1 
        1  1156 1 1  73 ALA HA   H   6.265   3.513  -6.735 1.00 . A A .  73 ALA HA   1 1 
        1  1157 1 1  73 ALA HB1  H   6.527   4.745  -4.642 1.00 . A A .  73 ALA HB1  1 1 
        1  1158 1 1  73 ALA HB2  H   7.003   5.723  -6.029 1.00 . A A .  73 ALA HB2  1 1 
        1  1159 1 1  73 ALA HB3  H   8.235   4.996  -4.998 1.00 . A A .  73 ALA HB3  1 1 
        1  1160 1 1  73 ALA N    N   7.509   2.414  -5.500 1.00 . A A .  73 ALA N    1 1 
        1  1161 1 1  73 ALA O    O   9.253   4.495  -7.357 1.00 . A A .  73 ALA O    1 1 
        1  1162 1 1  74 ALA C    C  10.280   2.764  -9.626 1.00 . A A .  74 ALA C    1 1 
        1  1163 1 1  74 ALA CA   C   8.797   3.153  -9.812 1.00 . A A .  74 ALA CA   1 1 
        1  1164 1 1  74 ALA CB   C   8.688   4.553 -10.409 1.00 . A A .  74 ALA CB   1 1 
        1  1165 1 1  74 ALA H    H   7.238   2.440  -8.556 1.00 . A A .  74 ALA H    1 1 
        1  1166 1 1  74 ALA HA   H   8.356   2.465 -10.522 1.00 . A A .  74 ALA HA   1 1 
        1  1167 1 1  74 ALA HB1  H   9.176   5.263  -9.757 1.00 . A A .  74 ALA HB1  1 1 
        1  1168 1 1  74 ALA HB2  H   7.646   4.821 -10.516 1.00 . A A .  74 ALA HB2  1 1 
        1  1169 1 1  74 ALA HB3  H   9.163   4.571 -11.379 1.00 . A A .  74 ALA HB3  1 1 
        1  1170 1 1  74 ALA N    N   8.000   3.056  -8.572 1.00 . A A .  74 ALA N    1 1 
        1  1171 1 1  74 ALA O    O  10.715   1.703 -10.083 1.00 . A A .  74 ALA O    1 1 
        1  1172 1 1  75 ASN C    C  12.741   2.275  -7.758 1.00 . A A .  75 ASN C    1 1 
        1  1173 1 1  75 ASN CA   C  12.494   3.399  -8.778 1.00 . A A .  75 ASN CA   1 1 
        1  1174 1 1  75 ASN CB   C  13.191   4.689  -8.330 1.00 . A A .  75 ASN CB   1 1 
        1  1175 1 1  75 ASN CG   C  12.945   5.845  -9.282 1.00 . A A .  75 ASN CG   1 1 
        1  1176 1 1  75 ASN H    H  10.652   4.446  -8.613 1.00 . A A .  75 ASN H    1 1 
        1  1177 1 1  75 ASN HA   H  12.909   3.093  -9.730 1.00 . A A .  75 ASN HA   1 1 
        1  1178 1 1  75 ASN HB2  H  12.826   4.968  -7.353 1.00 . A A .  75 ASN HB2  1 1 
        1  1179 1 1  75 ASN HB3  H  14.257   4.514  -8.273 1.00 . A A .  75 ASN HB3  1 1 
        1  1180 1 1  75 ASN HD21 H  13.237   7.155  -7.824 1.00 . A A .  75 ASN HD21 1 1 
        1  1181 1 1  75 ASN HD22 H  12.872   7.820  -9.375 1.00 . A A .  75 ASN HD22 1 1 
        1  1182 1 1  75 ASN N    N  11.056   3.633  -8.976 1.00 . A A .  75 ASN N    1 1 
        1  1183 1 1  75 ASN ND2  N  13.023   7.060  -8.774 1.00 . A A .  75 ASN ND2  1 1 
        1  1184 1 1  75 ASN O    O  12.843   2.517  -6.553 1.00 . A A .  75 ASN O    1 1 
        1  1185 1 1  75 ASN OD1  O  12.695   5.652 -10.467 1.00 . A A .  75 ASN OD1  1 1 
        1  1186 1 1  76 ALA C    C  14.071  -1.092  -7.854 1.00 . A A .  76 ALA C    1 1 
        1  1187 1 1  76 ALA CA   C  12.963  -0.134  -7.386 1.00 . A A .  76 ALA CA   1 1 
        1  1188 1 1  76 ALA CB   C  11.633  -0.876  -7.323 1.00 . A A .  76 ALA CB   1 1 
        1  1189 1 1  76 ALA H    H  12.798   0.920  -9.225 1.00 . A A .  76 ALA H    1 1 
        1  1190 1 1  76 ALA HA   H  13.197   0.211  -6.387 1.00 . A A .  76 ALA HA   1 1 
        1  1191 1 1  76 ALA HB1  H  11.385  -1.259  -8.303 1.00 . A A .  76 ALA HB1  1 1 
        1  1192 1 1  76 ALA HB2  H  10.857  -0.199  -6.998 1.00 . A A .  76 ALA HB2  1 1 
        1  1193 1 1  76 ALA HB3  H  11.708  -1.698  -6.624 1.00 . A A .  76 ALA HB3  1 1 
        1  1194 1 1  76 ALA N    N  12.830   1.042  -8.252 1.00 . A A .  76 ALA N    1 1 
        1  1195 1 1  76 ALA O    O  14.802  -1.656  -7.038 1.00 . A A .  76 ALA O    1 1 
        1  1196 1 1  77 GLY C    C  14.514  -3.654  -9.865 1.00 . A A .  77 GLY C    1 1 
        1  1197 1 1  77 GLY CA   C  15.127  -2.260  -9.716 1.00 . A A .  77 GLY CA   1 1 
        1  1198 1 1  77 GLY H    H  13.626  -0.754  -9.777 1.00 . A A .  77 GLY H    1 1 
        1  1199 1 1  77 GLY HA2  H  15.454  -1.918 -10.688 1.00 . A A .  77 GLY HA2  1 1 
        1  1200 1 1  77 GLY HA3  H  15.987  -2.325  -9.064 1.00 . A A .  77 GLY HA3  1 1 
        1  1201 1 1  77 GLY N    N  14.181  -1.285  -9.169 1.00 . A A .  77 GLY N    1 1 
        1  1202 1 1  77 GLY O    O  14.906  -4.428 -10.739 1.00 . A A .  77 GLY O    1 1 
        1  1203 1 1  78 VAL C    C  11.956  -5.349 -10.313 1.00 . A A .  78 VAL C    1 1 
        1  1204 1 1  78 VAL CA   C  12.831  -5.248  -9.042 1.00 . A A .  78 VAL CA   1 1 
        1  1205 1 1  78 VAL CB   C  11.938  -5.407  -7.778 1.00 . A A .  78 VAL CB   1 1 
        1  1206 1 1  78 VAL CG1  C  11.244  -6.768  -7.746 1.00 . A A .  78 VAL CG1  1 1 
        1  1207 1 1  78 VAL CG2  C  12.759  -5.189  -6.506 1.00 . A A .  78 VAL CG2  1 1 
        1  1208 1 1  78 VAL H    H  13.334  -3.328  -8.293 1.00 . A A .  78 VAL H    1 1 
        1  1209 1 1  78 VAL HA   H  13.561  -6.048  -9.050 1.00 . A A .  78 VAL HA   1 1 
        1  1210 1 1  78 VAL HB   H  11.172  -4.643  -7.812 1.00 . A A .  78 VAL HB   1 1 
        1  1211 1 1  78 VAL HG11 H  11.986  -7.553  -7.704 1.00 . A A .  78 VAL HG11 1 1 
        1  1212 1 1  78 VAL HG12 H  10.644  -6.890  -8.637 1.00 . A A .  78 VAL HG12 1 1 
        1  1213 1 1  78 VAL HG13 H  10.606  -6.829  -6.874 1.00 . A A .  78 VAL HG13 1 1 
        1  1214 1 1  78 VAL HG21 H  12.118  -5.285  -5.640 1.00 . A A .  78 VAL HG21 1 1 
        1  1215 1 1  78 VAL HG22 H  13.195  -4.198  -6.520 1.00 . A A .  78 VAL HG22 1 1 
        1  1216 1 1  78 VAL HG23 H  13.548  -5.926  -6.451 1.00 . A A .  78 VAL HG23 1 1 
        1  1217 1 1  78 VAL N    N  13.557  -3.971  -8.996 1.00 . A A .  78 VAL N    1 1 
        1  1218 1 1  78 VAL O    O  11.640  -4.335 -10.940 1.00 . A A .  78 VAL O    1 1 
        1  1219 1 1  79 THR C    C   9.418  -5.965 -11.772 1.00 . A A .  79 THR C    1 1 
        1  1220 1 1  79 THR CA   C  10.709  -6.800 -11.861 1.00 . A A .  79 THR CA   1 1 
        1  1221 1 1  79 THR CB   C  10.330  -8.297 -12.000 1.00 . A A .  79 THR CB   1 1 
        1  1222 1 1  79 THR CG2  C   9.289  -8.518 -13.096 1.00 . A A .  79 THR CG2  1 1 
        1  1223 1 1  79 THR H    H  11.922  -7.352 -10.200 1.00 . A A .  79 THR H    1 1 
        1  1224 1 1  79 THR HA   H  11.254  -6.505 -12.748 1.00 . A A .  79 THR HA   1 1 
        1  1225 1 1  79 THR HB   H   9.915  -8.631 -11.059 1.00 . A A .  79 THR HB   1 1 
        1  1226 1 1  79 THR HG1  H  11.690  -9.030 -13.238 1.00 . A A .  79 THR HG1  1 1 
        1  1227 1 1  79 THR HG21 H   8.387  -7.976 -12.855 1.00 . A A .  79 THR HG21 1 1 
        1  1228 1 1  79 THR HG22 H   9.065  -9.572 -13.174 1.00 . A A .  79 THR HG22 1 1 
        1  1229 1 1  79 THR HG23 H   9.678  -8.165 -14.041 1.00 . A A .  79 THR HG23 1 1 
        1  1230 1 1  79 THR N    N  11.589  -6.575 -10.699 1.00 . A A .  79 THR N    1 1 
        1  1231 1 1  79 THR O    O   8.728  -5.975 -10.751 1.00 . A A .  79 THR O    1 1 
        1  1232 1 1  79 THR OG1  O  11.501  -9.078 -12.291 1.00 . A A .  79 THR OG1  1 1 
        1  1233 1 1  80 ALA C    C   6.607  -5.192 -12.789 1.00 . A A .  80 ALA C    1 1 
        1  1234 1 1  80 ALA CA   C   7.914  -4.386 -12.890 1.00 . A A .  80 ALA CA   1 1 
        1  1235 1 1  80 ALA CB   C   7.919  -3.544 -14.161 1.00 . A A .  80 ALA CB   1 1 
        1  1236 1 1  80 ALA H    H   9.687  -5.286 -13.633 1.00 . A A .  80 ALA H    1 1 
        1  1237 1 1  80 ALA HA   H   7.967  -3.709 -12.047 1.00 . A A .  80 ALA HA   1 1 
        1  1238 1 1  80 ALA HB1  H   7.069  -2.876 -14.157 1.00 . A A .  80 ALA HB1  1 1 
        1  1239 1 1  80 ALA HB2  H   7.863  -4.191 -15.025 1.00 . A A .  80 ALA HB2  1 1 
        1  1240 1 1  80 ALA HB3  H   8.830  -2.964 -14.205 1.00 . A A .  80 ALA HB3  1 1 
        1  1241 1 1  80 ALA N    N   9.103  -5.245 -12.848 1.00 . A A .  80 ALA N    1 1 
        1  1242 1 1  80 ALA O    O   6.248  -5.936 -13.702 1.00 . A A .  80 ALA O    1 1 
        1  1243 1 1  81 SER C    C   4.632  -7.188 -11.348 1.00 . A A .  81 SER C    1 1 
        1  1244 1 1  81 SER CA   C   4.592  -5.646 -11.439 1.00 . A A .  81 SER CA   1 1 
        1  1245 1 1  81 SER CB   C   3.593  -5.202 -12.522 1.00 . A A .  81 SER CB   1 1 
        1  1246 1 1  81 SER H    H   6.311  -4.499 -10.948 1.00 . A A .  81 SER H    1 1 
        1  1247 1 1  81 SER HA   H   4.238  -5.272 -10.489 1.00 . A A .  81 SER HA   1 1 
        1  1248 1 1  81 SER HB2  H   3.971  -5.481 -13.496 1.00 . A A .  81 SER HB2  1 1 
        1  1249 1 1  81 SER HB3  H   2.642  -5.686 -12.353 1.00 . A A .  81 SER HB3  1 1 
        1  1250 1 1  81 SER HG   H   2.468  -3.598 -12.670 1.00 . A A .  81 SER HG   1 1 
        1  1251 1 1  81 SER N    N   5.917  -5.037 -11.663 1.00 . A A .  81 SER N    1 1 
        1  1252 1 1  81 SER O    O   4.199  -7.891 -12.265 1.00 . A A .  81 SER O    1 1 
        1  1253 1 1  81 SER OG   O   3.396  -3.794 -12.498 1.00 . A A .  81 SER OG   1 1 
        1  1254 1 1  82 PRO C    C   3.600  -9.665  -9.900 1.00 . A A .  82 PRO C    1 1 
        1  1255 1 1  82 PRO CA   C   5.079  -9.167  -9.868 1.00 . A A .  82 PRO CA   1 1 
        1  1256 1 1  82 PRO CB   C   5.679  -9.172  -8.471 1.00 . A A .  82 PRO CB   1 1 
        1  1257 1 1  82 PRO CD   C   5.995  -6.966  -9.266 1.00 . A A .  82 PRO CD   1 1 
        1  1258 1 1  82 PRO CG   C   6.652  -8.047  -8.468 1.00 . A A .  82 PRO CG   1 1 
        1  1259 1 1  82 PRO HA   H   5.675  -9.782 -10.529 1.00 . A A .  82 PRO HA   1 1 
        1  1260 1 1  82 PRO HB2  H   4.899  -9.025  -7.736 1.00 . A A .  82 PRO HB2  1 1 
        1  1261 1 1  82 PRO HB3  H   6.173 -10.115  -8.292 1.00 . A A .  82 PRO HB3  1 1 
        1  1262 1 1  82 PRO HD2  H   5.369  -6.351  -8.633 1.00 . A A .  82 PRO HD2  1 1 
        1  1263 1 1  82 PRO HD3  H   6.735  -6.363  -9.770 1.00 . A A .  82 PRO HD3  1 1 
        1  1264 1 1  82 PRO HG2  H   6.834  -7.716  -7.454 1.00 . A A .  82 PRO HG2  1 1 
        1  1265 1 1  82 PRO HG3  H   7.576  -8.353  -8.937 1.00 . A A .  82 PRO HG3  1 1 
        1  1266 1 1  82 PRO N    N   5.186  -7.723 -10.236 1.00 . A A .  82 PRO N    1 1 
        1  1267 1 1  82 PRO O    O   2.696  -8.830  -9.945 1.00 . A A .  82 PRO O    1 1 
        1  1268 1 1  83 PRO C    C   4.782 -11.970  -7.911 1.00 . A A .  83 PRO C    1 1 
        1  1269 1 1  83 PRO CA   C   3.807 -12.157  -9.097 1.00 . A A .  83 PRO CA   1 1 
        1  1270 1 1  83 PRO CB   C   4.346 -12.954 -10.270 1.00 . A A .  83 PRO CB   1 1 
        1  1271 1 1  83 PRO CD   C   2.366 -11.617 -10.831 1.00 . A A .  83 PRO CD   1 1 
        1  1272 1 1  83 PRO CG   C   3.240 -12.790 -11.304 1.00 . A A .  83 PRO CG   1 1 
        1  1273 1 1  83 PRO HA   H   2.979 -12.727  -8.694 1.00 . A A .  83 PRO HA   1 1 
        1  1274 1 1  83 PRO HB2  H   5.285 -12.531 -10.602 1.00 . A A .  83 PRO HB2  1 1 
        1  1275 1 1  83 PRO HB3  H   4.480 -13.989  -9.989 1.00 . A A .  83 PRO HB3  1 1 
        1  1276 1 1  83 PRO HD2  H   2.146 -10.946 -11.650 1.00 . A A .  83 PRO HD2  1 1 
        1  1277 1 1  83 PRO HD3  H   1.456 -11.972 -10.366 1.00 . A A .  83 PRO HD3  1 1 
        1  1278 1 1  83 PRO HG2  H   3.671 -12.568 -12.269 1.00 . A A .  83 PRO HG2  1 1 
        1  1279 1 1  83 PRO HG3  H   2.651 -13.696 -11.359 1.00 . A A .  83 PRO HG3  1 1 
        1  1280 1 1  83 PRO N    N   3.257 -11.003  -9.854 1.00 . A A .  83 PRO N    1 1 
        1  1281 1 1  83 PRO O    O   5.907 -12.473  -7.924 1.00 . A A .  83 PRO O    1 1 
        1  1282 1 1  84 THR C    C   4.452  -9.924  -4.792 1.00 . A A .  84 THR C    1 1 
        1  1283 1 1  84 THR CA   C   4.809 -11.252  -5.481 1.00 . A A .  84 THR CA   1 1 
        1  1284 1 1  84 THR CB   C   6.344 -11.527  -5.311 1.00 . A A .  84 THR CB   1 1 
        1  1285 1 1  84 THR CG2  C   7.232 -10.487  -5.984 1.00 . A A .  84 THR CG2  1 1 
        1  1286 1 1  84 THR H    H   3.496 -10.702  -7.064 1.00 . A A .  84 THR H    1 1 
        1  1287 1 1  84 THR HA   H   4.279 -12.039  -4.954 1.00 . A A .  84 THR HA   1 1 
        1  1288 1 1  84 THR HB   H   6.563 -12.495  -5.744 1.00 . A A .  84 THR HB   1 1 
        1  1289 1 1  84 THR HG1  H   6.961 -10.687  -3.624 1.00 . A A .  84 THR HG1  1 1 
        1  1290 1 1  84 THR HG21 H   7.094 -10.533  -7.054 1.00 . A A .  84 THR HG21 1 1 
        1  1291 1 1  84 THR HG22 H   8.266 -10.691  -5.748 1.00 . A A .  84 THR HG22 1 1 
        1  1292 1 1  84 THR HG23 H   6.969  -9.500  -5.630 1.00 . A A .  84 THR HG23 1 1 
        1  1293 1 1  84 THR N    N   4.279 -11.261  -6.879 1.00 . A A .  84 THR N    1 1 
        1  1294 1 1  84 THR O    O   3.866  -9.906  -3.711 1.00 . A A .  84 THR O    1 1 
        1  1295 1 1  84 THR OG1  O   6.673 -11.568  -3.913 1.00 . A A .  84 THR OG1  1 1 
        1  1296 1 1  85 ASP C    C   3.971  -6.638  -6.203 1.00 . A A .  85 ASP C    1 1 
        1  1297 1 1  85 ASP CA   C   4.447  -7.471  -4.994 1.00 . A A .  85 ASP CA   1 1 
        1  1298 1 1  85 ASP CB   C   5.664  -6.824  -4.322 1.00 . A A .  85 ASP CB   1 1 
        1  1299 1 1  85 ASP CG   C   6.186  -7.654  -3.158 1.00 . A A .  85 ASP CG   1 1 
        1  1300 1 1  85 ASP H    H   5.329  -8.910  -6.252 1.00 . A A .  85 ASP H    1 1 
        1  1301 1 1  85 ASP HA   H   3.638  -7.548  -4.279 1.00 . A A .  85 ASP HA   1 1 
        1  1302 1 1  85 ASP HB2  H   6.455  -6.712  -5.052 1.00 . A A .  85 ASP HB2  1 1 
        1  1303 1 1  85 ASP HB3  H   5.386  -5.848  -3.951 1.00 . A A .  85 ASP HB3  1 1 
        1  1304 1 1  85 ASP N    N   4.801  -8.820  -5.443 1.00 . A A .  85 ASP N    1 1 
        1  1305 1 1  85 ASP O    O   3.611  -7.205  -7.230 1.00 . A A .  85 ASP O    1 1 
        1  1306 1 1  85 ASP OD1  O   5.613  -7.565  -2.053 1.00 . A A .  85 ASP OD1  1 1 
        1  1307 1 1  85 ASP OD2  O   7.171  -8.403  -3.345 1.00 . A A .  85 ASP OD2  1 1 
        1  1308 1 1  86 LEU C    C   4.400  -3.165  -7.316 1.00 . A A .  86 LEU C    1 1 
        1  1309 1 1  86 LEU CA   C   3.550  -4.445  -7.225 1.00 . A A .  86 LEU CA   1 1 
        1  1310 1 1  86 LEU CB   C   2.060  -4.070  -7.110 1.00 . A A .  86 LEU CB   1 1 
        1  1311 1 1  86 LEU CD1  C  -0.372  -4.735  -7.129 1.00 . A A .  86 LEU CD1  1 1 
        1  1312 1 1  86 LEU CD2  C   1.218  -5.765  -8.782 1.00 . A A .  86 LEU CD2  1 1 
        1  1313 1 1  86 LEU CG   C   1.059  -5.212  -7.364 1.00 . A A .  86 LEU CG   1 1 
        1  1314 1 1  86 LEU H    H   4.231  -4.889  -5.250 1.00 . A A .  86 LEU H    1 1 
        1  1315 1 1  86 LEU HA   H   3.693  -5.012  -8.136 1.00 . A A .  86 LEU HA   1 1 
        1  1316 1 1  86 LEU HB2  H   1.887  -3.684  -6.115 1.00 . A A .  86 LEU HB2  1 1 
        1  1317 1 1  86 LEU HB3  H   1.853  -3.281  -7.819 1.00 . A A .  86 LEU HB3  1 1 
        1  1318 1 1  86 LEU HD11 H  -0.598  -3.921  -7.803 1.00 . A A .  86 LEU HD11 1 1 
        1  1319 1 1  86 LEU HD12 H  -0.475  -4.395  -6.109 1.00 . A A .  86 LEU HD12 1 1 
        1  1320 1 1  86 LEU HD13 H  -1.058  -5.550  -7.305 1.00 . A A .  86 LEU HD13 1 1 
        1  1321 1 1  86 LEU HD21 H   2.205  -6.190  -8.896 1.00 . A A .  86 LEU HD21 1 1 
        1  1322 1 1  86 LEU HD22 H   1.083  -4.968  -9.499 1.00 . A A .  86 LEU HD22 1 1 
        1  1323 1 1  86 LEU HD23 H   0.475  -6.533  -8.956 1.00 . A A .  86 LEU HD23 1 1 
        1  1324 1 1  86 LEU HG   H   1.258  -6.015  -6.670 1.00 . A A .  86 LEU HG   1 1 
        1  1325 1 1  86 LEU N    N   3.961  -5.306  -6.095 1.00 . A A .  86 LEU N    1 1 
        1  1326 1 1  86 LEU O    O   4.800  -2.595  -6.303 1.00 . A A .  86 LEU O    1 1 
        1  1327 1 1  87 ILE C    C   4.503  -0.350  -9.269 1.00 . A A .  87 ILE C    1 1 
        1  1328 1 1  87 ILE CA   C   5.430  -1.477  -8.774 1.00 . A A .  87 ILE CA   1 1 
        1  1329 1 1  87 ILE CB   C   6.595  -1.682  -9.795 1.00 . A A .  87 ILE CB   1 1 
        1  1330 1 1  87 ILE CD1  C   7.516  -3.822  -8.688 1.00 . A A .  87 ILE CD1  1 1 
        1  1331 1 1  87 ILE CG1  C   7.796  -2.403  -9.141 1.00 . A A .  87 ILE CG1  1 1 
        1  1332 1 1  87 ILE CG2  C   7.050  -0.345 -10.394 1.00 . A A .  87 ILE CG2  1 1 
        1  1333 1 1  87 ILE H    H   4.357  -3.229  -9.317 1.00 . A A .  87 ILE H    1 1 
        1  1334 1 1  87 ILE HA   H   5.863  -1.174  -7.829 1.00 . A A .  87 ILE HA   1 1 
        1  1335 1 1  87 ILE HB   H   6.222  -2.292 -10.607 1.00 . A A .  87 ILE HB   1 1 
        1  1336 1 1  87 ILE HD11 H   8.410  -4.242  -8.252 1.00 . A A .  87 ILE HD11 1 1 
        1  1337 1 1  87 ILE HD12 H   7.215  -4.419  -9.537 1.00 . A A .  87 ILE HD12 1 1 
        1  1338 1 1  87 ILE HD13 H   6.727  -3.817  -7.953 1.00 . A A .  87 ILE HD13 1 1 
        1  1339 1 1  87 ILE HG12 H   8.609  -2.444  -9.850 1.00 . A A .  87 ILE HG12 1 1 
        1  1340 1 1  87 ILE HG13 H   8.115  -1.837  -8.275 1.00 . A A .  87 ILE HG13 1 1 
        1  1341 1 1  87 ILE HG21 H   7.856  -0.518 -11.093 1.00 . A A .  87 ILE HG21 1 1 
        1  1342 1 1  87 ILE HG22 H   7.394   0.308  -9.604 1.00 . A A .  87 ILE HG22 1 1 
        1  1343 1 1  87 ILE HG23 H   6.222   0.123 -10.908 1.00 . A A .  87 ILE HG23 1 1 
        1  1344 1 1  87 ILE N    N   4.675  -2.719  -8.544 1.00 . A A .  87 ILE N    1 1 
        1  1345 1 1  87 ILE O    O   3.803  -0.497 -10.273 1.00 . A A .  87 ILE O    1 1 
        1  1346 1 1  88 TRP C    C   4.291   2.595 -10.204 1.00 . A A .  88 TRP C    1 1 
        1  1347 1 1  88 TRP CA   C   3.716   1.948  -8.927 1.00 . A A .  88 TRP CA   1 1 
        1  1348 1 1  88 TRP CB   C   3.720   2.955  -7.761 1.00 . A A .  88 TRP CB   1 1 
        1  1349 1 1  88 TRP CD1  C   2.100   4.546  -8.982 1.00 . A A .  88 TRP CD1  1 1 
        1  1350 1 1  88 TRP CD2  C   2.153   4.797  -6.759 1.00 . A A .  88 TRP CD2  1 1 
        1  1351 1 1  88 TRP CE2  C   1.236   5.721  -7.292 1.00 . A A .  88 TRP CE2  1 1 
        1  1352 1 1  88 TRP CE3  C   2.357   4.771  -5.378 1.00 . A A .  88 TRP CE3  1 1 
        1  1353 1 1  88 TRP CG   C   2.693   4.050  -7.856 1.00 . A A .  88 TRP CG   1 1 
        1  1354 1 1  88 TRP CH2  C   0.743   6.563  -5.142 1.00 . A A .  88 TRP CH2  1 1 
        1  1355 1 1  88 TRP CZ2  C   0.525   6.610  -6.491 1.00 . A A .  88 TRP CZ2  1 1 
        1  1356 1 1  88 TRP CZ3  C   1.649   5.654  -4.583 1.00 . A A .  88 TRP CZ3  1 1 
        1  1357 1 1  88 TRP H    H   5.049   0.806  -7.738 1.00 . A A .  88 TRP H    1 1 
        1  1358 1 1  88 TRP HA   H   2.700   1.630  -9.119 1.00 . A A .  88 TRP HA   1 1 
        1  1359 1 1  88 TRP HB2  H   3.539   2.421  -6.838 1.00 . A A .  88 TRP HB2  1 1 
        1  1360 1 1  88 TRP HB3  H   4.695   3.422  -7.706 1.00 . A A .  88 TRP HB3  1 1 
        1  1361 1 1  88 TRP HD1  H   2.300   4.190  -9.982 1.00 . A A .  88 TRP HD1  1 1 
        1  1362 1 1  88 TRP HE1  H   0.669   6.054  -9.283 1.00 . A A .  88 TRP HE1  1 1 
        1  1363 1 1  88 TRP HE3  H   3.051   4.075  -4.927 1.00 . A A .  88 TRP HE3  1 1 
        1  1364 1 1  88 TRP HH2  H   0.214   7.237  -4.484 1.00 . A A .  88 TRP HH2  1 1 
        1  1365 1 1  88 TRP HZ2  H  -0.177   7.318  -6.909 1.00 . A A .  88 TRP HZ2  1 1 
        1  1366 1 1  88 TRP HZ3  H   1.796   5.648  -3.512 1.00 . A A .  88 TRP HZ3  1 1 
        1  1367 1 1  88 TRP N    N   4.504   0.769  -8.551 1.00 . A A .  88 TRP N    1 1 
        1  1368 1 1  88 TRP NE1  N   1.220   5.546  -8.651 1.00 . A A .  88 TRP NE1  1 1 
        1  1369 1 1  88 TRP O    O   5.167   3.454 -10.137 1.00 . A A .  88 TRP O    1 1 
        1  1370 1 1  89 LYS C    C   3.782   4.040 -13.057 1.00 . A A .  89 LYS C    1 1 
        1  1371 1 1  89 LYS CA   C   4.327   2.653 -12.659 1.00 . A A .  89 LYS CA   1 1 
        1  1372 1 1  89 LYS CB   C   4.022   1.626 -13.762 1.00 . A A .  89 LYS CB   1 1 
        1  1373 1 1  89 LYS CD   C   4.441  -0.708 -14.695 1.00 . A A .  89 LYS CD   1 1 
        1  1374 1 1  89 LYS CE   C   3.029  -1.301 -14.686 1.00 . A A .  89 LYS CE   1 1 
        1  1375 1 1  89 LYS CG   C   4.687   0.269 -13.539 1.00 . A A .  89 LYS CG   1 1 
        1  1376 1 1  89 LYS H    H   3.060   1.525 -11.367 1.00 . A A .  89 LYS H    1 1 
        1  1377 1 1  89 LYS HA   H   5.400   2.733 -12.555 1.00 . A A .  89 LYS HA   1 1 
        1  1378 1 1  89 LYS HB2  H   2.952   1.476 -13.814 1.00 . A A .  89 LYS HB2  1 1 
        1  1379 1 1  89 LYS HB3  H   4.365   2.020 -14.710 1.00 . A A .  89 LYS HB3  1 1 
        1  1380 1 1  89 LYS HD2  H   4.588  -0.186 -15.629 1.00 . A A .  89 LYS HD2  1 1 
        1  1381 1 1  89 LYS HD3  H   5.157  -1.515 -14.623 1.00 . A A .  89 LYS HD3  1 1 
        1  1382 1 1  89 LYS HE2  H   2.975  -2.071 -15.442 1.00 . A A .  89 LYS HE2  1 1 
        1  1383 1 1  89 LYS HE3  H   2.847  -1.744 -13.716 1.00 . A A .  89 LYS HE3  1 1 
        1  1384 1 1  89 LYS HG2  H   5.753   0.418 -13.436 1.00 . A A .  89 LYS HG2  1 1 
        1  1385 1 1  89 LYS HG3  H   4.298  -0.163 -12.625 1.00 . A A .  89 LYS HG3  1 1 
        1  1386 1 1  89 LYS HZ1  H   2.133   0.163 -15.879 1.00 . A A .  89 LYS HZ1  1 1 
        1  1387 1 1  89 LYS HZ2  H   1.964   0.436 -14.217 1.00 . A A .  89 LYS HZ2  1 1 
        1  1388 1 1  89 LYS HZ3  H   1.036  -0.753 -14.977 1.00 . A A .  89 LYS HZ3  1 1 
        1  1389 1 1  89 LYS N    N   3.793   2.178 -11.369 1.00 . A A .  89 LYS N    1 1 
        1  1390 1 1  89 LYS NZ   N   1.969  -0.293 -14.959 1.00 . A A .  89 LYS NZ   1 1 
        1  1391 1 1  89 LYS O    O   3.839   4.427 -14.224 1.00 . A A .  89 LYS O    1 1 
        1  1392 1 1  90 ASN C    C   3.332   7.210 -11.417 1.00 . A A .  90 ASN C    1 1 
        1  1393 1 1  90 ASN CA   C   2.734   6.143 -12.353 1.00 . A A .  90 ASN CA   1 1 
        1  1394 1 1  90 ASN CB   C   1.206   6.138 -12.200 1.00 . A A .  90 ASN CB   1 1 
        1  1395 1 1  90 ASN CG   C   0.500   5.210 -13.176 1.00 . A A .  90 ASN CG   1 1 
        1  1396 1 1  90 ASN H    H   3.277   4.456 -11.171 1.00 . A A .  90 ASN H    1 1 
        1  1397 1 1  90 ASN HA   H   2.981   6.406 -13.374 1.00 . A A .  90 ASN HA   1 1 
        1  1398 1 1  90 ASN HB2  H   0.952   5.828 -11.198 1.00 . A A .  90 ASN HB2  1 1 
        1  1399 1 1  90 ASN HB3  H   0.834   7.143 -12.360 1.00 . A A .  90 ASN HB3  1 1 
        1  1400 1 1  90 ASN HD21 H   1.915   5.478 -14.538 1.00 . A A .  90 ASN HD21 1 1 
        1  1401 1 1  90 ASN HD22 H   0.618   4.440 -14.990 1.00 . A A .  90 ASN HD22 1 1 
        1  1402 1 1  90 ASN N    N   3.281   4.800 -12.085 1.00 . A A .  90 ASN N    1 1 
        1  1403 1 1  90 ASN ND2  N   1.071   5.021 -14.348 1.00 . A A .  90 ASN ND2  1 1 
        1  1404 1 1  90 ASN O    O   2.991   8.391 -11.517 1.00 . A A .  90 ASN O    1 1 
        1  1405 1 1  90 ASN OD1  O  -0.557   4.666 -12.877 1.00 . A A .  90 ASN OD1  1 1 
        1  1406 1 1  91 GLN C    C   6.063   7.159  -8.902 1.00 . A A .  91 GLN C    1 1 
        1  1407 1 1  91 GLN CA   C   4.743   7.703  -9.483 1.00 . A A .  91 GLN CA   1 1 
        1  1408 1 1  91 GLN CB   C   3.665   7.860  -8.393 1.00 . A A .  91 GLN CB   1 1 
        1  1409 1 1  91 GLN CD   C   4.799   9.156  -6.513 1.00 . A A .  91 GLN CD   1 1 
        1  1410 1 1  91 GLN CG   C   3.728   9.155  -7.587 1.00 . A A .  91 GLN CG   1 1 
        1  1411 1 1  91 GLN H    H   4.558   5.879 -10.560 1.00 . A A .  91 GLN H    1 1 
        1  1412 1 1  91 GLN HA   H   4.930   8.666  -9.940 1.00 . A A .  91 GLN HA   1 1 
        1  1413 1 1  91 GLN HB2  H   2.695   7.815  -8.864 1.00 . A A .  91 GLN HB2  1 1 
        1  1414 1 1  91 GLN HB3  H   3.746   7.029  -7.704 1.00 . A A .  91 GLN HB3  1 1 
        1  1415 1 1  91 GLN HE21 H   6.056  10.101  -7.705 1.00 . A A .  91 GLN HE21 1 1 
        1  1416 1 1  91 GLN HE22 H   6.661   9.691  -6.145 1.00 . A A .  91 GLN HE22 1 1 
        1  1417 1 1  91 GLN HG2  H   3.924   9.972  -8.265 1.00 . A A .  91 GLN HG2  1 1 
        1  1418 1 1  91 GLN HG3  H   2.769   9.311  -7.113 1.00 . A A .  91 GLN HG3  1 1 
        1  1419 1 1  91 GLN N    N   4.228   6.801 -10.522 1.00 . A A .  91 GLN N    1 1 
        1  1420 1 1  91 GLN NE2  N   5.950   9.712  -6.817 1.00 . A A .  91 GLN NE2  1 1 
        1  1421 1 1  91 GLN O    O   6.138   6.004  -8.486 1.00 . A A .  91 GLN O    1 1 
        1  1422 1 1  91 GLN OE1  O   4.570   8.703  -5.398 1.00 . A A .  91 GLN OE1  1 1 
        1  1423 1 1  92 ASN C    C   8.698   7.684  -6.969 1.00 . A A .  92 ASN C    1 1 
        1  1424 1 1  92 ASN CA   C   8.457   7.580  -8.490 1.00 . A A .  92 ASN CA   1 1 
        1  1425 1 1  92 ASN CB   C   9.490   8.434  -9.237 1.00 . A A .  92 ASN CB   1 1 
        1  1426 1 1  92 ASN CG   C   9.432   8.252 -10.745 1.00 . A A .  92 ASN CG   1 1 
        1  1427 1 1  92 ASN H    H   6.953   8.930  -9.157 1.00 . A A .  92 ASN H    1 1 
        1  1428 1 1  92 ASN HA   H   8.583   6.549  -8.786 1.00 . A A .  92 ASN HA   1 1 
        1  1429 1 1  92 ASN HB2  H   9.315   9.477  -9.015 1.00 . A A .  92 ASN HB2  1 1 
        1  1430 1 1  92 ASN HB3  H  10.481   8.162  -8.899 1.00 . A A .  92 ASN HB3  1 1 
        1  1431 1 1  92 ASN HD21 H  11.338   8.757 -10.908 1.00 . A A .  92 ASN HD21 1 1 
        1  1432 1 1  92 ASN HD22 H  10.529   8.368 -12.383 1.00 . A A .  92 ASN HD22 1 1 
        1  1433 1 1  92 ASN N    N   7.101   8.000  -8.888 1.00 . A A .  92 ASN N    1 1 
        1  1434 1 1  92 ASN ND2  N  10.544   8.482 -11.411 1.00 . A A .  92 ASN ND2  1 1 
        1  1435 1 1  92 ASN O    O   7.870   8.202  -6.227 1.00 . A A .  92 ASN O    1 1 
        1  1436 1 1  92 ASN OD1  O   8.394   7.923 -11.315 1.00 . A A .  92 ASN OD1  1 1 
        1  1437 1 1  93 SER C    C  10.052   8.671  -4.533 1.00 . A A .  93 SER C    1 1 
        1  1438 1 1  93 SER CA   C  10.253   7.255  -5.098 1.00 . A A .  93 SER CA   1 1 
        1  1439 1 1  93 SER CB   C  11.722   6.833  -4.931 1.00 . A A .  93 SER CB   1 1 
        1  1440 1 1  93 SER H    H  10.446   6.729  -7.152 1.00 . A A .  93 SER H    1 1 
        1  1441 1 1  93 SER HA   H   9.627   6.567  -4.543 1.00 . A A .  93 SER HA   1 1 
        1  1442 1 1  93 SER HB2  H  11.829   5.794  -5.207 1.00 . A A .  93 SER HB2  1 1 
        1  1443 1 1  93 SER HB3  H  12.344   7.438  -5.575 1.00 . A A .  93 SER HB3  1 1 
        1  1444 1 1  93 SER HG   H  12.504   7.888  -3.468 1.00 . A A .  93 SER HG   1 1 
        1  1445 1 1  93 SER N    N   9.853   7.179  -6.520 1.00 . A A .  93 SER N    1 1 
        1  1446 1 1  93 SER O    O  10.559   9.650  -5.089 1.00 . A A .  93 SER O    1 1 
        1  1447 1 1  93 SER OG   O  12.165   6.992  -3.591 1.00 . A A .  93 SER OG   1 1 
        1  1448 1 1  94 TRP C    C   9.936  10.570  -1.811 1.00 . A A .  94 TRP C    1 1 
        1  1449 1 1  94 TRP CA   C   8.942  10.080  -2.872 1.00 . A A .  94 TRP CA   1 1 
        1  1450 1 1  94 TRP CB   C   7.522  10.025  -2.281 1.00 . A A .  94 TRP CB   1 1 
        1  1451 1 1  94 TRP CD1  C   7.489   9.324   0.195 1.00 . A A .  94 TRP CD1  1 1 
        1  1452 1 1  94 TRP CD2  C   7.030   7.665  -1.235 1.00 . A A .  94 TRP CD2  1 1 
        1  1453 1 1  94 TRP CE2  C   6.979   7.157   0.076 1.00 . A A .  94 TRP CE2  1 1 
        1  1454 1 1  94 TRP CE3  C   6.773   6.801  -2.304 1.00 . A A .  94 TRP CE3  1 1 
        1  1455 1 1  94 TRP CG   C   7.359   9.057  -1.140 1.00 . A A .  94 TRP CG   1 1 
        1  1456 1 1  94 TRP CH2  C   6.434   5.003  -0.717 1.00 . A A .  94 TRP CH2  1 1 
        1  1457 1 1  94 TRP CZ2  C   6.680   5.825   0.348 1.00 . A A .  94 TRP CZ2  1 1 
        1  1458 1 1  94 TRP CZ3  C   6.478   5.479  -2.032 1.00 . A A .  94 TRP CZ3  1 1 
        1  1459 1 1  94 TRP H    H   9.015   7.958  -2.981 1.00 . A A .  94 TRP H    1 1 
        1  1460 1 1  94 TRP HA   H   8.940  10.794  -3.688 1.00 . A A .  94 TRP HA   1 1 
        1  1461 1 1  94 TRP HB2  H   7.252  11.007  -1.922 1.00 . A A .  94 TRP HB2  1 1 
        1  1462 1 1  94 TRP HB3  H   6.832   9.735  -3.061 1.00 . A A .  94 TRP HB3  1 1 
        1  1463 1 1  94 TRP HD1  H   7.739  10.293   0.601 1.00 . A A .  94 TRP HD1  1 1 
        1  1464 1 1  94 TRP HE1  H   7.296   8.126   1.911 1.00 . A A .  94 TRP HE1  1 1 
        1  1465 1 1  94 TRP HE3  H   6.801   7.151  -3.325 1.00 . A A .  94 TRP HE3  1 1 
        1  1466 1 1  94 TRP HH2  H   6.201   3.962  -0.551 1.00 . A A .  94 TRP HH2  1 1 
        1  1467 1 1  94 TRP HZ2  H   6.642   5.443   1.357 1.00 . A A .  94 TRP HZ2  1 1 
        1  1468 1 1  94 TRP HZ3  H   6.277   4.795  -2.847 1.00 . A A .  94 TRP HZ3  1 1 
        1  1469 1 1  94 TRP N    N   9.314   8.775  -3.431 1.00 . A A .  94 TRP N    1 1 
        1  1470 1 1  94 TRP NE1  N   7.262   8.188   0.930 1.00 . A A .  94 TRP NE1  1 1 
        1  1471 1 1  94 TRP O    O  10.145  11.775  -1.664 1.00 . A A .  94 TRP O    1 1 
        1  1472 1 1  95 GLY C    C  10.611  10.507   1.239 1.00 . A A .  95 GLY C    1 1 
        1  1473 1 1  95 GLY CA   C  11.416  10.020   0.033 1.00 . A A .  95 GLY CA   1 1 
        1  1474 1 1  95 GLY H    H  10.436   8.695  -1.312 1.00 . A A .  95 GLY H    1 1 
        1  1475 1 1  95 GLY HA2  H  12.007   9.163   0.326 1.00 . A A .  95 GLY HA2  1 1 
        1  1476 1 1  95 GLY HA3  H  12.082  10.810  -0.286 1.00 . A A .  95 GLY HA3  1 1 
        1  1477 1 1  95 GLY N    N  10.556   9.642  -1.084 1.00 . A A .  95 GLY N    1 1 
        1  1478 1 1  95 GLY O    O  10.142  11.649   1.261 1.00 . A A .  95 GLY O    1 1 
        1  1479 1 1  96 THR C    C  10.133  10.902   4.416 1.00 . A A .  96 THR C    1 1 
        1  1480 1 1  96 THR CA   C   9.541   9.934   3.374 1.00 . A A .  96 THR CA   1 1 
        1  1481 1 1  96 THR CB   C   9.087   8.627   4.079 1.00 . A A .  96 THR CB   1 1 
        1  1482 1 1  96 THR CG2  C  10.258   7.919   4.750 1.00 . A A .  96 THR CG2  1 1 
        1  1483 1 1  96 THR H    H  10.983   8.823   2.259 1.00 . A A .  96 THR H    1 1 
        1  1484 1 1  96 THR HA   H   8.658  10.397   2.953 1.00 . A A .  96 THR HA   1 1 
        1  1485 1 1  96 THR HB   H   8.669   7.966   3.331 1.00 . A A .  96 THR HB   1 1 
        1  1486 1 1  96 THR HG1  H   8.442   9.466   5.756 1.00 . A A .  96 THR HG1  1 1 
        1  1487 1 1  96 THR HG21 H   9.911   7.007   5.216 1.00 . A A .  96 THR HG21 1 1 
        1  1488 1 1  96 THR HG22 H  10.690   8.565   5.499 1.00 . A A .  96 THR HG22 1 1 
        1  1489 1 1  96 THR HG23 H  11.007   7.679   4.006 1.00 . A A .  96 THR HG23 1 1 
        1  1490 1 1  96 THR N    N  10.460   9.653   2.254 1.00 . A A .  96 THR N    1 1 
        1  1491 1 1  96 THR O    O   9.765  10.862   5.591 1.00 . A A .  96 THR O    1 1 
        1  1492 1 1  96 THR OG1  O   8.072   8.911   5.057 1.00 . A A .  96 THR OG1  1 1 
        1  1493 1 1  97 GLY C    C  10.281  13.677   5.369 1.00 . A A .  97 GLY C    1 1 
        1  1494 1 1  97 GLY CA   C  11.475  12.883   4.847 1.00 . A A .  97 GLY CA   1 1 
        1  1495 1 1  97 GLY H    H  11.405  11.697   3.083 1.00 . A A .  97 GLY H    1 1 
        1  1496 1 1  97 GLY HA2  H  12.030  12.477   5.682 1.00 . A A .  97 GLY HA2  1 1 
        1  1497 1 1  97 GLY HA3  H  12.118  13.542   4.282 1.00 . A A .  97 GLY HA3  1 1 
        1  1498 1 1  97 GLY N    N  11.035  11.788   3.983 1.00 . A A .  97 GLY N    1 1 
        1  1499 1 1  97 GLY O    O  10.246  14.101   6.527 1.00 . A A .  97 GLY O    1 1 
        1  1500 1 1  98 GLU C    C   7.087  13.172   5.261 1.00 . A A .  98 GLU C    1 1 
        1  1501 1 1  98 GLU CA   C   7.977  14.362   4.880 1.00 . A A .  98 GLU CA   1 1 
        1  1502 1 1  98 GLU CB   C   7.333  15.141   3.724 1.00 . A A .  98 GLU CB   1 1 
        1  1503 1 1  98 GLU CD   C   7.996  17.458   4.504 1.00 . A A .  98 GLU CD   1 1 
        1  1504 1 1  98 GLU CG   C   8.043  16.441   3.374 1.00 . A A .  98 GLU CG   1 1 
        1  1505 1 1  98 GLU H    H   9.471  13.684   3.545 1.00 . A A .  98 GLU H    1 1 
        1  1506 1 1  98 GLU HA   H   8.091  15.014   5.736 1.00 . A A .  98 GLU HA   1 1 
        1  1507 1 1  98 GLU HB2  H   7.328  14.514   2.844 1.00 . A A .  98 GLU HB2  1 1 
        1  1508 1 1  98 GLU HB3  H   6.311  15.377   3.989 1.00 . A A .  98 GLU HB3  1 1 
        1  1509 1 1  98 GLU HG2  H   9.076  16.219   3.146 1.00 . A A .  98 GLU HG2  1 1 
        1  1510 1 1  98 GLU HG3  H   7.570  16.870   2.501 1.00 . A A .  98 GLU HG3  1 1 
        1  1511 1 1  98 GLU N    N   9.301  13.876   4.489 1.00 . A A .  98 GLU N    1 1 
        1  1512 1 1  98 GLU O    O   6.906  12.253   4.460 1.00 . A A .  98 GLU O    1 1 
        1  1513 1 1  98 GLU OE1  O   6.889  17.935   4.833 1.00 . A A .  98 GLU OE1  1 1 
        1  1514 1 1  98 GLU OE2  O   9.061  17.795   5.058 1.00 . A A .  98 GLU OE2  1 1 
        1  1515 1 1  99 ASP C    C   4.595  11.682   6.017 1.00 . A A .  99 ASP C    1 1 
        1  1516 1 1  99 ASP CA   C   5.730  12.077   6.982 1.00 . A A .  99 ASP CA   1 1 
        1  1517 1 1  99 ASP CB   C   5.170  12.431   8.361 1.00 . A A .  99 ASP CB   1 1 
        1  1518 1 1  99 ASP CG   C   6.279  12.590   9.383 1.00 . A A .  99 ASP CG   1 1 
        1  1519 1 1  99 ASP H    H   6.690  13.970   7.051 1.00 . A A .  99 ASP H    1 1 
        1  1520 1 1  99 ASP HA   H   6.391  11.229   7.091 1.00 . A A .  99 ASP HA   1 1 
        1  1521 1 1  99 ASP HB2  H   4.620  13.361   8.298 1.00 . A A .  99 ASP HB2  1 1 
        1  1522 1 1  99 ASP HB3  H   4.505  11.644   8.691 1.00 . A A .  99 ASP HB3  1 1 
        1  1523 1 1  99 ASP N    N   6.539  13.191   6.473 1.00 . A A .  99 ASP N    1 1 
        1  1524 1 1  99 ASP O    O   3.553  12.342   5.945 1.00 . A A .  99 ASP O    1 1 
        1  1525 1 1  99 ASP OD1  O   6.947  13.651   9.379 1.00 . A A .  99 ASP OD1  1 1 
        1  1526 1 1  99 ASP OD2  O   6.508  11.648  10.168 1.00 . A A .  99 ASP OD2  1 1 
        1  1527 1 1 100 VAL C    C   2.635   9.450   4.982 1.00 . A A . 100 VAL C    1 1 
        1  1528 1 1 100 VAL CA   C   3.860  10.089   4.299 1.00 . A A . 100 VAL CA   1 1 
        1  1529 1 1 100 VAL CB   C   4.534   9.064   3.344 1.00 . A A . 100 VAL CB   1 1 
        1  1530 1 1 100 VAL CG1  C   5.143   7.906   4.129 1.00 . A A . 100 VAL CG1  1 1 
        1  1531 1 1 100 VAL CG2  C   3.548   8.546   2.298 1.00 . A A . 100 VAL CG2  1 1 
        1  1532 1 1 100 VAL H    H   5.670  10.116   5.400 1.00 . A A . 100 VAL H    1 1 
        1  1533 1 1 100 VAL HA   H   3.525  10.929   3.706 1.00 . A A . 100 VAL HA   1 1 
        1  1534 1 1 100 VAL HB   H   5.337   9.572   2.824 1.00 . A A . 100 VAL HB   1 1 
        1  1535 1 1 100 VAL HG11 H   5.852   8.291   4.850 1.00 . A A . 100 VAL HG11 1 1 
        1  1536 1 1 100 VAL HG12 H   5.651   7.235   3.451 1.00 . A A . 100 VAL HG12 1 1 
        1  1537 1 1 100 VAL HG13 H   4.361   7.369   4.646 1.00 . A A . 100 VAL HG13 1 1 
        1  1538 1 1 100 VAL HG21 H   4.054   7.860   1.635 1.00 . A A . 100 VAL HG21 1 1 
        1  1539 1 1 100 VAL HG22 H   3.158   9.375   1.726 1.00 . A A . 100 VAL HG22 1 1 
        1  1540 1 1 100 VAL HG23 H   2.734   8.035   2.791 1.00 . A A . 100 VAL HG23 1 1 
        1  1541 1 1 100 VAL N    N   4.822  10.595   5.279 1.00 . A A . 100 VAL N    1 1 
        1  1542 1 1 100 VAL O    O   2.758   8.764   6.001 1.00 . A A . 100 VAL O    1 1 
        1  1543 1 1 101 LYS C    C  -0.577   8.372   3.914 1.00 . A A . 101 LYS C    1 1 
        1  1544 1 1 101 LYS CA   C   0.195   9.179   4.967 1.00 . A A . 101 LYS CA   1 1 
        1  1545 1 1 101 LYS CB   C  -0.658  10.353   5.468 1.00 . A A . 101 LYS CB   1 1 
        1  1546 1 1 101 LYS CD   C  -2.723  11.143   6.695 1.00 . A A . 101 LYS CD   1 1 
        1  1547 1 1 101 LYS CE   C  -1.892  11.940   7.697 1.00 . A A . 101 LYS CE   1 1 
        1  1548 1 1 101 LYS CG   C  -1.958   9.936   6.156 1.00 . A A . 101 LYS CG   1 1 
        1  1549 1 1 101 LYS H    H   1.429  10.227   3.597 1.00 . A A . 101 LYS H    1 1 
        1  1550 1 1 101 LYS HA   H   0.431   8.532   5.801 1.00 . A A . 101 LYS HA   1 1 
        1  1551 1 1 101 LYS HB2  H  -0.073  10.926   6.174 1.00 . A A . 101 LYS HB2  1 1 
        1  1552 1 1 101 LYS HB3  H  -0.906  10.987   4.627 1.00 . A A . 101 LYS HB3  1 1 
        1  1553 1 1 101 LYS HD2  H  -2.990  11.786   5.869 1.00 . A A . 101 LYS HD2  1 1 
        1  1554 1 1 101 LYS HD3  H  -3.622  10.795   7.184 1.00 . A A . 101 LYS HD3  1 1 
        1  1555 1 1 101 LYS HE2  H  -1.611  11.292   8.515 1.00 . A A . 101 LYS HE2  1 1 
        1  1556 1 1 101 LYS HE3  H  -1.000  12.299   7.204 1.00 . A A . 101 LYS HE3  1 1 
        1  1557 1 1 101 LYS HG2  H  -2.581   9.417   5.441 1.00 . A A . 101 LYS HG2  1 1 
        1  1558 1 1 101 LYS HG3  H  -1.723   9.272   6.977 1.00 . A A . 101 LYS HG3  1 1 
        1  1559 1 1 101 LYS HZ1  H  -2.914  13.745   7.472 1.00 . A A . 101 LYS HZ1  1 1 
        1  1560 1 1 101 LYS HZ2  H  -2.048  13.621   8.918 1.00 . A A . 101 LYS HZ2  1 1 
        1  1561 1 1 101 LYS HZ3  H  -3.500  12.778   8.729 1.00 . A A . 101 LYS HZ3  1 1 
        1  1562 1 1 101 LYS N    N   1.455   9.691   4.415 1.00 . A A . 101 LYS N    1 1 
        1  1563 1 1 101 LYS NZ   N  -2.640  13.102   8.241 1.00 . A A . 101 LYS NZ   1 1 
        1  1564 1 1 101 LYS O    O  -0.983   8.908   2.884 1.00 . A A . 101 LYS O    1 1 
        1  1565 1 1 102 VAL C    C  -2.907   5.953   3.551 1.00 . A A . 102 VAL C    1 1 
        1  1566 1 1 102 VAL CA   C  -1.421   6.185   3.218 1.00 . A A . 102 VAL CA   1 1 
        1  1567 1 1 102 VAL CB   C  -0.685   4.826   3.166 1.00 . A A . 102 VAL CB   1 1 
        1  1568 1 1 102 VAL CG1  C  -1.324   3.896   2.141 1.00 . A A . 102 VAL CG1  1 1 
        1  1569 1 1 102 VAL CG2  C   0.799   5.033   2.868 1.00 . A A . 102 VAL CG2  1 1 
        1  1570 1 1 102 VAL H    H  -0.487   6.729   5.043 1.00 . A A . 102 VAL H    1 1 
        1  1571 1 1 102 VAL HA   H  -1.353   6.640   2.237 1.00 . A A . 102 VAL HA   1 1 
        1  1572 1 1 102 VAL HB   H  -0.770   4.362   4.139 1.00 . A A . 102 VAL HB   1 1 
        1  1573 1 1 102 VAL HG11 H  -2.355   3.714   2.410 1.00 . A A . 102 VAL HG11 1 1 
        1  1574 1 1 102 VAL HG12 H  -0.789   2.957   2.120 1.00 . A A . 102 VAL HG12 1 1 
        1  1575 1 1 102 VAL HG13 H  -1.285   4.355   1.162 1.00 . A A . 102 VAL HG13 1 1 
        1  1576 1 1 102 VAL HG21 H   1.248   5.629   3.651 1.00 . A A . 102 VAL HG21 1 1 
        1  1577 1 1 102 VAL HG22 H   0.910   5.543   1.921 1.00 . A A . 102 VAL HG22 1 1 
        1  1578 1 1 102 VAL HG23 H   1.295   4.073   2.819 1.00 . A A . 102 VAL HG23 1 1 
        1  1579 1 1 102 VAL N    N  -0.776   7.086   4.178 1.00 . A A . 102 VAL N    1 1 
        1  1580 1 1 102 VAL O    O  -3.254   5.522   4.656 1.00 . A A . 102 VAL O    1 1 
        1  1581 1 1 103 ILE C    C  -5.711   4.833   1.950 1.00 . A A . 103 ILE C    1 1 
        1  1582 1 1 103 ILE CA   C  -5.222   6.067   2.737 1.00 . A A . 103 ILE CA   1 1 
        1  1583 1 1 103 ILE CB   C  -5.991   7.317   2.226 1.00 . A A . 103 ILE CB   1 1 
        1  1584 1 1 103 ILE CD1  C  -5.408   8.726   4.296 1.00 . A A . 103 ILE CD1  1 1 
        1  1585 1 1 103 ILE CG1  C  -5.377   8.618   2.787 1.00 . A A . 103 ILE CG1  1 1 
        1  1586 1 1 103 ILE CG2  C  -7.473   7.221   2.583 1.00 . A A . 103 ILE CG2  1 1 
        1  1587 1 1 103 ILE H    H  -3.430   6.604   1.742 1.00 . A A . 103 ILE H    1 1 
        1  1588 1 1 103 ILE HA   H  -5.443   5.931   3.786 1.00 . A A . 103 ILE HA   1 1 
        1  1589 1 1 103 ILE HB   H  -5.913   7.333   1.147 1.00 . A A . 103 ILE HB   1 1 
        1  1590 1 1 103 ILE HD11 H  -4.973   9.666   4.599 1.00 . A A . 103 ILE HD11 1 1 
        1  1591 1 1 103 ILE HD12 H  -4.841   7.914   4.729 1.00 . A A . 103 ILE HD12 1 1 
        1  1592 1 1 103 ILE HD13 H  -6.430   8.675   4.643 1.00 . A A . 103 ILE HD13 1 1 
        1  1593 1 1 103 ILE HG12 H  -4.345   8.683   2.475 1.00 . A A . 103 ILE HG12 1 1 
        1  1594 1 1 103 ILE HG13 H  -5.918   9.463   2.385 1.00 . A A . 103 ILE HG13 1 1 
        1  1595 1 1 103 ILE HG21 H  -7.901   6.344   2.117 1.00 . A A . 103 ILE HG21 1 1 
        1  1596 1 1 103 ILE HG22 H  -7.989   8.102   2.228 1.00 . A A . 103 ILE HG22 1 1 
        1  1597 1 1 103 ILE HG23 H  -7.586   7.147   3.656 1.00 . A A . 103 ILE HG23 1 1 
        1  1598 1 1 103 ILE N    N  -3.775   6.246   2.585 1.00 . A A . 103 ILE N    1 1 
        1  1599 1 1 103 ILE O    O  -5.615   4.798   0.719 1.00 . A A . 103 ILE O    1 1 
        1  1600 1 1 104 LEU C    C  -8.231   2.659   1.711 1.00 . A A . 104 LEU C    1 1 
        1  1601 1 1 104 LEU CA   C  -6.723   2.600   2.003 1.00 . A A . 104 LEU CA   1 1 
        1  1602 1 1 104 LEU CB   C  -6.416   1.371   2.875 1.00 . A A . 104 LEU CB   1 1 
        1  1603 1 1 104 LEU CD1  C  -4.753  -0.199   3.929 1.00 . A A . 104 LEU CD1  1 1 
        1  1604 1 1 104 LEU CD2  C  -4.169   0.995   1.790 1.00 . A A . 104 LEU CD2  1 1 
        1  1605 1 1 104 LEU CG   C  -4.925   1.084   3.117 1.00 . A A . 104 LEU CG   1 1 
        1  1606 1 1 104 LEU H    H  -6.317   3.917   3.626 1.00 . A A . 104 LEU H    1 1 
        1  1607 1 1 104 LEU HA   H  -6.197   2.496   1.063 1.00 . A A . 104 LEU HA   1 1 
        1  1608 1 1 104 LEU HB2  H  -6.894   1.509   3.834 1.00 . A A . 104 LEU HB2  1 1 
        1  1609 1 1 104 LEU HB3  H  -6.851   0.504   2.398 1.00 . A A . 104 LEU HB3  1 1 
        1  1610 1 1 104 LEU HD11 H  -5.174  -1.033   3.385 1.00 . A A . 104 LEU HD11 1 1 
        1  1611 1 1 104 LEU HD12 H  -5.262  -0.097   4.877 1.00 . A A . 104 LEU HD12 1 1 
        1  1612 1 1 104 LEU HD13 H  -3.703  -0.378   4.106 1.00 . A A . 104 LEU HD13 1 1 
        1  1613 1 1 104 LEU HD21 H  -4.270   1.928   1.254 1.00 . A A . 104 LEU HD21 1 1 
        1  1614 1 1 104 LEU HD22 H  -4.576   0.191   1.194 1.00 . A A . 104 LEU HD22 1 1 
        1  1615 1 1 104 LEU HD23 H  -3.122   0.806   1.982 1.00 . A A . 104 LEU HD23 1 1 
        1  1616 1 1 104 LEU HG   H  -4.500   1.896   3.690 1.00 . A A . 104 LEU HG   1 1 
        1  1617 1 1 104 LEU N    N  -6.242   3.831   2.652 1.00 . A A . 104 LEU N    1 1 
        1  1618 1 1 104 LEU O    O  -9.058   2.577   2.626 1.00 . A A . 104 LEU O    1 1 
        1  1619 1 1 105 LYS C    C -10.289   1.567  -0.882 1.00 . A A . 105 LYS C    1 1 
        1  1620 1 1 105 LYS CA   C  -9.987   2.791   0.004 1.00 . A A . 105 LYS CA   1 1 
        1  1621 1 1 105 LYS CB   C -10.329   4.085  -0.753 1.00 . A A . 105 LYS CB   1 1 
        1  1622 1 1 105 LYS CD   C -10.554   6.605  -0.707 1.00 . A A . 105 LYS CD   1 1 
        1  1623 1 1 105 LYS CE   C -10.290   7.892   0.072 1.00 . A A . 105 LYS CE   1 1 
        1  1624 1 1 105 LYS CG   C -10.164   5.358   0.083 1.00 . A A . 105 LYS CG   1 1 
        1  1625 1 1 105 LYS H    H  -7.880   2.917  -0.245 1.00 . A A . 105 LYS H    1 1 
        1  1626 1 1 105 LYS HA   H -10.605   2.734   0.891 1.00 . A A . 105 LYS HA   1 1 
        1  1627 1 1 105 LYS HB2  H  -9.683   4.162  -1.618 1.00 . A A . 105 LYS HB2  1 1 
        1  1628 1 1 105 LYS HB3  H -11.355   4.032  -1.089 1.00 . A A . 105 LYS HB3  1 1 
        1  1629 1 1 105 LYS HD2  H  -9.980   6.632  -1.622 1.00 . A A . 105 LYS HD2  1 1 
        1  1630 1 1 105 LYS HD3  H -11.608   6.550  -0.946 1.00 . A A . 105 LYS HD3  1 1 
        1  1631 1 1 105 LYS HE2  H  -9.244   7.931   0.339 1.00 . A A . 105 LYS HE2  1 1 
        1  1632 1 1 105 LYS HE3  H -10.527   8.736  -0.561 1.00 . A A . 105 LYS HE3  1 1 
        1  1633 1 1 105 LYS HG2  H -10.796   5.286   0.957 1.00 . A A . 105 LYS HG2  1 1 
        1  1634 1 1 105 LYS HG3  H  -9.130   5.444   0.389 1.00 . A A . 105 LYS HG3  1 1 
        1  1635 1 1 105 LYS HZ1  H -10.779   7.286   2.016 1.00 . A A . 105 LYS HZ1  1 1 
        1  1636 1 1 105 LYS HZ2  H -12.106   7.811   1.102 1.00 . A A . 105 LYS HZ2  1 1 
        1  1637 1 1 105 LYS HZ3  H -11.013   8.934   1.727 1.00 . A A . 105 LYS HZ3  1 1 
        1  1638 1 1 105 LYS N    N  -8.582   2.801   0.433 1.00 . A A . 105 LYS N    1 1 
        1  1639 1 1 105 LYS NZ   N -11.103   7.984   1.315 1.00 . A A . 105 LYS NZ   1 1 
        1  1640 1 1 105 LYS O    O  -9.480   1.184  -1.730 1.00 . A A . 105 LYS O    1 1 
        1  1641 1 1 106 ASN C    C -12.088   0.099  -2.925 1.00 . A A . 106 ASN C    1 1 
        1  1642 1 1 106 ASN CA   C -11.894  -0.216  -1.432 1.00 . A A . 106 ASN CA   1 1 
        1  1643 1 1 106 ASN CB   C -13.212  -0.750  -0.865 1.00 . A A . 106 ASN CB   1 1 
        1  1644 1 1 106 ASN CG   C -13.137  -1.045   0.617 1.00 . A A . 106 ASN CG   1 1 
        1  1645 1 1 106 ASN H    H -12.041   1.306   0.035 1.00 . A A . 106 ASN H    1 1 
        1  1646 1 1 106 ASN HA   H -11.136  -0.979  -1.332 1.00 . A A . 106 ASN HA   1 1 
        1  1647 1 1 106 ASN HB2  H -13.989  -0.015  -1.025 1.00 . A A . 106 ASN HB2  1 1 
        1  1648 1 1 106 ASN HB3  H -13.477  -1.662  -1.383 1.00 . A A . 106 ASN HB3  1 1 
        1  1649 1 1 106 ASN HD21 H -12.625  -2.922   0.262 1.00 . A A . 106 ASN HD21 1 1 
        1  1650 1 1 106 ASN HD22 H -12.763  -2.478   1.923 1.00 . A A . 106 ASN HD22 1 1 
        1  1651 1 1 106 ASN N    N -11.457   0.960  -0.668 1.00 . A A . 106 ASN N    1 1 
        1  1652 1 1 106 ASN ND2  N -12.806  -2.269   0.968 1.00 . A A . 106 ASN ND2  1 1 
        1  1653 1 1 106 ASN O    O -12.024   1.254  -3.349 1.00 . A A . 106 ASN O    1 1 
        1  1654 1 1 106 ASN OD1  O -13.385  -0.179   1.449 1.00 . A A . 106 ASN OD1  1 1 
        1  1655 1 1 107 SER C    C -13.681   0.189  -5.510 1.00 . A A . 107 SER C    1 1 
        1  1656 1 1 107 SER CA   C -12.570  -0.817  -5.154 1.00 . A A . 107 SER CA   1 1 
        1  1657 1 1 107 SER CB   C -12.913  -2.187  -5.756 1.00 . A A . 107 SER CB   1 1 
        1  1658 1 1 107 SER H    H -12.448  -1.832  -3.294 1.00 . A A . 107 SER H    1 1 
        1  1659 1 1 107 SER HA   H -11.638  -0.474  -5.583 1.00 . A A . 107 SER HA   1 1 
        1  1660 1 1 107 SER HB2  H -13.844  -2.537  -5.337 1.00 . A A . 107 SER HB2  1 1 
        1  1661 1 1 107 SER HB3  H -13.016  -2.093  -6.828 1.00 . A A . 107 SER HB3  1 1 
        1  1662 1 1 107 SER HG   H -12.175  -3.702  -4.737 1.00 . A A . 107 SER HG   1 1 
        1  1663 1 1 107 SER N    N -12.374  -0.944  -3.703 1.00 . A A . 107 SER N    1 1 
        1  1664 1 1 107 SER O    O -13.661   0.793  -6.582 1.00 . A A . 107 SER O    1 1 
        1  1665 1 1 107 SER OG   O -11.902  -3.148  -5.478 1.00 . A A . 107 SER OG   1 1 
        1  1666 1 1 108 GLN C    C -15.639   2.618  -4.120 1.00 . A A . 108 GLN C    1 1 
        1  1667 1 1 108 GLN CA   C -15.785   1.270  -4.858 1.00 . A A . 108 GLN CA   1 1 
        1  1668 1 1 108 GLN CB   C -17.100   0.587  -4.457 1.00 . A A . 108 GLN CB   1 1 
        1  1669 1 1 108 GLN CD   C -18.741  -1.297  -4.911 1.00 . A A . 108 GLN CD   1 1 
        1  1670 1 1 108 GLN CG   C -17.443  -0.625  -5.320 1.00 . A A . 108 GLN CG   1 1 
        1  1671 1 1 108 GLN H    H -14.625  -0.154  -3.777 1.00 . A A . 108 GLN H    1 1 
        1  1672 1 1 108 GLN HA   H -15.819   1.472  -5.919 1.00 . A A . 108 GLN HA   1 1 
        1  1673 1 1 108 GLN HB2  H -17.028   0.264  -3.428 1.00 . A A . 108 GLN HB2  1 1 
        1  1674 1 1 108 GLN HB3  H -17.906   1.303  -4.544 1.00 . A A . 108 GLN HB3  1 1 
        1  1675 1 1 108 GLN HE21 H -18.081  -3.040  -5.562 1.00 . A A . 108 GLN HE21 1 1 
        1  1676 1 1 108 GLN HE22 H -19.667  -3.037  -4.888 1.00 . A A . 108 GLN HE22 1 1 
        1  1677 1 1 108 GLN HG2  H -17.534  -0.305  -6.349 1.00 . A A . 108 GLN HG2  1 1 
        1  1678 1 1 108 GLN HG3  H -16.639  -1.345  -5.240 1.00 . A A . 108 GLN HG3  1 1 
        1  1679 1 1 108 GLN N    N -14.656   0.358  -4.615 1.00 . A A . 108 GLN N    1 1 
        1  1680 1 1 108 GLN NE2  N -18.839  -2.587  -5.144 1.00 . A A . 108 GLN NE2  1 1 
        1  1681 1 1 108 GLN O    O -16.626   3.319  -3.895 1.00 . A A . 108 GLN O    1 1 
        1  1682 1 1 108 GLN OE1  O -19.653  -0.662  -4.399 1.00 . A A . 108 GLN OE1  1 1 
        1  1683 1 1 109 GLY C    C -14.340   4.379  -1.647 1.00 . A A . 109 GLY C    1 1 
        1  1684 1 1 109 GLY CA   C -14.167   4.310  -3.165 1.00 . A A . 109 GLY CA   1 1 
        1  1685 1 1 109 GLY H    H -13.666   2.361  -3.873 1.00 . A A . 109 GLY H    1 1 
        1  1686 1 1 109 GLY HA2  H -13.157   4.604  -3.403 1.00 . A A . 109 GLY HA2  1 1 
        1  1687 1 1 109 GLY HA3  H -14.843   5.021  -3.623 1.00 . A A . 109 GLY HA3  1 1 
        1  1688 1 1 109 GLY N    N -14.413   2.986  -3.747 1.00 . A A . 109 GLY N    1 1 
        1  1689 1 1 109 GLY O    O -13.703   5.203  -0.988 1.00 . A A . 109 GLY O    1 1 
        1  1690 1 1 110 GLU C    C -14.089   3.196   1.093 1.00 . A A . 110 GLU C    1 1 
        1  1691 1 1 110 GLU CA   C -15.420   3.456   0.362 1.00 . A A . 110 GLU CA   1 1 
        1  1692 1 1 110 GLU CB   C -16.456   2.364   0.686 1.00 . A A . 110 GLU CB   1 1 
        1  1693 1 1 110 GLU CD   C -17.334   0.031   0.200 1.00 . A A . 110 GLU CD   1 1 
        1  1694 1 1 110 GLU CG   C -16.254   1.064  -0.087 1.00 . A A . 110 GLU CG   1 1 
        1  1695 1 1 110 GLU H    H -15.763   2.976  -1.682 1.00 . A A . 110 GLU H    1 1 
        1  1696 1 1 110 GLU HA   H -15.808   4.411   0.694 1.00 . A A . 110 GLU HA   1 1 
        1  1697 1 1 110 GLU HB2  H -16.411   2.141   1.743 1.00 . A A . 110 GLU HB2  1 1 
        1  1698 1 1 110 GLU HB3  H -17.443   2.744   0.453 1.00 . A A . 110 GLU HB3  1 1 
        1  1699 1 1 110 GLU HG2  H -16.263   1.287  -1.145 1.00 . A A . 110 GLU HG2  1 1 
        1  1700 1 1 110 GLU HG3  H -15.292   0.649   0.182 1.00 . A A . 110 GLU HG3  1 1 
        1  1701 1 1 110 GLU N    N -15.223   3.543  -1.098 1.00 . A A . 110 GLU N    1 1 
        1  1702 1 1 110 GLU O    O -13.182   2.584   0.540 1.00 . A A . 110 GLU O    1 1 
        1  1703 1 1 110 GLU OE1  O -18.495   0.241  -0.211 1.00 . A A . 110 GLU OE1  1 1 
        1  1704 1 1 110 GLU OE2  O -17.029  -1.000   0.832 1.00 . A A . 110 GLU OE2  1 1 
        1  1705 1 1 111 GLU C    C -12.612   2.641   4.180 1.00 . A A . 111 GLU C    1 1 
        1  1706 1 1 111 GLU CA   C -12.679   3.673   3.037 1.00 . A A . 111 GLU CA   1 1 
        1  1707 1 1 111 GLU CB   C -12.405   5.081   3.581 1.00 . A A . 111 GLU CB   1 1 
        1  1708 1 1 111 GLU CD   C -10.785   6.685   4.673 1.00 . A A . 111 GLU CD   1 1 
        1  1709 1 1 111 GLU CG   C -11.042   5.250   4.244 1.00 . A A . 111 GLU CG   1 1 
        1  1710 1 1 111 GLU H    H -14.762   4.025   2.786 1.00 . A A . 111 GLU H    1 1 
        1  1711 1 1 111 GLU HA   H -11.910   3.432   2.314 1.00 . A A . 111 GLU HA   1 1 
        1  1712 1 1 111 GLU HB2  H -12.472   5.788   2.764 1.00 . A A . 111 GLU HB2  1 1 
        1  1713 1 1 111 GLU HB3  H -13.167   5.324   4.309 1.00 . A A . 111 GLU HB3  1 1 
        1  1714 1 1 111 GLU HG2  H -10.998   4.611   5.115 1.00 . A A . 111 GLU HG2  1 1 
        1  1715 1 1 111 GLU HG3  H -10.275   4.953   3.542 1.00 . A A . 111 GLU HG3  1 1 
        1  1716 1 1 111 GLU N    N -13.971   3.671   2.331 1.00 . A A . 111 GLU N    1 1 
        1  1717 1 1 111 GLU O    O -13.545   2.505   4.974 1.00 . A A . 111 GLU O    1 1 
        1  1718 1 1 111 GLU OE1  O -10.403   7.503   3.814 1.00 . A A . 111 GLU OE1  1 1 
        1  1719 1 1 111 GLU OE2  O -10.985   7.004   5.862 1.00 . A A . 111 GLU OE2  1 1 
        1  1720 1 1 112 VAL C    C -10.431   1.517   6.480 1.00 . A A . 112 VAL C    1 1 
        1  1721 1 1 112 VAL CA   C -11.260   0.934   5.323 1.00 . A A . 112 VAL CA   1 1 
        1  1722 1 1 112 VAL CB   C -10.537  -0.324   4.775 1.00 . A A . 112 VAL CB   1 1 
        1  1723 1 1 112 VAL CG1  C -10.255  -1.329   5.893 1.00 . A A . 112 VAL CG1  1 1 
        1  1724 1 1 112 VAL CG2  C -11.352  -0.971   3.661 1.00 . A A . 112 VAL CG2  1 1 
        1  1725 1 1 112 VAL H    H -10.785   2.067   3.589 1.00 . A A . 112 VAL H    1 1 
        1  1726 1 1 112 VAL HA   H -12.226   0.626   5.706 1.00 . A A . 112 VAL HA   1 1 
        1  1727 1 1 112 VAL HB   H  -9.587  -0.013   4.358 1.00 . A A . 112 VAL HB   1 1 
        1  1728 1 1 112 VAL HG11 H  -9.775  -2.205   5.479 1.00 . A A . 112 VAL HG11 1 1 
        1  1729 1 1 112 VAL HG12 H -11.184  -1.618   6.366 1.00 . A A . 112 VAL HG12 1 1 
        1  1730 1 1 112 VAL HG13 H  -9.604  -0.880   6.628 1.00 . A A . 112 VAL HG13 1 1 
        1  1731 1 1 112 VAL HG21 H -11.475  -0.268   2.848 1.00 . A A . 112 VAL HG21 1 1 
        1  1732 1 1 112 VAL HG22 H -12.324  -1.255   4.039 1.00 . A A . 112 VAL HG22 1 1 
        1  1733 1 1 112 VAL HG23 H -10.837  -1.850   3.298 1.00 . A A . 112 VAL HG23 1 1 
        1  1734 1 1 112 VAL N    N -11.485   1.925   4.262 1.00 . A A . 112 VAL N    1 1 
        1  1735 1 1 112 VAL O    O -10.852   1.478   7.639 1.00 . A A . 112 VAL O    1 1 
        1  1736 1 1 113 ALA C    C  -7.313   3.551   6.602 1.00 . A A . 113 ALA C    1 1 
        1  1737 1 1 113 ALA CA   C  -8.343   2.577   7.187 1.00 . A A . 113 ALA CA   1 1 
        1  1738 1 1 113 ALA CB   C  -7.632   1.428   7.892 1.00 . A A . 113 ALA CB   1 1 
        1  1739 1 1 113 ALA H    H  -8.986   2.100   5.219 1.00 . A A . 113 ALA H    1 1 
        1  1740 1 1 113 ALA HA   H  -8.938   3.102   7.922 1.00 . A A . 113 ALA HA   1 1 
        1  1741 1 1 113 ALA HB1  H  -7.012   1.819   8.685 1.00 . A A . 113 ALA HB1  1 1 
        1  1742 1 1 113 ALA HB2  H  -7.015   0.895   7.182 1.00 . A A . 113 ALA HB2  1 1 
        1  1743 1 1 113 ALA HB3  H  -8.365   0.751   8.309 1.00 . A A . 113 ALA HB3  1 1 
        1  1744 1 1 113 ALA N    N  -9.252   2.051   6.162 1.00 . A A . 113 ALA N    1 1 
        1  1745 1 1 113 ALA O    O  -7.179   3.678   5.383 1.00 . A A . 113 ALA O    1 1 
        1  1746 1 1 114 GLN C    C  -4.457   5.316   8.148 1.00 . A A . 114 GLN C    1 1 
        1  1747 1 1 114 GLN CA   C  -5.560   5.193   7.080 1.00 . A A . 114 GLN CA   1 1 
        1  1748 1 1 114 GLN CB   C  -6.204   6.564   6.812 1.00 . A A . 114 GLN CB   1 1 
        1  1749 1 1 114 GLN CD   C  -7.681   8.440   7.656 1.00 . A A . 114 GLN CD   1 1 
        1  1750 1 1 114 GLN CG   C  -7.067   7.083   7.957 1.00 . A A . 114 GLN CG   1 1 
        1  1751 1 1 114 GLN H    H  -6.738   4.071   8.442 1.00 . A A . 114 GLN H    1 1 
        1  1752 1 1 114 GLN HA   H  -5.112   4.832   6.163 1.00 . A A . 114 GLN HA   1 1 
        1  1753 1 1 114 GLN HB2  H  -5.421   7.285   6.622 1.00 . A A . 114 GLN HB2  1 1 
        1  1754 1 1 114 GLN HB3  H  -6.825   6.486   5.928 1.00 . A A . 114 GLN HB3  1 1 
        1  1755 1 1 114 GLN HE21 H  -9.273   7.585   6.841 1.00 . A A . 114 GLN HE21 1 1 
        1  1756 1 1 114 GLN HE22 H  -9.265   9.308   6.861 1.00 . A A . 114 GLN HE22 1 1 
        1  1757 1 1 114 GLN HG2  H  -7.865   6.376   8.137 1.00 . A A . 114 GLN HG2  1 1 
        1  1758 1 1 114 GLN HG3  H  -6.456   7.168   8.844 1.00 . A A . 114 GLN HG3  1 1 
        1  1759 1 1 114 GLN N    N  -6.584   4.225   7.486 1.00 . A A . 114 GLN N    1 1 
        1  1760 1 1 114 GLN NE2  N  -8.856   8.444   7.061 1.00 . A A . 114 GLN NE2  1 1 
        1  1761 1 1 114 GLN O    O  -4.741   5.422   9.342 1.00 . A A . 114 GLN O    1 1 
        1  1762 1 1 114 GLN OE1  O  -7.097   9.478   7.948 1.00 . A A . 114 GLN OE1  1 1 
        1  1763 1 1 115 ARG C    C  -0.883   6.149   8.063 1.00 . A A . 115 ARG C    1 1 
        1  1764 1 1 115 ARG CA   C  -2.057   5.337   8.640 1.00 . A A . 115 ARG CA   1 1 
        1  1765 1 1 115 ARG CB   C  -1.599   3.898   8.944 1.00 . A A . 115 ARG CB   1 1 
        1  1766 1 1 115 ARG CD   C  -0.014   2.366  10.192 1.00 . A A . 115 ARG CD   1 1 
        1  1767 1 1 115 ARG CG   C  -0.472   3.805   9.969 1.00 . A A . 115 ARG CG   1 1 
        1  1768 1 1 115 ARG CZ   C   1.950   1.360  11.261 1.00 . A A . 115 ARG CZ   1 1 
        1  1769 1 1 115 ARG H    H  -3.031   5.288   6.743 1.00 . A A . 115 ARG H    1 1 
        1  1770 1 1 115 ARG HA   H  -2.385   5.803   9.559 1.00 . A A . 115 ARG HA   1 1 
        1  1771 1 1 115 ARG HB2  H  -2.445   3.338   9.320 1.00 . A A . 115 ARG HB2  1 1 
        1  1772 1 1 115 ARG HB3  H  -1.261   3.442   8.024 1.00 . A A . 115 ARG HB3  1 1 
        1  1773 1 1 115 ARG HD2  H  -0.860   1.776  10.512 1.00 . A A . 115 ARG HD2  1 1 
        1  1774 1 1 115 ARG HD3  H   0.367   1.973   9.258 1.00 . A A . 115 ARG HD3  1 1 
        1  1775 1 1 115 ARG HE   H   1.051   2.986  11.892 1.00 . A A . 115 ARG HE   1 1 
        1  1776 1 1 115 ARG HG2  H   0.368   4.387   9.620 1.00 . A A . 115 ARG HG2  1 1 
        1  1777 1 1 115 ARG HG3  H  -0.822   4.209  10.910 1.00 . A A . 115 ARG HG3  1 1 
        1  1778 1 1 115 ARG HH11 H   1.259   0.324   9.711 1.00 . A A . 115 ARG HH11 1 1 
        1  1779 1 1 115 ARG HH12 H   2.674  -0.313  10.470 1.00 . A A . 115 ARG HH12 1 1 
        1  1780 1 1 115 ARG HH21 H   2.832   2.144  12.858 1.00 . A A . 115 ARG HH21 1 1 
        1  1781 1 1 115 ARG HH22 H   3.556   0.701  12.226 1.00 . A A . 115 ARG HH22 1 1 
        1  1782 1 1 115 ARG N    N  -3.199   5.308   7.711 1.00 . A A . 115 ARG N    1 1 
        1  1783 1 1 115 ARG NE   N   1.033   2.288  11.207 1.00 . A A . 115 ARG NE   1 1 
        1  1784 1 1 115 ARG NH1  N   1.959   0.384  10.416 1.00 . A A . 115 ARG NH1  1 1 
        1  1785 1 1 115 ARG NH2  N   2.847   1.404  12.187 1.00 . A A . 115 ARG NH2  1 1 
        1  1786 1 1 115 ARG O    O  -0.703   6.220   6.847 1.00 . A A . 115 ARG O    1 1 
        1  1787 1 1 116 SER C    C   2.368   7.063   9.230 1.00 . A A . 116 SER C    1 1 
        1  1788 1 1 116 SER CA   C   1.095   7.533   8.514 1.00 . A A . 116 SER CA   1 1 
        1  1789 1 1 116 SER CB   C   0.890   9.033   8.790 1.00 . A A . 116 SER CB   1 1 
        1  1790 1 1 116 SER H    H  -0.291   6.691   9.900 1.00 . A A . 116 SER H    1 1 
        1  1791 1 1 116 SER HA   H   1.226   7.388   7.450 1.00 . A A . 116 SER HA   1 1 
        1  1792 1 1 116 SER HB2  H   1.669   9.597   8.299 1.00 . A A . 116 SER HB2  1 1 
        1  1793 1 1 116 SER HB3  H  -0.072   9.338   8.402 1.00 . A A . 116 SER HB3  1 1 
        1  1794 1 1 116 SER HG   H   1.852   9.337  10.478 1.00 . A A . 116 SER HG   1 1 
        1  1795 1 1 116 SER N    N  -0.085   6.758   8.941 1.00 . A A . 116 SER N    1 1 
        1  1796 1 1 116 SER O    O   2.344   6.123  10.029 1.00 . A A . 116 SER O    1 1 
        1  1797 1 1 116 SER OG   O   0.930   9.320  10.183 1.00 . A A . 116 SER OG   1 1 
        1  1798 1 1 117 THR C    C   4.829   8.145  10.976 1.00 . A A . 117 THR C    1 1 
        1  1799 1 1 117 THR CA   C   4.758   7.450   9.607 1.00 . A A . 117 THR CA   1 1 
        1  1800 1 1 117 THR CB   C   5.962   7.914   8.752 1.00 . A A . 117 THR CB   1 1 
        1  1801 1 1 117 THR CG2  C   6.084   7.089   7.474 1.00 . A A . 117 THR CG2  1 1 
        1  1802 1 1 117 THR H    H   3.462   8.401   8.218 1.00 . A A . 117 THR H    1 1 
        1  1803 1 1 117 THR HA   H   4.840   6.382   9.754 1.00 . A A . 117 THR HA   1 1 
        1  1804 1 1 117 THR HB   H   6.867   7.782   9.331 1.00 . A A . 117 THR HB   1 1 
        1  1805 1 1 117 THR HG1  H   6.225   9.848   9.112 1.00 . A A . 117 THR HG1  1 1 
        1  1806 1 1 117 THR HG21 H   5.189   7.209   6.879 1.00 . A A . 117 THR HG21 1 1 
        1  1807 1 1 117 THR HG22 H   6.210   6.047   7.729 1.00 . A A . 117 THR HG22 1 1 
        1  1808 1 1 117 THR HG23 H   6.940   7.426   6.908 1.00 . A A . 117 THR HG23 1 1 
        1  1809 1 1 117 THR N    N   3.485   7.720   8.928 1.00 . A A . 117 THR N    1 1 
        1  1810 1 1 117 THR O    O   3.862   8.766  11.430 1.00 . A A . 117 THR O    1 1 
        1  1811 1 1 117 THR OG1  O   5.823   9.303   8.418 1.00 . A A . 117 THR OG1  1 1 
        1  1812 1 1 118 VAL C    C   7.330   9.710  12.845 1.00 . A A . 118 VAL C    1 1 
        1  1813 1 1 118 VAL CA   C   6.212   8.662  12.941 1.00 . A A . 118 VAL CA   1 1 
        1  1814 1 1 118 VAL CB   C   6.584   7.621  14.028 1.00 . A A . 118 VAL CB   1 1 
        1  1815 1 1 118 VAL CG1  C   6.749   8.290  15.394 1.00 . A A . 118 VAL CG1  1 1 
        1  1816 1 1 118 VAL CG2  C   5.534   6.515  14.092 1.00 . A A . 118 VAL CG2  1 1 
        1  1817 1 1 118 VAL H    H   6.699   7.489  11.242 1.00 . A A . 118 VAL H    1 1 
        1  1818 1 1 118 VAL HA   H   5.295   9.155  13.242 1.00 . A A . 118 VAL HA   1 1 
        1  1819 1 1 118 VAL HB   H   7.530   7.172  13.757 1.00 . A A . 118 VAL HB   1 1 
        1  1820 1 1 118 VAL HG11 H   7.004   7.545  16.136 1.00 . A A . 118 VAL HG11 1 1 
        1  1821 1 1 118 VAL HG12 H   5.823   8.773  15.674 1.00 . A A . 118 VAL HG12 1 1 
        1  1822 1 1 118 VAL HG13 H   7.536   9.029  15.343 1.00 . A A . 118 VAL HG13 1 1 
        1  1823 1 1 118 VAL HG21 H   5.824   5.781  14.832 1.00 . A A . 118 VAL HG21 1 1 
        1  1824 1 1 118 VAL HG22 H   5.455   6.036  13.125 1.00 . A A . 118 VAL HG22 1 1 
        1  1825 1 1 118 VAL HG23 H   4.578   6.940  14.362 1.00 . A A . 118 VAL HG23 1 1 
        1  1826 1 1 118 VAL N    N   5.980   8.020  11.639 1.00 . A A . 118 VAL N    1 1 
        1  1827 1 1 118 VAL O    O   8.389   9.449  12.269 1.00 . A A . 118 VAL O    1 1 
        1  1828 1 1 119 PHE C    C   9.364  11.639  14.114 1.00 . A A . 119 PHE C    1 1 
        1  1829 1 1 119 PHE CA   C   8.058  11.990  13.374 1.00 . A A . 119 PHE CA   1 1 
        1  1830 1 1 119 PHE CB   C   7.438  13.262  13.974 1.00 . A A . 119 PHE CB   1 1 
        1  1831 1 1 119 PHE CD1  C   4.951  13.090  13.616 1.00 . A A . 119 PHE CD1  1 1 
        1  1832 1 1 119 PHE CD2  C   6.166  14.697  12.339 1.00 . A A . 119 PHE CD2  1 1 
        1  1833 1 1 119 PHE CE1  C   3.781  13.475  12.996 1.00 . A A . 119 PHE CE1  1 1 
        1  1834 1 1 119 PHE CE2  C   4.996  15.086  11.715 1.00 . A A . 119 PHE CE2  1 1 
        1  1835 1 1 119 PHE CG   C   6.159  13.693  13.296 1.00 . A A . 119 PHE CG   1 1 
        1  1836 1 1 119 PHE CZ   C   3.801  14.473  12.046 1.00 . A A . 119 PHE CZ   1 1 
        1  1837 1 1 119 PHE H    H   6.241  11.021  13.883 1.00 . A A . 119 PHE H    1 1 
        1  1838 1 1 119 PHE HA   H   8.291  12.175  12.335 1.00 . A A . 119 PHE HA   1 1 
        1  1839 1 1 119 PHE HB2  H   7.215  13.091  15.018 1.00 . A A . 119 PHE HB2  1 1 
        1  1840 1 1 119 PHE HB3  H   8.148  14.073  13.895 1.00 . A A . 119 PHE HB3  1 1 
        1  1841 1 1 119 PHE HD1  H   4.929  12.309  14.363 1.00 . A A . 119 PHE HD1  1 1 
        1  1842 1 1 119 PHE HD2  H   7.100  15.177  12.078 1.00 . A A . 119 PHE HD2  1 1 
        1  1843 1 1 119 PHE HE1  H   2.849  12.995  13.256 1.00 . A A . 119 PHE HE1  1 1 
        1  1844 1 1 119 PHE HE2  H   5.013  15.869  10.972 1.00 . A A . 119 PHE HE2  1 1 
        1  1845 1 1 119 PHE HZ   H   2.885  14.776  11.559 1.00 . A A . 119 PHE HZ   1 1 
        1  1846 1 1 119 PHE N    N   7.093  10.885  13.421 1.00 . A A . 119 PHE N    1 1 
        1  1847 1 1 119 PHE O    O   9.481  11.837  15.326 1.00 . A A . 119 PHE O    1 1 
        1  1848 1 1 120 LYS C    C  12.779  11.065  12.977 1.00 . A A . 120 LYS C    1 1 
        1  1849 1 1 120 LYS CA   C  11.639  10.747  13.956 1.00 . A A . 120 LYS CA   1 1 
        1  1850 1 1 120 LYS CB   C  11.680   9.253  14.322 1.00 . A A . 120 LYS CB   1 1 
        1  1851 1 1 120 LYS CD   C  13.010   7.340  15.362 1.00 . A A . 120 LYS CD   1 1 
        1  1852 1 1 120 LYS CE   C  13.848   6.659  14.277 1.00 . A A . 120 LYS CE   1 1 
        1  1853 1 1 120 LYS CG   C  12.899   8.856  15.158 1.00 . A A . 120 LYS CG   1 1 
        1  1854 1 1 120 LYS H    H  10.162  10.907  12.435 1.00 . A A . 120 LYS H    1 1 
        1  1855 1 1 120 LYS HA   H  11.778  11.333  14.854 1.00 . A A . 120 LYS HA   1 1 
        1  1856 1 1 120 LYS HB2  H  10.789   9.008  14.884 1.00 . A A . 120 LYS HB2  1 1 
        1  1857 1 1 120 LYS HB3  H  11.689   8.669  13.411 1.00 . A A . 120 LYS HB3  1 1 
        1  1858 1 1 120 LYS HD2  H  13.471   7.152  16.320 1.00 . A A . 120 LYS HD2  1 1 
        1  1859 1 1 120 LYS HD3  H  12.015   6.913  15.356 1.00 . A A . 120 LYS HD3  1 1 
        1  1860 1 1 120 LYS HE2  H  14.835   7.098  14.276 1.00 . A A . 120 LYS HE2  1 1 
        1  1861 1 1 120 LYS HE3  H  13.929   5.607  14.514 1.00 . A A . 120 LYS HE3  1 1 
        1  1862 1 1 120 LYS HG2  H  13.791   9.205  14.658 1.00 . A A . 120 LYS HG2  1 1 
        1  1863 1 1 120 LYS HG3  H  12.824   9.336  16.126 1.00 . A A . 120 LYS HG3  1 1 
        1  1864 1 1 120 LYS HZ1  H  13.818   6.244  12.233 1.00 . A A . 120 LYS HZ1  1 1 
        1  1865 1 1 120 LYS HZ2  H  13.274   7.799  12.620 1.00 . A A . 120 LYS HZ2  1 1 
        1  1866 1 1 120 LYS HZ3  H  12.285   6.460  12.909 1.00 . A A . 120 LYS HZ3  1 1 
        1  1867 1 1 120 LYS N    N  10.334  11.095  13.381 1.00 . A A . 120 LYS N    1 1 
        1  1868 1 1 120 LYS NZ   N  13.264   6.802  12.917 1.00 . A A . 120 LYS NZ   1 1 
        1  1869 1 1 120 LYS O    O  12.593  11.040  11.757 1.00 . A A . 120 LYS O    1 1 
        1  1870 1 1 121 THR C    C  15.642  10.288  12.031 1.00 . A A . 121 THR C    1 1 
        1  1871 1 1 121 THR CA   C  15.161  11.582  12.709 1.00 . A A . 121 THR CA   1 1 
        1  1872 1 1 121 THR CB   C  16.317  12.163  13.566 1.00 . A A . 121 THR CB   1 1 
        1  1873 1 1 121 THR CG2  C  15.995  13.579  14.040 1.00 . A A . 121 THR CG2  1 1 
        1  1874 1 1 121 THR H    H  14.030  11.407  14.497 1.00 . A A . 121 THR H    1 1 
        1  1875 1 1 121 THR HA   H  14.911  12.304  11.942 1.00 . A A . 121 THR HA   1 1 
        1  1876 1 1 121 THR HB   H  17.213  12.199  12.960 1.00 . A A . 121 THR HB   1 1 
        1  1877 1 1 121 THR HG1  H  16.162  11.721  15.490 1.00 . A A . 121 THR HG1  1 1 
        1  1878 1 1 121 THR HG21 H  15.817  14.218  13.187 1.00 . A A . 121 THR HG21 1 1 
        1  1879 1 1 121 THR HG22 H  16.829  13.967  14.610 1.00 . A A . 121 THR HG22 1 1 
        1  1880 1 1 121 THR HG23 H  15.114  13.560  14.664 1.00 . A A . 121 THR HG23 1 1 
        1  1881 1 1 121 THR N    N  13.959  11.350  13.521 1.00 . A A . 121 THR N    1 1 
        1  1882 1 1 121 THR O    O  15.141   9.195  12.320 1.00 . A A . 121 THR O    1 1 
        1  1883 1 1 121 THR OG1  O  16.560  11.320  14.704 1.00 . A A . 121 THR OG1  1 1 
        1  1884 1 1 122 THR C    C  18.692   9.235  10.406 1.00 . A A . 122 THR C    1 1 
        1  1885 1 1 122 THR CA   C  17.146   9.266  10.380 1.00 . A A . 122 THR CA   1 1 
        1  1886 1 1 122 THR CB   C  16.625   9.248   8.913 1.00 . A A . 122 THR CB   1 1 
        1  1887 1 1 122 THR CG2  C  16.712  10.629   8.262 1.00 . A A . 122 THR CG2  1 1 
        1  1888 1 1 122 THR H    H  16.975  11.312  10.943 1.00 . A A . 122 THR H    1 1 
        1  1889 1 1 122 THR HA   H  16.785   8.368  10.868 1.00 . A A . 122 THR HA   1 1 
        1  1890 1 1 122 THR HB   H  15.586   8.947   8.930 1.00 . A A . 122 THR HB   1 1 
        1  1891 1 1 122 THR HG1  H  18.291   8.557   8.101 1.00 . A A . 122 THR HG1  1 1 
        1  1892 1 1 122 THR HG21 H  16.142  11.341   8.843 1.00 . A A . 122 THR HG21 1 1 
        1  1893 1 1 122 THR HG22 H  16.311  10.581   7.260 1.00 . A A . 122 THR HG22 1 1 
        1  1894 1 1 122 THR HG23 H  17.745  10.944   8.220 1.00 . A A . 122 THR HG23 1 1 
        1  1895 1 1 122 THR N    N  16.607  10.419  11.122 1.00 . A A . 122 THR N    1 1 
        1  1896 1 1 122 THR O    O  19.339   9.738   9.459 1.00 . A A . 122 THR O    1 1 
        1  1897 1 1 122 THR OXT  O  19.257   8.715  11.395 1.00 . A A . 122 THR OXT  1 1 
        1  1898 1 1 122 THR OG1  O  17.360   8.294   8.131 1.00 . A A . 122 THR OG1  1 1 
        2  1899 1 1   1 MET C    C  -8.076 -17.257 -20.873 1.00 . A A .   1 MET C    1 1 
        2  1900 1 1   1 MET CA   C  -7.444 -16.855 -22.211 1.00 . A A .   1 MET CA   1 1 
        2  1901 1 1   1 MET CB   C  -5.922 -16.726 -22.057 1.00 . A A .   1 MET CB   1 1 
        2  1902 1 1   1 MET CE   C  -4.606 -17.405 -25.961 1.00 . A A .   1 MET CE   1 1 
        2  1903 1 1   1 MET CG   C  -5.191 -16.559 -23.380 1.00 . A A .   1 MET CG   1 1 
        2  1904 1 1   1 MET H1   H  -7.860 -14.818 -22.036 1.00 . A A .   1 MET H1   1 1 
        2  1905 1 1   1 MET H2   H  -9.045 -15.689 -22.865 1.00 . A A .   1 MET H2   1 1 
        2  1906 1 1   1 MET H3   H  -7.582 -15.322 -23.627 1.00 . A A .   1 MET H3   1 1 
        2  1907 1 1   1 MET HA   H  -7.659 -17.629 -22.936 1.00 . A A .   1 MET HA   1 1 
        2  1908 1 1   1 MET HB2  H  -5.704 -15.867 -21.438 1.00 . A A .   1 MET HB2  1 1 
        2  1909 1 1   1 MET HB3  H  -5.545 -17.614 -21.571 1.00 . A A .   1 MET HB3  1 1 
        2  1910 1 1   1 MET HE1  H  -4.746 -18.127 -26.752 1.00 . A A .   1 MET HE1  1 1 
        2  1911 1 1   1 MET HE2  H  -3.560 -17.355 -25.701 1.00 . A A .   1 MET HE2  1 1 
        2  1912 1 1   1 MET HE3  H  -4.941 -16.436 -26.298 1.00 . A A .   1 MET HE3  1 1 
        2  1913 1 1   1 MET HG2  H  -5.491 -15.625 -23.832 1.00 . A A .   1 MET HG2  1 1 
        2  1914 1 1   1 MET HG3  H  -4.126 -16.543 -23.191 1.00 . A A .   1 MET HG3  1 1 
        2  1915 1 1   1 MET N    N  -8.023 -15.584 -22.719 1.00 . A A .   1 MET N    1 1 
        2  1916 1 1   1 MET O    O  -8.398 -16.399 -20.049 1.00 . A A .   1 MET O    1 1 
        2  1917 1 1   1 MET SD   S  -5.557 -17.902 -24.527 1.00 . A A .   1 MET SD   1 1 
        2  1918 1 1   2 GLY C    C -10.389 -18.835 -19.420 1.00 . A A .   2 GLY C    1 1 
        2  1919 1 1   2 GLY CA   C  -8.878 -19.060 -19.447 1.00 . A A .   2 GLY CA   1 1 
        2  1920 1 1   2 GLY H    H  -7.953 -19.204 -21.354 1.00 . A A .   2 GLY H    1 1 
        2  1921 1 1   2 GLY HA2  H  -8.682 -20.119 -19.362 1.00 . A A .   2 GLY HA2  1 1 
        2  1922 1 1   2 GLY HA3  H  -8.436 -18.557 -18.597 1.00 . A A .   2 GLY HA3  1 1 
        2  1923 1 1   2 GLY N    N  -8.252 -18.565 -20.669 1.00 . A A .   2 GLY N    1 1 
        2  1924 1 1   2 GLY O    O -10.853 -17.739 -19.103 1.00 . A A .   2 GLY O    1 1 
        2  1925 1 1   3 HIS C    C -13.259 -19.405 -18.429 1.00 . A A .   3 HIS C    1 1 
        2  1926 1 1   3 HIS CA   C -12.632 -19.761 -19.793 1.00 . A A .   3 HIS CA   1 1 
        2  1927 1 1   3 HIS CB   C -13.256 -21.051 -20.353 1.00 . A A .   3 HIS CB   1 1 
        2  1928 1 1   3 HIS CD2  C -11.755 -23.069 -19.697 1.00 . A A .   3 HIS CD2  1 1 
        2  1929 1 1   3 HIS CE1  C -13.084 -23.982 -18.217 1.00 . A A .   3 HIS CE1  1 1 
        2  1930 1 1   3 HIS CG   C -12.867 -22.297 -19.616 1.00 . A A .   3 HIS CG   1 1 
        2  1931 1 1   3 HIS H    H -10.740 -20.731 -19.957 1.00 . A A .   3 HIS H    1 1 
        2  1932 1 1   3 HIS HA   H -12.858 -18.956 -20.478 1.00 . A A .   3 HIS HA   1 1 
        2  1933 1 1   3 HIS HB2  H -14.333 -20.966 -20.312 1.00 . A A .   3 HIS HB2  1 1 
        2  1934 1 1   3 HIS HB3  H -12.955 -21.167 -21.385 1.00 . A A .   3 HIS HB3  1 1 
        2  1935 1 1   3 HIS HD1  H -14.563 -22.585 -18.395 1.00 . A A .   3 HIS HD1  1 1 
        2  1936 1 1   3 HIS HD2  H -10.900 -22.898 -20.333 1.00 . A A .   3 HIS HD2  1 1 
        2  1937 1 1   3 HIS HE1  H -13.488 -24.655 -17.475 1.00 . A A .   3 HIS HE1  1 1 
        2  1938 1 1   3 HIS HE2  H -11.204 -24.711 -18.519 1.00 . A A .   3 HIS HE2  1 1 
        2  1939 1 1   3 HIS N    N -11.163 -19.874 -19.737 1.00 . A A .   3 HIS N    1 1 
        2  1940 1 1   3 HIS ND1  N -13.677 -22.900 -18.679 1.00 . A A .   3 HIS ND1  1 1 
        2  1941 1 1   3 HIS NE2  N -11.918 -24.108 -18.816 1.00 . A A .   3 HIS NE2  1 1 
        2  1942 1 1   3 HIS O    O -14.455 -19.124 -18.346 1.00 . A A .   3 HIS O    1 1 
        2  1943 1 1   4 HIS C    C -13.351 -17.475 -16.131 1.00 . A A .   4 HIS C    1 1 
        2  1944 1 1   4 HIS CA   C -12.903 -18.949 -16.049 1.00 . A A .   4 HIS CA   1 1 
        2  1945 1 1   4 HIS CB   C -11.791 -19.118 -14.998 1.00 . A A .   4 HIS CB   1 1 
        2  1946 1 1   4 HIS CD2  C  -9.303 -19.159 -15.743 1.00 . A A .   4 HIS CD2  1 1 
        2  1947 1 1   4 HIS CE1  C  -8.967 -17.000 -15.863 1.00 . A A .   4 HIS CE1  1 1 
        2  1948 1 1   4 HIS CG   C -10.463 -18.548 -15.404 1.00 . A A .   4 HIS CG   1 1 
        2  1949 1 1   4 HIS H    H -11.556 -19.805 -17.458 1.00 . A A .   4 HIS H    1 1 
        2  1950 1 1   4 HIS HA   H -13.753 -19.549 -15.753 1.00 . A A .   4 HIS HA   1 1 
        2  1951 1 1   4 HIS HB2  H -12.090 -18.630 -14.083 1.00 . A A .   4 HIS HB2  1 1 
        2  1952 1 1   4 HIS HB3  H -11.653 -20.173 -14.803 1.00 . A A .   4 HIS HB3  1 1 
        2  1953 1 1   4 HIS HD1  H -10.865 -16.482 -15.310 1.00 . A A .   4 HIS HD1  1 1 
        2  1954 1 1   4 HIS HD2  H  -9.126 -20.225 -15.784 1.00 . A A .   4 HIS HD2  1 1 
        2  1955 1 1   4 HIS HE1  H  -8.496 -16.040 -16.012 1.00 . A A .   4 HIS HE1  1 1 
        2  1956 1 1   4 HIS HE2  H  -7.424 -18.310 -16.146 1.00 . A A .   4 HIS HE2  1 1 
        2  1957 1 1   4 HIS N    N -12.458 -19.435 -17.362 1.00 . A A .   4 HIS N    1 1 
        2  1958 1 1   4 HIS ND1  N -10.214 -17.197 -15.490 1.00 . A A .   4 HIS ND1  1 1 
        2  1959 1 1   4 HIS NE2  N  -8.392 -18.172 -16.023 1.00 . A A .   4 HIS NE2  1 1 
        2  1960 1 1   4 HIS O    O -12.569 -16.594 -16.497 1.00 . A A .   4 HIS O    1 1 
        2  1961 1 1   5 HIS C    C -15.180 -15.067 -14.646 1.00 . A A .   5 HIS C    1 1 
        2  1962 1 1   5 HIS CA   C -15.201 -15.880 -15.954 1.00 . A A .   5 HIS CA   1 1 
        2  1963 1 1   5 HIS CB   C -16.639 -16.004 -16.473 1.00 . A A .   5 HIS CB   1 1 
        2  1964 1 1   5 HIS CD2  C -16.098 -16.585 -18.948 1.00 . A A .   5 HIS CD2  1 1 
        2  1965 1 1   5 HIS CE1  C -17.454 -18.288 -19.176 1.00 . A A .   5 HIS CE1  1 1 
        2  1966 1 1   5 HIS CG   C -16.740 -16.757 -17.766 1.00 . A A .   5 HIS CG   1 1 
        2  1967 1 1   5 HIS H    H -15.163 -17.940 -15.432 1.00 . A A .   5 HIS H    1 1 
        2  1968 1 1   5 HIS HA   H -14.616 -15.352 -16.694 1.00 . A A .   5 HIS HA   1 1 
        2  1969 1 1   5 HIS HB2  H -17.239 -16.522 -15.739 1.00 . A A .   5 HIS HB2  1 1 
        2  1970 1 1   5 HIS HB3  H -17.049 -15.017 -16.631 1.00 . A A .   5 HIS HB3  1 1 
        2  1971 1 1   5 HIS HD1  H -18.200 -18.195 -17.275 1.00 . A A .   5 HIS HD1  1 1 
        2  1972 1 1   5 HIS HD2  H -15.359 -15.828 -19.175 1.00 . A A .   5 HIS HD2  1 1 
        2  1973 1 1   5 HIS HE1  H -17.989 -19.125 -19.599 1.00 . A A .   5 HIS HE1  1 1 
        2  1974 1 1   5 HIS HE2  H -16.205 -17.738 -20.699 1.00 . A A .   5 HIS HE2  1 1 
        2  1975 1 1   5 HIS N    N -14.613 -17.216 -15.795 1.00 . A A .   5 HIS N    1 1 
        2  1976 1 1   5 HIS ND1  N -17.584 -17.831 -17.948 1.00 . A A .   5 HIS ND1  1 1 
        2  1977 1 1   5 HIS NE2  N -16.562 -17.552 -19.803 1.00 . A A .   5 HIS NE2  1 1 
        2  1978 1 1   5 HIS O    O -15.624 -15.536 -13.597 1.00 . A A .   5 HIS O    1 1 
        2  1979 1 1   6 HIS C    C -16.030 -12.241 -13.423 1.00 . A A .   6 HIS C    1 1 
        2  1980 1 1   6 HIS CA   C -14.655 -12.909 -13.597 1.00 . A A .   6 HIS CA   1 1 
        2  1981 1 1   6 HIS CB   C -13.567 -11.841 -13.810 1.00 . A A .   6 HIS CB   1 1 
        2  1982 1 1   6 HIS CD2  C -13.962  -9.352 -13.177 1.00 . A A .   6 HIS CD2  1 1 
        2  1983 1 1   6 HIS CE1  C -13.673  -9.519 -11.012 1.00 . A A .   6 HIS CE1  1 1 
        2  1984 1 1   6 HIS CG   C -13.681 -10.651 -12.902 1.00 . A A .   6 HIS CG   1 1 
        2  1985 1 1   6 HIS H    H -14.252 -13.562 -15.575 1.00 . A A .   6 HIS H    1 1 
        2  1986 1 1   6 HIS HA   H -14.422 -13.471 -12.702 1.00 . A A .   6 HIS HA   1 1 
        2  1987 1 1   6 HIS HB2  H -12.597 -12.288 -13.644 1.00 . A A .   6 HIS HB2  1 1 
        2  1988 1 1   6 HIS HB3  H -13.618 -11.486 -14.830 1.00 . A A .   6 HIS HB3  1 1 
        2  1989 1 1   6 HIS HD1  H -13.304 -11.528 -11.021 1.00 . A A .   6 HIS HD1  1 1 
        2  1990 1 1   6 HIS HD2  H -14.160  -8.931 -14.152 1.00 . A A .   6 HIS HD2  1 1 
        2  1991 1 1   6 HIS HE1  H -13.593  -9.270  -9.964 1.00 . A A .   6 HIS HE1  1 1 
        2  1992 1 1   6 HIS HE2  H -14.231  -7.743 -11.859 1.00 . A A .   6 HIS HE2  1 1 
        2  1993 1 1   6 HIS N    N -14.658 -13.845 -14.727 1.00 . A A .   6 HIS N    1 1 
        2  1994 1 1   6 HIS ND1  N -13.507 -10.717 -11.535 1.00 . A A .   6 HIS ND1  1 1 
        2  1995 1 1   6 HIS NE2  N -13.949  -8.675 -11.984 1.00 . A A .   6 HIS NE2  1 1 
        2  1996 1 1   6 HIS O    O -16.475 -11.489 -14.287 1.00 . A A .   6 HIS O    1 1 
        2  1997 1 1   7 HIS C    C -17.897 -10.724 -11.076 1.00 . A A .   7 HIS C    1 1 
        2  1998 1 1   7 HIS CA   C -18.010 -11.932 -12.018 1.00 . A A .   7 HIS CA   1 1 
        2  1999 1 1   7 HIS CB   C -18.937 -12.988 -11.399 1.00 . A A .   7 HIS CB   1 1 
        2  2000 1 1   7 HIS CD2  C -18.520 -15.375 -12.343 1.00 . A A .   7 HIS CD2  1 1 
        2  2001 1 1   7 HIS CE1  C -20.074 -15.383 -13.886 1.00 . A A .   7 HIS CE1  1 1 
        2  2002 1 1   7 HIS CG   C -19.157 -14.180 -12.284 1.00 . A A .   7 HIS CG   1 1 
        2  2003 1 1   7 HIS H    H -16.290 -13.131 -11.649 1.00 . A A .   7 HIS H    1 1 
        2  2004 1 1   7 HIS HA   H -18.437 -11.601 -12.955 1.00 . A A .   7 HIS HA   1 1 
        2  2005 1 1   7 HIS HB2  H -18.506 -13.338 -10.471 1.00 . A A .   7 HIS HB2  1 1 
        2  2006 1 1   7 HIS HB3  H -19.901 -12.539 -11.195 1.00 . A A .   7 HIS HB3  1 1 
        2  2007 1 1   7 HIS HD1  H -20.755 -13.499 -13.482 1.00 . A A .   7 HIS HD1  1 1 
        2  2008 1 1   7 HIS HD2  H -17.705 -15.700 -11.710 1.00 . A A .   7 HIS HD2  1 1 
        2  2009 1 1   7 HIS HE1  H -20.717 -15.697 -14.696 1.00 . A A .   7 HIS HE1  1 1 
        2  2010 1 1   7 HIS HE2  H -18.938 -17.046 -13.540 1.00 . A A .   7 HIS HE2  1 1 
        2  2011 1 1   7 HIS N    N -16.693 -12.518 -12.302 1.00 . A A .   7 HIS N    1 1 
        2  2012 1 1   7 HIS ND1  N -20.125 -14.221 -13.267 1.00 . A A .   7 HIS ND1  1 1 
        2  2013 1 1   7 HIS NE2  N -19.111 -16.100 -13.348 1.00 . A A .   7 HIS NE2  1 1 
        2  2014 1 1   7 HIS O    O -17.184 -10.777 -10.069 1.00 . A A .   7 HIS O    1 1 
        2  2015 1 1   8 HIS C    C -19.176  -8.783  -9.149 1.00 . A A .   8 HIS C    1 1 
        2  2016 1 1   8 HIS CA   C -18.642  -8.444 -10.556 1.00 . A A .   8 HIS CA   1 1 
        2  2017 1 1   8 HIS CB   C -19.495  -7.342 -11.210 1.00 . A A .   8 HIS CB   1 1 
        2  2018 1 1   8 HIS CD2  C -21.335  -8.154 -12.861 1.00 . A A .   8 HIS CD2  1 1 
        2  2019 1 1   8 HIS CE1  C -22.989  -8.340 -11.438 1.00 . A A .   8 HIS CE1  1 1 
        2  2020 1 1   8 HIS CG   C -20.863  -7.797 -11.642 1.00 . A A .   8 HIS CG   1 1 
        2  2021 1 1   8 HIS H    H -19.069  -9.627 -12.274 1.00 . A A .   8 HIS H    1 1 
        2  2022 1 1   8 HIS HA   H -17.628  -8.081 -10.456 1.00 . A A .   8 HIS HA   1 1 
        2  2023 1 1   8 HIS HB2  H -19.623  -6.531 -10.509 1.00 . A A .   8 HIS HB2  1 1 
        2  2024 1 1   8 HIS HB3  H -18.978  -6.972 -12.085 1.00 . A A .   8 HIS HB3  1 1 
        2  2025 1 1   8 HIS HD1  H -21.905  -7.755  -9.809 1.00 . A A .   8 HIS HD1  1 1 
        2  2026 1 1   8 HIS HD2  H -20.774  -8.170 -13.786 1.00 . A A .   8 HIS HD2  1 1 
        2  2027 1 1   8 HIS HE1  H -23.964  -8.522 -11.015 1.00 . A A .   8 HIS HE1  1 1 
        2  2028 1 1   8 HIS HE2  H -23.209  -8.941 -13.376 1.00 . A A .   8 HIS HE2  1 1 
        2  2029 1 1   8 HIS N    N -18.593  -9.636 -11.414 1.00 . A A .   8 HIS N    1 1 
        2  2030 1 1   8 HIS ND1  N -21.928  -7.926 -10.777 1.00 . A A .   8 HIS ND1  1 1 
        2  2031 1 1   8 HIS NE2  N -22.658  -8.486 -12.704 1.00 . A A .   8 HIS NE2  1 1 
        2  2032 1 1   8 HIS O    O -20.380  -8.756  -8.899 1.00 . A A .   8 HIS O    1 1 
        2  2033 1 1   9 SER C    C -17.904  -8.709  -5.816 1.00 . A A .   9 SER C    1 1 
        2  2034 1 1   9 SER CA   C -18.639  -9.534  -6.882 1.00 . A A .   9 SER CA   1 1 
        2  2035 1 1   9 SER CB   C -18.341 -11.028  -6.695 1.00 . A A .   9 SER CB   1 1 
        2  2036 1 1   9 SER H    H -17.319  -9.096  -8.488 1.00 . A A .   9 SER H    1 1 
        2  2037 1 1   9 SER HA   H -19.703  -9.374  -6.763 1.00 . A A .   9 SER HA   1 1 
        2  2038 1 1   9 SER HB2  H -18.559 -11.314  -5.677 1.00 . A A .   9 SER HB2  1 1 
        2  2039 1 1   9 SER HB3  H -18.962 -11.602  -7.369 1.00 . A A .   9 SER HB3  1 1 
        2  2040 1 1   9 SER HG   H -16.865 -11.457  -7.920 1.00 . A A .   9 SER HG   1 1 
        2  2041 1 1   9 SER N    N -18.268  -9.118  -8.241 1.00 . A A .   9 SER N    1 1 
        2  2042 1 1   9 SER O    O -17.276  -7.691  -6.122 1.00 . A A .   9 SER O    1 1 
        2  2043 1 1   9 SER OG   O -16.977 -11.322  -6.969 1.00 . A A .   9 SER OG   1 1 
        2  2044 1 1  10 HIS C    C -16.010  -9.056  -3.086 1.00 . A A .  10 HIS C    1 1 
        2  2045 1 1  10 HIS CA   C -17.367  -8.432  -3.442 1.00 . A A .  10 HIS CA   1 1 
        2  2046 1 1  10 HIS CB   C -18.289  -8.443  -2.217 1.00 . A A .  10 HIS CB   1 1 
        2  2047 1 1  10 HIS CD2  C -20.853  -8.464  -2.618 1.00 . A A .  10 HIS CD2  1 1 
        2  2048 1 1  10 HIS CE1  C -21.148  -6.320  -2.916 1.00 . A A .  10 HIS CE1  1 1 
        2  2049 1 1  10 HIS CG   C -19.644  -7.866  -2.492 1.00 . A A .  10 HIS CG   1 1 
        2  2050 1 1  10 HIS H    H -18.511  -9.960  -4.373 1.00 . A A .  10 HIS H    1 1 
        2  2051 1 1  10 HIS HA   H -17.207  -7.407  -3.748 1.00 . A A .  10 HIS HA   1 1 
        2  2052 1 1  10 HIS HB2  H -18.422  -9.461  -1.880 1.00 . A A .  10 HIS HB2  1 1 
        2  2053 1 1  10 HIS HB3  H -17.835  -7.864  -1.425 1.00 . A A .  10 HIS HB3  1 1 
        2  2054 1 1  10 HIS HD1  H -19.187  -5.814  -2.660 1.00 . A A .  10 HIS HD1  1 1 
        2  2055 1 1  10 HIS HD2  H -21.058  -9.522  -2.529 1.00 . A A .  10 HIS HD2  1 1 
        2  2056 1 1  10 HIS HE1  H -21.613  -5.363  -3.104 1.00 . A A .  10 HIS HE1  1 1 
        2  2057 1 1  10 HIS HE2  H -22.740  -7.594  -2.883 1.00 . A A .  10 HIS HE2  1 1 
        2  2058 1 1  10 HIS N    N -18.002  -9.140  -4.558 1.00 . A A .  10 HIS N    1 1 
        2  2059 1 1  10 HIS ND1  N -19.868  -6.521  -2.686 1.00 . A A .  10 HIS ND1  1 1 
        2  2060 1 1  10 HIS NE2  N -21.767  -7.478  -2.882 1.00 . A A .  10 HIS NE2  1 1 
        2  2061 1 1  10 HIS O    O -15.916 -10.253  -2.801 1.00 . A A .  10 HIS O    1 1 
        2  2062 1 1  11 MET C    C -13.413  -8.660  -1.232 1.00 . A A .  11 MET C    1 1 
        2  2063 1 1  11 MET CA   C -13.616  -8.697  -2.756 1.00 . A A .  11 MET CA   1 1 
        2  2064 1 1  11 MET CB   C -12.563  -7.835  -3.459 1.00 . A A .  11 MET CB   1 1 
        2  2065 1 1  11 MET CE   C -12.248  -9.568  -7.254 1.00 . A A .  11 MET CE   1 1 
        2  2066 1 1  11 MET CG   C -12.561  -8.001  -4.973 1.00 . A A .  11 MET CG   1 1 
        2  2067 1 1  11 MET H    H -15.090  -7.309  -3.394 1.00 . A A .  11 MET H    1 1 
        2  2068 1 1  11 MET HA   H -13.513  -9.721  -3.093 1.00 . A A .  11 MET HA   1 1 
        2  2069 1 1  11 MET HB2  H -12.751  -6.795  -3.231 1.00 . A A .  11 MET HB2  1 1 
        2  2070 1 1  11 MET HB3  H -11.584  -8.105  -3.089 1.00 . A A .  11 MET HB3  1 1 
        2  2071 1 1  11 MET HE1  H -13.238  -9.257  -7.553 1.00 . A A .  11 MET HE1  1 1 
        2  2072 1 1  11 MET HE2  H -12.023 -10.529  -7.691 1.00 . A A .  11 MET HE2  1 1 
        2  2073 1 1  11 MET HE3  H -11.523  -8.841  -7.593 1.00 . A A .  11 MET HE3  1 1 
        2  2074 1 1  11 MET HG2  H -13.538  -7.740  -5.357 1.00 . A A .  11 MET HG2  1 1 
        2  2075 1 1  11 MET HG3  H -11.820  -7.338  -5.396 1.00 . A A .  11 MET HG3  1 1 
        2  2076 1 1  11 MET N    N -14.961  -8.241  -3.117 1.00 . A A .  11 MET N    1 1 
        2  2077 1 1  11 MET O    O -13.377  -7.592  -0.622 1.00 . A A .  11 MET O    1 1 
        2  2078 1 1  11 MET SD   S -12.175  -9.692  -5.468 1.00 . A A .  11 MET SD   1 1 
        2  2079 1 1  12 THR C    C -11.717  -9.921   1.335 1.00 . A A .  12 THR C    1 1 
        2  2080 1 1  12 THR CA   C -13.171  -9.977   0.832 1.00 . A A .  12 THR CA   1 1 
        2  2081 1 1  12 THR CB   C -13.807 -11.308   1.298 1.00 . A A .  12 THR CB   1 1 
        2  2082 1 1  12 THR CG2  C -15.318 -11.308   1.069 1.00 . A A .  12 THR CG2  1 1 
        2  2083 1 1  12 THR H    H -13.264 -10.654  -1.180 1.00 . A A .  12 THR H    1 1 
        2  2084 1 1  12 THR HA   H -13.722  -9.165   1.285 1.00 . A A .  12 THR HA   1 1 
        2  2085 1 1  12 THR HB   H -13.617 -11.434   2.355 1.00 . A A .  12 THR HB   1 1 
        2  2086 1 1  12 THR HG1  H -12.792 -13.003   1.208 1.00 . A A .  12 THR HG1  1 1 
        2  2087 1 1  12 THR HG21 H -15.736 -12.239   1.423 1.00 . A A .  12 THR HG21 1 1 
        2  2088 1 1  12 THR HG22 H -15.522 -11.200   0.014 1.00 . A A .  12 THR HG22 1 1 
        2  2089 1 1  12 THR HG23 H -15.766 -10.486   1.610 1.00 . A A .  12 THR HG23 1 1 
        2  2090 1 1  12 THR N    N -13.279  -9.841  -0.630 1.00 . A A .  12 THR N    1 1 
        2  2091 1 1  12 THR O    O -11.451 -10.186   2.509 1.00 . A A .  12 THR O    1 1 
        2  2092 1 1  12 THR OG1  O -13.216 -12.405   0.583 1.00 . A A .  12 THR OG1  1 1 
        2  2093 1 1  13 GLY C    C  -9.037  -8.326   1.763 1.00 . A A .  13 GLY C    1 1 
        2  2094 1 1  13 GLY CA   C  -9.371  -9.493   0.833 1.00 . A A .  13 GLY CA   1 1 
        2  2095 1 1  13 GLY H    H -11.051  -9.323  -0.454 1.00 . A A .  13 GLY H    1 1 
        2  2096 1 1  13 GLY HA2  H  -9.100 -10.415   1.325 1.00 . A A .  13 GLY HA2  1 1 
        2  2097 1 1  13 GLY HA3  H  -8.783  -9.398  -0.067 1.00 . A A .  13 GLY HA3  1 1 
        2  2098 1 1  13 GLY N    N -10.784  -9.555   0.457 1.00 . A A .  13 GLY N    1 1 
        2  2099 1 1  13 GLY O    O  -8.672  -7.247   1.304 1.00 . A A .  13 GLY O    1 1 
        2  2100 1 1  14 ASN C    C  -7.371  -7.150   4.105 1.00 . A A .  14 ASN C    1 1 
        2  2101 1 1  14 ASN CA   C  -8.870  -7.499   4.068 1.00 . A A .  14 ASN CA   1 1 
        2  2102 1 1  14 ASN CB   C  -9.339  -7.945   5.461 1.00 . A A .  14 ASN CB   1 1 
        2  2103 1 1  14 ASN CG   C -10.773  -8.441   5.456 1.00 . A A .  14 ASN CG   1 1 
        2  2104 1 1  14 ASN H    H  -9.445  -9.429   3.378 1.00 . A A .  14 ASN H    1 1 
        2  2105 1 1  14 ASN HA   H  -9.422  -6.614   3.782 1.00 . A A .  14 ASN HA   1 1 
        2  2106 1 1  14 ASN HB2  H  -8.702  -8.745   5.810 1.00 . A A .  14 ASN HB2  1 1 
        2  2107 1 1  14 ASN HB3  H  -9.266  -7.112   6.147 1.00 . A A .  14 ASN HB3  1 1 
        2  2108 1 1  14 ASN HD21 H -10.159 -10.302   5.189 1.00 . A A .  14 ASN HD21 1 1 
        2  2109 1 1  14 ASN HD22 H -11.865 -10.081   5.285 1.00 . A A .  14 ASN HD22 1 1 
        2  2110 1 1  14 ASN N    N  -9.155  -8.546   3.073 1.00 . A A .  14 ASN N    1 1 
        2  2111 1 1  14 ASN ND2  N -10.949  -9.738   5.293 1.00 . A A .  14 ASN ND2  1 1 
        2  2112 1 1  14 ASN O    O  -6.626  -7.641   4.956 1.00 . A A .  14 ASN O    1 1 
        2  2113 1 1  14 ASN OD1  O -11.716  -7.674   5.603 1.00 . A A .  14 ASN OD1  1 1 
        2  2114 1 1  15 VAL C    C  -5.242  -4.569   3.712 1.00 . A A .  15 VAL C    1 1 
        2  2115 1 1  15 VAL CA   C  -5.520  -5.938   3.062 1.00 . A A .  15 VAL CA   1 1 
        2  2116 1 1  15 VAL CB   C  -5.062  -5.904   1.581 1.00 . A A .  15 VAL CB   1 1 
        2  2117 1 1  15 VAL CG1  C  -3.563  -5.632   1.484 1.00 . A A .  15 VAL CG1  1 1 
        2  2118 1 1  15 VAL CG2  C  -5.424  -7.209   0.868 1.00 . A A .  15 VAL CG2  1 1 
        2  2119 1 1  15 VAL H    H  -7.571  -5.956   2.515 1.00 . A A .  15 VAL H    1 1 
        2  2120 1 1  15 VAL HA   H  -4.934  -6.690   3.575 1.00 . A A .  15 VAL HA   1 1 
        2  2121 1 1  15 VAL HB   H  -5.581  -5.095   1.083 1.00 . A A .  15 VAL HB   1 1 
        2  2122 1 1  15 VAL HG11 H  -3.021  -6.412   2.000 1.00 . A A .  15 VAL HG11 1 1 
        2  2123 1 1  15 VAL HG12 H  -3.339  -4.678   1.941 1.00 . A A .  15 VAL HG12 1 1 
        2  2124 1 1  15 VAL HG13 H  -3.264  -5.614   0.446 1.00 . A A .  15 VAL HG13 1 1 
        2  2125 1 1  15 VAL HG21 H  -4.951  -8.040   1.371 1.00 . A A .  15 VAL HG21 1 1 
        2  2126 1 1  15 VAL HG22 H  -5.084  -7.169  -0.157 1.00 . A A .  15 VAL HG22 1 1 
        2  2127 1 1  15 VAL HG23 H  -6.497  -7.343   0.881 1.00 . A A .  15 VAL HG23 1 1 
        2  2128 1 1  15 VAL N    N  -6.932  -6.316   3.167 1.00 . A A .  15 VAL N    1 1 
        2  2129 1 1  15 VAL O    O  -5.658  -3.528   3.203 1.00 . A A .  15 VAL O    1 1 
        2  2130 1 1  16 CYS C    C  -2.627  -3.102   5.375 1.00 . A A .  16 CYS C    1 1 
        2  2131 1 1  16 CYS CA   C  -4.135  -3.343   5.534 1.00 . A A .  16 CYS CA   1 1 
        2  2132 1 1  16 CYS CB   C  -4.498  -3.407   7.024 1.00 . A A .  16 CYS CB   1 1 
        2  2133 1 1  16 CYS H    H  -4.282  -5.446   5.231 1.00 . A A .  16 CYS H    1 1 
        2  2134 1 1  16 CYS HA   H  -4.666  -2.518   5.077 1.00 . A A .  16 CYS HA   1 1 
        2  2135 1 1  16 CYS HB2  H  -5.564  -3.560   7.121 1.00 . A A .  16 CYS HB2  1 1 
        2  2136 1 1  16 CYS HB3  H  -3.980  -4.239   7.481 1.00 . A A .  16 CYS HB3  1 1 
        2  2137 1 1  16 CYS HG   H  -4.912  -1.820   8.982 1.00 . A A .  16 CYS HG   1 1 
        2  2138 1 1  16 CYS N    N  -4.539  -4.582   4.846 1.00 . A A .  16 CYS N    1 1 
        2  2139 1 1  16 CYS O    O  -1.910  -3.951   4.856 1.00 . A A .  16 CYS O    1 1 
        2  2140 1 1  16 CYS SG   S  -4.074  -1.912   7.957 1.00 . A A .  16 CYS SG   1 1 
        2  2141 1 1  17 ILE C    C   0.115  -2.104   6.876 1.00 . A A .  17 ILE C    1 1 
        2  2142 1 1  17 ILE CA   C  -0.715  -1.606   5.681 1.00 . A A .  17 ILE CA   1 1 
        2  2143 1 1  17 ILE CB   C  -0.519  -0.074   5.542 1.00 . A A .  17 ILE CB   1 1 
        2  2144 1 1  17 ILE CD1  C  -1.228   1.965   4.165 1.00 . A A .  17 ILE CD1  1 1 
        2  2145 1 1  17 ILE CG1  C  -1.327   0.463   4.349 1.00 . A A .  17 ILE CG1  1 1 
        2  2146 1 1  17 ILE CG2  C   0.966   0.274   5.389 1.00 . A A .  17 ILE CG2  1 1 
        2  2147 1 1  17 ILE H    H  -2.742  -1.318   6.269 1.00 . A A .  17 ILE H    1 1 
        2  2148 1 1  17 ILE HA   H  -0.345  -2.077   4.778 1.00 . A A .  17 ILE HA   1 1 
        2  2149 1 1  17 ILE HB   H  -0.878   0.395   6.448 1.00 . A A .  17 ILE HB   1 1 
        2  2150 1 1  17 ILE HD11 H  -0.192   2.244   4.034 1.00 . A A .  17 ILE HD11 1 1 
        2  2151 1 1  17 ILE HD12 H  -1.626   2.460   5.037 1.00 . A A .  17 ILE HD12 1 1 
        2  2152 1 1  17 ILE HD13 H  -1.793   2.259   3.293 1.00 . A A .  17 ILE HD13 1 1 
        2  2153 1 1  17 ILE HG12 H  -0.974  -0.002   3.440 1.00 . A A .  17 ILE HG12 1 1 
        2  2154 1 1  17 ILE HG13 H  -2.371   0.217   4.490 1.00 . A A .  17 ILE HG13 1 1 
        2  2155 1 1  17 ILE HG21 H   1.510  -0.066   6.259 1.00 . A A .  17 ILE HG21 1 1 
        2  2156 1 1  17 ILE HG22 H   1.079   1.345   5.293 1.00 . A A .  17 ILE HG22 1 1 
        2  2157 1 1  17 ILE HG23 H   1.361  -0.209   4.507 1.00 . A A .  17 ILE HG23 1 1 
        2  2158 1 1  17 ILE N    N  -2.140  -1.949   5.825 1.00 . A A .  17 ILE N    1 1 
        2  2159 1 1  17 ILE O    O  -0.128  -1.702   8.014 1.00 . A A .  17 ILE O    1 1 
        2  2160 1 1  18 GLU C    C   3.022  -2.342   8.038 1.00 . A A .  18 GLU C    1 1 
        2  2161 1 1  18 GLU CA   C   2.003  -3.435   7.682 1.00 . A A .  18 GLU CA   1 1 
        2  2162 1 1  18 GLU CB   C   2.747  -4.722   7.274 1.00 . A A .  18 GLU CB   1 1 
        2  2163 1 1  18 GLU CD   C   4.468  -6.493   7.967 1.00 . A A .  18 GLU CD   1 1 
        2  2164 1 1  18 GLU CG   C   3.665  -5.263   8.377 1.00 . A A .  18 GLU CG   1 1 
        2  2165 1 1  18 GLU H    H   1.226  -3.297   5.703 1.00 . A A .  18 GLU H    1 1 
        2  2166 1 1  18 GLU HA   H   1.400  -3.644   8.557 1.00 . A A .  18 GLU HA   1 1 
        2  2167 1 1  18 GLU HB2  H   2.020  -5.485   7.028 1.00 . A A .  18 GLU HB2  1 1 
        2  2168 1 1  18 GLU HB3  H   3.350  -4.519   6.399 1.00 . A A .  18 GLU HB3  1 1 
        2  2169 1 1  18 GLU HG2  H   4.358  -4.483   8.661 1.00 . A A .  18 GLU HG2  1 1 
        2  2170 1 1  18 GLU HG3  H   3.056  -5.520   9.233 1.00 . A A .  18 GLU HG3  1 1 
        2  2171 1 1  18 GLU N    N   1.099  -2.971   6.620 1.00 . A A .  18 GLU N    1 1 
        2  2172 1 1  18 GLU O    O   3.219  -2.020   9.210 1.00 . A A .  18 GLU O    1 1 
        2  2173 1 1  18 GLU OE1  O   3.980  -7.628   8.168 1.00 . A A .  18 GLU OE1  1 1 
        2  2174 1 1  18 GLU OE2  O   5.601  -6.327   7.461 1.00 . A A .  18 GLU OE2  1 1 
        2  2175 1 1  19 GLU C    C   4.861   0.178   6.018 1.00 . A A .  19 GLU C    1 1 
        2  2176 1 1  19 GLU CA   C   4.687  -0.744   7.237 1.00 . A A .  19 GLU CA   1 1 
        2  2177 1 1  19 GLU CB   C   6.028  -1.416   7.560 1.00 . A A .  19 GLU CB   1 1 
        2  2178 1 1  19 GLU CD   C   6.657   0.001   9.558 1.00 . A A .  19 GLU CD   1 1 
        2  2179 1 1  19 GLU CG   C   7.056  -0.469   8.167 1.00 . A A .  19 GLU CG   1 1 
        2  2180 1 1  19 GLU H    H   3.418  -2.019   6.099 1.00 . A A .  19 GLU H    1 1 
        2  2181 1 1  19 GLU HA   H   4.386  -0.143   8.084 1.00 . A A .  19 GLU HA   1 1 
        2  2182 1 1  19 GLU HB2  H   5.855  -2.225   8.258 1.00 . A A .  19 GLU HB2  1 1 
        2  2183 1 1  19 GLU HB3  H   6.442  -1.826   6.649 1.00 . A A .  19 GLU HB3  1 1 
        2  2184 1 1  19 GLU HG2  H   8.007  -0.981   8.231 1.00 . A A .  19 GLU HG2  1 1 
        2  2185 1 1  19 GLU HG3  H   7.156   0.393   7.524 1.00 . A A .  19 GLU HG3  1 1 
        2  2186 1 1  19 GLU N    N   3.654  -1.761   7.017 1.00 . A A .  19 GLU N    1 1 
        2  2187 1 1  19 GLU O    O   4.589  -0.215   4.882 1.00 . A A .  19 GLU O    1 1 
        2  2188 1 1  19 GLU OE1  O   5.893   0.985   9.666 1.00 . A A .  19 GLU OE1  1 1 
        2  2189 1 1  19 GLU OE2  O   7.093  -0.627  10.547 1.00 . A A .  19 GLU OE2  1 1 
        2  2190 1 1  20 ILE C    C   7.116   2.755   5.243 1.00 . A A .  20 ILE C    1 1 
        2  2191 1 1  20 ILE CA   C   5.632   2.353   5.185 1.00 . A A .  20 ILE CA   1 1 
        2  2192 1 1  20 ILE CB   C   4.749   3.628   5.264 1.00 . A A .  20 ILE CB   1 1 
        2  2193 1 1  20 ILE CD1  C   2.334   4.441   5.518 1.00 . A A .  20 ILE CD1  1 1 
        2  2194 1 1  20 ILE CG1  C   3.262   3.252   5.359 1.00 . A A .  20 ILE CG1  1 1 
        2  2195 1 1  20 ILE CG2  C   4.998   4.522   4.050 1.00 . A A .  20 ILE CG2  1 1 
        2  2196 1 1  20 ILE H    H   5.474   1.679   7.194 1.00 . A A .  20 ILE H    1 1 
        2  2197 1 1  20 ILE HA   H   5.440   1.862   4.239 1.00 . A A .  20 ILE HA   1 1 
        2  2198 1 1  20 ILE HB   H   5.032   4.181   6.151 1.00 . A A .  20 ILE HB   1 1 
        2  2199 1 1  20 ILE HD11 H   1.313   4.095   5.599 1.00 . A A .  20 ILE HD11 1 1 
        2  2200 1 1  20 ILE HD12 H   2.424   5.090   4.658 1.00 . A A .  20 ILE HD12 1 1 
        2  2201 1 1  20 ILE HD13 H   2.599   4.990   6.410 1.00 . A A .  20 ILE HD13 1 1 
        2  2202 1 1  20 ILE HG12 H   2.971   2.724   4.462 1.00 . A A .  20 ILE HG12 1 1 
        2  2203 1 1  20 ILE HG13 H   3.115   2.603   6.212 1.00 . A A .  20 ILE HG13 1 1 
        2  2204 1 1  20 ILE HG21 H   4.756   3.982   3.146 1.00 . A A .  20 ILE HG21 1 1 
        2  2205 1 1  20 ILE HG22 H   6.038   4.816   4.023 1.00 . A A .  20 ILE HG22 1 1 
        2  2206 1 1  20 ILE HG23 H   4.377   5.406   4.117 1.00 . A A .  20 ILE HG23 1 1 
        2  2207 1 1  20 ILE N    N   5.321   1.405   6.263 1.00 . A A .  20 ILE N    1 1 
        2  2208 1 1  20 ILE O    O   7.604   3.200   6.283 1.00 . A A .  20 ILE O    1 1 
        2  2209 1 1  21 ASP C    C   9.628   4.327   4.230 1.00 . A A .  21 ASP C    1 1 
        2  2210 1 1  21 ASP CA   C   9.268   2.836   4.078 1.00 . A A .  21 ASP CA   1 1 
        2  2211 1 1  21 ASP CB   C   9.824   2.278   2.766 1.00 . A A .  21 ASP CB   1 1 
        2  2212 1 1  21 ASP CG   C  11.283   2.610   2.543 1.00 . A A .  21 ASP CG   1 1 
        2  2213 1 1  21 ASP H    H   7.364   2.312   3.308 1.00 . A A .  21 ASP H    1 1 
        2  2214 1 1  21 ASP HA   H   9.716   2.292   4.899 1.00 . A A .  21 ASP HA   1 1 
        2  2215 1 1  21 ASP HB2  H   9.719   1.203   2.769 1.00 . A A .  21 ASP HB2  1 1 
        2  2216 1 1  21 ASP HB3  H   9.250   2.683   1.944 1.00 . A A .  21 ASP HB3  1 1 
        2  2217 1 1  21 ASP N    N   7.823   2.594   4.128 1.00 . A A .  21 ASP N    1 1 
        2  2218 1 1  21 ASP O    O   8.925   5.211   3.735 1.00 . A A .  21 ASP O    1 1 
        2  2219 1 1  21 ASP OD1  O  12.086   2.460   3.487 1.00 . A A .  21 ASP OD1  1 1 
        2  2220 1 1  21 ASP OD2  O  11.633   3.011   1.415 1.00 . A A .  21 ASP OD2  1 1 
        2  2221 1 1  22 VAL C    C  12.315   6.344   4.121 1.00 . A A .  22 VAL C    1 1 
        2  2222 1 1  22 VAL CA   C  11.229   5.955   5.143 1.00 . A A .  22 VAL CA   1 1 
        2  2223 1 1  22 VAL CB   C  11.786   6.113   6.584 1.00 . A A .  22 VAL CB   1 1 
        2  2224 1 1  22 VAL CG1  C  13.015   5.228   6.800 1.00 . A A .  22 VAL CG1  1 1 
        2  2225 1 1  22 VAL CG2  C  12.101   7.577   6.897 1.00 . A A .  22 VAL CG2  1 1 
        2  2226 1 1  22 VAL H    H  11.263   3.834   5.270 1.00 . A A .  22 VAL H    1 1 
        2  2227 1 1  22 VAL HA   H  10.389   6.628   5.030 1.00 . A A .  22 VAL HA   1 1 
        2  2228 1 1  22 VAL HB   H  11.018   5.783   7.274 1.00 . A A .  22 VAL HB   1 1 
        2  2229 1 1  22 VAL HG11 H  13.801   5.530   6.124 1.00 . A A .  22 VAL HG11 1 1 
        2  2230 1 1  22 VAL HG12 H  12.756   4.197   6.609 1.00 . A A .  22 VAL HG12 1 1 
        2  2231 1 1  22 VAL HG13 H  13.359   5.328   7.819 1.00 . A A .  22 VAL HG13 1 1 
        2  2232 1 1  22 VAL HG21 H  12.431   7.665   7.924 1.00 . A A .  22 VAL HG21 1 1 
        2  2233 1 1  22 VAL HG22 H  11.214   8.177   6.753 1.00 . A A .  22 VAL HG22 1 1 
        2  2234 1 1  22 VAL HG23 H  12.884   7.929   6.238 1.00 . A A .  22 VAL HG23 1 1 
        2  2235 1 1  22 VAL N    N  10.745   4.588   4.914 1.00 . A A .  22 VAL N    1 1 
        2  2236 1 1  22 VAL O    O  12.594   7.527   3.915 1.00 . A A .  22 VAL O    1 1 
        2  2237 1 1  23 ASP C    C  13.341   6.287   1.246 1.00 . A A .  23 ASP C    1 1 
        2  2238 1 1  23 ASP CA   C  13.948   5.570   2.463 1.00 . A A .  23 ASP CA   1 1 
        2  2239 1 1  23 ASP CB   C  14.560   4.228   2.042 1.00 . A A .  23 ASP CB   1 1 
        2  2240 1 1  23 ASP CG   C  15.757   4.372   1.118 1.00 . A A .  23 ASP CG   1 1 
        2  2241 1 1  23 ASP H    H  12.668   4.416   3.702 1.00 . A A .  23 ASP H    1 1 
        2  2242 1 1  23 ASP HA   H  14.718   6.195   2.892 1.00 . A A .  23 ASP HA   1 1 
        2  2243 1 1  23 ASP HB2  H  14.877   3.694   2.928 1.00 . A A .  23 ASP HB2  1 1 
        2  2244 1 1  23 ASP HB3  H  13.806   3.643   1.535 1.00 . A A .  23 ASP HB3  1 1 
        2  2245 1 1  23 ASP N    N  12.922   5.341   3.486 1.00 . A A .  23 ASP N    1 1 
        2  2246 1 1  23 ASP O    O  13.966   7.170   0.648 1.00 . A A .  23 ASP O    1 1 
        2  2247 1 1  23 ASP OD1  O  15.564   4.668  -0.078 1.00 . A A .  23 ASP OD1  1 1 
        2  2248 1 1  23 ASP OD2  O  16.902   4.176   1.584 1.00 . A A .  23 ASP OD2  1 1 
        2  2249 1 1  24 GLY C    C  11.083   5.582  -1.358 1.00 . A A .  24 GLY C    1 1 
        2  2250 1 1  24 GLY CA   C  11.401   6.535  -0.210 1.00 . A A .  24 GLY CA   1 1 
        2  2251 1 1  24 GLY H    H  11.695   5.161   1.382 1.00 . A A .  24 GLY H    1 1 
        2  2252 1 1  24 GLY HA2  H  10.472   6.935   0.171 1.00 . A A .  24 GLY HA2  1 1 
        2  2253 1 1  24 GLY HA3  H  11.997   7.353  -0.593 1.00 . A A .  24 GLY HA3  1 1 
        2  2254 1 1  24 GLY N    N  12.116   5.897   0.891 1.00 . A A .  24 GLY N    1 1 
        2  2255 1 1  24 GLY O    O  10.880   6.015  -2.495 1.00 . A A .  24 GLY O    1 1 
        2  2256 1 1  25 LYS C    C   9.452   2.553  -1.996 1.00 . A A .  25 LYS C    1 1 
        2  2257 1 1  25 LYS CA   C  10.813   3.267  -2.103 1.00 . A A .  25 LYS CA   1 1 
        2  2258 1 1  25 LYS CB   C  11.944   2.228  -2.067 1.00 . A A .  25 LYS CB   1 1 
        2  2259 1 1  25 LYS CD   C  14.369   1.690  -2.531 1.00 . A A .  25 LYS CD   1 1 
        2  2260 1 1  25 LYS CE   C  15.707   2.223  -3.027 1.00 . A A .  25 LYS CE   1 1 
        2  2261 1 1  25 LYS CG   C  13.314   2.791  -2.436 1.00 . A A .  25 LYS CG   1 1 
        2  2262 1 1  25 LYS H    H  11.128   4.000  -0.134 1.00 . A A .  25 LYS H    1 1 
        2  2263 1 1  25 LYS HA   H  10.850   3.771  -3.061 1.00 . A A .  25 LYS HA   1 1 
        2  2264 1 1  25 LYS HB2  H  12.006   1.816  -1.069 1.00 . A A .  25 LYS HB2  1 1 
        2  2265 1 1  25 LYS HB3  H  11.708   1.431  -2.761 1.00 . A A .  25 LYS HB3  1 1 
        2  2266 1 1  25 LYS HD2  H  14.508   1.255  -1.552 1.00 . A A .  25 LYS HD2  1 1 
        2  2267 1 1  25 LYS HD3  H  14.020   0.928  -3.215 1.00 . A A .  25 LYS HD3  1 1 
        2  2268 1 1  25 LYS HE2  H  16.391   1.393  -3.139 1.00 . A A .  25 LYS HE2  1 1 
        2  2269 1 1  25 LYS HE3  H  15.559   2.694  -3.989 1.00 . A A .  25 LYS HE3  1 1 
        2  2270 1 1  25 LYS HG2  H  13.243   3.293  -3.392 1.00 . A A .  25 LYS HG2  1 1 
        2  2271 1 1  25 LYS HG3  H  13.614   3.503  -1.678 1.00 . A A .  25 LYS HG3  1 1 
        2  2272 1 1  25 LYS HZ1  H  15.604   3.937  -1.830 1.00 . A A .  25 LYS HZ1  1 1 
        2  2273 1 1  25 LYS HZ2  H  17.121   3.675  -2.534 1.00 . A A .  25 LYS HZ2  1 1 
        2  2274 1 1  25 LYS HZ3  H  16.621   2.735  -1.225 1.00 . A A .  25 LYS HZ3  1 1 
        2  2275 1 1  25 LYS N    N  11.021   4.283  -1.065 1.00 . A A .  25 LYS N    1 1 
        2  2276 1 1  25 LYS NZ   N  16.302   3.211  -2.091 1.00 . A A .  25 LYS NZ   1 1 
        2  2277 1 1  25 LYS O    O   8.629   2.653  -2.903 1.00 . A A .  25 LYS O    1 1 
        2  2278 1 1  26 PHE C    C   7.043   1.175   0.260 1.00 . A A .  26 PHE C    1 1 
        2  2279 1 1  26 PHE CA   C   8.064   0.897  -0.860 1.00 . A A .  26 PHE CA   1 1 
        2  2280 1 1  26 PHE CB   C   8.578  -0.546  -0.745 1.00 . A A .  26 PHE CB   1 1 
        2  2281 1 1  26 PHE CD1  C   8.676  -1.286   1.663 1.00 . A A .  26 PHE CD1  1 1 
        2  2282 1 1  26 PHE CD2  C  10.719  -0.702   0.576 1.00 . A A .  26 PHE CD2  1 1 
        2  2283 1 1  26 PHE CE1  C   9.369  -1.573   2.822 1.00 . A A .  26 PHE CE1  1 1 
        2  2284 1 1  26 PHE CE2  C  11.418  -0.991   1.735 1.00 . A A .  26 PHE CE2  1 1 
        2  2285 1 1  26 PHE CG   C   9.340  -0.848   0.525 1.00 . A A .  26 PHE CG   1 1 
        2  2286 1 1  26 PHE CZ   C  10.742  -1.425   2.859 1.00 . A A .  26 PHE CZ   1 1 
        2  2287 1 1  26 PHE H    H   9.784   1.930  -0.112 1.00 . A A .  26 PHE H    1 1 
        2  2288 1 1  26 PHE HA   H   7.546   0.987  -1.804 1.00 . A A .  26 PHE HA   1 1 
        2  2289 1 1  26 PHE HB2  H   7.738  -1.224  -0.794 1.00 . A A .  26 PHE HB2  1 1 
        2  2290 1 1  26 PHE HB3  H   9.234  -0.747  -1.581 1.00 . A A .  26 PHE HB3  1 1 
        2  2291 1 1  26 PHE HD1  H   7.602  -1.401   1.638 1.00 . A A .  26 PHE HD1  1 1 
        2  2292 1 1  26 PHE HD2  H  11.250  -0.362  -0.302 1.00 . A A .  26 PHE HD2  1 1 
        2  2293 1 1  26 PHE HE1  H   8.838  -1.915   3.698 1.00 . A A .  26 PHE HE1  1 1 
        2  2294 1 1  26 PHE HE2  H  12.491  -0.871   1.763 1.00 . A A .  26 PHE HE2  1 1 
        2  2295 1 1  26 PHE HZ   H  11.287  -1.651   3.765 1.00 . A A .  26 PHE HZ   1 1 
        2  2296 1 1  26 PHE N    N   9.206   1.831  -0.900 1.00 . A A .  26 PHE N    1 1 
        2  2297 1 1  26 PHE O    O   7.359   1.751   1.300 1.00 . A A .  26 PHE O    1 1 
        2  2298 1 1  27 ILE C    C   4.178  -0.675   1.179 1.00 . A A .  27 ILE C    1 1 
        2  2299 1 1  27 ILE CA   C   4.740   0.750   1.026 1.00 . A A .  27 ILE CA   1 1 
        2  2300 1 1  27 ILE CB   C   3.589   1.714   0.636 1.00 . A A .  27 ILE CB   1 1 
        2  2301 1 1  27 ILE CD1  C   3.089   4.122  -0.087 1.00 . A A .  27 ILE CD1  1 1 
        2  2302 1 1  27 ILE CG1  C   4.133   3.137   0.404 1.00 . A A .  27 ILE CG1  1 1 
        2  2303 1 1  27 ILE CG2  C   2.502   1.720   1.713 1.00 . A A .  27 ILE CG2  1 1 
        2  2304 1 1  27 ILE H    H   5.589   0.429  -0.887 1.00 . A A .  27 ILE H    1 1 
        2  2305 1 1  27 ILE HA   H   5.163   1.072   1.971 1.00 . A A .  27 ILE HA   1 1 
        2  2306 1 1  27 ILE HB   H   3.146   1.354  -0.283 1.00 . A A .  27 ILE HB   1 1 
        2  2307 1 1  27 ILE HD11 H   3.547   5.087  -0.241 1.00 . A A .  27 ILE HD11 1 1 
        2  2308 1 1  27 ILE HD12 H   2.301   4.210   0.648 1.00 . A A .  27 ILE HD12 1 1 
        2  2309 1 1  27 ILE HD13 H   2.673   3.768  -1.018 1.00 . A A .  27 ILE HD13 1 1 
        2  2310 1 1  27 ILE HG12 H   4.530   3.519   1.333 1.00 . A A .  27 ILE HG12 1 1 
        2  2311 1 1  27 ILE HG13 H   4.925   3.100  -0.331 1.00 . A A .  27 ILE HG13 1 1 
        2  2312 1 1  27 ILE HG21 H   2.929   2.026   2.659 1.00 . A A .  27 ILE HG21 1 1 
        2  2313 1 1  27 ILE HG22 H   2.086   0.728   1.811 1.00 . A A .  27 ILE HG22 1 1 
        2  2314 1 1  27 ILE HG23 H   1.717   2.409   1.434 1.00 . A A .  27 ILE HG23 1 1 
        2  2315 1 1  27 ILE N    N   5.803   0.748   0.016 1.00 . A A .  27 ILE N    1 1 
        2  2316 1 1  27 ILE O    O   3.531  -1.193   0.271 1.00 . A A .  27 ILE O    1 1 
        2  2317 1 1  28 ARG C    C   2.703  -2.949   3.111 1.00 . A A .  28 ARG C    1 1 
        2  2318 1 1  28 ARG CA   C   4.097  -2.733   2.497 1.00 . A A .  28 ARG CA   1 1 
        2  2319 1 1  28 ARG CB   C   5.170  -3.422   3.355 1.00 . A A .  28 ARG CB   1 1 
        2  2320 1 1  28 ARG CD   C   6.048  -5.596   4.288 1.00 . A A .  28 ARG CD   1 1 
        2  2321 1 1  28 ARG CG   C   4.830  -4.862   3.742 1.00 . A A .  28 ARG CG   1 1 
        2  2322 1 1  28 ARG CZ   C   8.334  -5.900   3.462 1.00 . A A .  28 ARG CZ   1 1 
        2  2323 1 1  28 ARG H    H   4.848  -0.820   3.057 1.00 . A A .  28 ARG H    1 1 
        2  2324 1 1  28 ARG HA   H   4.106  -3.191   1.517 1.00 . A A .  28 ARG HA   1 1 
        2  2325 1 1  28 ARG HB2  H   6.100  -3.430   2.802 1.00 . A A .  28 ARG HB2  1 1 
        2  2326 1 1  28 ARG HB3  H   5.309  -2.849   4.262 1.00 . A A .  28 ARG HB3  1 1 
        2  2327 1 1  28 ARG HD2  H   6.488  -5.005   5.081 1.00 . A A .  28 ARG HD2  1 1 
        2  2328 1 1  28 ARG HD3  H   5.732  -6.550   4.686 1.00 . A A .  28 ARG HD3  1 1 
        2  2329 1 1  28 ARG HE   H   6.730  -5.951   2.334 1.00 . A A .  28 ARG HE   1 1 
        2  2330 1 1  28 ARG HG2  H   4.063  -4.847   4.502 1.00 . A A .  28 ARG HG2  1 1 
        2  2331 1 1  28 ARG HG3  H   4.464  -5.387   2.868 1.00 . A A .  28 ARG HG3  1 1 
        2  2332 1 1  28 ARG HH11 H   8.214  -5.493   5.409 1.00 . A A .  28 ARG HH11 1 1 
        2  2333 1 1  28 ARG HH12 H   9.805  -5.771   4.792 1.00 . A A .  28 ARG HH12 1 1 
        2  2334 1 1  28 ARG HH21 H   8.765  -6.308   1.564 1.00 . A A .  28 ARG HH21 1 1 
        2  2335 1 1  28 ARG HH22 H  10.117  -6.219   2.641 1.00 . A A .  28 ARG HH22 1 1 
        2  2336 1 1  28 ARG N    N   4.435  -1.313   2.317 1.00 . A A .  28 ARG N    1 1 
        2  2337 1 1  28 ARG NE   N   7.051  -5.825   3.247 1.00 . A A .  28 ARG NE   1 1 
        2  2338 1 1  28 ARG NH1  N   8.822  -5.704   4.645 1.00 . A A .  28 ARG NH1  1 1 
        2  2339 1 1  28 ARG NH2  N   9.133  -6.161   2.480 1.00 . A A .  28 ARG NH2  1 1 
        2  2340 1 1  28 ARG O    O   2.441  -2.558   4.253 1.00 . A A .  28 ARG O    1 1 
        2  2341 1 1  29 LEU C    C   0.481  -5.443   3.300 1.00 . A A .  29 LEU C    1 1 
        2  2342 1 1  29 LEU CA   C   0.491  -3.976   2.832 1.00 . A A .  29 LEU CA   1 1 
        2  2343 1 1  29 LEU CB   C  -0.579  -3.757   1.753 1.00 . A A .  29 LEU CB   1 1 
        2  2344 1 1  29 LEU CD1  C   0.186  -1.543   0.781 1.00 . A A .  29 LEU CD1  1 1 
        2  2345 1 1  29 LEU CD2  C  -2.235  -2.219   0.642 1.00 . A A .  29 LEU CD2  1 1 
        2  2346 1 1  29 LEU CG   C  -0.955  -2.291   1.471 1.00 . A A .  29 LEU CG   1 1 
        2  2347 1 1  29 LEU H    H   2.062  -3.801   1.418 1.00 . A A .  29 LEU H    1 1 
        2  2348 1 1  29 LEU HA   H   0.258  -3.348   3.681 1.00 . A A .  29 LEU HA   1 1 
        2  2349 1 1  29 LEU HB2  H  -0.229  -4.202   0.831 1.00 . A A .  29 LEU HB2  1 1 
        2  2350 1 1  29 LEU HB3  H  -1.476  -4.278   2.061 1.00 . A A .  29 LEU HB3  1 1 
        2  2351 1 1  29 LEU HD11 H   1.056  -1.542   1.421 1.00 . A A .  29 LEU HD11 1 1 
        2  2352 1 1  29 LEU HD12 H  -0.118  -0.523   0.588 1.00 . A A .  29 LEU HD12 1 1 
        2  2353 1 1  29 LEU HD13 H   0.426  -2.030  -0.153 1.00 . A A .  29 LEU HD13 1 1 
        2  2354 1 1  29 LEU HD21 H  -3.031  -2.728   1.166 1.00 . A A .  29 LEU HD21 1 1 
        2  2355 1 1  29 LEU HD22 H  -2.074  -2.696  -0.315 1.00 . A A .  29 LEU HD22 1 1 
        2  2356 1 1  29 LEU HD23 H  -2.510  -1.185   0.487 1.00 . A A .  29 LEU HD23 1 1 
        2  2357 1 1  29 LEU HG   H  -1.147  -1.795   2.412 1.00 . A A .  29 LEU HG   1 1 
        2  2358 1 1  29 LEU N    N   1.818  -3.585   2.343 1.00 . A A .  29 LEU N    1 1 
        2  2359 1 1  29 LEU O    O   1.495  -6.140   3.223 1.00 . A A .  29 LEU O    1 1 
        2  2360 1 1  30 LYS C    C  -2.231  -7.693   4.527 1.00 . A A .  30 LYS C    1 1 
        2  2361 1 1  30 LYS CA   C  -0.768  -7.227   4.411 1.00 . A A .  30 LYS CA   1 1 
        2  2362 1 1  30 LYS CB   C  -0.131  -7.129   5.805 1.00 . A A .  30 LYS CB   1 1 
        2  2363 1 1  30 LYS CD   C   0.815  -8.223   7.844 1.00 . A A .  30 LYS CD   1 1 
        2  2364 1 1  30 LYS CE   C   1.282  -9.513   8.502 1.00 . A A .  30 LYS CE   1 1 
        2  2365 1 1  30 LYS CG   C   0.099  -8.456   6.518 1.00 . A A .  30 LYS CG   1 1 
        2  2366 1 1  30 LYS H    H  -1.480  -5.361   3.688 1.00 . A A .  30 LYS H    1 1 
        2  2367 1 1  30 LYS HA   H  -0.213  -7.939   3.816 1.00 . A A .  30 LYS HA   1 1 
        2  2368 1 1  30 LYS HB2  H   0.826  -6.637   5.707 1.00 . A A .  30 LYS HB2  1 1 
        2  2369 1 1  30 LYS HB3  H  -0.767  -6.519   6.430 1.00 . A A .  30 LYS HB3  1 1 
        2  2370 1 1  30 LYS HD2  H   1.679  -7.599   7.666 1.00 . A A .  30 LYS HD2  1 1 
        2  2371 1 1  30 LYS HD3  H   0.141  -7.711   8.517 1.00 . A A .  30 LYS HD3  1 1 
        2  2372 1 1  30 LYS HE2  H   0.420 -10.072   8.837 1.00 . A A .  30 LYS HE2  1 1 
        2  2373 1 1  30 LYS HE3  H   1.835 -10.097   7.781 1.00 . A A .  30 LYS HE3  1 1 
        2  2374 1 1  30 LYS HG2  H  -0.854  -8.931   6.705 1.00 . A A .  30 LYS HG2  1 1 
        2  2375 1 1  30 LYS HG3  H   0.708  -9.094   5.892 1.00 . A A .  30 LYS HG3  1 1 
        2  2376 1 1  30 LYS HZ1  H   2.500 -10.117  10.091 1.00 . A A .  30 LYS HZ1  1 1 
        2  2377 1 1  30 LYS HZ2  H   1.633  -8.693  10.388 1.00 . A A .  30 LYS HZ2  1 1 
        2  2378 1 1  30 LYS HZ3  H   2.980  -8.665   9.367 1.00 . A A .  30 LYS HZ3  1 1 
        2  2379 1 1  30 LYS N    N  -0.674  -5.913   3.768 1.00 . A A .  30 LYS N    1 1 
        2  2380 1 1  30 LYS NZ   N   2.158  -9.230   9.668 1.00 . A A .  30 LYS NZ   1 1 
        2  2381 1 1  30 LYS O    O  -3.068  -6.998   5.108 1.00 . A A .  30 LYS O    1 1 
        2  2382 1 1  31 ASN C    C  -4.190  -9.973   5.460 1.00 . A A .  31 ASN C    1 1 
        2  2383 1 1  31 ASN CA   C  -3.894  -9.427   4.053 1.00 . A A .  31 ASN CA   1 1 
        2  2384 1 1  31 ASN CB   C  -4.079 -10.530   2.999 1.00 . A A .  31 ASN CB   1 1 
        2  2385 1 1  31 ASN CG   C  -5.433 -11.223   3.077 1.00 . A A .  31 ASN CG   1 1 
        2  2386 1 1  31 ASN H    H  -1.840  -9.359   3.490 1.00 . A A .  31 ASN H    1 1 
        2  2387 1 1  31 ASN HA   H  -4.593  -8.628   3.843 1.00 . A A .  31 ASN HA   1 1 
        2  2388 1 1  31 ASN HB2  H  -3.983 -10.095   2.017 1.00 . A A .  31 ASN HB2  1 1 
        2  2389 1 1  31 ASN HB3  H  -3.305 -11.274   3.131 1.00 . A A .  31 ASN HB3  1 1 
        2  2390 1 1  31 ASN HD21 H  -4.672 -12.863   2.275 1.00 . A A .  31 ASN HD21 1 1 
        2  2391 1 1  31 ASN HD22 H  -6.351 -12.926   2.666 1.00 . A A .  31 ASN HD22 1 1 
        2  2392 1 1  31 ASN N    N  -2.537  -8.864   3.970 1.00 . A A .  31 ASN N    1 1 
        2  2393 1 1  31 ASN ND2  N  -5.492 -12.461   2.629 1.00 . A A .  31 ASN ND2  1 1 
        2  2394 1 1  31 ASN O    O  -3.840 -11.108   5.787 1.00 . A A .  31 ASN O    1 1 
        2  2395 1 1  31 ASN OD1  O  -6.421 -10.654   3.530 1.00 . A A .  31 ASN OD1  1 1 
        2  2396 1 1  32 THR C    C  -6.467 -10.378   7.687 1.00 . A A .  32 THR C    1 1 
        2  2397 1 1  32 THR CA   C  -5.171  -9.557   7.658 1.00 . A A .  32 THR CA   1 1 
        2  2398 1 1  32 THR CB   C  -5.319  -8.329   8.593 1.00 . A A .  32 THR CB   1 1 
        2  2399 1 1  32 THR CG2  C  -3.996  -7.575   8.721 1.00 . A A .  32 THR CG2  1 1 
        2  2400 1 1  32 THR H    H  -5.075  -8.258   5.980 1.00 . A A .  32 THR H    1 1 
        2  2401 1 1  32 THR HA   H  -4.365 -10.172   8.036 1.00 . A A .  32 THR HA   1 1 
        2  2402 1 1  32 THR HB   H  -5.611  -8.677   9.575 1.00 . A A .  32 THR HB   1 1 
        2  2403 1 1  32 THR HG1  H  -7.117  -7.939   7.856 1.00 . A A .  32 THR HG1  1 1 
        2  2404 1 1  32 THR HG21 H  -3.686  -7.220   7.748 1.00 . A A .  32 THR HG21 1 1 
        2  2405 1 1  32 THR HG22 H  -3.240  -8.236   9.121 1.00 . A A .  32 THR HG22 1 1 
        2  2406 1 1  32 THR HG23 H  -4.123  -6.733   9.387 1.00 . A A .  32 THR HG23 1 1 
        2  2407 1 1  32 THR N    N  -4.825  -9.156   6.292 1.00 . A A .  32 THR N    1 1 
        2  2408 1 1  32 THR O    O  -7.563  -9.836   7.835 1.00 . A A .  32 THR O    1 1 
        2  2409 1 1  32 THR OG1  O  -6.329  -7.436   8.093 1.00 . A A .  32 THR OG1  1 1 
        2  2410 1 1  33 SER C    C  -7.065 -14.028   7.901 1.00 . A A .  33 SER C    1 1 
        2  2411 1 1  33 SER CA   C  -7.484 -12.603   7.515 1.00 . A A .  33 SER CA   1 1 
        2  2412 1 1  33 SER CB   C  -8.150 -12.618   6.133 1.00 . A A .  33 SER CB   1 1 
        2  2413 1 1  33 SER H    H  -5.434 -12.059   7.382 1.00 . A A .  33 SER H    1 1 
        2  2414 1 1  33 SER HA   H  -8.197 -12.244   8.243 1.00 . A A .  33 SER HA   1 1 
        2  2415 1 1  33 SER HB2  H  -9.001 -13.284   6.150 1.00 . A A .  33 SER HB2  1 1 
        2  2416 1 1  33 SER HB3  H  -8.483 -11.620   5.887 1.00 . A A .  33 SER HB3  1 1 
        2  2417 1 1  33 SER HG   H  -6.881 -12.287   4.677 1.00 . A A .  33 SER HG   1 1 
        2  2418 1 1  33 SER N    N  -6.332 -11.690   7.517 1.00 . A A .  33 SER N    1 1 
        2  2419 1 1  33 SER O    O  -5.880 -14.310   8.085 1.00 . A A .  33 SER O    1 1 
        2  2420 1 1  33 SER OG   O  -7.247 -13.055   5.129 1.00 . A A .  33 SER OG   1 1 
        2  2421 1 1  34 GLU C    C  -7.828 -17.288   7.234 1.00 . A A .  34 GLU C    1 1 
        2  2422 1 1  34 GLU CA   C  -7.785 -16.314   8.426 1.00 . A A .  34 GLU CA   1 1 
        2  2423 1 1  34 GLU CB   C  -8.819 -16.755   9.473 1.00 . A A .  34 GLU CB   1 1 
        2  2424 1 1  34 GLU CD   C  -9.808 -16.441  11.782 1.00 . A A .  34 GLU CD   1 1 
        2  2425 1 1  34 GLU CG   C  -8.789 -15.947  10.768 1.00 . A A .  34 GLU CG   1 1 
        2  2426 1 1  34 GLU H    H  -8.972 -14.642   7.853 1.00 . A A .  34 GLU H    1 1 
        2  2427 1 1  34 GLU HA   H  -6.801 -16.355   8.870 1.00 . A A .  34 GLU HA   1 1 
        2  2428 1 1  34 GLU HB2  H  -9.807 -16.665   9.043 1.00 . A A .  34 GLU HB2  1 1 
        2  2429 1 1  34 GLU HB3  H  -8.643 -17.794   9.721 1.00 . A A .  34 GLU HB3  1 1 
        2  2430 1 1  34 GLU HG2  H  -7.802 -16.022  11.203 1.00 . A A .  34 GLU HG2  1 1 
        2  2431 1 1  34 GLU HG3  H  -9.000 -14.912  10.537 1.00 . A A .  34 GLU HG3  1 1 
        2  2432 1 1  34 GLU N    N  -8.045 -14.923   8.023 1.00 . A A .  34 GLU N    1 1 
        2  2433 1 1  34 GLU O    O  -7.690 -18.501   7.413 1.00 . A A .  34 GLU O    1 1 
        2  2434 1 1  34 GLU OE1  O  -9.560 -17.490  12.413 1.00 . A A .  34 GLU OE1  1 1 
        2  2435 1 1  34 GLU OE2  O -10.870 -15.797  11.937 1.00 . A A .  34 GLU OE2  1 1 
        2  2436 1 1  35 GLN C    C  -7.642 -16.934   3.574 1.00 . A A .  35 GLN C    1 1 
        2  2437 1 1  35 GLN CA   C  -8.192 -17.609   4.839 1.00 . A A .  35 GLN CA   1 1 
        2  2438 1 1  35 GLN CB   C  -9.688 -17.917   4.676 1.00 . A A .  35 GLN CB   1 1 
        2  2439 1 1  35 GLN CD   C -11.497 -19.279   3.533 1.00 . A A .  35 GLN CD   1 1 
        2  2440 1 1  35 GLN CG   C -10.013 -18.934   3.586 1.00 . A A .  35 GLN CG   1 1 
        2  2441 1 1  35 GLN H    H  -8.011 -15.787   5.922 1.00 . A A .  35 GLN H    1 1 
        2  2442 1 1  35 GLN HA   H  -7.658 -18.535   5.001 1.00 . A A .  35 GLN HA   1 1 
        2  2443 1 1  35 GLN HB2  H -10.066 -18.298   5.613 1.00 . A A .  35 GLN HB2  1 1 
        2  2444 1 1  35 GLN HB3  H -10.205 -16.996   4.442 1.00 . A A .  35 GLN HB3  1 1 
        2  2445 1 1  35 GLN HE21 H -11.387 -19.678   1.595 1.00 . A A .  35 GLN HE21 1 1 
        2  2446 1 1  35 GLN HE22 H -12.940 -19.880   2.325 1.00 . A A .  35 GLN HE22 1 1 
        2  2447 1 1  35 GLN HG2  H  -9.718 -18.528   2.629 1.00 . A A .  35 GLN HG2  1 1 
        2  2448 1 1  35 GLN HG3  H  -9.456 -19.840   3.779 1.00 . A A .  35 GLN HG3  1 1 
        2  2449 1 1  35 GLN N    N  -8.006 -16.762   6.025 1.00 . A A .  35 GLN N    1 1 
        2  2450 1 1  35 GLN NE2  N -11.991 -19.644   2.367 1.00 . A A .  35 GLN NE2  1 1 
        2  2451 1 1  35 GLN O    O  -7.561 -15.712   3.502 1.00 . A A .  35 GLN O    1 1 
        2  2452 1 1  35 GLN OE1  O -12.194 -19.224   4.538 1.00 . A A .  35 GLN OE1  1 1 
        2  2453 1 1  36 ASP C    C  -7.832 -16.359   0.607 1.00 . A A .  36 ASP C    1 1 
        2  2454 1 1  36 ASP CA   C  -6.758 -17.219   1.303 1.00 . A A .  36 ASP CA   1 1 
        2  2455 1 1  36 ASP CB   C  -6.341 -18.384   0.398 1.00 . A A .  36 ASP CB   1 1 
        2  2456 1 1  36 ASP CG   C  -5.367 -19.323   1.090 1.00 . A A .  36 ASP CG   1 1 
        2  2457 1 1  36 ASP H    H  -7.277 -18.708   2.724 1.00 . A A .  36 ASP H    1 1 
        2  2458 1 1  36 ASP HA   H  -5.893 -16.601   1.505 1.00 . A A .  36 ASP HA   1 1 
        2  2459 1 1  36 ASP HB2  H  -7.220 -18.948   0.117 1.00 . A A .  36 ASP HB2  1 1 
        2  2460 1 1  36 ASP HB3  H  -5.870 -17.992  -0.492 1.00 . A A .  36 ASP HB3  1 1 
        2  2461 1 1  36 ASP N    N  -7.250 -17.739   2.586 1.00 . A A .  36 ASP N    1 1 
        2  2462 1 1  36 ASP O    O  -8.910 -16.850   0.259 1.00 . A A .  36 ASP O    1 1 
        2  2463 1 1  36 ASP OD1  O  -5.818 -20.154   1.907 1.00 . A A .  36 ASP OD1  1 1 
        2  2464 1 1  36 ASP OD2  O  -4.148 -19.234   0.832 1.00 . A A .  36 ASP OD2  1 1 
        2  2465 1 1  37 GLN C    C  -8.078 -13.573  -1.501 1.00 . A A .  37 GLN C    1 1 
        2  2466 1 1  37 GLN CA   C  -8.521 -14.121  -0.130 1.00 . A A .  37 GLN CA   1 1 
        2  2467 1 1  37 GLN CB   C  -8.704 -12.949   0.852 1.00 . A A .  37 GLN CB   1 1 
        2  2468 1 1  37 GLN CD   C -10.485 -14.005   2.342 1.00 . A A .  37 GLN CD   1 1 
        2  2469 1 1  37 GLN CG   C  -9.112 -13.353   2.269 1.00 . A A .  37 GLN CG   1 1 
        2  2470 1 1  37 GLN H    H  -6.633 -14.757   0.622 1.00 . A A .  37 GLN H    1 1 
        2  2471 1 1  37 GLN HA   H  -9.464 -14.636  -0.246 1.00 . A A .  37 GLN HA   1 1 
        2  2472 1 1  37 GLN HB2  H  -7.773 -12.405   0.916 1.00 . A A .  37 GLN HB2  1 1 
        2  2473 1 1  37 GLN HB3  H  -9.466 -12.288   0.460 1.00 . A A .  37 GLN HB3  1 1 
        2  2474 1 1  37 GLN HE21 H  -9.698 -15.796   2.077 1.00 . A A .  37 GLN HE21 1 1 
        2  2475 1 1  37 GLN HE22 H -11.415 -15.744   2.250 1.00 . A A .  37 GLN HE22 1 1 
        2  2476 1 1  37 GLN HG2  H  -8.381 -14.049   2.652 1.00 . A A .  37 GLN HG2  1 1 
        2  2477 1 1  37 GLN HG3  H  -9.118 -12.468   2.891 1.00 . A A .  37 GLN HG3  1 1 
        2  2478 1 1  37 GLN N    N  -7.539 -15.076   0.412 1.00 . A A .  37 GLN N    1 1 
        2  2479 1 1  37 GLN NE2  N -10.535 -15.313   2.211 1.00 . A A .  37 GLN NE2  1 1 
        2  2480 1 1  37 GLN O    O  -6.921 -13.712  -1.885 1.00 . A A .  37 GLN O    1 1 
        2  2481 1 1  37 GLN OE1  O -11.495 -13.338   2.524 1.00 . A A .  37 GLN OE1  1 1 
        2  2482 1 1  38 PRO C    C  -8.005 -10.852  -3.148 1.00 . A A .  38 PRO C    1 1 
        2  2483 1 1  38 PRO CA   C  -8.634 -12.217  -3.490 1.00 . A A .  38 PRO CA   1 1 
        2  2484 1 1  38 PRO CB   C  -9.978 -12.026  -4.228 1.00 . A A .  38 PRO CB   1 1 
        2  2485 1 1  38 PRO CD   C -10.451 -12.930  -2.042 1.00 . A A .  38 PRO CD   1 1 
        2  2486 1 1  38 PRO CG   C -11.001 -12.785  -3.436 1.00 . A A .  38 PRO CG   1 1 
        2  2487 1 1  38 PRO HA   H  -7.950 -12.787  -4.108 1.00 . A A .  38 PRO HA   1 1 
        2  2488 1 1  38 PRO HB2  H -10.223 -10.974  -4.274 1.00 . A A .  38 PRO HB2  1 1 
        2  2489 1 1  38 PRO HB3  H  -9.894 -12.417  -5.231 1.00 . A A .  38 PRO HB3  1 1 
        2  2490 1 1  38 PRO HD2  H -10.735 -12.085  -1.430 1.00 . A A .  38 PRO HD2  1 1 
        2  2491 1 1  38 PRO HD3  H -10.790 -13.854  -1.593 1.00 . A A .  38 PRO HD3  1 1 
        2  2492 1 1  38 PRO HG2  H -11.931 -12.235  -3.417 1.00 . A A .  38 PRO HG2  1 1 
        2  2493 1 1  38 PRO HG3  H -11.156 -13.759  -3.878 1.00 . A A .  38 PRO HG3  1 1 
        2  2494 1 1  38 PRO N    N  -8.999 -12.954  -2.270 1.00 . A A .  38 PRO N    1 1 
        2  2495 1 1  38 PRO O    O  -8.405 -10.219  -2.171 1.00 . A A .  38 PRO O    1 1 
        2  2496 1 1  39 MET C    C  -7.338  -7.968  -3.470 1.00 . A A .  39 MET C    1 1 
        2  2497 1 1  39 MET CA   C  -6.338  -9.123  -3.660 1.00 . A A .  39 MET CA   1 1 
        2  2498 1 1  39 MET CB   C  -5.346  -8.778  -4.778 1.00 . A A .  39 MET CB   1 1 
        2  2499 1 1  39 MET CE   C  -3.038  -5.785  -2.982 1.00 . A A .  39 MET CE   1 1 
        2  2500 1 1  39 MET CG   C  -4.596  -7.468  -4.548 1.00 . A A .  39 MET CG   1 1 
        2  2501 1 1  39 MET H    H  -6.755 -10.926  -4.725 1.00 . A A .  39 MET H    1 1 
        2  2502 1 1  39 MET HA   H  -5.789  -9.252  -2.738 1.00 . A A .  39 MET HA   1 1 
        2  2503 1 1  39 MET HB2  H  -4.619  -9.574  -4.853 1.00 . A A .  39 MET HB2  1 1 
        2  2504 1 1  39 MET HB3  H  -5.884  -8.703  -5.713 1.00 . A A .  39 MET HB3  1 1 
        2  2505 1 1  39 MET HE1  H  -2.422  -5.645  -3.858 1.00 . A A .  39 MET HE1  1 1 
        2  2506 1 1  39 MET HE2  H  -2.442  -5.637  -2.094 1.00 . A A .  39 MET HE2  1 1 
        2  2507 1 1  39 MET HE3  H  -3.849  -5.070  -2.994 1.00 . A A .  39 MET HE3  1 1 
        2  2508 1 1  39 MET HG2  H  -3.885  -7.329  -5.350 1.00 . A A .  39 MET HG2  1 1 
        2  2509 1 1  39 MET HG3  H  -5.307  -6.654  -4.552 1.00 . A A .  39 MET HG3  1 1 
        2  2510 1 1  39 MET N    N  -7.026 -10.398  -3.944 1.00 . A A .  39 MET N    1 1 
        2  2511 1 1  39 MET O    O  -7.345  -7.308  -2.434 1.00 . A A .  39 MET O    1 1 
        2  2512 1 1  39 MET SD   S  -3.705  -7.448  -2.980 1.00 . A A .  39 MET SD   1 1 
        2  2513 1 1  40 GLY C    C  -8.951  -5.440  -5.123 1.00 . A A .  40 GLY C    1 1 
        2  2514 1 1  40 GLY CA   C  -9.231  -6.725  -4.352 1.00 . A A .  40 GLY CA   1 1 
        2  2515 1 1  40 GLY H    H  -8.090  -8.245  -5.305 1.00 . A A .  40 GLY H    1 1 
        2  2516 1 1  40 GLY HA2  H -10.152  -7.150  -4.722 1.00 . A A .  40 GLY HA2  1 1 
        2  2517 1 1  40 GLY HA3  H  -9.363  -6.480  -3.306 1.00 . A A .  40 GLY HA3  1 1 
        2  2518 1 1  40 GLY N    N  -8.182  -7.733  -4.474 1.00 . A A .  40 GLY N    1 1 
        2  2519 1 1  40 GLY O    O  -7.800  -5.028  -5.280 1.00 . A A .  40 GLY O    1 1 
        2  2520 1 1  41 GLY C    C  -9.799  -2.323  -5.421 1.00 . A A .  41 GLY C    1 1 
        2  2521 1 1  41 GLY CA   C  -9.882  -3.543  -6.334 1.00 . A A .  41 GLY CA   1 1 
        2  2522 1 1  41 GLY H    H -10.906  -5.173  -5.445 1.00 . A A .  41 GLY H    1 1 
        2  2523 1 1  41 GLY HA2  H  -8.989  -3.585  -6.941 1.00 . A A .  41 GLY HA2  1 1 
        2  2524 1 1  41 GLY HA3  H -10.737  -3.432  -6.985 1.00 . A A .  41 GLY HA3  1 1 
        2  2525 1 1  41 GLY N    N -10.017  -4.795  -5.598 1.00 . A A .  41 GLY N    1 1 
        2  2526 1 1  41 GLY O    O -10.631  -1.416  -5.505 1.00 . A A .  41 GLY O    1 1 
        2  2527 1 1  42 TRP C    C  -7.885  -0.019  -4.331 1.00 . A A .  42 TRP C    1 1 
        2  2528 1 1  42 TRP CA   C  -8.589  -1.187  -3.620 1.00 . A A .  42 TRP CA   1 1 
        2  2529 1 1  42 TRP CB   C  -7.735  -1.643  -2.425 1.00 . A A .  42 TRP CB   1 1 
        2  2530 1 1  42 TRP CD1  C  -7.681  -4.172  -2.026 1.00 . A A .  42 TRP CD1  1 1 
        2  2531 1 1  42 TRP CD2  C  -9.263  -3.101  -0.861 1.00 . A A .  42 TRP CD2  1 1 
        2  2532 1 1  42 TRP CE2  C  -9.336  -4.473  -0.563 1.00 . A A .  42 TRP CE2  1 1 
        2  2533 1 1  42 TRP CE3  C -10.163  -2.232  -0.242 1.00 . A A .  42 TRP CE3  1 1 
        2  2534 1 1  42 TRP CG   C  -8.196  -2.929  -1.804 1.00 . A A .  42 TRP CG   1 1 
        2  2535 1 1  42 TRP CH2  C -11.136  -4.124   0.916 1.00 . A A .  42 TRP CH2  1 1 
        2  2536 1 1  42 TRP CZ2  C -10.269  -4.996   0.324 1.00 . A A .  42 TRP CZ2  1 1 
        2  2537 1 1  42 TRP CZ3  C -11.089  -2.755   0.640 1.00 . A A .  42 TRP CZ3  1 1 
        2  2538 1 1  42 TRP H    H  -8.183  -3.070  -4.515 1.00 . A A .  42 TRP H    1 1 
        2  2539 1 1  42 TRP HA   H  -9.553  -0.854  -3.263 1.00 . A A .  42 TRP HA   1 1 
        2  2540 1 1  42 TRP HB2  H  -6.714  -1.785  -2.754 1.00 . A A .  42 TRP HB2  1 1 
        2  2541 1 1  42 TRP HB3  H  -7.755  -0.877  -1.662 1.00 . A A .  42 TRP HB3  1 1 
        2  2542 1 1  42 TRP HD1  H  -6.858  -4.381  -2.695 1.00 . A A .  42 TRP HD1  1 1 
        2  2543 1 1  42 TRP HE1  H  -8.175  -6.070  -1.275 1.00 . A A .  42 TRP HE1  1 1 
        2  2544 1 1  42 TRP HE3  H -10.142  -1.171  -0.443 1.00 . A A .  42 TRP HE3  1 1 
        2  2545 1 1  42 TRP HH2  H -11.877  -4.487   1.612 1.00 . A A .  42 TRP HH2  1 1 
        2  2546 1 1  42 TRP HZ2  H -10.317  -6.052   0.545 1.00 . A A .  42 TRP HZ2  1 1 
        2  2547 1 1  42 TRP HZ3  H -11.793  -2.098   1.131 1.00 . A A .  42 TRP HZ3  1 1 
        2  2548 1 1  42 TRP N    N  -8.799  -2.308  -4.544 1.00 . A A .  42 TRP N    1 1 
        2  2549 1 1  42 TRP NE1  N  -8.362  -5.104  -1.287 1.00 . A A .  42 TRP NE1  1 1 
        2  2550 1 1  42 TRP O    O  -7.395  -0.168  -5.454 1.00 . A A .  42 TRP O    1 1 
        2  2551 1 1  43 GLU C    C  -6.265   2.987  -3.125 1.00 . A A .  43 GLU C    1 1 
        2  2552 1 1  43 GLU CA   C  -7.072   2.275  -4.221 1.00 . A A .  43 GLU CA   1 1 
        2  2553 1 1  43 GLU CB   C  -8.008   3.258  -4.935 1.00 . A A .  43 GLU CB   1 1 
        2  2554 1 1  43 GLU CD   C  -8.158   5.140  -6.636 1.00 . A A .  43 GLU CD   1 1 
        2  2555 1 1  43 GLU CG   C  -7.270   4.376  -5.665 1.00 . A A .  43 GLU CG   1 1 
        2  2556 1 1  43 GLU H    H  -8.306   1.240  -2.829 1.00 . A A .  43 GLU H    1 1 
        2  2557 1 1  43 GLU HA   H  -6.374   1.879  -4.949 1.00 . A A .  43 GLU HA   1 1 
        2  2558 1 1  43 GLU HB2  H  -8.598   2.711  -5.657 1.00 . A A .  43 GLU HB2  1 1 
        2  2559 1 1  43 GLU HB3  H  -8.672   3.704  -4.207 1.00 . A A .  43 GLU HB3  1 1 
        2  2560 1 1  43 GLU HG2  H  -6.876   5.067  -4.934 1.00 . A A .  43 GLU HG2  1 1 
        2  2561 1 1  43 GLU HG3  H  -6.449   3.942  -6.219 1.00 . A A .  43 GLU HG3  1 1 
        2  2562 1 1  43 GLU N    N  -7.824   1.139  -3.680 1.00 . A A .  43 GLU N    1 1 
        2  2563 1 1  43 GLU O    O  -6.808   3.403  -2.098 1.00 . A A .  43 GLU O    1 1 
        2  2564 1 1  43 GLU OE1  O  -8.393   4.628  -7.755 1.00 . A A .  43 GLU OE1  1 1 
        2  2565 1 1  43 GLU OE2  O  -8.618   6.250  -6.297 1.00 . A A .  43 GLU OE2  1 1 
        2  2566 1 1  44 MET C    C  -3.848   5.238  -2.759 1.00 . A A .  44 MET C    1 1 
        2  2567 1 1  44 MET CA   C  -4.039   3.752  -2.413 1.00 . A A .  44 MET CA   1 1 
        2  2568 1 1  44 MET CB   C  -2.681   3.035  -2.439 1.00 . A A .  44 MET CB   1 1 
        2  2569 1 1  44 MET CE   C   0.384   2.902  -3.318 1.00 . A A .  44 MET CE   1 1 
        2  2570 1 1  44 MET CG   C  -1.622   3.691  -1.568 1.00 . A A .  44 MET CG   1 1 
        2  2571 1 1  44 MET H    H  -4.590   2.717  -4.174 1.00 . A A .  44 MET H    1 1 
        2  2572 1 1  44 MET HA   H  -4.459   3.672  -1.421 1.00 . A A .  44 MET HA   1 1 
        2  2573 1 1  44 MET HB2  H  -2.817   2.020  -2.095 1.00 . A A .  44 MET HB2  1 1 
        2  2574 1 1  44 MET HB3  H  -2.317   3.013  -3.457 1.00 . A A .  44 MET HB3  1 1 
        2  2575 1 1  44 MET HE1  H  -0.392   2.437  -3.911 1.00 . A A .  44 MET HE1  1 1 
        2  2576 1 1  44 MET HE2  H   1.318   2.388  -3.483 1.00 . A A .  44 MET HE2  1 1 
        2  2577 1 1  44 MET HE3  H   0.487   3.937  -3.609 1.00 . A A .  44 MET HE3  1 1 
        2  2578 1 1  44 MET HG2  H  -1.454   4.696  -1.922 1.00 . A A .  44 MET HG2  1 1 
        2  2579 1 1  44 MET HG3  H  -1.987   3.727  -0.550 1.00 . A A .  44 MET HG3  1 1 
        2  2580 1 1  44 MET N    N  -4.956   3.099  -3.350 1.00 . A A .  44 MET N    1 1 
        2  2581 1 1  44 MET O    O  -3.208   5.571  -3.754 1.00 . A A .  44 MET O    1 1 
        2  2582 1 1  44 MET SD   S  -0.050   2.808  -1.583 1.00 . A A .  44 MET SD   1 1 
        2  2583 1 1  45 ILE C    C  -3.115   8.108  -1.230 1.00 . A A .  45 ILE C    1 1 
        2  2584 1 1  45 ILE CA   C  -4.237   7.569  -2.134 1.00 . A A .  45 ILE CA   1 1 
        2  2585 1 1  45 ILE CB   C  -5.544   8.365  -1.841 1.00 . A A .  45 ILE CB   1 1 
        2  2586 1 1  45 ILE CD1  C  -7.297   6.589  -2.475 1.00 . A A .  45 ILE CD1  1 1 
        2  2587 1 1  45 ILE CG1  C  -6.692   7.946  -2.786 1.00 . A A .  45 ILE CG1  1 1 
        2  2588 1 1  45 ILE CG2  C  -5.288   9.870  -1.947 1.00 . A A .  45 ILE CG2  1 1 
        2  2589 1 1  45 ILE H    H  -4.954   5.803  -1.192 1.00 . A A .  45 ILE H    1 1 
        2  2590 1 1  45 ILE HA   H  -3.964   7.740  -3.168 1.00 . A A .  45 ILE HA   1 1 
        2  2591 1 1  45 ILE HB   H  -5.837   8.153  -0.822 1.00 . A A .  45 ILE HB   1 1 
        2  2592 1 1  45 ILE HD11 H  -6.543   5.823  -2.581 1.00 . A A .  45 ILE HD11 1 1 
        2  2593 1 1  45 ILE HD12 H  -8.108   6.391  -3.159 1.00 . A A .  45 ILE HD12 1 1 
        2  2594 1 1  45 ILE HD13 H  -7.673   6.585  -1.462 1.00 . A A .  45 ILE HD13 1 1 
        2  2595 1 1  45 ILE HG12 H  -7.485   8.675  -2.719 1.00 . A A .  45 ILE HG12 1 1 
        2  2596 1 1  45 ILE HG13 H  -6.323   7.919  -3.803 1.00 . A A .  45 ILE HG13 1 1 
        2  2597 1 1  45 ILE HG21 H  -6.205  10.408  -1.748 1.00 . A A .  45 ILE HG21 1 1 
        2  2598 1 1  45 ILE HG22 H  -4.940  10.112  -2.941 1.00 . A A .  45 ILE HG22 1 1 
        2  2599 1 1  45 ILE HG23 H  -4.539  10.163  -1.224 1.00 . A A .  45 ILE HG23 1 1 
        2  2600 1 1  45 ILE N    N  -4.410   6.125  -1.943 1.00 . A A .  45 ILE N    1 1 
        2  2601 1 1  45 ILE O    O  -3.224   8.073  -0.003 1.00 . A A .  45 ILE O    1 1 
        2  2602 1 1  46 ARG C    C  -1.184  10.645  -0.721 1.00 . A A .  46 ARG C    1 1 
        2  2603 1 1  46 ARG CA   C  -0.921   9.172  -1.076 1.00 . A A .  46 ARG CA   1 1 
        2  2604 1 1  46 ARG CB   C   0.392   9.052  -1.869 1.00 . A A .  46 ARG CB   1 1 
        2  2605 1 1  46 ARG CD   C   2.863   9.624  -1.999 1.00 . A A .  46 ARG CD   1 1 
        2  2606 1 1  46 ARG CG   C   1.597   9.653  -1.149 1.00 . A A .  46 ARG CG   1 1 
        2  2607 1 1  46 ARG CZ   C   4.936  10.936  -1.935 1.00 . A A .  46 ARG CZ   1 1 
        2  2608 1 1  46 ARG H    H  -1.990   8.586  -2.817 1.00 . A A .  46 ARG H    1 1 
        2  2609 1 1  46 ARG HA   H  -0.824   8.607  -0.158 1.00 . A A .  46 ARG HA   1 1 
        2  2610 1 1  46 ARG HB2  H   0.593   8.005  -2.056 1.00 . A A .  46 ARG HB2  1 1 
        2  2611 1 1  46 ARG HB3  H   0.273   9.559  -2.817 1.00 . A A .  46 ARG HB3  1 1 
        2  2612 1 1  46 ARG HD2  H   3.126   8.595  -2.200 1.00 . A A .  46 ARG HD2  1 1 
        2  2613 1 1  46 ARG HD3  H   2.669  10.135  -2.933 1.00 . A A .  46 ARG HD3  1 1 
        2  2614 1 1  46 ARG HE   H   4.022  10.217  -0.352 1.00 . A A .  46 ARG HE   1 1 
        2  2615 1 1  46 ARG HG2  H   1.376  10.680  -0.896 1.00 . A A .  46 ARG HG2  1 1 
        2  2616 1 1  46 ARG HG3  H   1.773   9.092  -0.240 1.00 . A A .  46 ARG HG3  1 1 
        2  2617 1 1  46 ARG HH11 H   4.258  10.565  -3.769 1.00 . A A .  46 ARG HH11 1 1 
        2  2618 1 1  46 ARG HH12 H   5.683  11.543  -3.674 1.00 . A A .  46 ARG HH12 1 1 
        2  2619 1 1  46 ARG HH21 H   5.893  11.446  -0.265 1.00 . A A .  46 ARG HH21 1 1 
        2  2620 1 1  46 ARG HH22 H   6.594  12.010  -1.740 1.00 . A A .  46 ARG HH22 1 1 
        2  2621 1 1  46 ARG N    N  -2.037   8.602  -1.836 1.00 . A A .  46 ARG N    1 1 
        2  2622 1 1  46 ARG NE   N   3.987  10.276  -1.322 1.00 . A A .  46 ARG NE   1 1 
        2  2623 1 1  46 ARG NH1  N   4.960  11.016  -3.224 1.00 . A A .  46 ARG NH1  1 1 
        2  2624 1 1  46 ARG NH2  N   5.877  11.507  -1.258 1.00 . A A .  46 ARG NH2  1 1 
        2  2625 1 1  46 ARG O    O  -0.959  11.540  -1.537 1.00 . A A .  46 ARG O    1 1 
        2  2626 1 1  47 LYS C    C  -0.737  12.818   1.754 1.00 . A A .  47 LYS C    1 1 
        2  2627 1 1  47 LYS CA   C  -1.924  12.260   0.958 1.00 . A A .  47 LYS CA   1 1 
        2  2628 1 1  47 LYS CB   C  -3.196  12.312   1.812 1.00 . A A .  47 LYS CB   1 1 
        2  2629 1 1  47 LYS CD   C  -5.720  12.224   1.897 1.00 . A A .  47 LYS CD   1 1 
        2  2630 1 1  47 LYS CE   C  -7.002  12.189   1.076 1.00 . A A .  47 LYS CE   1 1 
        2  2631 1 1  47 LYS CG   C  -4.478  12.112   1.014 1.00 . A A .  47 LYS CG   1 1 
        2  2632 1 1  47 LYS H    H  -1.865  10.139   1.093 1.00 . A A .  47 LYS H    1 1 
        2  2633 1 1  47 LYS HA   H  -2.070  12.881   0.085 1.00 . A A .  47 LYS HA   1 1 
        2  2634 1 1  47 LYS HB2  H  -3.142  11.540   2.568 1.00 . A A .  47 LYS HB2  1 1 
        2  2635 1 1  47 LYS HB3  H  -3.249  13.277   2.300 1.00 . A A .  47 LYS HB3  1 1 
        2  2636 1 1  47 LYS HD2  H  -5.730  11.401   2.598 1.00 . A A .  47 LYS HD2  1 1 
        2  2637 1 1  47 LYS HD3  H  -5.678  13.158   2.441 1.00 . A A .  47 LYS HD3  1 1 
        2  2638 1 1  47 LYS HE2  H  -6.999  11.305   0.455 1.00 . A A .  47 LYS HE2  1 1 
        2  2639 1 1  47 LYS HE3  H  -7.845  12.149   1.752 1.00 . A A .  47 LYS HE3  1 1 
        2  2640 1 1  47 LYS HG2  H  -4.528  12.865   0.239 1.00 . A A .  47 LYS HG2  1 1 
        2  2641 1 1  47 LYS HG3  H  -4.457  11.130   0.559 1.00 . A A .  47 LYS HG3  1 1 
        2  2642 1 1  47 LYS HZ1  H  -6.280  13.521  -0.362 1.00 . A A .  47 LYS HZ1  1 1 
        2  2643 1 1  47 LYS HZ2  H  -7.289  14.238   0.788 1.00 . A A .  47 LYS HZ2  1 1 
        2  2644 1 1  47 LYS HZ3  H  -7.951  13.277  -0.435 1.00 . A A .  47 LYS HZ3  1 1 
        2  2645 1 1  47 LYS N    N  -1.670  10.891   0.494 1.00 . A A .  47 LYS N    1 1 
        2  2646 1 1  47 LYS NZ   N  -7.139  13.388   0.207 1.00 . A A .  47 LYS NZ   1 1 
        2  2647 1 1  47 LYS O    O  -0.206  12.163   2.654 1.00 . A A .  47 LYS O    1 1 
        2  2648 1 1  48 ILE C    C   0.630  16.230   2.080 1.00 . A A .  48 ILE C    1 1 
        2  2649 1 1  48 ILE CA   C   0.798  14.694   2.088 1.00 . A A .  48 ILE CA   1 1 
        2  2650 1 1  48 ILE CB   C   2.144  14.277   1.426 1.00 . A A .  48 ILE CB   1 1 
        2  2651 1 1  48 ILE CD1  C   4.686  14.222   1.767 1.00 . A A .  48 ILE CD1  1 1 
        2  2652 1 1  48 ILE CG1  C   3.344  14.691   2.301 1.00 . A A .  48 ILE CG1  1 1 
        2  2653 1 1  48 ILE CG2  C   2.258  14.863   0.017 1.00 . A A .  48 ILE CG2  1 1 
        2  2654 1 1  48 ILE H    H  -0.780  14.500   0.676 1.00 . A A .  48 ILE H    1 1 
        2  2655 1 1  48 ILE HA   H   0.807  14.355   3.114 1.00 . A A .  48 ILE HA   1 1 
        2  2656 1 1  48 ILE HB   H   2.140  13.198   1.330 1.00 . A A .  48 ILE HB   1 1 
        2  2657 1 1  48 ILE HD11 H   5.472  14.545   2.434 1.00 . A A .  48 ILE HD11 1 1 
        2  2658 1 1  48 ILE HD12 H   4.852  14.642   0.785 1.00 . A A .  48 ILE HD12 1 1 
        2  2659 1 1  48 ILE HD13 H   4.690  13.144   1.702 1.00 . A A .  48 ILE HD13 1 1 
        2  2660 1 1  48 ILE HG12 H   3.377  15.769   2.371 1.00 . A A .  48 ILE HG12 1 1 
        2  2661 1 1  48 ILE HG13 H   3.220  14.278   3.292 1.00 . A A .  48 ILE HG13 1 1 
        2  2662 1 1  48 ILE HG21 H   2.254  15.943   0.072 1.00 . A A .  48 ILE HG21 1 1 
        2  2663 1 1  48 ILE HG22 H   1.421  14.532  -0.580 1.00 . A A .  48 ILE HG22 1 1 
        2  2664 1 1  48 ILE HG23 H   3.178  14.530  -0.440 1.00 . A A .  48 ILE HG23 1 1 
        2  2665 1 1  48 ILE N    N  -0.325  14.037   1.411 1.00 . A A .  48 ILE N    1 1 
        2  2666 1 1  48 ILE O    O   1.588  16.987   2.244 1.00 . A A .  48 ILE O    1 1 
        2  2667 1 1  49 GLY C    C  -1.090  18.719   0.537 1.00 . A A .  49 GLY C    1 1 
        2  2668 1 1  49 GLY CA   C  -0.908  18.112   1.926 1.00 . A A .  49 GLY CA   1 1 
        2  2669 1 1  49 GLY H    H  -1.340  16.041   1.770 1.00 . A A .  49 GLY H    1 1 
        2  2670 1 1  49 GLY HA2  H  -1.817  18.264   2.489 1.00 . A A .  49 GLY HA2  1 1 
        2  2671 1 1  49 GLY HA3  H  -0.103  18.631   2.430 1.00 . A A .  49 GLY HA3  1 1 
        2  2672 1 1  49 GLY N    N  -0.612  16.682   1.904 1.00 . A A .  49 GLY N    1 1 
        2  2673 1 1  49 GLY O    O  -2.161  19.237   0.208 1.00 . A A .  49 GLY O    1 1 
        2  2674 1 1  50 ASP C    C  -0.745  18.335  -2.658 1.00 . A A .  50 ASP C    1 1 
        2  2675 1 1  50 ASP CA   C  -0.078  19.263  -1.622 1.00 . A A .  50 ASP CA   1 1 
        2  2676 1 1  50 ASP CB   C   1.342  19.620  -2.070 1.00 . A A .  50 ASP CB   1 1 
        2  2677 1 1  50 ASP CG   C   2.034  20.544  -1.084 1.00 . A A .  50 ASP CG   1 1 
        2  2678 1 1  50 ASP H    H   0.778  18.227   0.027 1.00 . A A .  50 ASP H    1 1 
        2  2679 1 1  50 ASP HA   H  -0.657  20.176  -1.558 1.00 . A A .  50 ASP HA   1 1 
        2  2680 1 1  50 ASP HB2  H   1.924  18.713  -2.163 1.00 . A A .  50 ASP HB2  1 1 
        2  2681 1 1  50 ASP HB3  H   1.300  20.113  -3.033 1.00 . A A .  50 ASP HB3  1 1 
        2  2682 1 1  50 ASP N    N  -0.043  18.665  -0.282 1.00 . A A .  50 ASP N    1 1 
        2  2683 1 1  50 ASP O    O  -1.817  18.644  -3.184 1.00 . A A .  50 ASP O    1 1 
        2  2684 1 1  50 ASP OD1  O   1.727  21.753  -1.075 1.00 . A A .  50 ASP OD1  1 1 
        2  2685 1 1  50 ASP OD2  O   2.879  20.063  -0.301 1.00 . A A .  50 ASP OD2  1 1 
        2  2686 1 1  51 THR C    C  -1.443  15.132  -3.356 1.00 . A A .  51 THR C    1 1 
        2  2687 1 1  51 THR CA   C  -0.606  16.265  -3.968 1.00 . A A .  51 THR CA   1 1 
        2  2688 1 1  51 THR CB   C   0.558  15.643  -4.781 1.00 . A A .  51 THR CB   1 1 
        2  2689 1 1  51 THR CG2  C   1.517  14.877  -3.875 1.00 . A A .  51 THR CG2  1 1 
        2  2690 1 1  51 THR H    H   0.714  16.987  -2.462 1.00 . A A .  51 THR H    1 1 
        2  2691 1 1  51 THR HA   H  -1.230  16.822  -4.653 1.00 . A A .  51 THR HA   1 1 
        2  2692 1 1  51 THR HB   H   1.105  16.441  -5.262 1.00 . A A .  51 THR HB   1 1 
        2  2693 1 1  51 THR HG1  H   0.736  14.603  -6.457 1.00 . A A .  51 THR HG1  1 1 
        2  2694 1 1  51 THR HG21 H   2.328  14.474  -4.467 1.00 . A A .  51 THR HG21 1 1 
        2  2695 1 1  51 THR HG22 H   0.990  14.067  -3.392 1.00 . A A .  51 THR HG22 1 1 
        2  2696 1 1  51 THR HG23 H   1.918  15.543  -3.125 1.00 . A A .  51 THR HG23 1 1 
        2  2697 1 1  51 THR N    N  -0.107  17.203  -2.946 1.00 . A A .  51 THR N    1 1 
        2  2698 1 1  51 THR O    O  -1.534  14.995  -2.133 1.00 . A A .  51 THR O    1 1 
        2  2699 1 1  51 THR OG1  O   0.048  14.759  -5.794 1.00 . A A .  51 THR OG1  1 1 
        2  2700 1 1  52 SER C    C  -2.750  11.991  -4.754 1.00 . A A .  52 SER C    1 1 
        2  2701 1 1  52 SER CA   C  -2.881  13.183  -3.791 1.00 . A A .  52 SER CA   1 1 
        2  2702 1 1  52 SER CB   C  -4.356  13.609  -3.689 1.00 . A A .  52 SER CB   1 1 
        2  2703 1 1  52 SER H    H  -1.921  14.476  -5.185 1.00 . A A .  52 SER H    1 1 
        2  2704 1 1  52 SER HA   H  -2.538  12.874  -2.813 1.00 . A A .  52 SER HA   1 1 
        2  2705 1 1  52 SER HB2  H  -4.940  12.784  -3.307 1.00 . A A .  52 SER HB2  1 1 
        2  2706 1 1  52 SER HB3  H  -4.439  14.447  -3.013 1.00 . A A .  52 SER HB3  1 1 
        2  2707 1 1  52 SER HG   H  -4.509  14.837  -5.223 1.00 . A A .  52 SER HG   1 1 
        2  2708 1 1  52 SER N    N  -2.046  14.316  -4.223 1.00 . A A .  52 SER N    1 1 
        2  2709 1 1  52 SER O    O  -3.702  11.232  -4.953 1.00 . A A .  52 SER O    1 1 
        2  2710 1 1  52 SER OG   O  -4.886  13.989  -4.956 1.00 . A A .  52 SER OG   1 1 
        2  2711 1 1  53 VAL C    C  -1.753   9.364  -5.741 1.00 . A A .  53 VAL C    1 1 
        2  2712 1 1  53 VAL CA   C  -1.285  10.731  -6.284 1.00 . A A .  53 VAL CA   1 1 
        2  2713 1 1  53 VAL CB   C   0.221  10.666  -6.649 1.00 . A A .  53 VAL CB   1 1 
        2  2714 1 1  53 VAL CG1  C   1.083  10.525  -5.397 1.00 . A A .  53 VAL CG1  1 1 
        2  2715 1 1  53 VAL CG2  C   0.498   9.530  -7.637 1.00 . A A .  53 VAL CG2  1 1 
        2  2716 1 1  53 VAL H    H  -0.839  12.457  -5.122 1.00 . A A .  53 VAL H    1 1 
        2  2717 1 1  53 VAL HA   H  -1.839  10.949  -7.188 1.00 . A A .  53 VAL HA   1 1 
        2  2718 1 1  53 VAL HB   H   0.488  11.599  -7.129 1.00 . A A .  53 VAL HB   1 1 
        2  2719 1 1  53 VAL HG11 H   0.922  11.374  -4.749 1.00 . A A .  53 VAL HG11 1 1 
        2  2720 1 1  53 VAL HG12 H   2.127  10.481  -5.679 1.00 . A A .  53 VAL HG12 1 1 
        2  2721 1 1  53 VAL HG13 H   0.816   9.616  -4.874 1.00 . A A .  53 VAL HG13 1 1 
        2  2722 1 1  53 VAL HG21 H   1.551   9.514  -7.886 1.00 . A A .  53 VAL HG21 1 1 
        2  2723 1 1  53 VAL HG22 H  -0.079   9.684  -8.537 1.00 . A A .  53 VAL HG22 1 1 
        2  2724 1 1  53 VAL HG23 H   0.223   8.585  -7.191 1.00 . A A .  53 VAL HG23 1 1 
        2  2725 1 1  53 VAL N    N  -1.557  11.825  -5.334 1.00 . A A .  53 VAL N    1 1 
        2  2726 1 1  53 VAL O    O  -1.413   8.968  -4.623 1.00 . A A .  53 VAL O    1 1 
        2  2727 1 1  54 SER C    C  -2.660   6.172  -6.860 1.00 . A A .  54 SER C    1 1 
        2  2728 1 1  54 SER CA   C  -3.172   7.399  -6.094 1.00 . A A .  54 SER CA   1 1 
        2  2729 1 1  54 SER CB   C  -4.696   7.497  -6.245 1.00 . A A .  54 SER CB   1 1 
        2  2730 1 1  54 SER H    H  -2.717   8.975  -7.451 1.00 . A A .  54 SER H    1 1 
        2  2731 1 1  54 SER HA   H  -2.940   7.267  -5.047 1.00 . A A .  54 SER HA   1 1 
        2  2732 1 1  54 SER HB2  H  -5.153   6.581  -5.901 1.00 . A A .  54 SER HB2  1 1 
        2  2733 1 1  54 SER HB3  H  -5.062   8.324  -5.654 1.00 . A A .  54 SER HB3  1 1 
        2  2734 1 1  54 SER HG   H  -5.078   8.661  -7.781 1.00 . A A .  54 SER HG   1 1 
        2  2735 1 1  54 SER N    N  -2.544   8.651  -6.540 1.00 . A A .  54 SER N    1 1 
        2  2736 1 1  54 SER O    O  -1.827   6.278  -7.764 1.00 . A A .  54 SER O    1 1 
        2  2737 1 1  54 SER OG   O  -5.068   7.709  -7.601 1.00 . A A .  54 SER OG   1 1 
        2  2738 1 1  55 TYR C    C  -3.968   2.720  -6.972 1.00 . A A .  55 TYR C    1 1 
        2  2739 1 1  55 TYR CA   C  -2.837   3.744  -7.141 1.00 . A A .  55 TYR CA   1 1 
        2  2740 1 1  55 TYR CB   C  -1.525   3.160  -6.593 1.00 . A A .  55 TYR CB   1 1 
        2  2741 1 1  55 TYR CD1  C  -0.821   1.536  -8.411 1.00 . A A .  55 TYR CD1  1 1 
        2  2742 1 1  55 TYR CD2  C  -1.325   0.651  -6.252 1.00 . A A .  55 TYR CD2  1 1 
        2  2743 1 1  55 TYR CE1  C  -0.545   0.261  -8.871 1.00 . A A .  55 TYR CE1  1 1 
        2  2744 1 1  55 TYR CE2  C  -1.049  -0.626  -6.707 1.00 . A A .  55 TYR CE2  1 1 
        2  2745 1 1  55 TYR CG   C  -1.217   1.756  -7.096 1.00 . A A .  55 TYR CG   1 1 
        2  2746 1 1  55 TYR CZ   C  -0.660  -0.816  -8.015 1.00 . A A .  55 TYR CZ   1 1 
        2  2747 1 1  55 TYR H    H  -3.750   4.982  -5.685 1.00 . A A .  55 TYR H    1 1 
        2  2748 1 1  55 TYR HA   H  -2.713   3.955  -8.195 1.00 . A A .  55 TYR HA   1 1 
        2  2749 1 1  55 TYR HB2  H  -0.706   3.802  -6.881 1.00 . A A .  55 TYR HB2  1 1 
        2  2750 1 1  55 TYR HB3  H  -1.581   3.125  -5.514 1.00 . A A .  55 TYR HB3  1 1 
        2  2751 1 1  55 TYR HD1  H  -0.731   2.381  -9.081 1.00 . A A .  55 TYR HD1  1 1 
        2  2752 1 1  55 TYR HD2  H  -1.631   0.801  -5.226 1.00 . A A .  55 TYR HD2  1 1 
        2  2753 1 1  55 TYR HE1  H  -0.241   0.114  -9.897 1.00 . A A .  55 TYR HE1  1 1 
        2  2754 1 1  55 TYR HE2  H  -1.140  -1.467  -6.034 1.00 . A A .  55 TYR HE2  1 1 
        2  2755 1 1  55 TYR HH   H   0.446  -2.088  -8.944 1.00 . A A .  55 TYR HH   1 1 
        2  2756 1 1  55 TYR N    N  -3.158   5.003  -6.467 1.00 . A A .  55 TYR N    1 1 
        2  2757 1 1  55 TYR O    O  -4.180   2.193  -5.880 1.00 . A A .  55 TYR O    1 1 
        2  2758 1 1  55 TYR OH   O  -0.392  -2.089  -8.472 1.00 . A A .  55 TYR OH   1 1 
        2  2759 1 1  56 LYS C    C  -5.034   0.021  -8.201 1.00 . A A .  56 LYS C    1 1 
        2  2760 1 1  56 LYS CA   C  -5.713   1.392  -8.040 1.00 . A A .  56 LYS CA   1 1 
        2  2761 1 1  56 LYS CB   C  -6.744   1.625  -9.154 1.00 . A A .  56 LYS CB   1 1 
        2  2762 1 1  56 LYS CD   C  -8.857   0.832 -10.332 1.00 . A A .  56 LYS CD   1 1 
        2  2763 1 1  56 LYS CE   C  -9.850   1.950  -9.998 1.00 . A A .  56 LYS CE   1 1 
        2  2764 1 1  56 LYS CG   C  -7.847   0.570  -9.209 1.00 . A A .  56 LYS CG   1 1 
        2  2765 1 1  56 LYS H    H  -4.560   2.975  -8.865 1.00 . A A .  56 LYS H    1 1 
        2  2766 1 1  56 LYS HA   H  -6.216   1.420  -7.082 1.00 . A A .  56 LYS HA   1 1 
        2  2767 1 1  56 LYS HB2  H  -7.207   2.589  -8.999 1.00 . A A .  56 LYS HB2  1 1 
        2  2768 1 1  56 LYS HB3  H  -6.232   1.633 -10.107 1.00 . A A .  56 LYS HB3  1 1 
        2  2769 1 1  56 LYS HD2  H  -8.318   1.107 -11.228 1.00 . A A .  56 LYS HD2  1 1 
        2  2770 1 1  56 LYS HD3  H  -9.411  -0.079 -10.516 1.00 . A A .  56 LYS HD3  1 1 
        2  2771 1 1  56 LYS HE2  H -10.615   1.969 -10.759 1.00 . A A .  56 LYS HE2  1 1 
        2  2772 1 1  56 LYS HE3  H -10.307   1.732  -9.044 1.00 . A A .  56 LYS HE3  1 1 
        2  2773 1 1  56 LYS HG2  H  -7.394  -0.399  -9.373 1.00 . A A .  56 LYS HG2  1 1 
        2  2774 1 1  56 LYS HG3  H  -8.371   0.564  -8.263 1.00 . A A .  56 LYS HG3  1 1 
        2  2775 1 1  56 LYS HZ1  H  -8.560   3.351  -9.125 1.00 . A A .  56 LYS HZ1  1 1 
        2  2776 1 1  56 LYS HZ2  H  -9.948   4.025  -9.811 1.00 . A A .  56 LYS HZ2  1 1 
        2  2777 1 1  56 LYS HZ3  H  -8.692   3.494 -10.807 1.00 . A A .  56 LYS HZ3  1 1 
        2  2778 1 1  56 LYS N    N  -4.701   2.451  -8.048 1.00 . A A .  56 LYS N    1 1 
        2  2779 1 1  56 LYS NZ   N  -9.217   3.296  -9.931 1.00 . A A .  56 LYS NZ   1 1 
        2  2780 1 1  56 LYS O    O  -4.333  -0.225  -9.187 1.00 . A A .  56 LYS O    1 1 
        2  2781 1 1  57 TYR C    C  -4.955  -3.110  -8.283 1.00 . A A .  57 TYR C    1 1 
        2  2782 1 1  57 TYR CA   C  -4.524  -2.142  -7.172 1.00 . A A .  57 TYR CA   1 1 
        2  2783 1 1  57 TYR CB   C  -4.722  -2.797  -5.799 1.00 . A A .  57 TYR CB   1 1 
        2  2784 1 1  57 TYR CD1  C  -4.544  -0.891  -4.138 1.00 . A A .  57 TYR CD1  1 1 
        2  2785 1 1  57 TYR CD2  C  -2.819  -2.536  -4.150 1.00 . A A .  57 TYR CD2  1 1 
        2  2786 1 1  57 TYR CE1  C  -3.900  -0.220  -3.117 1.00 . A A .  57 TYR CE1  1 1 
        2  2787 1 1  57 TYR CE2  C  -2.173  -1.868  -3.130 1.00 . A A .  57 TYR CE2  1 1 
        2  2788 1 1  57 TYR CG   C  -4.017  -2.062  -4.673 1.00 . A A .  57 TYR CG   1 1 
        2  2789 1 1  57 TYR CZ   C  -2.715  -0.711  -2.619 1.00 . A A .  57 TYR CZ   1 1 
        2  2790 1 1  57 TYR H    H  -5.883  -0.644  -6.520 1.00 . A A .  57 TYR H    1 1 
        2  2791 1 1  57 TYR HA   H  -3.471  -1.930  -7.297 1.00 . A A .  57 TYR HA   1 1 
        2  2792 1 1  57 TYR HB2  H  -5.778  -2.827  -5.569 1.00 . A A .  57 TYR HB2  1 1 
        2  2793 1 1  57 TYR HB3  H  -4.337  -3.807  -5.830 1.00 . A A .  57 TYR HB3  1 1 
        2  2794 1 1  57 TYR HD1  H  -5.474  -0.505  -4.531 1.00 . A A .  57 TYR HD1  1 1 
        2  2795 1 1  57 TYR HD2  H  -2.392  -3.444  -4.552 1.00 . A A .  57 TYR HD2  1 1 
        2  2796 1 1  57 TYR HE1  H  -4.328   0.688  -2.715 1.00 . A A .  57 TYR HE1  1 1 
        2  2797 1 1  57 TYR HE2  H  -1.243  -2.254  -2.738 1.00 . A A .  57 TYR HE2  1 1 
        2  2798 1 1  57 TYR HH   H  -2.698   0.189  -0.922 1.00 . A A .  57 TYR HH   1 1 
        2  2799 1 1  57 TYR N    N  -5.235  -0.859  -7.225 1.00 . A A .  57 TYR N    1 1 
        2  2800 1 1  57 TYR O    O  -6.137  -3.438  -8.428 1.00 . A A .  57 TYR O    1 1 
        2  2801 1 1  57 TYR OH   O  -2.068  -0.044  -1.606 1.00 . A A .  57 TYR OH   1 1 
        2  2802 1 1  58 THR C    C  -4.508  -5.957  -9.519 1.00 . A A .  58 THR C    1 1 
        2  2803 1 1  58 THR CA   C  -4.223  -4.565 -10.112 1.00 . A A .  58 THR CA   1 1 
        2  2804 1 1  58 THR CB   C  -3.038  -4.643 -11.112 1.00 . A A .  58 THR CB   1 1 
        2  2805 1 1  58 THR CG2  C  -1.699  -4.808 -10.394 1.00 . A A .  58 THR CG2  1 1 
        2  2806 1 1  58 THR H    H  -3.068  -3.235  -8.924 1.00 . A A .  58 THR H    1 1 
        2  2807 1 1  58 THR HA   H  -5.098  -4.243 -10.662 1.00 . A A .  58 THR HA   1 1 
        2  2808 1 1  58 THR HB   H  -3.010  -3.718 -11.670 1.00 . A A .  58 THR HB   1 1 
        2  2809 1 1  58 THR HG1  H  -2.429  -5.823 -12.579 1.00 . A A .  58 THR HG1  1 1 
        2  2810 1 1  58 THR HG21 H  -1.710  -5.717  -9.810 1.00 . A A .  58 THR HG21 1 1 
        2  2811 1 1  58 THR HG22 H  -1.531  -3.962  -9.742 1.00 . A A .  58 THR HG22 1 1 
        2  2812 1 1  58 THR HG23 H  -0.905  -4.860 -11.123 1.00 . A A .  58 THR HG23 1 1 
        2  2813 1 1  58 THR N    N  -3.978  -3.573  -9.059 1.00 . A A .  58 THR N    1 1 
        2  2814 1 1  58 THR O    O  -3.608  -6.784  -9.356 1.00 . A A .  58 THR O    1 1 
        2  2815 1 1  58 THR OG1  O  -3.224  -5.727 -12.038 1.00 . A A .  58 THR OG1  1 1 
        2  2816 1 1  59 SER C    C  -6.182  -8.602  -9.634 1.00 . A A .  59 SER C    1 1 
        2  2817 1 1  59 SER CA   C  -6.189  -7.483  -8.582 1.00 . A A .  59 SER CA   1 1 
        2  2818 1 1  59 SER CB   C  -7.582  -7.359  -7.946 1.00 . A A .  59 SER CB   1 1 
        2  2819 1 1  59 SER H    H  -6.438  -5.490  -9.291 1.00 . A A .  59 SER H    1 1 
        2  2820 1 1  59 SER HA   H  -5.476  -7.739  -7.809 1.00 . A A .  59 SER HA   1 1 
        2  2821 1 1  59 SER HB2  H  -7.558  -6.590  -7.189 1.00 . A A .  59 SER HB2  1 1 
        2  2822 1 1  59 SER HB3  H  -8.303  -7.090  -8.706 1.00 . A A .  59 SER HB3  1 1 
        2  2823 1 1  59 SER HG   H  -8.548  -9.072  -7.952 1.00 . A A .  59 SER HG   1 1 
        2  2824 1 1  59 SER N    N  -5.772  -6.198  -9.168 1.00 . A A .  59 SER N    1 1 
        2  2825 1 1  59 SER O    O  -7.233  -9.063 -10.089 1.00 . A A .  59 SER O    1 1 
        2  2826 1 1  59 SER OG   O  -7.990  -8.579  -7.338 1.00 . A A .  59 SER OG   1 1 
        2  2827 1 1  60 ARG C    C  -4.451 -11.423 -10.450 1.00 . A A .  60 ARG C    1 1 
        2  2828 1 1  60 ARG CA   C  -4.806 -10.054 -11.055 1.00 . A A .  60 ARG CA   1 1 
        2  2829 1 1  60 ARG CB   C  -3.712  -9.619 -12.046 1.00 . A A .  60 ARG CB   1 1 
        2  2830 1 1  60 ARG CD   C  -1.323  -8.854 -12.387 1.00 . A A .  60 ARG CD   1 1 
        2  2831 1 1  60 ARG CG   C  -2.404  -9.208 -11.373 1.00 . A A .  60 ARG CG   1 1 
        2  2832 1 1  60 ARG CZ   C   1.107  -8.644 -12.095 1.00 . A A .  60 ARG CZ   1 1 
        2  2833 1 1  60 ARG H    H  -4.187  -8.613  -9.619 1.00 . A A .  60 ARG H    1 1 
        2  2834 1 1  60 ARG HA   H  -5.739 -10.149 -11.590 1.00 . A A .  60 ARG HA   1 1 
        2  2835 1 1  60 ARG HB2  H  -3.506 -10.440 -12.722 1.00 . A A .  60 ARG HB2  1 1 
        2  2836 1 1  60 ARG HB3  H  -4.076  -8.778 -12.619 1.00 . A A .  60 ARG HB3  1 1 
        2  2837 1 1  60 ARG HD2  H  -1.071  -9.742 -12.949 1.00 . A A .  60 ARG HD2  1 1 
        2  2838 1 1  60 ARG HD3  H  -1.712  -8.102 -13.061 1.00 . A A .  60 ARG HD3  1 1 
        2  2839 1 1  60 ARG HE   H  -0.236  -7.696 -11.011 1.00 . A A .  60 ARG HE   1 1 
        2  2840 1 1  60 ARG HG2  H  -2.589  -8.345 -10.749 1.00 . A A .  60 ARG HG2  1 1 
        2  2841 1 1  60 ARG HG3  H  -2.054 -10.027 -10.759 1.00 . A A .  60 ARG HG3  1 1 
        2  2842 1 1  60 ARG HH11 H   0.554  -9.969 -13.477 1.00 . A A .  60 ARG HH11 1 1 
        2  2843 1 1  60 ARG HH12 H   2.256  -9.756 -13.274 1.00 . A A .  60 ARG HH12 1 1 
        2  2844 1 1  60 ARG HH21 H   1.961  -7.433 -10.766 1.00 . A A .  60 ARG HH21 1 1 
        2  2845 1 1  60 ARG HH22 H   3.047  -8.316 -11.784 1.00 . A A .  60 ARG HH22 1 1 
        2  2846 1 1  60 ARG N    N  -4.981  -9.022 -10.025 1.00 . A A .  60 ARG N    1 1 
        2  2847 1 1  60 ARG NE   N  -0.115  -8.333 -11.742 1.00 . A A .  60 ARG NE   1 1 
        2  2848 1 1  60 ARG NH1  N   1.324  -9.521 -13.023 1.00 . A A .  60 ARG NH1  1 1 
        2  2849 1 1  60 ARG NH2  N   2.116  -8.090 -11.499 1.00 . A A .  60 ARG NH2  1 1 
        2  2850 1 1  60 ARG O    O  -4.183 -12.378 -11.179 1.00 . A A .  60 ARG O    1 1 
        2  2851 1 1  61 TYR C    C  -4.716 -12.782  -6.992 1.00 . A A .  61 TYR C    1 1 
        2  2852 1 1  61 TYR CA   C  -4.140 -12.768  -8.420 1.00 . A A .  61 TYR CA   1 1 
        2  2853 1 1  61 TYR CB   C  -2.617 -12.998  -8.384 1.00 . A A .  61 TYR CB   1 1 
        2  2854 1 1  61 TYR CD1  C  -1.413 -10.770  -8.335 1.00 . A A .  61 TYR CD1  1 1 
        2  2855 1 1  61 TYR CD2  C  -1.503 -12.038  -6.315 1.00 . A A .  61 TYR CD2  1 1 
        2  2856 1 1  61 TYR CE1  C  -0.694  -9.784  -7.689 1.00 . A A .  61 TYR CE1  1 1 
        2  2857 1 1  61 TYR CE2  C  -0.783 -11.054  -5.661 1.00 . A A .  61 TYR CE2  1 1 
        2  2858 1 1  61 TYR CG   C  -1.832 -11.913  -7.664 1.00 . A A .  61 TYR CG   1 1 
        2  2859 1 1  61 TYR CZ   C  -0.381  -9.930  -6.353 1.00 . A A .  61 TYR CZ   1 1 
        2  2860 1 1  61 TYR H    H  -4.688 -10.722  -8.590 1.00 . A A .  61 TYR H    1 1 
        2  2861 1 1  61 TYR HA   H  -4.599 -13.572  -8.977 1.00 . A A .  61 TYR HA   1 1 
        2  2862 1 1  61 TYR HB2  H  -2.416 -13.936  -7.887 1.00 . A A .  61 TYR HB2  1 1 
        2  2863 1 1  61 TYR HB3  H  -2.249 -13.056  -9.400 1.00 . A A .  61 TYR HB3  1 1 
        2  2864 1 1  61 TYR HD1  H  -1.657 -10.656  -9.382 1.00 . A A .  61 TYR HD1  1 1 
        2  2865 1 1  61 TYR HD2  H  -1.820 -12.921  -5.776 1.00 . A A .  61 TYR HD2  1 1 
        2  2866 1 1  61 TYR HE1  H  -0.378  -8.904  -8.230 1.00 . A A .  61 TYR HE1  1 1 
        2  2867 1 1  61 TYR HE2  H  -0.538 -11.172  -4.616 1.00 . A A .  61 TYR HE2  1 1 
        2  2868 1 1  61 TYR HH   H   1.068  -9.340  -5.229 1.00 . A A .  61 TYR HH   1 1 
        2  2869 1 1  61 TYR N    N  -4.458 -11.513  -9.118 1.00 . A A .  61 TYR N    1 1 
        2  2870 1 1  61 TYR O    O  -5.127 -11.744  -6.464 1.00 . A A .  61 TYR O    1 1 
        2  2871 1 1  61 TYR OH   O   0.334  -8.945  -5.709 1.00 . A A .  61 TYR OH   1 1 
        2  2872 1 1  62 VAL C    C  -4.133 -13.922  -3.967 1.00 . A A .  62 VAL C    1 1 
        2  2873 1 1  62 VAL CA   C  -5.250 -14.119  -5.007 1.00 . A A .  62 VAL CA   1 1 
        2  2874 1 1  62 VAL CB   C  -5.907 -15.508  -4.798 1.00 . A A .  62 VAL CB   1 1 
        2  2875 1 1  62 VAL CG1  C  -7.133 -15.668  -5.697 1.00 . A A .  62 VAL CG1  1 1 
        2  2876 1 1  62 VAL CG2  C  -4.901 -16.633  -5.051 1.00 . A A .  62 VAL CG2  1 1 
        2  2877 1 1  62 VAL H    H  -4.440 -14.759  -6.864 1.00 . A A .  62 VAL H    1 1 
        2  2878 1 1  62 VAL HA   H  -6.008 -13.362  -4.843 1.00 . A A .  62 VAL HA   1 1 
        2  2879 1 1  62 VAL HB   H  -6.236 -15.575  -3.769 1.00 . A A .  62 VAL HB   1 1 
        2  2880 1 1  62 VAL HG11 H  -6.836 -15.589  -6.733 1.00 . A A .  62 VAL HG11 1 1 
        2  2881 1 1  62 VAL HG12 H  -7.850 -14.892  -5.470 1.00 . A A .  62 VAL HG12 1 1 
        2  2882 1 1  62 VAL HG13 H  -7.584 -16.634  -5.524 1.00 . A A .  62 VAL HG13 1 1 
        2  2883 1 1  62 VAL HG21 H  -4.079 -16.548  -4.352 1.00 . A A .  62 VAL HG21 1 1 
        2  2884 1 1  62 VAL HG22 H  -4.523 -16.561  -6.062 1.00 . A A .  62 VAL HG22 1 1 
        2  2885 1 1  62 VAL HG23 H  -5.386 -17.590  -4.918 1.00 . A A .  62 VAL HG23 1 1 
        2  2886 1 1  62 VAL N    N  -4.751 -13.963  -6.379 1.00 . A A .  62 VAL N    1 1 
        2  2887 1 1  62 VAL O    O  -2.985 -14.326  -4.180 1.00 . A A .  62 VAL O    1 1 
        2  2888 1 1  63 LEU C    C  -3.753 -13.910  -0.544 1.00 . A A .  63 LEU C    1 1 
        2  2889 1 1  63 LEU CA   C  -3.516 -13.011  -1.776 1.00 . A A .  63 LEU CA   1 1 
        2  2890 1 1  63 LEU CB   C  -3.619 -11.527  -1.385 1.00 . A A .  63 LEU CB   1 1 
        2  2891 1 1  63 LEU CD1  C  -1.144 -11.051  -1.373 1.00 . A A .  63 LEU CD1  1 1 
        2  2892 1 1  63 LEU CD2  C  -2.713  -9.539  -0.127 1.00 . A A .  63 LEU CD2  1 1 
        2  2893 1 1  63 LEU CG   C  -2.439 -10.975  -0.568 1.00 . A A .  63 LEU CG   1 1 
        2  2894 1 1  63 LEU H    H  -5.418 -13.053  -2.712 1.00 . A A .  63 LEU H    1 1 
        2  2895 1 1  63 LEU HA   H  -2.524 -13.204  -2.162 1.00 . A A .  63 LEU HA   1 1 
        2  2896 1 1  63 LEU HB2  H  -3.707 -10.943  -2.290 1.00 . A A .  63 LEU HB2  1 1 
        2  2897 1 1  63 LEU HB3  H  -4.521 -11.391  -0.805 1.00 . A A .  63 LEU HB3  1 1 
        2  2898 1 1  63 LEU HD11 H  -0.936 -12.080  -1.629 1.00 . A A .  63 LEU HD11 1 1 
        2  2899 1 1  63 LEU HD12 H  -0.329 -10.657  -0.784 1.00 . A A .  63 LEU HD12 1 1 
        2  2900 1 1  63 LEU HD13 H  -1.244 -10.469  -2.278 1.00 . A A .  63 LEU HD13 1 1 
        2  2901 1 1  63 LEU HD21 H  -1.878  -9.172   0.453 1.00 . A A .  63 LEU HD21 1 1 
        2  2902 1 1  63 LEU HD22 H  -3.609  -9.514   0.479 1.00 . A A .  63 LEU HD22 1 1 
        2  2903 1 1  63 LEU HD23 H  -2.851  -8.912  -0.996 1.00 . A A .  63 LEU HD23 1 1 
        2  2904 1 1  63 LEU HG   H  -2.312 -11.579   0.319 1.00 . A A .  63 LEU HG   1 1 
        2  2905 1 1  63 LEU N    N  -4.482 -13.309  -2.840 1.00 . A A .  63 LEU N    1 1 
        2  2906 1 1  63 LEU O    O  -4.852 -13.945   0.019 1.00 . A A .  63 LEU O    1 1 
        2  2907 1 1  64 LYS C    C  -3.060 -14.871   2.345 1.00 . A A .  64 LYS C    1 1 
        2  2908 1 1  64 LYS CA   C  -2.809 -15.575   0.997 1.00 . A A .  64 LYS CA   1 1 
        2  2909 1 1  64 LYS CB   C  -1.527 -16.417   1.078 1.00 . A A .  64 LYS CB   1 1 
        2  2910 1 1  64 LYS CD   C   0.091 -17.955  -0.110 1.00 . A A .  64 LYS CD   1 1 
        2  2911 1 1  64 LYS CE   C   0.377 -18.749  -1.381 1.00 . A A .  64 LYS CE   1 1 
        2  2912 1 1  64 LYS CG   C  -1.243 -17.220  -0.188 1.00 . A A .  64 LYS CG   1 1 
        2  2913 1 1  64 LYS H    H  -1.854 -14.528  -0.591 1.00 . A A .  64 LYS H    1 1 
        2  2914 1 1  64 LYS HA   H  -3.641 -16.235   0.796 1.00 . A A .  64 LYS HA   1 1 
        2  2915 1 1  64 LYS HB2  H  -0.687 -15.760   1.261 1.00 . A A .  64 LYS HB2  1 1 
        2  2916 1 1  64 LYS HB3  H  -1.615 -17.111   1.904 1.00 . A A .  64 LYS HB3  1 1 
        2  2917 1 1  64 LYS HD2  H   0.882 -17.233   0.035 1.00 . A A .  64 LYS HD2  1 1 
        2  2918 1 1  64 LYS HD3  H   0.067 -18.636   0.731 1.00 . A A .  64 LYS HD3  1 1 
        2  2919 1 1  64 LYS HE2  H   1.320 -19.262  -1.268 1.00 . A A .  64 LYS HE2  1 1 
        2  2920 1 1  64 LYS HE3  H  -0.411 -19.478  -1.521 1.00 . A A .  64 LYS HE3  1 1 
        2  2921 1 1  64 LYS HG2  H  -2.034 -17.944  -0.325 1.00 . A A .  64 LYS HG2  1 1 
        2  2922 1 1  64 LYS HG3  H  -1.224 -16.545  -1.034 1.00 . A A .  64 LYS HG3  1 1 
        2  2923 1 1  64 LYS HZ1  H   0.633 -18.458  -3.433 1.00 . A A .  64 LYS HZ1  1 1 
        2  2924 1 1  64 LYS HZ2  H   1.213 -17.185  -2.484 1.00 . A A .  64 LYS HZ2  1 1 
        2  2925 1 1  64 LYS HZ3  H  -0.450 -17.372  -2.722 1.00 . A A .  64 LYS HZ3  1 1 
        2  2926 1 1  64 LYS N    N  -2.712 -14.629  -0.127 1.00 . A A .  64 LYS N    1 1 
        2  2927 1 1  64 LYS NZ   N   0.448 -17.880  -2.587 1.00 . A A .  64 LYS NZ   1 1 
        2  2928 1 1  64 LYS O    O  -2.879 -13.657   2.478 1.00 . A A .  64 LYS O    1 1 
        2  2929 1 1  65 ALA C    C  -2.456 -14.668   5.392 1.00 . A A .  65 ALA C    1 1 
        2  2930 1 1  65 ALA CA   C  -3.746 -15.111   4.685 1.00 . A A .  65 ALA CA   1 1 
        2  2931 1 1  65 ALA CB   C  -4.484 -16.150   5.522 1.00 . A A .  65 ALA CB   1 1 
        2  2932 1 1  65 ALA H    H  -3.574 -16.611   3.190 1.00 . A A .  65 ALA H    1 1 
        2  2933 1 1  65 ALA HA   H  -4.394 -14.254   4.569 1.00 . A A .  65 ALA HA   1 1 
        2  2934 1 1  65 ALA HB1  H  -3.855 -17.019   5.660 1.00 . A A .  65 ALA HB1  1 1 
        2  2935 1 1  65 ALA HB2  H  -5.392 -16.442   5.016 1.00 . A A .  65 ALA HB2  1 1 
        2  2936 1 1  65 ALA HB3  H  -4.731 -15.728   6.486 1.00 . A A .  65 ALA HB3  1 1 
        2  2937 1 1  65 ALA N    N  -3.467 -15.648   3.347 1.00 . A A .  65 ALA N    1 1 
        2  2938 1 1  65 ALA O    O  -1.515 -15.447   5.543 1.00 . A A .  65 ALA O    1 1 
        2  2939 1 1  66 GLY C    C  -0.105 -12.541   5.496 1.00 . A A .  66 GLY C    1 1 
        2  2940 1 1  66 GLY CA   C  -1.232 -12.862   6.473 1.00 . A A .  66 GLY CA   1 1 
        2  2941 1 1  66 GLY H    H  -3.207 -12.839   5.698 1.00 . A A .  66 GLY H    1 1 
        2  2942 1 1  66 GLY HA2  H  -1.510 -11.954   6.990 1.00 . A A .  66 GLY HA2  1 1 
        2  2943 1 1  66 GLY HA3  H  -0.872 -13.577   7.200 1.00 . A A .  66 GLY HA3  1 1 
        2  2944 1 1  66 GLY N    N  -2.419 -13.407   5.821 1.00 . A A .  66 GLY N    1 1 
        2  2945 1 1  66 GLY O    O   1.003 -12.193   5.909 1.00 . A A .  66 GLY O    1 1 
        2  2946 1 1  67 GLN C    C   0.973 -10.912   3.051 1.00 . A A .  67 GLN C    1 1 
        2  2947 1 1  67 GLN CA   C   0.622 -12.405   3.161 1.00 . A A .  67 GLN CA   1 1 
        2  2948 1 1  67 GLN CB   C   0.126 -12.929   1.804 1.00 . A A .  67 GLN CB   1 1 
        2  2949 1 1  67 GLN CD   C   2.420 -13.585   0.913 1.00 . A A .  67 GLN CD   1 1 
        2  2950 1 1  67 GLN CG   C   1.145 -12.793   0.672 1.00 . A A .  67 GLN CG   1 1 
        2  2951 1 1  67 GLN H    H  -1.300 -12.895   3.928 1.00 . A A .  67 GLN H    1 1 
        2  2952 1 1  67 GLN HA   H   1.512 -12.951   3.440 1.00 . A A .  67 GLN HA   1 1 
        2  2953 1 1  67 GLN HB2  H  -0.127 -13.976   1.908 1.00 . A A .  67 GLN HB2  1 1 
        2  2954 1 1  67 GLN HB3  H  -0.765 -12.381   1.525 1.00 . A A .  67 GLN HB3  1 1 
        2  2955 1 1  67 GLN HE21 H   1.431 -14.978   1.912 1.00 . A A .  67 GLN HE21 1 1 
        2  2956 1 1  67 GLN HE22 H   3.130 -15.220   1.765 1.00 . A A .  67 GLN HE22 1 1 
        2  2957 1 1  67 GLN HG2  H   0.696 -13.142  -0.247 1.00 . A A .  67 GLN HG2  1 1 
        2  2958 1 1  67 GLN HG3  H   1.405 -11.749   0.564 1.00 . A A .  67 GLN HG3  1 1 
        2  2959 1 1  67 GLN N    N  -0.387 -12.647   4.197 1.00 . A A .  67 GLN N    1 1 
        2  2960 1 1  67 GLN NE2  N   2.313 -14.707   1.597 1.00 . A A .  67 GLN NE2  1 1 
        2  2961 1 1  67 GLN O    O   0.088 -10.053   2.999 1.00 . A A .  67 GLN O    1 1 
        2  2962 1 1  67 GLN OE1  O   3.495 -13.195   0.477 1.00 . A A .  67 GLN OE1  1 1 
        2  2963 1 1  68 THR C    C   3.001  -8.817   1.456 1.00 . A A .  68 THR C    1 1 
        2  2964 1 1  68 THR CA   C   2.763  -9.237   2.912 1.00 . A A .  68 THR CA   1 1 
        2  2965 1 1  68 THR CB   C   4.084  -9.058   3.703 1.00 . A A .  68 THR CB   1 1 
        2  2966 1 1  68 THR CG2  C   3.851  -9.208   5.204 1.00 . A A .  68 THR CG2  1 1 
        2  2967 1 1  68 THR H    H   2.923 -11.347   3.054 1.00 . A A .  68 THR H    1 1 
        2  2968 1 1  68 THR HA   H   2.019  -8.582   3.346 1.00 . A A .  68 THR HA   1 1 
        2  2969 1 1  68 THR HB   H   4.469  -8.065   3.512 1.00 . A A .  68 THR HB   1 1 
        2  2970 1 1  68 THR HG1  H   5.196  -9.939   2.314 1.00 . A A .  68 THR HG1  1 1 
        2  2971 1 1  68 THR HG21 H   3.158  -8.450   5.540 1.00 . A A .  68 THR HG21 1 1 
        2  2972 1 1  68 THR HG22 H   4.790  -9.092   5.729 1.00 . A A .  68 THR HG22 1 1 
        2  2973 1 1  68 THR HG23 H   3.441 -10.186   5.412 1.00 . A A .  68 THR HG23 1 1 
        2  2974 1 1  68 THR N    N   2.271 -10.617   3.011 1.00 . A A .  68 THR N    1 1 
        2  2975 1 1  68 THR O    O   4.024  -9.158   0.858 1.00 . A A .  68 THR O    1 1 
        2  2976 1 1  68 THR OG1  O   5.059 -10.023   3.270 1.00 . A A .  68 THR OG1  1 1 
        2  2977 1 1  69 VAL C    C   2.740  -6.121  -0.443 1.00 . A A .  69 VAL C    1 1 
        2  2978 1 1  69 VAL CA   C   2.184  -7.555  -0.475 1.00 . A A .  69 VAL CA   1 1 
        2  2979 1 1  69 VAL CB   C   0.836  -7.594  -1.247 1.00 . A A .  69 VAL CB   1 1 
        2  2980 1 1  69 VAL CG1  C  -0.262  -6.834  -0.497 1.00 . A A .  69 VAL CG1  1 1 
        2  2981 1 1  69 VAL CG2  C   1.007  -7.045  -2.664 1.00 . A A .  69 VAL CG2  1 1 
        2  2982 1 1  69 VAL H    H   1.232  -7.889   1.393 1.00 . A A .  69 VAL H    1 1 
        2  2983 1 1  69 VAL HA   H   2.890  -8.185  -1.004 1.00 . A A .  69 VAL HA   1 1 
        2  2984 1 1  69 VAL HB   H   0.525  -8.628  -1.327 1.00 . A A .  69 VAL HB   1 1 
        2  2985 1 1  69 VAL HG11 H   0.029  -5.799  -0.381 1.00 . A A .  69 VAL HG11 1 1 
        2  2986 1 1  69 VAL HG12 H  -0.408  -7.276   0.477 1.00 . A A .  69 VAL HG12 1 1 
        2  2987 1 1  69 VAL HG13 H  -1.184  -6.886  -1.057 1.00 . A A .  69 VAL HG13 1 1 
        2  2988 1 1  69 VAL HG21 H   0.068  -7.120  -3.193 1.00 . A A .  69 VAL HG21 1 1 
        2  2989 1 1  69 VAL HG22 H   1.760  -7.617  -3.185 1.00 . A A .  69 VAL HG22 1 1 
        2  2990 1 1  69 VAL HG23 H   1.309  -6.008  -2.618 1.00 . A A .  69 VAL HG23 1 1 
        2  2991 1 1  69 VAL N    N   2.046  -8.086   0.884 1.00 . A A .  69 VAL N    1 1 
        2  2992 1 1  69 VAL O    O   2.096  -5.194   0.054 1.00 . A A .  69 VAL O    1 1 
        2  2993 1 1  70 THR C    C   4.532  -3.857  -2.180 1.00 . A A .  70 THR C    1 1 
        2  2994 1 1  70 THR CA   C   4.644  -4.652  -0.875 1.00 . A A .  70 THR CA   1 1 
        2  2995 1 1  70 THR CB   C   6.140  -4.846  -0.538 1.00 . A A .  70 THR CB   1 1 
        2  2996 1 1  70 THR CG2  C   6.821  -3.516  -0.240 1.00 . A A .  70 THR CG2  1 1 
        2  2997 1 1  70 THR H    H   4.400  -6.698  -1.405 1.00 . A A .  70 THR H    1 1 
        2  2998 1 1  70 THR HA   H   4.190  -4.079  -0.077 1.00 . A A .  70 THR HA   1 1 
        2  2999 1 1  70 THR HB   H   6.631  -5.303  -1.387 1.00 . A A .  70 THR HB   1 1 
        2  3000 1 1  70 THR HG1  H   6.477  -6.608   0.283 1.00 . A A .  70 THR HG1  1 1 
        2  3001 1 1  70 THR HG21 H   6.344  -3.047   0.609 1.00 . A A .  70 THR HG21 1 1 
        2  3002 1 1  70 THR HG22 H   6.743  -2.866  -1.100 1.00 . A A .  70 THR HG22 1 1 
        2  3003 1 1  70 THR HG23 H   7.864  -3.687  -0.013 1.00 . A A .  70 THR HG23 1 1 
        2  3004 1 1  70 THR N    N   3.952  -5.944  -0.957 1.00 . A A .  70 THR N    1 1 
        2  3005 1 1  70 THR O    O   4.764  -4.388  -3.268 1.00 . A A .  70 THR O    1 1 
        2  3006 1 1  70 THR OG1  O   6.278  -5.714   0.594 1.00 . A A .  70 THR OG1  1 1 
        2  3007 1 1  71 ILE C    C   5.407  -0.911  -3.407 1.00 . A A .  71 ILE C    1 1 
        2  3008 1 1  71 ILE CA   C   4.089  -1.682  -3.214 1.00 . A A .  71 ILE CA   1 1 
        2  3009 1 1  71 ILE CB   C   2.919  -0.675  -3.057 1.00 . A A .  71 ILE CB   1 1 
        2  3010 1 1  71 ILE CD1  C   1.205  -2.401  -3.863 1.00 . A A .  71 ILE CD1  1 1 
        2  3011 1 1  71 ILE CG1  C   1.601  -1.418  -2.780 1.00 . A A .  71 ILE CG1  1 1 
        2  3012 1 1  71 ILE CG2  C   2.790   0.201  -4.302 1.00 . A A .  71 ILE CG2  1 1 
        2  3013 1 1  71 ILE H    H   3.938  -2.238  -1.175 1.00 . A A .  71 ILE H    1 1 
        2  3014 1 1  71 ILE HA   H   3.903  -2.284  -4.093 1.00 . A A .  71 ILE HA   1 1 
        2  3015 1 1  71 ILE HB   H   3.141  -0.030  -2.217 1.00 . A A .  71 ILE HB   1 1 
        2  3016 1 1  71 ILE HD11 H   1.089  -1.878  -4.801 1.00 . A A .  71 ILE HD11 1 1 
        2  3017 1 1  71 ILE HD12 H   0.271  -2.871  -3.596 1.00 . A A .  71 ILE HD12 1 1 
        2  3018 1 1  71 ILE HD13 H   1.971  -3.156  -3.964 1.00 . A A .  71 ILE HD13 1 1 
        2  3019 1 1  71 ILE HG12 H   1.693  -1.970  -1.856 1.00 . A A .  71 ILE HG12 1 1 
        2  3020 1 1  71 ILE HG13 H   0.803  -0.695  -2.681 1.00 . A A .  71 ILE HG13 1 1 
        2  3021 1 1  71 ILE HG21 H   3.712   0.745  -4.458 1.00 . A A .  71 ILE HG21 1 1 
        2  3022 1 1  71 ILE HG22 H   1.980   0.903  -4.168 1.00 . A A .  71 ILE HG22 1 1 
        2  3023 1 1  71 ILE HG23 H   2.589  -0.420  -5.162 1.00 . A A .  71 ILE HG23 1 1 
        2  3024 1 1  71 ILE N    N   4.170  -2.583  -2.060 1.00 . A A .  71 ILE N    1 1 
        2  3025 1 1  71 ILE O    O   5.672   0.072  -2.715 1.00 . A A .  71 ILE O    1 1 
        2  3026 1 1  72 TRP C    C   7.430   0.339  -5.676 1.00 . A A .  72 TRP C    1 1 
        2  3027 1 1  72 TRP CA   C   7.543  -0.758  -4.604 1.00 . A A .  72 TRP CA   1 1 
        2  3028 1 1  72 TRP CB   C   8.545  -1.827  -5.074 1.00 . A A .  72 TRP CB   1 1 
        2  3029 1 1  72 TRP CD1  C   7.953  -4.016  -3.864 1.00 . A A .  72 TRP CD1  1 1 
        2  3030 1 1  72 TRP CD2  C   9.888  -3.103  -3.207 1.00 . A A .  72 TRP CD2  1 1 
        2  3031 1 1  72 TRP CE2  C   9.679  -4.288  -2.475 1.00 . A A .  72 TRP CE2  1 1 
        2  3032 1 1  72 TRP CE3  C  11.045  -2.357  -2.965 1.00 . A A .  72 TRP CE3  1 1 
        2  3033 1 1  72 TRP CG   C   8.769  -2.944  -4.088 1.00 . A A .  72 TRP CG   1 1 
        2  3034 1 1  72 TRP CH2  C  11.708  -3.996  -1.304 1.00 . A A .  72 TRP CH2  1 1 
        2  3035 1 1  72 TRP CZ2  C  10.584  -4.744  -1.519 1.00 . A A .  72 TRP CZ2  1 1 
        2  3036 1 1  72 TRP CZ3  C  11.943  -2.812  -2.015 1.00 . A A .  72 TRP CZ3  1 1 
        2  3037 1 1  72 TRP H    H   5.958  -2.153  -4.871 1.00 . A A .  72 TRP H    1 1 
        2  3038 1 1  72 TRP HA   H   7.903  -0.316  -3.685 1.00 . A A .  72 TRP HA   1 1 
        2  3039 1 1  72 TRP HB2  H   8.183  -2.267  -5.992 1.00 . A A .  72 TRP HB2  1 1 
        2  3040 1 1  72 TRP HB3  H   9.499  -1.355  -5.263 1.00 . A A .  72 TRP HB3  1 1 
        2  3041 1 1  72 TRP HD1  H   7.018  -4.188  -4.377 1.00 . A A .  72 TRP HD1  1 1 
        2  3042 1 1  72 TRP HE1  H   8.092  -5.657  -2.554 1.00 . A A .  72 TRP HE1  1 1 
        2  3043 1 1  72 TRP HE3  H  11.243  -1.443  -3.506 1.00 . A A .  72 TRP HE3  1 1 
        2  3044 1 1  72 TRP HH2  H  12.436  -4.312  -0.571 1.00 . A A .  72 TRP HH2  1 1 
        2  3045 1 1  72 TRP HZ2  H  10.418  -5.656  -0.963 1.00 . A A .  72 TRP HZ2  1 1 
        2  3046 1 1  72 TRP HZ3  H  12.842  -2.249  -1.815 1.00 . A A .  72 TRP HZ3  1 1 
        2  3047 1 1  72 TRP N    N   6.235  -1.376  -4.339 1.00 . A A .  72 TRP N    1 1 
        2  3048 1 1  72 TRP NE1  N   8.493  -4.826  -2.892 1.00 . A A .  72 TRP NE1  1 1 
        2  3049 1 1  72 TRP O    O   7.018   0.067  -6.796 1.00 . A A .  72 TRP O    1 1 
        2  3050 1 1  73 ALA C    C   8.557   2.384  -7.571 1.00 . A A .  73 ALA C    1 1 
        2  3051 1 1  73 ALA CA   C   7.746   2.688  -6.297 1.00 . A A .  73 ALA CA   1 1 
        2  3052 1 1  73 ALA CB   C   8.254   3.968  -5.644 1.00 . A A .  73 ALA CB   1 1 
        2  3053 1 1  73 ALA H    H   8.089   1.746  -4.418 1.00 . A A .  73 ALA H    1 1 
        2  3054 1 1  73 ALA HA   H   6.711   2.842  -6.572 1.00 . A A .  73 ALA HA   1 1 
        2  3055 1 1  73 ALA HB1  H   7.668   4.179  -4.761 1.00 . A A .  73 ALA HB1  1 1 
        2  3056 1 1  73 ALA HB2  H   8.163   4.791  -6.341 1.00 . A A .  73 ALA HB2  1 1 
        2  3057 1 1  73 ALA HB3  H   9.291   3.846  -5.366 1.00 . A A .  73 ALA HB3  1 1 
        2  3058 1 1  73 ALA N    N   7.792   1.573  -5.335 1.00 . A A .  73 ALA N    1 1 
        2  3059 1 1  73 ALA O    O   9.512   1.606  -7.538 1.00 . A A .  73 ALA O    1 1 
        2  3060 1 1  74 ALA C    C  10.349   2.710  -9.916 1.00 . A A .  74 ALA C    1 1 
        2  3061 1 1  74 ALA CA   C   8.810   2.770  -9.994 1.00 . A A .  74 ALA CA   1 1 
        2  3062 1 1  74 ALA CB   C   8.378   3.844 -10.989 1.00 . A A .  74 ALA CB   1 1 
        2  3063 1 1  74 ALA H    H   7.435   3.662  -8.634 1.00 . A A .  74 ALA H    1 1 
        2  3064 1 1  74 ALA HA   H   8.444   1.818 -10.358 1.00 . A A .  74 ALA HA   1 1 
        2  3065 1 1  74 ALA HB1  H   8.738   4.808 -10.659 1.00 . A A .  74 ALA HB1  1 1 
        2  3066 1 1  74 ALA HB2  H   7.300   3.866 -11.052 1.00 . A A .  74 ALA HB2  1 1 
        2  3067 1 1  74 ALA HB3  H   8.789   3.622 -11.964 1.00 . A A .  74 ALA HB3  1 1 
        2  3068 1 1  74 ALA N    N   8.177   3.016  -8.686 1.00 . A A .  74 ALA N    1 1 
        2  3069 1 1  74 ALA O    O  10.978   1.852 -10.530 1.00 . A A .  74 ALA O    1 1 
        2  3070 1 1  75 ASN C    C  12.912   2.895  -7.790 1.00 . A A .  75 ASN C    1 1 
        2  3071 1 1  75 ASN CA   C  12.413   3.686  -9.017 1.00 . A A .  75 ASN CA   1 1 
        2  3072 1 1  75 ASN CB   C  12.871   5.152  -8.939 1.00 . A A .  75 ASN CB   1 1 
        2  3073 1 1  75 ASN CG   C  12.814   5.872 -10.283 1.00 . A A .  75 ASN CG   1 1 
        2  3074 1 1  75 ASN H    H  10.397   4.263  -8.661 1.00 . A A .  75 ASN H    1 1 
        2  3075 1 1  75 ASN HA   H  12.844   3.238  -9.903 1.00 . A A .  75 ASN HA   1 1 
        2  3076 1 1  75 ASN HB2  H  12.236   5.683  -8.243 1.00 . A A .  75 ASN HB2  1 1 
        2  3077 1 1  75 ASN HB3  H  13.890   5.184  -8.580 1.00 . A A .  75 ASN HB3  1 1 
        2  3078 1 1  75 ASN HD21 H  11.370   4.682 -10.940 1.00 . A A .  75 ASN HD21 1 1 
        2  3079 1 1  75 ASN HD22 H  11.902   5.898 -12.040 1.00 . A A .  75 ASN HD22 1 1 
        2  3080 1 1  75 ASN N    N  10.949   3.623  -9.154 1.00 . A A .  75 ASN N    1 1 
        2  3081 1 1  75 ASN ND2  N  11.939   5.438 -11.172 1.00 . A A .  75 ASN ND2  1 1 
        2  3082 1 1  75 ASN O    O  13.786   3.352  -7.050 1.00 . A A .  75 ASN O    1 1 
        2  3083 1 1  75 ASN OD1  O  13.563   6.810 -10.529 1.00 . A A .  75 ASN OD1  1 1 
        2  3084 1 1  76 ALA C    C  13.836  -0.222  -7.021 1.00 . A A .  76 ALA C    1 1 
        2  3085 1 1  76 ALA CA   C  12.817   0.809  -6.509 1.00 . A A .  76 ALA CA   1 1 
        2  3086 1 1  76 ALA CB   C  11.631   0.104  -5.864 1.00 . A A .  76 ALA CB   1 1 
        2  3087 1 1  76 ALA H    H  11.613   1.414  -8.156 1.00 . A A .  76 ALA H    1 1 
        2  3088 1 1  76 ALA HA   H  13.294   1.418  -5.752 1.00 . A A .  76 ALA HA   1 1 
        2  3089 1 1  76 ALA HB1  H  10.917   0.837  -5.518 1.00 . A A .  76 ALA HB1  1 1 
        2  3090 1 1  76 ALA HB2  H  11.974  -0.487  -5.026 1.00 . A A .  76 ALA HB2  1 1 
        2  3091 1 1  76 ALA HB3  H  11.157  -0.543  -6.590 1.00 . A A .  76 ALA HB3  1 1 
        2  3092 1 1  76 ALA N    N  12.358   1.699  -7.584 1.00 . A A .  76 ALA N    1 1 
        2  3093 1 1  76 ALA O    O  14.384  -1.006  -6.245 1.00 . A A .  76 ALA O    1 1 
        2  3094 1 1  77 GLY C    C  14.446  -2.497  -9.313 1.00 . A A .  77 GLY C    1 1 
        2  3095 1 1  77 GLY CA   C  15.048  -1.147  -8.923 1.00 . A A .  77 GLY CA   1 1 
        2  3096 1 1  77 GLY H    H  13.602   0.408  -8.909 1.00 . A A .  77 GLY H    1 1 
        2  3097 1 1  77 GLY HA2  H  15.463  -0.687  -9.808 1.00 . A A .  77 GLY HA2  1 1 
        2  3098 1 1  77 GLY HA3  H  15.847  -1.315  -8.215 1.00 . A A .  77 GLY HA3  1 1 
        2  3099 1 1  77 GLY N    N  14.080  -0.225  -8.332 1.00 . A A .  77 GLY N    1 1 
        2  3100 1 1  77 GLY O    O  14.635  -2.968 -10.437 1.00 . A A .  77 GLY O    1 1 
        2  3101 1 1  78 VAL C    C  12.171  -4.414  -9.856 1.00 . A A .  78 VAL C    1 1 
        2  3102 1 1  78 VAL CA   C  13.083  -4.425  -8.610 1.00 . A A .  78 VAL CA   1 1 
        2  3103 1 1  78 VAL CB   C  12.251  -4.858  -7.371 1.00 . A A .  78 VAL CB   1 1 
        2  3104 1 1  78 VAL CG1  C  11.630  -6.241  -7.573 1.00 . A A .  78 VAL CG1  1 1 
        2  3105 1 1  78 VAL CG2  C  13.113  -4.829  -6.106 1.00 . A A .  78 VAL CG2  1 1 
        2  3106 1 1  78 VAL H    H  13.609  -2.682  -7.510 1.00 . A A .  78 VAL H    1 1 
        2  3107 1 1  78 VAL HA   H  13.868  -5.153  -8.761 1.00 . A A .  78 VAL HA   1 1 
        2  3108 1 1  78 VAL HB   H  11.446  -4.148  -7.242 1.00 . A A .  78 VAL HB   1 1 
        2  3109 1 1  78 VAL HG11 H  12.411  -6.963  -7.760 1.00 . A A .  78 VAL HG11 1 1 
        2  3110 1 1  78 VAL HG12 H  10.955  -6.214  -8.418 1.00 . A A .  78 VAL HG12 1 1 
        2  3111 1 1  78 VAL HG13 H  11.083  -6.525  -6.687 1.00 . A A .  78 VAL HG13 1 1 
        2  3112 1 1  78 VAL HG21 H  12.517  -5.124  -5.254 1.00 . A A .  78 VAL HG21 1 1 
        2  3113 1 1  78 VAL HG22 H  13.492  -3.829  -5.949 1.00 . A A .  78 VAL HG22 1 1 
        2  3114 1 1  78 VAL HG23 H  13.942  -5.513  -6.218 1.00 . A A .  78 VAL HG23 1 1 
        2  3115 1 1  78 VAL N    N  13.720  -3.117  -8.381 1.00 . A A .  78 VAL N    1 1 
        2  3116 1 1  78 VAL O    O  11.559  -3.394 -10.178 1.00 . A A .  78 VAL O    1 1 
        2  3117 1 1  79 THR C    C   9.787  -5.309 -11.450 1.00 . A A .  79 THR C    1 1 
        2  3118 1 1  79 THR CA   C  11.247  -5.680 -11.754 1.00 . A A .  79 THR CA   1 1 
        2  3119 1 1  79 THR CB   C  11.296  -7.118 -12.335 1.00 . A A .  79 THR CB   1 1 
        2  3120 1 1  79 THR CG2  C  10.351  -7.278 -13.522 1.00 . A A .  79 THR CG2  1 1 
        2  3121 1 1  79 THR H    H  12.640  -6.317 -10.276 1.00 . A A .  79 THR H    1 1 
        2  3122 1 1  79 THR HA   H  11.627  -5.000 -12.505 1.00 . A A .  79 THR HA   1 1 
        2  3123 1 1  79 THR HB   H  10.998  -7.814 -11.561 1.00 . A A .  79 THR HB   1 1 
        2  3124 1 1  79 THR HG1  H  13.055  -7.996 -12.089 1.00 . A A .  79 THR HG1  1 1 
        2  3125 1 1  79 THR HG21 H   9.338  -7.078 -13.207 1.00 . A A .  79 THR HG21 1 1 
        2  3126 1 1  79 THR HG22 H  10.417  -8.287 -13.903 1.00 . A A .  79 THR HG22 1 1 
        2  3127 1 1  79 THR HG23 H  10.629  -6.582 -14.300 1.00 . A A .  79 THR HG23 1 1 
        2  3128 1 1  79 THR N    N  12.101  -5.549 -10.560 1.00 . A A .  79 THR N    1 1 
        2  3129 1 1  79 THR O    O   9.205  -5.785 -10.474 1.00 . A A .  79 THR O    1 1 
        2  3130 1 1  79 THR OG1  O  12.633  -7.434 -12.753 1.00 . A A .  79 THR OG1  1 1 
        2  3131 1 1  80 ALA C    C   6.785  -5.024 -11.869 1.00 . A A .  80 ALA C    1 1 
        2  3132 1 1  80 ALA CA   C   7.847  -3.936 -12.105 1.00 . A A .  80 ALA CA   1 1 
        2  3133 1 1  80 ALA CB   C   7.446  -3.057 -13.285 1.00 . A A .  80 ALA CB   1 1 
        2  3134 1 1  80 ALA H    H   9.697  -4.204 -13.115 1.00 . A A .  80 ALA H    1 1 
        2  3135 1 1  80 ALA HA   H   7.886  -3.305 -11.230 1.00 . A A .  80 ALA HA   1 1 
        2  3136 1 1  80 ALA HB1  H   6.484  -2.605 -13.089 1.00 . A A .  80 ALA HB1  1 1 
        2  3137 1 1  80 ALA HB2  H   7.385  -3.657 -14.180 1.00 . A A .  80 ALA HB2  1 1 
        2  3138 1 1  80 ALA HB3  H   8.185  -2.280 -13.423 1.00 . A A .  80 ALA HB3  1 1 
        2  3139 1 1  80 ALA N    N   9.200  -4.476 -12.313 1.00 . A A .  80 ALA N    1 1 
        2  3140 1 1  80 ALA O    O   5.752  -4.769 -11.244 1.00 . A A .  80 ALA O    1 1 
        2  3141 1 1  81 SER C    C   6.841  -8.614 -11.709 1.00 . A A .  81 SER C    1 1 
        2  3142 1 1  81 SER CA   C   6.099  -7.349 -12.172 1.00 . A A .  81 SER CA   1 1 
        2  3143 1 1  81 SER CB   C   5.318  -7.624 -13.469 1.00 . A A .  81 SER CB   1 1 
        2  3144 1 1  81 SER H    H   7.866  -6.380 -12.859 1.00 . A A .  81 SER H    1 1 
        2  3145 1 1  81 SER HA   H   5.398  -7.065 -11.400 1.00 . A A .  81 SER HA   1 1 
        2  3146 1 1  81 SER HB2  H   4.949  -6.690 -13.866 1.00 . A A .  81 SER HB2  1 1 
        2  3147 1 1  81 SER HB3  H   5.977  -8.083 -14.193 1.00 . A A .  81 SER HB3  1 1 
        2  3148 1 1  81 SER HG   H   3.554  -8.342 -13.940 1.00 . A A .  81 SER HG   1 1 
        2  3149 1 1  81 SER N    N   7.035  -6.233 -12.363 1.00 . A A .  81 SER N    1 1 
        2  3150 1 1  81 SER O    O   7.211  -9.463 -12.522 1.00 . A A .  81 SER O    1 1 
        2  3151 1 1  81 SER OG   O   4.210  -8.487 -13.245 1.00 . A A .  81 SER OG   1 1 
        2  3152 1 1  82 PRO C    C   7.220 -11.277 -10.132 1.00 . A A .  82 PRO C    1 1 
        2  3153 1 1  82 PRO CA   C   7.827  -9.883  -9.797 1.00 . A A .  82 PRO CA   1 1 
        2  3154 1 1  82 PRO CB   C   7.785  -9.598  -8.287 1.00 . A A .  82 PRO CB   1 1 
        2  3155 1 1  82 PRO CD   C   6.805  -7.700  -9.367 1.00 . A A .  82 PRO CD   1 1 
        2  3156 1 1  82 PRO CG   C   7.651  -8.116  -8.189 1.00 . A A .  82 PRO CG   1 1 
        2  3157 1 1  82 PRO HA   H   8.860  -9.884 -10.118 1.00 . A A .  82 PRO HA   1 1 
        2  3158 1 1  82 PRO HB2  H   6.939 -10.104  -7.841 1.00 . A A .  82 PRO HB2  1 1 
        2  3159 1 1  82 PRO HB3  H   8.700  -9.943  -7.826 1.00 . A A .  82 PRO HB3  1 1 
        2  3160 1 1  82 PRO HD2  H   5.755  -7.724  -9.108 1.00 . A A .  82 PRO HD2  1 1 
        2  3161 1 1  82 PRO HD3  H   7.088  -6.715  -9.708 1.00 . A A .  82 PRO HD3  1 1 
        2  3162 1 1  82 PRO HG2  H   7.161  -7.850  -7.261 1.00 . A A .  82 PRO HG2  1 1 
        2  3163 1 1  82 PRO HG3  H   8.626  -7.651  -8.244 1.00 . A A .  82 PRO HG3  1 1 
        2  3164 1 1  82 PRO N    N   7.116  -8.725 -10.387 1.00 . A A .  82 PRO N    1 1 
        2  3165 1 1  82 PRO O    O   7.964 -12.177 -10.525 1.00 . A A .  82 PRO O    1 1 
        2  3166 1 1  83 PRO C    C   4.392 -10.764  -8.095 1.00 . A A .  83 PRO C    1 1 
        2  3167 1 1  83 PRO CA   C   4.873 -10.546  -9.550 1.00 . A A .  83 PRO CA   1 1 
        2  3168 1 1  83 PRO CB   C   3.741 -10.842 -10.535 1.00 . A A .  83 PRO CB   1 1 
        2  3169 1 1  83 PRO CD   C   5.220 -12.768 -10.387 1.00 . A A .  83 PRO CD   1 1 
        2  3170 1 1  83 PRO CG   C   3.811 -12.328 -10.754 1.00 . A A .  83 PRO CG   1 1 
        2  3171 1 1  83 PRO HA   H   5.201  -9.526  -9.673 1.00 . A A .  83 PRO HA   1 1 
        2  3172 1 1  83 PRO HB2  H   2.793 -10.544 -10.105 1.00 . A A .  83 PRO HB2  1 1 
        2  3173 1 1  83 PRO HB3  H   3.909 -10.299 -11.455 1.00 . A A .  83 PRO HB3  1 1 
        2  3174 1 1  83 PRO HD2  H   5.198 -13.457  -9.553 1.00 . A A .  83 PRO HD2  1 1 
        2  3175 1 1  83 PRO HD3  H   5.710 -13.221 -11.237 1.00 . A A .  83 PRO HD3  1 1 
        2  3176 1 1  83 PRO HG2  H   3.090 -12.824 -10.121 1.00 . A A .  83 PRO HG2  1 1 
        2  3177 1 1  83 PRO HG3  H   3.608 -12.554 -11.793 1.00 . A A .  83 PRO HG3  1 1 
        2  3178 1 1  83 PRO N    N   5.881 -11.508 -10.008 1.00 . A A .  83 PRO N    1 1 
        2  3179 1 1  83 PRO O    O   3.274 -10.379  -7.755 1.00 . A A .  83 PRO O    1 1 
        2  3180 1 1  84 THR C    C   4.555 -10.237  -5.124 1.00 . A A .  84 THR C    1 1 
        2  3181 1 1  84 THR CA   C   4.874 -11.573  -5.820 1.00 . A A .  84 THR CA   1 1 
        2  3182 1 1  84 THR CB   C   5.997 -12.303  -5.031 1.00 . A A .  84 THR CB   1 1 
        2  3183 1 1  84 THR CG2  C   7.322 -11.547  -5.111 1.00 . A A .  84 THR CG2  1 1 
        2  3184 1 1  84 THR H    H   6.078 -11.732  -7.579 1.00 . A A .  84 THR H    1 1 
        2  3185 1 1  84 THR HA   H   3.987 -12.193  -5.788 1.00 . A A .  84 THR HA   1 1 
        2  3186 1 1  84 THR HB   H   6.137 -13.281  -5.470 1.00 . A A .  84 THR HB   1 1 
        2  3187 1 1  84 THR HG1  H   5.424 -11.606  -3.260 1.00 . A A .  84 THR HG1  1 1 
        2  3188 1 1  84 THR HG21 H   7.613 -11.434  -6.146 1.00 . A A .  84 THR HG21 1 1 
        2  3189 1 1  84 THR HG22 H   8.084 -12.098  -4.581 1.00 . A A .  84 THR HG22 1 1 
        2  3190 1 1  84 THR HG23 H   7.209 -10.571  -4.663 1.00 . A A .  84 THR HG23 1 1 
        2  3191 1 1  84 THR N    N   5.225 -11.379  -7.244 1.00 . A A .  84 THR N    1 1 
        2  3192 1 1  84 THR O    O   3.709 -10.175  -4.232 1.00 . A A .  84 THR O    1 1 
        2  3193 1 1  84 THR OG1  O   5.620 -12.471  -3.650 1.00 . A A .  84 THR OG1  1 1 
        2  3194 1 1  85 ASP C    C   4.434  -6.954  -6.235 1.00 . A A .  85 ASP C    1 1 
        2  3195 1 1  85 ASP CA   C   4.955  -7.814  -5.069 1.00 . A A .  85 ASP CA   1 1 
        2  3196 1 1  85 ASP CB   C   6.209  -7.174  -4.459 1.00 . A A .  85 ASP CB   1 1 
        2  3197 1 1  85 ASP CG   C   6.685  -7.892  -3.206 1.00 . A A .  85 ASP CG   1 1 
        2  3198 1 1  85 ASP H    H   5.982  -9.310  -6.163 1.00 . A A .  85 ASP H    1 1 
        2  3199 1 1  85 ASP HA   H   4.184  -7.875  -4.313 1.00 . A A .  85 ASP HA   1 1 
        2  3200 1 1  85 ASP HB2  H   7.005  -7.194  -5.190 1.00 . A A .  85 ASP HB2  1 1 
        2  3201 1 1  85 ASP HB3  H   5.992  -6.145  -4.203 1.00 . A A .  85 ASP HB3  1 1 
        2  3202 1 1  85 ASP N    N   5.250  -9.177  -5.532 1.00 . A A .  85 ASP N    1 1 
        2  3203 1 1  85 ASP O    O   4.444  -7.387  -7.389 1.00 . A A .  85 ASP O    1 1 
        2  3204 1 1  85 ASP OD1  O   6.098  -7.670  -2.126 1.00 . A A .  85 ASP OD1  1 1 
        2  3205 1 1  85 ASP OD2  O   7.659  -8.670  -3.286 1.00 . A A .  85 ASP OD2  1 1 
        2  3206 1 1  86 LEU C    C   4.236  -3.508  -7.008 1.00 . A A .  86 LEU C    1 1 
        2  3207 1 1  86 LEU CA   C   3.459  -4.831  -6.974 1.00 . A A .  86 LEU CA   1 1 
        2  3208 1 1  86 LEU CB   C   1.968  -4.553  -6.729 1.00 . A A .  86 LEU CB   1 1 
        2  3209 1 1  86 LEU CD1  C  -0.396  -5.395  -6.464 1.00 . A A .  86 LEU CD1  1 1 
        2  3210 1 1  86 LEU CD2  C   1.125  -6.455  -8.165 1.00 . A A .  86 LEU CD2  1 1 
        2  3211 1 1  86 LEU CG   C   1.045  -5.783  -6.793 1.00 . A A .  86 LEU CG   1 1 
        2  3212 1 1  86 LEU H    H   4.018  -5.425  -5.008 1.00 . A A .  86 LEU H    1 1 
        2  3213 1 1  86 LEU HA   H   3.570  -5.322  -7.933 1.00 . A A .  86 LEU HA   1 1 
        2  3214 1 1  86 LEU HB2  H   1.868  -4.106  -5.750 1.00 . A A .  86 LEU HB2  1 1 
        2  3215 1 1  86 LEU HB3  H   1.630  -3.838  -7.468 1.00 . A A .  86 LEU HB3  1 1 
        2  3216 1 1  86 LEU HD11 H  -1.024  -6.272  -6.513 1.00 . A A .  86 LEU HD11 1 1 
        2  3217 1 1  86 LEU HD12 H  -0.747  -4.661  -7.176 1.00 . A A .  86 LEU HD12 1 1 
        2  3218 1 1  86 LEU HD13 H  -0.438  -4.979  -5.467 1.00 . A A .  86 LEU HD13 1 1 
        2  3219 1 1  86 LEU HD21 H   2.144  -6.759  -8.360 1.00 . A A .  86 LEU HD21 1 1 
        2  3220 1 1  86 LEU HD22 H   0.805  -5.761  -8.930 1.00 . A A .  86 LEU HD22 1 1 
        2  3221 1 1  86 LEU HD23 H   0.485  -7.324  -8.180 1.00 . A A .  86 LEU HD23 1 1 
        2  3222 1 1  86 LEU HG   H   1.370  -6.502  -6.053 1.00 . A A .  86 LEU HG   1 1 
        2  3223 1 1  86 LEU N    N   3.988  -5.733  -5.940 1.00 . A A .  86 LEU N    1 1 
        2  3224 1 1  86 LEU O    O   4.380  -2.835  -5.990 1.00 . A A .  86 LEU O    1 1 
        2  3225 1 1  87 ILE C    C   4.591  -0.707  -8.738 1.00 . A A .  87 ILE C    1 1 
        2  3226 1 1  87 ILE CA   C   5.496  -1.890  -8.335 1.00 . A A .  87 ILE CA   1 1 
        2  3227 1 1  87 ILE CB   C   6.665  -2.053  -9.354 1.00 . A A .  87 ILE CB   1 1 
        2  3228 1 1  87 ILE CD1  C   7.550  -4.184  -8.209 1.00 . A A .  87 ILE CD1  1 1 
        2  3229 1 1  87 ILE CG1  C   7.861  -2.785  -8.706 1.00 . A A .  87 ILE CG1  1 1 
        2  3230 1 1  87 ILE CG2  C   7.117  -0.700  -9.909 1.00 . A A .  87 ILE CG2  1 1 
        2  3231 1 1  87 ILE H    H   4.604  -3.713  -8.963 1.00 . A A .  87 ILE H    1 1 
        2  3232 1 1  87 ILE HA   H   5.935  -1.664  -7.370 1.00 . A A .  87 ILE HA   1 1 
        2  3233 1 1  87 ILE HB   H   6.302  -2.645 -10.183 1.00 . A A .  87 ILE HB   1 1 
        2  3234 1 1  87 ILE HD11 H   8.441  -4.620  -7.783 1.00 . A A .  87 ILE HD11 1 1 
        2  3235 1 1  87 ILE HD12 H   7.209  -4.795  -9.033 1.00 . A A .  87 ILE HD12 1 1 
        2  3236 1 1  87 ILE HD13 H   6.779  -4.134  -7.454 1.00 . A A .  87 ILE HD13 1 1 
        2  3237 1 1  87 ILE HG12 H   8.659  -2.869  -9.431 1.00 . A A .  87 ILE HG12 1 1 
        2  3238 1 1  87 ILE HG13 H   8.212  -2.205  -7.863 1.00 . A A .  87 ILE HG13 1 1 
        2  3239 1 1  87 ILE HG21 H   7.932  -0.848 -10.604 1.00 . A A .  87 ILE HG21 1 1 
        2  3240 1 1  87 ILE HG22 H   7.448  -0.070  -9.096 1.00 . A A .  87 ILE HG22 1 1 
        2  3241 1 1  87 ILE HG23 H   6.292  -0.224 -10.418 1.00 . A A .  87 ILE HG23 1 1 
        2  3242 1 1  87 ILE N    N   4.737  -3.137  -8.182 1.00 . A A .  87 ILE N    1 1 
        2  3243 1 1  87 ILE O    O   3.865  -0.761  -9.736 1.00 . A A .  87 ILE O    1 1 
        2  3244 1 1  88 TRP C    C   4.487   2.376  -9.361 1.00 . A A .  88 TRP C    1 1 
        2  3245 1 1  88 TRP CA   C   3.875   1.578  -8.195 1.00 . A A .  88 TRP CA   1 1 
        2  3246 1 1  88 TRP CB   C   3.828   2.431  -6.913 1.00 . A A .  88 TRP CB   1 1 
        2  3247 1 1  88 TRP CD1  C   1.837   3.767  -7.852 1.00 . A A .  88 TRP CD1  1 1 
        2  3248 1 1  88 TRP CD2  C   2.670   4.569  -5.937 1.00 . A A .  88 TRP CD2  1 1 
        2  3249 1 1  88 TRP CE2  C   1.595   5.384  -6.333 1.00 . A A .  88 TRP CE2  1 1 
        2  3250 1 1  88 TRP CE3  C   3.351   4.878  -4.753 1.00 . A A .  88 TRP CE3  1 1 
        2  3251 1 1  88 TRP CG   C   2.814   3.541  -6.925 1.00 . A A .  88 TRP CG   1 1 
        2  3252 1 1  88 TRP CH2  C   1.864   6.767  -4.441 1.00 . A A .  88 TRP CH2  1 1 
        2  3253 1 1  88 TRP CZ2  C   1.184   6.488  -5.593 1.00 . A A .  88 TRP CZ2  1 1 
        2  3254 1 1  88 TRP CZ3  C   2.939   5.975  -4.019 1.00 . A A .  88 TRP CZ3  1 1 
        2  3255 1 1  88 TRP H    H   5.233   0.329  -7.159 1.00 . A A .  88 TRP H    1 1 
        2  3256 1 1  88 TRP HA   H   2.868   1.286  -8.461 1.00 . A A .  88 TRP HA   1 1 
        2  3257 1 1  88 TRP HB2  H   3.597   1.790  -6.078 1.00 . A A .  88 TRP HB2  1 1 
        2  3258 1 1  88 TRP HB3  H   4.803   2.874  -6.752 1.00 . A A .  88 TRP HB3  1 1 
        2  3259 1 1  88 TRP HD1  H   1.678   3.158  -8.730 1.00 . A A .  88 TRP HD1  1 1 
        2  3260 1 1  88 TRP HE1  H   0.349   5.245  -8.015 1.00 . A A .  88 TRP HE1  1 1 
        2  3261 1 1  88 TRP HE3  H   4.184   4.277  -4.412 1.00 . A A .  88 TRP HE3  1 1 
        2  3262 1 1  88 TRP HH2  H   1.576   7.615  -3.836 1.00 . A A .  88 TRP HH2  1 1 
        2  3263 1 1  88 TRP HZ2  H   0.356   7.108  -5.903 1.00 . A A .  88 TRP HZ2  1 1 
        2  3264 1 1  88 TRP HZ3  H   3.452   6.230  -3.102 1.00 . A A .  88 TRP HZ3  1 1 
        2  3265 1 1  88 TRP N    N   4.648   0.361  -7.943 1.00 . A A .  88 TRP N    1 1 
        2  3266 1 1  88 TRP NE1  N   1.104   4.876  -7.506 1.00 . A A .  88 TRP NE1  1 1 
        2  3267 1 1  88 TRP O    O   5.232   3.334  -9.158 1.00 . A A .  88 TRP O    1 1 
        2  3268 1 1  89 LYS C    C   4.154   4.039 -11.966 1.00 . A A .  89 LYS C    1 1 
        2  3269 1 1  89 LYS CA   C   4.713   2.611 -11.792 1.00 . A A .  89 LYS CA   1 1 
        2  3270 1 1  89 LYS CB   C   4.391   1.758 -13.031 1.00 . A A .  89 LYS CB   1 1 
        2  3271 1 1  89 LYS CD   C   4.517  -0.525 -14.140 1.00 . A A .  89 LYS CD   1 1 
        2  3272 1 1  89 LYS CE   C   4.989  -0.015 -15.501 1.00 . A A .  89 LYS CE   1 1 
        2  3273 1 1  89 LYS CG   C   4.999   0.356 -12.986 1.00 . A A .  89 LYS CG   1 1 
        2  3274 1 1  89 LYS H    H   3.601   1.171 -10.684 1.00 . A A .  89 LYS H    1 1 
        2  3275 1 1  89 LYS HA   H   5.786   2.673 -11.684 1.00 . A A .  89 LYS HA   1 1 
        2  3276 1 1  89 LYS HB2  H   3.318   1.660 -13.117 1.00 . A A .  89 LYS HB2  1 1 
        2  3277 1 1  89 LYS HB3  H   4.768   2.263 -13.911 1.00 . A A .  89 LYS HB3  1 1 
        2  3278 1 1  89 LYS HD2  H   4.897  -1.526 -13.996 1.00 . A A .  89 LYS HD2  1 1 
        2  3279 1 1  89 LYS HD3  H   3.435  -0.549 -14.133 1.00 . A A .  89 LYS HD3  1 1 
        2  3280 1 1  89 LYS HE2  H   4.508  -0.594 -16.275 1.00 . A A .  89 LYS HE2  1 1 
        2  3281 1 1  89 LYS HE3  H   4.704   1.022 -15.603 1.00 . A A .  89 LYS HE3  1 1 
        2  3282 1 1  89 LYS HG2  H   6.075   0.442 -13.037 1.00 . A A .  89 LYS HG2  1 1 
        2  3283 1 1  89 LYS HG3  H   4.722  -0.110 -12.051 1.00 . A A .  89 LYS HG3  1 1 
        2  3284 1 1  89 LYS HZ1  H   6.766  -1.114 -15.526 1.00 . A A .  89 LYS HZ1  1 1 
        2  3285 1 1  89 LYS HZ2  H   6.956   0.476 -14.985 1.00 . A A .  89 LYS HZ2  1 1 
        2  3286 1 1  89 LYS HZ3  H   6.739   0.166 -16.629 1.00 . A A .  89 LYS HZ3  1 1 
        2  3287 1 1  89 LYS N    N   4.183   1.955 -10.585 1.00 . A A .  89 LYS N    1 1 
        2  3288 1 1  89 LYS NZ   N   6.463  -0.129 -15.669 1.00 . A A .  89 LYS NZ   1 1 
        2  3289 1 1  89 LYS O    O   4.702   4.844 -12.724 1.00 . A A .  89 LYS O    1 1 
        2  3290 1 1  90 ASN C    C   3.246   6.748 -10.591 1.00 . A A .  90 ASN C    1 1 
        2  3291 1 1  90 ASN CA   C   2.427   5.671 -11.328 1.00 . A A .  90 ASN CA   1 1 
        2  3292 1 1  90 ASN CB   C   1.014   5.600 -10.736 1.00 . A A .  90 ASN CB   1 1 
        2  3293 1 1  90 ASN CG   C   0.184   4.483 -11.345 1.00 . A A .  90 ASN CG   1 1 
        2  3294 1 1  90 ASN H    H   2.679   3.667 -10.667 1.00 . A A .  90 ASN H    1 1 
        2  3295 1 1  90 ASN HA   H   2.355   5.948 -12.371 1.00 . A A .  90 ASN HA   1 1 
        2  3296 1 1  90 ASN HB2  H   1.083   5.430  -9.670 1.00 . A A .  90 ASN HB2  1 1 
        2  3297 1 1  90 ASN HB3  H   0.508   6.539 -10.911 1.00 . A A .  90 ASN HB3  1 1 
        2  3298 1 1  90 ASN HD21 H  -0.566   5.718 -12.700 1.00 . A A .  90 ASN HD21 1 1 
        2  3299 1 1  90 ASN HD22 H  -1.114   4.081 -12.780 1.00 . A A .  90 ASN HD22 1 1 
        2  3300 1 1  90 ASN N    N   3.068   4.347 -11.253 1.00 . A A .  90 ASN N    1 1 
        2  3301 1 1  90 ASN ND2  N  -0.574   4.791 -12.377 1.00 . A A .  90 ASN ND2  1 1 
        2  3302 1 1  90 ASN O    O   2.978   7.945 -10.728 1.00 . A A .  90 ASN O    1 1 
        2  3303 1 1  90 ASN OD1  O   0.221   3.348 -10.885 1.00 . A A .  90 ASN OD1  1 1 
        2  3304 1 1  91 GLN C    C   6.524   6.703  -8.898 1.00 . A A .  91 GLN C    1 1 
        2  3305 1 1  91 GLN CA   C   5.097   7.256  -9.069 1.00 . A A .  91 GLN CA   1 1 
        2  3306 1 1  91 GLN CB   C   4.501   7.563  -7.687 1.00 . A A .  91 GLN CB   1 1 
        2  3307 1 1  91 GLN CD   C   4.884   8.689  -5.445 1.00 . A A .  91 GLN CD   1 1 
        2  3308 1 1  91 GLN CG   C   5.274   8.626  -6.911 1.00 . A A .  91 GLN CG   1 1 
        2  3309 1 1  91 GLN H    H   4.398   5.359  -9.718 1.00 . A A .  91 GLN H    1 1 
        2  3310 1 1  91 GLN HA   H   5.150   8.175  -9.637 1.00 . A A .  91 GLN HA   1 1 
        2  3311 1 1  91 GLN HB2  H   3.485   7.910  -7.817 1.00 . A A .  91 GLN HB2  1 1 
        2  3312 1 1  91 GLN HB3  H   4.487   6.653  -7.102 1.00 . A A .  91 GLN HB3  1 1 
        2  3313 1 1  91 GLN HE21 H   6.293   7.376  -4.992 1.00 . A A .  91 GLN HE21 1 1 
        2  3314 1 1  91 GLN HE22 H   5.338   7.947  -3.673 1.00 . A A .  91 GLN HE22 1 1 
        2  3315 1 1  91 GLN HG2  H   6.330   8.406  -6.976 1.00 . A A .  91 GLN HG2  1 1 
        2  3316 1 1  91 GLN HG3  H   5.084   9.591  -7.361 1.00 . A A .  91 GLN HG3  1 1 
        2  3317 1 1  91 GLN N    N   4.238   6.322  -9.805 1.00 . A A .  91 GLN N    1 1 
        2  3318 1 1  91 GLN NE2  N   5.574   7.929  -4.620 1.00 . A A .  91 GLN NE2  1 1 
        2  3319 1 1  91 GLN O    O   6.720   5.512  -8.651 1.00 . A A .  91 GLN O    1 1 
        2  3320 1 1  91 GLN OE1  O   3.980   9.417  -5.053 1.00 . A A .  91 GLN OE1  1 1 
        2  3321 1 1  92 ASN C    C   9.236   7.209  -7.273 1.00 . A A .  92 ASN C    1 1 
        2  3322 1 1  92 ASN CA   C   8.920   7.197  -8.786 1.00 . A A .  92 ASN CA   1 1 
        2  3323 1 1  92 ASN CB   C   9.869   8.141  -9.542 1.00 . A A .  92 ASN CB   1 1 
        2  3324 1 1  92 ASN CG   C   9.804   7.981 -11.056 1.00 . A A .  92 ASN CG   1 1 
        2  3325 1 1  92 ASN H    H   7.316   8.499  -9.302 1.00 . A A .  92 ASN H    1 1 
        2  3326 1 1  92 ASN HA   H   9.058   6.190  -9.158 1.00 . A A .  92 ASN HA   1 1 
        2  3327 1 1  92 ASN HB2  H   9.615   9.163  -9.301 1.00 . A A .  92 ASN HB2  1 1 
        2  3328 1 1  92 ASN HB3  H  10.884   7.946  -9.223 1.00 . A A .  92 ASN HB3  1 1 
        2  3329 1 1  92 ASN HD21 H   7.860   7.591 -11.005 1.00 . A A .  92 ASN HD21 1 1 
        2  3330 1 1  92 ASN HD22 H   8.589   7.597 -12.568 1.00 . A A .  92 ASN HD22 1 1 
        2  3331 1 1  92 ASN N    N   7.522   7.576  -9.033 1.00 . A A .  92 ASN N    1 1 
        2  3332 1 1  92 ASN ND2  N   8.635   7.692 -11.593 1.00 . A A .  92 ASN ND2  1 1 
        2  3333 1 1  92 ASN O    O   8.334   7.347  -6.444 1.00 . A A .  92 ASN O    1 1 
        2  3334 1 1  92 ASN OD1  O  10.804   8.134 -11.747 1.00 . A A .  92 ASN OD1  1 1 
        2  3335 1 1  93 SER C    C  10.846   8.466  -4.903 1.00 . A A .  93 SER C    1 1 
        2  3336 1 1  93 SER CA   C  10.912   7.049  -5.491 1.00 . A A .  93 SER CA   1 1 
        2  3337 1 1  93 SER CB   C  12.326   6.470  -5.312 1.00 . A A .  93 SER CB   1 1 
        2  3338 1 1  93 SER H    H  11.203   6.965  -7.602 1.00 . A A .  93 SER H    1 1 
        2  3339 1 1  93 SER HA   H  10.208   6.422  -4.956 1.00 . A A .  93 SER HA   1 1 
        2  3340 1 1  93 SER HB2  H  12.551   6.393  -4.258 1.00 . A A .  93 SER HB2  1 1 
        2  3341 1 1  93 SER HB3  H  12.365   5.486  -5.758 1.00 . A A .  93 SER HB3  1 1 
        2  3342 1 1  93 SER HG   H  12.889   8.037  -6.362 1.00 . A A .  93 SER HG   1 1 
        2  3343 1 1  93 SER N    N  10.513   7.055  -6.911 1.00 . A A .  93 SER N    1 1 
        2  3344 1 1  93 SER O    O  11.397   9.411  -5.474 1.00 . A A .  93 SER O    1 1 
        2  3345 1 1  93 SER OG   O  13.314   7.284  -5.928 1.00 . A A .  93 SER OG   1 1 
        2  3346 1 1  94 TRP C    C  11.047  10.353  -2.206 1.00 . A A .  94 TRP C    1 1 
        2  3347 1 1  94 TRP CA   C   9.932   9.930  -3.174 1.00 . A A .  94 TRP CA   1 1 
        2  3348 1 1  94 TRP CB   C   8.565   9.957  -2.465 1.00 . A A .  94 TRP CB   1 1 
        2  3349 1 1  94 TRP CD1  C   8.747   9.235  -0.002 1.00 . A A .  94 TRP CD1  1 1 
        2  3350 1 1  94 TRP CD2  C   7.924   7.656  -1.360 1.00 . A A .  94 TRP CD2  1 1 
        2  3351 1 1  94 TRP CE2  C   7.971   7.144  -0.049 1.00 . A A .  94 TRP CE2  1 1 
        2  3352 1 1  94 TRP CE3  C   7.440   6.838  -2.383 1.00 . A A .  94 TRP CE3  1 1 
        2  3353 1 1  94 TRP CG   C   8.431   8.997  -1.311 1.00 . A A .  94 TRP CG   1 1 
        2  3354 1 1  94 TRP CH2  C   7.081   5.076  -0.758 1.00 . A A .  94 TRP CH2  1 1 
        2  3355 1 1  94 TRP CZ2  C   7.551   5.855   0.263 1.00 . A A .  94 TRP CZ2  1 1 
        2  3356 1 1  94 TRP CZ3  C   7.024   5.557  -2.072 1.00 . A A .  94 TRP CZ3  1 1 
        2  3357 1 1  94 TRP H    H   9.858   7.810  -3.292 1.00 . A A .  94 TRP H    1 1 
        2  3358 1 1  94 TRP HA   H   9.904  10.643  -3.986 1.00 . A A .  94 TRP HA   1 1 
        2  3359 1 1  94 TRP HB2  H   8.387  10.953  -2.084 1.00 . A A .  94 TRP HB2  1 1 
        2  3360 1 1  94 TRP HB3  H   7.794   9.719  -3.185 1.00 . A A .  94 TRP HB3  1 1 
        2  3361 1 1  94 TRP HD1  H   9.154  10.166   0.366 1.00 . A A .  94 TRP HD1  1 1 
        2  3362 1 1  94 TRP HE1  H   8.622   8.046   1.726 1.00 . A A .  94 TRP HE1  1 1 
        2  3363 1 1  94 TRP HE3  H   7.390   7.191  -3.405 1.00 . A A .  94 TRP HE3  1 1 
        2  3364 1 1  94 TRP HH2  H   6.747   4.069  -0.561 1.00 . A A .  94 TRP HH2  1 1 
        2  3365 1 1  94 TRP HZ2  H   7.589   5.471   1.270 1.00 . A A .  94 TRP HZ2  1 1 
        2  3366 1 1  94 TRP HZ3  H   6.647   4.908  -2.851 1.00 . A A .  94 TRP HZ3  1 1 
        2  3367 1 1  94 TRP N    N  10.179   8.609  -3.760 1.00 . A A .  94 TRP N    1 1 
        2  3368 1 1  94 TRP NE1  N   8.475   8.126   0.759 1.00 . A A .  94 TRP NE1  1 1 
        2  3369 1 1  94 TRP O    O  11.591   9.537  -1.463 1.00 . A A .  94 TRP O    1 1 
        2  3370 1 1  95 GLY C    C  11.781  13.056  -0.222 1.00 . A A .  95 GLY C    1 1 
        2  3371 1 1  95 GLY CA   C  12.387  12.181  -1.316 1.00 . A A .  95 GLY CA   1 1 
        2  3372 1 1  95 GLY H    H  10.945  12.235  -2.872 1.00 . A A .  95 GLY H    1 1 
        2  3373 1 1  95 GLY HA2  H  12.924  11.365  -0.852 1.00 . A A .  95 GLY HA2  1 1 
        2  3374 1 1  95 GLY HA3  H  13.086  12.774  -1.888 1.00 . A A .  95 GLY HA3  1 1 
        2  3375 1 1  95 GLY N    N  11.381  11.640  -2.225 1.00 . A A .  95 GLY N    1 1 
        2  3376 1 1  95 GLY O    O  12.457  13.918   0.343 1.00 . A A .  95 GLY O    1 1 
        2  3377 1 1  96 THR C    C  10.113  13.163   2.519 1.00 . A A .  96 THR C    1 1 
        2  3378 1 1  96 THR CA   C   9.789  13.623   1.094 1.00 . A A .  96 THR CA   1 1 
        2  3379 1 1  96 THR CB   C   8.256  13.548   0.900 1.00 . A A .  96 THR CB   1 1 
        2  3380 1 1  96 THR CG2  C   7.838  14.182  -0.420 1.00 . A A .  96 THR CG2  1 1 
        2  3381 1 1  96 THR H    H  10.024  12.123  -0.393 1.00 . A A .  96 THR H    1 1 
        2  3382 1 1  96 THR HA   H  10.092  14.657   0.981 1.00 . A A .  96 THR HA   1 1 
        2  3383 1 1  96 THR HB   H   7.779  14.091   1.706 1.00 . A A .  96 THR HB   1 1 
        2  3384 1 1  96 THR HG1  H   8.288  11.706   1.633 1.00 . A A .  96 THR HG1  1 1 
        2  3385 1 1  96 THR HG21 H   8.153  15.216  -0.441 1.00 . A A .  96 THR HG21 1 1 
        2  3386 1 1  96 THR HG22 H   6.763  14.132  -0.520 1.00 . A A .  96 THR HG22 1 1 
        2  3387 1 1  96 THR HG23 H   8.300  13.649  -1.239 1.00 . A A .  96 THR HG23 1 1 
        2  3388 1 1  96 THR N    N  10.503  12.834   0.079 1.00 . A A .  96 THR N    1 1 
        2  3389 1 1  96 THR O    O   9.993  11.980   2.844 1.00 . A A .  96 THR O    1 1 
        2  3390 1 1  96 THR OG1  O   7.813  12.179   0.935 1.00 . A A .  96 THR OG1  1 1 
        2  3391 1 1  97 GLY C    C   9.583  13.911   5.680 1.00 . A A .  97 GLY C    1 1 
        2  3392 1 1  97 GLY CA   C  10.802  13.802   4.766 1.00 . A A .  97 GLY CA   1 1 
        2  3393 1 1  97 GLY H    H  10.609  15.030   3.044 1.00 . A A .  97 GLY H    1 1 
        2  3394 1 1  97 GLY HA2  H  11.195  12.798   4.830 1.00 . A A .  97 GLY HA2  1 1 
        2  3395 1 1  97 GLY HA3  H  11.558  14.490   5.117 1.00 . A A .  97 GLY HA3  1 1 
        2  3396 1 1  97 GLY N    N  10.507  14.109   3.370 1.00 . A A .  97 GLY N    1 1 
        2  3397 1 1  97 GLY O    O   9.640  13.519   6.847 1.00 . A A .  97 GLY O    1 1 
        2  3398 1 1  98 GLU C    C   6.555  13.225   6.104 1.00 . A A .  98 GLU C    1 1 
        2  3399 1 1  98 GLU CA   C   7.242  14.588   5.923 1.00 . A A .  98 GLU CA   1 1 
        2  3400 1 1  98 GLU CB   C   6.275  15.553   5.220 1.00 . A A .  98 GLU CB   1 1 
        2  3401 1 1  98 GLU CD   C   7.488  17.619   6.062 1.00 . A A .  98 GLU CD   1 1 
        2  3402 1 1  98 GLU CG   C   6.884  16.903   4.864 1.00 . A A .  98 GLU CG   1 1 
        2  3403 1 1  98 GLU H    H   8.520  14.799   4.238 1.00 . A A .  98 GLU H    1 1 
        2  3404 1 1  98 GLU HA   H   7.489  14.987   6.897 1.00 . A A .  98 GLU HA   1 1 
        2  3405 1 1  98 GLU HB2  H   5.928  15.091   4.306 1.00 . A A .  98 GLU HB2  1 1 
        2  3406 1 1  98 GLU HB3  H   5.427  15.726   5.868 1.00 . A A .  98 GLU HB3  1 1 
        2  3407 1 1  98 GLU HG2  H   7.658  16.751   4.122 1.00 . A A .  98 GLU HG2  1 1 
        2  3408 1 1  98 GLU HG3  H   6.110  17.531   4.441 1.00 . A A .  98 GLU HG3  1 1 
        2  3409 1 1  98 GLU N    N   8.488  14.460   5.156 1.00 . A A .  98 GLU N    1 1 
        2  3410 1 1  98 GLU O    O   6.756  12.305   5.306 1.00 . A A .  98 GLU O    1 1 
        2  3411 1 1  98 GLU OE1  O   6.726  18.168   6.886 1.00 . A A .  98 GLU OE1  1 1 
        2  3412 1 1  98 GLU OE2  O   8.731  17.648   6.178 1.00 . A A .  98 GLU OE2  1 1 
        2  3413 1 1  99 ASP C    C   3.948  11.596   6.304 1.00 . A A .  99 ASP C    1 1 
        2  3414 1 1  99 ASP CA   C   5.005  11.852   7.393 1.00 . A A .  99 ASP CA   1 1 
        2  3415 1 1  99 ASP CB   C   4.370  11.863   8.795 1.00 . A A .  99 ASP CB   1 1 
        2  3416 1 1  99 ASP CG   C   3.462  13.060   9.030 1.00 . A A .  99 ASP CG   1 1 
        2  3417 1 1  99 ASP H    H   5.605  13.854   7.756 1.00 . A A .  99 ASP H    1 1 
        2  3418 1 1  99 ASP HA   H   5.729  11.049   7.353 1.00 . A A .  99 ASP HA   1 1 
        2  3419 1 1  99 ASP HB2  H   3.788  10.961   8.926 1.00 . A A .  99 ASP HB2  1 1 
        2  3420 1 1  99 ASP HB3  H   5.157  11.881   9.536 1.00 . A A .  99 ASP HB3  1 1 
        2  3421 1 1  99 ASP N    N   5.730  13.098   7.144 1.00 . A A .  99 ASP N    1 1 
        2  3422 1 1  99 ASP O    O   2.798  12.035   6.404 1.00 . A A .  99 ASP O    1 1 
        2  3423 1 1  99 ASP OD1  O   3.987  14.183   9.189 1.00 . A A .  99 ASP OD1  1 1 
        2  3424 1 1  99 ASP OD2  O   2.224  12.885   9.069 1.00 . A A .  99 ASP OD2  1 1 
        2  3425 1 1 100 VAL C    C   2.284   9.691   4.696 1.00 . A A . 100 VAL C    1 1 
        2  3426 1 1 100 VAL CA   C   3.447  10.540   4.157 1.00 . A A . 100 VAL CA   1 1 
        2  3427 1 1 100 VAL CB   C   4.179   9.792   3.008 1.00 . A A . 100 VAL CB   1 1 
        2  3428 1 1 100 VAL CG1  C   4.971   8.596   3.533 1.00 . A A . 100 VAL CG1  1 1 
        2  3429 1 1 100 VAL CG2  C   3.189   9.363   1.925 1.00 . A A . 100 VAL CG2  1 1 
        2  3430 1 1 100 VAL H    H   5.310  10.664   5.171 1.00 . A A . 100 VAL H    1 1 
        2  3431 1 1 100 VAL HA   H   3.041  11.458   3.750 1.00 . A A . 100 VAL HA   1 1 
        2  3432 1 1 100 VAL HB   H   4.883  10.479   2.559 1.00 . A A . 100 VAL HB   1 1 
        2  3433 1 1 100 VAL HG11 H   5.705   8.938   4.249 1.00 . A A . 100 VAL HG11 1 1 
        2  3434 1 1 100 VAL HG12 H   5.474   8.105   2.713 1.00 . A A . 100 VAL HG12 1 1 
        2  3435 1 1 100 VAL HG13 H   4.301   7.898   4.013 1.00 . A A . 100 VAL HG13 1 1 
        2  3436 1 1 100 VAL HG21 H   2.462   8.681   2.343 1.00 . A A . 100 VAL HG21 1 1 
        2  3437 1 1 100 VAL HG22 H   3.721   8.871   1.121 1.00 . A A . 100 VAL HG22 1 1 
        2  3438 1 1 100 VAL HG23 H   2.680  10.235   1.536 1.00 . A A . 100 VAL HG23 1 1 
        2  3439 1 1 100 VAL N    N   4.364  10.912   5.237 1.00 . A A . 100 VAL N    1 1 
        2  3440 1 1 100 VAL O    O   2.484   8.600   5.233 1.00 . A A . 100 VAL O    1 1 
        2  3441 1 1 101 LYS C    C  -0.932   8.848   4.073 1.00 . A A . 101 LYS C    1 1 
        2  3442 1 1 101 LYS CA   C  -0.108   9.573   5.151 1.00 . A A . 101 LYS CA   1 1 
        2  3443 1 1 101 LYS CB   C  -0.940  10.630   5.894 1.00 . A A . 101 LYS CB   1 1 
        2  3444 1 1 101 LYS CD   C  -2.454  11.114   7.879 1.00 . A A . 101 LYS CD   1 1 
        2  3445 1 1 101 LYS CE   C  -1.366  11.584   8.857 1.00 . A A . 101 LYS CE   1 1 
        2  3446 1 1 101 LYS CG   C  -1.948  10.056   6.887 1.00 . A A . 101 LYS CG   1 1 
        2  3447 1 1 101 LYS H    H   0.958  11.048   4.061 1.00 . A A . 101 LYS H    1 1 
        2  3448 1 1 101 LYS HA   H   0.237   8.841   5.868 1.00 . A A . 101 LYS HA   1 1 
        2  3449 1 1 101 LYS HB2  H  -0.266  11.277   6.438 1.00 . A A . 101 LYS HB2  1 1 
        2  3450 1 1 101 LYS HB3  H  -1.478  11.224   5.168 1.00 . A A . 101 LYS HB3  1 1 
        2  3451 1 1 101 LYS HD2  H  -2.813  11.970   7.323 1.00 . A A . 101 LYS HD2  1 1 
        2  3452 1 1 101 LYS HD3  H  -3.274  10.691   8.445 1.00 . A A . 101 LYS HD3  1 1 
        2  3453 1 1 101 LYS HE2  H  -1.840  12.114   9.672 1.00 . A A . 101 LYS HE2  1 1 
        2  3454 1 1 101 LYS HE3  H  -0.858  10.715   9.250 1.00 . A A . 101 LYS HE3  1 1 
        2  3455 1 1 101 LYS HG2  H  -2.792   9.662   6.339 1.00 . A A . 101 LYS HG2  1 1 
        2  3456 1 1 101 LYS HG3  H  -1.475   9.257   7.441 1.00 . A A . 101 LYS HG3  1 1 
        2  3457 1 1 101 LYS HZ1  H  -0.816  13.362   7.897 1.00 . A A . 101 LYS HZ1  1 1 
        2  3458 1 1 101 LYS HZ2  H   0.094  12.022   7.421 1.00 . A A . 101 LYS HZ2  1 1 
        2  3459 1 1 101 LYS HZ3  H   0.381  12.741   8.918 1.00 . A A . 101 LYS HZ3  1 1 
        2  3460 1 1 101 LYS N    N   1.069  10.213   4.566 1.00 . A A . 101 LYS N    1 1 
        2  3461 1 1 101 LYS NZ   N  -0.358  12.487   8.228 1.00 . A A . 101 LYS NZ   1 1 
        2  3462 1 1 101 LYS O    O  -1.705   9.461   3.333 1.00 . A A . 101 LYS O    1 1 
        2  3463 1 1 102 VAL C    C  -2.788   6.312   3.273 1.00 . A A . 102 VAL C    1 1 
        2  3464 1 1 102 VAL CA   C  -1.338   6.707   2.943 1.00 . A A . 102 VAL CA   1 1 
        2  3465 1 1 102 VAL CB   C  -0.493   5.430   2.723 1.00 . A A . 102 VAL CB   1 1 
        2  3466 1 1 102 VAL CG1  C  -1.113   4.539   1.653 1.00 . A A . 102 VAL CG1  1 1 
        2  3467 1 1 102 VAL CG2  C   0.946   5.794   2.360 1.00 . A A . 102 VAL CG2  1 1 
        2  3468 1 1 102 VAL H    H  -0.163   7.105   4.658 1.00 . A A . 102 VAL H    1 1 
        2  3469 1 1 102 VAL HA   H  -1.331   7.276   2.022 1.00 . A A . 102 VAL HA   1 1 
        2  3470 1 1 102 VAL HB   H  -0.473   4.874   3.653 1.00 . A A . 102 VAL HB   1 1 
        2  3471 1 1 102 VAL HG11 H  -2.106   4.240   1.964 1.00 . A A . 102 VAL HG11 1 1 
        2  3472 1 1 102 VAL HG12 H  -0.503   3.658   1.515 1.00 . A A . 102 VAL HG12 1 1 
        2  3473 1 1 102 VAL HG13 H  -1.177   5.083   0.722 1.00 . A A . 102 VAL HG13 1 1 
        2  3474 1 1 102 VAL HG21 H   1.525   4.890   2.222 1.00 . A A . 102 VAL HG21 1 1 
        2  3475 1 1 102 VAL HG22 H   1.380   6.382   3.155 1.00 . A A . 102 VAL HG22 1 1 
        2  3476 1 1 102 VAL HG23 H   0.953   6.367   1.444 1.00 . A A . 102 VAL HG23 1 1 
        2  3477 1 1 102 VAL N    N  -0.734   7.536   3.989 1.00 . A A . 102 VAL N    1 1 
        2  3478 1 1 102 VAL O    O  -3.088   5.864   4.383 1.00 . A A . 102 VAL O    1 1 
        2  3479 1 1 103 ILE C    C  -5.529   4.955   1.608 1.00 . A A . 103 ILE C    1 1 
        2  3480 1 1 103 ILE CA   C  -5.104   6.168   2.461 1.00 . A A . 103 ILE CA   1 1 
        2  3481 1 1 103 ILE CB   C  -5.973   7.385   2.049 1.00 . A A . 103 ILE CB   1 1 
        2  3482 1 1 103 ILE CD1  C  -5.557   8.596   4.272 1.00 . A A . 103 ILE CD1  1 1 
        2  3483 1 1 103 ILE CG1  C  -5.499   8.666   2.761 1.00 . A A . 103 ILE CG1  1 1 
        2  3484 1 1 103 ILE CG2  C  -7.446   7.117   2.339 1.00 . A A . 103 ILE CG2  1 1 
        2  3485 1 1 103 ILE H    H  -3.367   6.810   1.427 1.00 . A A . 103 ILE H    1 1 
        2  3486 1 1 103 ILE HA   H  -5.289   5.953   3.504 1.00 . A A . 103 ILE HA   1 1 
        2  3487 1 1 103 ILE HB   H  -5.866   7.523   0.980 1.00 . A A . 103 ILE HB   1 1 
        2  3488 1 1 103 ILE HD11 H  -6.579   8.451   4.588 1.00 . A A . 103 ILE HD11 1 1 
        2  3489 1 1 103 ILE HD12 H  -5.180   9.518   4.687 1.00 . A A . 103 ILE HD12 1 1 
        2  3490 1 1 103 ILE HD13 H  -4.951   7.772   4.620 1.00 . A A . 103 ILE HD13 1 1 
        2  3491 1 1 103 ILE HG12 H  -4.476   8.868   2.482 1.00 . A A . 103 ILE HG12 1 1 
        2  3492 1 1 103 ILE HG13 H  -6.118   9.493   2.445 1.00 . A A . 103 ILE HG13 1 1 
        2  3493 1 1 103 ILE HG21 H  -7.779   6.266   1.765 1.00 . A A . 103 ILE HG21 1 1 
        2  3494 1 1 103 ILE HG22 H  -8.032   7.984   2.067 1.00 . A A . 103 ILE HG22 1 1 
        2  3495 1 1 103 ILE HG23 H  -7.575   6.912   3.392 1.00 . A A . 103 ILE HG23 1 1 
        2  3496 1 1 103 ILE N    N  -3.677   6.471   2.293 1.00 . A A . 103 ILE N    1 1 
        2  3497 1 1 103 ILE O    O  -5.192   4.872   0.427 1.00 . A A . 103 ILE O    1 1 
        2  3498 1 1 104 LEU C    C  -8.340   2.932   1.368 1.00 . A A . 104 LEU C    1 1 
        2  3499 1 1 104 LEU CA   C  -6.809   2.861   1.477 1.00 . A A . 104 LEU CA   1 1 
        2  3500 1 1 104 LEU CB   C  -6.404   1.553   2.176 1.00 . A A . 104 LEU CB   1 1 
        2  3501 1 1 104 LEU CD1  C  -4.627  -0.048   2.962 1.00 . A A . 104 LEU CD1  1 1 
        2  3502 1 1 104 LEU CD2  C  -4.263   1.301   0.868 1.00 . A A . 104 LEU CD2  1 1 
        2  3503 1 1 104 LEU CG   C  -4.893   1.284   2.262 1.00 . A A . 104 LEU CG   1 1 
        2  3504 1 1 104 LEU H    H  -6.475   4.116   3.163 1.00 . A A . 104 LEU H    1 1 
        2  3505 1 1 104 LEU HA   H  -6.391   2.868   0.480 1.00 . A A . 104 LEU HA   1 1 
        2  3506 1 1 104 LEU HB2  H  -6.801   1.573   3.183 1.00 . A A . 104 LEU HB2  1 1 
        2  3507 1 1 104 LEU HB3  H  -6.863   0.730   1.646 1.00 . A A . 104 LEU HB3  1 1 
        2  3508 1 1 104 LEU HD11 H  -3.561  -0.211   3.038 1.00 . A A . 104 LEU HD11 1 1 
        2  3509 1 1 104 LEU HD12 H  -5.074  -0.852   2.396 1.00 . A A . 104 LEU HD12 1 1 
        2  3510 1 1 104 LEU HD13 H  -5.055  -0.025   3.955 1.00 . A A . 104 LEU HD13 1 1 
        2  3511 1 1 104 LEU HD21 H  -3.202   1.111   0.949 1.00 . A A . 104 LEU HD21 1 1 
        2  3512 1 1 104 LEU HD22 H  -4.420   2.269   0.412 1.00 . A A . 104 LEU HD22 1 1 
        2  3513 1 1 104 LEU HD23 H  -4.720   0.537   0.254 1.00 . A A . 104 LEU HD23 1 1 
        2  3514 1 1 104 LEU HG   H  -4.428   2.064   2.848 1.00 . A A . 104 LEU HG   1 1 
        2  3515 1 1 104 LEU N    N  -6.276   4.024   2.206 1.00 . A A . 104 LEU N    1 1 
        2  3516 1 1 104 LEU O    O  -9.051   2.781   2.367 1.00 . A A . 104 LEU O    1 1 
        2  3517 1 1 105 LYS C    C -10.799   2.215  -1.078 1.00 . A A . 105 LYS C    1 1 
        2  3518 1 1 105 LYS CA   C -10.293   3.266  -0.074 1.00 . A A . 105 LYS CA   1 1 
        2  3519 1 1 105 LYS CB   C -10.667   4.678  -0.549 1.00 . A A . 105 LYS CB   1 1 
        2  3520 1 1 105 LYS CD   C -10.967   7.115   0.068 1.00 . A A . 105 LYS CD   1 1 
        2  3521 1 1 105 LYS CE   C -10.737   8.187   1.130 1.00 . A A . 105 LYS CE   1 1 
        2  3522 1 1 105 LYS CG   C -10.407   5.762   0.496 1.00 . A A . 105 LYS CG   1 1 
        2  3523 1 1 105 LYS H    H  -8.231   3.276  -0.603 1.00 . A A . 105 LYS H    1 1 
        2  3524 1 1 105 LYS HA   H -10.787   3.084   0.873 1.00 . A A . 105 LYS HA   1 1 
        2  3525 1 1 105 LYS HB2  H -10.092   4.914  -1.434 1.00 . A A . 105 LYS HB2  1 1 
        2  3526 1 1 105 LYS HB3  H -11.719   4.694  -0.799 1.00 . A A . 105 LYS HB3  1 1 
        2  3527 1 1 105 LYS HD2  H -10.483   7.422  -0.848 1.00 . A A . 105 LYS HD2  1 1 
        2  3528 1 1 105 LYS HD3  H -12.030   7.015  -0.103 1.00 . A A . 105 LYS HD3  1 1 
        2  3529 1 1 105 LYS HE2  H  -9.675   8.347   1.236 1.00 . A A . 105 LYS HE2  1 1 
        2  3530 1 1 105 LYS HE3  H -11.205   9.106   0.803 1.00 . A A . 105 LYS HE3  1 1 
        2  3531 1 1 105 LYS HG2  H -10.872   5.471   1.426 1.00 . A A . 105 LYS HG2  1 1 
        2  3532 1 1 105 LYS HG3  H  -9.339   5.855   0.642 1.00 . A A . 105 LYS HG3  1 1 
        2  3533 1 1 105 LYS HZ1  H -12.256   7.414   2.342 1.00 . A A . 105 LYS HZ1  1 1 
        2  3534 1 1 105 LYS HZ2  H -11.346   8.638   3.076 1.00 . A A . 105 LYS HZ2  1 1 
        2  3535 1 1 105 LYS HZ3  H -10.694   7.090   2.910 1.00 . A A . 105 LYS HZ3  1 1 
        2  3536 1 1 105 LYS N    N  -8.845   3.166   0.156 1.00 . A A . 105 LYS N    1 1 
        2  3537 1 1 105 LYS NZ   N -11.298   7.805   2.455 1.00 . A A . 105 LYS NZ   1 1 
        2  3538 1 1 105 LYS O    O -10.034   1.670  -1.878 1.00 . A A . 105 LYS O    1 1 
        2  3539 1 1 106 ASN C    C -13.354   1.506  -3.132 1.00 . A A . 106 ASN C    1 1 
        2  3540 1 1 106 ASN CA   C -12.740   0.918  -1.851 1.00 . A A . 106 ASN CA   1 1 
        2  3541 1 1 106 ASN CB   C -13.844   0.215  -1.050 1.00 . A A . 106 ASN CB   1 1 
        2  3542 1 1 106 ASN CG   C -13.360  -0.355   0.271 1.00 . A A . 106 ASN CG   1 1 
        2  3543 1 1 106 ASN H    H -12.657   2.457  -0.395 1.00 . A A . 106 ASN H    1 1 
        2  3544 1 1 106 ASN HA   H -11.988   0.192  -2.125 1.00 . A A . 106 ASN HA   1 1 
        2  3545 1 1 106 ASN HB2  H -14.633   0.920  -0.841 1.00 . A A . 106 ASN HB2  1 1 
        2  3546 1 1 106 ASN HB3  H -14.245  -0.596  -1.645 1.00 . A A . 106 ASN HB3  1 1 
        2  3547 1 1 106 ASN HD21 H -14.772  -1.739   0.231 1.00 . A A . 106 ASN HD21 1 1 
        2  3548 1 1 106 ASN HD22 H -13.724  -1.769   1.599 1.00 . A A . 106 ASN HD22 1 1 
        2  3549 1 1 106 ASN N    N -12.104   1.949  -1.023 1.00 . A A . 106 ASN N    1 1 
        2  3550 1 1 106 ASN ND2  N -14.018  -1.393   0.746 1.00 . A A . 106 ASN ND2  1 1 
        2  3551 1 1 106 ASN O    O -13.306   2.712  -3.371 1.00 . A A . 106 ASN O    1 1 
        2  3552 1 1 106 ASN OD1  O -12.414   0.140   0.871 1.00 . A A . 106 ASN OD1  1 1 
        2  3553 1 1 107 SER C    C -15.755   2.048  -4.972 1.00 . A A . 107 SER C    1 1 
        2  3554 1 1 107 SER CA   C -14.610   1.041  -5.196 1.00 . A A . 107 SER CA   1 1 
        2  3555 1 1 107 SER CB   C -15.151  -0.196  -5.928 1.00 . A A . 107 SER CB   1 1 
        2  3556 1 1 107 SER H    H -13.973  -0.311  -3.688 1.00 . A A . 107 SER H    1 1 
        2  3557 1 1 107 SER HA   H -13.858   1.508  -5.813 1.00 . A A . 107 SER HA   1 1 
        2  3558 1 1 107 SER HB2  H -15.955  -0.632  -5.353 1.00 . A A . 107 SER HB2  1 1 
        2  3559 1 1 107 SER HB3  H -15.524   0.099  -6.900 1.00 . A A . 107 SER HB3  1 1 
        2  3560 1 1 107 SER HG   H -13.314  -0.745  -6.383 1.00 . A A . 107 SER HG   1 1 
        2  3561 1 1 107 SER N    N -13.967   0.636  -3.936 1.00 . A A . 107 SER N    1 1 
        2  3562 1 1 107 SER O    O -16.162   2.751  -5.896 1.00 . A A . 107 SER O    1 1 
        2  3563 1 1 107 SER OG   O -14.136  -1.177  -6.109 1.00 . A A . 107 SER OG   1 1 
        2  3564 1 1 108 GLN C    C -16.881   4.273  -2.643 1.00 . A A . 108 GLN C    1 1 
        2  3565 1 1 108 GLN CA   C -17.374   3.035  -3.415 1.00 . A A . 108 GLN CA   1 1 
        2  3566 1 1 108 GLN CB   C -18.454   2.304  -2.600 1.00 . A A . 108 GLN CB   1 1 
        2  3567 1 1 108 GLN CD   C -20.300   0.553  -2.582 1.00 . A A . 108 GLN CD   1 1 
        2  3568 1 1 108 GLN CG   C -19.157   1.185  -3.367 1.00 . A A . 108 GLN CG   1 1 
        2  3569 1 1 108 GLN H    H -15.919   1.526  -3.046 1.00 . A A . 108 GLN H    1 1 
        2  3570 1 1 108 GLN HA   H -17.815   3.369  -4.344 1.00 . A A . 108 GLN HA   1 1 
        2  3571 1 1 108 GLN HB2  H -17.995   1.873  -1.720 1.00 . A A . 108 GLN HB2  1 1 
        2  3572 1 1 108 GLN HB3  H -19.199   3.022  -2.290 1.00 . A A . 108 GLN HB3  1 1 
        2  3573 1 1 108 GLN HE21 H -20.031  -1.172  -3.511 1.00 . A A . 108 GLN HE21 1 1 
        2  3574 1 1 108 GLN HE22 H -21.301  -1.132  -2.346 1.00 . A A . 108 GLN HE22 1 1 
        2  3575 1 1 108 GLN HG2  H -19.553   1.589  -4.287 1.00 . A A . 108 GLN HG2  1 1 
        2  3576 1 1 108 GLN HG3  H -18.432   0.417  -3.598 1.00 . A A . 108 GLN HG3  1 1 
        2  3577 1 1 108 GLN N    N -16.276   2.111  -3.745 1.00 . A A . 108 GLN N    1 1 
        2  3578 1 1 108 GLN NE2  N -20.571  -0.709  -2.840 1.00 . A A . 108 GLN NE2  1 1 
        2  3579 1 1 108 GLN O    O -17.672   4.977  -2.016 1.00 . A A . 108 GLN O    1 1 
        2  3580 1 1 108 GLN OE1  O -20.943   1.197  -1.758 1.00 . A A . 108 GLN OE1  1 1 
        2  3581 1 1 109 GLY C    C -14.849   5.515  -0.491 1.00 . A A . 109 GLY C    1 1 
        2  3582 1 1 109 GLY CA   C -15.016   5.705  -2.001 1.00 . A A . 109 GLY CA   1 1 
        2  3583 1 1 109 GLY H    H -14.977   3.935  -3.181 1.00 . A A . 109 GLY H    1 1 
        2  3584 1 1 109 GLY HA2  H -14.048   5.921  -2.427 1.00 . A A . 109 GLY HA2  1 1 
        2  3585 1 1 109 GLY HA3  H -15.665   6.553  -2.176 1.00 . A A . 109 GLY HA3  1 1 
        2  3586 1 1 109 GLY N    N -15.573   4.535  -2.681 1.00 . A A . 109 GLY N    1 1 
        2  3587 1 1 109 GLY O    O -14.097   6.252   0.150 1.00 . A A . 109 GLY O    1 1 
        2  3588 1 1 110 GLU C    C -14.019   3.845   1.894 1.00 . A A . 110 GLU C    1 1 
        2  3589 1 1 110 GLU CA   C -15.461   4.212   1.502 1.00 . A A . 110 GLU CA   1 1 
        2  3590 1 1 110 GLU CB   C -16.414   3.055   1.833 1.00 . A A . 110 GLU CB   1 1 
        2  3591 1 1 110 GLU CD   C -17.131   0.685   1.279 1.00 . A A . 110 GLU CD   1 1 
        2  3592 1 1 110 GLU CG   C -16.056   1.747   1.137 1.00 . A A . 110 GLU CG   1 1 
        2  3593 1 1 110 GLU H    H -16.168   4.019  -0.485 1.00 . A A . 110 GLU H    1 1 
        2  3594 1 1 110 GLU HA   H -15.761   5.087   2.061 1.00 . A A . 110 GLU HA   1 1 
        2  3595 1 1 110 GLU HB2  H -16.401   2.886   2.900 1.00 . A A . 110 GLU HB2  1 1 
        2  3596 1 1 110 GLU HB3  H -17.415   3.335   1.535 1.00 . A A . 110 GLU HB3  1 1 
        2  3597 1 1 110 GLU HG2  H -15.900   1.945   0.085 1.00 . A A . 110 GLU HG2  1 1 
        2  3598 1 1 110 GLU HG3  H -15.137   1.367   1.565 1.00 . A A . 110 GLU HG3  1 1 
        2  3599 1 1 110 GLU N    N -15.556   4.535   0.072 1.00 . A A . 110 GLU N    1 1 
        2  3600 1 1 110 GLU O    O -13.215   3.469   1.041 1.00 . A A . 110 GLU O    1 1 
        2  3601 1 1 110 GLU OE1  O -17.390   0.240   2.413 1.00 . A A . 110 GLU OE1  1 1 
        2  3602 1 1 110 GLU OE2  O -17.733   0.302   0.252 1.00 . A A . 110 GLU OE2  1 1 
        2  3603 1 1 111 GLU C    C -12.192   2.617   4.667 1.00 . A A . 111 GLU C    1 1 
        2  3604 1 1 111 GLU CA   C -12.315   3.748   3.637 1.00 . A A . 111 GLU CA   1 1 
        2  3605 1 1 111 GLU CB   C -11.795   5.052   4.238 1.00 . A A . 111 GLU CB   1 1 
        2  3606 1 1 111 GLU CD   C  -9.919   6.284   5.371 1.00 . A A . 111 GLU CD   1 1 
        2  3607 1 1 111 GLU CG   C -10.360   4.980   4.739 1.00 . A A . 111 GLU CG   1 1 
        2  3608 1 1 111 GLU H    H -14.398   4.138   3.835 1.00 . A A . 111 GLU H    1 1 
        2  3609 1 1 111 GLU HA   H -11.708   3.499   2.776 1.00 . A A . 111 GLU HA   1 1 
        2  3610 1 1 111 GLU HB2  H -11.852   5.827   3.485 1.00 . A A . 111 GLU HB2  1 1 
        2  3611 1 1 111 GLU HB3  H -12.430   5.328   5.068 1.00 . A A . 111 GLU HB3  1 1 
        2  3612 1 1 111 GLU HG2  H -10.287   4.192   5.475 1.00 . A A . 111 GLU HG2  1 1 
        2  3613 1 1 111 GLU HG3  H  -9.707   4.757   3.907 1.00 . A A . 111 GLU HG3  1 1 
        2  3614 1 1 111 GLU N    N -13.696   3.940   3.178 1.00 . A A . 111 GLU N    1 1 
        2  3615 1 1 111 GLU O    O -12.887   2.608   5.685 1.00 . A A . 111 GLU O    1 1 
        2  3616 1 1 111 GLU OE1  O  -9.615   7.232   4.619 1.00 . A A . 111 GLU OE1  1 1 
        2  3617 1 1 111 GLU OE2  O  -9.918   6.373   6.616 1.00 . A A . 111 GLU OE2  1 1 
        2  3618 1 1 112 VAL C    C  -9.854   0.835   6.272 1.00 . A A . 112 VAL C    1 1 
        2  3619 1 1 112 VAL CA   C -11.035   0.561   5.322 1.00 . A A . 112 VAL CA   1 1 
        2  3620 1 1 112 VAL CB   C -10.775  -0.760   4.550 1.00 . A A . 112 VAL CB   1 1 
        2  3621 1 1 112 VAL CG1  C -12.032  -1.203   3.804 1.00 . A A . 112 VAL CG1  1 1 
        2  3622 1 1 112 VAL CG2  C  -9.592  -0.608   3.591 1.00 . A A . 112 VAL CG2  1 1 
        2  3623 1 1 112 VAL H    H -10.767   1.737   3.572 1.00 . A A . 112 VAL H    1 1 
        2  3624 1 1 112 VAL HA   H -11.927   0.423   5.919 1.00 . A A . 112 VAL HA   1 1 
        2  3625 1 1 112 VAL HB   H -10.526  -1.530   5.271 1.00 . A A . 112 VAL HB   1 1 
        2  3626 1 1 112 VAL HG11 H -12.839  -1.343   4.509 1.00 . A A . 112 VAL HG11 1 1 
        2  3627 1 1 112 VAL HG12 H -11.838  -2.134   3.290 1.00 . A A . 112 VAL HG12 1 1 
        2  3628 1 1 112 VAL HG13 H -12.311  -0.448   3.084 1.00 . A A . 112 VAL HG13 1 1 
        2  3629 1 1 112 VAL HG21 H  -8.701  -0.366   4.152 1.00 . A A . 112 VAL HG21 1 1 
        2  3630 1 1 112 VAL HG22 H  -9.798   0.183   2.884 1.00 . A A . 112 VAL HG22 1 1 
        2  3631 1 1 112 VAL HG23 H  -9.438  -1.535   3.056 1.00 . A A . 112 VAL HG23 1 1 
        2  3632 1 1 112 VAL N    N -11.282   1.678   4.405 1.00 . A A . 112 VAL N    1 1 
        2  3633 1 1 112 VAL O    O  -9.867   0.402   7.428 1.00 . A A . 112 VAL O    1 1 
        2  3634 1 1 113 ALA C    C  -6.835   3.031   6.091 1.00 . A A . 113 ALA C    1 1 
        2  3635 1 1 113 ALA CA   C  -7.640   1.822   6.598 1.00 . A A . 113 ALA CA   1 1 
        2  3636 1 1 113 ALA CB   C  -6.749   0.584   6.628 1.00 . A A . 113 ALA CB   1 1 
        2  3637 1 1 113 ALA H    H  -8.899   1.926   4.884 1.00 . A A . 113 ALA H    1 1 
        2  3638 1 1 113 ALA HA   H  -7.962   2.023   7.612 1.00 . A A . 113 ALA HA   1 1 
        2  3639 1 1 113 ALA HB1  H  -6.388   0.378   5.630 1.00 . A A . 113 ALA HB1  1 1 
        2  3640 1 1 113 ALA HB2  H  -7.317  -0.263   6.987 1.00 . A A . 113 ALA HB2  1 1 
        2  3641 1 1 113 ALA HB3  H  -5.909   0.758   7.285 1.00 . A A . 113 ALA HB3  1 1 
        2  3642 1 1 113 ALA N    N  -8.840   1.560   5.792 1.00 . A A . 113 ALA N    1 1 
        2  3643 1 1 113 ALA O    O  -6.822   3.335   4.899 1.00 . A A . 113 ALA O    1 1 
        2  3644 1 1 114 GLN C    C  -4.085   4.854   7.700 1.00 . A A . 114 GLN C    1 1 
        2  3645 1 1 114 GLN CA   C  -5.256   4.820   6.702 1.00 . A A . 114 GLN CA   1 1 
        2  3646 1 1 114 GLN CB   C  -6.013   6.160   6.724 1.00 . A A . 114 GLN CB   1 1 
        2  3647 1 1 114 GLN CD   C  -7.345   7.855   8.076 1.00 . A A . 114 GLN CD   1 1 
        2  3648 1 1 114 GLN CG   C  -6.659   6.496   8.066 1.00 . A A . 114 GLN CG   1 1 
        2  3649 1 1 114 GLN H    H  -6.285   3.460   7.962 1.00 . A A . 114 GLN H    1 1 
        2  3650 1 1 114 GLN HA   H  -4.859   4.653   5.708 1.00 . A A . 114 GLN HA   1 1 
        2  3651 1 1 114 GLN HB2  H  -5.322   6.954   6.476 1.00 . A A . 114 GLN HB2  1 1 
        2  3652 1 1 114 GLN HB3  H  -6.791   6.129   5.973 1.00 . A A . 114 GLN HB3  1 1 
        2  3653 1 1 114 GLN HE21 H  -8.658   7.213   9.408 1.00 . A A . 114 GLN HE21 1 1 
        2  3654 1 1 114 GLN HE22 H  -8.844   8.849   8.896 1.00 . A A . 114 GLN HE22 1 1 
        2  3655 1 1 114 GLN HG2  H  -7.397   5.740   8.295 1.00 . A A . 114 GLN HG2  1 1 
        2  3656 1 1 114 GLN HG3  H  -5.895   6.491   8.829 1.00 . A A . 114 GLN HG3  1 1 
        2  3657 1 1 114 GLN N    N  -6.163   3.709   7.022 1.00 . A A . 114 GLN N    1 1 
        2  3658 1 1 114 GLN NE2  N  -8.385   7.985   8.875 1.00 . A A . 114 GLN NE2  1 1 
        2  3659 1 1 114 GLN O    O  -4.277   4.604   8.893 1.00 . A A . 114 GLN O    1 1 
        2  3660 1 1 114 GLN OE1  O  -6.944   8.779   7.376 1.00 . A A . 114 GLN OE1  1 1 
        2  3661 1 1 115 ARG C    C  -0.578   6.069   7.588 1.00 . A A . 115 ARG C    1 1 
        2  3662 1 1 115 ARG CA   C  -1.692   5.136   8.101 1.00 . A A . 115 ARG CA   1 1 
        2  3663 1 1 115 ARG CB   C  -1.155   3.699   8.223 1.00 . A A . 115 ARG CB   1 1 
        2  3664 1 1 115 ARG CD   C   0.456   2.121   9.372 1.00 . A A . 115 ARG CD   1 1 
        2  3665 1 1 115 ARG CG   C  -0.131   3.527   9.338 1.00 . A A . 115 ARG CG   1 1 
        2  3666 1 1 115 ARG CZ   C   2.527   1.567  10.565 1.00 . A A . 115 ARG CZ   1 1 
        2  3667 1 1 115 ARG H    H  -2.774   5.403   6.280 1.00 . A A . 115 ARG H    1 1 
        2  3668 1 1 115 ARG HA   H  -2.000   5.475   9.082 1.00 . A A . 115 ARG HA   1 1 
        2  3669 1 1 115 ARG HB2  H  -1.983   3.032   8.418 1.00 . A A . 115 ARG HB2  1 1 
        2  3670 1 1 115 ARG HB3  H  -0.691   3.416   7.287 1.00 . A A . 115 ARG HB3  1 1 
        2  3671 1 1 115 ARG HD2  H  -0.352   1.404   9.367 1.00 . A A . 115 ARG HD2  1 1 
        2  3672 1 1 115 ARG HD3  H   1.072   1.978   8.495 1.00 . A A . 115 ARG HD3  1 1 
        2  3673 1 1 115 ARG HE   H   0.828   2.047  11.435 1.00 . A A . 115 ARG HE   1 1 
        2  3674 1 1 115 ARG HG2  H   0.672   4.234   9.188 1.00 . A A . 115 ARG HG2  1 1 
        2  3675 1 1 115 ARG HG3  H  -0.612   3.728  10.285 1.00 . A A . 115 ARG HG3  1 1 
        2  3676 1 1 115 ARG HH11 H   2.693   1.466   8.590 1.00 . A A . 115 ARG HH11 1 1 
        2  3677 1 1 115 ARG HH12 H   4.128   1.101   9.482 1.00 . A A . 115 ARG HH12 1 1 
        2  3678 1 1 115 ARG HH21 H   2.673   1.586  12.543 1.00 . A A . 115 ARG HH21 1 1 
        2  3679 1 1 115 ARG HH22 H   4.112   1.156  11.686 1.00 . A A . 115 ARG HH22 1 1 
        2  3680 1 1 115 ARG N    N  -2.876   5.157   7.227 1.00 . A A . 115 ARG N    1 1 
        2  3681 1 1 115 ARG NE   N   1.268   1.911  10.567 1.00 . A A . 115 ARG NE   1 1 
        2  3682 1 1 115 ARG NH1  N   3.161   1.361   9.456 1.00 . A A . 115 ARG NH1  1 1 
        2  3683 1 1 115 ARG NH2  N   3.151   1.426  11.681 1.00 . A A . 115 ARG NH2  1 1 
        2  3684 1 1 115 ARG O    O  -0.516   6.387   6.404 1.00 . A A . 115 ARG O    1 1 
        2  3685 1 1 116 SER C    C   2.775   6.758   8.614 1.00 . A A . 116 SER C    1 1 
        2  3686 1 1 116 SER CA   C   1.443   7.362   8.141 1.00 . A A . 116 SER CA   1 1 
        2  3687 1 1 116 SER CB   C   1.272   8.757   8.761 1.00 . A A . 116 SER CB   1 1 
        2  3688 1 1 116 SER H    H   0.184   6.233   9.431 1.00 . A A . 116 SER H    1 1 
        2  3689 1 1 116 SER HA   H   1.471   7.459   7.065 1.00 . A A . 116 SER HA   1 1 
        2  3690 1 1 116 SER HB2  H   2.108   9.382   8.479 1.00 . A A . 116 SER HB2  1 1 
        2  3691 1 1 116 SER HB3  H   0.355   9.201   8.399 1.00 . A A . 116 SER HB3  1 1 
        2  3692 1 1 116 SER HG   H   2.082   8.907  10.541 1.00 . A A . 116 SER HG   1 1 
        2  3693 1 1 116 SER N    N   0.303   6.499   8.494 1.00 . A A . 116 SER N    1 1 
        2  3694 1 1 116 SER O    O   2.796   5.778   9.362 1.00 . A A . 116 SER O    1 1 
        2  3695 1 1 116 SER OG   O   1.217   8.689  10.178 1.00 . A A . 116 SER OG   1 1 
        2  3696 1 1 117 THR C    C   5.519   7.326  10.051 1.00 . A A . 117 THR C    1 1 
        2  3697 1 1 117 THR CA   C   5.224   6.919   8.601 1.00 . A A . 117 THR CA   1 1 
        2  3698 1 1 117 THR CB   C   6.334   7.512   7.697 1.00 . A A . 117 THR CB   1 1 
        2  3699 1 1 117 THR CG2  C   6.284   6.917   6.298 1.00 . A A . 117 THR CG2  1 1 
        2  3700 1 1 117 THR H    H   3.807   8.093   7.538 1.00 . A A . 117 THR H    1 1 
        2  3701 1 1 117 THR HA   H   5.269   5.841   8.526 1.00 . A A . 117 THR HA   1 1 
        2  3702 1 1 117 THR HB   H   7.297   7.276   8.133 1.00 . A A . 117 THR HB   1 1 
        2  3703 1 1 117 THR HG1  H   7.062   9.328   7.420 1.00 . A A . 117 THR HG1  1 1 
        2  3704 1 1 117 THR HG21 H   5.314   7.108   5.861 1.00 . A A . 117 THR HG21 1 1 
        2  3705 1 1 117 THR HG22 H   6.451   5.851   6.353 1.00 . A A . 117 THR HG22 1 1 
        2  3706 1 1 117 THR HG23 H   7.050   7.370   5.684 1.00 . A A . 117 THR HG23 1 1 
        2  3707 1 1 117 THR N    N   3.885   7.350   8.172 1.00 . A A . 117 THR N    1 1 
        2  3708 1 1 117 THR O    O   4.893   8.239  10.600 1.00 . A A . 117 THR O    1 1 
        2  3709 1 1 117 THR OG1  O   6.204   8.939   7.620 1.00 . A A . 117 THR OG1  1 1 
        2  3710 1 1 118 VAL C    C   7.788   8.208  12.070 1.00 . A A . 118 VAL C    1 1 
        2  3711 1 1 118 VAL CA   C   6.897   6.952  12.036 1.00 . A A . 118 VAL CA   1 1 
        2  3712 1 1 118 VAL CB   C   7.648   5.756  12.681 1.00 . A A . 118 VAL CB   1 1 
        2  3713 1 1 118 VAL CG1  C   7.999   6.052  14.139 1.00 . A A . 118 VAL CG1  1 1 
        2  3714 1 1 118 VAL CG2  C   6.818   4.475  12.569 1.00 . A A . 118 VAL CG2  1 1 
        2  3715 1 1 118 VAL H    H   6.919   5.904  10.195 1.00 . A A . 118 VAL H    1 1 
        2  3716 1 1 118 VAL HA   H   6.005   7.145  12.620 1.00 . A A . 118 VAL HA   1 1 
        2  3717 1 1 118 VAL HB   H   8.574   5.607  12.138 1.00 . A A . 118 VAL HB   1 1 
        2  3718 1 1 118 VAL HG11 H   8.516   5.203  14.565 1.00 . A A . 118 VAL HG11 1 1 
        2  3719 1 1 118 VAL HG12 H   7.094   6.241  14.698 1.00 . A A . 118 VAL HG12 1 1 
        2  3720 1 1 118 VAL HG13 H   8.640   6.920  14.186 1.00 . A A . 118 VAL HG13 1 1 
        2  3721 1 1 118 VAL HG21 H   7.349   3.659  13.035 1.00 . A A . 118 VAL HG21 1 1 
        2  3722 1 1 118 VAL HG22 H   6.649   4.245  11.525 1.00 . A A . 118 VAL HG22 1 1 
        2  3723 1 1 118 VAL HG23 H   5.865   4.614  13.064 1.00 . A A . 118 VAL HG23 1 1 
        2  3724 1 1 118 VAL N    N   6.481   6.641  10.668 1.00 . A A . 118 VAL N    1 1 
        2  3725 1 1 118 VAL O    O   9.011   8.130  11.932 1.00 . A A . 118 VAL O    1 1 
        2  3726 1 1 119 PHE C    C   8.636  10.765  13.639 1.00 . A A . 119 PHE C    1 1 
        2  3727 1 1 119 PHE CA   C   7.874  10.647  12.305 1.00 . A A . 119 PHE CA   1 1 
        2  3728 1 1 119 PHE CB   C   6.894  11.824  12.150 1.00 . A A . 119 PHE CB   1 1 
        2  3729 1 1 119 PHE CD1  C   4.721  11.103  13.210 1.00 . A A . 119 PHE CD1  1 1 
        2  3730 1 1 119 PHE CD2  C   6.010  12.792  14.306 1.00 . A A . 119 PHE CD2  1 1 
        2  3731 1 1 119 PHE CE1  C   3.772  11.178  14.212 1.00 . A A . 119 PHE CE1  1 1 
        2  3732 1 1 119 PHE CE2  C   5.062  12.869  15.307 1.00 . A A . 119 PHE CE2  1 1 
        2  3733 1 1 119 PHE CG   C   5.854  11.908  13.243 1.00 . A A . 119 PHE CG   1 1 
        2  3734 1 1 119 PHE CZ   C   3.943  12.062  15.260 1.00 . A A . 119 PHE CZ   1 1 
        2  3735 1 1 119 PHE H    H   6.173   9.371  12.226 1.00 . A A . 119 PHE H    1 1 
        2  3736 1 1 119 PHE HA   H   8.591  10.682  11.496 1.00 . A A . 119 PHE HA   1 1 
        2  3737 1 1 119 PHE HB2  H   7.451  12.751  12.148 1.00 . A A . 119 PHE HB2  1 1 
        2  3738 1 1 119 PHE HB3  H   6.377  11.727  11.205 1.00 . A A . 119 PHE HB3  1 1 
        2  3739 1 1 119 PHE HD1  H   4.585  10.411  12.390 1.00 . A A . 119 PHE HD1  1 1 
        2  3740 1 1 119 PHE HD2  H   6.885  13.425  14.347 1.00 . A A . 119 PHE HD2  1 1 
        2  3741 1 1 119 PHE HE1  H   2.894  10.546  14.174 1.00 . A A . 119 PHE HE1  1 1 
        2  3742 1 1 119 PHE HE2  H   5.196  13.562  16.125 1.00 . A A . 119 PHE HE2  1 1 
        2  3743 1 1 119 PHE HZ   H   3.201  12.121  16.044 1.00 . A A . 119 PHE HZ   1 1 
        2  3744 1 1 119 PHE N    N   7.153   9.369  12.210 1.00 . A A . 119 PHE N    1 1 
        2  3745 1 1 119 PHE O    O   9.623  11.494  13.745 1.00 . A A . 119 PHE O    1 1 
        2  3746 1 1 120 LYS C    C   9.637   8.806  16.211 1.00 . A A . 120 LYS C    1 1 
        2  3747 1 1 120 LYS CA   C   8.786  10.064  15.981 1.00 . A A . 120 LYS CA   1 1 
        2  3748 1 1 120 LYS CB   C   7.711  10.178  17.077 1.00 . A A . 120 LYS CB   1 1 
        2  3749 1 1 120 LYS CD   C   8.780  11.647  18.888 1.00 . A A . 120 LYS CD   1 1 
        2  3750 1 1 120 LYS CE   C  10.134  11.970  18.256 1.00 . A A . 120 LYS CE   1 1 
        2  3751 1 1 120 LYS CG   C   8.250  10.255  18.513 1.00 . A A . 120 LYS CG   1 1 
        2  3752 1 1 120 LYS H    H   7.366   9.492  14.513 1.00 . A A . 120 LYS H    1 1 
        2  3753 1 1 120 LYS HA   H   9.430  10.933  16.035 1.00 . A A . 120 LYS HA   1 1 
        2  3754 1 1 120 LYS HB2  H   7.124  11.066  16.893 1.00 . A A . 120 LYS HB2  1 1 
        2  3755 1 1 120 LYS HB3  H   7.062   9.314  17.006 1.00 . A A . 120 LYS HB3  1 1 
        2  3756 1 1 120 LYS HD2  H   8.065  12.389  18.561 1.00 . A A . 120 LYS HD2  1 1 
        2  3757 1 1 120 LYS HD3  H   8.878  11.701  19.964 1.00 . A A . 120 LYS HD3  1 1 
        2  3758 1 1 120 LYS HE2  H  10.053  11.870  17.185 1.00 . A A . 120 LYS HE2  1 1 
        2  3759 1 1 120 LYS HE3  H  10.393  12.990  18.498 1.00 . A A . 120 LYS HE3  1 1 
        2  3760 1 1 120 LYS HG2  H   7.451  10.000  19.194 1.00 . A A . 120 LYS HG2  1 1 
        2  3761 1 1 120 LYS HG3  H   9.050   9.536  18.622 1.00 . A A . 120 LYS HG3  1 1 
        2  3762 1 1 120 LYS HZ1  H  11.354  11.190  19.768 1.00 . A A . 120 LYS HZ1  1 1 
        2  3763 1 1 120 LYS HZ2  H  12.114  11.301  18.261 1.00 . A A . 120 LYS HZ2  1 1 
        2  3764 1 1 120 LYS HZ3  H  10.985  10.078  18.552 1.00 . A A . 120 LYS HZ3  1 1 
        2  3765 1 1 120 LYS N    N   8.159  10.049  14.656 1.00 . A A . 120 LYS N    1 1 
        2  3766 1 1 120 LYS NZ   N  11.219  11.071  18.743 1.00 . A A . 120 LYS NZ   1 1 
        2  3767 1 1 120 LYS O    O   9.125   7.754  16.586 1.00 . A A . 120 LYS O    1 1 
        2  3768 1 1 121 THR C    C  12.268   7.686  17.661 1.00 . A A . 121 THR C    1 1 
        2  3769 1 1 121 THR CA   C  11.876   7.813  16.182 1.00 . A A . 121 THR CA   1 1 
        2  3770 1 1 121 THR CB   C  13.161   7.984  15.337 1.00 . A A . 121 THR CB   1 1 
        2  3771 1 1 121 THR CG2  C  12.832   8.024  13.845 1.00 . A A . 121 THR CG2  1 1 
        2  3772 1 1 121 THR H    H  11.280   9.779  15.630 1.00 . A A . 121 THR H    1 1 
        2  3773 1 1 121 THR HA   H  11.388   6.898  15.875 1.00 . A A . 121 THR HA   1 1 
        2  3774 1 1 121 THR HB   H  13.813   7.141  15.522 1.00 . A A . 121 THR HB   1 1 
        2  3775 1 1 121 THR HG1  H  14.747   9.167  15.361 1.00 . A A . 121 THR HG1  1 1 
        2  3776 1 1 121 THR HG21 H  13.744   8.145  13.276 1.00 . A A . 121 THR HG21 1 1 
        2  3777 1 1 121 THR HG22 H  12.172   8.854  13.643 1.00 . A A . 121 THR HG22 1 1 
        2  3778 1 1 121 THR HG23 H  12.348   7.103  13.555 1.00 . A A . 121 THR HG23 1 1 
        2  3779 1 1 121 THR N    N  10.937   8.925  15.967 1.00 . A A . 121 THR N    1 1 
        2  3780 1 1 121 THR O    O  12.210   8.663  18.417 1.00 . A A . 121 THR O    1 1 
        2  3781 1 1 121 THR OG1  O  13.845   9.192  15.711 1.00 . A A . 121 THR OG1  1 1 
        2  3782 1 1 122 THR C    C  13.650   4.782  19.625 1.00 . A A . 122 THR C    1 1 
        2  3783 1 1 122 THR CA   C  13.050   6.199  19.462 1.00 . A A . 122 THR CA   1 1 
        2  3784 1 1 122 THR CB   C  11.860   6.400  20.447 1.00 . A A . 122 THR CB   1 1 
        2  3785 1 1 122 THR CG2  C  10.582   5.735  19.936 1.00 . A A . 122 THR CG2  1 1 
        2  3786 1 1 122 THR H    H  12.693   5.745  17.411 1.00 . A A . 122 THR H    1 1 
        2  3787 1 1 122 THR HA   H  13.816   6.918  19.724 1.00 . A A . 122 THR HA   1 1 
        2  3788 1 1 122 THR HB   H  11.675   7.463  20.533 1.00 . A A . 122 THR HB   1 1 
        2  3789 1 1 122 THR HG1  H  12.373   4.947  21.689 1.00 . A A . 122 THR HG1  1 1 
        2  3790 1 1 122 THR HG21 H  10.316   6.153  18.975 1.00 . A A . 122 THR HG21 1 1 
        2  3791 1 1 122 THR HG22 H   9.780   5.908  20.638 1.00 . A A . 122 THR HG22 1 1 
        2  3792 1 1 122 THR HG23 H  10.743   4.672  19.831 1.00 . A A . 122 THR HG23 1 1 
        2  3793 1 1 122 THR N    N  12.656   6.476  18.068 1.00 . A A . 122 THR N    1 1 
        2  3794 1 1 122 THR O    O  12.926   3.841  20.027 1.00 . A A . 122 THR O    1 1 
        2  3795 1 1 122 THR OXT  O  14.850   4.609  19.328 1.00 . A A . 122 THR OXT  1 1 
        2  3796 1 1 122 THR OG1  O  12.192   5.895  21.751 1.00 . A A . 122 THR OG1  1 1 
        3  3797 1 1   1 MET C    C -37.358 -27.135  -8.192 1.00 . A A .   1 MET C    1 1 
        3  3798 1 1   1 MET CA   C -38.633 -27.628  -7.487 1.00 . A A .   1 MET CA   1 1 
        3  3799 1 1   1 MET CB   C -38.447 -29.075  -7.003 1.00 . A A .   1 MET CB   1 1 
        3  3800 1 1   1 MET CE   C -38.791 -31.133  -4.583 1.00 . A A .   1 MET CE   1 1 
        3  3801 1 1   1 MET CG   C -37.314 -29.255  -5.999 1.00 . A A .   1 MET CG   1 1 
        3  3802 1 1   1 MET H1   H -39.981 -26.561  -8.673 1.00 . A A .   1 MET H1   1 1 
        3  3803 1 1   1 MET H2   H -40.657 -27.916  -7.922 1.00 . A A .   1 MET H2   1 1 
        3  3804 1 1   1 MET H3   H -39.637 -28.112  -9.253 1.00 . A A .   1 MET H3   1 1 
        3  3805 1 1   1 MET HA   H -38.828 -26.994  -6.636 1.00 . A A .   1 MET HA   1 1 
        3  3806 1 1   1 MET HB2  H -39.366 -29.405  -6.537 1.00 . A A .   1 MET HB2  1 1 
        3  3807 1 1   1 MET HB3  H -38.245 -29.704  -7.858 1.00 . A A .   1 MET HB3  1 1 
        3  3808 1 1   1 MET HE1  H -38.907 -30.372  -3.824 1.00 . A A .   1 MET HE1  1 1 
        3  3809 1 1   1 MET HE2  H -38.854 -32.110  -4.129 1.00 . A A .   1 MET HE2  1 1 
        3  3810 1 1   1 MET HE3  H -39.574 -31.027  -5.320 1.00 . A A .   1 MET HE3  1 1 
        3  3811 1 1   1 MET HG2  H -36.380 -28.997  -6.478 1.00 . A A .   1 MET HG2  1 1 
        3  3812 1 1   1 MET HG3  H -37.481 -28.591  -5.161 1.00 . A A .   1 MET HG3  1 1 
        3  3813 1 1   1 MET N    N -39.807 -27.548  -8.396 1.00 . A A .   1 MET N    1 1 
        3  3814 1 1   1 MET O    O -36.984 -27.660  -9.243 1.00 . A A .   1 MET O    1 1 
        3  3815 1 1   1 MET SD   S -37.194 -30.947  -5.380 1.00 . A A .   1 MET SD   1 1 
        3  3816 1 1   2 GLY C    C -34.849 -24.420  -7.486 1.00 . A A .   2 GLY C    1 1 
        3  3817 1 1   2 GLY CA   C -35.484 -25.589  -8.243 1.00 . A A .   2 GLY CA   1 1 
        3  3818 1 1   2 GLY H    H -37.029 -25.741  -6.780 1.00 . A A .   2 GLY H    1 1 
        3  3819 1 1   2 GLY HA2  H -34.755 -26.383  -8.316 1.00 . A A .   2 GLY HA2  1 1 
        3  3820 1 1   2 GLY HA3  H -35.729 -25.258  -9.243 1.00 . A A .   2 GLY HA3  1 1 
        3  3821 1 1   2 GLY N    N -36.696 -26.124  -7.622 1.00 . A A .   2 GLY N    1 1 
        3  3822 1 1   2 GLY O    O -35.002 -23.258  -7.872 1.00 . A A .   2 GLY O    1 1 
        3  3823 1 1   3 HIS C    C -32.077 -24.312  -5.073 1.00 . A A .   3 HIS C    1 1 
        3  3824 1 1   3 HIS CA   C -33.357 -23.703  -5.673 1.00 . A A .   3 HIS CA   1 1 
        3  3825 1 1   3 HIS CB   C -34.205 -23.023  -4.583 1.00 . A A .   3 HIS CB   1 1 
        3  3826 1 1   3 HIS CD2  C -36.246 -24.310  -3.631 1.00 . A A .   3 HIS CD2  1 1 
        3  3827 1 1   3 HIS CE1  C -35.229 -25.406  -2.035 1.00 . A A .   3 HIS CE1  1 1 
        3  3828 1 1   3 HIS CG   C -34.938 -23.967  -3.675 1.00 . A A .   3 HIS CG   1 1 
        3  3829 1 1   3 HIS H    H -34.123 -25.650  -6.084 1.00 . A A .   3 HIS H    1 1 
        3  3830 1 1   3 HIS HA   H -33.061 -22.951  -6.394 1.00 . A A .   3 HIS HA   1 1 
        3  3831 1 1   3 HIS HB2  H -33.563 -22.409  -3.969 1.00 . A A .   3 HIS HB2  1 1 
        3  3832 1 1   3 HIS HB3  H -34.940 -22.388  -5.059 1.00 . A A .   3 HIS HB3  1 1 
        3  3833 1 1   3 HIS HD1  H -33.377 -24.653  -2.433 1.00 . A A .   3 HIS HD1  1 1 
        3  3834 1 1   3 HIS HD2  H -37.026 -23.951  -4.288 1.00 . A A .   3 HIS HD2  1 1 
        3  3835 1 1   3 HIS HE1  H -35.038 -26.067  -1.203 1.00 . A A .   3 HIS HE1  1 1 
        3  3836 1 1   3 HIS HE2  H -37.249 -25.567  -2.286 1.00 . A A .   3 HIS HE2  1 1 
        3  3837 1 1   3 HIS N    N -34.133 -24.721  -6.402 1.00 . A A .   3 HIS N    1 1 
        3  3838 1 1   3 HIS ND1  N -34.332 -24.673  -2.658 1.00 . A A .   3 HIS ND1  1 1 
        3  3839 1 1   3 HIS NE2  N -36.396 -25.202  -2.603 1.00 . A A .   3 HIS NE2  1 1 
        3  3840 1 1   3 HIS O    O -32.118 -24.995  -4.050 1.00 . A A .   3 HIS O    1 1 
        3  3841 1 1   4 HIS C    C -28.806 -23.729  -4.449 1.00 . A A .   4 HIS C    1 1 
        3  3842 1 1   4 HIS CA   C -29.665 -24.680  -5.306 1.00 . A A .   4 HIS CA   1 1 
        3  3843 1 1   4 HIS CB   C -28.880 -25.147  -6.540 1.00 . A A .   4 HIS CB   1 1 
        3  3844 1 1   4 HIS CD2  C -30.424 -26.257  -8.319 1.00 . A A .   4 HIS CD2  1 1 
        3  3845 1 1   4 HIS CE1  C -30.056 -28.353  -7.795 1.00 . A A .   4 HIS CE1  1 1 
        3  3846 1 1   4 HIS CG   C -29.547 -26.269  -7.285 1.00 . A A .   4 HIS CG   1 1 
        3  3847 1 1   4 HIS H    H -30.956 -23.490  -6.516 1.00 . A A .   4 HIS H    1 1 
        3  3848 1 1   4 HIS HA   H -29.900 -25.549  -4.704 1.00 . A A .   4 HIS HA   1 1 
        3  3849 1 1   4 HIS HB2  H -28.765 -24.317  -7.221 1.00 . A A .   4 HIS HB2  1 1 
        3  3850 1 1   4 HIS HB3  H -27.901 -25.490  -6.232 1.00 . A A .   4 HIS HB3  1 1 
        3  3851 1 1   4 HIS HD1  H -28.754 -27.944  -6.275 1.00 . A A .   4 HIS HD1  1 1 
        3  3852 1 1   4 HIS HD2  H -30.811 -25.382  -8.821 1.00 . A A .   4 HIS HD2  1 1 
        3  3853 1 1   4 HIS HE1  H -30.090 -29.432  -7.792 1.00 . A A .   4 HIS HE1  1 1 
        3  3854 1 1   4 HIS HE2  H -31.241 -27.867  -9.391 1.00 . A A .   4 HIS HE2  1 1 
        3  3855 1 1   4 HIS N    N -30.939 -24.077  -5.726 1.00 . A A .   4 HIS N    1 1 
        3  3856 1 1   4 HIS ND1  N -29.342 -27.599  -6.983 1.00 . A A .   4 HIS ND1  1 1 
        3  3857 1 1   4 HIS NE2  N -30.721 -27.564  -8.614 1.00 . A A .   4 HIS NE2  1 1 
        3  3858 1 1   4 HIS O    O -27.617 -23.981  -4.244 1.00 . A A .   4 HIS O    1 1 
        3  3859 1 1   5 HIS C    C -27.475 -21.067  -3.619 1.00 . A A .   5 HIS C    1 1 
        3  3860 1 1   5 HIS CA   C -28.730 -21.731  -3.007 1.00 . A A .   5 HIS CA   1 1 
        3  3861 1 1   5 HIS CB   C -28.375 -22.515  -1.724 1.00 . A A .   5 HIS CB   1 1 
        3  3862 1 1   5 HIS CD2  C -26.517 -21.648  -0.121 1.00 . A A .   5 HIS CD2  1 1 
        3  3863 1 1   5 HIS CE1  C -27.717 -20.192   0.992 1.00 . A A .   5 HIS CE1  1 1 
        3  3864 1 1   5 HIS CG   C -27.778 -21.683  -0.626 1.00 . A A .   5 HIS CG   1 1 
        3  3865 1 1   5 HIS H    H -30.324 -22.442  -4.230 1.00 . A A .   5 HIS H    1 1 
        3  3866 1 1   5 HIS HA   H -29.435 -20.954  -2.751 1.00 . A A .   5 HIS HA   1 1 
        3  3867 1 1   5 HIS HB2  H -29.272 -22.976  -1.335 1.00 . A A .   5 HIS HB2  1 1 
        3  3868 1 1   5 HIS HB3  H -27.667 -23.292  -1.976 1.00 . A A .   5 HIS HB3  1 1 
        3  3869 1 1   5 HIS HD1  H -29.448 -20.542  -0.038 1.00 . A A .   5 HIS HD1  1 1 
        3  3870 1 1   5 HIS HD2  H -25.677 -22.245  -0.448 1.00 . A A .   5 HIS HD2  1 1 
        3  3871 1 1   5 HIS HE1  H -28.015 -19.437   1.703 1.00 . A A .   5 HIS HE1  1 1 
        3  3872 1 1   5 HIS HE2  H -25.778 -20.569   1.518 1.00 . A A .   5 HIS HE2  1 1 
        3  3873 1 1   5 HIS N    N -29.404 -22.641  -3.955 1.00 . A A .   5 HIS N    1 1 
        3  3874 1 1   5 HIS ND1  N -28.500 -20.760   0.096 1.00 . A A .   5 HIS ND1  1 1 
        3  3875 1 1   5 HIS NE2  N -26.511 -20.711   0.881 1.00 . A A .   5 HIS NE2  1 1 
        3  3876 1 1   5 HIS O    O -26.604 -20.576  -2.905 1.00 . A A .   5 HIS O    1 1 
        3  3877 1 1   6 HIS C    C -26.361 -18.915  -5.798 1.00 . A A .   6 HIS C    1 1 
        3  3878 1 1   6 HIS CA   C -26.238 -20.446  -5.638 1.00 . A A .   6 HIS CA   1 1 
        3  3879 1 1   6 HIS CB   C -26.039 -21.122  -7.008 1.00 . A A .   6 HIS CB   1 1 
        3  3880 1 1   6 HIS CD2  C -27.845 -19.977  -8.491 1.00 . A A .   6 HIS CD2  1 1 
        3  3881 1 1   6 HIS CE1  C -28.865 -21.776  -9.193 1.00 . A A .   6 HIS CE1  1 1 
        3  3882 1 1   6 HIS CG   C -27.224 -21.040  -7.927 1.00 . A A .   6 HIS CG   1 1 
        3  3883 1 1   6 HIS H    H -28.144 -21.382  -5.476 1.00 . A A .   6 HIS H    1 1 
        3  3884 1 1   6 HIS HA   H -25.368 -20.650  -5.029 1.00 . A A .   6 HIS HA   1 1 
        3  3885 1 1   6 HIS HB2  H -25.205 -20.656  -7.511 1.00 . A A .   6 HIS HB2  1 1 
        3  3886 1 1   6 HIS HB3  H -25.812 -22.167  -6.851 1.00 . A A .   6 HIS HB3  1 1 
        3  3887 1 1   6 HIS HD1  H -27.663 -23.083  -8.186 1.00 . A A .   6 HIS HD1  1 1 
        3  3888 1 1   6 HIS HD2  H -27.589 -18.937  -8.352 1.00 . A A .   6 HIS HD2  1 1 
        3  3889 1 1   6 HIS HE1  H -29.553 -22.437  -9.701 1.00 . A A .   6 HIS HE1  1 1 
        3  3890 1 1   6 HIS HE2  H -29.330 -19.949  -9.964 1.00 . A A .   6 HIS HE2  1 1 
        3  3891 1 1   6 HIS N    N -27.402 -21.024  -4.949 1.00 . A A .   6 HIS N    1 1 
        3  3892 1 1   6 HIS ND1  N -27.890 -22.151  -8.392 1.00 . A A .   6 HIS ND1  1 1 
        3  3893 1 1   6 HIS NE2  N -28.860 -20.465  -9.274 1.00 . A A .   6 HIS NE2  1 1 
        3  3894 1 1   6 HIS O    O -27.296 -18.300  -5.283 1.00 . A A .   6 HIS O    1 1 
        3  3895 1 1   7 HIS C    C -24.917 -16.065  -5.546 1.00 . A A .   7 HIS C    1 1 
        3  3896 1 1   7 HIS CA   C -25.365 -16.867  -6.789 1.00 . A A .   7 HIS CA   1 1 
        3  3897 1 1   7 HIS CB   C -26.726 -16.375  -7.319 1.00 . A A .   7 HIS CB   1 1 
        3  3898 1 1   7 HIS CD2  C -27.229 -13.826  -7.428 1.00 . A A .   7 HIS CD2  1 1 
        3  3899 1 1   7 HIS CE1  C -26.166 -13.377  -9.292 1.00 . A A .   7 HIS CE1  1 1 
        3  3900 1 1   7 HIS CG   C -26.692 -14.985  -7.881 1.00 . A A .   7 HIS CG   1 1 
        3  3901 1 1   7 HIS H    H -24.684 -18.879  -6.894 1.00 . A A .   7 HIS H    1 1 
        3  3902 1 1   7 HIS HA   H -24.624 -16.714  -7.561 1.00 . A A .   7 HIS HA   1 1 
        3  3903 1 1   7 HIS HB2  H -27.060 -17.041  -8.102 1.00 . A A .   7 HIS HB2  1 1 
        3  3904 1 1   7 HIS HB3  H -27.446 -16.393  -6.512 1.00 . A A .   7 HIS HB3  1 1 
        3  3905 1 1   7 HIS HD1  H -25.553 -15.295  -9.632 1.00 . A A .   7 HIS HD1  1 1 
        3  3906 1 1   7 HIS HD2  H -27.817 -13.700  -6.529 1.00 . A A .   7 HIS HD2  1 1 
        3  3907 1 1   7 HIS HE1  H -25.754 -12.847 -10.138 1.00 . A A .   7 HIS HE1  1 1 
        3  3908 1 1   7 HIS HE2  H -27.216 -11.922  -8.314 1.00 . A A .   7 HIS HE2  1 1 
        3  3909 1 1   7 HIS N    N -25.402 -18.320  -6.522 1.00 . A A .   7 HIS N    1 1 
        3  3910 1 1   7 HIS ND1  N -26.040 -14.667  -9.054 1.00 . A A .   7 HIS ND1  1 1 
        3  3911 1 1   7 HIS NE2  N -26.883 -12.845  -8.325 1.00 . A A .   7 HIS NE2  1 1 
        3  3912 1 1   7 HIS O    O -25.239 -14.885  -5.394 1.00 . A A .   7 HIS O    1 1 
        3  3913 1 1   8 HIS C    C -22.529 -14.968  -3.932 1.00 . A A .   8 HIS C    1 1 
        3  3914 1 1   8 HIS CA   C -23.539 -16.060  -3.510 1.00 . A A .   8 HIS CA   1 1 
        3  3915 1 1   8 HIS CB   C -22.872 -17.130  -2.619 1.00 . A A .   8 HIS CB   1 1 
        3  3916 1 1   8 HIS CD2  C -20.407 -16.845  -1.858 1.00 . A A .   8 HIS CD2  1 1 
        3  3917 1 1   8 HIS CE1  C -20.739 -15.524  -0.144 1.00 . A A .   8 HIS CE1  1 1 
        3  3918 1 1   8 HIS CG   C -21.741 -16.630  -1.765 1.00 . A A .   8 HIS CG   1 1 
        3  3919 1 1   8 HIS H    H -23.974 -17.667  -4.826 1.00 . A A .   8 HIS H    1 1 
        3  3920 1 1   8 HIS HA   H -24.337 -15.591  -2.951 1.00 . A A .   8 HIS HA   1 1 
        3  3921 1 1   8 HIS HB2  H -23.616 -17.545  -1.957 1.00 . A A .   8 HIS HB2  1 1 
        3  3922 1 1   8 HIS HB3  H -22.486 -17.920  -3.249 1.00 . A A .   8 HIS HB3  1 1 
        3  3923 1 1   8 HIS HD1  H -22.776 -15.473  -0.331 1.00 . A A .   8 HIS HD1  1 1 
        3  3924 1 1   8 HIS HD2  H -19.906 -17.466  -2.590 1.00 . A A .   8 HIS HD2  1 1 
        3  3925 1 1   8 HIS HE1  H -20.570 -14.900   0.721 1.00 . A A .   8 HIS HE1  1 1 
        3  3926 1 1   8 HIS HE2  H -18.844 -15.963  -0.777 1.00 . A A .   8 HIS HE2  1 1 
        3  3927 1 1   8 HIS N    N -24.144 -16.716  -4.679 1.00 . A A .   8 HIS N    1 1 
        3  3928 1 1   8 HIS ND1  N -21.914 -15.801  -0.677 1.00 . A A .   8 HIS ND1  1 1 
        3  3929 1 1   8 HIS NE2  N -19.808 -16.144  -0.842 1.00 . A A .   8 HIS NE2  1 1 
        3  3930 1 1   8 HIS O    O -21.879 -15.076  -4.971 1.00 . A A .   8 HIS O    1 1 
        3  3931 1 1   9 SER C    C -20.030 -13.194  -3.438 1.00 . A A .   9 SER C    1 1 
        3  3932 1 1   9 SER CA   C -21.512 -12.780  -3.396 1.00 . A A .   9 SER CA   1 1 
        3  3933 1 1   9 SER CB   C -21.704 -11.672  -2.350 1.00 . A A .   9 SER CB   1 1 
        3  3934 1 1   9 SER H    H -22.944 -13.903  -2.288 1.00 . A A .   9 SER H    1 1 
        3  3935 1 1   9 SER HA   H -21.783 -12.389  -4.365 1.00 . A A .   9 SER HA   1 1 
        3  3936 1 1   9 SER HB2  H -22.737 -11.356  -2.349 1.00 . A A .   9 SER HB2  1 1 
        3  3937 1 1   9 SER HB3  H -21.443 -12.055  -1.373 1.00 . A A .   9 SER HB3  1 1 
        3  3938 1 1   9 SER HG   H -21.431  -9.750  -2.679 1.00 . A A .   9 SER HG   1 1 
        3  3939 1 1   9 SER N    N -22.410 -13.919  -3.109 1.00 . A A .   9 SER N    1 1 
        3  3940 1 1   9 SER O    O -19.683 -14.347  -3.183 1.00 . A A .   9 SER O    1 1 
        3  3941 1 1   9 SER OG   O -20.884 -10.544  -2.634 1.00 . A A .   9 SER OG   1 1 
        3  3942 1 1  10 HIS C    C -16.886 -11.878  -2.785 1.00 . A A .  10 HIS C    1 1 
        3  3943 1 1  10 HIS CA   C -17.720 -12.521  -3.906 1.00 . A A .  10 HIS CA   1 1 
        3  3944 1 1  10 HIS CB   C -17.241 -12.018  -5.273 1.00 . A A .  10 HIS CB   1 1 
        3  3945 1 1  10 HIS CD2  C -17.904 -13.710  -7.131 1.00 . A A .  10 HIS CD2  1 1 
        3  3946 1 1  10 HIS CE1  C -19.650 -12.647  -7.913 1.00 . A A .  10 HIS CE1  1 1 
        3  3947 1 1  10 HIS CG   C -18.042 -12.569  -6.413 1.00 . A A .  10 HIS CG   1 1 
        3  3948 1 1  10 HIS H    H -19.475 -11.319  -3.863 1.00 . A A .  10 HIS H    1 1 
        3  3949 1 1  10 HIS HA   H -17.584 -13.594  -3.865 1.00 . A A .  10 HIS HA   1 1 
        3  3950 1 1  10 HIS HB2  H -17.316 -10.939  -5.300 1.00 . A A .  10 HIS HB2  1 1 
        3  3951 1 1  10 HIS HB3  H -16.210 -12.307  -5.418 1.00 . A A .  10 HIS HB3  1 1 
        3  3952 1 1  10 HIS HD1  H -19.503 -11.071  -6.630 1.00 . A A .  10 HIS HD1  1 1 
        3  3953 1 1  10 HIS HD2  H -17.139 -14.461  -7.000 1.00 . A A .  10 HIS HD2  1 1 
        3  3954 1 1  10 HIS HE1  H -20.516 -12.386  -8.502 1.00 . A A .  10 HIS HE1  1 1 
        3  3955 1 1  10 HIS HE2  H -18.973 -14.344  -8.822 1.00 . A A .  10 HIS HE2  1 1 
        3  3956 1 1  10 HIS N    N -19.153 -12.240  -3.749 1.00 . A A .  10 HIS N    1 1 
        3  3957 1 1  10 HIS ND1  N -19.143 -11.929  -6.935 1.00 . A A .  10 HIS ND1  1 1 
        3  3958 1 1  10 HIS NE2  N -18.918 -13.731  -8.056 1.00 . A A .  10 HIS NE2  1 1 
        3  3959 1 1  10 HIS O    O -17.168 -10.765  -2.339 1.00 . A A .  10 HIS O    1 1 
        3  3960 1 1  11 MET C    C -13.861 -11.173  -1.813 1.00 . A A .  11 MET C    1 1 
        3  3961 1 1  11 MET CA   C -14.969 -12.100  -1.276 1.00 . A A .  11 MET CA   1 1 
        3  3962 1 1  11 MET CB   C -14.340 -13.292  -0.549 1.00 . A A .  11 MET CB   1 1 
        3  3963 1 1  11 MET CE   C -17.236 -14.569   2.174 1.00 . A A .  11 MET CE   1 1 
        3  3964 1 1  11 MET CG   C -15.345 -14.164   0.189 1.00 . A A .  11 MET CG   1 1 
        3  3965 1 1  11 MET H    H -15.662 -13.455  -2.754 1.00 . A A .  11 MET H    1 1 
        3  3966 1 1  11 MET HA   H -15.575 -11.543  -0.572 1.00 . A A .  11 MET HA   1 1 
        3  3967 1 1  11 MET HB2  H -13.823 -13.906  -1.273 1.00 . A A .  11 MET HB2  1 1 
        3  3968 1 1  11 MET HB3  H -13.623 -12.921   0.169 1.00 . A A .  11 MET HB3  1 1 
        3  3969 1 1  11 MET HE1  H -17.826 -14.172   2.986 1.00 . A A .  11 MET HE1  1 1 
        3  3970 1 1  11 MET HE2  H -16.614 -15.373   2.540 1.00 . A A .  11 MET HE2  1 1 
        3  3971 1 1  11 MET HE3  H -17.890 -14.943   1.401 1.00 . A A .  11 MET HE3  1 1 
        3  3972 1 1  11 MET HG2  H -16.079 -14.527  -0.517 1.00 . A A .  11 MET HG2  1 1 
        3  3973 1 1  11 MET HG3  H -14.821 -15.004   0.625 1.00 . A A .  11 MET HG3  1 1 
        3  3974 1 1  11 MET N    N -15.847 -12.583  -2.347 1.00 . A A .  11 MET N    1 1 
        3  3975 1 1  11 MET O    O -12.931 -11.624  -2.480 1.00 . A A .  11 MET O    1 1 
        3  3976 1 1  11 MET SD   S -16.198 -13.271   1.502 1.00 . A A .  11 MET SD   1 1 
        3  3977 1 1  12 THR C    C -11.677  -8.942  -1.101 1.00 . A A .  12 THR C    1 1 
        3  3978 1 1  12 THR CA   C -12.961  -8.888  -1.947 1.00 . A A .  12 THR CA   1 1 
        3  3979 1 1  12 THR CB   C -13.518  -7.441  -1.912 1.00 . A A .  12 THR CB   1 1 
        3  3980 1 1  12 THR CG2  C -14.025  -7.071  -0.518 1.00 . A A .  12 THR CG2  1 1 
        3  3981 1 1  12 THR H    H -14.749  -9.573  -1.006 1.00 . A A .  12 THR H    1 1 
        3  3982 1 1  12 THR HA   H -12.702  -9.118  -2.973 1.00 . A A .  12 THR HA   1 1 
        3  3983 1 1  12 THR HB   H -14.345  -7.377  -2.607 1.00 . A A .  12 THR HB   1 1 
        3  3984 1 1  12 THR HG1  H -11.681  -6.981  -2.510 1.00 . A A .  12 THR HG1  1 1 
        3  3985 1 1  12 THR HG21 H -14.816  -7.748  -0.228 1.00 . A A .  12 THR HG21 1 1 
        3  3986 1 1  12 THR HG22 H -14.403  -6.059  -0.526 1.00 . A A .  12 THR HG22 1 1 
        3  3987 1 1  12 THR HG23 H -13.214  -7.144   0.193 1.00 . A A .  12 THR HG23 1 1 
        3  3988 1 1  12 THR N    N -13.967  -9.877  -1.511 1.00 . A A .  12 THR N    1 1 
        3  3989 1 1  12 THR O    O -10.594  -8.651  -1.597 1.00 . A A .  12 THR O    1 1 
        3  3990 1 1  12 THR OG1  O -12.501  -6.504  -2.321 1.00 . A A .  12 THR OG1  1 1 
        3  3991 1 1  13 GLY C    C -10.475  -8.249   2.030 1.00 . A A .  13 GLY C    1 1 
        3  3992 1 1  13 GLY CA   C -10.635  -9.412   1.049 1.00 . A A .  13 GLY CA   1 1 
        3  3993 1 1  13 GLY H    H -12.698  -9.467   0.536 1.00 . A A .  13 GLY H    1 1 
        3  3994 1 1  13 GLY HA2  H -10.725 -10.325   1.617 1.00 . A A .  13 GLY HA2  1 1 
        3  3995 1 1  13 GLY HA3  H  -9.746  -9.474   0.436 1.00 . A A .  13 GLY HA3  1 1 
        3  3996 1 1  13 GLY N    N -11.806  -9.294   0.178 1.00 . A A .  13 GLY N    1 1 
        3  3997 1 1  13 GLY O    O -11.385  -7.434   2.195 1.00 . A A .  13 GLY O    1 1 
        3  3998 1 1  14 ASN C    C  -7.506  -6.911   3.803 1.00 . A A .  14 ASN C    1 1 
        3  3999 1 1  14 ASN CA   C  -9.024  -7.118   3.665 1.00 . A A .  14 ASN CA   1 1 
        3  4000 1 1  14 ASN CB   C  -9.627  -7.457   5.036 1.00 . A A .  14 ASN CB   1 1 
        3  4001 1 1  14 ASN CG   C  -9.441  -6.339   6.051 1.00 . A A .  14 ASN CG   1 1 
        3  4002 1 1  14 ASN H    H  -8.643  -8.879   2.535 1.00 . A A .  14 ASN H    1 1 
        3  4003 1 1  14 ASN HA   H  -9.470  -6.203   3.299 1.00 . A A .  14 ASN HA   1 1 
        3  4004 1 1  14 ASN HB2  H -10.686  -7.637   4.923 1.00 . A A .  14 ASN HB2  1 1 
        3  4005 1 1  14 ASN HB3  H  -9.154  -8.351   5.420 1.00 . A A .  14 ASN HB3  1 1 
        3  4006 1 1  14 ASN HD21 H  -9.176  -7.652   7.504 1.00 . A A .  14 ASN HD21 1 1 
        3  4007 1 1  14 ASN HD22 H  -9.093  -5.993   7.962 1.00 . A A .  14 ASN HD22 1 1 
        3  4008 1 1  14 ASN N    N  -9.319  -8.188   2.697 1.00 . A A .  14 ASN N    1 1 
        3  4009 1 1  14 ASN ND2  N  -9.217  -6.697   7.297 1.00 . A A .  14 ASN ND2  1 1 
        3  4010 1 1  14 ASN O    O  -6.806  -7.749   4.371 1.00 . A A .  14 ASN O    1 1 
        3  4011 1 1  14 ASN OD1  O  -9.481  -5.160   5.712 1.00 . A A .  14 ASN OD1  1 1 
        3  4012 1 1  15 VAL C    C  -5.298  -4.097   3.901 1.00 . A A .  15 VAL C    1 1 
        3  4013 1 1  15 VAL CA   C  -5.564  -5.496   3.315 1.00 . A A .  15 VAL CA   1 1 
        3  4014 1 1  15 VAL CB   C  -4.939  -5.596   1.896 1.00 . A A .  15 VAL CB   1 1 
        3  4015 1 1  15 VAL CG1  C  -3.441  -5.301   1.927 1.00 . A A .  15 VAL CG1  1 1 
        3  4016 1 1  15 VAL CG2  C  -5.203  -6.972   1.284 1.00 . A A .  15 VAL CG2  1 1 
        3  4017 1 1  15 VAL H    H  -7.610  -5.148   2.866 1.00 . A A .  15 VAL H    1 1 
        3  4018 1 1  15 VAL HA   H  -5.085  -6.233   3.949 1.00 . A A .  15 VAL HA   1 1 
        3  4019 1 1  15 VAL HB   H  -5.414  -4.854   1.266 1.00 . A A .  15 VAL HB   1 1 
        3  4020 1 1  15 VAL HG11 H  -2.943  -6.023   2.558 1.00 . A A .  15 VAL HG11 1 1 
        3  4021 1 1  15 VAL HG12 H  -3.276  -4.307   2.319 1.00 . A A .  15 VAL HG12 1 1 
        3  4022 1 1  15 VAL HG13 H  -3.040  -5.363   0.925 1.00 . A A .  15 VAL HG13 1 1 
        3  4023 1 1  15 VAL HG21 H  -6.269  -7.135   1.204 1.00 . A A .  15 VAL HG21 1 1 
        3  4024 1 1  15 VAL HG22 H  -4.768  -7.739   1.912 1.00 . A A .  15 VAL HG22 1 1 
        3  4025 1 1  15 VAL HG23 H  -4.759  -7.021   0.300 1.00 . A A .  15 VAL HG23 1 1 
        3  4026 1 1  15 VAL N    N  -7.002  -5.793   3.281 1.00 . A A .  15 VAL N    1 1 
        3  4027 1 1  15 VAL O    O  -5.940  -3.122   3.516 1.00 . A A .  15 VAL O    1 1 
        3  4028 1 1  16 CYS C    C  -2.506  -2.479   5.537 1.00 . A A .  16 CYS C    1 1 
        3  4029 1 1  16 CYS CA   C  -4.022  -2.734   5.501 1.00 . A A .  16 CYS CA   1 1 
        3  4030 1 1  16 CYS CB   C  -4.575  -2.739   6.932 1.00 . A A .  16 CYS CB   1 1 
        3  4031 1 1  16 CYS H    H  -3.836  -4.812   5.070 1.00 . A A .  16 CYS H    1 1 
        3  4032 1 1  16 CYS HA   H  -4.494  -1.934   4.947 1.00 . A A .  16 CYS HA   1 1 
        3  4033 1 1  16 CYS HB2  H  -4.366  -1.786   7.398 1.00 . A A .  16 CYS HB2  1 1 
        3  4034 1 1  16 CYS HB3  H  -5.645  -2.888   6.899 1.00 . A A .  16 CYS HB3  1 1 
        3  4035 1 1  16 CYS HG   H  -4.118  -5.201   7.418 1.00 . A A .  16 CYS HG   1 1 
        3  4036 1 1  16 CYS N    N  -4.342  -4.005   4.829 1.00 . A A .  16 CYS N    1 1 
        3  4037 1 1  16 CYS O    O  -1.709  -3.406   5.414 1.00 . A A .  16 CYS O    1 1 
        3  4038 1 1  16 CYS SG   S  -3.876  -4.029   7.989 1.00 . A A .  16 CYS SG   1 1 
        3  4039 1 1  17 ILE C    C  -0.075  -1.085   7.142 1.00 . A A .  17 ILE C    1 1 
        3  4040 1 1  17 ILE CA   C  -0.689  -0.844   5.754 1.00 . A A .  17 ILE CA   1 1 
        3  4041 1 1  17 ILE CB   C  -0.478   0.643   5.365 1.00 . A A .  17 ILE CB   1 1 
        3  4042 1 1  17 ILE CD1  C  -0.885   2.350   3.504 1.00 . A A .  17 ILE CD1  1 1 
        3  4043 1 1  17 ILE CG1  C  -0.998   0.905   3.944 1.00 . A A .  17 ILE CG1  1 1 
        3  4044 1 1  17 ILE CG2  C   1.000   1.030   5.480 1.00 . A A .  17 ILE CG2  1 1 
        3  4045 1 1  17 ILE H    H  -2.789  -0.520   5.826 1.00 . A A .  17 ILE H    1 1 
        3  4046 1 1  17 ILE HA   H  -0.167  -1.458   5.029 1.00 . A A .  17 ILE HA   1 1 
        3  4047 1 1  17 ILE HB   H  -1.036   1.255   6.061 1.00 . A A .  17 ILE HB   1 1 
        3  4048 1 1  17 ILE HD11 H   0.152   2.653   3.518 1.00 . A A .  17 ILE HD11 1 1 
        3  4049 1 1  17 ILE HD12 H  -1.453   2.978   4.174 1.00 . A A .  17 ILE HD12 1 1 
        3  4050 1 1  17 ILE HD13 H  -1.272   2.451   2.501 1.00 . A A .  17 ILE HD13 1 1 
        3  4051 1 1  17 ILE HG12 H  -0.438   0.302   3.242 1.00 . A A .  17 ILE HG12 1 1 
        3  4052 1 1  17 ILE HG13 H  -2.040   0.626   3.897 1.00 . A A .  17 ILE HG13 1 1 
        3  4053 1 1  17 ILE HG21 H   1.126   2.069   5.206 1.00 . A A .  17 ILE HG21 1 1 
        3  4054 1 1  17 ILE HG22 H   1.589   0.412   4.817 1.00 . A A .  17 ILE HG22 1 1 
        3  4055 1 1  17 ILE HG23 H   1.335   0.883   6.496 1.00 . A A .  17 ILE HG23 1 1 
        3  4056 1 1  17 ILE N    N  -2.113  -1.217   5.715 1.00 . A A .  17 ILE N    1 1 
        3  4057 1 1  17 ILE O    O  -0.475  -0.460   8.131 1.00 . A A .  17 ILE O    1 1 
        3  4058 1 1  18 GLU C    C   2.684  -1.228   8.755 1.00 . A A .  18 GLU C    1 1 
        3  4059 1 1  18 GLU CA   C   1.606  -2.279   8.458 1.00 . A A .  18 GLU CA   1 1 
        3  4060 1 1  18 GLU CB   C   2.250  -3.671   8.394 1.00 . A A .  18 GLU CB   1 1 
        3  4061 1 1  18 GLU CD   C   3.739  -5.374   9.551 1.00 . A A .  18 GLU CD   1 1 
        3  4062 1 1  18 GLU CG   C   3.095  -4.002   9.622 1.00 . A A .  18 GLU CG   1 1 
        3  4063 1 1  18 GLU H    H   1.165  -2.458   6.389 1.00 . A A .  18 GLU H    1 1 
        3  4064 1 1  18 GLU HA   H   0.878  -2.268   9.259 1.00 . A A .  18 GLU HA   1 1 
        3  4065 1 1  18 GLU HB2  H   1.470  -4.415   8.305 1.00 . A A .  18 GLU HB2  1 1 
        3  4066 1 1  18 GLU HB3  H   2.885  -3.723   7.520 1.00 . A A .  18 GLU HB3  1 1 
        3  4067 1 1  18 GLU HG2  H   3.877  -3.261   9.714 1.00 . A A .  18 GLU HG2  1 1 
        3  4068 1 1  18 GLU HG3  H   2.461  -3.960  10.498 1.00 . A A .  18 GLU HG3  1 1 
        3  4069 1 1  18 GLU N    N   0.903  -1.982   7.206 1.00 . A A .  18 GLU N    1 1 
        3  4070 1 1  18 GLU O    O   2.752  -0.682   9.858 1.00 . A A .  18 GLU O    1 1 
        3  4071 1 1  18 GLU OE1  O   4.849  -5.490   8.990 1.00 . A A .  18 GLU OE1  1 1 
        3  4072 1 1  18 GLU OE2  O   3.146  -6.341  10.074 1.00 . A A .  18 GLU OE2  1 1 
        3  4073 1 1  19 GLU C    C   5.191   0.473   6.591 1.00 . A A .  19 GLU C    1 1 
        3  4074 1 1  19 GLU CA   C   4.647  -0.017   7.943 1.00 . A A .  19 GLU CA   1 1 
        3  4075 1 1  19 GLU CB   C   5.767  -0.688   8.756 1.00 . A A .  19 GLU CB   1 1 
        3  4076 1 1  19 GLU CD   C   7.969  -0.453   9.983 1.00 . A A .  19 GLU CD   1 1 
        3  4077 1 1  19 GLU CG   C   6.929   0.236   9.116 1.00 . A A .  19 GLU CG   1 1 
        3  4078 1 1  19 GLU H    H   3.400  -1.381   6.893 1.00 . A A .  19 GLU H    1 1 
        3  4079 1 1  19 GLU HA   H   4.277   0.836   8.495 1.00 . A A .  19 GLU HA   1 1 
        3  4080 1 1  19 GLU HB2  H   5.345  -1.069   9.675 1.00 . A A .  19 GLU HB2  1 1 
        3  4081 1 1  19 GLU HB3  H   6.161  -1.519   8.185 1.00 . A A .  19 GLU HB3  1 1 
        3  4082 1 1  19 GLU HG2  H   7.402   0.575   8.203 1.00 . A A .  19 GLU HG2  1 1 
        3  4083 1 1  19 GLU HG3  H   6.539   1.091   9.652 1.00 . A A .  19 GLU HG3  1 1 
        3  4084 1 1  19 GLU N    N   3.530  -0.952   7.765 1.00 . A A .  19 GLU N    1 1 
        3  4085 1 1  19 GLU O    O   5.095  -0.217   5.578 1.00 . A A .  19 GLU O    1 1 
        3  4086 1 1  19 GLU OE1  O   7.798  -0.480  11.220 1.00 . A A .  19 GLU OE1  1 1 
        3  4087 1 1  19 GLU OE2  O   8.955  -0.988   9.437 1.00 . A A .  19 GLU OE2  1 1 
        3  4088 1 1  20 ILE C    C   7.857   2.461   5.556 1.00 . A A .  20 ILE C    1 1 
        3  4089 1 1  20 ILE CA   C   6.342   2.269   5.379 1.00 . A A .  20 ILE CA   1 1 
        3  4090 1 1  20 ILE CB   C   5.678   3.632   5.045 1.00 . A A .  20 ILE CB   1 1 
        3  4091 1 1  20 ILE CD1  C   3.407   4.755   4.627 1.00 . A A .  20 ILE CD1  1 1 
        3  4092 1 1  20 ILE CG1  C   4.153   3.464   4.907 1.00 . A A .  20 ILE CG1  1 1 
        3  4093 1 1  20 ILE CG2  C   6.270   4.236   3.769 1.00 . A A .  20 ILE CG2  1 1 
        3  4094 1 1  20 ILE H    H   5.781   2.190   7.421 1.00 . A A .  20 ILE H    1 1 
        3  4095 1 1  20 ILE HA   H   6.168   1.591   4.553 1.00 . A A .  20 ILE HA   1 1 
        3  4096 1 1  20 ILE HB   H   5.882   4.312   5.860 1.00 . A A .  20 ILE HB   1 1 
        3  4097 1 1  20 ILE HD11 H   2.348   4.552   4.566 1.00 . A A .  20 ILE HD11 1 1 
        3  4098 1 1  20 ILE HD12 H   3.749   5.172   3.690 1.00 . A A .  20 ILE HD12 1 1 
        3  4099 1 1  20 ILE HD13 H   3.592   5.461   5.423 1.00 . A A .  20 ILE HD13 1 1 
        3  4100 1 1  20 ILE HG12 H   3.945   2.783   4.095 1.00 . A A .  20 ILE HG12 1 1 
        3  4101 1 1  20 ILE HG13 H   3.760   3.047   5.824 1.00 . A A .  20 ILE HG13 1 1 
        3  4102 1 1  20 ILE HG21 H   7.332   4.391   3.899 1.00 . A A .  20 ILE HG21 1 1 
        3  4103 1 1  20 ILE HG22 H   5.795   5.184   3.561 1.00 . A A .  20 ILE HG22 1 1 
        3  4104 1 1  20 ILE HG23 H   6.107   3.563   2.938 1.00 . A A .  20 ILE HG23 1 1 
        3  4105 1 1  20 ILE N    N   5.752   1.680   6.587 1.00 . A A .  20 ILE N    1 1 
        3  4106 1 1  20 ILE O    O   8.336   2.685   6.668 1.00 . A A .  20 ILE O    1 1 
        3  4107 1 1  21 ASP C    C  10.519   3.846   5.069 1.00 . A A .  21 ASP C    1 1 
        3  4108 1 1  21 ASP CA   C  10.063   2.490   4.491 1.00 . A A .  21 ASP CA   1 1 
        3  4109 1 1  21 ASP CB   C  10.629   2.297   3.082 1.00 . A A .  21 ASP CB   1 1 
        3  4110 1 1  21 ASP CG   C  12.141   2.409   3.038 1.00 . A A .  21 ASP CG   1 1 
        3  4111 1 1  21 ASP H    H   8.160   2.222   3.593 1.00 . A A .  21 ASP H    1 1 
        3  4112 1 1  21 ASP HA   H  10.439   1.699   5.126 1.00 . A A .  21 ASP HA   1 1 
        3  4113 1 1  21 ASP HB2  H  10.351   1.318   2.719 1.00 . A A .  21 ASP HB2  1 1 
        3  4114 1 1  21 ASP HB3  H  10.209   3.047   2.427 1.00 . A A .  21 ASP HB3  1 1 
        3  4115 1 1  21 ASP N    N   8.603   2.368   4.456 1.00 . A A .  21 ASP N    1 1 
        3  4116 1 1  21 ASP O    O   9.890   4.879   4.838 1.00 . A A .  21 ASP O    1 1 
        3  4117 1 1  21 ASP OD1  O  12.816   1.758   3.860 1.00 . A A .  21 ASP OD1  1 1 
        3  4118 1 1  21 ASP OD2  O  12.660   3.143   2.178 1.00 . A A .  21 ASP OD2  1 1 
        3  4119 1 1  22 VAL C    C  12.763   6.018   5.415 1.00 . A A .  22 VAL C    1 1 
        3  4120 1 1  22 VAL CA   C  12.171   5.037   6.443 1.00 . A A .  22 VAL CA   1 1 
        3  4121 1 1  22 VAL CB   C  13.251   4.667   7.496 1.00 . A A .  22 VAL CB   1 1 
        3  4122 1 1  22 VAL CG1  C  14.408   3.902   6.853 1.00 . A A .  22 VAL CG1  1 1 
        3  4123 1 1  22 VAL CG2  C  13.757   5.912   8.227 1.00 . A A .  22 VAL CG2  1 1 
        3  4124 1 1  22 VAL H    H  12.107   2.979   5.916 1.00 . A A .  22 VAL H    1 1 
        3  4125 1 1  22 VAL HA   H  11.357   5.527   6.960 1.00 . A A .  22 VAL HA   1 1 
        3  4126 1 1  22 VAL HB   H  12.791   4.015   8.229 1.00 . A A .  22 VAL HB   1 1 
        3  4127 1 1  22 VAL HG11 H  14.898   4.530   6.121 1.00 . A A .  22 VAL HG11 1 1 
        3  4128 1 1  22 VAL HG12 H  14.028   3.014   6.365 1.00 . A A .  22 VAL HG12 1 1 
        3  4129 1 1  22 VAL HG13 H  15.120   3.614   7.613 1.00 . A A .  22 VAL HG13 1 1 
        3  4130 1 1  22 VAL HG21 H  14.473   5.623   8.985 1.00 . A A .  22 VAL HG21 1 1 
        3  4131 1 1  22 VAL HG22 H  12.926   6.419   8.696 1.00 . A A .  22 VAL HG22 1 1 
        3  4132 1 1  22 VAL HG23 H  14.232   6.579   7.522 1.00 . A A .  22 VAL HG23 1 1 
        3  4133 1 1  22 VAL N    N  11.631   3.828   5.804 1.00 . A A .  22 VAL N    1 1 
        3  4134 1 1  22 VAL O    O  12.718   7.237   5.600 1.00 . A A .  22 VAL O    1 1 
        3  4135 1 1  23 ASP C    C  12.820   6.821   2.319 1.00 . A A .  23 ASP C    1 1 
        3  4136 1 1  23 ASP CA   C  13.910   6.292   3.275 1.00 . A A .  23 ASP CA   1 1 
        3  4137 1 1  23 ASP CB   C  14.952   5.454   2.516 1.00 . A A .  23 ASP CB   1 1 
        3  4138 1 1  23 ASP CG   C  15.818   6.283   1.587 1.00 . A A .  23 ASP CG   1 1 
        3  4139 1 1  23 ASP H    H  13.318   4.501   4.238 1.00 . A A .  23 ASP H    1 1 
        3  4140 1 1  23 ASP HA   H  14.406   7.134   3.742 1.00 . A A .  23 ASP HA   1 1 
        3  4141 1 1  23 ASP HB2  H  15.597   4.963   3.232 1.00 . A A .  23 ASP HB2  1 1 
        3  4142 1 1  23 ASP HB3  H  14.441   4.702   1.930 1.00 . A A .  23 ASP HB3  1 1 
        3  4143 1 1  23 ASP N    N  13.313   5.477   4.332 1.00 . A A .  23 ASP N    1 1 
        3  4144 1 1  23 ASP O    O  12.785   8.012   1.991 1.00 . A A .  23 ASP O    1 1 
        3  4145 1 1  23 ASP OD1  O  15.432   6.480   0.420 1.00 . A A .  23 ASP OD1  1 1 
        3  4146 1 1  23 ASP OD2  O  16.903   6.733   2.016 1.00 . A A .  23 ASP OD2  1 1 
        3  4147 1 1  24 GLY C    C  10.713   5.441  -0.242 1.00 . A A .  24 GLY C    1 1 
        3  4148 1 1  24 GLY CA   C  10.813   6.297   1.022 1.00 . A A .  24 GLY CA   1 1 
        3  4149 1 1  24 GLY H    H  12.026   4.993   2.180 1.00 . A A .  24 GLY H    1 1 
        3  4150 1 1  24 GLY HA2  H   9.893   6.191   1.579 1.00 . A A .  24 GLY HA2  1 1 
        3  4151 1 1  24 GLY HA3  H  10.923   7.332   0.731 1.00 . A A .  24 GLY HA3  1 1 
        3  4152 1 1  24 GLY N    N  11.928   5.923   1.893 1.00 . A A .  24 GLY N    1 1 
        3  4153 1 1  24 GLY O    O  10.125   5.857  -1.238 1.00 . A A .  24 GLY O    1 1 
        3  4154 1 1  25 LYS C    C  10.095   2.434  -1.510 1.00 . A A .  25 LYS C    1 1 
        3  4155 1 1  25 LYS CA   C  11.318   3.364  -1.382 1.00 . A A .  25 LYS CA   1 1 
        3  4156 1 1  25 LYS CB   C  12.610   2.534  -1.370 1.00 . A A .  25 LYS CB   1 1 
        3  4157 1 1  25 LYS CD   C  15.136   2.519  -1.538 1.00 . A A .  25 LYS CD   1 1 
        3  4158 1 1  25 LYS CE   C  16.375   3.342  -1.879 1.00 . A A .  25 LYS CE   1 1 
        3  4159 1 1  25 LYS CG   C  13.871   3.372  -1.554 1.00 . A A .  25 LYS CG   1 1 
        3  4160 1 1  25 LYS H    H  11.668   3.919   0.642 1.00 . A A .  25 LYS H    1 1 
        3  4161 1 1  25 LYS HA   H  11.340   4.006  -2.252 1.00 . A A .  25 LYS HA   1 1 
        3  4162 1 1  25 LYS HB2  H  12.682   2.014  -0.425 1.00 . A A .  25 LYS HB2  1 1 
        3  4163 1 1  25 LYS HB3  H  12.565   1.806  -2.168 1.00 . A A .  25 LYS HB3  1 1 
        3  4164 1 1  25 LYS HD2  H  15.260   2.090  -0.553 1.00 . A A .  25 LYS HD2  1 1 
        3  4165 1 1  25 LYS HD3  H  15.032   1.724  -2.266 1.00 . A A .  25 LYS HD3  1 1 
        3  4166 1 1  25 LYS HE2  H  17.239   2.695  -1.854 1.00 . A A .  25 LYS HE2  1 1 
        3  4167 1 1  25 LYS HE3  H  16.261   3.747  -2.875 1.00 . A A .  25 LYS HE3  1 1 
        3  4168 1 1  25 LYS HG2  H  13.812   3.887  -2.503 1.00 . A A .  25 LYS HG2  1 1 
        3  4169 1 1  25 LYS HG3  H  13.927   4.099  -0.756 1.00 . A A .  25 LYS HG3  1 1 
        3  4170 1 1  25 LYS HZ1  H  16.817   4.092   0.019 1.00 . A A .  25 LYS HZ1  1 1 
        3  4171 1 1  25 LYS HZ2  H  15.741   5.057  -0.861 1.00 . A A .  25 LYS HZ2  1 1 
        3  4172 1 1  25 LYS HZ3  H  17.384   5.055  -1.248 1.00 . A A .  25 LYS HZ3  1 1 
        3  4173 1 1  25 LYS N    N  11.271   4.232  -0.198 1.00 . A A .  25 LYS N    1 1 
        3  4174 1 1  25 LYS NZ   N  16.593   4.462  -0.925 1.00 . A A .  25 LYS NZ   1 1 
        3  4175 1 1  25 LYS O    O   9.727   2.051  -2.625 1.00 . A A .  25 LYS O    1 1 
        3  4176 1 1  26 PHE C    C   7.315   1.284   0.692 1.00 . A A .  26 PHE C    1 1 
        3  4177 1 1  26 PHE CA   C   8.343   1.103  -0.444 1.00 . A A .  26 PHE CA   1 1 
        3  4178 1 1  26 PHE CB   C   8.880  -0.338  -0.432 1.00 . A A .  26 PHE CB   1 1 
        3  4179 1 1  26 PHE CD1  C   8.914  -1.178   1.951 1.00 . A A .  26 PHE CD1  1 1 
        3  4180 1 1  26 PHE CD2  C  10.997  -0.669   0.899 1.00 . A A .  26 PHE CD2  1 1 
        3  4181 1 1  26 PHE CE1  C   9.579  -1.545   3.103 1.00 . A A .  26 PHE CE1  1 1 
        3  4182 1 1  26 PHE CE2  C  11.667  -1.038   2.049 1.00 . A A .  26 PHE CE2  1 1 
        3  4183 1 1  26 PHE CG   C   9.612  -0.733   0.832 1.00 . A A .  26 PHE CG   1 1 
        3  4184 1 1  26 PHE CZ   C  10.959  -1.476   3.152 1.00 . A A .  26 PHE CZ   1 1 
        3  4185 1 1  26 PHE H    H   9.736   2.446   0.468 1.00 . A A .  26 PHE H    1 1 
        3  4186 1 1  26 PHE HA   H   7.831   1.263  -1.382 1.00 . A A .  26 PHE HA   1 1 
        3  4187 1 1  26 PHE HB2  H   8.053  -1.020  -0.561 1.00 . A A .  26 PHE HB2  1 1 
        3  4188 1 1  26 PHE HB3  H   9.563  -0.461  -1.263 1.00 . A A .  26 PHE HB3  1 1 
        3  4189 1 1  26 PHE HD1  H   7.836  -1.234   1.914 1.00 . A A .  26 PHE HD1  1 1 
        3  4190 1 1  26 PHE HD2  H  11.554  -0.325   0.039 1.00 . A A .  26 PHE HD2  1 1 
        3  4191 1 1  26 PHE HE1  H   9.023  -1.888   3.964 1.00 . A A .  26 PHE HE1  1 1 
        3  4192 1 1  26 PHE HE2  H  12.744  -0.983   2.087 1.00 . A A .  26 PHE HE2  1 1 
        3  4193 1 1  26 PHE HZ   H  11.483  -1.764   4.051 1.00 . A A .  26 PHE HZ   1 1 
        3  4194 1 1  26 PHE N    N   9.461   2.065  -0.391 1.00 . A A .  26 PHE N    1 1 
        3  4195 1 1  26 PHE O    O   7.600   1.881   1.732 1.00 . A A .  26 PHE O    1 1 
        3  4196 1 1  27 ILE C    C   4.512  -0.684   1.711 1.00 . A A .  27 ILE C    1 1 
        3  4197 1 1  27 ILE CA   C   5.028   0.749   1.469 1.00 . A A .  27 ILE CA   1 1 
        3  4198 1 1  27 ILE CB   C   3.847   1.638   0.990 1.00 . A A .  27 ILE CB   1 1 
        3  4199 1 1  27 ILE CD1  C   3.256   3.995   0.173 1.00 . A A .  27 ILE CD1  1 1 
        3  4200 1 1  27 ILE CG1  C   4.327   3.077   0.727 1.00 . A A .  27 ILE CG1  1 1 
        3  4201 1 1  27 ILE CG2  C   2.705   1.623   2.010 1.00 . A A .  27 ILE CG2  1 1 
        3  4202 1 1  27 ILE H    H   5.942   0.324  -0.402 1.00 . A A .  27 ILE H    1 1 
        3  4203 1 1  27 ILE HA   H   5.414   1.153   2.397 1.00 . A A .  27 ILE HA   1 1 
        3  4204 1 1  27 ILE HB   H   3.471   1.222   0.064 1.00 . A A .  27 ILE HB   1 1 
        3  4205 1 1  27 ILE HD11 H   2.880   3.591  -0.757 1.00 . A A .  27 ILE HD11 1 1 
        3  4206 1 1  27 ILE HD12 H   3.678   4.973  -0.004 1.00 . A A .  27 ILE HD12 1 1 
        3  4207 1 1  27 ILE HD13 H   2.447   4.076   0.884 1.00 . A A .  27 ILE HD13 1 1 
        3  4208 1 1  27 ILE HG12 H   4.680   3.508   1.652 1.00 . A A .  27 ILE HG12 1 1 
        3  4209 1 1  27 ILE HG13 H   5.142   3.054   0.015 1.00 . A A .  27 ILE HG13 1 1 
        3  4210 1 1  27 ILE HG21 H   3.060   2.001   2.958 1.00 . A A .  27 ILE HG21 1 1 
        3  4211 1 1  27 ILE HG22 H   2.347   0.611   2.138 1.00 . A A .  27 ILE HG22 1 1 
        3  4212 1 1  27 ILE HG23 H   1.896   2.244   1.654 1.00 . A A .  27 ILE HG23 1 1 
        3  4213 1 1  27 ILE N    N   6.112   0.742   0.471 1.00 . A A .  27 ILE N    1 1 
        3  4214 1 1  27 ILE O    O   4.050  -1.339   0.782 1.00 . A A .  27 ILE O    1 1 
        3  4215 1 1  28 ARG C    C   2.733  -2.707   3.682 1.00 . A A .  28 ARG C    1 1 
        3  4216 1 1  28 ARG CA   C   4.203  -2.569   3.240 1.00 . A A .  28 ARG CA   1 1 
        3  4217 1 1  28 ARG CB   C   5.108  -3.166   4.327 1.00 . A A .  28 ARG CB   1 1 
        3  4218 1 1  28 ARG CD   C   5.557  -5.135   5.860 1.00 . A A .  28 ARG CD   1 1 
        3  4219 1 1  28 ARG CG   C   4.812  -4.639   4.625 1.00 . A A .  28 ARG CG   1 1 
        3  4220 1 1  28 ARG CZ   C   7.790  -4.712   6.761 1.00 . A A .  28 ARG CZ   1 1 
        3  4221 1 1  28 ARG H    H   4.895  -0.598   3.681 1.00 . A A .  28 ARG H    1 1 
        3  4222 1 1  28 ARG HA   H   4.341  -3.139   2.330 1.00 . A A .  28 ARG HA   1 1 
        3  4223 1 1  28 ARG HB2  H   6.138  -3.083   4.009 1.00 . A A .  28 ARG HB2  1 1 
        3  4224 1 1  28 ARG HB3  H   4.977  -2.602   5.240 1.00 . A A .  28 ARG HB3  1 1 
        3  4225 1 1  28 ARG HD2  H   5.196  -4.597   6.725 1.00 . A A .  28 ARG HD2  1 1 
        3  4226 1 1  28 ARG HD3  H   5.355  -6.190   5.986 1.00 . A A .  28 ARG HD3  1 1 
        3  4227 1 1  28 ARG HE   H   7.393  -4.975   4.851 1.00 . A A .  28 ARG HE   1 1 
        3  4228 1 1  28 ARG HG2  H   3.751  -4.755   4.790 1.00 . A A .  28 ARG HG2  1 1 
        3  4229 1 1  28 ARG HG3  H   5.110  -5.234   3.774 1.00 . A A .  28 ARG HG3  1 1 
        3  4230 1 1  28 ARG HH11 H   6.348  -4.856   8.134 1.00 . A A .  28 ARG HH11 1 1 
        3  4231 1 1  28 ARG HH12 H   7.933  -4.510   8.737 1.00 . A A .  28 ARG HH12 1 1 
        3  4232 1 1  28 ARG HH21 H   9.423  -4.540   5.644 1.00 . A A .  28 ARG HH21 1 1 
        3  4233 1 1  28 ARG HH22 H   9.652  -4.329   7.341 1.00 . A A .  28 ARG HH22 1 1 
        3  4234 1 1  28 ARG N    N   4.585  -1.175   2.950 1.00 . A A .  28 ARG N    1 1 
        3  4235 1 1  28 ARG NE   N   7.002  -4.941   5.746 1.00 . A A .  28 ARG NE   1 1 
        3  4236 1 1  28 ARG NH1  N   7.322  -4.691   7.970 1.00 . A A .  28 ARG NH1  1 1 
        3  4237 1 1  28 ARG NH2  N   9.053  -4.515   6.566 1.00 . A A .  28 ARG NH2  1 1 
        3  4238 1 1  28 ARG O    O   2.342  -2.230   4.752 1.00 . A A .  28 ARG O    1 1 
        3  4239 1 1  29 LEU C    C   0.483  -5.209   3.663 1.00 . A A .  29 LEU C    1 1 
        3  4240 1 1  29 LEU CA   C   0.555  -3.736   3.222 1.00 . A A .  29 LEU CA   1 1 
        3  4241 1 1  29 LEU CB   C  -0.406  -3.495   2.046 1.00 . A A .  29 LEU CB   1 1 
        3  4242 1 1  29 LEU CD1  C   0.647  -1.433   1.001 1.00 . A A .  29 LEU CD1  1 1 
        3  4243 1 1  29 LEU CD2  C  -1.801  -1.902   0.675 1.00 . A A .  29 LEU CD2  1 1 
        3  4244 1 1  29 LEU CG   C  -0.614  -2.024   1.630 1.00 . A A .  29 LEU CG   1 1 
        3  4245 1 1  29 LEU H    H   2.273  -3.655   1.981 1.00 . A A .  29 LEU H    1 1 
        3  4246 1 1  29 LEU HA   H   0.257  -3.110   4.054 1.00 . A A .  29 LEU HA   1 1 
        3  4247 1 1  29 LEU HB2  H  -0.031  -4.040   1.189 1.00 . A A .  29 LEU HB2  1 1 
        3  4248 1 1  29 LEU HB3  H  -1.370  -3.907   2.313 1.00 . A A .  29 LEU HB3  1 1 
        3  4249 1 1  29 LEU HD11 H   1.455  -1.459   1.717 1.00 . A A .  29 LEU HD11 1 1 
        3  4250 1 1  29 LEU HD12 H   0.459  -0.408   0.711 1.00 . A A .  29 LEU HD12 1 1 
        3  4251 1 1  29 LEU HD13 H   0.922  -2.008   0.127 1.00 . A A .  29 LEU HD13 1 1 
        3  4252 1 1  29 LEU HD21 H  -2.693  -2.279   1.155 1.00 . A A .  29 LEU HD21 1 1 
        3  4253 1 1  29 LEU HD22 H  -1.606  -2.474  -0.222 1.00 . A A .  29 LEU HD22 1 1 
        3  4254 1 1  29 LEU HD23 H  -1.948  -0.863   0.413 1.00 . A A .  29 LEU HD23 1 1 
        3  4255 1 1  29 LEU HG   H  -0.844  -1.442   2.512 1.00 . A A .  29 LEU HG   1 1 
        3  4256 1 1  29 LEU N    N   1.931  -3.381   2.859 1.00 . A A .  29 LEU N    1 1 
        3  4257 1 1  29 LEU O    O   1.409  -5.984   3.416 1.00 . A A .  29 LEU O    1 1 
        3  4258 1 1  30 LYS C    C  -2.237  -7.415   4.853 1.00 . A A .  30 LYS C    1 1 
        3  4259 1 1  30 LYS CA   C  -0.765  -6.974   4.804 1.00 . A A .  30 LYS CA   1 1 
        3  4260 1 1  30 LYS CB   C  -0.136  -7.096   6.200 1.00 . A A .  30 LYS CB   1 1 
        3  4261 1 1  30 LYS CD   C   0.566  -8.595   8.112 1.00 . A A .  30 LYS CD   1 1 
        3  4262 1 1  30 LYS CE   C   0.638 -10.028   8.635 1.00 . A A .  30 LYS CE   1 1 
        3  4263 1 1  30 LYS CG   C  -0.138  -8.519   6.762 1.00 . A A .  30 LYS CG   1 1 
        3  4264 1 1  30 LYS H    H  -1.340  -4.958   4.450 1.00 . A A .  30 LYS H    1 1 
        3  4265 1 1  30 LYS HA   H  -0.232  -7.631   4.127 1.00 . A A .  30 LYS HA   1 1 
        3  4266 1 1  30 LYS HB2  H   0.889  -6.754   6.149 1.00 . A A .  30 LYS HB2  1 1 
        3  4267 1 1  30 LYS HB3  H  -0.680  -6.460   6.884 1.00 . A A .  30 LYS HB3  1 1 
        3  4268 1 1  30 LYS HD2  H   1.571  -8.212   8.004 1.00 . A A .  30 LYS HD2  1 1 
        3  4269 1 1  30 LYS HD3  H   0.024  -7.987   8.824 1.00 . A A .  30 LYS HD3  1 1 
        3  4270 1 1  30 LYS HE2  H  -0.367 -10.392   8.797 1.00 . A A .  30 LYS HE2  1 1 
        3  4271 1 1  30 LYS HE3  H   1.128 -10.647   7.895 1.00 . A A .  30 LYS HE3  1 1 
        3  4272 1 1  30 LYS HG2  H  -1.160  -8.850   6.882 1.00 . A A .  30 LYS HG2  1 1 
        3  4273 1 1  30 LYS HG3  H   0.371  -9.170   6.064 1.00 . A A .  30 LYS HG3  1 1 
        3  4274 1 1  30 LYS HZ1  H   0.910  -9.556  10.652 1.00 . A A .  30 LYS HZ1  1 1 
        3  4275 1 1  30 LYS HZ2  H   2.354  -9.752   9.789 1.00 . A A .  30 LYS HZ2  1 1 
        3  4276 1 1  30 LYS HZ3  H   1.444 -11.104  10.230 1.00 . A A .  30 LYS HZ3  1 1 
        3  4277 1 1  30 LYS N    N  -0.616  -5.601   4.304 1.00 . A A .  30 LYS N    1 1 
        3  4278 1 1  30 LYS NZ   N   1.390 -10.116   9.914 1.00 . A A .  30 LYS NZ   1 1 
        3  4279 1 1  30 LYS O    O  -3.121  -6.641   5.227 1.00 . A A .  30 LYS O    1 1 
        3  4280 1 1  31 ASN C    C  -4.084  -9.912   5.895 1.00 . A A .  31 ASN C    1 1 
        3  4281 1 1  31 ASN CA   C  -3.823  -9.267   4.520 1.00 . A A .  31 ASN CA   1 1 
        3  4282 1 1  31 ASN CB   C  -3.949 -10.315   3.403 1.00 . A A .  31 ASN CB   1 1 
        3  4283 1 1  31 ASN CG   C  -5.261 -11.080   3.430 1.00 . A A .  31 ASN CG   1 1 
        3  4284 1 1  31 ASN H    H  -1.736  -9.212   4.140 1.00 . A A .  31 ASN H    1 1 
        3  4285 1 1  31 ASN HA   H  -4.550  -8.483   4.354 1.00 . A A .  31 ASN HA   1 1 
        3  4286 1 1  31 ASN HB2  H  -3.872  -9.819   2.446 1.00 . A A .  31 ASN HB2  1 1 
        3  4287 1 1  31 ASN HB3  H  -3.138 -11.025   3.495 1.00 . A A .  31 ASN HB3  1 1 
        3  4288 1 1  31 ASN HD21 H  -4.391 -12.668   2.624 1.00 . A A .  31 ASN HD21 1 1 
        3  4289 1 1  31 ASN HD22 H  -6.076 -12.819   2.970 1.00 . A A .  31 ASN HD22 1 1 
        3  4290 1 1  31 ASN N    N  -2.483  -8.667   4.469 1.00 . A A .  31 ASN N    1 1 
        3  4291 1 1  31 ASN ND2  N  -5.238 -12.313   2.963 1.00 . A A .  31 ASN ND2  1 1 
        3  4292 1 1  31 ASN O    O  -3.169 -10.450   6.519 1.00 . A A .  31 ASN O    1 1 
        3  4293 1 1  31 ASN OD1  O  -6.289 -10.573   3.867 1.00 . A A .  31 ASN OD1  1 1 
        3  4294 1 1  32 THR C    C  -6.747 -11.530   7.579 1.00 . A A .  32 THR C    1 1 
        3  4295 1 1  32 THR CA   C  -5.694 -10.413   7.682 1.00 . A A .  32 THR CA   1 1 
        3  4296 1 1  32 THR CB   C  -6.239  -9.319   8.635 1.00 . A A .  32 THR CB   1 1 
        3  4297 1 1  32 THR CG2  C  -5.223  -8.194   8.822 1.00 . A A .  32 THR CG2  1 1 
        3  4298 1 1  32 THR H    H  -6.028  -9.427   5.819 1.00 . A A .  32 THR H    1 1 
        3  4299 1 1  32 THR HA   H  -4.797 -10.827   8.127 1.00 . A A .  32 THR HA   1 1 
        3  4300 1 1  32 THR HB   H  -6.433  -9.769   9.600 1.00 . A A .  32 THR HB   1 1 
        3  4301 1 1  32 THR HG1  H  -8.130  -8.783   8.827 1.00 . A A .  32 THR HG1  1 1 
        3  4302 1 1  32 THR HG21 H  -5.634  -7.441   9.481 1.00 . A A .  32 THR HG21 1 1 
        3  4303 1 1  32 THR HG22 H  -4.996  -7.745   7.865 1.00 . A A .  32 THR HG22 1 1 
        3  4304 1 1  32 THR HG23 H  -4.317  -8.594   9.255 1.00 . A A .  32 THR HG23 1 1 
        3  4305 1 1  32 THR N    N  -5.332  -9.856   6.364 1.00 . A A .  32 THR N    1 1 
        3  4306 1 1  32 THR O    O  -7.263 -11.999   8.595 1.00 . A A .  32 THR O    1 1 
        3  4307 1 1  32 THR OG1  O  -7.467  -8.777   8.124 1.00 . A A .  32 THR OG1  1 1 
        3  4308 1 1  33 SER C    C  -7.524 -14.416   6.370 1.00 . A A .  33 SER C    1 1 
        3  4309 1 1  33 SER CA   C  -8.085 -13.002   6.150 1.00 . A A .  33 SER CA   1 1 
        3  4310 1 1  33 SER CB   C  -8.672 -12.913   4.735 1.00 . A A .  33 SER CB   1 1 
        3  4311 1 1  33 SER H    H  -6.605 -11.577   5.582 1.00 . A A .  33 SER H    1 1 
        3  4312 1 1  33 SER HA   H  -8.879 -12.829   6.865 1.00 . A A .  33 SER HA   1 1 
        3  4313 1 1  33 SER HB2  H  -9.509 -13.591   4.649 1.00 . A A .  33 SER HB2  1 1 
        3  4314 1 1  33 SER HB3  H  -9.008 -11.903   4.548 1.00 . A A .  33 SER HB3  1 1 
        3  4315 1 1  33 SER HG   H  -8.080 -13.894   3.137 1.00 . A A .  33 SER HG   1 1 
        3  4316 1 1  33 SER N    N  -7.063 -11.963   6.360 1.00 . A A .  33 SER N    1 1 
        3  4317 1 1  33 SER O    O  -6.329 -14.661   6.216 1.00 . A A .  33 SER O    1 1 
        3  4318 1 1  33 SER OG   O  -7.705 -13.259   3.758 1.00 . A A .  33 SER OG   1 1 
        3  4319 1 1  34 GLU C    C  -7.968 -17.546   5.599 1.00 . A A .  34 GLU C    1 1 
        3  4320 1 1  34 GLU CA   C  -8.034 -16.757   6.920 1.00 . A A .  34 GLU CA   1 1 
        3  4321 1 1  34 GLU CB   C  -9.055 -17.431   7.846 1.00 . A A .  34 GLU CB   1 1 
        3  4322 1 1  34 GLU CD   C -10.229 -17.478  10.087 1.00 . A A .  34 GLU CD   1 1 
        3  4323 1 1  34 GLU CG   C  -9.151 -16.816   9.238 1.00 . A A .  34 GLU CG   1 1 
        3  4324 1 1  34 GLU H    H  -9.350 -15.094   6.820 1.00 . A A .  34 GLU H    1 1 
        3  4325 1 1  34 GLU HA   H  -7.061 -16.777   7.393 1.00 . A A .  34 GLU HA   1 1 
        3  4326 1 1  34 GLU HB2  H -10.032 -17.372   7.384 1.00 . A A .  34 GLU HB2  1 1 
        3  4327 1 1  34 GLU HB3  H  -8.786 -18.474   7.956 1.00 . A A .  34 GLU HB3  1 1 
        3  4328 1 1  34 GLU HG2  H  -8.198 -16.930   9.737 1.00 . A A .  34 GLU HG2  1 1 
        3  4329 1 1  34 GLU HG3  H  -9.382 -15.763   9.138 1.00 . A A .  34 GLU HG3  1 1 
        3  4330 1 1  34 GLU N    N  -8.413 -15.352   6.703 1.00 . A A .  34 GLU N    1 1 
        3  4331 1 1  34 GLU O    O  -7.799 -18.769   5.605 1.00 . A A .  34 GLU O    1 1 
        3  4332 1 1  34 GLU OE1  O -10.045 -18.650  10.479 1.00 . A A .  34 GLU OE1  1 1 
        3  4333 1 1  34 GLU OE2  O -11.270 -16.838  10.354 1.00 . A A .  34 GLU OE2  1 1 
        3  4334 1 1  35 GLN C    C  -7.536 -16.659   2.057 1.00 . A A .  35 GLN C    1 1 
        3  4335 1 1  35 GLN CA   C  -8.192 -17.506   3.161 1.00 . A A .  35 GLN CA   1 1 
        3  4336 1 1  35 GLN CB   C  -9.671 -17.760   2.826 1.00 . A A .  35 GLN CB   1 1 
        3  4337 1 1  35 GLN CD   C -11.389 -18.642   1.193 1.00 . A A .  35 GLN CD   1 1 
        3  4338 1 1  35 GLN CG   C  -9.910 -18.484   1.502 1.00 . A A .  35 GLN CG   1 1 
        3  4339 1 1  35 GLN H    H  -8.112 -15.872   4.520 1.00 . A A .  35 GLN H    1 1 
        3  4340 1 1  35 GLN HA   H  -7.678 -18.454   3.225 1.00 . A A .  35 GLN HA   1 1 
        3  4341 1 1  35 GLN HB2  H -10.106 -18.353   3.617 1.00 . A A .  35 GLN HB2  1 1 
        3  4342 1 1  35 GLN HB3  H -10.183 -16.808   2.785 1.00 . A A .  35 GLN HB3  1 1 
        3  4343 1 1  35 GLN HE21 H -11.409 -16.889   0.277 1.00 . A A .  35 GLN HE21 1 1 
        3  4344 1 1  35 GLN HE22 H -12.919 -17.728   0.344 1.00 . A A .  35 GLN HE22 1 1 
        3  4345 1 1  35 GLN HG2  H  -9.447 -17.919   0.704 1.00 . A A .  35 GLN HG2  1 1 
        3  4346 1 1  35 GLN HG3  H  -9.460 -19.467   1.554 1.00 . A A .  35 GLN HG3  1 1 
        3  4347 1 1  35 GLN N    N  -8.096 -16.849   4.473 1.00 . A A .  35 GLN N    1 1 
        3  4348 1 1  35 GLN NE2  N -11.961 -17.658   0.534 1.00 . A A .  35 GLN NE2  1 1 
        3  4349 1 1  35 GLN O    O  -7.406 -15.441   2.193 1.00 . A A .  35 GLN O    1 1 
        3  4350 1 1  35 GLN OE1  O -12.014 -19.632   1.558 1.00 . A A .  35 GLN OE1  1 1 
        3  4351 1 1  36 ASP C    C  -7.578 -15.769  -0.918 1.00 . A A .  36 ASP C    1 1 
        3  4352 1 1  36 ASP CA   C  -6.527 -16.627  -0.183 1.00 . A A .  36 ASP CA   1 1 
        3  4353 1 1  36 ASP CB   C  -5.919 -17.655  -1.149 1.00 . A A .  36 ASP CB   1 1 
        3  4354 1 1  36 ASP CG   C  -5.052 -18.674  -0.429 1.00 . A A .  36 ASP CG   1 1 
        3  4355 1 1  36 ASP H    H  -7.216 -18.290   0.942 1.00 . A A .  36 ASP H    1 1 
        3  4356 1 1  36 ASP HA   H  -5.740 -15.980   0.184 1.00 . A A .  36 ASP HA   1 1 
        3  4357 1 1  36 ASP HB2  H  -6.716 -18.179  -1.661 1.00 . A A .  36 ASP HB2  1 1 
        3  4358 1 1  36 ASP HB3  H  -5.309 -17.140  -1.880 1.00 . A A .  36 ASP HB3  1 1 
        3  4359 1 1  36 ASP N    N  -7.122 -17.316   0.970 1.00 . A A .  36 ASP N    1 1 
        3  4360 1 1  36 ASP O    O  -8.446 -16.297  -1.618 1.00 . A A .  36 ASP O    1 1 
        3  4361 1 1  36 ASP OD1  O  -5.592 -19.719   0.008 1.00 . A A .  36 ASP OD1  1 1 
        3  4362 1 1  36 ASP OD2  O  -3.834 -18.440  -0.288 1.00 . A A .  36 ASP OD2  1 1 
        3  4363 1 1  37 GLN C    C  -7.937 -12.770  -2.534 1.00 . A A .  37 GLN C    1 1 
        3  4364 1 1  37 GLN CA   C  -8.496 -13.528  -1.316 1.00 . A A .  37 GLN CA   1 1 
        3  4365 1 1  37 GLN CB   C  -8.942 -12.514  -0.248 1.00 . A A .  37 GLN CB   1 1 
        3  4366 1 1  37 GLN CD   C -10.582 -14.059   0.946 1.00 . A A .  37 GLN CD   1 1 
        3  4367 1 1  37 GLN CG   C  -9.376 -13.142   1.073 1.00 . A A .  37 GLN CG   1 1 
        3  4368 1 1  37 GLN H    H  -6.737 -14.079  -0.254 1.00 . A A .  37 GLN H    1 1 
        3  4369 1 1  37 GLN HA   H  -9.352 -14.111  -1.629 1.00 . A A .  37 GLN HA   1 1 
        3  4370 1 1  37 GLN HB2  H  -8.123 -11.837  -0.045 1.00 . A A .  37 GLN HB2  1 1 
        3  4371 1 1  37 GLN HB3  H  -9.774 -11.943  -0.638 1.00 . A A .  37 GLN HB3  1 1 
        3  4372 1 1  37 GLN HE21 H -11.806 -12.556   1.329 1.00 . A A .  37 GLN HE21 1 1 
        3  4373 1 1  37 GLN HE22 H -12.551 -14.087   1.061 1.00 . A A .  37 GLN HE22 1 1 
        3  4374 1 1  37 GLN HG2  H  -8.550 -13.717   1.469 1.00 . A A .  37 GLN HG2  1 1 
        3  4375 1 1  37 GLN HG3  H  -9.617 -12.348   1.768 1.00 . A A .  37 GLN HG3  1 1 
        3  4376 1 1  37 GLN N    N  -7.495 -14.449  -0.753 1.00 . A A .  37 GLN N    1 1 
        3  4377 1 1  37 GLN NE2  N -11.764 -13.511   1.129 1.00 . A A .  37 GLN NE2  1 1 
        3  4378 1 1  37 GLN O    O  -6.755 -12.437  -2.571 1.00 . A A .  37 GLN O    1 1 
        3  4379 1 1  37 GLN OE1  O -10.456 -15.249   0.698 1.00 . A A .  37 GLN OE1  1 1 
        3  4380 1 1  38 PRO C    C  -7.798 -10.309  -4.335 1.00 . A A .  38 PRO C    1 1 
        3  4381 1 1  38 PRO CA   C  -8.368 -11.690  -4.721 1.00 . A A .  38 PRO CA   1 1 
        3  4382 1 1  38 PRO CB   C  -9.673 -11.531  -5.520 1.00 . A A .  38 PRO CB   1 1 
        3  4383 1 1  38 PRO CD   C -10.184 -12.929  -3.649 1.00 . A A .  38 PRO CD   1 1 
        3  4384 1 1  38 PRO CG   C -10.519 -12.684  -5.096 1.00 . A A .  38 PRO CG   1 1 
        3  4385 1 1  38 PRO HA   H  -7.639 -12.219  -5.321 1.00 . A A .  38 PRO HA   1 1 
        3  4386 1 1  38 PRO HB2  H -10.141 -10.585  -5.275 1.00 . A A .  38 PRO HB2  1 1 
        3  4387 1 1  38 PRO HB3  H  -9.460 -11.566  -6.579 1.00 . A A .  38 PRO HB3  1 1 
        3  4388 1 1  38 PRO HD2  H -10.821 -12.338  -3.004 1.00 . A A .  38 PRO HD2  1 1 
        3  4389 1 1  38 PRO HD3  H -10.277 -13.981  -3.409 1.00 . A A .  38 PRO HD3  1 1 
        3  4390 1 1  38 PRO HG2  H -11.566 -12.434  -5.204 1.00 . A A .  38 PRO HG2  1 1 
        3  4391 1 1  38 PRO HG3  H -10.279 -13.555  -5.691 1.00 . A A .  38 PRO HG3  1 1 
        3  4392 1 1  38 PRO N    N  -8.780 -12.490  -3.551 1.00 . A A .  38 PRO N    1 1 
        3  4393 1 1  38 PRO O    O  -8.101  -9.777  -3.268 1.00 . A A .  38 PRO O    1 1 
        3  4394 1 1  39 MET C    C  -7.396  -7.312  -4.769 1.00 . A A .  39 MET C    1 1 
        3  4395 1 1  39 MET CA   C  -6.345  -8.429  -4.960 1.00 . A A .  39 MET CA   1 1 
        3  4396 1 1  39 MET CB   C  -5.393  -8.072  -6.114 1.00 . A A .  39 MET CB   1 1 
        3  4397 1 1  39 MET CE   C  -4.072  -6.816  -3.127 1.00 . A A .  39 MET CE   1 1 
        3  4398 1 1  39 MET CG   C  -4.558  -6.807  -5.896 1.00 . A A .  39 MET CG   1 1 
        3  4399 1 1  39 MET H    H  -6.768 -10.210  -6.046 1.00 . A A .  39 MET H    1 1 
        3  4400 1 1  39 MET HA   H  -5.770  -8.517  -4.050 1.00 . A A .  39 MET HA   1 1 
        3  4401 1 1  39 MET HB2  H  -4.712  -8.898  -6.266 1.00 . A A .  39 MET HB2  1 1 
        3  4402 1 1  39 MET HB3  H  -5.976  -7.937  -7.014 1.00 . A A .  39 MET HB3  1 1 
        3  4403 1 1  39 MET HE1  H  -4.851  -7.558  -3.039 1.00 . A A .  39 MET HE1  1 1 
        3  4404 1 1  39 MET HE2  H  -4.507  -5.828  -3.079 1.00 . A A .  39 MET HE2  1 1 
        3  4405 1 1  39 MET HE3  H  -3.367  -6.938  -2.316 1.00 . A A .  39 MET HE3  1 1 
        3  4406 1 1  39 MET HG2  H  -4.121  -6.515  -6.841 1.00 . A A .  39 MET HG2  1 1 
        3  4407 1 1  39 MET HG3  H  -5.211  -6.018  -5.551 1.00 . A A .  39 MET HG3  1 1 
        3  4408 1 1  39 MET N    N  -6.973  -9.738  -5.214 1.00 . A A .  39 MET N    1 1 
        3  4409 1 1  39 MET O    O  -7.153  -6.325  -4.073 1.00 . A A .  39 MET O    1 1 
        3  4410 1 1  39 MET SD   S  -3.220  -7.019  -4.694 1.00 . A A .  39 MET SD   1 1 
        3  4411 1 1  40 GLY C    C  -9.559  -5.316  -6.190 1.00 . A A .  40 GLY C    1 1 
        3  4412 1 1  40 GLY CA   C  -9.648  -6.513  -5.246 1.00 . A A .  40 GLY CA   1 1 
        3  4413 1 1  40 GLY H    H  -8.668  -8.235  -6.006 1.00 . A A .  40 GLY H    1 1 
        3  4414 1 1  40 GLY HA2  H -10.583  -7.027  -5.428 1.00 . A A .  40 GLY HA2  1 1 
        3  4415 1 1  40 GLY HA3  H  -9.649  -6.154  -4.227 1.00 . A A .  40 GLY HA3  1 1 
        3  4416 1 1  40 GLY N    N  -8.554  -7.468  -5.409 1.00 . A A .  40 GLY N    1 1 
        3  4417 1 1  40 GLY O    O  -8.608  -5.182  -6.962 1.00 . A A .  40 GLY O    1 1 
        3  4418 1 1  41 GLY C    C -10.539  -1.957  -6.174 1.00 . A A .  41 GLY C    1 1 
        3  4419 1 1  41 GLY CA   C -10.585  -3.251  -6.979 1.00 . A A .  41 GLY CA   1 1 
        3  4420 1 1  41 GLY H    H -11.301  -4.609  -5.512 1.00 . A A .  41 GLY H    1 1 
        3  4421 1 1  41 GLY HA2  H  -9.734  -3.272  -7.647 1.00 . A A .  41 GLY HA2  1 1 
        3  4422 1 1  41 GLY HA3  H -11.488  -3.261  -7.568 1.00 . A A .  41 GLY HA3  1 1 
        3  4423 1 1  41 GLY N    N -10.564  -4.443  -6.133 1.00 . A A .  41 GLY N    1 1 
        3  4424 1 1  41 GLY O    O -11.380  -1.074  -6.350 1.00 . A A .  41 GLY O    1 1 
        3  4425 1 1  42 TRP C    C  -8.366   0.301  -4.981 1.00 . A A .  42 TRP C    1 1 
        3  4426 1 1  42 TRP CA   C  -9.411  -0.676  -4.416 1.00 . A A .  42 TRP CA   1 1 
        3  4427 1 1  42 TRP CB   C  -8.992  -1.117  -3.004 1.00 . A A .  42 TRP CB   1 1 
        3  4428 1 1  42 TRP CD1  C -10.935  -2.771  -2.620 1.00 . A A .  42 TRP CD1  1 1 
        3  4429 1 1  42 TRP CD2  C  -8.928  -3.522  -1.964 1.00 . A A .  42 TRP CD2  1 1 
        3  4430 1 1  42 TRP CE2  C  -9.888  -4.516  -1.702 1.00 . A A .  42 TRP CE2  1 1 
        3  4431 1 1  42 TRP CE3  C  -7.590  -3.773  -1.632 1.00 . A A .  42 TRP CE3  1 1 
        3  4432 1 1  42 TRP CG   C  -9.614  -2.412  -2.555 1.00 . A A .  42 TRP CG   1 1 
        3  4433 1 1  42 TRP CH2  C  -8.242  -5.956  -0.811 1.00 . A A .  42 TRP CH2  1 1 
        3  4434 1 1  42 TRP CZ2  C  -9.555  -5.738  -1.126 1.00 . A A .  42 TRP CZ2  1 1 
        3  4435 1 1  42 TRP CZ3  C  -7.263  -4.988  -1.060 1.00 . A A .  42 TRP CZ3  1 1 
        3  4436 1 1  42 TRP H    H  -8.902  -2.579  -5.213 1.00 . A A .  42 TRP H    1 1 
        3  4437 1 1  42 TRP HA   H -10.369  -0.176  -4.361 1.00 . A A .  42 TRP HA   1 1 
        3  4438 1 1  42 TRP HB2  H  -7.918  -1.240  -2.977 1.00 . A A .  42 TRP HB2  1 1 
        3  4439 1 1  42 TRP HB3  H  -9.275  -0.349  -2.296 1.00 . A A .  42 TRP HB3  1 1 
        3  4440 1 1  42 TRP HD1  H -11.719  -2.142  -3.019 1.00 . A A .  42 TRP HD1  1 1 
        3  4441 1 1  42 TRP HE1  H -11.958  -4.524  -2.055 1.00 . A A .  42 TRP HE1  1 1 
        3  4442 1 1  42 TRP HE3  H  -6.820  -3.039  -1.819 1.00 . A A .  42 TRP HE3  1 1 
        3  4443 1 1  42 TRP HH2  H  -7.940  -6.893  -0.361 1.00 . A A .  42 TRP HH2  1 1 
        3  4444 1 1  42 TRP HZ2  H -10.299  -6.495  -0.928 1.00 . A A .  42 TRP HZ2  1 1 
        3  4445 1 1  42 TRP HZ3  H  -6.237  -5.201  -0.798 1.00 . A A .  42 TRP HZ3  1 1 
        3  4446 1 1  42 TRP N    N  -9.554  -1.850  -5.287 1.00 . A A .  42 TRP N    1 1 
        3  4447 1 1  42 TRP NE1  N -11.104  -4.037  -2.112 1.00 . A A .  42 TRP NE1  1 1 
        3  4448 1 1  42 TRP O    O  -7.672  -0.015  -5.947 1.00 . A A .  42 TRP O    1 1 
        3  4449 1 1  43 GLU C    C  -6.545   3.112  -3.589 1.00 . A A .  43 GLU C    1 1 
        3  4450 1 1  43 GLU CA   C  -7.231   2.457  -4.797 1.00 . A A .  43 GLU CA   1 1 
        3  4451 1 1  43 GLU CB   C  -7.844   3.532  -5.711 1.00 . A A .  43 GLU CB   1 1 
        3  4452 1 1  43 GLU CD   C  -7.406   5.533  -7.232 1.00 . A A .  43 GLU CD   1 1 
        3  4453 1 1  43 GLU CG   C  -6.822   4.542  -6.234 1.00 . A A .  43 GLU CG   1 1 
        3  4454 1 1  43 GLU H    H  -8.849   1.706  -3.632 1.00 . A A .  43 GLU H    1 1 
        3  4455 1 1  43 GLU HA   H  -6.478   1.919  -5.360 1.00 . A A .  43 GLU HA   1 1 
        3  4456 1 1  43 GLU HB2  H  -8.305   3.044  -6.560 1.00 . A A .  43 GLU HB2  1 1 
        3  4457 1 1  43 GLU HB3  H  -8.606   4.069  -5.161 1.00 . A A .  43 GLU HB3  1 1 
        3  4458 1 1  43 GLU HG2  H  -6.424   5.097  -5.395 1.00 . A A .  43 GLU HG2  1 1 
        3  4459 1 1  43 GLU HG3  H  -6.018   4.001  -6.714 1.00 . A A .  43 GLU HG3  1 1 
        3  4460 1 1  43 GLU N    N  -8.247   1.482  -4.376 1.00 . A A .  43 GLU N    1 1 
        3  4461 1 1  43 GLU O    O  -7.192   3.475  -2.603 1.00 . A A .  43 GLU O    1 1 
        3  4462 1 1  43 GLU OE1  O  -8.076   6.497  -6.801 1.00 . A A .  43 GLU OE1  1 1 
        3  4463 1 1  43 GLU OE2  O  -7.181   5.362  -8.451 1.00 . A A .  43 GLU OE2  1 1 
        3  4464 1 1  44 MET C    C  -3.974   5.269  -2.944 1.00 . A A .  44 MET C    1 1 
        3  4465 1 1  44 MET CA   C  -4.425   3.839  -2.597 1.00 . A A .  44 MET CA   1 1 
        3  4466 1 1  44 MET CB   C  -3.203   2.953  -2.332 1.00 . A A .  44 MET CB   1 1 
        3  4467 1 1  44 MET CE   C  -0.088   2.328  -2.383 1.00 . A A .  44 MET CE   1 1 
        3  4468 1 1  44 MET CG   C  -2.331   3.439  -1.189 1.00 . A A .  44 MET CG   1 1 
        3  4469 1 1  44 MET H    H  -4.771   2.952  -4.493 1.00 . A A .  44 MET H    1 1 
        3  4470 1 1  44 MET HA   H  -5.036   3.871  -1.705 1.00 . A A .  44 MET HA   1 1 
        3  4471 1 1  44 MET HB2  H  -3.543   1.955  -2.096 1.00 . A A .  44 MET HB2  1 1 
        3  4472 1 1  44 MET HB3  H  -2.598   2.913  -3.226 1.00 . A A .  44 MET HB3  1 1 
        3  4473 1 1  44 MET HE1  H   0.787   1.699  -2.304 1.00 . A A .  44 MET HE1  1 1 
        3  4474 1 1  44 MET HE2  H   0.215   3.337  -2.619 1.00 . A A .  44 MET HE2  1 1 
        3  4475 1 1  44 MET HE3  H  -0.731   1.952  -3.166 1.00 . A A .  44 MET HE3  1 1 
        3  4476 1 1  44 MET HG2  H  -1.920   4.403  -1.452 1.00 . A A .  44 MET HG2  1 1 
        3  4477 1 1  44 MET HG3  H  -2.943   3.544  -0.303 1.00 . A A .  44 MET HG3  1 1 
        3  4478 1 1  44 MET N    N  -5.225   3.253  -3.677 1.00 . A A .  44 MET N    1 1 
        3  4479 1 1  44 MET O    O  -3.321   5.493  -3.963 1.00 . A A .  44 MET O    1 1 
        3  4480 1 1  44 MET SD   S  -0.969   2.316  -0.822 1.00 . A A .  44 MET SD   1 1 
        3  4481 1 1  45 ILE C    C  -2.813   8.079  -1.380 1.00 . A A .  45 ILE C    1 1 
        3  4482 1 1  45 ILE CA   C  -3.958   7.643  -2.316 1.00 . A A .  45 ILE CA   1 1 
        3  4483 1 1  45 ILE CB   C  -5.170   8.603  -2.111 1.00 . A A .  45 ILE CB   1 1 
        3  4484 1 1  45 ILE CD1  C  -7.079   7.016  -2.813 1.00 . A A .  45 ILE CD1  1 1 
        3  4485 1 1  45 ILE CG1  C  -6.313   8.295  -3.105 1.00 . A A .  45 ILE CG1  1 1 
        3  4486 1 1  45 ILE CG2  C  -4.730  10.063  -2.247 1.00 . A A .  45 ILE CG2  1 1 
        3  4487 1 1  45 ILE H    H  -4.850   5.999  -1.297 1.00 . A A .  45 ILE H    1 1 
        3  4488 1 1  45 ILE HA   H  -3.623   7.740  -3.341 1.00 . A A .  45 ILE HA   1 1 
        3  4489 1 1  45 ILE HB   H  -5.537   8.463  -1.103 1.00 . A A .  45 ILE HB   1 1 
        3  4490 1 1  45 ILE HD11 H  -7.892   6.915  -3.517 1.00 . A A .  45 ILE HD11 1 1 
        3  4491 1 1  45 ILE HD12 H  -7.475   7.055  -1.809 1.00 . A A .  45 ILE HD12 1 1 
        3  4492 1 1  45 ILE HD13 H  -6.416   6.168  -2.905 1.00 . A A .  45 ILE HD13 1 1 
        3  4493 1 1  45 ILE HG12 H  -7.025   9.107  -3.086 1.00 . A A .  45 ILE HG12 1 1 
        3  4494 1 1  45 ILE HG13 H  -5.900   8.213  -4.102 1.00 . A A .  45 ILE HG13 1 1 
        3  4495 1 1  45 ILE HG21 H  -5.584  10.713  -2.118 1.00 . A A .  45 ILE HG21 1 1 
        3  4496 1 1  45 ILE HG22 H  -4.303  10.222  -3.227 1.00 . A A .  45 ILE HG22 1 1 
        3  4497 1 1  45 ILE HG23 H  -3.989  10.290  -1.493 1.00 . A A .  45 ILE HG23 1 1 
        3  4498 1 1  45 ILE N    N  -4.327   6.235  -2.094 1.00 . A A .  45 ILE N    1 1 
        3  4499 1 1  45 ILE O    O  -2.917   7.966  -0.162 1.00 . A A .  45 ILE O    1 1 
        3  4500 1 1  46 ARG C    C  -0.685  10.539  -0.827 1.00 . A A .  46 ARG C    1 1 
        3  4501 1 1  46 ARG CA   C  -0.571   9.047  -1.177 1.00 . A A .  46 ARG CA   1 1 
        3  4502 1 1  46 ARG CB   C   0.722   8.819  -1.971 1.00 . A A .  46 ARG CB   1 1 
        3  4503 1 1  46 ARG CD   C   3.204   9.255  -2.171 1.00 . A A .  46 ARG CD   1 1 
        3  4504 1 1  46 ARG CG   C   1.986   9.287  -1.250 1.00 . A A .  46 ARG CG   1 1 
        3  4505 1 1  46 ARG CZ   C   5.210  10.629  -1.832 1.00 . A A .  46 ARG CZ   1 1 
        3  4506 1 1  46 ARG H    H  -1.694   8.643  -2.932 1.00 . A A .  46 ARG H    1 1 
        3  4507 1 1  46 ARG HA   H  -0.528   8.472  -0.263 1.00 . A A .  46 ARG HA   1 1 
        3  4508 1 1  46 ARG HB2  H   0.823   7.763  -2.177 1.00 . A A .  46 ARG HB2  1 1 
        3  4509 1 1  46 ARG HB3  H   0.650   9.353  -2.910 1.00 . A A .  46 ARG HB3  1 1 
        3  4510 1 1  46 ARG HD2  H   3.318   8.253  -2.562 1.00 . A A .  46 ARG HD2  1 1 
        3  4511 1 1  46 ARG HD3  H   3.036   9.941  -2.992 1.00 . A A .  46 ARG HD3  1 1 
        3  4512 1 1  46 ARG HE   H   4.717   9.076  -0.727 1.00 . A A .  46 ARG HE   1 1 
        3  4513 1 1  46 ARG HG2  H   1.837  10.301  -0.904 1.00 . A A .  46 ARG HG2  1 1 
        3  4514 1 1  46 ARG HG3  H   2.167   8.639  -0.404 1.00 . A A .  46 ARG HG3  1 1 
        3  4515 1 1  46 ARG HH11 H   4.000  11.295  -3.270 1.00 . A A .  46 ARG HH11 1 1 
        3  4516 1 1  46 ARG HH12 H   5.479  12.166  -3.066 1.00 . A A .  46 ARG HH12 1 1 
        3  4517 1 1  46 ARG HH21 H   6.602  10.242  -0.467 1.00 . A A .  46 ARG HH21 1 1 
        3  4518 1 1  46 ARG HH22 H   6.913  11.600  -1.489 1.00 . A A .  46 ARG HH22 1 1 
        3  4519 1 1  46 ARG N    N  -1.726   8.583  -1.956 1.00 . A A .  46 ARG N    1 1 
        3  4520 1 1  46 ARG NE   N   4.439   9.629  -1.480 1.00 . A A .  46 ARG NE   1 1 
        3  4521 1 1  46 ARG NH1  N   4.866  11.425  -2.791 1.00 . A A .  46 ARG NH1  1 1 
        3  4522 1 1  46 ARG NH2  N   6.325  10.837  -1.211 1.00 . A A .  46 ARG NH2  1 1 
        3  4523 1 1  46 ARG O    O  -0.810  11.380  -1.716 1.00 . A A .  46 ARG O    1 1 
        3  4524 1 1  47 LYS C    C   0.733  12.551   1.645 1.00 . A A .  47 LYS C    1 1 
        3  4525 1 1  47 LYS CA   C  -0.585  12.259   0.908 1.00 . A A .  47 LYS CA   1 1 
        3  4526 1 1  47 LYS CB   C  -1.773  12.591   1.827 1.00 . A A .  47 LYS CB   1 1 
        3  4527 1 1  47 LYS CD   C  -4.239  13.017   2.079 1.00 . A A .  47 LYS CD   1 1 
        3  4528 1 1  47 LYS CE   C  -5.603  13.021   1.402 1.00 . A A .  47 LYS CE   1 1 
        3  4529 1 1  47 LYS CG   C  -3.136  12.527   1.146 1.00 . A A .  47 LYS CG   1 1 
        3  4530 1 1  47 LYS H    H  -0.639  10.147   1.135 1.00 . A A .  47 LYS H    1 1 
        3  4531 1 1  47 LYS HA   H  -0.636  12.892   0.030 1.00 . A A .  47 LYS HA   1 1 
        3  4532 1 1  47 LYS HB2  H  -1.777  11.895   2.654 1.00 . A A .  47 LYS HB2  1 1 
        3  4533 1 1  47 LYS HB3  H  -1.639  13.591   2.217 1.00 . A A .  47 LYS HB3  1 1 
        3  4534 1 1  47 LYS HD2  H  -4.281  12.368   2.944 1.00 . A A .  47 LYS HD2  1 1 
        3  4535 1 1  47 LYS HD3  H  -4.003  14.023   2.397 1.00 . A A .  47 LYS HD3  1 1 
        3  4536 1 1  47 LYS HE2  H  -5.545  13.612   0.499 1.00 . A A .  47 LYS HE2  1 1 
        3  4537 1 1  47 LYS HE3  H  -5.872  12.003   1.150 1.00 . A A .  47 LYS HE3  1 1 
        3  4538 1 1  47 LYS HG2  H  -3.118  13.149   0.261 1.00 . A A .  47 LYS HG2  1 1 
        3  4539 1 1  47 LYS HG3  H  -3.341  11.504   0.865 1.00 . A A .  47 LYS HG3  1 1 
        3  4540 1 1  47 LYS HZ1  H  -7.565  13.608   1.794 1.00 . A A .  47 LYS HZ1  1 1 
        3  4541 1 1  47 LYS HZ2  H  -6.399  14.567   2.554 1.00 . A A .  47 LYS HZ2  1 1 
        3  4542 1 1  47 LYS HZ3  H  -6.748  13.023   3.149 1.00 . A A .  47 LYS HZ3  1 1 
        3  4543 1 1  47 LYS N    N  -0.635  10.862   0.462 1.00 . A A .  47 LYS N    1 1 
        3  4544 1 1  47 LYS NZ   N  -6.650  13.593   2.285 1.00 . A A .  47 LYS NZ   1 1 
        3  4545 1 1  47 LYS O    O   0.932  12.115   2.777 1.00 . A A .  47 LYS O    1 1 
        3  4546 1 1  48 ILE C    C   2.765  15.110   2.201 1.00 . A A .  48 ILE C    1 1 
        3  4547 1 1  48 ILE CA   C   2.895  13.685   1.633 1.00 . A A .  48 ILE CA   1 1 
        3  4548 1 1  48 ILE CB   C   4.093  13.609   0.645 1.00 . A A .  48 ILE CB   1 1 
        3  4549 1 1  48 ILE CD1  C   6.632  13.903   0.454 1.00 . A A .  48 ILE CD1  1 1 
        3  4550 1 1  48 ILE CG1  C   5.409  13.993   1.346 1.00 . A A .  48 ILE CG1  1 1 
        3  4551 1 1  48 ILE CG2  C   3.844  14.497  -0.573 1.00 . A A .  48 ILE CG2  1 1 
        3  4552 1 1  48 ILE H    H   1.478  13.507   0.055 1.00 . A A .  48 ILE H    1 1 
        3  4553 1 1  48 ILE HA   H   3.091  13.006   2.453 1.00 . A A .  48 ILE HA   1 1 
        3  4554 1 1  48 ILE HB   H   4.168  12.587   0.297 1.00 . A A .  48 ILE HB   1 1 
        3  4555 1 1  48 ILE HD11 H   6.760  12.885   0.116 1.00 . A A .  48 ILE HD11 1 1 
        3  4556 1 1  48 ILE HD12 H   7.507  14.207   1.010 1.00 . A A .  48 ILE HD12 1 1 
        3  4557 1 1  48 ILE HD13 H   6.506  14.552  -0.401 1.00 . A A .  48 ILE HD13 1 1 
        3  4558 1 1  48 ILE HG12 H   5.338  15.012   1.701 1.00 . A A .  48 ILE HG12 1 1 
        3  4559 1 1  48 ILE HG13 H   5.566  13.335   2.189 1.00 . A A .  48 ILE HG13 1 1 
        3  4560 1 1  48 ILE HG21 H   4.673  14.412  -1.260 1.00 . A A .  48 ILE HG21 1 1 
        3  4561 1 1  48 ILE HG22 H   3.746  15.526  -0.256 1.00 . A A .  48 ILE HG22 1 1 
        3  4562 1 1  48 ILE HG23 H   2.935  14.187  -1.067 1.00 . A A .  48 ILE HG23 1 1 
        3  4563 1 1  48 ILE N    N   1.643  13.264   0.989 1.00 . A A .  48 ILE N    1 1 
        3  4564 1 1  48 ILE O    O   3.479  15.497   3.126 1.00 . A A .  48 ILE O    1 1 
        3  4565 1 1  49 GLY C    C   0.601  17.985   1.231 1.00 . A A .  49 GLY C    1 1 
        3  4566 1 1  49 GLY CA   C   1.595  17.237   2.110 1.00 . A A .  49 GLY CA   1 1 
        3  4567 1 1  49 GLY H    H   1.300  15.518   0.907 1.00 . A A .  49 GLY H    1 1 
        3  4568 1 1  49 GLY HA2  H   1.209  17.197   3.119 1.00 . A A .  49 GLY HA2  1 1 
        3  4569 1 1  49 GLY HA3  H   2.532  17.776   2.116 1.00 . A A .  49 GLY HA3  1 1 
        3  4570 1 1  49 GLY N    N   1.834  15.878   1.643 1.00 . A A .  49 GLY N    1 1 
        3  4571 1 1  49 GLY O    O  -0.612  17.868   1.413 1.00 . A A .  49 GLY O    1 1 
        3  4572 1 1  50 ASP C    C  -0.014  18.631  -1.939 1.00 . A A .  50 ASP C    1 1 
        3  4573 1 1  50 ASP CA   C   0.271  19.474  -0.681 1.00 . A A .  50 ASP CA   1 1 
        3  4574 1 1  50 ASP CB   C   0.929  20.807  -1.062 1.00 . A A .  50 ASP CB   1 1 
        3  4575 1 1  50 ASP CG   C   2.302  20.626  -1.686 1.00 . A A .  50 ASP CG   1 1 
        3  4576 1 1  50 ASP H    H   2.091  18.828   0.200 1.00 . A A .  50 ASP H    1 1 
        3  4577 1 1  50 ASP HA   H  -0.672  19.682  -0.188 1.00 . A A .  50 ASP HA   1 1 
        3  4578 1 1  50 ASP HB2  H   0.295  21.323  -1.769 1.00 . A A .  50 ASP HB2  1 1 
        3  4579 1 1  50 ASP HB3  H   1.034  21.414  -0.175 1.00 . A A .  50 ASP HB3  1 1 
        3  4580 1 1  50 ASP N    N   1.115  18.746   0.270 1.00 . A A .  50 ASP N    1 1 
        3  4581 1 1  50 ASP O    O  -1.138  18.616  -2.445 1.00 . A A .  50 ASP O    1 1 
        3  4582 1 1  50 ASP OD1  O   3.282  20.444  -0.934 1.00 . A A .  50 ASP OD1  1 1 
        3  4583 1 1  50 ASP OD2  O   2.406  20.657  -2.927 1.00 . A A .  50 ASP OD2  1 1 
        3  4584 1 1  51 THR C    C   0.500  15.632  -3.277 1.00 . A A .  51 THR C    1 1 
        3  4585 1 1  51 THR CA   C   0.862  17.082  -3.635 1.00 . A A .  51 THR CA   1 1 
        3  4586 1 1  51 THR CB   C   2.150  17.080  -4.501 1.00 . A A .  51 THR CB   1 1 
        3  4587 1 1  51 THR CG2  C   3.369  16.666  -3.686 1.00 . A A .  51 THR CG2  1 1 
        3  4588 1 1  51 THR H    H   1.874  17.965  -1.978 1.00 . A A .  51 THR H    1 1 
        3  4589 1 1  51 THR HA   H   0.061  17.497  -4.233 1.00 . A A .  51 THR HA   1 1 
        3  4590 1 1  51 THR HB   H   2.311  18.082  -4.876 1.00 . A A .  51 THR HB   1 1 
        3  4591 1 1  51 THR HG1  H   1.510  16.638  -6.324 1.00 . A A .  51 THR HG1  1 1 
        3  4592 1 1  51 THR HG21 H   4.245  16.676  -4.319 1.00 . A A .  51 THR HG21 1 1 
        3  4593 1 1  51 THR HG22 H   3.221  15.670  -3.293 1.00 . A A .  51 THR HG22 1 1 
        3  4594 1 1  51 THR HG23 H   3.510  17.358  -2.869 1.00 . A A .  51 THR HG23 1 1 
        3  4595 1 1  51 THR N    N   1.004  17.924  -2.432 1.00 . A A .  51 THR N    1 1 
        3  4596 1 1  51 THR O    O   0.908  15.110  -2.234 1.00 . A A .  51 THR O    1 1 
        3  4597 1 1  51 THR OG1  O   2.000  16.187  -5.620 1.00 . A A .  51 THR OG1  1 1 
        3  4598 1 1  52 SER C    C  -0.694  12.774  -5.218 1.00 . A A .  52 SER C    1 1 
        3  4599 1 1  52 SER CA   C  -0.720  13.601  -3.924 1.00 . A A .  52 SER CA   1 1 
        3  4600 1 1  52 SER CB   C  -2.144  13.588  -3.341 1.00 . A A .  52 SER CB   1 1 
        3  4601 1 1  52 SER H    H  -0.529  15.438  -4.983 1.00 . A A .  52 SER H    1 1 
        3  4602 1 1  52 SER HA   H  -0.048  13.144  -3.212 1.00 . A A .  52 SER HA   1 1 
        3  4603 1 1  52 SER HB2  H  -2.404  12.580  -3.051 1.00 . A A .  52 SER HB2  1 1 
        3  4604 1 1  52 SER HB3  H  -2.177  14.230  -2.473 1.00 . A A .  52 SER HB3  1 1 
        3  4605 1 1  52 SER HG   H  -2.786  14.866  -4.696 1.00 . A A .  52 SER HG   1 1 
        3  4606 1 1  52 SER N    N  -0.265  14.981  -4.154 1.00 . A A .  52 SER N    1 1 
        3  4607 1 1  52 SER O    O  -0.521  13.311  -6.312 1.00 . A A .  52 SER O    1 1 
        3  4608 1 1  52 SER OG   O  -3.104  14.048  -4.287 1.00 . A A .  52 SER OG   1 1 
        3  4609 1 1  53 VAL C    C  -1.546   9.206  -5.829 1.00 . A A .  53 VAL C    1 1 
        3  4610 1 1  53 VAL CA   C  -0.911  10.547  -6.231 1.00 . A A .  53 VAL CA   1 1 
        3  4611 1 1  53 VAL CB   C   0.506  10.307  -6.825 1.00 . A A .  53 VAL CB   1 1 
        3  4612 1 1  53 VAL CG1  C   1.448   9.730  -5.773 1.00 . A A .  53 VAL CG1  1 1 
        3  4613 1 1  53 VAL CG2  C   0.441   9.406  -8.060 1.00 . A A .  53 VAL CG2  1 1 
        3  4614 1 1  53 VAL H    H  -0.960  11.091  -4.178 1.00 . A A .  53 VAL H    1 1 
        3  4615 1 1  53 VAL HA   H  -1.527  11.006  -6.994 1.00 . A A .  53 VAL HA   1 1 
        3  4616 1 1  53 VAL HB   H   0.904  11.266  -7.133 1.00 . A A .  53 VAL HB   1 1 
        3  4617 1 1  53 VAL HG11 H   1.075   8.775  -5.435 1.00 . A A .  53 VAL HG11 1 1 
        3  4618 1 1  53 VAL HG12 H   1.509  10.408  -4.934 1.00 . A A .  53 VAL HG12 1 1 
        3  4619 1 1  53 VAL HG13 H   2.434   9.602  -6.200 1.00 . A A .  53 VAL HG13 1 1 
        3  4620 1 1  53 VAL HG21 H  -0.162   9.881  -8.820 1.00 . A A .  53 VAL HG21 1 1 
        3  4621 1 1  53 VAL HG22 H   0.000   8.456  -7.793 1.00 . A A .  53 VAL HG22 1 1 
        3  4622 1 1  53 VAL HG23 H   1.440   9.243  -8.443 1.00 . A A .  53 VAL HG23 1 1 
        3  4623 1 1  53 VAL N    N  -0.865  11.461  -5.081 1.00 . A A .  53 VAL N    1 1 
        3  4624 1 1  53 VAL O    O  -1.316   8.714  -4.724 1.00 . A A .  53 VAL O    1 1 
        3  4625 1 1  54 SER C    C  -2.657   6.187  -7.235 1.00 . A A .  54 SER C    1 1 
        3  4626 1 1  54 SER CA   C  -3.093   7.391  -6.388 1.00 . A A .  54 SER CA   1 1 
        3  4627 1 1  54 SER CB   C  -4.602   7.623  -6.558 1.00 . A A .  54 SER CB   1 1 
        3  4628 1 1  54 SER H    H  -2.443   9.012  -7.609 1.00 . A A .  54 SER H    1 1 
        3  4629 1 1  54 SER HA   H  -2.900   7.159  -5.348 1.00 . A A .  54 SER HA   1 1 
        3  4630 1 1  54 SER HB2  H  -5.137   6.727  -6.280 1.00 . A A .  54 SER HB2  1 1 
        3  4631 1 1  54 SER HB3  H  -4.912   8.437  -5.916 1.00 . A A .  54 SER HB3  1 1 
        3  4632 1 1  54 SER HG   H  -5.898   7.926  -8.007 1.00 . A A .  54 SER HG   1 1 
        3  4633 1 1  54 SER N    N  -2.348   8.619  -6.716 1.00 . A A .  54 SER N    1 1 
        3  4634 1 1  54 SER O    O  -2.066   6.333  -8.308 1.00 . A A .  54 SER O    1 1 
        3  4635 1 1  54 SER OG   O  -4.935   7.953  -7.901 1.00 . A A .  54 SER OG   1 1 
        3  4636 1 1  55 TYR C    C  -3.744   2.694  -7.192 1.00 . A A .  55 TYR C    1 1 
        3  4637 1 1  55 TYR CA   C  -2.642   3.737  -7.429 1.00 . A A .  55 TYR CA   1 1 
        3  4638 1 1  55 TYR CB   C  -1.289   3.200  -6.941 1.00 . A A .  55 TYR CB   1 1 
        3  4639 1 1  55 TYR CD1  C  -0.368   1.943  -8.943 1.00 . A A .  55 TYR CD1  1 1 
        3  4640 1 1  55 TYR CD2  C  -0.825   0.702  -6.958 1.00 . A A .  55 TYR CD2  1 1 
        3  4641 1 1  55 TYR CE1  C   0.077   0.792  -9.565 1.00 . A A .  55 TYR CE1  1 1 
        3  4642 1 1  55 TYR CE2  C  -0.386  -0.454  -7.577 1.00 . A A .  55 TYR CE2  1 1 
        3  4643 1 1  55 TYR CG   C  -0.826   1.922  -7.629 1.00 . A A .  55 TYR CG   1 1 
        3  4644 1 1  55 TYR CZ   C   0.065  -0.403  -8.880 1.00 . A A .  55 TYR CZ   1 1 
        3  4645 1 1  55 TYR H    H  -3.400   4.946  -5.858 1.00 . A A .  55 TYR H    1 1 
        3  4646 1 1  55 TYR HA   H  -2.578   3.947  -8.490 1.00 . A A .  55 TYR HA   1 1 
        3  4647 1 1  55 TYR HB2  H  -0.533   3.953  -7.108 1.00 . A A .  55 TYR HB2  1 1 
        3  4648 1 1  55 TYR HB3  H  -1.355   3.001  -5.880 1.00 . A A .  55 TYR HB3  1 1 
        3  4649 1 1  55 TYR HD1  H  -0.362   2.880  -9.482 1.00 . A A .  55 TYR HD1  1 1 
        3  4650 1 1  55 TYR HD2  H  -1.179   0.663  -5.937 1.00 . A A .  55 TYR HD2  1 1 
        3  4651 1 1  55 TYR HE1  H   0.429   0.832 -10.586 1.00 . A A .  55 TYR HE1  1 1 
        3  4652 1 1  55 TYR HE2  H  -0.397  -1.391  -7.040 1.00 . A A .  55 TYR HE2  1 1 
        3  4653 1 1  55 TYR HH   H   1.370  -1.376  -9.906 1.00 . A A .  55 TYR HH   1 1 
        3  4654 1 1  55 TYR N    N  -2.959   4.990  -6.734 1.00 . A A .  55 TYR N    1 1 
        3  4655 1 1  55 TYR O    O  -3.965   2.263  -6.059 1.00 . A A .  55 TYR O    1 1 
        3  4656 1 1  55 TYR OH   O   0.513  -1.549  -9.498 1.00 . A A .  55 TYR OH   1 1 
        3  4657 1 1  56 LYS C    C  -4.971  -0.127  -8.255 1.00 . A A .  56 LYS C    1 1 
        3  4658 1 1  56 LYS CA   C  -5.516   1.305  -8.139 1.00 . A A .  56 LYS CA   1 1 
        3  4659 1 1  56 LYS CB   C  -6.601   1.536  -9.205 1.00 . A A .  56 LYS CB   1 1 
        3  4660 1 1  56 LYS CD   C  -8.800   0.744 -10.209 1.00 . A A .  56 LYS CD   1 1 
        3  4661 1 1  56 LYS CE   C  -9.885  -0.327 -10.144 1.00 . A A .  56 LYS CE   1 1 
        3  4662 1 1  56 LYS CG   C  -7.748   0.529  -9.125 1.00 . A A .  56 LYS CG   1 1 
        3  4663 1 1  56 LYS H    H  -4.241   2.688  -9.130 1.00 . A A .  56 LYS H    1 1 
        3  4664 1 1  56 LYS HA   H  -5.966   1.418  -7.161 1.00 . A A .  56 LYS HA   1 1 
        3  4665 1 1  56 LYS HB2  H  -7.011   2.529  -9.079 1.00 . A A .  56 LYS HB2  1 1 
        3  4666 1 1  56 LYS HB3  H  -6.151   1.463 -10.187 1.00 . A A .  56 LYS HB3  1 1 
        3  4667 1 1  56 LYS HD2  H  -9.257   1.714 -10.071 1.00 . A A .  56 LYS HD2  1 1 
        3  4668 1 1  56 LYS HD3  H  -8.324   0.704 -11.180 1.00 . A A .  56 LYS HD3  1 1 
        3  4669 1 1  56 LYS HE2  H  -9.421  -1.298 -10.236 1.00 . A A .  56 LYS HE2  1 1 
        3  4670 1 1  56 LYS HE3  H -10.383  -0.259  -9.188 1.00 . A A .  56 LYS HE3  1 1 
        3  4671 1 1  56 LYS HG2  H  -7.343  -0.466  -9.232 1.00 . A A .  56 LYS HG2  1 1 
        3  4672 1 1  56 LYS HG3  H  -8.221   0.619  -8.155 1.00 . A A .  56 LYS HG3  1 1 
        3  4673 1 1  56 LYS HZ1  H -11.568  -0.967 -11.195 1.00 . A A .  56 LYS HZ1  1 1 
        3  4674 1 1  56 LYS HZ2  H -10.426  -0.173 -12.153 1.00 . A A .  56 LYS HZ2  1 1 
        3  4675 1 1  56 LYS HZ3  H -11.418   0.714 -11.111 1.00 . A A .  56 LYS HZ3  1 1 
        3  4676 1 1  56 LYS N    N  -4.445   2.301  -8.254 1.00 . A A .  56 LYS N    1 1 
        3  4677 1 1  56 LYS NZ   N -10.893  -0.176 -11.224 1.00 . A A .  56 LYS NZ   1 1 
        3  4678 1 1  56 LYS O    O  -4.091  -0.411  -9.070 1.00 . A A .  56 LYS O    1 1 
        3  4679 1 1  57 TYR C    C  -5.907  -3.249  -8.464 1.00 . A A .  57 TYR C    1 1 
        3  4680 1 1  57 TYR CA   C  -5.107  -2.431  -7.439 1.00 . A A .  57 TYR CA   1 1 
        3  4681 1 1  57 TYR CB   C  -5.280  -3.022  -6.034 1.00 . A A .  57 TYR CB   1 1 
        3  4682 1 1  57 TYR CD1  C  -4.821  -1.166  -4.372 1.00 . A A .  57 TYR CD1  1 1 
        3  4683 1 1  57 TYR CD2  C  -3.168  -2.866  -4.646 1.00 . A A .  57 TYR CD2  1 1 
        3  4684 1 1  57 TYR CE1  C  -4.022  -0.536  -3.436 1.00 . A A .  57 TYR CE1  1 1 
        3  4685 1 1  57 TYR CE2  C  -2.364  -2.239  -3.715 1.00 . A A .  57 TYR CE2  1 1 
        3  4686 1 1  57 TYR CG   C  -4.410  -2.342  -4.993 1.00 . A A .  57 TYR CG   1 1 
        3  4687 1 1  57 TYR CZ   C  -2.795  -1.076  -3.112 1.00 . A A .  57 TYR CZ   1 1 
        3  4688 1 1  57 TYR H    H  -6.211  -0.734  -6.819 1.00 . A A .  57 TYR H    1 1 
        3  4689 1 1  57 TYR HA   H  -4.060  -2.473  -7.706 1.00 . A A .  57 TYR HA   1 1 
        3  4690 1 1  57 TYR HB2  H  -6.311  -2.918  -5.727 1.00 . A A .  57 TYR HB2  1 1 
        3  4691 1 1  57 TYR HB3  H  -5.020  -4.072  -6.055 1.00 . A A .  57 TYR HB3  1 1 
        3  4692 1 1  57 TYR HD1  H  -5.782  -0.744  -4.629 1.00 . A A .  57 TYR HD1  1 1 
        3  4693 1 1  57 TYR HD2  H  -2.831  -3.779  -5.119 1.00 . A A .  57 TYR HD2  1 1 
        3  4694 1 1  57 TYR HE1  H  -4.360   0.375  -2.965 1.00 . A A .  57 TYR HE1  1 1 
        3  4695 1 1  57 TYR HE2  H  -1.402  -2.662  -3.461 1.00 . A A .  57 TYR HE2  1 1 
        3  4696 1 1  57 TYR HH   H  -2.519  -0.148  -1.448 1.00 . A A .  57 TYR HH   1 1 
        3  4697 1 1  57 TYR N    N  -5.513  -1.024  -7.441 1.00 . A A .  57 TYR N    1 1 
        3  4698 1 1  57 TYR O    O  -7.090  -2.989  -8.704 1.00 . A A .  57 TYR O    1 1 
        3  4699 1 1  57 TYR OH   O  -1.990  -0.446  -2.191 1.00 . A A .  57 TYR OH   1 1 
        3  4700 1 1  58 THR C    C  -5.854  -6.576  -9.677 1.00 . A A .  58 THR C    1 1 
        3  4701 1 1  58 THR CA   C  -5.892  -5.095 -10.082 1.00 . A A .  58 THR CA   1 1 
        3  4702 1 1  58 THR CB   C  -5.228  -4.932 -11.474 1.00 . A A .  58 THR CB   1 1 
        3  4703 1 1  58 THR CG2  C  -3.717  -5.144 -11.407 1.00 . A A .  58 THR CG2  1 1 
        3  4704 1 1  58 THR H    H  -4.315  -4.401  -8.832 1.00 . A A .  58 THR H    1 1 
        3  4705 1 1  58 THR HA   H  -6.927  -4.788 -10.169 1.00 . A A .  58 THR HA   1 1 
        3  4706 1 1  58 THR HB   H  -5.416  -3.926 -11.824 1.00 . A A .  58 THR HB   1 1 
        3  4707 1 1  58 THR HG1  H  -5.987  -5.397 -13.243 1.00 . A A .  58 THR HG1  1 1 
        3  4708 1 1  58 THR HG21 H  -3.505  -6.138 -11.039 1.00 . A A .  58 THR HG21 1 1 
        3  4709 1 1  58 THR HG22 H  -3.279  -4.412 -10.742 1.00 . A A .  58 THR HG22 1 1 
        3  4710 1 1  58 THR HG23 H  -3.292  -5.030 -12.394 1.00 . A A .  58 THR HG23 1 1 
        3  4711 1 1  58 THR N    N  -5.252  -4.239  -9.071 1.00 . A A .  58 THR N    1 1 
        3  4712 1 1  58 THR O    O  -4.803  -7.106  -9.308 1.00 . A A .  58 THR O    1 1 
        3  4713 1 1  58 THR OG1  O  -5.802  -5.857 -12.411 1.00 . A A .  58 THR OG1  1 1 
        3  4714 1 1  59 SER C    C  -6.474  -9.571 -10.447 1.00 . A A .  59 SER C    1 1 
        3  4715 1 1  59 SER CA   C  -7.098  -8.665  -9.378 1.00 . A A .  59 SER CA   1 1 
        3  4716 1 1  59 SER CB   C  -8.556  -9.078  -9.124 1.00 . A A .  59 SER CB   1 1 
        3  4717 1 1  59 SER H    H  -7.814  -6.769 -10.039 1.00 . A A .  59 SER H    1 1 
        3  4718 1 1  59 SER HA   H  -6.543  -8.796  -8.458 1.00 . A A .  59 SER HA   1 1 
        3  4719 1 1  59 SER HB2  H  -9.161  -8.797  -9.973 1.00 . A A .  59 SER HB2  1 1 
        3  4720 1 1  59 SER HB3  H  -8.607 -10.149  -8.983 1.00 . A A .  59 SER HB3  1 1 
        3  4721 1 1  59 SER HG   H -10.027  -8.553  -7.932 1.00 . A A .  59 SER HG   1 1 
        3  4722 1 1  59 SER N    N  -7.006  -7.242  -9.742 1.00 . A A .  59 SER N    1 1 
        3  4723 1 1  59 SER O    O  -7.176 -10.218 -11.221 1.00 . A A .  59 SER O    1 1 
        3  4724 1 1  59 SER OG   O  -9.070  -8.440  -7.964 1.00 . A A .  59 SER OG   1 1 
        3  4725 1 1  60 ARG C    C  -3.928 -11.752 -10.683 1.00 . A A .  60 ARG C    1 1 
        3  4726 1 1  60 ARG CA   C  -4.399 -10.474 -11.399 1.00 . A A .  60 ARG CA   1 1 
        3  4727 1 1  60 ARG CB   C  -3.197  -9.730 -12.000 1.00 . A A .  60 ARG CB   1 1 
        3  4728 1 1  60 ARG CD   C  -1.070  -8.429 -11.552 1.00 . A A .  60 ARG CD   1 1 
        3  4729 1 1  60 ARG CG   C  -2.416  -8.889 -10.993 1.00 . A A .  60 ARG CG   1 1 
        3  4730 1 1  60 ARG CZ   C   0.226 -10.325 -12.434 1.00 . A A .  60 ARG CZ   1 1 
        3  4731 1 1  60 ARG H    H  -4.646  -8.976  -9.908 1.00 . A A .  60 ARG H    1 1 
        3  4732 1 1  60 ARG HA   H  -5.065 -10.761 -12.200 1.00 . A A .  60 ARG HA   1 1 
        3  4733 1 1  60 ARG HB2  H  -2.522 -10.453 -12.435 1.00 . A A .  60 ARG HB2  1 1 
        3  4734 1 1  60 ARG HB3  H  -3.553  -9.073 -12.781 1.00 . A A .  60 ARG HB3  1 1 
        3  4735 1 1  60 ARG HD2  H  -1.198  -8.138 -12.584 1.00 . A A .  60 ARG HD2  1 1 
        3  4736 1 1  60 ARG HD3  H  -0.732  -7.575 -10.981 1.00 . A A .  60 ARG HD3  1 1 
        3  4737 1 1  60 ARG HE   H   0.451  -9.550 -10.641 1.00 . A A .  60 ARG HE   1 1 
        3  4738 1 1  60 ARG HG2  H  -3.003  -8.019 -10.736 1.00 . A A .  60 ARG HG2  1 1 
        3  4739 1 1  60 ARG HG3  H  -2.243  -9.478 -10.103 1.00 . A A .  60 ARG HG3  1 1 
        3  4740 1 1  60 ARG HH11 H  -1.137  -9.625 -13.711 1.00 . A A .  60 ARG HH11 1 1 
        3  4741 1 1  60 ARG HH12 H  -0.183 -10.945 -14.280 1.00 . A A .  60 ARG HH12 1 1 
        3  4742 1 1  60 ARG HH21 H   1.658 -11.231 -11.399 1.00 . A A .  60 ARG HH21 1 1 
        3  4743 1 1  60 ARG HH22 H   1.372 -11.857 -12.980 1.00 . A A .  60 ARG HH22 1 1 
        3  4744 1 1  60 ARG N    N  -5.143  -9.589 -10.490 1.00 . A A .  60 ARG N    1 1 
        3  4745 1 1  60 ARG NE   N  -0.055  -9.481 -11.472 1.00 . A A .  60 ARG NE   1 1 
        3  4746 1 1  60 ARG NH1  N  -0.414 -10.295 -13.560 1.00 . A A .  60 ARG NH1  1 1 
        3  4747 1 1  60 ARG NH2  N   1.158 -11.200 -12.256 1.00 . A A .  60 ARG NH2  1 1 
        3  4748 1 1  60 ARG O    O  -3.315 -12.631 -11.292 1.00 . A A .  60 ARG O    1 1 
        3  4749 1 1  61 TYR C    C  -4.579 -12.943  -7.212 1.00 . A A .  61 TYR C    1 1 
        3  4750 1 1  61 TYR CA   C  -3.891 -13.018  -8.580 1.00 . A A .  61 TYR CA   1 1 
        3  4751 1 1  61 TYR CB   C  -2.367 -13.174  -8.396 1.00 . A A .  61 TYR CB   1 1 
        3  4752 1 1  61 TYR CD1  C  -1.650 -11.963  -6.283 1.00 . A A .  61 TYR CD1  1 1 
        3  4753 1 1  61 TYR CD2  C  -1.072 -10.992  -8.383 1.00 . A A .  61 TYR CD2  1 1 
        3  4754 1 1  61 TYR CE1  C  -1.024 -10.921  -5.625 1.00 . A A .  61 TYR CE1  1 1 
        3  4755 1 1  61 TYR CE2  C  -0.446  -9.947  -7.731 1.00 . A A .  61 TYR CE2  1 1 
        3  4756 1 1  61 TYR CG   C  -1.689 -12.018  -7.673 1.00 . A A .  61 TYR CG   1 1 
        3  4757 1 1  61 TYR CZ   C  -0.423  -9.915  -6.353 1.00 . A A .  61 TYR CZ   1 1 
        3  4758 1 1  61 TYR H    H  -4.664 -11.083  -8.955 1.00 . A A .  61 TYR H    1 1 
        3  4759 1 1  61 TYR HA   H  -4.270 -13.885  -9.106 1.00 . A A .  61 TYR HA   1 1 
        3  4760 1 1  61 TYR HB2  H  -2.173 -14.074  -7.829 1.00 . A A .  61 TYR HB2  1 1 
        3  4761 1 1  61 TYR HB3  H  -1.907 -13.274  -9.371 1.00 . A A .  61 TYR HB3  1 1 
        3  4762 1 1  61 TYR HD1  H  -2.124 -12.748  -5.714 1.00 . A A .  61 TYR HD1  1 1 
        3  4763 1 1  61 TYR HD2  H  -1.092 -11.016  -9.463 1.00 . A A .  61 TYR HD2  1 1 
        3  4764 1 1  61 TYR HE1  H  -1.007 -10.898  -4.545 1.00 . A A .  61 TYR HE1  1 1 
        3  4765 1 1  61 TYR HE2  H   0.025  -9.159  -8.303 1.00 . A A .  61 TYR HE2  1 1 
        3  4766 1 1  61 TYR HH   H   0.627  -9.199  -4.906 1.00 . A A .  61 TYR HH   1 1 
        3  4767 1 1  61 TYR N    N  -4.214 -11.836  -9.386 1.00 . A A .  61 TYR N    1 1 
        3  4768 1 1  61 TYR O    O  -5.180 -11.920  -6.865 1.00 . A A .  61 TYR O    1 1 
        3  4769 1 1  61 TYR OH   O   0.205  -8.875  -5.706 1.00 . A A .  61 TYR OH   1 1 
        3  4770 1 1  62 VAL C    C  -3.989 -13.802  -4.016 1.00 . A A .  62 VAL C    1 1 
        3  4771 1 1  62 VAL CA   C  -5.058 -14.057  -5.090 1.00 . A A .  62 VAL CA   1 1 
        3  4772 1 1  62 VAL CB   C  -5.770 -15.405  -4.804 1.00 . A A .  62 VAL CB   1 1 
        3  4773 1 1  62 VAL CG1  C  -6.996 -15.561  -5.703 1.00 . A A .  62 VAL CG1  1 1 
        3  4774 1 1  62 VAL CG2  C  -4.811 -16.587  -4.984 1.00 . A A .  62 VAL CG2  1 1 
        3  4775 1 1  62 VAL H    H  -4.026 -14.813  -6.780 1.00 . A A .  62 VAL H    1 1 
        3  4776 1 1  62 VAL HA   H  -5.800 -13.270  -5.025 1.00 . A A .  62 VAL HA   1 1 
        3  4777 1 1  62 VAL HB   H  -6.109 -15.398  -3.775 1.00 . A A .  62 VAL HB   1 1 
        3  4778 1 1  62 VAL HG11 H  -6.690 -15.535  -6.740 1.00 . A A .  62 VAL HG11 1 1 
        3  4779 1 1  62 VAL HG12 H  -7.687 -14.752  -5.512 1.00 . A A .  62 VAL HG12 1 1 
        3  4780 1 1  62 VAL HG13 H  -7.480 -16.503  -5.493 1.00 . A A .  62 VAL HG13 1 1 
        3  4781 1 1  62 VAL HG21 H  -4.470 -16.626  -6.009 1.00 . A A .  62 VAL HG21 1 1 
        3  4782 1 1  62 VAL HG22 H  -5.323 -17.508  -4.741 1.00 . A A .  62 VAL HG22 1 1 
        3  4783 1 1  62 VAL HG23 H  -3.961 -16.468  -4.328 1.00 . A A .  62 VAL HG23 1 1 
        3  4784 1 1  62 VAL N    N  -4.488 -14.022  -6.439 1.00 . A A .  62 VAL N    1 1 
        3  4785 1 1  62 VAL O    O  -2.944 -14.463  -3.984 1.00 . A A .  62 VAL O    1 1 
        3  4786 1 1  63 LEU C    C  -3.558 -13.609  -0.945 1.00 . A A .  63 LEU C    1 1 
        3  4787 1 1  63 LEU CA   C  -3.378 -12.527  -2.025 1.00 . A A .  63 LEU CA   1 1 
        3  4788 1 1  63 LEU CB   C  -3.705 -11.122  -1.473 1.00 . A A .  63 LEU CB   1 1 
        3  4789 1 1  63 LEU CD1  C  -2.106 -11.098   0.499 1.00 . A A .  63 LEU CD1  1 1 
        3  4790 1 1  63 LEU CD2  C  -1.368 -10.195  -1.724 1.00 . A A .  63 LEU CD2  1 1 
        3  4791 1 1  63 LEU CG   C  -2.549 -10.378  -0.770 1.00 . A A .  63 LEU CG   1 1 
        3  4792 1 1  63 LEU H    H  -5.064 -12.294  -3.276 1.00 . A A .  63 LEU H    1 1 
        3  4793 1 1  63 LEU HA   H  -2.354 -12.545  -2.378 1.00 . A A .  63 LEU HA   1 1 
        3  4794 1 1  63 LEU HB2  H  -4.044 -10.510  -2.296 1.00 . A A .  63 LEU HB2  1 1 
        3  4795 1 1  63 LEU HB3  H  -4.520 -11.217  -0.768 1.00 . A A .  63 LEU HB3  1 1 
        3  4796 1 1  63 LEU HD11 H  -2.949 -11.209   1.165 1.00 . A A .  63 LEU HD11 1 1 
        3  4797 1 1  63 LEU HD12 H  -1.336 -10.522   0.991 1.00 . A A .  63 LEU HD12 1 1 
        3  4798 1 1  63 LEU HD13 H  -1.717 -12.074   0.247 1.00 . A A .  63 LEU HD13 1 1 
        3  4799 1 1  63 LEU HD21 H  -0.982 -11.163  -2.012 1.00 . A A .  63 LEU HD21 1 1 
        3  4800 1 1  63 LEU HD22 H  -0.590  -9.630  -1.232 1.00 . A A .  63 LEU HD22 1 1 
        3  4801 1 1  63 LEU HD23 H  -1.695  -9.663  -2.605 1.00 . A A .  63 LEU HD23 1 1 
        3  4802 1 1  63 LEU HG   H  -2.894  -9.395  -0.482 1.00 . A A .  63 LEU HG   1 1 
        3  4803 1 1  63 LEU N    N  -4.251 -12.826  -3.155 1.00 . A A .  63 LEU N    1 1 
        3  4804 1 1  63 LEU O    O  -4.657 -13.803  -0.421 1.00 . A A .  63 LEU O    1 1 
        3  4805 1 1  64 LYS C    C  -3.020 -15.128   1.682 1.00 . A A .  64 LYS C    1 1 
        3  4806 1 1  64 LYS CA   C  -2.537 -15.481   0.260 1.00 . A A .  64 LYS CA   1 1 
        3  4807 1 1  64 LYS CB   C  -1.164 -16.162   0.323 1.00 . A A .  64 LYS CB   1 1 
        3  4808 1 1  64 LYS CD   C   0.708 -17.324  -0.928 1.00 . A A .  64 LYS CD   1 1 
        3  4809 1 1  64 LYS CE   C   1.273 -17.687  -2.297 1.00 . A A .  64 LYS CE   1 1 
        3  4810 1 1  64 LYS CG   C  -0.614 -16.564  -1.044 1.00 . A A .  64 LYS CG   1 1 
        3  4811 1 1  64 LYS H    H  -1.612 -14.045  -0.995 1.00 . A A .  64 LYS H    1 1 
        3  4812 1 1  64 LYS HA   H  -3.244 -16.177  -0.174 1.00 . A A .  64 LYS HA   1 1 
        3  4813 1 1  64 LYS HB2  H  -0.460 -15.487   0.787 1.00 . A A .  64 LYS HB2  1 1 
        3  4814 1 1  64 LYS HB3  H  -1.245 -17.054   0.929 1.00 . A A .  64 LYS HB3  1 1 
        3  4815 1 1  64 LYS HD2  H   1.426 -16.707  -0.407 1.00 . A A .  64 LYS HD2  1 1 
        3  4816 1 1  64 LYS HD3  H   0.541 -18.233  -0.366 1.00 . A A .  64 LYS HD3  1 1 
        3  4817 1 1  64 LYS HE2  H   1.500 -16.777  -2.833 1.00 . A A .  64 LYS HE2  1 1 
        3  4818 1 1  64 LYS HE3  H   2.181 -18.259  -2.159 1.00 . A A .  64 LYS HE3  1 1 
        3  4819 1 1  64 LYS HG2  H  -1.338 -17.197  -1.539 1.00 . A A .  64 LYS HG2  1 1 
        3  4820 1 1  64 LYS HG3  H  -0.458 -15.670  -1.633 1.00 . A A .  64 LYS HG3  1 1 
        3  4821 1 1  64 LYS HZ1  H   0.015 -19.336  -2.568 1.00 . A A .  64 LYS HZ1  1 1 
        3  4822 1 1  64 LYS HZ2  H   0.754 -18.796  -3.989 1.00 . A A .  64 LYS HZ2  1 1 
        3  4823 1 1  64 LYS HZ3  H  -0.532 -17.925  -3.322 1.00 . A A .  64 LYS HZ3  1 1 
        3  4824 1 1  64 LYS N    N  -2.476 -14.313  -0.627 1.00 . A A .  64 LYS N    1 1 
        3  4825 1 1  64 LYS NZ   N   0.311 -18.491  -3.099 1.00 . A A .  64 LYS NZ   1 1 
        3  4826 1 1  64 LYS O    O  -2.934 -13.976   2.123 1.00 . A A .  64 LYS O    1 1 
        3  4827 1 1  65 ALA C    C  -2.984 -15.374   4.703 1.00 . A A .  65 ALA C    1 1 
        3  4828 1 1  65 ALA CA   C  -4.036 -15.972   3.754 1.00 . A A .  65 ALA CA   1 1 
        3  4829 1 1  65 ALA CB   C  -4.523 -17.315   4.292 1.00 . A A .  65 ALA CB   1 1 
        3  4830 1 1  65 ALA H    H  -3.531 -17.035   1.987 1.00 . A A .  65 ALA H    1 1 
        3  4831 1 1  65 ALA HA   H  -4.886 -15.303   3.705 1.00 . A A .  65 ALA HA   1 1 
        3  4832 1 1  65 ALA HB1  H  -4.969 -17.175   5.266 1.00 . A A .  65 ALA HB1  1 1 
        3  4833 1 1  65 ALA HB2  H  -3.686 -17.995   4.375 1.00 . A A .  65 ALA HB2  1 1 
        3  4834 1 1  65 ALA HB3  H  -5.258 -17.731   3.618 1.00 . A A .  65 ALA HB3  1 1 
        3  4835 1 1  65 ALA N    N  -3.515 -16.141   2.391 1.00 . A A .  65 ALA N    1 1 
        3  4836 1 1  65 ALA O    O  -1.965 -16.005   4.991 1.00 . A A .  65 ALA O    1 1 
        3  4837 1 1  66 GLY C    C  -0.980 -13.104   5.487 1.00 . A A .  66 GLY C    1 1 
        3  4838 1 1  66 GLY CA   C  -2.326 -13.486   6.105 1.00 . A A .  66 GLY CA   1 1 
        3  4839 1 1  66 GLY H    H  -4.065 -13.700   4.903 1.00 . A A .  66 GLY H    1 1 
        3  4840 1 1  66 GLY HA2  H  -2.802 -12.589   6.468 1.00 . A A .  66 GLY HA2  1 1 
        3  4841 1 1  66 GLY HA3  H  -2.148 -14.143   6.946 1.00 . A A .  66 GLY HA3  1 1 
        3  4842 1 1  66 GLY N    N  -3.240 -14.152   5.177 1.00 . A A .  66 GLY N    1 1 
        3  4843 1 1  66 GLY O    O   0.004 -12.906   6.205 1.00 . A A .  66 GLY O    1 1 
        3  4844 1 1  67 GLN C    C   0.514 -11.137   3.345 1.00 . A A .  67 GLN C    1 1 
        3  4845 1 1  67 GLN CA   C   0.304 -12.661   3.444 1.00 . A A .  67 GLN CA   1 1 
        3  4846 1 1  67 GLN CB   C   0.273 -13.278   2.032 1.00 . A A .  67 GLN CB   1 1 
        3  4847 1 1  67 GLN CD   C   2.695 -13.892   1.429 1.00 . A A .  67 GLN CD   1 1 
        3  4848 1 1  67 GLN CG   C   1.501 -12.974   1.171 1.00 . A A .  67 GLN CG   1 1 
        3  4849 1 1  67 GLN H    H  -1.754 -13.152   3.645 1.00 . A A .  67 GLN H    1 1 
        3  4850 1 1  67 GLN HA   H   1.131 -13.091   3.991 1.00 . A A .  67 GLN HA   1 1 
        3  4851 1 1  67 GLN HB2  H   0.188 -14.352   2.127 1.00 . A A .  67 GLN HB2  1 1 
        3  4852 1 1  67 GLN HB3  H  -0.601 -12.910   1.514 1.00 . A A .  67 GLN HB3  1 1 
        3  4853 1 1  67 GLN HE21 H   2.136 -14.243   3.301 1.00 . A A .  67 GLN HE21 1 1 
        3  4854 1 1  67 GLN HE22 H   3.582 -15.023   2.785 1.00 . A A .  67 GLN HE22 1 1 
        3  4855 1 1  67 GLN HG2  H   1.222 -13.073   0.133 1.00 . A A .  67 GLN HG2  1 1 
        3  4856 1 1  67 GLN HG3  H   1.808 -11.953   1.356 1.00 . A A .  67 GLN HG3  1 1 
        3  4857 1 1  67 GLN N    N  -0.935 -12.997   4.160 1.00 . A A .  67 GLN N    1 1 
        3  4858 1 1  67 GLN NE2  N   2.812 -14.439   2.625 1.00 . A A .  67 GLN NE2  1 1 
        3  4859 1 1  67 GLN O    O  -0.444 -10.363   3.302 1.00 . A A .  67 GLN O    1 1 
        3  4860 1 1  67 GLN OE1  O   3.507 -14.124   0.540 1.00 . A A .  67 GLN OE1  1 1 
        3  4861 1 1  68 THR C    C   2.373  -8.963   1.664 1.00 . A A .  68 THR C    1 1 
        3  4862 1 1  68 THR CA   C   2.138  -9.303   3.144 1.00 . A A .  68 THR CA   1 1 
        3  4863 1 1  68 THR CB   C   3.425  -8.943   3.926 1.00 . A A .  68 THR CB   1 1 
        3  4864 1 1  68 THR CG2  C   3.241  -9.162   5.423 1.00 . A A .  68 THR CG2  1 1 
        3  4865 1 1  68 THR H    H   2.496 -11.377   3.444 1.00 . A A .  68 THR H    1 1 
        3  4866 1 1  68 THR HA   H   1.328  -8.694   3.524 1.00 . A A .  68 THR HA   1 1 
        3  4867 1 1  68 THR HB   H   3.652  -7.898   3.756 1.00 . A A .  68 THR HB   1 1 
        3  4868 1 1  68 THR HG1  H   4.408  -9.933   2.520 1.00 . A A .  68 THR HG1  1 1 
        3  4869 1 1  68 THR HG21 H   2.464  -8.508   5.790 1.00 . A A .  68 THR HG21 1 1 
        3  4870 1 1  68 THR HG22 H   4.165  -8.944   5.935 1.00 . A A .  68 THR HG22 1 1 
        3  4871 1 1  68 THR HG23 H   2.961 -10.189   5.609 1.00 . A A .  68 THR HG23 1 1 
        3  4872 1 1  68 THR N    N   1.779 -10.718   3.323 1.00 . A A .  68 THR N    1 1 
        3  4873 1 1  68 THR O    O   2.894  -9.780   0.906 1.00 . A A .  68 THR O    1 1 
        3  4874 1 1  68 THR OG1  O   4.528  -9.739   3.457 1.00 . A A .  68 THR OG1  1 1 
        3  4875 1 1  69 VAL C    C   2.814  -5.824  -0.051 1.00 . A A .  69 VAL C    1 1 
        3  4876 1 1  69 VAL CA   C   2.253  -7.257  -0.092 1.00 . A A .  69 VAL CA   1 1 
        3  4877 1 1  69 VAL CB   C   0.965  -7.304  -0.964 1.00 . A A .  69 VAL CB   1 1 
        3  4878 1 1  69 VAL CG1  C  -0.179  -6.523  -0.313 1.00 . A A .  69 VAL CG1  1 1 
        3  4879 1 1  69 VAL CG2  C   1.246  -6.788  -2.380 1.00 . A A .  69 VAL CG2  1 1 
        3  4880 1 1  69 VAL H    H   1.554  -7.158   1.910 1.00 . A A .  69 VAL H    1 1 
        3  4881 1 1  69 VAL HA   H   2.994  -7.904  -0.546 1.00 . A A .  69 VAL HA   1 1 
        3  4882 1 1  69 VAL HB   H   0.657  -8.337  -1.043 1.00 . A A .  69 VAL HB   1 1 
        3  4883 1 1  69 VAL HG11 H   0.113  -5.490  -0.191 1.00 . A A .  69 VAL HG11 1 1 
        3  4884 1 1  69 VAL HG12 H  -0.401  -6.951   0.655 1.00 . A A .  69 VAL HG12 1 1 
        3  4885 1 1  69 VAL HG13 H  -1.056  -6.577  -0.940 1.00 . A A .  69 VAL HG13 1 1 
        3  4886 1 1  69 VAL HG21 H   0.344  -6.848  -2.973 1.00 . A A .  69 VAL HG21 1 1 
        3  4887 1 1  69 VAL HG22 H   2.018  -7.391  -2.838 1.00 . A A .  69 VAL HG22 1 1 
        3  4888 1 1  69 VAL HG23 H   1.576  -5.760  -2.331 1.00 . A A .  69 VAL HG23 1 1 
        3  4889 1 1  69 VAL N    N   2.004  -7.748   1.269 1.00 . A A .  69 VAL N    1 1 
        3  4890 1 1  69 VAL O    O   2.199  -4.920   0.515 1.00 . A A .  69 VAL O    1 1 
        3  4891 1 1  70 THR C    C   4.531  -3.544  -1.899 1.00 . A A .  70 THR C    1 1 
        3  4892 1 1  70 THR CA   C   4.661  -4.313  -0.576 1.00 . A A .  70 THR CA   1 1 
        3  4893 1 1  70 THR CB   C   6.163  -4.459  -0.232 1.00 . A A .  70 THR CB   1 1 
        3  4894 1 1  70 THR CG2  C   6.809  -3.101   0.007 1.00 . A A .  70 THR CG2  1 1 
        3  4895 1 1  70 THR H    H   4.438  -6.368  -1.096 1.00 . A A .  70 THR H    1 1 
        3  4896 1 1  70 THR HA   H   4.193  -3.734   0.209 1.00 . A A .  70 THR HA   1 1 
        3  4897 1 1  70 THR HB   H   6.663  -4.936  -1.063 1.00 . A A .  70 THR HB   1 1 
        3  4898 1 1  70 THR HG1  H   6.316  -6.207   0.675 1.00 . A A .  70 THR HG1  1 1 
        3  4899 1 1  70 THR HG21 H   6.714  -2.494  -0.882 1.00 . A A .  70 THR HG21 1 1 
        3  4900 1 1  70 THR HG22 H   7.856  -3.236   0.239 1.00 . A A .  70 THR HG22 1 1 
        3  4901 1 1  70 THR HG23 H   6.320  -2.608   0.835 1.00 . A A .  70 THR HG23 1 1 
        3  4902 1 1  70 THR N    N   3.996  -5.623  -0.630 1.00 . A A .  70 THR N    1 1 
        3  4903 1 1  70 THR O    O   4.668  -4.110  -2.982 1.00 . A A .  70 THR O    1 1 
        3  4904 1 1  70 THR OG1  O   6.328  -5.276   0.938 1.00 . A A .  70 THR OG1  1 1 
        3  4905 1 1  71 ILE C    C   5.547  -0.649  -3.168 1.00 . A A .  71 ILE C    1 1 
        3  4906 1 1  71 ILE CA   C   4.203  -1.368  -2.968 1.00 . A A .  71 ILE CA   1 1 
        3  4907 1 1  71 ILE CB   C   3.079  -0.306  -2.825 1.00 . A A .  71 ILE CB   1 1 
        3  4908 1 1  71 ILE CD1  C   1.257  -1.913  -3.643 1.00 . A A .  71 ILE CD1  1 1 
        3  4909 1 1  71 ILE CG1  C   1.726  -0.983  -2.542 1.00 . A A .  71 ILE CG1  1 1 
        3  4910 1 1  71 ILE CG2  C   2.995   0.567  -4.078 1.00 . A A .  71 ILE CG2  1 1 
        3  4911 1 1  71 ILE H    H   4.071  -1.873  -0.917 1.00 . A A .  71 ILE H    1 1 
        3  4912 1 1  71 ILE HA   H   3.992  -1.972  -3.841 1.00 . A A .  71 ILE HA   1 1 
        3  4913 1 1  71 ILE HB   H   3.328   0.336  -1.990 1.00 . A A .  71 ILE HB   1 1 
        3  4914 1 1  71 ILE HD11 H   0.308  -2.347  -3.369 1.00 . A A .  71 ILE HD11 1 1 
        3  4915 1 1  71 ILE HD12 H   1.985  -2.701  -3.786 1.00 . A A .  71 ILE HD12 1 1 
        3  4916 1 1  71 ILE HD13 H   1.146  -1.356  -4.562 1.00 . A A .  71 ILE HD13 1 1 
        3  4917 1 1  71 ILE HG12 H   1.803  -1.564  -1.634 1.00 . A A .  71 ILE HG12 1 1 
        3  4918 1 1  71 ILE HG13 H   0.970  -0.222  -2.408 1.00 . A A .  71 ILE HG13 1 1 
        3  4919 1 1  71 ILE HG21 H   3.931   1.089  -4.220 1.00 . A A .  71 ILE HG21 1 1 
        3  4920 1 1  71 ILE HG22 H   2.198   1.289  -3.966 1.00 . A A .  71 ILE HG22 1 1 
        3  4921 1 1  71 ILE HG23 H   2.798  -0.055  -4.942 1.00 . A A .  71 ILE HG23 1 1 
        3  4922 1 1  71 ILE N    N   4.254  -2.249  -1.800 1.00 . A A .  71 ILE N    1 1 
        3  4923 1 1  71 ILE O    O   5.916   0.223  -2.380 1.00 . A A .  71 ILE O    1 1 
        3  4924 1 1  72 TRP C    C   7.378   0.665  -5.628 1.00 . A A .  72 TRP C    1 1 
        3  4925 1 1  72 TRP CA   C   7.566  -0.394  -4.535 1.00 . A A .  72 TRP CA   1 1 
        3  4926 1 1  72 TRP CB   C   8.588  -1.442  -5.004 1.00 . A A .  72 TRP CB   1 1 
        3  4927 1 1  72 TRP CD1  C   8.190  -3.507  -3.538 1.00 . A A .  72 TRP CD1  1 1 
        3  4928 1 1  72 TRP CD2  C  10.164  -2.513  -3.195 1.00 . A A .  72 TRP CD2  1 1 
        3  4929 1 1  72 TRP CE2  C  10.069  -3.627  -2.339 1.00 . A A .  72 TRP CE2  1 1 
        3  4930 1 1  72 TRP CE3  C  11.323  -1.733  -3.158 1.00 . A A .  72 TRP CE3  1 1 
        3  4931 1 1  72 TRP CG   C   8.949  -2.454  -3.953 1.00 . A A .  72 TRP CG   1 1 
        3  4932 1 1  72 TRP CH2  C  12.212  -3.198  -1.442 1.00 . A A .  72 TRP CH2  1 1 
        3  4933 1 1  72 TRP CZ2  C  11.089  -3.979  -1.457 1.00 . A A .  72 TRP CZ2  1 1 
        3  4934 1 1  72 TRP CZ3  C  12.334  -2.084  -2.281 1.00 . A A .  72 TRP CZ3  1 1 
        3  4935 1 1  72 TRP H    H   5.959  -1.765  -4.775 1.00 . A A .  72 TRP H    1 1 
        3  4936 1 1  72 TRP HA   H   7.941   0.089  -3.641 1.00 . A A .  72 TRP HA   1 1 
        3  4937 1 1  72 TRP HB2  H   8.182  -1.976  -5.851 1.00 . A A .  72 TRP HB2  1 1 
        3  4938 1 1  72 TRP HB3  H   9.497  -0.939  -5.310 1.00 . A A .  72 TRP HB3  1 1 
        3  4939 1 1  72 TRP HD1  H   7.209  -3.738  -3.922 1.00 . A A .  72 TRP HD1  1 1 
        3  4940 1 1  72 TRP HE1  H   8.517  -5.019  -2.113 1.00 . A A .  72 TRP HE1  1 1 
        3  4941 1 1  72 TRP HE3  H  11.435  -0.869  -3.797 1.00 . A A .  72 TRP HE3  1 1 
        3  4942 1 1  72 TRP HH2  H  13.027  -3.434  -0.773 1.00 . A A .  72 TRP HH2  1 1 
        3  4943 1 1  72 TRP HZ2  H  11.009  -4.837  -0.804 1.00 . A A .  72 TRP HZ2  1 1 
        3  4944 1 1  72 TRP HZ3  H  13.236  -1.494  -2.237 1.00 . A A .  72 TRP HZ3  1 1 
        3  4945 1 1  72 TRP N    N   6.284  -1.034  -4.207 1.00 . A A .  72 TRP N    1 1 
        3  4946 1 1  72 TRP NE1  N   8.856  -4.218  -2.567 1.00 . A A .  72 TRP NE1  1 1 
        3  4947 1 1  72 TRP O    O   6.677   0.431  -6.611 1.00 . A A .  72 TRP O    1 1 
        3  4948 1 1  73 ALA C    C   8.477   2.506  -7.812 1.00 . A A .  73 ALA C    1 1 
        3  4949 1 1  73 ALA CA   C   7.903   2.911  -6.437 1.00 . A A .  73 ALA CA   1 1 
        3  4950 1 1  73 ALA CB   C   8.606   4.156  -5.911 1.00 . A A .  73 ALA CB   1 1 
        3  4951 1 1  73 ALA H    H   8.548   1.961  -4.646 1.00 . A A .  73 ALA H    1 1 
        3  4952 1 1  73 ALA HA   H   6.855   3.148  -6.556 1.00 . A A .  73 ALA HA   1 1 
        3  4953 1 1  73 ALA HB1  H   8.200   4.420  -4.945 1.00 . A A .  73 ALA HB1  1 1 
        3  4954 1 1  73 ALA HB2  H   8.454   4.976  -6.599 1.00 . A A .  73 ALA HB2  1 1 
        3  4955 1 1  73 ALA HB3  H   9.663   3.961  -5.813 1.00 . A A .  73 ALA HB3  1 1 
        3  4956 1 1  73 ALA N    N   8.006   1.826  -5.455 1.00 . A A .  73 ALA N    1 1 
        3  4957 1 1  73 ALA O    O   9.297   1.591  -7.907 1.00 . A A .  73 ALA O    1 1 
        3  4958 1 1  74 ALA C    C   9.999   2.710 -10.363 1.00 . A A .  74 ALA C    1 1 
        3  4959 1 1  74 ALA CA   C   8.478   2.900 -10.249 1.00 . A A .  74 ALA CA   1 1 
        3  4960 1 1  74 ALA CB   C   8.017   4.001 -11.198 1.00 . A A .  74 ALA CB   1 1 
        3  4961 1 1  74 ALA H    H   7.403   3.934  -8.726 1.00 . A A .  74 ALA H    1 1 
        3  4962 1 1  74 ALA HA   H   7.992   1.981 -10.546 1.00 . A A .  74 ALA HA   1 1 
        3  4963 1 1  74 ALA HB1  H   8.496   4.934 -10.932 1.00 . A A .  74 ALA HB1  1 1 
        3  4964 1 1  74 ALA HB2  H   6.947   4.115 -11.124 1.00 . A A .  74 ALA HB2  1 1 
        3  4965 1 1  74 ALA HB3  H   8.282   3.738 -12.213 1.00 . A A .  74 ALA HB3  1 1 
        3  4966 1 1  74 ALA N    N   8.046   3.204  -8.870 1.00 . A A .  74 ALA N    1 1 
        3  4967 1 1  74 ALA O    O  10.473   1.778 -11.018 1.00 . A A .  74 ALA O    1 1 
        3  4968 1 1  75 ASN C    C  12.770   2.798  -8.514 1.00 . A A .  75 ASN C    1 1 
        3  4969 1 1  75 ASN CA   C  12.225   3.516  -9.760 1.00 . A A .  75 ASN CA   1 1 
        3  4970 1 1  75 ASN CB   C  12.845   4.913  -9.891 1.00 . A A .  75 ASN CB   1 1 
        3  4971 1 1  75 ASN CG   C  12.436   5.608 -11.177 1.00 . A A .  75 ASN CG   1 1 
        3  4972 1 1  75 ASN H    H  10.332   4.327  -9.243 1.00 . A A .  75 ASN H    1 1 
        3  4973 1 1  75 ASN HA   H  12.502   2.937 -10.632 1.00 . A A .  75 ASN HA   1 1 
        3  4974 1 1  75 ASN HB2  H  12.526   5.527  -9.057 1.00 . A A .  75 ASN HB2  1 1 
        3  4975 1 1  75 ASN HB3  H  13.923   4.827  -9.875 1.00 . A A .  75 ASN HB3  1 1 
        3  4976 1 1  75 ASN HD21 H  14.207   6.468 -11.312 1.00 . A A .  75 ASN HD21 1 1 
        3  4977 1 1  75 ASN HD22 H  13.093   6.832 -12.579 1.00 . A A .  75 ASN HD22 1 1 
        3  4978 1 1  75 ASN N    N  10.760   3.600  -9.735 1.00 . A A .  75 ASN N    1 1 
        3  4979 1 1  75 ASN ND2  N  13.333   6.381 -11.745 1.00 . A A .  75 ASN ND2  1 1 
        3  4980 1 1  75 ASN O    O  13.299   3.427  -7.596 1.00 . A A .  75 ASN O    1 1 
        3  4981 1 1  75 ASN OD1  O  11.323   5.446 -11.661 1.00 . A A .  75 ASN OD1  1 1 
        3  4982 1 1  76 ALA C    C  14.059  -0.454  -7.913 1.00 . A A .  76 ALA C    1 1 
        3  4983 1 1  76 ALA CA   C  13.125   0.651  -7.387 1.00 . A A .  76 ALA CA   1 1 
        3  4984 1 1  76 ALA CB   C  11.963   0.045  -6.603 1.00 . A A .  76 ALA CB   1 1 
        3  4985 1 1  76 ALA H    H  12.129   1.045  -9.217 1.00 . A A .  76 ALA H    1 1 
        3  4986 1 1  76 ALA HA   H  13.687   1.288  -6.715 1.00 . A A .  76 ALA HA   1 1 
        3  4987 1 1  76 ALA HB1  H  11.396  -0.609  -7.249 1.00 . A A .  76 ALA HB1  1 1 
        3  4988 1 1  76 ALA HB2  H  11.321   0.835  -6.241 1.00 . A A .  76 ALA HB2  1 1 
        3  4989 1 1  76 ALA HB3  H  12.344  -0.520  -5.764 1.00 . A A .  76 ALA HB3  1 1 
        3  4990 1 1  76 ALA N    N  12.612   1.478  -8.484 1.00 . A A .  76 ALA N    1 1 
        3  4991 1 1  76 ALA O    O  14.550  -1.286  -7.147 1.00 . A A .  76 ALA O    1 1 
        3  4992 1 1  77 GLY C    C  14.608  -2.869  -9.787 1.00 . A A .  77 GLY C    1 1 
        3  4993 1 1  77 GLY CA   C  15.168  -1.449  -9.850 1.00 . A A .  77 GLY CA   1 1 
        3  4994 1 1  77 GLY H    H  13.904   0.256  -9.777 1.00 . A A .  77 GLY H    1 1 
        3  4995 1 1  77 GLY HA2  H  15.307  -1.181 -10.886 1.00 . A A .  77 GLY HA2  1 1 
        3  4996 1 1  77 GLY HA3  H  16.131  -1.430  -9.358 1.00 . A A .  77 GLY HA3  1 1 
        3  4997 1 1  77 GLY N    N  14.302  -0.448  -9.225 1.00 . A A .  77 GLY N    1 1 
        3  4998 1 1  77 GLY O    O  15.339  -3.842  -9.992 1.00 . A A .  77 GLY O    1 1 
        3  4999 1 1  78 VAL C    C  12.093  -4.845 -10.680 1.00 . A A .  78 VAL C    1 1 
        3  5000 1 1  78 VAL CA   C  12.662  -4.300  -9.355 1.00 . A A .  78 VAL CA   1 1 
        3  5001 1 1  78 VAL CB   C  11.533  -4.233  -8.293 1.00 . A A .  78 VAL CB   1 1 
        3  5002 1 1  78 VAL CG1  C  12.102  -3.867  -6.920 1.00 . A A .  78 VAL CG1  1 1 
        3  5003 1 1  78 VAL CG2  C  10.451  -3.238  -8.713 1.00 . A A .  78 VAL CG2  1 1 
        3  5004 1 1  78 VAL H    H  12.768  -2.178  -9.439 1.00 . A A .  78 VAL H    1 1 
        3  5005 1 1  78 VAL HA   H  13.411  -4.995  -8.996 1.00 . A A .  78 VAL HA   1 1 
        3  5006 1 1  78 VAL HB   H  11.079  -5.214  -8.216 1.00 . A A .  78 VAL HB   1 1 
        3  5007 1 1  78 VAL HG11 H  11.303  -3.838  -6.192 1.00 . A A .  78 VAL HG11 1 1 
        3  5008 1 1  78 VAL HG12 H  12.577  -2.898  -6.973 1.00 . A A .  78 VAL HG12 1 1 
        3  5009 1 1  78 VAL HG13 H  12.831  -4.608  -6.624 1.00 . A A .  78 VAL HG13 1 1 
        3  5010 1 1  78 VAL HG21 H  10.887  -2.254  -8.818 1.00 . A A .  78 VAL HG21 1 1 
        3  5011 1 1  78 VAL HG22 H   9.676  -3.209  -7.961 1.00 . A A .  78 VAL HG22 1 1 
        3  5012 1 1  78 VAL HG23 H  10.026  -3.545  -9.656 1.00 . A A .  78 VAL HG23 1 1 
        3  5013 1 1  78 VAL N    N  13.309  -2.989  -9.522 1.00 . A A .  78 VAL N    1 1 
        3  5014 1 1  78 VAL O    O  12.061  -4.145 -11.698 1.00 . A A .  78 VAL O    1 1 
        3  5015 1 1  79 THR C    C   9.653  -6.421 -12.117 1.00 . A A .  79 THR C    1 1 
        3  5016 1 1  79 THR CA   C  11.121  -6.778 -11.848 1.00 . A A .  79 THR CA   1 1 
        3  5017 1 1  79 THR CB   C  11.239  -8.315 -11.719 1.00 . A A .  79 THR CB   1 1 
        3  5018 1 1  79 THR CG2  C  12.693  -8.749 -11.546 1.00 . A A .  79 THR CG2  1 1 
        3  5019 1 1  79 THR H    H  11.669  -6.594  -9.805 1.00 . A A .  79 THR H    1 1 
        3  5020 1 1  79 THR HA   H  11.714  -6.466 -12.697 1.00 . A A .  79 THR HA   1 1 
        3  5021 1 1  79 THR HB   H  10.851  -8.769 -12.621 1.00 . A A .  79 THR HB   1 1 
        3  5022 1 1  79 THR HG1  H  10.347  -9.732 -10.665 1.00 . A A .  79 THR HG1  1 1 
        3  5023 1 1  79 THR HG21 H  13.278  -8.395 -12.383 1.00 . A A .  79 THR HG21 1 1 
        3  5024 1 1  79 THR HG22 H  12.743  -9.828 -11.504 1.00 . A A .  79 THR HG22 1 1 
        3  5025 1 1  79 THR HG23 H  13.088  -8.336 -10.630 1.00 . A A .  79 THR HG23 1 1 
        3  5026 1 1  79 THR N    N  11.648  -6.101 -10.652 1.00 . A A .  79 THR N    1 1 
        3  5027 1 1  79 THR O    O   8.955  -5.895 -11.246 1.00 . A A .  79 THR O    1 1 
        3  5028 1 1  79 THR OG1  O  10.467  -8.777 -10.599 1.00 . A A .  79 THR OG1  1 1 
        3  5029 1 1  80 ALA C    C   6.817  -7.457 -13.175 1.00 . A A .  80 ALA C    1 1 
        3  5030 1 1  80 ALA CA   C   7.806  -6.414 -13.722 1.00 . A A .  80 ALA CA   1 1 
        3  5031 1 1  80 ALA CB   C   7.699  -6.315 -15.242 1.00 . A A .  80 ALA CB   1 1 
        3  5032 1 1  80 ALA H    H   9.780  -7.154 -13.975 1.00 . A A .  80 ALA H    1 1 
        3  5033 1 1  80 ALA HA   H   7.547  -5.449 -13.309 1.00 . A A .  80 ALA HA   1 1 
        3  5034 1 1  80 ALA HB1  H   6.702  -6.003 -15.516 1.00 . A A .  80 ALA HB1  1 1 
        3  5035 1 1  80 ALA HB2  H   7.907  -7.279 -15.683 1.00 . A A .  80 ALA HB2  1 1 
        3  5036 1 1  80 ALA HB3  H   8.413  -5.591 -15.608 1.00 . A A .  80 ALA HB3  1 1 
        3  5037 1 1  80 ALA N    N   9.185  -6.716 -13.329 1.00 . A A .  80 ALA N    1 1 
        3  5038 1 1  80 ALA O    O   6.546  -8.471 -13.822 1.00 . A A .  80 ALA O    1 1 
        3  5039 1 1  81 SER C    C   5.941  -9.504 -11.091 1.00 . A A .  81 SER C    1 1 
        3  5040 1 1  81 SER CA   C   5.338  -8.103 -11.308 1.00 . A A .  81 SER CA   1 1 
        3  5041 1 1  81 SER CB   C   4.037  -8.198 -12.124 1.00 . A A .  81 SER CB   1 1 
        3  5042 1 1  81 SER H    H   6.581  -6.384 -11.505 1.00 . A A .  81 SER H    1 1 
        3  5043 1 1  81 SER HA   H   5.109  -7.678 -10.341 1.00 . A A .  81 SER HA   1 1 
        3  5044 1 1  81 SER HB2  H   3.634  -7.207 -12.268 1.00 . A A .  81 SER HB2  1 1 
        3  5045 1 1  81 SER HB3  H   4.253  -8.636 -13.089 1.00 . A A .  81 SER HB3  1 1 
        3  5046 1 1  81 SER HG   H   2.294  -9.086 -12.056 1.00 . A A .  81 SER HG   1 1 
        3  5047 1 1  81 SER N    N   6.300  -7.201 -11.968 1.00 . A A .  81 SER N    1 1 
        3  5048 1 1  81 SER O    O   5.699 -10.423 -11.879 1.00 . A A .  81 SER O    1 1 
        3  5049 1 1  81 SER OG   O   3.056  -8.992 -11.472 1.00 . A A .  81 SER OG   1 1 
        3  5050 1 1  82 PRO C    C   6.672 -12.240  -9.931 1.00 . A A .  82 PRO C    1 1 
        3  5051 1 1  82 PRO CA   C   7.492 -10.930  -9.753 1.00 . A A .  82 PRO CA   1 1 
        3  5052 1 1  82 PRO CB   C   7.983 -10.751  -8.311 1.00 . A A .  82 PRO CB   1 1 
        3  5053 1 1  82 PRO CD   C   7.029  -8.650  -8.985 1.00 . A A .  82 PRO CD   1 1 
        3  5054 1 1  82 PRO CG   C   8.123  -9.271  -8.147 1.00 . A A .  82 PRO CG   1 1 
        3  5055 1 1  82 PRO HA   H   8.355 -10.989 -10.404 1.00 . A A .  82 PRO HA   1 1 
        3  5056 1 1  82 PRO HB2  H   7.256 -11.161  -7.623 1.00 . A A .  82 PRO HB2  1 1 
        3  5057 1 1  82 PRO HB3  H   8.930 -11.253  -8.181 1.00 . A A .  82 PRO HB3  1 1 
        3  5058 1 1  82 PRO HD2  H   6.150  -8.462  -8.381 1.00 . A A .  82 PRO HD2  1 1 
        3  5059 1 1  82 PRO HD3  H   7.375  -7.732  -9.441 1.00 . A A .  82 PRO HD3  1 1 
        3  5060 1 1  82 PRO HG2  H   8.000  -9.002  -7.107 1.00 . A A .  82 PRO HG2  1 1 
        3  5061 1 1  82 PRO HG3  H   9.095  -8.950  -8.503 1.00 . A A .  82 PRO HG3  1 1 
        3  5062 1 1  82 PRO N    N   6.750  -9.677 -10.016 1.00 . A A .  82 PRO N    1 1 
        3  5063 1 1  82 PRO O    O   7.120 -13.133 -10.652 1.00 . A A .  82 PRO O    1 1 
        3  5064 1 1  83 PRO C    C   4.988 -11.773  -6.916 1.00 . A A .  83 PRO C    1 1 
        3  5065 1 1  83 PRO CA   C   4.822 -11.442  -8.420 1.00 . A A .  83 PRO CA   1 1 
        3  5066 1 1  83 PRO CB   C   3.360 -11.585  -8.840 1.00 . A A .  83 PRO CB   1 1 
        3  5067 1 1  83 PRO CD   C   4.592 -13.572  -9.503 1.00 . A A .  83 PRO CD   1 1 
        3  5068 1 1  83 PRO CG   C   3.205 -13.041  -9.175 1.00 . A A .  83 PRO CG   1 1 
        3  5069 1 1  83 PRO HA   H   5.155 -10.431  -8.608 1.00 . A A .  83 PRO HA   1 1 
        3  5070 1 1  83 PRO HB2  H   2.712 -11.290  -8.025 1.00 . A A .  83 PRO HB2  1 1 
        3  5071 1 1  83 PRO HB3  H   3.166 -10.961  -9.701 1.00 . A A .  83 PRO HB3  1 1 
        3  5072 1 1  83 PRO HD2  H   4.866 -14.365  -8.820 1.00 . A A .  83 PRO HD2  1 1 
        3  5073 1 1  83 PRO HD3  H   4.633 -13.924 -10.524 1.00 . A A .  83 PRO HD3  1 1 
        3  5074 1 1  83 PRO HG2  H   2.796 -13.569  -8.325 1.00 . A A .  83 PRO HG2  1 1 
        3  5075 1 1  83 PRO HG3  H   2.551 -13.150 -10.031 1.00 . A A .  83 PRO HG3  1 1 
        3  5076 1 1  83 PRO N    N   5.467 -12.403  -9.316 1.00 . A A .  83 PRO N    1 1 
        3  5077 1 1  83 PRO O    O   5.086 -12.933  -6.516 1.00 . A A .  83 PRO O    1 1 
        3  5078 1 1  84 THR C    C   4.856  -9.437  -4.034 1.00 . A A .  84 THR C    1 1 
        3  5079 1 1  84 THR CA   C   5.058 -10.825  -4.632 1.00 . A A .  84 THR CA   1 1 
        3  5080 1 1  84 THR CB   C   6.388 -11.428  -4.090 1.00 . A A .  84 THR CB   1 1 
        3  5081 1 1  84 THR CG2  C   7.607 -10.686  -4.633 1.00 . A A .  84 THR CG2  1 1 
        3  5082 1 1  84 THR H    H   4.998  -9.828  -6.507 1.00 . A A .  84 THR H    1 1 
        3  5083 1 1  84 THR HA   H   4.240 -11.460  -4.320 1.00 . A A .  84 THR HA   1 1 
        3  5084 1 1  84 THR HB   H   6.447 -12.459  -4.411 1.00 . A A .  84 THR HB   1 1 
        3  5085 1 1  84 THR HG1  H   5.662 -10.871  -2.320 1.00 . A A .  84 THR HG1  1 1 
        3  5086 1 1  84 THR HG21 H   7.604 -10.727  -5.712 1.00 . A A .  84 THR HG21 1 1 
        3  5087 1 1  84 THR HG22 H   8.508 -11.150  -4.257 1.00 . A A .  84 THR HG22 1 1 
        3  5088 1 1  84 THR HG23 H   7.576  -9.654  -4.313 1.00 . A A .  84 THR HG23 1 1 
        3  5089 1 1  84 THR N    N   5.016 -10.722  -6.104 1.00 . A A .  84 THR N    1 1 
        3  5090 1 1  84 THR O    O   4.193  -9.268  -3.013 1.00 . A A .  84 THR O    1 1 
        3  5091 1 1  84 THR OG1  O   6.410 -11.392  -2.646 1.00 . A A .  84 THR OG1  1 1 
        3  5092 1 1  85 ASP C    C   4.723  -6.327  -5.668 1.00 . A A .  85 ASP C    1 1 
        3  5093 1 1  85 ASP CA   C   5.222  -7.043  -4.400 1.00 . A A .  85 ASP CA   1 1 
        3  5094 1 1  85 ASP CB   C   6.525  -6.414  -3.904 1.00 . A A .  85 ASP CB   1 1 
        3  5095 1 1  85 ASP CG   C   7.115  -7.171  -2.726 1.00 . A A .  85 ASP CG   1 1 
        3  5096 1 1  85 ASP H    H   6.079  -8.679  -5.409 1.00 . A A .  85 ASP H    1 1 
        3  5097 1 1  85 ASP HA   H   4.468  -6.972  -3.629 1.00 . A A .  85 ASP HA   1 1 
        3  5098 1 1  85 ASP HB2  H   7.246  -6.410  -4.709 1.00 . A A .  85 ASP HB2  1 1 
        3  5099 1 1  85 ASP HB3  H   6.334  -5.395  -3.594 1.00 . A A .  85 ASP HB3  1 1 
        3  5100 1 1  85 ASP N    N   5.447  -8.452  -4.699 1.00 . A A .  85 ASP N    1 1 
        3  5101 1 1  85 ASP O    O   4.961  -6.800  -6.783 1.00 . A A .  85 ASP O    1 1 
        3  5102 1 1  85 ASP OD1  O   6.498  -7.166  -1.641 1.00 . A A .  85 ASP OD1  1 1 
        3  5103 1 1  85 ASP OD2  O   8.196  -7.778  -2.880 1.00 . A A .  85 ASP OD2  1 1 
        3  5104 1 1  86 LEU C    C   4.252  -3.225  -7.011 1.00 . A A .  86 LEU C    1 1 
        3  5105 1 1  86 LEU CA   C   3.453  -4.489  -6.660 1.00 . A A .  86 LEU CA   1 1 
        3  5106 1 1  86 LEU CB   C   1.986  -4.130  -6.385 1.00 . A A .  86 LEU CB   1 1 
        3  5107 1 1  86 LEU CD1  C  -0.381  -4.867  -5.907 1.00 . A A .  86 LEU CD1  1 1 
        3  5108 1 1  86 LEU CD2  C   1.064  -6.223  -7.454 1.00 . A A .  86 LEU CD2  1 1 
        3  5109 1 1  86 LEU CG   C   1.040  -5.332  -6.212 1.00 . A A .  86 LEU CG   1 1 
        3  5110 1 1  86 LEU H    H   3.911  -4.834  -4.607 1.00 . A A .  86 LEU H    1 1 
        3  5111 1 1  86 LEU HA   H   3.488  -5.158  -7.511 1.00 . A A .  86 LEU HA   1 1 
        3  5112 1 1  86 LEU HB2  H   1.949  -3.536  -5.484 1.00 . A A .  86 LEU HB2  1 1 
        3  5113 1 1  86 LEU HB3  H   1.623  -3.529  -7.208 1.00 . A A .  86 LEU HB3  1 1 
        3  5114 1 1  86 LEU HD11 H  -1.019  -5.726  -5.768 1.00 . A A .  86 LEU HD11 1 1 
        3  5115 1 1  86 LEU HD12 H  -0.754  -4.273  -6.729 1.00 . A A .  86 LEU HD12 1 1 
        3  5116 1 1  86 LEU HD13 H  -0.381  -4.272  -5.005 1.00 . A A .  86 LEU HD13 1 1 
        3  5117 1 1  86 LEU HD21 H   2.071  -6.579  -7.625 1.00 . A A .  86 LEU HD21 1 1 
        3  5118 1 1  86 LEU HD22 H   0.732  -5.659  -8.314 1.00 . A A .  86 LEU HD22 1 1 
        3  5119 1 1  86 LEU HD23 H   0.408  -7.067  -7.305 1.00 . A A .  86 LEU HD23 1 1 
        3  5120 1 1  86 LEU HG   H   1.380  -5.924  -5.373 1.00 . A A .  86 LEU HG   1 1 
        3  5121 1 1  86 LEU N    N   4.029  -5.202  -5.511 1.00 . A A .  86 LEU N    1 1 
        3  5122 1 1  86 LEU O    O   4.727  -2.508  -6.128 1.00 . A A .  86 LEU O    1 1 
        3  5123 1 1  87 ILE C    C   4.254  -0.597  -9.068 1.00 . A A .  87 ILE C    1 1 
        3  5124 1 1  87 ILE CA   C   5.163  -1.813  -8.800 1.00 . A A .  87 ILE CA   1 1 
        3  5125 1 1  87 ILE CB   C   5.951  -2.157 -10.099 1.00 . A A .  87 ILE CB   1 1 
        3  5126 1 1  87 ILE CD1  C   6.404  -4.644  -9.587 1.00 . A A .  87 ILE CD1  1 1 
        3  5127 1 1  87 ILE CG1  C   6.993  -3.271  -9.852 1.00 . A A .  87 ILE CG1  1 1 
        3  5128 1 1  87 ILE CG2  C   6.639  -0.910 -10.660 1.00 . A A .  87 ILE CG2  1 1 
        3  5129 1 1  87 ILE H    H   3.960  -3.551  -8.961 1.00 . A A .  87 ILE H    1 1 
        3  5130 1 1  87 ILE HA   H   5.881  -1.546  -8.033 1.00 . A A .  87 ILE HA   1 1 
        3  5131 1 1  87 ILE HB   H   5.239  -2.502 -10.838 1.00 . A A .  87 ILE HB   1 1 
        3  5132 1 1  87 ILE HD11 H   7.204  -5.357  -9.444 1.00 . A A .  87 ILE HD11 1 1 
        3  5133 1 1  87 ILE HD12 H   5.800  -4.947 -10.430 1.00 . A A .  87 ILE HD12 1 1 
        3  5134 1 1  87 ILE HD13 H   5.792  -4.609  -8.698 1.00 . A A .  87 ILE HD13 1 1 
        3  5135 1 1  87 ILE HG12 H   7.628  -3.357 -10.721 1.00 . A A .  87 ILE HG12 1 1 
        3  5136 1 1  87 ILE HG13 H   7.601  -3.004  -8.999 1.00 . A A .  87 ILE HG13 1 1 
        3  5137 1 1  87 ILE HG21 H   7.183  -1.170 -11.556 1.00 . A A .  87 ILE HG21 1 1 
        3  5138 1 1  87 ILE HG22 H   7.325  -0.513  -9.926 1.00 . A A .  87 ILE HG22 1 1 
        3  5139 1 1  87 ILE HG23 H   5.895  -0.161 -10.897 1.00 . A A .  87 ILE HG23 1 1 
        3  5140 1 1  87 ILE N    N   4.390  -2.960  -8.311 1.00 . A A .  87 ILE N    1 1 
        3  5141 1 1  87 ILE O    O   3.313  -0.662  -9.867 1.00 . A A .  87 ILE O    1 1 
        3  5142 1 1  88 TRP C    C   4.380   2.616  -9.667 1.00 . A A .  88 TRP C    1 1 
        3  5143 1 1  88 TRP CA   C   3.790   1.751  -8.541 1.00 . A A .  88 TRP CA   1 1 
        3  5144 1 1  88 TRP CB   C   3.811   2.513  -7.205 1.00 . A A .  88 TRP CB   1 1 
        3  5145 1 1  88 TRP CD1  C   2.100   4.218  -8.101 1.00 . A A .  88 TRP CD1  1 1 
        3  5146 1 1  88 TRP CD2  C   2.489   4.358  -5.905 1.00 . A A .  88 TRP CD2  1 1 
        3  5147 1 1  88 TRP CE2  C   1.538   5.331  -6.254 1.00 . A A .  88 TRP CE2  1 1 
        3  5148 1 1  88 TRP CE3  C   2.893   4.256  -4.570 1.00 . A A .  88 TRP CE3  1 1 
        3  5149 1 1  88 TRP CG   C   2.833   3.650  -7.099 1.00 . A A .  88 TRP CG   1 1 
        3  5150 1 1  88 TRP CH2  C   1.396   6.078  -4.021 1.00 . A A .  88 TRP CH2  1 1 
        3  5151 1 1  88 TRP CZ2  C   0.983   6.198  -5.319 1.00 . A A .  88 TRP CZ2  1 1 
        3  5152 1 1  88 TRP CZ3  C   2.343   5.118  -3.642 1.00 . A A .  88 TRP CZ3  1 1 
        3  5153 1 1  88 TRP H    H   5.311   0.491  -7.780 1.00 . A A .  88 TRP H    1 1 
        3  5154 1 1  88 TRP HA   H   2.767   1.498  -8.788 1.00 . A A .  88 TRP HA   1 1 
        3  5155 1 1  88 TRP HB2  H   3.588   1.819  -6.408 1.00 . A A .  88 TRP HB2  1 1 
        3  5156 1 1  88 TRP HB3  H   4.804   2.912  -7.047 1.00 . A A .  88 TRP HB3  1 1 
        3  5157 1 1  88 TRP HD1  H   2.136   3.905  -9.134 1.00 . A A .  88 TRP HD1  1 1 
        3  5158 1 1  88 TRP HE1  H   0.694   5.781  -8.119 1.00 . A A .  88 TRP HE1  1 1 
        3  5159 1 1  88 TRP HE3  H   3.623   3.520  -4.261 1.00 . A A .  88 TRP HE3  1 1 
        3  5160 1 1  88 TRP HH2  H   0.993   6.731  -3.262 1.00 . A A .  88 TRP HH2  1 1 
        3  5161 1 1  88 TRP HZ2  H   0.250   6.942  -5.594 1.00 . A A .  88 TRP HZ2  1 1 
        3  5162 1 1  88 TRP HZ3  H   2.644   5.057  -2.607 1.00 . A A .  88 TRP HZ3  1 1 
        3  5163 1 1  88 TRP N    N   4.551   0.508  -8.398 1.00 . A A .  88 TRP N    1 1 
        3  5164 1 1  88 TRP NE1  N   1.315   5.226  -7.598 1.00 . A A .  88 TRP NE1  1 1 
        3  5165 1 1  88 TRP O    O   5.189   3.508  -9.420 1.00 . A A .  88 TRP O    1 1 
        3  5166 1 1  89 LYS C    C   3.948   4.493 -12.177 1.00 . A A .  89 LYS C    1 1 
        3  5167 1 1  89 LYS CA   C   4.523   3.069 -12.066 1.00 . A A .  89 LYS CA   1 1 
        3  5168 1 1  89 LYS CB   C   4.259   2.299 -13.367 1.00 . A A .  89 LYS CB   1 1 
        3  5169 1 1  89 LYS CD   C   4.850   0.298 -14.804 1.00 . A A .  89 LYS CD   1 1 
        3  5170 1 1  89 LYS CE   C   3.424   0.138 -15.324 1.00 . A A .  89 LYS CE   1 1 
        3  5171 1 1  89 LYS CG   C   4.895   0.911 -13.404 1.00 . A A .  89 LYS CG   1 1 
        3  5172 1 1  89 LYS H    H   3.326   1.628 -11.053 1.00 . A A .  89 LYS H    1 1 
        3  5173 1 1  89 LYS HA   H   5.591   3.147 -11.927 1.00 . A A .  89 LYS HA   1 1 
        3  5174 1 1  89 LYS HB2  H   3.192   2.185 -13.494 1.00 . A A .  89 LYS HB2  1 1 
        3  5175 1 1  89 LYS HB3  H   4.651   2.872 -14.197 1.00 . A A .  89 LYS HB3  1 1 
        3  5176 1 1  89 LYS HD2  H   5.394   0.938 -15.483 1.00 . A A .  89 LYS HD2  1 1 
        3  5177 1 1  89 LYS HD3  H   5.323  -0.675 -14.774 1.00 . A A .  89 LYS HD3  1 1 
        3  5178 1 1  89 LYS HE2  H   2.903  -0.576 -14.702 1.00 . A A .  89 LYS HE2  1 1 
        3  5179 1 1  89 LYS HE3  H   2.923   1.094 -15.270 1.00 . A A .  89 LYS HE3  1 1 
        3  5180 1 1  89 LYS HG2  H   5.928   0.993 -13.094 1.00 . A A .  89 LYS HG2  1 1 
        3  5181 1 1  89 LYS HG3  H   4.365   0.263 -12.717 1.00 . A A .  89 LYS HG3  1 1 
        3  5182 1 1  89 LYS HZ1  H   3.885  -1.256 -16.810 1.00 . A A .  89 LYS HZ1  1 1 
        3  5183 1 1  89 LYS HZ2  H   3.872   0.345 -17.353 1.00 . A A .  89 LYS HZ2  1 1 
        3  5184 1 1  89 LYS HZ3  H   2.415  -0.457 -17.052 1.00 . A A .  89 LYS HZ3  1 1 
        3  5185 1 1  89 LYS N    N   3.983   2.341 -10.909 1.00 . A A .  89 LYS N    1 1 
        3  5186 1 1  89 LYS NZ   N   3.396  -0.341 -16.732 1.00 . A A .  89 LYS NZ   1 1 
        3  5187 1 1  89 LYS O    O   4.499   5.335 -12.885 1.00 . A A .  89 LYS O    1 1 
        3  5188 1 1  90 ASN C    C   3.084   7.162 -10.874 1.00 . A A .  90 ASN C    1 1 
        3  5189 1 1  90 ASN CA   C   2.191   6.074 -11.503 1.00 . A A .  90 ASN CA   1 1 
        3  5190 1 1  90 ASN CB   C   0.847   6.026 -10.757 1.00 . A A .  90 ASN CB   1 1 
        3  5191 1 1  90 ASN CG   C  -0.027   4.855 -11.172 1.00 . A A .  90 ASN CG   1 1 
        3  5192 1 1  90 ASN H    H   2.448   4.038 -10.938 1.00 . A A .  90 ASN H    1 1 
        3  5193 1 1  90 ASN HA   H   2.010   6.330 -12.537 1.00 . A A .  90 ASN HA   1 1 
        3  5194 1 1  90 ASN HB2  H   1.033   5.946  -9.696 1.00 . A A .  90 ASN HB2  1 1 
        3  5195 1 1  90 ASN HB3  H   0.305   6.942 -10.951 1.00 . A A .  90 ASN HB3  1 1 
        3  5196 1 1  90 ASN HD21 H  -1.663   5.904 -10.805 1.00 . A A .  90 ASN HD21 1 1 
        3  5197 1 1  90 ASN HD22 H  -1.906   4.288 -11.367 1.00 . A A .  90 ASN HD22 1 1 
        3  5198 1 1  90 ASN N    N   2.846   4.754 -11.475 1.00 . A A .  90 ASN N    1 1 
        3  5199 1 1  90 ASN ND2  N  -1.327   5.035 -11.111 1.00 . A A .  90 ASN ND2  1 1 
        3  5200 1 1  90 ASN O    O   2.842   8.358 -11.052 1.00 . A A .  90 ASN O    1 1 
        3  5201 1 1  90 ASN OD1  O   0.462   3.791 -11.533 1.00 . A A .  90 ASN OD1  1 1 
        3  5202 1 1  91 GLN C    C   6.433   7.077  -9.353 1.00 . A A .  91 GLN C    1 1 
        3  5203 1 1  91 GLN CA   C   5.018   7.668  -9.458 1.00 . A A .  91 GLN CA   1 1 
        3  5204 1 1  91 GLN CB   C   4.490   7.993  -8.056 1.00 . A A .  91 GLN CB   1 1 
        3  5205 1 1  91 GLN CD   C   4.917   9.163  -5.840 1.00 . A A .  91 GLN CD   1 1 
        3  5206 1 1  91 GLN CG   C   5.331   9.017  -7.296 1.00 . A A .  91 GLN CG   1 1 
        3  5207 1 1  91 GLN H    H   4.259   5.776 -10.037 1.00 . A A .  91 GLN H    1 1 
        3  5208 1 1  91 GLN HA   H   5.060   8.579 -10.041 1.00 . A A .  91 GLN HA   1 1 
        3  5209 1 1  91 GLN HB2  H   3.486   8.381  -8.145 1.00 . A A .  91 GLN HB2  1 1 
        3  5210 1 1  91 GLN HB3  H   4.461   7.081  -7.476 1.00 . A A .  91 GLN HB3  1 1 
        3  5211 1 1  91 GLN HE21 H   4.419   7.247  -5.745 1.00 . A A .  91 GLN HE21 1 1 
        3  5212 1 1  91 GLN HE22 H   4.206   8.156  -4.301 1.00 . A A .  91 GLN HE22 1 1 
        3  5213 1 1  91 GLN HG2  H   6.366   8.711  -7.329 1.00 . A A .  91 GLN HG2  1 1 
        3  5214 1 1  91 GLN HG3  H   5.228   9.979  -7.781 1.00 . A A .  91 GLN HG3  1 1 
        3  5215 1 1  91 GLN N    N   4.107   6.739 -10.131 1.00 . A A .  91 GLN N    1 1 
        3  5216 1 1  91 GLN NE2  N   4.467   8.079  -5.235 1.00 . A A .  91 GLN NE2  1 1 
        3  5217 1 1  91 GLN O    O   6.598   5.890  -9.068 1.00 . A A .  91 GLN O    1 1 
        3  5218 1 1  91 GLN OE1  O   5.021  10.236  -5.255 1.00 . A A .  91 GLN OE1  1 1 
        3  5219 1 1  92 ASN C    C   9.220   7.306  -7.946 1.00 . A A .  92 ASN C    1 1 
        3  5220 1 1  92 ASN CA   C   8.844   7.472  -9.431 1.00 . A A .  92 ASN CA   1 1 
        3  5221 1 1  92 ASN CB   C   9.792   8.468 -10.109 1.00 . A A .  92 ASN CB   1 1 
        3  5222 1 1  92 ASN CG   C   9.438   8.703 -11.568 1.00 . A A .  92 ASN CG   1 1 
        3  5223 1 1  92 ASN H    H   7.261   8.827  -9.864 1.00 . A A .  92 ASN H    1 1 
        3  5224 1 1  92 ASN HA   H   8.943   6.511  -9.919 1.00 . A A .  92 ASN HA   1 1 
        3  5225 1 1  92 ASN HB2  H   9.741   9.416  -9.590 1.00 . A A .  92 ASN HB2  1 1 
        3  5226 1 1  92 ASN HB3  H  10.804   8.092 -10.056 1.00 . A A .  92 ASN HB3  1 1 
        3  5227 1 1  92 ASN HD21 H  10.486   7.119 -12.130 1.00 . A A .  92 ASN HD21 1 1 
        3  5228 1 1  92 ASN HD22 H   9.700   7.994 -13.393 1.00 . A A .  92 ASN HD22 1 1 
        3  5229 1 1  92 ASN N    N   7.450   7.905  -9.581 1.00 . A A .  92 ASN N    1 1 
        3  5230 1 1  92 ASN ND2  N   9.925   7.853 -12.450 1.00 . A A .  92 ASN ND2  1 1 
        3  5231 1 1  92 ASN O    O   8.385   7.475  -7.057 1.00 . A A .  92 ASN O    1 1 
        3  5232 1 1  92 ASN OD1  O   8.726   9.642 -11.904 1.00 . A A .  92 ASN OD1  1 1 
        3  5233 1 1  93 SER C    C  11.187   8.073  -5.568 1.00 . A A .  93 SER C    1 1 
        3  5234 1 1  93 SER CA   C  10.951   6.748  -6.302 1.00 . A A .  93 SER CA   1 1 
        3  5235 1 1  93 SER CB   C  12.242   5.924  -6.307 1.00 . A A .  93 SER CB   1 1 
        3  5236 1 1  93 SER H    H  11.118   6.888  -8.420 1.00 . A A .  93 SER H    1 1 
        3  5237 1 1  93 SER HA   H  10.185   6.194  -5.779 1.00 . A A .  93 SER HA   1 1 
        3  5238 1 1  93 SER HB2  H  12.061   4.980  -6.801 1.00 . A A .  93 SER HB2  1 1 
        3  5239 1 1  93 SER HB3  H  13.010   6.464  -6.843 1.00 . A A .  93 SER HB3  1 1 
        3  5240 1 1  93 SER HG   H  12.975   4.742  -4.921 1.00 . A A .  93 SER HG   1 1 
        3  5241 1 1  93 SER N    N  10.482   6.971  -7.681 1.00 . A A .  93 SER N    1 1 
        3  5242 1 1  93 SER O    O  11.661   9.042  -6.164 1.00 . A A .  93 SER O    1 1 
        3  5243 1 1  93 SER OG   O  12.700   5.666  -4.992 1.00 . A A .  93 SER OG   1 1 
        3  5244 1 1  94 TRP C    C  11.877   9.060  -2.222 1.00 . A A .  94 TRP C    1 1 
        3  5245 1 1  94 TRP CA   C  11.031   9.328  -3.474 1.00 . A A .  94 TRP CA   1 1 
        3  5246 1 1  94 TRP CB   C   9.660   9.902  -3.076 1.00 . A A .  94 TRP CB   1 1 
        3  5247 1 1  94 TRP CD1  C   8.903   9.113  -0.747 1.00 . A A .  94 TRP CD1  1 1 
        3  5248 1 1  94 TRP CD2  C   7.961   7.992  -2.442 1.00 . A A .  94 TRP CD2  1 1 
        3  5249 1 1  94 TRP CE2  C   7.468   7.474  -1.229 1.00 . A A .  94 TRP CE2  1 1 
        3  5250 1 1  94 TRP CE3  C   7.508   7.438  -3.643 1.00 . A A .  94 TRP CE3  1 1 
        3  5251 1 1  94 TRP CG   C   8.882   9.040  -2.114 1.00 . A A .  94 TRP CG   1 1 
        3  5252 1 1  94 TRP CH2  C   6.119   5.912  -2.375 1.00 . A A .  94 TRP CH2  1 1 
        3  5253 1 1  94 TRP CZ2  C   6.545   6.433  -1.184 1.00 . A A .  94 TRP CZ2  1 1 
        3  5254 1 1  94 TRP CZ3  C   6.594   6.405  -3.597 1.00 . A A .  94 TRP CZ3  1 1 
        3  5255 1 1  94 TRP H    H  10.529   7.298  -3.842 1.00 . A A .  94 TRP H    1 1 
        3  5256 1 1  94 TRP HA   H  11.547  10.059  -4.083 1.00 . A A .  94 TRP HA   1 1 
        3  5257 1 1  94 TRP HB2  H   9.804  10.868  -2.614 1.00 . A A .  94 TRP HB2  1 1 
        3  5258 1 1  94 TRP HB3  H   9.062  10.030  -3.969 1.00 . A A .  94 TRP HB3  1 1 
        3  5259 1 1  94 TRP HD1  H   9.500   9.816  -0.184 1.00 . A A .  94 TRP HD1  1 1 
        3  5260 1 1  94 TRP HE1  H   7.899   8.032   0.746 1.00 . A A .  94 TRP HE1  1 1 
        3  5261 1 1  94 TRP HE3  H   7.863   7.804  -4.595 1.00 . A A .  94 TRP HE3  1 1 
        3  5262 1 1  94 TRP HH2  H   5.404   5.100  -2.387 1.00 . A A .  94 TRP HH2  1 1 
        3  5263 1 1  94 TRP HZ2  H   6.169   6.040  -0.250 1.00 . A A .  94 TRP HZ2  1 1 
        3  5264 1 1  94 TRP HZ3  H   6.235   5.964  -4.516 1.00 . A A .  94 TRP HZ3  1 1 
        3  5265 1 1  94 TRP N    N  10.868   8.110  -4.276 1.00 . A A .  94 TRP N    1 1 
        3  5266 1 1  94 TRP NE1  N   8.053   8.179  -0.210 1.00 . A A .  94 TRP NE1  1 1 
        3  5267 1 1  94 TRP O    O  11.991   7.923  -1.767 1.00 . A A .  94 TRP O    1 1 
        3  5268 1 1  95 GLY C    C  13.567  11.300   0.211 1.00 . A A .  95 GLY C    1 1 
        3  5269 1 1  95 GLY CA   C  13.276   9.968  -0.464 1.00 . A A .  95 GLY CA   1 1 
        3  5270 1 1  95 GLY H    H  12.380  10.989  -2.097 1.00 . A A .  95 GLY H    1 1 
        3  5271 1 1  95 GLY HA2  H  12.749   9.333   0.234 1.00 . A A .  95 GLY HA2  1 1 
        3  5272 1 1  95 GLY HA3  H  14.213   9.497  -0.723 1.00 . A A .  95 GLY HA3  1 1 
        3  5273 1 1  95 GLY N    N  12.473  10.110  -1.672 1.00 . A A .  95 GLY N    1 1 
        3  5274 1 1  95 GLY O    O  13.803  12.302  -0.463 1.00 . A A .  95 GLY O    1 1 
        3  5275 1 1  96 THR C    C  13.647  12.308   3.832 1.00 . A A .  96 THR C    1 1 
        3  5276 1 1  96 THR CA   C  13.810  12.539   2.325 1.00 . A A .  96 THR CA   1 1 
        3  5277 1 1  96 THR CB   C  12.882  13.715   1.910 1.00 . A A .  96 THR CB   1 1 
        3  5278 1 1  96 THR CG2  C  11.407  13.336   2.033 1.00 . A A .  96 THR CG2  1 1 
        3  5279 1 1  96 THR H    H  13.379  10.469   2.019 1.00 . A A .  96 THR H    1 1 
        3  5280 1 1  96 THR HA   H  14.833  12.836   2.132 1.00 . A A .  96 THR HA   1 1 
        3  5281 1 1  96 THR HB   H  13.086  13.960   0.876 1.00 . A A .  96 THR HB   1 1 
        3  5282 1 1  96 THR HG1  H  13.293  14.619   3.634 1.00 . A A .  96 THR HG1  1 1 
        3  5283 1 1  96 THR HG21 H  11.182  13.082   3.059 1.00 . A A .  96 THR HG21 1 1 
        3  5284 1 1  96 THR HG22 H  11.198  12.487   1.399 1.00 . A A .  96 THR HG22 1 1 
        3  5285 1 1  96 THR HG23 H  10.792  14.173   1.728 1.00 . A A .  96 THR HG23 1 1 
        3  5286 1 1  96 THR N    N  13.550  11.311   1.546 1.00 . A A .  96 THR N    1 1 
        3  5287 1 1  96 THR O    O  14.256  13.008   4.640 1.00 . A A .  96 THR O    1 1 
        3  5288 1 1  96 THR OG1  O  13.148  14.879   2.716 1.00 . A A .  96 THR OG1  1 1 
        3  5289 1 1  97 GLY C    C  11.458  11.904   6.236 1.00 . A A .  97 GLY C    1 1 
        3  5290 1 1  97 GLY CA   C  12.574  11.058   5.622 1.00 . A A .  97 GLY CA   1 1 
        3  5291 1 1  97 GLY H    H  12.361  10.807   3.525 1.00 . A A .  97 GLY H    1 1 
        3  5292 1 1  97 GLY HA2  H  12.311  10.016   5.721 1.00 . A A .  97 GLY HA2  1 1 
        3  5293 1 1  97 GLY HA3  H  13.489  11.236   6.172 1.00 . A A .  97 GLY HA3  1 1 
        3  5294 1 1  97 GLY N    N  12.812  11.342   4.207 1.00 . A A .  97 GLY N    1 1 
        3  5295 1 1  97 GLY O    O  11.492  12.207   7.428 1.00 . A A .  97 GLY O    1 1 
        3  5296 1 1  98 GLU C    C   8.105  12.078   6.121 1.00 . A A .  98 GLU C    1 1 
        3  5297 1 1  98 GLU CA   C   9.293  13.028   5.906 1.00 . A A .  98 GLU CA   1 1 
        3  5298 1 1  98 GLU CB   C   8.898  14.123   4.900 1.00 . A A .  98 GLU CB   1 1 
        3  5299 1 1  98 GLU CD   C  10.136  16.098   5.933 1.00 . A A .  98 GLU CD   1 1 
        3  5300 1 1  98 GLU CG   C   9.951  15.214   4.707 1.00 . A A .  98 GLU CG   1 1 
        3  5301 1 1  98 GLU H    H  10.533  12.067   4.474 1.00 . A A .  98 GLU H    1 1 
        3  5302 1 1  98 GLU HA   H   9.547  13.491   6.850 1.00 . A A .  98 GLU HA   1 1 
        3  5303 1 1  98 GLU HB2  H   8.717  13.660   3.939 1.00 . A A .  98 GLU HB2  1 1 
        3  5304 1 1  98 GLU HB3  H   7.983  14.593   5.236 1.00 . A A .  98 GLU HB3  1 1 
        3  5305 1 1  98 GLU HG2  H  10.898  14.744   4.476 1.00 . A A .  98 GLU HG2  1 1 
        3  5306 1 1  98 GLU HG3  H   9.655  15.837   3.874 1.00 . A A .  98 GLU HG3  1 1 
        3  5307 1 1  98 GLU N    N  10.473  12.288   5.424 1.00 . A A .  98 GLU N    1 1 
        3  5308 1 1  98 GLU O    O   7.921  11.125   5.359 1.00 . A A .  98 GLU O    1 1 
        3  5309 1 1  98 GLU OE1  O   9.322  17.022   6.137 1.00 . A A .  98 GLU OE1  1 1 
        3  5310 1 1  98 GLU OE2  O  11.106  15.881   6.690 1.00 . A A .  98 GLU OE2  1 1 
        3  5311 1 1  99 ASP C    C   5.082  11.549   6.326 1.00 . A A .  99 ASP C    1 1 
        3  5312 1 1  99 ASP CA   C   6.134  11.500   7.447 1.00 . A A .  99 ASP CA   1 1 
        3  5313 1 1  99 ASP CB   C   5.488  11.896   8.781 1.00 . A A .  99 ASP CB   1 1 
        3  5314 1 1  99 ASP CG   C   6.369  11.579   9.976 1.00 . A A .  99 ASP CG   1 1 
        3  5315 1 1  99 ASP H    H   7.492  13.110   7.725 1.00 . A A .  99 ASP H    1 1 
        3  5316 1 1  99 ASP HA   H   6.490  10.483   7.530 1.00 . A A .  99 ASP HA   1 1 
        3  5317 1 1  99 ASP HB2  H   5.287  12.959   8.774 1.00 . A A .  99 ASP HB2  1 1 
        3  5318 1 1  99 ASP HB3  H   4.553  11.365   8.895 1.00 . A A .  99 ASP HB3  1 1 
        3  5319 1 1  99 ASP N    N   7.298  12.341   7.150 1.00 . A A .  99 ASP N    1 1 
        3  5320 1 1  99 ASP O    O   4.288  12.489   6.236 1.00 . A A .  99 ASP O    1 1 
        3  5321 1 1  99 ASP OD1  O   6.473  10.388  10.346 1.00 . A A .  99 ASP OD1  1 1 
        3  5322 1 1  99 ASP OD2  O   6.943  12.519  10.561 1.00 . A A .  99 ASP OD2  1 1 
        3  5323 1 1 100 VAL C    C   2.840   9.662   4.913 1.00 . A A . 100 VAL C    1 1 
        3  5324 1 1 100 VAL CA   C   4.088  10.410   4.408 1.00 . A A . 100 VAL CA   1 1 
        3  5325 1 1 100 VAL CB   C   4.661   9.704   3.147 1.00 . A A . 100 VAL CB   1 1 
        3  5326 1 1 100 VAL CG1  C   5.206   8.316   3.483 1.00 . A A . 100 VAL CG1  1 1 
        3  5327 1 1 100 VAL CG2  C   3.609   9.625   2.038 1.00 . A A . 100 VAL CG2  1 1 
        3  5328 1 1 100 VAL H    H   5.790   9.853   5.547 1.00 . A A . 100 VAL H    1 1 
        3  5329 1 1 100 VAL HA   H   3.792  11.412   4.121 1.00 . A A . 100 VAL HA   1 1 
        3  5330 1 1 100 VAL HB   H   5.486  10.299   2.778 1.00 . A A . 100 VAL HB   1 1 
        3  5331 1 1 100 VAL HG11 H   4.403   7.688   3.842 1.00 . A A . 100 VAL HG11 1 1 
        3  5332 1 1 100 VAL HG12 H   5.963   8.402   4.250 1.00 . A A . 100 VAL HG12 1 1 
        3  5333 1 1 100 VAL HG13 H   5.642   7.873   2.599 1.00 . A A . 100 VAL HG13 1 1 
        3  5334 1 1 100 VAL HG21 H   4.033   9.140   1.170 1.00 . A A . 100 VAL HG21 1 1 
        3  5335 1 1 100 VAL HG22 H   3.291  10.623   1.770 1.00 . A A . 100 VAL HG22 1 1 
        3  5336 1 1 100 VAL HG23 H   2.756   9.059   2.384 1.00 . A A . 100 VAL HG23 1 1 
        3  5337 1 1 100 VAL N    N   5.091  10.534   5.466 1.00 . A A . 100 VAL N    1 1 
        3  5338 1 1 100 VAL O    O   2.932   8.567   5.474 1.00 . A A . 100 VAL O    1 1 
        3  5339 1 1 101 LYS C    C  -0.387   9.117   3.981 1.00 . A A . 101 LYS C    1 1 
        3  5340 1 1 101 LYS CA   C   0.405   9.691   5.166 1.00 . A A . 101 LYS CA   1 1 
        3  5341 1 1 101 LYS CB   C  -0.410  10.753   5.914 1.00 . A A . 101 LYS CB   1 1 
        3  5342 1 1 101 LYS CD   C  -2.500  11.268   7.243 1.00 . A A . 101 LYS CD   1 1 
        3  5343 1 1 101 LYS CE   C  -2.285  12.747   6.917 1.00 . A A . 101 LYS CE   1 1 
        3  5344 1 1 101 LYS CG   C  -1.844  10.337   6.227 1.00 . A A . 101 LYS CG   1 1 
        3  5345 1 1 101 LYS H    H   1.667  11.148   4.280 1.00 . A A . 101 LYS H    1 1 
        3  5346 1 1 101 LYS HA   H   0.631   8.884   5.852 1.00 . A A . 101 LYS HA   1 1 
        3  5347 1 1 101 LYS HB2  H   0.089  10.974   6.847 1.00 . A A . 101 LYS HB2  1 1 
        3  5348 1 1 101 LYS HB3  H  -0.440  11.653   5.315 1.00 . A A . 101 LYS HB3  1 1 
        3  5349 1 1 101 LYS HD2  H  -3.561  11.068   7.260 1.00 . A A . 101 LYS HD2  1 1 
        3  5350 1 1 101 LYS HD3  H  -2.084  11.062   8.221 1.00 . A A . 101 LYS HD3  1 1 
        3  5351 1 1 101 LYS HE2  H  -2.871  13.343   7.600 1.00 . A A . 101 LYS HE2  1 1 
        3  5352 1 1 101 LYS HE3  H  -1.237  12.982   7.049 1.00 . A A . 101 LYS HE3  1 1 
        3  5353 1 1 101 LYS HG2  H  -2.422  10.357   5.313 1.00 . A A . 101 LYS HG2  1 1 
        3  5354 1 1 101 LYS HG3  H  -1.838   9.332   6.625 1.00 . A A . 101 LYS HG3  1 1 
        3  5355 1 1 101 LYS HZ1  H  -3.583  12.636   5.288 1.00 . A A . 101 LYS HZ1  1 1 
        3  5356 1 1 101 LYS HZ2  H  -1.953  12.773   4.855 1.00 . A A . 101 LYS HZ2  1 1 
        3  5357 1 1 101 LYS HZ3  H  -2.792  14.120   5.434 1.00 . A A . 101 LYS HZ3  1 1 
        3  5358 1 1 101 LYS N    N   1.676  10.273   4.726 1.00 . A A . 101 LYS N    1 1 
        3  5359 1 1 101 LYS NZ   N  -2.682  13.092   5.526 1.00 . A A . 101 LYS NZ   1 1 
        3  5360 1 1 101 LYS O    O  -0.754   9.835   3.053 1.00 . A A . 101 LYS O    1 1 
        3  5361 1 1 102 VAL C    C  -2.745   6.719   3.217 1.00 . A A . 102 VAL C    1 1 
        3  5362 1 1 102 VAL CA   C  -1.289   7.119   2.901 1.00 . A A . 102 VAL CA   1 1 
        3  5363 1 1 102 VAL CB   C  -0.469   5.864   2.511 1.00 . A A . 102 VAL CB   1 1 
        3  5364 1 1 102 VAL CG1  C  -1.038   5.205   1.259 1.00 . A A . 102 VAL CG1  1 1 
        3  5365 1 1 102 VAL CG2  C   1.002   6.226   2.311 1.00 . A A . 102 VAL CG2  1 1 
        3  5366 1 1 102 VAL H    H  -0.427   7.308   4.830 1.00 . A A . 102 VAL H    1 1 
        3  5367 1 1 102 VAL HA   H  -1.292   7.791   2.052 1.00 . A A . 102 VAL HA   1 1 
        3  5368 1 1 102 VAL HB   H  -0.532   5.153   3.324 1.00 . A A . 102 VAL HB   1 1 
        3  5369 1 1 102 VAL HG11 H  -1.044   5.918   0.445 1.00 . A A . 102 VAL HG11 1 1 
        3  5370 1 1 102 VAL HG12 H  -2.048   4.873   1.452 1.00 . A A . 102 VAL HG12 1 1 
        3  5371 1 1 102 VAL HG13 H  -0.428   4.356   0.987 1.00 . A A . 102 VAL HG13 1 1 
        3  5372 1 1 102 VAL HG21 H   1.091   6.955   1.519 1.00 . A A . 102 VAL HG21 1 1 
        3  5373 1 1 102 VAL HG22 H   1.560   5.338   2.047 1.00 . A A . 102 VAL HG22 1 1 
        3  5374 1 1 102 VAL HG23 H   1.400   6.640   3.227 1.00 . A A . 102 VAL HG23 1 1 
        3  5375 1 1 102 VAL N    N  -0.655   7.815   4.023 1.00 . A A . 102 VAL N    1 1 
        3  5376 1 1 102 VAL O    O  -3.089   6.417   4.362 1.00 . A A . 102 VAL O    1 1 
        3  5377 1 1 103 ILE C    C  -5.452   5.174   1.568 1.00 . A A . 103 ILE C    1 1 
        3  5378 1 1 103 ILE CA   C  -5.033   6.449   2.331 1.00 . A A . 103 ILE CA   1 1 
        3  5379 1 1 103 ILE CB   C  -5.870   7.638   1.782 1.00 . A A . 103 ILE CB   1 1 
        3  5380 1 1 103 ILE CD1  C  -5.414   9.136   3.825 1.00 . A A . 103 ILE CD1  1 1 
        3  5381 1 1 103 ILE CG1  C  -5.345   8.986   2.317 1.00 . A A . 103 ILE CG1  1 1 
        3  5382 1 1 103 ILE CG2  C  -7.347   7.459   2.126 1.00 . A A . 103 ILE CG2  1 1 
        3  5383 1 1 103 ILE H    H  -3.241   6.910   1.291 1.00 . A A . 103 ILE H    1 1 
        3  5384 1 1 103 ILE HA   H  -5.256   6.329   3.383 1.00 . A A . 103 ILE HA   1 1 
        3  5385 1 1 103 ILE HB   H  -5.783   7.634   0.704 1.00 . A A . 103 ILE HB   1 1 
        3  5386 1 1 103 ILE HD11 H  -6.440   9.051   4.152 1.00 . A A . 103 ILE HD11 1 1 
        3  5387 1 1 103 ILE HD12 H  -5.026  10.102   4.108 1.00 . A A . 103 ILE HD12 1 1 
        3  5388 1 1 103 ILE HD13 H  -4.823   8.361   4.293 1.00 . A A . 103 ILE HD13 1 1 
        3  5389 1 1 103 ILE HG12 H  -4.312   9.100   2.026 1.00 . A A . 103 ILE HG12 1 1 
        3  5390 1 1 103 ILE HG13 H  -5.924   9.787   1.878 1.00 . A A . 103 ILE HG13 1 1 
        3  5391 1 1 103 ILE HG21 H  -7.711   6.537   1.695 1.00 . A A . 103 ILE HG21 1 1 
        3  5392 1 1 103 ILE HG22 H  -7.916   8.289   1.731 1.00 . A A . 103 ILE HG22 1 1 
        3  5393 1 1 103 ILE HG23 H  -7.465   7.424   3.200 1.00 . A A . 103 ILE HG23 1 1 
        3  5394 1 1 103 ILE N    N  -3.592   6.720   2.184 1.00 . A A . 103 ILE N    1 1 
        3  5395 1 1 103 ILE O    O  -5.194   5.051   0.367 1.00 . A A . 103 ILE O    1 1 
        3  5396 1 1 104 LEU C    C  -8.165   3.008   1.559 1.00 . A A . 104 LEU C    1 1 
        3  5397 1 1 104 LEU CA   C  -6.629   3.011   1.614 1.00 . A A . 104 LEU CA   1 1 
        3  5398 1 1 104 LEU CB   C  -6.153   1.754   2.362 1.00 . A A . 104 LEU CB   1 1 
        3  5399 1 1 104 LEU CD1  C  -4.327   0.164   3.041 1.00 . A A . 104 LEU CD1  1 1 
        3  5400 1 1 104 LEU CD2  C  -4.345   1.139   0.721 1.00 . A A . 104 LEU CD2  1 1 
        3  5401 1 1 104 LEU CG   C  -4.672   1.390   2.194 1.00 . A A . 104 LEU CG   1 1 
        3  5402 1 1 104 LEU H    H  -6.245   4.359   3.220 1.00 . A A . 104 LEU H    1 1 
        3  5403 1 1 104 LEU HA   H  -6.246   2.978   0.602 1.00 . A A . 104 LEU HA   1 1 
        3  5404 1 1 104 LEU HB2  H  -6.349   1.899   3.415 1.00 . A A . 104 LEU HB2  1 1 
        3  5405 1 1 104 LEU HB3  H  -6.745   0.916   2.021 1.00 . A A . 104 LEU HB3  1 1 
        3  5406 1 1 104 LEU HD11 H  -3.285  -0.088   2.905 1.00 . A A . 104 LEU HD11 1 1 
        3  5407 1 1 104 LEU HD12 H  -4.939  -0.673   2.736 1.00 . A A . 104 LEU HD12 1 1 
        3  5408 1 1 104 LEU HD13 H  -4.509   0.380   4.083 1.00 . A A . 104 LEU HD13 1 1 
        3  5409 1 1 104 LEU HD21 H  -4.941   0.316   0.353 1.00 . A A . 104 LEU HD21 1 1 
        3  5410 1 1 104 LEU HD22 H  -3.297   0.898   0.618 1.00 . A A . 104 LEU HD22 1 1 
        3  5411 1 1 104 LEU HD23 H  -4.566   2.028   0.145 1.00 . A A . 104 LEU HD23 1 1 
        3  5412 1 1 104 LEU HG   H  -4.064   2.214   2.538 1.00 . A A . 104 LEU HG   1 1 
        3  5413 1 1 104 LEU N    N  -6.108   4.234   2.258 1.00 . A A . 104 LEU N    1 1 
        3  5414 1 1 104 LEU O    O  -8.831   2.807   2.577 1.00 . A A . 104 LEU O    1 1 
        3  5415 1 1 105 LYS C    C -10.592   2.106  -0.850 1.00 . A A . 105 LYS C    1 1 
        3  5416 1 1 105 LYS CA   C -10.183   3.178   0.177 1.00 . A A . 105 LYS CA   1 1 
        3  5417 1 1 105 LYS CB   C -10.718   4.557  -0.243 1.00 . A A . 105 LYS CB   1 1 
        3  5418 1 1 105 LYS CD   C -11.382   6.897   0.470 1.00 . A A . 105 LYS CD   1 1 
        3  5419 1 1 105 LYS CE   C -11.719   7.783   1.672 1.00 . A A . 105 LYS CE   1 1 
        3  5420 1 1 105 LYS CG   C -10.737   5.580   0.894 1.00 . A A . 105 LYS CG   1 1 
        3  5421 1 1 105 LYS H    H  -8.151   3.411  -0.404 1.00 . A A . 105 LYS H    1 1 
        3  5422 1 1 105 LYS HA   H -10.627   2.914   1.130 1.00 . A A . 105 LYS HA   1 1 
        3  5423 1 1 105 LYS HB2  H -10.096   4.942  -1.039 1.00 . A A . 105 LYS HB2  1 1 
        3  5424 1 1 105 LYS HB3  H -11.727   4.440  -0.611 1.00 . A A . 105 LYS HB3  1 1 
        3  5425 1 1 105 LYS HD2  H -10.700   7.432  -0.174 1.00 . A A . 105 LYS HD2  1 1 
        3  5426 1 1 105 LYS HD3  H -12.295   6.683  -0.070 1.00 . A A . 105 LYS HD3  1 1 
        3  5427 1 1 105 LYS HE2  H -12.237   8.663   1.319 1.00 . A A . 105 LYS HE2  1 1 
        3  5428 1 1 105 LYS HE3  H -12.370   7.233   2.333 1.00 . A A . 105 LYS HE3  1 1 
        3  5429 1 1 105 LYS HG2  H -11.296   5.170   1.724 1.00 . A A . 105 LYS HG2  1 1 
        3  5430 1 1 105 LYS HG3  H  -9.720   5.772   1.207 1.00 . A A . 105 LYS HG3  1 1 
        3  5431 1 1 105 LYS HZ1  H  -9.873   8.756   1.823 1.00 . A A . 105 LYS HZ1  1 1 
        3  5432 1 1 105 LYS HZ2  H -10.006   7.389   2.818 1.00 . A A . 105 LYS HZ2  1 1 
        3  5433 1 1 105 LYS HZ3  H -10.797   8.825   3.232 1.00 . A A . 105 LYS HZ3  1 1 
        3  5434 1 1 105 LYS N    N  -8.726   3.221   0.368 1.00 . A A . 105 LYS N    1 1 
        3  5435 1 1 105 LYS NZ   N -10.514   8.216   2.436 1.00 . A A . 105 LYS NZ   1 1 
        3  5436 1 1 105 LYS O    O  -9.926   1.907  -1.869 1.00 . A A . 105 LYS O    1 1 
        3  5437 1 1 106 ASN C    C -12.966   0.827  -2.628 1.00 . A A . 106 ASN C    1 1 
        3  5438 1 1 106 ASN CA   C -12.186   0.323  -1.401 1.00 . A A . 106 ASN CA   1 1 
        3  5439 1 1 106 ASN CB   C -13.071  -0.613  -0.566 1.00 . A A . 106 ASN CB   1 1 
        3  5440 1 1 106 ASN CG   C -12.366  -1.117   0.682 1.00 . A A . 106 ASN CG   1 1 
        3  5441 1 1 106 ASN H    H -12.200   1.657   0.245 1.00 . A A . 106 ASN H    1 1 
        3  5442 1 1 106 ASN HA   H -11.328  -0.233  -1.746 1.00 . A A . 106 ASN HA   1 1 
        3  5443 1 1 106 ASN HB2  H -13.963  -0.081  -0.261 1.00 . A A . 106 ASN HB2  1 1 
        3  5444 1 1 106 ASN HB3  H -13.356  -1.465  -1.167 1.00 . A A . 106 ASN HB3  1 1 
        3  5445 1 1 106 ASN HD21 H -11.678  -2.705  -0.282 1.00 . A A . 106 ASN HD21 1 1 
        3  5446 1 1 106 ASN HD22 H -11.243  -2.583   1.382 1.00 . A A . 106 ASN HD22 1 1 
        3  5447 1 1 106 ASN N    N -11.697   1.421  -0.562 1.00 . A A . 106 ASN N    1 1 
        3  5448 1 1 106 ASN ND2  N -11.693  -2.248   0.582 1.00 . A A . 106 ASN ND2  1 1 
        3  5449 1 1 106 ASN O    O -13.157   2.029  -2.817 1.00 . A A . 106 ASN O    1 1 
        3  5450 1 1 106 ASN OD1  O -12.420  -0.491   1.731 1.00 . A A . 106 ASN OD1  1 1 
        3  5451 1 1 107 SER C    C -15.344   1.114  -4.479 1.00 . A A . 107 SER C    1 1 
        3  5452 1 1 107 SER CA   C -14.145   0.179  -4.695 1.00 . A A . 107 SER CA   1 1 
        3  5453 1 1 107 SER CB   C -14.617  -1.127  -5.347 1.00 . A A . 107 SER CB   1 1 
        3  5454 1 1 107 SER H    H -13.308  -1.057  -3.190 1.00 . A A . 107 SER H    1 1 
        3  5455 1 1 107 SER HA   H -13.443   0.664  -5.360 1.00 . A A . 107 SER HA   1 1 
        3  5456 1 1 107 SER HB2  H -15.196  -0.904  -6.231 1.00 . A A . 107 SER HB2  1 1 
        3  5457 1 1 107 SER HB3  H -13.757  -1.723  -5.622 1.00 . A A . 107 SER HB3  1 1 
        3  5458 1 1 107 SER HG   H -15.996  -2.469  -4.954 1.00 . A A . 107 SER HG   1 1 
        3  5459 1 1 107 SER N    N -13.435  -0.120  -3.440 1.00 . A A . 107 SER N    1 1 
        3  5460 1 1 107 SER O    O -15.491   2.116  -5.182 1.00 . A A . 107 SER O    1 1 
        3  5461 1 1 107 SER OG   O -15.422  -1.877  -4.451 1.00 . A A . 107 SER OG   1 1 
        3  5462 1 1 108 GLN C    C -17.052   2.967  -2.588 1.00 . A A . 108 GLN C    1 1 
        3  5463 1 1 108 GLN CA   C -17.391   1.600  -3.215 1.00 . A A . 108 GLN CA   1 1 
        3  5464 1 1 108 GLN CB   C -18.353   0.841  -2.287 1.00 . A A . 108 GLN CB   1 1 
        3  5465 1 1 108 GLN CD   C -20.015  -1.054  -2.044 1.00 . A A . 108 GLN CD   1 1 
        3  5466 1 1 108 GLN CG   C -18.874  -0.472  -2.865 1.00 . A A . 108 GLN CG   1 1 
        3  5467 1 1 108 GLN H    H -16.020  -0.018  -2.973 1.00 . A A . 108 GLN H    1 1 
        3  5468 1 1 108 GLN HA   H -17.894   1.776  -4.155 1.00 . A A . 108 GLN HA   1 1 
        3  5469 1 1 108 GLN HB2  H -17.843   0.623  -1.358 1.00 . A A . 108 GLN HB2  1 1 
        3  5470 1 1 108 GLN HB3  H -19.202   1.477  -2.077 1.00 . A A . 108 GLN HB3  1 1 
        3  5471 1 1 108 GLN HE21 H -18.744  -2.035  -0.886 1.00 . A A . 108 GLN HE21 1 1 
        3  5472 1 1 108 GLN HE22 H -20.416  -2.230  -0.509 1.00 . A A . 108 GLN HE22 1 1 
        3  5473 1 1 108 GLN HG2  H -19.228  -0.294  -3.871 1.00 . A A . 108 GLN HG2  1 1 
        3  5474 1 1 108 GLN HG3  H -18.066  -1.189  -2.894 1.00 . A A . 108 GLN HG3  1 1 
        3  5475 1 1 108 GLN N    N -16.193   0.791  -3.502 1.00 . A A . 108 GLN N    1 1 
        3  5476 1 1 108 GLN NE2  N -19.691  -1.854  -1.048 1.00 . A A . 108 GLN NE2  1 1 
        3  5477 1 1 108 GLN O    O -17.941   3.789  -2.367 1.00 . A A . 108 GLN O    1 1 
        3  5478 1 1 108 GLN OE1  O -21.180  -0.774  -2.297 1.00 . A A . 108 GLN OE1  1 1 
        3  5479 1 1 109 GLY C    C -15.199   4.409  -0.184 1.00 . A A . 109 GLY C    1 1 
        3  5480 1 1 109 GLY CA   C -15.364   4.482  -1.701 1.00 . A A . 109 GLY CA   1 1 
        3  5481 1 1 109 GLY H    H -15.097   2.536  -2.520 1.00 . A A . 109 GLY H    1 1 
        3  5482 1 1 109 GLY HA2  H -14.423   4.780  -2.135 1.00 . A A . 109 GLY HA2  1 1 
        3  5483 1 1 109 GLY HA3  H -16.105   5.236  -1.933 1.00 . A A . 109 GLY HA3  1 1 
        3  5484 1 1 109 GLY N    N -15.774   3.212  -2.305 1.00 . A A . 109 GLY N    1 1 
        3  5485 1 1 109 GLY O    O -14.583   5.288   0.424 1.00 . A A . 109 GLY O    1 1 
        3  5486 1 1 110 GLU C    C -14.140   2.802   2.215 1.00 . A A . 110 GLU C    1 1 
        3  5487 1 1 110 GLU CA   C -15.597   3.153   1.876 1.00 . A A . 110 GLU CA   1 1 
        3  5488 1 1 110 GLU CB   C -16.558   2.060   2.372 1.00 . A A . 110 GLU CB   1 1 
        3  5489 1 1 110 GLU CD   C -17.533  -0.256   2.039 1.00 . A A . 110 GLU CD   1 1 
        3  5490 1 1 110 GLU CG   C -16.446   0.730   1.629 1.00 . A A . 110 GLU CG   1 1 
        3  5491 1 1 110 GLU H    H -16.282   2.730  -0.087 1.00 . A A . 110 GLU H    1 1 
        3  5492 1 1 110 GLU HA   H -15.847   4.083   2.372 1.00 . A A . 110 GLU HA   1 1 
        3  5493 1 1 110 GLU HB2  H -16.364   1.878   3.419 1.00 . A A . 110 GLU HB2  1 1 
        3  5494 1 1 110 GLU HB3  H -17.572   2.421   2.265 1.00 . A A . 110 GLU HB3  1 1 
        3  5495 1 1 110 GLU HG2  H -16.528   0.914   0.566 1.00 . A A . 110 GLU HG2  1 1 
        3  5496 1 1 110 GLU HG3  H -15.481   0.291   1.842 1.00 . A A . 110 GLU HG3  1 1 
        3  5497 1 1 110 GLU N    N -15.757   3.367   0.435 1.00 . A A . 110 GLU N    1 1 
        3  5498 1 1 110 GLU O    O -13.464   2.121   1.450 1.00 . A A . 110 GLU O    1 1 
        3  5499 1 1 110 GLU OE1  O -18.628  -0.225   1.437 1.00 . A A . 110 GLU OE1  1 1 
        3  5500 1 1 110 GLU OE2  O -17.303  -1.050   2.979 1.00 . A A . 110 GLU OE2  1 1 
        3  5501 1 1 111 GLU C    C -11.948   2.081   4.734 1.00 . A A . 111 GLU C    1 1 
        3  5502 1 1 111 GLU CA   C -12.239   3.193   3.713 1.00 . A A . 111 GLU CA   1 1 
        3  5503 1 1 111 GLU CB   C -11.787   4.541   4.282 1.00 . A A . 111 GLU CB   1 1 
        3  5504 1 1 111 GLU CD   C  -9.940   5.921   5.313 1.00 . A A . 111 GLU CD   1 1 
        3  5505 1 1 111 GLU CG   C -10.320   4.589   4.693 1.00 . A A . 111 GLU CG   1 1 
        3  5506 1 1 111 GLU H    H -14.283   3.695   3.991 1.00 . A A . 111 GLU H    1 1 
        3  5507 1 1 111 GLU HA   H -11.680   2.992   2.808 1.00 . A A . 111 GLU HA   1 1 
        3  5508 1 1 111 GLU HB2  H -11.953   5.307   3.536 1.00 . A A . 111 GLU HB2  1 1 
        3  5509 1 1 111 GLU HB3  H -12.389   4.768   5.153 1.00 . A A . 111 GLU HB3  1 1 
        3  5510 1 1 111 GLU HG2  H -10.133   3.803   5.413 1.00 . A A . 111 GLU HG2  1 1 
        3  5511 1 1 111 GLU HG3  H  -9.706   4.426   3.816 1.00 . A A . 111 GLU HG3  1 1 
        3  5512 1 1 111 GLU N    N -13.663   3.277   3.360 1.00 . A A . 111 GLU N    1 1 
        3  5513 1 1 111 GLU O    O -12.605   1.998   5.775 1.00 . A A . 111 GLU O    1 1 
        3  5514 1 1 111 GLU OE1  O  -9.562   6.845   4.561 1.00 . A A . 111 GLU OE1  1 1 
        3  5515 1 1 111 GLU OE2  O -10.041   6.050   6.555 1.00 . A A . 111 GLU OE2  1 1 
        3  5516 1 1 112 VAL C    C  -9.625   0.868   6.505 1.00 . A A . 112 VAL C    1 1 
        3  5517 1 1 112 VAL CA   C -10.490   0.234   5.405 1.00 . A A . 112 VAL CA   1 1 
        3  5518 1 1 112 VAL CB   C  -9.700  -0.921   4.727 1.00 . A A . 112 VAL CB   1 1 
        3  5519 1 1 112 VAL CG1  C -10.626  -1.788   3.878 1.00 . A A . 112 VAL CG1  1 1 
        3  5520 1 1 112 VAL CG2  C  -8.546  -0.381   3.883 1.00 . A A . 112 VAL CG2  1 1 
        3  5521 1 1 112 VAL H    H -10.521   1.302   3.564 1.00 . A A . 112 VAL H    1 1 
        3  5522 1 1 112 VAL HA   H -11.369  -0.193   5.872 1.00 . A A . 112 VAL HA   1 1 
        3  5523 1 1 112 VAL HB   H  -9.282  -1.546   5.507 1.00 . A A . 112 VAL HB   1 1 
        3  5524 1 1 112 VAL HG11 H -11.076  -1.184   3.105 1.00 . A A . 112 VAL HG11 1 1 
        3  5525 1 1 112 VAL HG12 H -11.401  -2.207   4.504 1.00 . A A . 112 VAL HG12 1 1 
        3  5526 1 1 112 VAL HG13 H -10.058  -2.589   3.425 1.00 . A A . 112 VAL HG13 1 1 
        3  5527 1 1 112 VAL HG21 H  -7.872   0.185   4.510 1.00 . A A . 112 VAL HG21 1 1 
        3  5528 1 1 112 VAL HG22 H  -8.936   0.262   3.105 1.00 . A A . 112 VAL HG22 1 1 
        3  5529 1 1 112 VAL HG23 H  -8.009  -1.204   3.432 1.00 . A A . 112 VAL HG23 1 1 
        3  5530 1 1 112 VAL N    N -10.950   1.244   4.443 1.00 . A A . 112 VAL N    1 1 
        3  5531 1 1 112 VAL O    O  -9.820   0.587   7.689 1.00 . A A . 112 VAL O    1 1 
        3  5532 1 1 113 ALA C    C  -6.851   3.417   6.389 1.00 . A A . 113 ALA C    1 1 
        3  5533 1 1 113 ALA CA   C  -7.798   2.410   7.068 1.00 . A A . 113 ALA CA   1 1 
        3  5534 1 1 113 ALA CB   C  -6.979   1.387   7.856 1.00 . A A . 113 ALA CB   1 1 
        3  5535 1 1 113 ALA H    H  -8.581   1.921   5.150 1.00 . A A . 113 ALA H    1 1 
        3  5536 1 1 113 ALA HA   H  -8.423   2.945   7.769 1.00 . A A . 113 ALA HA   1 1 
        3  5537 1 1 113 ALA HB1  H  -6.366   1.898   8.586 1.00 . A A . 113 ALA HB1  1 1 
        3  5538 1 1 113 ALA HB2  H  -6.343   0.831   7.180 1.00 . A A . 113 ALA HB2  1 1 
        3  5539 1 1 113 ALA HB3  H  -7.645   0.705   8.363 1.00 . A A . 113 ALA HB3  1 1 
        3  5540 1 1 113 ALA N    N  -8.682   1.733   6.108 1.00 . A A . 113 ALA N    1 1 
        3  5541 1 1 113 ALA O    O  -6.243   3.125   5.359 1.00 . A A . 113 ALA O    1 1 
        3  5542 1 1 114 GLN C    C  -4.637   5.650   7.660 1.00 . A A . 114 GLN C    1 1 
        3  5543 1 1 114 GLN CA   C  -5.733   5.596   6.583 1.00 . A A . 114 GLN CA   1 1 
        3  5544 1 1 114 GLN CB   C  -6.364   6.984   6.384 1.00 . A A . 114 GLN CB   1 1 
        3  5545 1 1 114 GLN CD   C  -7.753   8.872   7.374 1.00 . A A . 114 GLN CD   1 1 
        3  5546 1 1 114 GLN CG   C  -7.087   7.525   7.615 1.00 . A A . 114 GLN CG   1 1 
        3  5547 1 1 114 GLN H    H  -7.389   4.843   7.682 1.00 . A A . 114 GLN H    1 1 
        3  5548 1 1 114 GLN HA   H  -5.288   5.271   5.651 1.00 . A A . 114 GLN HA   1 1 
        3  5549 1 1 114 GLN HB2  H  -5.587   7.685   6.112 1.00 . A A . 114 GLN HB2  1 1 
        3  5550 1 1 114 GLN HB3  H  -7.077   6.927   5.573 1.00 . A A . 114 GLN HB3  1 1 
        3  5551 1 1 114 GLN HE21 H  -9.167   8.442   8.688 1.00 . A A . 114 GLN HE21 1 1 
        3  5552 1 1 114 GLN HE22 H  -9.303   9.976   7.912 1.00 . A A . 114 GLN HE22 1 1 
        3  5553 1 1 114 GLN HG2  H  -7.845   6.817   7.911 1.00 . A A . 114 GLN HG2  1 1 
        3  5554 1 1 114 GLN HG3  H  -6.370   7.636   8.417 1.00 . A A . 114 GLN HG3  1 1 
        3  5555 1 1 114 GLN N    N  -6.754   4.612   6.970 1.00 . A A . 114 GLN N    1 1 
        3  5556 1 1 114 GLN NE2  N  -8.848   9.123   8.063 1.00 . A A . 114 GLN NE2  1 1 
        3  5557 1 1 114 GLN O    O  -4.935   5.548   8.856 1.00 . A A . 114 GLN O    1 1 
        3  5558 1 1 114 GLN OE1  O  -7.292   9.679   6.574 1.00 . A A . 114 GLN OE1  1 1 
        3  5559 1 1 115 ARG C    C  -1.012   6.469   7.736 1.00 . A A . 115 ARG C    1 1 
        3  5560 1 1 115 ARG CA   C  -2.263   5.711   8.216 1.00 . A A . 115 ARG CA   1 1 
        3  5561 1 1 115 ARG CB   C  -1.923   4.229   8.457 1.00 . A A . 115 ARG CB   1 1 
        3  5562 1 1 115 ARG CD   C  -0.828   2.480   9.916 1.00 . A A . 115 ARG CD   1 1 
        3  5563 1 1 115 ARG CG   C  -1.058   3.974   9.688 1.00 . A A . 115 ARG CG   1 1 
        3  5564 1 1 115 ARG CZ   C   0.229   1.042  11.591 1.00 . A A . 115 ARG CZ   1 1 
        3  5565 1 1 115 ARG H    H  -3.185   5.971   6.306 1.00 . A A . 115 ARG H    1 1 
        3  5566 1 1 115 ARG HA   H  -2.596   6.147   9.148 1.00 . A A . 115 ARG HA   1 1 
        3  5567 1 1 115 ARG HB2  H  -2.847   3.679   8.575 1.00 . A A . 115 ARG HB2  1 1 
        3  5568 1 1 115 ARG HB3  H  -1.402   3.846   7.590 1.00 . A A . 115 ARG HB3  1 1 
        3  5569 1 1 115 ARG HD2  H  -1.778   1.968   9.853 1.00 . A A . 115 ARG HD2  1 1 
        3  5570 1 1 115 ARG HD3  H  -0.169   2.108   9.143 1.00 . A A . 115 ARG HD3  1 1 
        3  5571 1 1 115 ARG HE   H  -0.200   2.943  11.865 1.00 . A A . 115 ARG HE   1 1 
        3  5572 1 1 115 ARG HG2  H  -0.102   4.459   9.554 1.00 . A A . 115 ARG HG2  1 1 
        3  5573 1 1 115 ARG HG3  H  -1.553   4.389  10.555 1.00 . A A . 115 ARG HG3  1 1 
        3  5574 1 1 115 ARG HH11 H  -0.162   0.134   9.860 1.00 . A A . 115 ARG HH11 1 1 
        3  5575 1 1 115 ARG HH12 H   0.562  -0.852  11.085 1.00 . A A . 115 ARG HH12 1 1 
        3  5576 1 1 115 ARG HH21 H   0.722   1.643  13.423 1.00 . A A . 115 ARG HH21 1 1 
        3  5577 1 1 115 ARG HH22 H   1.058  -0.012  13.057 1.00 . A A . 115 ARG HH22 1 1 
        3  5578 1 1 115 ARG N    N  -3.375   5.799   7.256 1.00 . A A . 115 ARG N    1 1 
        3  5579 1 1 115 ARG NE   N  -0.233   2.207  11.223 1.00 . A A . 115 ARG NE   1 1 
        3  5580 1 1 115 ARG NH1  N   0.208   0.032  10.782 1.00 . A A . 115 ARG NH1  1 1 
        3  5581 1 1 115 ARG NH2  N   0.706   0.881  12.782 1.00 . A A . 115 ARG NH2  1 1 
        3  5582 1 1 115 ARG O    O  -0.736   6.542   6.538 1.00 . A A . 115 ARG O    1 1 
        3  5583 1 1 116 SER C    C   2.210   6.948   8.872 1.00 . A A . 116 SER C    1 1 
        3  5584 1 1 116 SER CA   C   0.991   7.738   8.379 1.00 . A A . 116 SER CA   1 1 
        3  5585 1 1 116 SER CB   C   0.995   9.136   9.020 1.00 . A A . 116 SER CB   1 1 
        3  5586 1 1 116 SER H    H  -0.554   6.967   9.619 1.00 . A A . 116 SER H    1 1 
        3  5587 1 1 116 SER HA   H   1.061   7.847   7.305 1.00 . A A . 116 SER HA   1 1 
        3  5588 1 1 116 SER HB2  H   1.924   9.634   8.785 1.00 . A A . 116 SER HB2  1 1 
        3  5589 1 1 116 SER HB3  H   0.172   9.712   8.623 1.00 . A A . 116 SER HB3  1 1 
        3  5590 1 1 116 SER HG   H   1.678   9.367  10.850 1.00 . A A . 116 SER HG   1 1 
        3  5591 1 1 116 SER N    N  -0.263   7.032   8.685 1.00 . A A . 116 SER N    1 1 
        3  5592 1 1 116 SER O    O   2.076   5.964   9.602 1.00 . A A . 116 SER O    1 1 
        3  5593 1 1 116 SER OG   O   0.861   9.063  10.434 1.00 . A A . 116 SER OG   1 1 
        3  5594 1 1 117 THR C    C   4.960   7.045  10.386 1.00 . A A . 117 THR C    1 1 
        3  5595 1 1 117 THR CA   C   4.650   6.749   8.912 1.00 . A A . 117 THR CA   1 1 
        3  5596 1 1 117 THR CB   C   5.853   7.219   8.065 1.00 . A A . 117 THR CB   1 1 
        3  5597 1 1 117 THR CG2  C   5.714   6.775   6.615 1.00 . A A . 117 THR CG2  1 1 
        3  5598 1 1 117 THR H    H   3.448   8.151   7.858 1.00 . A A . 117 THR H    1 1 
        3  5599 1 1 117 THR HA   H   4.543   5.679   8.784 1.00 . A A . 117 THR HA   1 1 
        3  5600 1 1 117 THR HB   H   6.756   6.783   8.472 1.00 . A A . 117 THR HB   1 1 
        3  5601 1 1 117 THR HG1  H   6.341   8.911   8.972 1.00 . A A . 117 THR HG1  1 1 
        3  5602 1 1 117 THR HG21 H   4.820   7.208   6.187 1.00 . A A . 117 THR HG21 1 1 
        3  5603 1 1 117 THR HG22 H   5.645   5.697   6.575 1.00 . A A . 117 THR HG22 1 1 
        3  5604 1 1 117 THR HG23 H   6.576   7.101   6.052 1.00 . A A . 117 THR HG23 1 1 
        3  5605 1 1 117 THR N    N   3.400   7.385   8.471 1.00 . A A . 117 THR N    1 1 
        3  5606 1 1 117 THR O    O   4.375   7.943  10.992 1.00 . A A . 117 THR O    1 1 
        3  5607 1 1 117 THR OG1  O   5.962   8.644   8.121 1.00 . A A . 117 THR OG1  1 1 
        3  5608 1 1 118 VAL C    C   7.839   6.111  12.448 1.00 . A A . 118 VAL C    1 1 
        3  5609 1 1 118 VAL CA   C   6.361   6.507  12.319 1.00 . A A . 118 VAL CA   1 1 
        3  5610 1 1 118 VAL CB   C   5.512   5.743  13.370 1.00 . A A . 118 VAL CB   1 1 
        3  5611 1 1 118 VAL CG1  C   5.438   4.248  13.052 1.00 . A A . 118 VAL CG1  1 1 
        3  5612 1 1 118 VAL CG2  C   6.056   5.976  14.779 1.00 . A A . 118 VAL CG2  1 1 
        3  5613 1 1 118 VAL H    H   6.249   5.522  10.448 1.00 . A A . 118 VAL H    1 1 
        3  5614 1 1 118 VAL HA   H   6.273   7.568  12.522 1.00 . A A . 118 VAL HA   1 1 
        3  5615 1 1 118 VAL HB   H   4.508   6.137  13.332 1.00 . A A . 118 VAL HB   1 1 
        3  5616 1 1 118 VAL HG11 H   4.829   3.751  13.793 1.00 . A A . 118 VAL HG11 1 1 
        3  5617 1 1 118 VAL HG12 H   6.432   3.825  13.064 1.00 . A A . 118 VAL HG12 1 1 
        3  5618 1 1 118 VAL HG13 H   5.000   4.107  12.074 1.00 . A A . 118 VAL HG13 1 1 
        3  5619 1 1 118 VAL HG21 H   6.032   7.033  15.006 1.00 . A A . 118 VAL HG21 1 1 
        3  5620 1 1 118 VAL HG22 H   7.074   5.619  14.837 1.00 . A A . 118 VAL HG22 1 1 
        3  5621 1 1 118 VAL HG23 H   5.445   5.443  15.495 1.00 . A A . 118 VAL HG23 1 1 
        3  5622 1 1 118 VAL N    N   5.881   6.274  10.955 1.00 . A A . 118 VAL N    1 1 
        3  5623 1 1 118 VAL O    O   8.203   4.951  12.257 1.00 . A A . 118 VAL O    1 1 
        3  5624 1 1 119 PHE C    C  10.498   6.255  14.234 1.00 . A A . 119 PHE C    1 1 
        3  5625 1 1 119 PHE CA   C  10.129   6.832  12.860 1.00 . A A . 119 PHE CA   1 1 
        3  5626 1 1 119 PHE CB   C  10.920   8.120  12.592 1.00 . A A . 119 PHE CB   1 1 
        3  5627 1 1 119 PHE CD1  C  11.186   8.025  10.093 1.00 . A A . 119 PHE CD1  1 1 
        3  5628 1 1 119 PHE CD2  C   9.980   9.857  11.030 1.00 . A A . 119 PHE CD2  1 1 
        3  5629 1 1 119 PHE CE1  C  10.972   8.528   8.826 1.00 . A A . 119 PHE CE1  1 1 
        3  5630 1 1 119 PHE CE2  C   9.761  10.364   9.764 1.00 . A A . 119 PHE CE2  1 1 
        3  5631 1 1 119 PHE CG   C  10.694   8.683  11.212 1.00 . A A . 119 PHE CG   1 1 
        3  5632 1 1 119 PHE CZ   C  10.258   9.698   8.661 1.00 . A A . 119 PHE CZ   1 1 
        3  5633 1 1 119 PHE H    H   8.347   7.992  12.901 1.00 . A A . 119 PHE H    1 1 
        3  5634 1 1 119 PHE HA   H  10.389   6.105  12.103 1.00 . A A . 119 PHE HA   1 1 
        3  5635 1 1 119 PHE HB2  H  10.629   8.871  13.314 1.00 . A A . 119 PHE HB2  1 1 
        3  5636 1 1 119 PHE HB3  H  11.976   7.916  12.700 1.00 . A A . 119 PHE HB3  1 1 
        3  5637 1 1 119 PHE HD1  H  11.746   7.110  10.220 1.00 . A A . 119 PHE HD1  1 1 
        3  5638 1 1 119 PHE HD2  H   9.592  10.381  11.892 1.00 . A A . 119 PHE HD2  1 1 
        3  5639 1 1 119 PHE HE1  H  11.360   8.007   7.963 1.00 . A A . 119 PHE HE1  1 1 
        3  5640 1 1 119 PHE HE2  H   9.202  11.280   9.637 1.00 . A A . 119 PHE HE2  1 1 
        3  5641 1 1 119 PHE HZ   H  10.087  10.093   7.670 1.00 . A A . 119 PHE HZ   1 1 
        3  5642 1 1 119 PHE N    N   8.690   7.083  12.751 1.00 . A A . 119 PHE N    1 1 
        3  5643 1 1 119 PHE O    O  10.345   6.919  15.262 1.00 . A A . 119 PHE O    1 1 
        3  5644 1 1 120 LYS C    C  12.839   4.813  15.852 1.00 . A A . 120 LYS C    1 1 
        3  5645 1 1 120 LYS CA   C  11.419   4.361  15.480 1.00 . A A . 120 LYS CA   1 1 
        3  5646 1 1 120 LYS CB   C  11.380   2.829  15.332 1.00 . A A . 120 LYS CB   1 1 
        3  5647 1 1 120 LYS CD   C  10.002   0.727  15.085 1.00 . A A . 120 LYS CD   1 1 
        3  5648 1 1 120 LYS CE   C   8.598   0.134  14.979 1.00 . A A . 120 LYS CE   1 1 
        3  5649 1 1 120 LYS CG   C   9.978   2.252  15.143 1.00 . A A . 120 LYS CG   1 1 
        3  5650 1 1 120 LYS H    H  11.026   4.517  13.396 1.00 . A A . 120 LYS H    1 1 
        3  5651 1 1 120 LYS HA   H  10.742   4.652  16.273 1.00 . A A . 120 LYS HA   1 1 
        3  5652 1 1 120 LYS HB2  H  11.977   2.548  14.475 1.00 . A A . 120 LYS HB2  1 1 
        3  5653 1 1 120 LYS HB3  H  11.812   2.385  16.220 1.00 . A A . 120 LYS HB3  1 1 
        3  5654 1 1 120 LYS HD2  H  10.575   0.421  14.222 1.00 . A A . 120 LYS HD2  1 1 
        3  5655 1 1 120 LYS HD3  H  10.477   0.350  15.982 1.00 . A A . 120 LYS HD3  1 1 
        3  5656 1 1 120 LYS HE2  H   8.673  -0.942  15.033 1.00 . A A . 120 LYS HE2  1 1 
        3  5657 1 1 120 LYS HE3  H   8.006   0.494  15.808 1.00 . A A . 120 LYS HE3  1 1 
        3  5658 1 1 120 LYS HG2  H   9.355   2.562  15.970 1.00 . A A . 120 LYS HG2  1 1 
        3  5659 1 1 120 LYS HG3  H   9.565   2.633  14.218 1.00 . A A . 120 LYS HG3  1 1 
        3  5660 1 1 120 LYS HZ1  H   7.927   1.534  13.579 1.00 . A A . 120 LYS HZ1  1 1 
        3  5661 1 1 120 LYS HZ2  H   6.940   0.169  13.708 1.00 . A A . 120 LYS HZ2  1 1 
        3  5662 1 1 120 LYS HZ3  H   8.415   0.071  12.897 1.00 . A A . 120 LYS HZ3  1 1 
        3  5663 1 1 120 LYS N    N  10.972   5.012  14.243 1.00 . A A . 120 LYS N    1 1 
        3  5664 1 1 120 LYS NZ   N   7.923   0.503  13.705 1.00 . A A . 120 LYS NZ   1 1 
        3  5665 1 1 120 LYS O    O  13.812   4.442  15.190 1.00 . A A . 120 LYS O    1 1 
        3  5666 1 1 121 THR C    C  15.016   5.026  18.141 1.00 . A A . 121 THR C    1 1 
        3  5667 1 1 121 THR CA   C  14.258   6.112  17.368 1.00 . A A . 121 THR CA   1 1 
        3  5668 1 1 121 THR CB   C  14.116   7.368  18.264 1.00 . A A . 121 THR CB   1 1 
        3  5669 1 1 121 THR CG2  C  13.506   8.526  17.485 1.00 . A A . 121 THR CG2  1 1 
        3  5670 1 1 121 THR H    H  12.140   5.901  17.381 1.00 . A A . 121 THR H    1 1 
        3  5671 1 1 121 THR HA   H  14.838   6.385  16.495 1.00 . A A . 121 THR HA   1 1 
        3  5672 1 1 121 THR HB   H  15.098   7.665  18.606 1.00 . A A . 121 THR HB   1 1 
        3  5673 1 1 121 THR HG1  H  13.757   6.454  19.984 1.00 . A A . 121 THR HG1  1 1 
        3  5674 1 1 121 THR HG21 H  14.130   8.757  16.634 1.00 . A A . 121 THR HG21 1 1 
        3  5675 1 1 121 THR HG22 H  13.435   9.394  18.124 1.00 . A A . 121 THR HG22 1 1 
        3  5676 1 1 121 THR HG23 H  12.517   8.251  17.143 1.00 . A A . 121 THR HG23 1 1 
        3  5677 1 1 121 THR N    N  12.953   5.623  16.904 1.00 . A A . 121 THR N    1 1 
        3  5678 1 1 121 THR O    O  14.667   4.696  19.277 1.00 . A A . 121 THR O    1 1 
        3  5679 1 1 121 THR OG1  O  13.294   7.078  19.408 1.00 . A A . 121 THR OG1  1 1 
        3  5680 1 1 122 THR C    C  18.362   3.588  17.918 1.00 . A A . 122 THR C    1 1 
        3  5681 1 1 122 THR CA   C  16.843   3.386  18.128 1.00 . A A . 122 THR CA   1 1 
        3  5682 1 1 122 THR CB   C  16.404   1.985  17.616 1.00 . A A . 122 THR CB   1 1 
        3  5683 1 1 122 THR CG2  C  16.314   1.934  16.091 1.00 . A A . 122 THR CG2  1 1 
        3  5684 1 1 122 THR H    H  16.286   4.780  16.612 1.00 . A A . 122 THR H    1 1 
        3  5685 1 1 122 THR HA   H  16.647   3.418  19.193 1.00 . A A . 122 THR HA   1 1 
        3  5686 1 1 122 THR HB   H  15.422   1.777  18.019 1.00 . A A . 122 THR HB   1 1 
        3  5687 1 1 122 THR HG1  H  18.223   1.266  17.967 1.00 . A A . 122 THR HG1  1 1 
        3  5688 1 1 122 THR HG21 H  17.289   2.118  15.667 1.00 . A A . 122 THR HG21 1 1 
        3  5689 1 1 122 THR HG22 H  15.623   2.689  15.745 1.00 . A A . 122 THR HG22 1 1 
        3  5690 1 1 122 THR HG23 H  15.966   0.958  15.780 1.00 . A A . 122 THR HG23 1 1 
        3  5691 1 1 122 THR N    N  16.048   4.463  17.512 1.00 . A A . 122 THR N    1 1 
        3  5692 1 1 122 THR O    O  18.899   3.201  16.854 1.00 . A A . 122 THR O    1 1 
        3  5693 1 1 122 THR OXT  O  19.016   4.131  18.836 1.00 . A A . 122 THR OXT  1 1 
        3  5694 1 1 122 THR OG1  O  17.308   0.969  18.091 1.00 . A A . 122 THR OG1  1 1 
        4  5695 1 1   1 MET C    C -23.134   0.722 -20.388 1.00 . A A .   1 MET C    1 1 
        4  5696 1 1   1 MET CA   C -23.303   1.339 -21.781 1.00 . A A .   1 MET CA   1 1 
        4  5697 1 1   1 MET CB   C -22.122   2.276 -22.081 1.00 . A A .   1 MET CB   1 1 
        4  5698 1 1   1 MET CE   C -20.502   0.808 -24.424 1.00 . A A .   1 MET CE   1 1 
        4  5699 1 1   1 MET CG   C -22.138   2.855 -23.489 1.00 . A A .   1 MET CG   1 1 
        4  5700 1 1   1 MET H1   H -24.601   2.880 -21.221 1.00 . A A .   1 MET H1   1 1 
        4  5701 1 1   1 MET H2   H -25.383   1.446 -21.646 1.00 . A A .   1 MET H2   1 1 
        4  5702 1 1   1 MET H3   H -24.730   2.433 -22.848 1.00 . A A .   1 MET H3   1 1 
        4  5703 1 1   1 MET HA   H -23.318   0.544 -22.514 1.00 . A A .   1 MET HA   1 1 
        4  5704 1 1   1 MET HB2  H -22.142   3.098 -21.379 1.00 . A A .   1 MET HB2  1 1 
        4  5705 1 1   1 MET HB3  H -21.199   1.729 -21.952 1.00 . A A .   1 MET HB3  1 1 
        4  5706 1 1   1 MET HE1  H -20.312   0.035 -25.156 1.00 . A A .   1 MET HE1  1 1 
        4  5707 1 1   1 MET HE2  H -20.519   0.369 -23.436 1.00 . A A .   1 MET HE2  1 1 
        4  5708 1 1   1 MET HE3  H -19.719   1.549 -24.474 1.00 . A A .   1 MET HE3  1 1 
        4  5709 1 1   1 MET HG2  H -23.040   3.433 -23.616 1.00 . A A .   1 MET HG2  1 1 
        4  5710 1 1   1 MET HG3  H -21.279   3.501 -23.609 1.00 . A A .   1 MET HG3  1 1 
        4  5711 1 1   1 MET N    N -24.590   2.077 -21.882 1.00 . A A .   1 MET N    1 1 
        4  5712 1 1   1 MET O    O -23.613   1.273 -19.399 1.00 . A A .   1 MET O    1 1 
        4  5713 1 1   1 MET SD   S -22.084   1.582 -24.767 1.00 . A A .   1 MET SD   1 1 
        4  5714 1 1   2 GLY C    C -21.269  -0.278 -18.126 1.00 . A A .   2 GLY C    1 1 
        4  5715 1 1   2 GLY CA   C -22.208  -1.075 -19.035 1.00 . A A .   2 GLY CA   1 1 
        4  5716 1 1   2 GLY H    H -22.146  -0.846 -21.148 1.00 . A A .   2 GLY H    1 1 
        4  5717 1 1   2 GLY HA2  H -23.151  -1.217 -18.525 1.00 . A A .   2 GLY HA2  1 1 
        4  5718 1 1   2 GLY HA3  H -21.768  -2.042 -19.222 1.00 . A A .   2 GLY HA3  1 1 
        4  5719 1 1   2 GLY N    N -22.463  -0.425 -20.318 1.00 . A A .   2 GLY N    1 1 
        4  5720 1 1   2 GLY O    O -20.352   0.393 -18.602 1.00 . A A .   2 GLY O    1 1 
        4  5721 1 1   3 HIS C    C -20.128  -0.545 -14.724 1.00 . A A .   3 HIS C    1 1 
        4  5722 1 1   3 HIS CA   C -20.672   0.377 -15.833 1.00 . A A .   3 HIS CA   1 1 
        4  5723 1 1   3 HIS CB   C -21.488   1.518 -15.206 1.00 . A A .   3 HIS CB   1 1 
        4  5724 1 1   3 HIS CD2  C -22.568   2.889 -17.134 1.00 . A A .   3 HIS CD2  1 1 
        4  5725 1 1   3 HIS CE1  C -21.364   4.709 -16.933 1.00 . A A .   3 HIS CE1  1 1 
        4  5726 1 1   3 HIS CG   C -21.696   2.691 -16.115 1.00 . A A .   3 HIS CG   1 1 
        4  5727 1 1   3 HIS H    H -22.239  -0.906 -16.492 1.00 . A A .   3 HIS H    1 1 
        4  5728 1 1   3 HIS HA   H -19.829   0.804 -16.359 1.00 . A A .   3 HIS HA   1 1 
        4  5729 1 1   3 HIS HB2  H -22.461   1.142 -14.927 1.00 . A A .   3 HIS HB2  1 1 
        4  5730 1 1   3 HIS HB3  H -20.980   1.872 -14.318 1.00 . A A .   3 HIS HB3  1 1 
        4  5731 1 1   3 HIS HD1  H -20.246   4.025 -15.366 1.00 . A A .   3 HIS HD1  1 1 
        4  5732 1 1   3 HIS HD2  H -23.303   2.183 -17.495 1.00 . A A .   3 HIS HD2  1 1 
        4  5733 1 1   3 HIS HE1  H -20.962   5.699 -17.094 1.00 . A A .   3 HIS HE1  1 1 
        4  5734 1 1   3 HIS HE2  H -22.926   4.633 -18.251 1.00 . A A .   3 HIS HE2  1 1 
        4  5735 1 1   3 HIS N    N -21.494  -0.351 -16.814 1.00 . A A .   3 HIS N    1 1 
        4  5736 1 1   3 HIS ND1  N -20.959   3.852 -16.020 1.00 . A A .   3 HIS ND1  1 1 
        4  5737 1 1   3 HIS NE2  N -22.340   4.153 -17.624 1.00 . A A .   3 HIS NE2  1 1 
        4  5738 1 1   3 HIS O    O -19.781  -0.079 -13.636 1.00 . A A .   3 HIS O    1 1 
        4  5739 1 1   4 HIS C    C -18.428  -3.711 -14.734 1.00 . A A .   4 HIS C    1 1 
        4  5740 1 1   4 HIS CA   C -19.468  -2.809 -14.047 1.00 . A A .   4 HIS CA   1 1 
        4  5741 1 1   4 HIS CB   C -20.564  -3.673 -13.411 1.00 . A A .   4 HIS CB   1 1 
        4  5742 1 1   4 HIS CD2  C -21.536  -2.151 -11.540 1.00 . A A .   4 HIS CD2  1 1 
        4  5743 1 1   4 HIS CE1  C -23.611  -2.085 -12.238 1.00 . A A .   4 HIS CE1  1 1 
        4  5744 1 1   4 HIS CG   C -21.609  -2.892 -12.673 1.00 . A A .   4 HIS CG   1 1 
        4  5745 1 1   4 HIS H    H -20.389  -2.173 -15.858 1.00 . A A .   4 HIS H    1 1 
        4  5746 1 1   4 HIS HA   H -18.972  -2.246 -13.265 1.00 . A A .   4 HIS HA   1 1 
        4  5747 1 1   4 HIS HB2  H -21.063  -4.235 -14.189 1.00 . A A .   4 HIS HB2  1 1 
        4  5748 1 1   4 HIS HB3  H -20.111  -4.364 -12.713 1.00 . A A .   4 HIS HB3  1 1 
        4  5749 1 1   4 HIS HD1  H -23.299  -3.270 -13.870 1.00 . A A .   4 HIS HD1  1 1 
        4  5750 1 1   4 HIS HD2  H -20.652  -1.974 -10.945 1.00 . A A .   4 HIS HD2  1 1 
        4  5751 1 1   4 HIS HE1  H -24.664  -1.856 -12.310 1.00 . A A .   4 HIS HE1  1 1 
        4  5752 1 1   4 HIS HE2  H -23.070  -1.174 -10.491 1.00 . A A .   4 HIS HE2  1 1 
        4  5753 1 1   4 HIS N    N -20.048  -1.846 -14.998 1.00 . A A .   4 HIS N    1 1 
        4  5754 1 1   4 HIS ND1  N -22.923  -2.827 -13.080 1.00 . A A .   4 HIS ND1  1 1 
        4  5755 1 1   4 HIS NE2  N -22.796  -1.663 -11.295 1.00 . A A .   4 HIS NE2  1 1 
        4  5756 1 1   4 HIS O    O -18.775  -4.566 -15.553 1.00 . A A .   4 HIS O    1 1 
        4  5757 1 1   5 HIS C    C -15.818  -5.601 -14.166 1.00 . A A .   5 HIS C    1 1 
        4  5758 1 1   5 HIS CA   C -16.062  -4.317 -14.974 1.00 . A A .   5 HIS CA   1 1 
        4  5759 1 1   5 HIS CB   C -14.773  -3.487 -15.049 1.00 . A A .   5 HIS CB   1 1 
        4  5760 1 1   5 HIS CD2  C -14.826  -2.390 -17.394 1.00 . A A .   5 HIS CD2  1 1 
        4  5761 1 1   5 HIS CE1  C -14.965  -0.298 -16.777 1.00 . A A .   5 HIS CE1  1 1 
        4  5762 1 1   5 HIS CG   C -14.844  -2.367 -16.043 1.00 . A A .   5 HIS CG   1 1 
        4  5763 1 1   5 HIS H    H -16.936  -2.808 -13.750 1.00 . A A .   5 HIS H    1 1 
        4  5764 1 1   5 HIS HA   H -16.352  -4.595 -15.980 1.00 . A A .   5 HIS HA   1 1 
        4  5765 1 1   5 HIS HB2  H -14.570  -3.056 -14.080 1.00 . A A .   5 HIS HB2  1 1 
        4  5766 1 1   5 HIS HB3  H -13.950  -4.131 -15.332 1.00 . A A .   5 HIS HB3  1 1 
        4  5767 1 1   5 HIS HD1  H -14.968  -0.687 -14.773 1.00 . A A .   5 HIS HD1  1 1 
        4  5768 1 1   5 HIS HD2  H -14.769  -3.271 -18.019 1.00 . A A .   5 HIS HD2  1 1 
        4  5769 1 1   5 HIS HE1  H -15.034   0.780 -16.806 1.00 . A A .   5 HIS HE1  1 1 
        4  5770 1 1   5 HIS HE2  H -15.083  -0.816 -18.749 1.00 . A A .   5 HIS HE2  1 1 
        4  5771 1 1   5 HIS N    N -17.153  -3.514 -14.401 1.00 . A A .   5 HIS N    1 1 
        4  5772 1 1   5 HIS ND1  N -14.930  -1.039 -15.690 1.00 . A A .   5 HIS ND1  1 1 
        4  5773 1 1   5 HIS NE2  N -14.902  -1.092 -17.825 1.00 . A A .   5 HIS NE2  1 1 
        4  5774 1 1   5 HIS O    O -15.998  -6.711 -14.671 1.00 . A A .   5 HIS O    1 1 
        4  5775 1 1   6 HIS C    C -16.232  -6.771 -10.977 1.00 . A A .   6 HIS C    1 1 
        4  5776 1 1   6 HIS CA   C -15.137  -6.594 -12.039 1.00 . A A .   6 HIS CA   1 1 
        4  5777 1 1   6 HIS CB   C -13.750  -6.466 -11.384 1.00 . A A .   6 HIS CB   1 1 
        4  5778 1 1   6 HIS CD2  C -12.713  -4.097 -11.570 1.00 . A A .   6 HIS CD2  1 1 
        4  5779 1 1   6 HIS CE1  C -13.295  -3.327  -9.609 1.00 . A A .   6 HIS CE1  1 1 
        4  5780 1 1   6 HIS CG   C -13.401  -5.078 -10.939 1.00 . A A .   6 HIS CG   1 1 
        4  5781 1 1   6 HIS H    H -15.332  -4.540 -12.545 1.00 . A A .   6 HIS H    1 1 
        4  5782 1 1   6 HIS HA   H -15.134  -7.478 -12.665 1.00 . A A .   6 HIS HA   1 1 
        4  5783 1 1   6 HIS HB2  H -13.709  -7.107 -10.517 1.00 . A A .   6 HIS HB2  1 1 
        4  5784 1 1   6 HIS HB3  H -12.998  -6.786 -12.092 1.00 . A A .   6 HIS HB3  1 1 
        4  5785 1 1   6 HIS HD1  H -14.250  -5.031  -9.010 1.00 . A A .   6 HIS HD1  1 1 
        4  5786 1 1   6 HIS HD2  H -12.282  -4.152 -12.561 1.00 . A A .   6 HIS HD2  1 1 
        4  5787 1 1   6 HIS HE1  H -13.423  -2.676  -8.756 1.00 . A A .   6 HIS HE1  1 1 
        4  5788 1 1   6 HIS HE2  H -12.068  -2.248 -10.834 1.00 . A A .   6 HIS HE2  1 1 
        4  5789 1 1   6 HIS N    N -15.416  -5.446 -12.908 1.00 . A A .   6 HIS N    1 1 
        4  5790 1 1   6 HIS ND1  N -13.749  -4.561  -9.711 1.00 . A A .   6 HIS ND1  1 1 
        4  5791 1 1   6 HIS NE2  N -12.663  -3.022 -10.721 1.00 . A A .   6 HIS NE2  1 1 
        4  5792 1 1   6 HIS O    O -16.477  -5.885 -10.158 1.00 . A A .   6 HIS O    1 1 
        4  5793 1 1   7 HIS C    C -17.813  -9.656  -9.507 1.00 . A A .   7 HIS C    1 1 
        4  5794 1 1   7 HIS CA   C -17.979  -8.246 -10.092 1.00 . A A .   7 HIS CA   1 1 
        4  5795 1 1   7 HIS CB   C -19.325  -8.119 -10.826 1.00 . A A .   7 HIS CB   1 1 
        4  5796 1 1   7 HIS CD2  C -19.064  -8.466 -13.390 1.00 . A A .   7 HIS CD2  1 1 
        4  5797 1 1   7 HIS CE1  C -19.744 -10.545 -13.501 1.00 . A A .   7 HIS CE1  1 1 
        4  5798 1 1   7 HIS CG   C -19.380  -8.859 -12.130 1.00 . A A .   7 HIS CG   1 1 
        4  5799 1 1   7 HIS H    H -16.572  -8.622 -11.633 1.00 . A A .   7 HIS H    1 1 
        4  5800 1 1   7 HIS HA   H -17.955  -7.530  -9.280 1.00 . A A .   7 HIS HA   1 1 
        4  5801 1 1   7 HIS HB2  H -20.111  -8.507 -10.194 1.00 . A A .   7 HIS HB2  1 1 
        4  5802 1 1   7 HIS HB3  H -19.518  -7.075 -11.028 1.00 . A A .   7 HIS HB3  1 1 
        4  5803 1 1   7 HIS HD1  H -20.096 -10.738 -11.498 1.00 . A A .   7 HIS HD1  1 1 
        4  5804 1 1   7 HIS HD2  H -18.694  -7.493 -13.685 1.00 . A A .   7 HIS HD2  1 1 
        4  5805 1 1   7 HIS HE1  H -20.009 -11.519 -13.882 1.00 . A A .   7 HIS HE1  1 1 
        4  5806 1 1   7 HIS HE2  H -19.257  -9.514 -15.198 1.00 . A A .   7 HIS HE2  1 1 
        4  5807 1 1   7 HIS N    N -16.873  -7.934 -11.000 1.00 . A A .   7 HIS N    1 1 
        4  5808 1 1   7 HIS ND1  N -19.802 -10.167 -12.240 1.00 . A A .   7 HIS ND1  1 1 
        4  5809 1 1   7 HIS NE2  N -19.301  -9.534 -14.217 1.00 . A A .   7 HIS NE2  1 1 
        4  5810 1 1   7 HIS O    O -17.922 -10.656 -10.216 1.00 . A A .   7 HIS O    1 1 
        4  5811 1 1   8 HIS C    C -18.001 -11.028  -6.169 1.00 . A A .   8 HIS C    1 1 
        4  5812 1 1   8 HIS CA   C -17.296 -10.997  -7.533 1.00 . A A .   8 HIS CA   1 1 
        4  5813 1 1   8 HIS CB   C -15.780 -11.199  -7.375 1.00 . A A .   8 HIS CB   1 1 
        4  5814 1 1   8 HIS CD2  C -15.007 -12.824  -5.500 1.00 . A A .   8 HIS CD2  1 1 
        4  5815 1 1   8 HIS CE1  C -14.953 -14.667  -6.677 1.00 . A A .   8 HIS CE1  1 1 
        4  5816 1 1   8 HIS CG   C -15.383 -12.511  -6.763 1.00 . A A .   8 HIS CG   1 1 
        4  5817 1 1   8 HIS H    H -17.499  -8.894  -7.691 1.00 . A A .   8 HIS H    1 1 
        4  5818 1 1   8 HIS HA   H -17.695 -11.790  -8.151 1.00 . A A .   8 HIS HA   1 1 
        4  5819 1 1   8 HIS HB2  H -15.316 -11.142  -8.348 1.00 . A A .   8 HIS HB2  1 1 
        4  5820 1 1   8 HIS HB3  H -15.384 -10.408  -6.753 1.00 . A A .   8 HIS HB3  1 1 
        4  5821 1 1   8 HIS HD1  H -15.546 -13.799  -8.424 1.00 . A A .   8 HIS HD1  1 1 
        4  5822 1 1   8 HIS HD2  H -14.922 -12.139  -4.668 1.00 . A A .   8 HIS HD2  1 1 
        4  5823 1 1   8 HIS HE1  H -14.825 -15.702  -6.962 1.00 . A A .   8 HIS HE1  1 1 
        4  5824 1 1   8 HIS HE2  H -14.623 -14.705  -4.659 1.00 . A A .   8 HIS HE2  1 1 
        4  5825 1 1   8 HIS N    N -17.539  -9.724  -8.211 1.00 . A A .   8 HIS N    1 1 
        4  5826 1 1   8 HIS ND1  N -15.337 -13.692  -7.471 1.00 . A A .   8 HIS ND1  1 1 
        4  5827 1 1   8 HIS NE2  N -14.746 -14.169  -5.475 1.00 . A A .   8 HIS NE2  1 1 
        4  5828 1 1   8 HIS O    O -18.296  -9.977  -5.596 1.00 . A A .   8 HIS O    1 1 
        4  5829 1 1   9 SER C    C -18.282 -11.527  -3.273 1.00 . A A .   9 SER C    1 1 
        4  5830 1 1   9 SER CA   C -18.938 -12.405  -4.354 1.00 . A A .   9 SER CA   1 1 
        4  5831 1 1   9 SER CB   C -18.901 -13.875  -3.922 1.00 . A A .   9 SER CB   1 1 
        4  5832 1 1   9 SER H    H -18.057 -13.031  -6.192 1.00 . A A .   9 SER H    1 1 
        4  5833 1 1   9 SER HA   H -19.970 -12.102  -4.466 1.00 . A A .   9 SER HA   1 1 
        4  5834 1 1   9 SER HB2  H -19.396 -14.480  -4.668 1.00 . A A .   9 SER HB2  1 1 
        4  5835 1 1   9 SER HB3  H -17.873 -14.195  -3.826 1.00 . A A .   9 SER HB3  1 1 
        4  5836 1 1   9 SER HG   H -19.778 -15.001  -2.575 1.00 . A A .   9 SER HG   1 1 
        4  5837 1 1   9 SER N    N -18.282 -12.234  -5.664 1.00 . A A .   9 SER N    1 1 
        4  5838 1 1   9 SER O    O -17.069 -11.597  -3.051 1.00 . A A .   9 SER O    1 1 
        4  5839 1 1   9 SER OG   O -19.556 -14.064  -2.677 1.00 . A A .   9 SER OG   1 1 
        4  5840 1 1  10 HIS C    C -17.896 -10.259  -0.432 1.00 . A A .  10 HIS C    1 1 
        4  5841 1 1  10 HIS CA   C -18.579  -9.686  -1.683 1.00 . A A .  10 HIS CA   1 1 
        4  5842 1 1  10 HIS CB   C -19.706  -8.732  -1.261 1.00 . A A .  10 HIS CB   1 1 
        4  5843 1 1  10 HIS CD2  C -21.044  -7.633  -3.198 1.00 . A A .  10 HIS CD2  1 1 
        4  5844 1 1  10 HIS CE1  C -19.808  -5.845  -3.452 1.00 . A A .  10 HIS CE1  1 1 
        4  5845 1 1  10 HIS CG   C -20.038  -7.701  -2.296 1.00 . A A .  10 HIS CG   1 1 
        4  5846 1 1  10 HIS H    H -20.061 -10.803  -2.721 1.00 . A A .  10 HIS H    1 1 
        4  5847 1 1  10 HIS HA   H -17.845  -9.113  -2.230 1.00 . A A .  10 HIS HA   1 1 
        4  5848 1 1  10 HIS HB2  H -20.601  -9.306  -1.066 1.00 . A A .  10 HIS HB2  1 1 
        4  5849 1 1  10 HIS HB3  H -19.416  -8.213  -0.358 1.00 . A A .  10 HIS HB3  1 1 
        4  5850 1 1  10 HIS HD1  H -18.484  -6.317  -1.972 1.00 . A A .  10 HIS HD1  1 1 
        4  5851 1 1  10 HIS HD2  H -21.831  -8.362  -3.339 1.00 . A A .  10 HIS HD2  1 1 
        4  5852 1 1  10 HIS HE1  H -19.428  -4.901  -3.810 1.00 . A A .  10 HIS HE1  1 1 
        4  5853 1 1  10 HIS HE2  H -21.600  -6.015  -4.399 1.00 . A A .  10 HIS HE2  1 1 
        4  5854 1 1  10 HIS N    N -19.091 -10.709  -2.603 1.00 . A A .  10 HIS N    1 1 
        4  5855 1 1  10 HIS ND1  N -19.285  -6.565  -2.484 1.00 . A A .  10 HIS ND1  1 1 
        4  5856 1 1  10 HIS NE2  N -20.880  -6.464  -3.906 1.00 . A A .  10 HIS NE2  1 1 
        4  5857 1 1  10 HIS O    O -18.373 -11.213   0.186 1.00 . A A .  10 HIS O    1 1 
        4  5858 1 1  11 MET C    C -15.420  -8.592   1.674 1.00 . A A .  11 MET C    1 1 
        4  5859 1 1  11 MET CA   C -16.057  -9.898   1.172 1.00 . A A .  11 MET CA   1 1 
        4  5860 1 1  11 MET CB   C -14.982 -10.989   1.000 1.00 . A A .  11 MET CB   1 1 
        4  5861 1 1  11 MET CE   C -16.642 -14.471   2.605 1.00 . A A .  11 MET CE   1 1 
        4  5862 1 1  11 MET CG   C -15.520 -12.410   1.114 1.00 . A A .  11 MET CG   1 1 
        4  5863 1 1  11 MET H    H -16.384  -8.994  -0.707 1.00 . A A .  11 MET H    1 1 
        4  5864 1 1  11 MET HA   H -16.785 -10.228   1.902 1.00 . A A .  11 MET HA   1 1 
        4  5865 1 1  11 MET HB2  H -14.522 -10.879   0.026 1.00 . A A .  11 MET HB2  1 1 
        4  5866 1 1  11 MET HB3  H -14.225 -10.856   1.759 1.00 . A A .  11 MET HB3  1 1 
        4  5867 1 1  11 MET HE1  H -17.340 -14.614   1.794 1.00 . A A .  11 MET HE1  1 1 
        4  5868 1 1  11 MET HE2  H -17.089 -14.807   3.528 1.00 . A A .  11 MET HE2  1 1 
        4  5869 1 1  11 MET HE3  H -15.743 -15.041   2.412 1.00 . A A .  11 MET HE3  1 1 
        4  5870 1 1  11 MET HG2  H -16.288 -12.556   0.367 1.00 . A A .  11 MET HG2  1 1 
        4  5871 1 1  11 MET HG3  H -14.713 -13.106   0.943 1.00 . A A .  11 MET HG3  1 1 
        4  5872 1 1  11 MET N    N -16.765  -9.648  -0.086 1.00 . A A .  11 MET N    1 1 
        4  5873 1 1  11 MET O    O -15.194  -7.668   0.889 1.00 . A A .  11 MET O    1 1 
        4  5874 1 1  11 MET SD   S -16.230 -12.733   2.741 1.00 . A A .  11 MET SD   1 1 
        4  5875 1 1  12 THR C    C -13.139  -7.024   3.084 1.00 . A A .  12 THR C    1 1 
        4  5876 1 1  12 THR CA   C -14.571  -7.293   3.572 1.00 . A A .  12 THR CA   1 1 
        4  5877 1 1  12 THR CB   C -14.553  -7.376   5.117 1.00 . A A .  12 THR CB   1 1 
        4  5878 1 1  12 THR CG2  C -15.967  -7.454   5.685 1.00 . A A .  12 THR CG2  1 1 
        4  5879 1 1  12 THR H    H -15.329  -9.286   3.550 1.00 . A A .  12 THR H    1 1 
        4  5880 1 1  12 THR HA   H -15.197  -6.457   3.287 1.00 . A A .  12 THR HA   1 1 
        4  5881 1 1  12 THR HB   H -14.074  -6.487   5.508 1.00 . A A .  12 THR HB   1 1 
        4  5882 1 1  12 THR HG1  H -13.964  -8.692   6.473 1.00 . A A .  12 THR HG1  1 1 
        4  5883 1 1  12 THR HG21 H -15.918  -7.529   6.761 1.00 . A A .  12 THR HG21 1 1 
        4  5884 1 1  12 THR HG22 H -16.469  -8.326   5.287 1.00 . A A .  12 THR HG22 1 1 
        4  5885 1 1  12 THR HG23 H -16.517  -6.567   5.411 1.00 . A A .  12 THR HG23 1 1 
        4  5886 1 1  12 THR N    N -15.144  -8.511   2.972 1.00 . A A .  12 THR N    1 1 
        4  5887 1 1  12 THR O    O -12.787  -5.888   2.761 1.00 . A A .  12 THR O    1 1 
        4  5888 1 1  12 THR OG1  O -13.806  -8.528   5.533 1.00 . A A .  12 THR OG1  1 1 
        4  5889 1 1  13 GLY C    C -10.077  -7.271   3.723 1.00 . A A .  13 GLY C    1 1 
        4  5890 1 1  13 GLY CA   C -10.925  -7.925   2.636 1.00 . A A .  13 GLY CA   1 1 
        4  5891 1 1  13 GLY H    H -12.667  -8.960   3.268 1.00 . A A .  13 GLY H    1 1 
        4  5892 1 1  13 GLY HA2  H -10.519  -8.904   2.418 1.00 . A A .  13 GLY HA2  1 1 
        4  5893 1 1  13 GLY HA3  H -10.875  -7.322   1.741 1.00 . A A .  13 GLY HA3  1 1 
        4  5894 1 1  13 GLY N    N -12.320  -8.075   3.031 1.00 . A A .  13 GLY N    1 1 
        4  5895 1 1  13 GLY O    O  -9.813  -6.071   3.676 1.00 . A A .  13 GLY O    1 1 
        4  5896 1 1  14 ASN C    C  -7.401  -7.269   5.481 1.00 . A A .  14 ASN C    1 1 
        4  5897 1 1  14 ASN CA   C  -8.875  -7.550   5.849 1.00 . A A .  14 ASN CA   1 1 
        4  5898 1 1  14 ASN CB   C  -8.946  -8.557   7.005 1.00 . A A .  14 ASN CB   1 1 
        4  5899 1 1  14 ASN CG   C -10.378  -8.926   7.367 1.00 . A A .  14 ASN CG   1 1 
        4  5900 1 1  14 ASN H    H  -9.865  -9.017   4.671 1.00 . A A .  14 ASN H    1 1 
        4  5901 1 1  14 ASN HA   H  -9.333  -6.623   6.168 1.00 . A A .  14 ASN HA   1 1 
        4  5902 1 1  14 ASN HB2  H  -8.424  -9.460   6.721 1.00 . A A .  14 ASN HB2  1 1 
        4  5903 1 1  14 ASN HB3  H  -8.468  -8.132   7.877 1.00 . A A .  14 ASN HB3  1 1 
        4  5904 1 1  14 ASN HD21 H -10.481  -7.449   8.682 1.00 . A A .  14 ASN HD21 1 1 
        4  5905 1 1  14 ASN HD22 H -11.895  -8.425   8.526 1.00 . A A .  14 ASN HD22 1 1 
        4  5906 1 1  14 ASN N    N  -9.647  -8.063   4.705 1.00 . A A .  14 ASN N    1 1 
        4  5907 1 1  14 ASN ND2  N -10.977  -8.193   8.282 1.00 . A A .  14 ASN ND2  1 1 
        4  5908 1 1  14 ASN O    O  -6.481  -7.652   6.210 1.00 . A A .  14 ASN O    1 1 
        4  5909 1 1  14 ASN OD1  O -10.947  -9.866   6.822 1.00 . A A .  14 ASN OD1  1 1 
        4  5910 1 1  15 VAL C    C  -5.458  -4.803   4.277 1.00 . A A .  15 VAL C    1 1 
        4  5911 1 1  15 VAL CA   C  -5.829  -6.248   3.900 1.00 . A A .  15 VAL CA   1 1 
        4  5912 1 1  15 VAL CB   C  -5.694  -6.434   2.366 1.00 . A A .  15 VAL CB   1 1 
        4  5913 1 1  15 VAL CG1  C  -4.254  -6.192   1.909 1.00 . A A .  15 VAL CG1  1 1 
        4  5914 1 1  15 VAL CG2  C  -6.173  -7.825   1.944 1.00 . A A .  15 VAL CG2  1 1 
        4  5915 1 1  15 VAL H    H  -7.951  -6.268   3.838 1.00 . A A .  15 VAL H    1 1 
        4  5916 1 1  15 VAL HA   H  -5.135  -6.922   4.386 1.00 . A A .  15 VAL HA   1 1 
        4  5917 1 1  15 VAL HB   H  -6.326  -5.702   1.881 1.00 . A A .  15 VAL HB   1 1 
        4  5918 1 1  15 VAL HG11 H  -3.597  -6.902   2.393 1.00 . A A .  15 VAL HG11 1 1 
        4  5919 1 1  15 VAL HG12 H  -3.956  -5.188   2.172 1.00 . A A .  15 VAL HG12 1 1 
        4  5920 1 1  15 VAL HG13 H  -4.189  -6.316   0.836 1.00 . A A .  15 VAL HG13 1 1 
        4  5921 1 1  15 VAL HG21 H  -7.217  -7.941   2.204 1.00 . A A .  15 VAL HG21 1 1 
        4  5922 1 1  15 VAL HG22 H  -5.591  -8.580   2.453 1.00 . A A .  15 VAL HG22 1 1 
        4  5923 1 1  15 VAL HG23 H  -6.055  -7.939   0.876 1.00 . A A .  15 VAL HG23 1 1 
        4  5924 1 1  15 VAL N    N  -7.182  -6.578   4.362 1.00 . A A .  15 VAL N    1 1 
        4  5925 1 1  15 VAL O    O  -5.834  -3.848   3.594 1.00 . A A .  15 VAL O    1 1 
        4  5926 1 1  16 CYS C    C  -2.833  -3.098   5.767 1.00 . A A .  16 CYS C    1 1 
        4  5927 1 1  16 CYS CA   C  -4.345  -3.323   5.881 1.00 . A A .  16 CYS CA   1 1 
        4  5928 1 1  16 CYS CB   C  -4.777  -3.180   7.343 1.00 . A A .  16 CYS CB   1 1 
        4  5929 1 1  16 CYS H    H  -4.438  -5.448   5.866 1.00 . A A .  16 CYS H    1 1 
        4  5930 1 1  16 CYS HA   H  -4.855  -2.575   5.289 1.00 . A A .  16 CYS HA   1 1 
        4  5931 1 1  16 CYS HB2  H  -4.462  -2.216   7.716 1.00 . A A .  16 CYS HB2  1 1 
        4  5932 1 1  16 CYS HB3  H  -5.854  -3.247   7.400 1.00 . A A .  16 CYS HB3  1 1 
        4  5933 1 1  16 CYS HG   H  -3.185  -5.134   7.758 1.00 . A A .  16 CYS HG   1 1 
        4  5934 1 1  16 CYS N    N  -4.730  -4.649   5.376 1.00 . A A .  16 CYS N    1 1 
        4  5935 1 1  16 CYS O    O  -2.062  -4.050   5.675 1.00 . A A .  16 CYS O    1 1 
        4  5936 1 1  16 CYS SG   S  -4.090  -4.445   8.442 1.00 . A A .  16 CYS SG   1 1 
        4  5937 1 1  17 ILE C    C  -0.254  -2.031   6.966 1.00 . A A .  17 ILE C    1 1 
        4  5938 1 1  17 ILE CA   C  -0.985  -1.492   5.727 1.00 . A A .  17 ILE CA   1 1 
        4  5939 1 1  17 ILE CB   C  -0.765   0.043   5.651 1.00 . A A .  17 ILE CB   1 1 
        4  5940 1 1  17 ILE CD1  C  -1.330   2.132   4.287 1.00 . A A .  17 ILE CD1  1 1 
        4  5941 1 1  17 ILE CG1  C  -1.436   0.624   4.397 1.00 . A A .  17 ILE CG1  1 1 
        4  5942 1 1  17 ILE CG2  C   0.729   0.380   5.667 1.00 . A A .  17 ILE CG2  1 1 
        4  5943 1 1  17 ILE H    H  -3.073  -1.111   5.800 1.00 . A A .  17 ILE H    1 1 
        4  5944 1 1  17 ILE HA   H  -0.559  -1.942   4.841 1.00 . A A .  17 ILE HA   1 1 
        4  5945 1 1  17 ILE HB   H  -1.215   0.489   6.528 1.00 . A A .  17 ILE HB   1 1 
        4  5946 1 1  17 ILE HD11 H  -1.787   2.591   5.153 1.00 . A A .  17 ILE HD11 1 1 
        4  5947 1 1  17 ILE HD12 H  -1.839   2.464   3.395 1.00 . A A .  17 ILE HD12 1 1 
        4  5948 1 1  17 ILE HD13 H  -0.290   2.418   4.235 1.00 . A A .  17 ILE HD13 1 1 
        4  5949 1 1  17 ILE HG12 H  -0.977   0.198   3.516 1.00 . A A .  17 ILE HG12 1 1 
        4  5950 1 1  17 ILE HG13 H  -2.486   0.366   4.407 1.00 . A A .  17 ILE HG13 1 1 
        4  5951 1 1  17 ILE HG21 H   0.862   1.450   5.589 1.00 . A A .  17 ILE HG21 1 1 
        4  5952 1 1  17 ILE HG22 H   1.217  -0.105   4.833 1.00 . A A .  17 ILE HG22 1 1 
        4  5953 1 1  17 ILE HG23 H   1.168   0.030   6.590 1.00 . A A .  17 ILE HG23 1 1 
        4  5954 1 1  17 ILE N    N  -2.413  -1.832   5.768 1.00 . A A .  17 ILE N    1 1 
        4  5955 1 1  17 ILE O    O  -0.759  -1.922   8.080 1.00 . A A .  17 ILE O    1 1 
        4  5956 1 1  18 GLU C    C   2.718  -1.965   8.314 1.00 . A A .  18 GLU C    1 1 
        4  5957 1 1  18 GLU CA   C   1.752  -3.078   7.886 1.00 . A A .  18 GLU CA   1 1 
        4  5958 1 1  18 GLU CB   C   2.543  -4.341   7.500 1.00 . A A .  18 GLU CB   1 1 
        4  5959 1 1  18 GLU CD   C   4.211  -6.111   8.241 1.00 . A A .  18 GLU CD   1 1 
        4  5960 1 1  18 GLU CG   C   3.313  -4.957   8.664 1.00 . A A .  18 GLU CG   1 1 
        4  5961 1 1  18 GLU H    H   1.233  -2.764   5.850 1.00 . A A .  18 GLU H    1 1 
        4  5962 1 1  18 GLU HA   H   1.100  -3.310   8.716 1.00 . A A .  18 GLU HA   1 1 
        4  5963 1 1  18 GLU HB2  H   1.851  -5.081   7.120 1.00 . A A .  18 GLU HB2  1 1 
        4  5964 1 1  18 GLU HB3  H   3.248  -4.089   6.719 1.00 . A A .  18 GLU HB3  1 1 
        4  5965 1 1  18 GLU HG2  H   3.927  -4.192   9.117 1.00 . A A .  18 GLU HG2  1 1 
        4  5966 1 1  18 GLU HG3  H   2.604  -5.323   9.394 1.00 . A A .  18 GLU HG3  1 1 
        4  5967 1 1  18 GLU N    N   0.919  -2.625   6.767 1.00 . A A .  18 GLU N    1 1 
        4  5968 1 1  18 GLU O    O   2.564  -1.367   9.382 1.00 . A A .  18 GLU O    1 1 
        4  5969 1 1  18 GLU OE1  O   3.683  -7.181   7.863 1.00 . A A .  18 GLU OE1  1 1 
        4  5970 1 1  18 GLU OE2  O   5.448  -5.957   8.290 1.00 . A A .  18 GLU OE2  1 1 
        4  5971 1 1  19 GLU C    C   5.182   0.045   6.459 1.00 . A A .  19 GLU C    1 1 
        4  5972 1 1  19 GLU CA   C   4.699  -0.645   7.744 1.00 . A A .  19 GLU CA   1 1 
        4  5973 1 1  19 GLU CB   C   5.889  -1.278   8.480 1.00 . A A .  19 GLU CB   1 1 
        4  5974 1 1  19 GLU CD   C   8.095  -0.927   9.684 1.00 . A A .  19 GLU CD   1 1 
        4  5975 1 1  19 GLU CG   C   6.930  -0.270   8.959 1.00 . A A .  19 GLU CG   1 1 
        4  5976 1 1  19 GLU H    H   3.737  -2.150   6.603 1.00 . A A .  19 GLU H    1 1 
        4  5977 1 1  19 GLU HA   H   4.244   0.098   8.386 1.00 . A A .  19 GLU HA   1 1 
        4  5978 1 1  19 GLU HB2  H   5.518  -1.815   9.342 1.00 . A A .  19 GLU HB2  1 1 
        4  5979 1 1  19 GLU HB3  H   6.376  -1.978   7.815 1.00 . A A .  19 GLU HB3  1 1 
        4  5980 1 1  19 GLU HG2  H   7.313   0.266   8.102 1.00 . A A .  19 GLU HG2  1 1 
        4  5981 1 1  19 GLU HG3  H   6.454   0.429   9.632 1.00 . A A .  19 GLU HG3  1 1 
        4  5982 1 1  19 GLU N    N   3.692  -1.669   7.455 1.00 . A A .  19 GLU N    1 1 
        4  5983 1 1  19 GLU O    O   5.385  -0.603   5.428 1.00 . A A .  19 GLU O    1 1 
        4  5984 1 1  19 GLU OE1  O   7.907  -1.375  10.837 1.00 . A A .  19 GLU OE1  1 1 
        4  5985 1 1  19 GLU OE2  O   9.204  -0.994   9.109 1.00 . A A .  19 GLU OE2  1 1 
        4  5986 1 1  20 ILE C    C   7.344   2.490   5.581 1.00 . A A .  20 ILE C    1 1 
        4  5987 1 1  20 ILE CA   C   5.855   2.146   5.390 1.00 . A A .  20 ILE CA   1 1 
        4  5988 1 1  20 ILE CB   C   5.045   3.458   5.220 1.00 . A A .  20 ILE CB   1 1 
        4  5989 1 1  20 ILE CD1  C   2.668   4.376   5.009 1.00 . A A .  20 ILE CD1  1 1 
        4  5990 1 1  20 ILE CG1  C   3.543   3.145   5.113 1.00 . A A .  20 ILE CG1  1 1 
        4  5991 1 1  20 ILE CG2  C   5.527   4.246   3.999 1.00 . A A .  20 ILE CG2  1 1 
        4  5992 1 1  20 ILE H    H   5.123   1.830   7.358 1.00 . A A .  20 ILE H    1 1 
        4  5993 1 1  20 ILE HA   H   5.741   1.555   4.489 1.00 . A A .  20 ILE HA   1 1 
        4  5994 1 1  20 ILE HB   H   5.213   4.069   6.096 1.00 . A A .  20 ILE HB   1 1 
        4  5995 1 1  20 ILE HD11 H   2.935   4.936   4.124 1.00 . A A .  20 ILE HD11 1 1 
        4  5996 1 1  20 ILE HD12 H   2.814   4.993   5.884 1.00 . A A .  20 ILE HD12 1 1 
        4  5997 1 1  20 ILE HD13 H   1.633   4.077   4.948 1.00 . A A .  20 ILE HD13 1 1 
        4  5998 1 1  20 ILE HG12 H   3.367   2.542   4.235 1.00 . A A .  20 ILE HG12 1 1 
        4  5999 1 1  20 ILE HG13 H   3.233   2.593   5.989 1.00 . A A .  20 ILE HG13 1 1 
        4  6000 1 1  20 ILE HG21 H   6.566   4.509   4.129 1.00 . A A .  20 ILE HG21 1 1 
        4  6001 1 1  20 ILE HG22 H   4.940   5.147   3.893 1.00 . A A .  20 ILE HG22 1 1 
        4  6002 1 1  20 ILE HG23 H   5.418   3.639   3.111 1.00 . A A .  20 ILE HG23 1 1 
        4  6003 1 1  20 ILE N    N   5.349   1.363   6.523 1.00 . A A .  20 ILE N    1 1 
        4  6004 1 1  20 ILE O    O   7.785   2.774   6.700 1.00 . A A .  20 ILE O    1 1 
        4  6005 1 1  21 ASP C    C   9.842   4.262   4.690 1.00 . A A .  21 ASP C    1 1 
        4  6006 1 1  21 ASP CA   C   9.554   2.750   4.571 1.00 . A A .  21 ASP CA   1 1 
        4  6007 1 1  21 ASP CB   C  10.282   2.164   3.358 1.00 . A A .  21 ASP CB   1 1 
        4  6008 1 1  21 ASP CG   C  11.751   2.543   3.337 1.00 . A A .  21 ASP CG   1 1 
        4  6009 1 1  21 ASP H    H   7.721   2.225   3.631 1.00 . A A .  21 ASP H    1 1 
        4  6010 1 1  21 ASP HA   H   9.932   2.266   5.462 1.00 . A A .  21 ASP HA   1 1 
        4  6011 1 1  21 ASP HB2  H  10.205   1.084   3.385 1.00 . A A .  21 ASP HB2  1 1 
        4  6012 1 1  21 ASP HB3  H   9.815   2.529   2.454 1.00 . A A .  21 ASP HB3  1 1 
        4  6013 1 1  21 ASP N    N   8.118   2.458   4.497 1.00 . A A .  21 ASP N    1 1 
        4  6014 1 1  21 ASP O    O   9.095   5.101   4.177 1.00 . A A .  21 ASP O    1 1 
        4  6015 1 1  21 ASP OD1  O  12.498   2.121   4.245 1.00 . A A .  21 ASP OD1  1 1 
        4  6016 1 1  21 ASP OD2  O  12.155   3.289   2.429 1.00 . A A .  21 ASP OD2  1 1 
        4  6017 1 1  22 VAL C    C  12.237   6.559   4.497 1.00 . A A .  22 VAL C    1 1 
        4  6018 1 1  22 VAL CA   C  11.357   5.967   5.625 1.00 . A A .  22 VAL CA   1 1 
        4  6019 1 1  22 VAL CB   C  12.116   6.049   6.979 1.00 . A A .  22 VAL CB   1 1 
        4  6020 1 1  22 VAL CG1  C  13.319   5.105   6.985 1.00 . A A .  22 VAL CG1  1 1 
        4  6021 1 1  22 VAL CG2  C  12.541   7.485   7.295 1.00 . A A .  22 VAL CG2  1 1 
        4  6022 1 1  22 VAL H    H  11.525   3.853   5.682 1.00 . A A .  22 VAL H    1 1 
        4  6023 1 1  22 VAL HA   H  10.459   6.564   5.711 1.00 . A A .  22 VAL HA   1 1 
        4  6024 1 1  22 VAL HB   H  11.440   5.723   7.758 1.00 . A A .  22 VAL HB   1 1 
        4  6025 1 1  22 VAL HG11 H  14.009   5.392   6.204 1.00 . A A .  22 VAL HG11 1 1 
        4  6026 1 1  22 VAL HG12 H  12.983   4.092   6.812 1.00 . A A .  22 VAL HG12 1 1 
        4  6027 1 1  22 VAL HG13 H  13.816   5.158   7.943 1.00 . A A .  22 VAL HG13 1 1 
        4  6028 1 1  22 VAL HG21 H  12.996   7.521   8.276 1.00 . A A .  22 VAL HG21 1 1 
        4  6029 1 1  22 VAL HG22 H  11.674   8.130   7.280 1.00 . A A .  22 VAL HG22 1 1 
        4  6030 1 1  22 VAL HG23 H  13.253   7.827   6.558 1.00 . A A .  22 VAL HG23 1 1 
        4  6031 1 1  22 VAL N    N  10.953   4.580   5.356 1.00 . A A .  22 VAL N    1 1 
        4  6032 1 1  22 VAL O    O  12.191   7.762   4.225 1.00 . A A .  22 VAL O    1 1 
        4  6033 1 1  23 ASP C    C  13.144   6.517   1.490 1.00 . A A .  23 ASP C    1 1 
        4  6034 1 1  23 ASP CA   C  13.930   6.153   2.760 1.00 . A A .  23 ASP CA   1 1 
        4  6035 1 1  23 ASP CB   C  14.954   5.048   2.453 1.00 . A A .  23 ASP CB   1 1 
        4  6036 1 1  23 ASP CG   C  15.865   5.392   1.286 1.00 . A A .  23 ASP CG   1 1 
        4  6037 1 1  23 ASP H    H  12.997   4.756   4.066 1.00 . A A .  23 ASP H    1 1 
        4  6038 1 1  23 ASP HA   H  14.456   7.031   3.108 1.00 . A A .  23 ASP HA   1 1 
        4  6039 1 1  23 ASP HB2  H  15.569   4.885   3.328 1.00 . A A .  23 ASP HB2  1 1 
        4  6040 1 1  23 ASP HB3  H  14.427   4.132   2.220 1.00 . A A .  23 ASP HB3  1 1 
        4  6041 1 1  23 ASP N    N  13.028   5.709   3.837 1.00 . A A .  23 ASP N    1 1 
        4  6042 1 1  23 ASP O    O  13.532   7.412   0.734 1.00 . A A .  23 ASP O    1 1 
        4  6043 1 1  23 ASP OD1  O  16.837   6.150   1.485 1.00 . A A .  23 ASP OD1  1 1 
        4  6044 1 1  23 ASP OD2  O  15.623   4.898   0.162 1.00 . A A .  23 ASP OD2  1 1 
        4  6045 1 1  24 GLY C    C  11.333   4.847  -0.893 1.00 . A A .  24 GLY C    1 1 
        4  6046 1 1  24 GLY CA   C  11.236   6.025   0.070 1.00 . A A .  24 GLY CA   1 1 
        4  6047 1 1  24 GLY H    H  11.754   5.159   1.937 1.00 . A A .  24 GLY H    1 1 
        4  6048 1 1  24 GLY HA2  H  10.204   6.155   0.358 1.00 . A A .  24 GLY HA2  1 1 
        4  6049 1 1  24 GLY HA3  H  11.573   6.920  -0.437 1.00 . A A .  24 GLY HA3  1 1 
        4  6050 1 1  24 GLY N    N  12.034   5.824   1.271 1.00 . A A .  24 GLY N    1 1 
        4  6051 1 1  24 GLY O    O  11.305   5.025  -2.111 1.00 . A A .  24 GLY O    1 1 
        4  6052 1 1  25 LYS C    C  10.259   1.714  -1.372 1.00 . A A .  25 LYS C    1 1 
        4  6053 1 1  25 LYS CA   C  11.603   2.421  -1.135 1.00 . A A .  25 LYS CA   1 1 
        4  6054 1 1  25 LYS CB   C  12.559   1.444  -0.439 1.00 . A A .  25 LYS CB   1 1 
        4  6055 1 1  25 LYS CD   C  14.825   1.005   0.569 1.00 . A A .  25 LYS CD   1 1 
        4  6056 1 1  25 LYS CE   C  16.131   1.626   1.047 1.00 . A A .  25 LYS CE   1 1 
        4  6057 1 1  25 LYS CG   C  13.922   2.033  -0.106 1.00 . A A .  25 LYS CG   1 1 
        4  6058 1 1  25 LYS H    H  11.478   3.575   0.641 1.00 . A A .  25 LYS H    1 1 
        4  6059 1 1  25 LYS HA   H  12.023   2.696  -2.092 1.00 . A A .  25 LYS HA   1 1 
        4  6060 1 1  25 LYS HB2  H  12.103   1.110   0.483 1.00 . A A .  25 LYS HB2  1 1 
        4  6061 1 1  25 LYS HB3  H  12.708   0.588  -1.084 1.00 . A A .  25 LYS HB3  1 1 
        4  6062 1 1  25 LYS HD2  H  14.305   0.588   1.421 1.00 . A A .  25 LYS HD2  1 1 
        4  6063 1 1  25 LYS HD3  H  15.048   0.217  -0.138 1.00 . A A .  25 LYS HD3  1 1 
        4  6064 1 1  25 LYS HE2  H  15.911   2.328   1.837 1.00 . A A .  25 LYS HE2  1 1 
        4  6065 1 1  25 LYS HE3  H  16.767   0.842   1.433 1.00 . A A .  25 LYS HE3  1 1 
        4  6066 1 1  25 LYS HG2  H  14.394   2.365  -1.020 1.00 . A A .  25 LYS HG2  1 1 
        4  6067 1 1  25 LYS HG3  H  13.788   2.876   0.559 1.00 . A A .  25 LYS HG3  1 1 
        4  6068 1 1  25 LYS HZ1  H  16.327   3.198  -0.317 1.00 . A A .  25 LYS HZ1  1 1 
        4  6069 1 1  25 LYS HZ2  H  16.943   1.721  -0.876 1.00 . A A .  25 LYS HZ2  1 1 
        4  6070 1 1  25 LYS HZ3  H  17.799   2.616   0.278 1.00 . A A .  25 LYS HZ3  1 1 
        4  6071 1 1  25 LYS N    N  11.459   3.643  -0.337 1.00 . A A .  25 LYS N    1 1 
        4  6072 1 1  25 LYS NZ   N  16.849   2.338  -0.043 1.00 . A A .  25 LYS NZ   1 1 
        4  6073 1 1  25 LYS O    O   9.902   1.417  -2.512 1.00 . A A .  25 LYS O    1 1 
        4  6074 1 1  26 PHE C    C   7.256   0.886   0.685 1.00 . A A .  26 PHE C    1 1 
        4  6075 1 1  26 PHE CA   C   8.309   0.600  -0.402 1.00 . A A .  26 PHE CA   1 1 
        4  6076 1 1  26 PHE CB   C   8.706  -0.882  -0.344 1.00 . A A .  26 PHE CB   1 1 
        4  6077 1 1  26 PHE CD1  C  10.731  -1.204   1.127 1.00 . A A .  26 PHE CD1  1 1 
        4  6078 1 1  26 PHE CD2  C   8.592  -1.783   2.013 1.00 . A A .  26 PHE CD2  1 1 
        4  6079 1 1  26 PHE CE1  C  11.327  -1.584   2.316 1.00 . A A .  26 PHE CE1  1 1 
        4  6080 1 1  26 PHE CE2  C   9.183  -2.164   3.202 1.00 . A A .  26 PHE CE2  1 1 
        4  6081 1 1  26 PHE CG   C   9.357  -1.298   0.959 1.00 . A A .  26 PHE CG   1 1 
        4  6082 1 1  26 PHE CZ   C  10.552  -2.064   3.353 1.00 . A A .  26 PHE CZ   1 1 
        4  6083 1 1  26 PHE H    H   9.777   1.796   0.577 1.00 . A A .  26 PHE H    1 1 
        4  6084 1 1  26 PHE HA   H   7.861   0.794  -1.366 1.00 . A A .  26 PHE HA   1 1 
        4  6085 1 1  26 PHE HB2  H   7.822  -1.489  -0.482 1.00 . A A .  26 PHE HB2  1 1 
        4  6086 1 1  26 PHE HB3  H   9.400  -1.088  -1.145 1.00 . A A .  26 PHE HB3  1 1 
        4  6087 1 1  26 PHE HD1  H  11.341  -0.831   0.317 1.00 . A A .  26 PHE HD1  1 1 
        4  6088 1 1  26 PHE HD2  H   7.520  -1.862   1.898 1.00 . A A .  26 PHE HD2  1 1 
        4  6089 1 1  26 PHE HE1  H  12.397  -1.505   2.433 1.00 . A A .  26 PHE HE1  1 1 
        4  6090 1 1  26 PHE HE2  H   8.575  -2.541   4.012 1.00 . A A .  26 PHE HE2  1 1 
        4  6091 1 1  26 PHE HZ   H  11.018  -2.361   4.281 1.00 . A A .  26 PHE HZ   1 1 
        4  6092 1 1  26 PHE N    N   9.516   1.435  -0.295 1.00 . A A .  26 PHE N    1 1 
        4  6093 1 1  26 PHE O    O   7.526   1.545   1.693 1.00 . A A .  26 PHE O    1 1 
        4  6094 1 1  27 ILE C    C   4.361  -1.031   1.565 1.00 . A A .  27 ILE C    1 1 
        4  6095 1 1  27 ILE CA   C   4.945   0.389   1.419 1.00 . A A .  27 ILE CA   1 1 
        4  6096 1 1  27 ILE CB   C   3.812   1.361   0.979 1.00 . A A .  27 ILE CB   1 1 
        4  6097 1 1  27 ILE CD1  C   3.316   3.803   0.360 1.00 . A A .  27 ILE CD1  1 1 
        4  6098 1 1  27 ILE CG1  C   4.354   2.794   0.817 1.00 . A A .  27 ILE CG1  1 1 
        4  6099 1 1  27 ILE CG2  C   2.647   1.330   1.972 1.00 . A A .  27 ILE CG2  1 1 
        4  6100 1 1  27 ILE H    H   5.880  -0.028  -0.436 1.00 . A A .  27 ILE H    1 1 
        4  6101 1 1  27 ILE HA   H   5.337   0.714   2.376 1.00 . A A .  27 ILE HA   1 1 
        4  6102 1 1  27 ILE HB   H   3.438   1.020   0.023 1.00 . A A .  27 ILE HB   1 1 
        4  6103 1 1  27 ILE HD11 H   3.783   4.771   0.248 1.00 . A A .  27 ILE HD11 1 1 
        4  6104 1 1  27 ILE HD12 H   2.526   3.865   1.093 1.00 . A A .  27 ILE HD12 1 1 
        4  6105 1 1  27 ILE HD13 H   2.902   3.493  -0.590 1.00 . A A .  27 ILE HD13 1 1 
        4  6106 1 1  27 ILE HG12 H   4.744   3.135   1.764 1.00 . A A .  27 ILE HG12 1 1 
        4  6107 1 1  27 ILE HG13 H   5.153   2.789   0.088 1.00 . A A .  27 ILE HG13 1 1 
        4  6108 1 1  27 ILE HG21 H   2.990   1.655   2.944 1.00 . A A .  27 ILE HG21 1 1 
        4  6109 1 1  27 ILE HG22 H   2.259   0.325   2.047 1.00 . A A .  27 ILE HG22 1 1 
        4  6110 1 1  27 ILE HG23 H   1.863   1.991   1.629 1.00 . A A .  27 ILE HG23 1 1 
        4  6111 1 1  27 ILE N    N   6.046   0.372   0.445 1.00 . A A .  27 ILE N    1 1 
        4  6112 1 1  27 ILE O    O   3.680  -1.521   0.669 1.00 . A A .  27 ILE O    1 1 
        4  6113 1 1  28 ARG C    C   2.845  -3.213   3.538 1.00 . A A .  28 ARG C    1 1 
        4  6114 1 1  28 ARG CA   C   4.219  -3.099   2.857 1.00 . A A .  28 ARG CA   1 1 
        4  6115 1 1  28 ARG CB   C   5.280  -3.873   3.661 1.00 . A A .  28 ARG CB   1 1 
        4  6116 1 1  28 ARG CD   C   5.973  -6.058   4.745 1.00 . A A .  28 ARG CD   1 1 
        4  6117 1 1  28 ARG CG   C   4.829  -5.262   4.122 1.00 . A A .  28 ARG CG   1 1 
        4  6118 1 1  28 ARG CZ   C   6.192  -8.192   5.933 1.00 . A A .  28 ARG CZ   1 1 
        4  6119 1 1  28 ARG H    H   5.128  -1.248   3.403 1.00 . A A .  28 ARG H    1 1 
        4  6120 1 1  28 ARG HA   H   4.148  -3.543   1.872 1.00 . A A .  28 ARG HA   1 1 
        4  6121 1 1  28 ARG HB2  H   6.163  -3.992   3.048 1.00 . A A .  28 ARG HB2  1 1 
        4  6122 1 1  28 ARG HB3  H   5.539  -3.295   4.536 1.00 . A A .  28 ARG HB3  1 1 
        4  6123 1 1  28 ARG HD2  H   6.581  -6.470   3.952 1.00 . A A .  28 ARG HD2  1 1 
        4  6124 1 1  28 ARG HD3  H   6.573  -5.393   5.350 1.00 . A A .  28 ARG HD3  1 1 
        4  6125 1 1  28 ARG HE   H   4.576  -7.072   5.946 1.00 . A A .  28 ARG HE   1 1 
        4  6126 1 1  28 ARG HG2  H   4.043  -5.150   4.856 1.00 . A A .  28 ARG HG2  1 1 
        4  6127 1 1  28 ARG HG3  H   4.448  -5.806   3.268 1.00 . A A .  28 ARG HG3  1 1 
        4  6128 1 1  28 ARG HH11 H   7.772  -7.716   4.828 1.00 . A A .  28 ARG HH11 1 1 
        4  6129 1 1  28 ARG HH12 H   7.913  -9.171   5.744 1.00 . A A .  28 ARG HH12 1 1 
        4  6130 1 1  28 ARG HH21 H   4.777  -8.924   7.118 1.00 . A A .  28 ARG HH21 1 1 
        4  6131 1 1  28 ARG HH22 H   6.230  -9.852   7.021 1.00 . A A .  28 ARG HH22 1 1 
        4  6132 1 1  28 ARG N    N   4.641  -1.700   2.679 1.00 . A A .  28 ARG N    1 1 
        4  6133 1 1  28 ARG NE   N   5.485  -7.151   5.586 1.00 . A A .  28 ARG NE   1 1 
        4  6134 1 1  28 ARG NH1  N   7.384  -8.374   5.465 1.00 . A A .  28 ARG NH1  1 1 
        4  6135 1 1  28 ARG NH2  N   5.695  -9.058   6.753 1.00 . A A .  28 ARG NH2  1 1 
        4  6136 1 1  28 ARG O    O   2.631  -2.677   4.627 1.00 . A A .  28 ARG O    1 1 
        4  6137 1 1  29 LEU C    C   0.571  -5.554   4.176 1.00 . A A .  29 LEU C    1 1 
        4  6138 1 1  29 LEU CA   C   0.590  -4.195   3.450 1.00 . A A .  29 LEU CA   1 1 
        4  6139 1 1  29 LEU CB   C  -0.492  -4.164   2.353 1.00 . A A .  29 LEU CB   1 1 
        4  6140 1 1  29 LEU CD1  C   0.306  -2.110   1.099 1.00 . A A .  29 LEU CD1  1 1 
        4  6141 1 1  29 LEU CD2  C  -2.088  -2.849   0.904 1.00 . A A .  29 LEU CD2  1 1 
        4  6142 1 1  29 LEU CG   C  -0.868  -2.766   1.820 1.00 . A A .  29 LEU CG   1 1 
        4  6143 1 1  29 LEU H    H   2.133  -4.259   1.987 1.00 . A A .  29 LEU H    1 1 
        4  6144 1 1  29 LEU HA   H   0.373  -3.420   4.172 1.00 . A A .  29 LEU HA   1 1 
        4  6145 1 1  29 LEU HB2  H  -0.142  -4.760   1.521 1.00 . A A .  29 LEU HB2  1 1 
        4  6146 1 1  29 LEU HB3  H  -1.386  -4.624   2.749 1.00 . A A .  29 LEU HB3  1 1 
        4  6147 1 1  29 LEU HD11 H   1.138  -2.014   1.781 1.00 . A A .  29 LEU HD11 1 1 
        4  6148 1 1  29 LEU HD12 H   0.015  -1.130   0.750 1.00 . A A .  29 LEU HD12 1 1 
        4  6149 1 1  29 LEU HD13 H   0.601  -2.720   0.256 1.00 . A A .  29 LEU HD13 1 1 
        4  6150 1 1  29 LEU HD21 H  -2.922  -3.266   1.451 1.00 . A A .  29 LEU HD21 1 1 
        4  6151 1 1  29 LEU HD22 H  -1.863  -3.480   0.055 1.00 . A A .  29 LEU HD22 1 1 
        4  6152 1 1  29 LEU HD23 H  -2.347  -1.859   0.557 1.00 . A A .  29 LEU HD23 1 1 
        4  6153 1 1  29 LEU HG   H  -1.130  -2.132   2.656 1.00 . A A .  29 LEU HG   1 1 
        4  6154 1 1  29 LEU N    N   1.918  -3.916   2.882 1.00 . A A .  29 LEU N    1 1 
        4  6155 1 1  29 LEU O    O   1.592  -6.232   4.266 1.00 . A A .  29 LEU O    1 1 
        4  6156 1 1  30 LYS C    C  -2.184  -7.633   5.617 1.00 . A A .  30 LYS C    1 1 
        4  6157 1 1  30 LYS CA   C  -0.720  -7.160   5.507 1.00 . A A .  30 LYS CA   1 1 
        4  6158 1 1  30 LYS CB   C  -0.161  -6.869   6.909 1.00 . A A .  30 LYS CB   1 1 
        4  6159 1 1  30 LYS CD   C   0.398  -7.674   9.231 1.00 . A A .  30 LYS CD   1 1 
        4  6160 1 1  30 LYS CE   C   0.524  -8.874  10.159 1.00 . A A .  30 LYS CE   1 1 
        4  6161 1 1  30 LYS CG   C  -0.109  -8.072   7.845 1.00 . A A .  30 LYS CG   1 1 
        4  6162 1 1  30 LYS H    H  -1.395  -5.401   4.524 1.00 . A A .  30 LYS H    1 1 
        4  6163 1 1  30 LYS HA   H  -0.131  -7.941   5.045 1.00 . A A .  30 LYS HA   1 1 
        4  6164 1 1  30 LYS HB2  H   0.845  -6.486   6.803 1.00 . A A .  30 LYS HB2  1 1 
        4  6165 1 1  30 LYS HB3  H  -0.774  -6.107   7.372 1.00 . A A .  30 LYS HB3  1 1 
        4  6166 1 1  30 LYS HD2  H   1.371  -7.212   9.128 1.00 . A A .  30 LYS HD2  1 1 
        4  6167 1 1  30 LYS HD3  H  -0.292  -6.965   9.666 1.00 . A A .  30 LYS HD3  1 1 
        4  6168 1 1  30 LYS HE2  H   0.830  -8.528  11.135 1.00 . A A .  30 LYS HE2  1 1 
        4  6169 1 1  30 LYS HE3  H  -0.439  -9.358  10.236 1.00 . A A .  30 LYS HE3  1 1 
        4  6170 1 1  30 LYS HG2  H  -1.103  -8.487   7.940 1.00 . A A .  30 LYS HG2  1 1 
        4  6171 1 1  30 LYS HG3  H   0.555  -8.818   7.427 1.00 . A A .  30 LYS HG3  1 1 
        4  6172 1 1  30 LYS HZ1  H   1.554 -10.684  10.298 1.00 . A A .  30 LYS HZ1  1 1 
        4  6173 1 1  30 LYS HZ2  H   2.464  -9.427   9.630 1.00 . A A .  30 LYS HZ2  1 1 
        4  6174 1 1  30 LYS HZ3  H   1.266 -10.181   8.712 1.00 . A A .  30 LYS HZ3  1 1 
        4  6175 1 1  30 LYS N    N  -0.599  -5.947   4.688 1.00 . A A .  30 LYS N    1 1 
        4  6176 1 1  30 LYS NZ   N   1.520  -9.858   9.664 1.00 . A A .  30 LYS NZ   1 1 
        4  6177 1 1  30 LYS O    O  -3.045  -6.900   6.109 1.00 . A A .  30 LYS O    1 1 
        4  6178 1 1  31 ASN C    C  -3.952 -10.229   6.584 1.00 . A A .  31 ASN C    1 1 
        4  6179 1 1  31 ASN CA   C  -3.806  -9.445   5.273 1.00 . A A .  31 ASN CA   1 1 
        4  6180 1 1  31 ASN CB   C  -4.100 -10.366   4.078 1.00 . A A .  31 ASN CB   1 1 
        4  6181 1 1  31 ASN CG   C  -5.468 -11.030   4.167 1.00 . A A .  31 ASN CG   1 1 
        4  6182 1 1  31 ASN H    H  -1.746  -9.376   4.729 1.00 . A A .  31 ASN H    1 1 
        4  6183 1 1  31 ASN HA   H  -4.524  -8.636   5.272 1.00 . A A .  31 ASN HA   1 1 
        4  6184 1 1  31 ASN HB2  H  -4.065  -9.783   3.170 1.00 . A A .  31 ASN HB2  1 1 
        4  6185 1 1  31 ASN HB3  H  -3.345 -11.139   4.031 1.00 . A A .  31 ASN HB3  1 1 
        4  6186 1 1  31 ASN HD21 H  -4.831 -12.577   3.109 1.00 . A A .  31 ASN HD21 1 1 
        4  6187 1 1  31 ASN HD22 H  -6.479 -12.641   3.626 1.00 . A A .  31 ASN HD22 1 1 
        4  6188 1 1  31 ASN N    N  -2.460  -8.856   5.156 1.00 . A A .  31 ASN N    1 1 
        4  6189 1 1  31 ASN ND2  N  -5.606 -12.199   3.573 1.00 . A A .  31 ASN ND2  1 1 
        4  6190 1 1  31 ASN O    O  -3.348 -11.292   6.751 1.00 . A A .  31 ASN O    1 1 
        4  6191 1 1  31 ASN OD1  O  -6.398 -10.492   4.758 1.00 . A A .  31 ASN OD1  1 1 
        4  6192 1 1  32 THR C    C  -6.218 -11.214   8.870 1.00 . A A .  32 THR C    1 1 
        4  6193 1 1  32 THR CA   C  -4.957 -10.333   8.823 1.00 . A A .  32 THR CA   1 1 
        4  6194 1 1  32 THR CB   C  -5.040  -9.262   9.942 1.00 . A A .  32 THR CB   1 1 
        4  6195 1 1  32 THR CG2  C  -3.715  -8.516  10.087 1.00 . A A .  32 THR CG2  1 1 
        4  6196 1 1  32 THR H    H  -5.240  -8.873   7.299 1.00 . A A .  32 THR H    1 1 
        4  6197 1 1  32 THR HA   H  -4.097 -10.959   9.026 1.00 . A A .  32 THR HA   1 1 
        4  6198 1 1  32 THR HB   H  -5.259  -9.756  10.880 1.00 . A A .  32 THR HB   1 1 
        4  6199 1 1  32 THR HG1  H  -5.853  -7.463  10.039 1.00 . A A .  32 THR HG1  1 1 
        4  6200 1 1  32 THR HG21 H  -3.797  -7.784  10.877 1.00 . A A .  32 THR HG21 1 1 
        4  6201 1 1  32 THR HG22 H  -3.477  -8.016   9.158 1.00 . A A .  32 THR HG22 1 1 
        4  6202 1 1  32 THR HG23 H  -2.929  -9.216  10.329 1.00 . A A .  32 THR HG23 1 1 
        4  6203 1 1  32 THR N    N  -4.760  -9.707   7.506 1.00 . A A .  32 THR N    1 1 
        4  6204 1 1  32 THR O    O  -6.661 -11.624   9.945 1.00 . A A .  32 THR O    1 1 
        4  6205 1 1  32 THR OG1  O  -6.086  -8.320   9.658 1.00 . A A .  32 THR OG1  1 1 
        4  6206 1 1  33 SER C    C  -7.647 -13.863   7.734 1.00 . A A .  33 SER C    1 1 
        4  6207 1 1  33 SER CA   C  -7.981 -12.372   7.612 1.00 . A A .  33 SER CA   1 1 
        4  6208 1 1  33 SER CB   C  -8.716 -12.140   6.284 1.00 . A A .  33 SER CB   1 1 
        4  6209 1 1  33 SER H    H  -6.389 -11.159   6.878 1.00 . A A .  33 SER H    1 1 
        4  6210 1 1  33 SER HA   H  -8.641 -12.097   8.423 1.00 . A A .  33 SER HA   1 1 
        4  6211 1 1  33 SER HB2  H  -9.105 -11.133   6.262 1.00 . A A .  33 SER HB2  1 1 
        4  6212 1 1  33 SER HB3  H  -8.025 -12.274   5.463 1.00 . A A .  33 SER HB3  1 1 
        4  6213 1 1  33 SER HG   H -10.278 -12.839   5.312 1.00 . A A .  33 SER HG   1 1 
        4  6214 1 1  33 SER N    N  -6.783 -11.518   7.701 1.00 . A A .  33 SER N    1 1 
        4  6215 1 1  33 SER O    O  -6.521 -14.290   7.473 1.00 . A A .  33 SER O    1 1 
        4  6216 1 1  33 SER OG   O  -9.798 -13.050   6.125 1.00 . A A .  33 SER OG   1 1 
        4  6217 1 1  34 GLU C    C  -8.657 -16.724   6.771 1.00 . A A .  34 GLU C    1 1 
        4  6218 1 1  34 GLU CA   C  -8.520 -16.114   8.177 1.00 . A A .  34 GLU CA   1 1 
        4  6219 1 1  34 GLU CB   C  -9.611 -16.700   9.084 1.00 . A A .  34 GLU CB   1 1 
        4  6220 1 1  34 GLU CD   C -10.872 -16.530  11.273 1.00 . A A .  34 GLU CD   1 1 
        4  6221 1 1  34 GLU CG   C  -9.627 -16.125  10.496 1.00 . A A .  34 GLU CG   1 1 
        4  6222 1 1  34 GLU H    H  -9.496 -14.237   8.388 1.00 . A A .  34 GLU H    1 1 
        4  6223 1 1  34 GLU HA   H  -7.548 -16.361   8.579 1.00 . A A .  34 GLU HA   1 1 
        4  6224 1 1  34 GLU HB2  H -10.574 -16.509   8.631 1.00 . A A .  34 GLU HB2  1 1 
        4  6225 1 1  34 GLU HB3  H  -9.466 -17.769   9.156 1.00 . A A .  34 GLU HB3  1 1 
        4  6226 1 1  34 GLU HG2  H  -8.754 -16.478  11.027 1.00 . A A .  34 GLU HG2  1 1 
        4  6227 1 1  34 GLU HG3  H  -9.594 -15.046  10.433 1.00 . A A .  34 GLU HG3  1 1 
        4  6228 1 1  34 GLU N    N  -8.646 -14.650   8.124 1.00 . A A .  34 GLU N    1 1 
        4  6229 1 1  34 GLU O    O  -8.343 -17.896   6.553 1.00 . A A .  34 GLU O    1 1 
        4  6230 1 1  34 GLU OE1  O -11.909 -15.838  11.147 1.00 . A A .  34 GLU OE1  1 1 
        4  6231 1 1  34 GLU OE2  O -10.831 -17.548  11.997 1.00 . A A .  34 GLU OE2  1 1 
        4  6232 1 1  35 GLN C    C  -8.513 -15.696   3.427 1.00 . A A .  35 GLN C    1 1 
        4  6233 1 1  35 GLN CA   C  -9.418 -16.383   4.462 1.00 . A A .  35 GLN CA   1 1 
        4  6234 1 1  35 GLN CB   C -10.895 -16.116   4.123 1.00 . A A .  35 GLN CB   1 1 
        4  6235 1 1  35 GLN CD   C -12.750 -16.213   2.385 1.00 . A A .  35 GLN CD   1 1 
        4  6236 1 1  35 GLN CG   C -11.297 -16.524   2.706 1.00 . A A .  35 GLN CG   1 1 
        4  6237 1 1  35 GLN H    H  -9.295 -14.975   6.045 1.00 . A A .  35 GLN H    1 1 
        4  6238 1 1  35 GLN HA   H  -9.240 -17.449   4.428 1.00 . A A .  35 GLN HA   1 1 
        4  6239 1 1  35 GLN HB2  H -11.514 -16.662   4.819 1.00 . A A .  35 GLN HB2  1 1 
        4  6240 1 1  35 GLN HB3  H -11.091 -15.058   4.238 1.00 . A A .  35 GLN HB3  1 1 
        4  6241 1 1  35 GLN HE21 H -12.319 -15.978   0.468 1.00 . A A .  35 GLN HE21 1 1 
        4  6242 1 1  35 GLN HE22 H -13.975 -15.757   0.902 1.00 . A A .  35 GLN HE22 1 1 
        4  6243 1 1  35 GLN HG2  H -10.670 -15.998   2.002 1.00 . A A .  35 GLN HG2  1 1 
        4  6244 1 1  35 GLN HG3  H -11.141 -17.589   2.596 1.00 . A A .  35 GLN HG3  1 1 
        4  6245 1 1  35 GLN N    N  -9.135 -15.918   5.824 1.00 . A A .  35 GLN N    1 1 
        4  6246 1 1  35 GLN NE2  N -13.042 -15.955   1.126 1.00 . A A .  35 GLN NE2  1 1 
        4  6247 1 1  35 GLN O    O  -8.095 -14.548   3.605 1.00 . A A .  35 GLN O    1 1 
        4  6248 1 1  35 GLN OE1  O -13.609 -16.211   3.261 1.00 . A A .  35 GLN OE1  1 1 
        4  6249 1 1  36 ASP C    C  -8.355 -14.860   0.438 1.00 . A A .  36 ASP C    1 1 
        4  6250 1 1  36 ASP CA   C  -7.463 -15.844   1.225 1.00 . A A .  36 ASP CA   1 1 
        4  6251 1 1  36 ASP CB   C  -6.962 -16.969   0.312 1.00 . A A .  36 ASP CB   1 1 
        4  6252 1 1  36 ASP CG   C  -6.258 -18.069   1.095 1.00 . A A .  36 ASP CG   1 1 
        4  6253 1 1  36 ASP H    H  -8.487 -17.354   2.308 1.00 . A A .  36 ASP H    1 1 
        4  6254 1 1  36 ASP HA   H  -6.613 -15.306   1.625 1.00 . A A .  36 ASP HA   1 1 
        4  6255 1 1  36 ASP HB2  H  -7.802 -17.401  -0.215 1.00 . A A .  36 ASP HB2  1 1 
        4  6256 1 1  36 ASP HB3  H  -6.266 -16.558  -0.407 1.00 . A A .  36 ASP HB3  1 1 
        4  6257 1 1  36 ASP N    N  -8.209 -16.413   2.347 1.00 . A A .  36 ASP N    1 1 
        4  6258 1 1  36 ASP O    O  -9.290 -15.270  -0.255 1.00 . A A .  36 ASP O    1 1 
        4  6259 1 1  36 ASP OD1  O  -5.072 -17.897   1.442 1.00 . A A .  36 ASP OD1  1 1 
        4  6260 1 1  36 ASP OD2  O  -6.894 -19.106   1.374 1.00 . A A .  36 ASP OD2  1 1 
        4  6261 1 1  37 GLN C    C  -8.560 -12.117  -1.423 1.00 . A A .  37 GLN C    1 1 
        4  6262 1 1  37 GLN CA   C  -8.930 -12.510   0.020 1.00 . A A .  37 GLN CA   1 1 
        4  6263 1 1  37 GLN CB   C  -8.849 -11.270   0.927 1.00 . A A .  37 GLN CB   1 1 
        4  6264 1 1  37 GLN CD   C -10.627 -12.001   2.606 1.00 . A A .  37 GLN CD   1 1 
        4  6265 1 1  37 GLN CG   C  -9.189 -11.548   2.390 1.00 . A A .  37 GLN CG   1 1 
        4  6266 1 1  37 GLN H    H  -7.223 -13.311   0.997 1.00 . A A .  37 GLN H    1 1 
        4  6267 1 1  37 GLN HA   H  -9.947 -12.881   0.032 1.00 . A A .  37 GLN HA   1 1 
        4  6268 1 1  37 GLN HB2  H  -7.843 -10.876   0.884 1.00 . A A .  37 GLN HB2  1 1 
        4  6269 1 1  37 GLN HB3  H  -9.534 -10.515   0.556 1.00 . A A .  37 GLN HB3  1 1 
        4  6270 1 1  37 GLN HE21 H -11.261 -10.900   1.086 1.00 . A A .  37 GLN HE21 1 1 
        4  6271 1 1  37 GLN HE22 H -12.470 -11.800   1.926 1.00 . A A .  37 GLN HE22 1 1 
        4  6272 1 1  37 GLN HG2  H  -8.531 -12.323   2.754 1.00 . A A .  37 GLN HG2  1 1 
        4  6273 1 1  37 GLN HG3  H  -9.023 -10.644   2.962 1.00 . A A .  37 GLN HG3  1 1 
        4  6274 1 1  37 GLN N    N  -8.059 -13.567   0.553 1.00 . A A .  37 GLN N    1 1 
        4  6275 1 1  37 GLN NE2  N -11.543 -11.519   1.787 1.00 . A A .  37 GLN NE2  1 1 
        4  6276 1 1  37 GLN O    O  -7.443 -11.670  -1.684 1.00 . A A .  37 GLN O    1 1 
        4  6277 1 1  37 GLN OE1  O -10.917 -12.767   3.515 1.00 . A A .  37 GLN OE1  1 1 
        4  6278 1 1  38 PRO C    C  -9.162 -10.279  -3.847 1.00 . A A .  38 PRO C    1 1 
        4  6279 1 1  38 PRO CA   C  -9.282 -11.813  -3.768 1.00 . A A .  38 PRO CA   1 1 
        4  6280 1 1  38 PRO CB   C -10.534 -12.313  -4.511 1.00 . A A .  38 PRO CB   1 1 
        4  6281 1 1  38 PRO CD   C -10.809 -12.921  -2.211 1.00 . A A .  38 PRO CD   1 1 
        4  6282 1 1  38 PRO CG   C -11.563 -12.505  -3.446 1.00 . A A .  38 PRO CG   1 1 
        4  6283 1 1  38 PRO HA   H  -8.398 -12.260  -4.201 1.00 . A A .  38 PRO HA   1 1 
        4  6284 1 1  38 PRO HB2  H -10.848 -11.579  -5.242 1.00 . A A .  38 PRO HB2  1 1 
        4  6285 1 1  38 PRO HB3  H -10.307 -13.245  -5.011 1.00 . A A .  38 PRO HB3  1 1 
        4  6286 1 1  38 PRO HD2  H -11.304 -12.555  -1.322 1.00 . A A .  38 PRO HD2  1 1 
        4  6287 1 1  38 PRO HD3  H -10.705 -13.996  -2.170 1.00 . A A .  38 PRO HD3  1 1 
        4  6288 1 1  38 PRO HG2  H -12.088 -11.576  -3.270 1.00 . A A .  38 PRO HG2  1 1 
        4  6289 1 1  38 PRO HG3  H -12.258 -13.278  -3.740 1.00 . A A .  38 PRO HG3  1 1 
        4  6290 1 1  38 PRO N    N  -9.492 -12.276  -2.385 1.00 . A A .  38 PRO N    1 1 
        4  6291 1 1  38 PRO O    O  -9.932  -9.557  -3.213 1.00 . A A .  38 PRO O    1 1 
        4  6292 1 1  39 MET C    C  -9.151  -7.543  -5.188 1.00 . A A .  39 MET C    1 1 
        4  6293 1 1  39 MET CA   C  -7.923  -8.342  -4.700 1.00 . A A .  39 MET CA   1 1 
        4  6294 1 1  39 MET CB   C  -6.721  -8.082  -5.620 1.00 . A A .  39 MET CB   1 1 
        4  6295 1 1  39 MET CE   C  -6.475  -5.947  -2.907 1.00 . A A .  39 MET CE   1 1 
        4  6296 1 1  39 MET CG   C  -6.226  -6.633  -5.631 1.00 . A A .  39 MET CG   1 1 
        4  6297 1 1  39 MET H    H  -7.642 -10.405  -5.147 1.00 . A A .  39 MET H    1 1 
        4  6298 1 1  39 MET HA   H  -7.670  -8.009  -3.703 1.00 . A A .  39 MET HA   1 1 
        4  6299 1 1  39 MET HB2  H  -5.902  -8.712  -5.302 1.00 . A A .  39 MET HB2  1 1 
        4  6300 1 1  39 MET HB3  H  -6.993  -8.351  -6.631 1.00 . A A .  39 MET HB3  1 1 
        4  6301 1 1  39 MET HE1  H  -5.993  -5.652  -1.987 1.00 . A A .  39 MET HE1  1 1 
        4  6302 1 1  39 MET HE2  H  -7.017  -6.868  -2.749 1.00 . A A .  39 MET HE2  1 1 
        4  6303 1 1  39 MET HE3  H  -7.160  -5.174  -3.218 1.00 . A A .  39 MET HE3  1 1 
        4  6304 1 1  39 MET HG2  H  -5.621  -6.482  -6.512 1.00 . A A .  39 MET HG2  1 1 
        4  6305 1 1  39 MET HG3  H  -7.083  -5.974  -5.674 1.00 . A A .  39 MET HG3  1 1 
        4  6306 1 1  39 MET N    N  -8.194  -9.787  -4.623 1.00 . A A .  39 MET N    1 1 
        4  6307 1 1  39 MET O    O  -9.448  -6.464  -4.668 1.00 . A A .  39 MET O    1 1 
        4  6308 1 1  39 MET SD   S  -5.234  -6.192  -4.178 1.00 . A A .  39 MET SD   1 1 
        4  6309 1 1  40 GLY C    C -10.748  -6.157  -7.535 1.00 . A A .  40 GLY C    1 1 
        4  6310 1 1  40 GLY CA   C -11.053  -7.415  -6.716 1.00 . A A .  40 GLY CA   1 1 
        4  6311 1 1  40 GLY H    H  -9.562  -8.924  -6.575 1.00 . A A .  40 GLY H    1 1 
        4  6312 1 1  40 GLY HA2  H -11.581  -8.117  -7.346 1.00 . A A .  40 GLY HA2  1 1 
        4  6313 1 1  40 GLY HA3  H -11.696  -7.146  -5.889 1.00 . A A .  40 GLY HA3  1 1 
        4  6314 1 1  40 GLY N    N  -9.854  -8.075  -6.190 1.00 . A A .  40 GLY N    1 1 
        4  6315 1 1  40 GLY O    O -10.969  -6.128  -8.747 1.00 . A A .  40 GLY O    1 1 
        4  6316 1 1  41 GLY C    C -10.001  -2.655  -6.653 1.00 . A A .  41 GLY C    1 1 
        4  6317 1 1  41 GLY CA   C  -9.902  -3.876  -7.559 1.00 . A A .  41 GLY CA   1 1 
        4  6318 1 1  41 GLY H    H -10.090  -5.199  -5.908 1.00 . A A .  41 GLY H    1 1 
        4  6319 1 1  41 GLY HA2  H  -8.890  -3.952  -7.931 1.00 . A A .  41 GLY HA2  1 1 
        4  6320 1 1  41 GLY HA3  H -10.570  -3.740  -8.399 1.00 . A A .  41 GLY HA3  1 1 
        4  6321 1 1  41 GLY N    N -10.241  -5.119  -6.874 1.00 . A A .  41 GLY N    1 1 
        4  6322 1 1  41 GLY O    O -10.982  -1.911  -6.703 1.00 . A A .  41 GLY O    1 1 
        4  6323 1 1  42 TRP C    C  -8.098  -0.169  -5.426 1.00 . A A .  42 TRP C    1 1 
        4  6324 1 1  42 TRP CA   C  -8.959  -1.318  -4.876 1.00 . A A .  42 TRP CA   1 1 
        4  6325 1 1  42 TRP CB   C  -8.387  -1.756  -3.514 1.00 . A A .  42 TRP CB   1 1 
        4  6326 1 1  42 TRP CD1  C -10.182  -3.599  -3.328 1.00 . A A .  42 TRP CD1  1 1 
        4  6327 1 1  42 TRP CD2  C  -8.859  -3.404  -1.533 1.00 . A A .  42 TRP CD2  1 1 
        4  6328 1 1  42 TRP CE2  C  -9.777  -4.443  -1.302 1.00 . A A .  42 TRP CE2  1 1 
        4  6329 1 1  42 TRP CE3  C  -7.921  -3.098  -0.539 1.00 . A A .  42 TRP CE3  1 1 
        4  6330 1 1  42 TRP CG   C  -9.130  -2.877  -2.838 1.00 . A A .  42 TRP CG   1 1 
        4  6331 1 1  42 TRP CH2  C  -8.863  -4.857   0.836 1.00 . A A .  42 TRP CH2  1 1 
        4  6332 1 1  42 TRP CZ2  C  -9.792  -5.174  -0.117 1.00 . A A .  42 TRP CZ2  1 1 
        4  6333 1 1  42 TRP CZ3  C  -7.935  -3.826   0.636 1.00 . A A .  42 TRP CZ3  1 1 
        4  6334 1 1  42 TRP H    H  -8.232  -3.076  -5.828 1.00 . A A .  42 TRP H    1 1 
        4  6335 1 1  42 TRP HA   H  -9.972  -0.967  -4.738 1.00 . A A .  42 TRP HA   1 1 
        4  6336 1 1  42 TRP HB2  H  -7.367  -2.082  -3.651 1.00 . A A .  42 TRP HB2  1 1 
        4  6337 1 1  42 TRP HB3  H  -8.395  -0.906  -2.845 1.00 . A A .  42 TRP HB3  1 1 
        4  6338 1 1  42 TRP HD1  H -10.628  -3.443  -4.300 1.00 . A A .  42 TRP HD1  1 1 
        4  6339 1 1  42 TRP HE1  H -11.306  -5.182  -2.530 1.00 . A A .  42 TRP HE1  1 1 
        4  6340 1 1  42 TRP HE3  H  -7.196  -2.308  -0.677 1.00 . A A .  42 TRP HE3  1 1 
        4  6341 1 1  42 TRP HH2  H  -8.839  -5.401   1.771 1.00 . A A .  42 TRP HH2  1 1 
        4  6342 1 1  42 TRP HZ2  H -10.499  -5.970   0.051 1.00 . A A .  42 TRP HZ2  1 1 
        4  6343 1 1  42 TRP HZ3  H  -7.217  -3.603   1.416 1.00 . A A .  42 TRP HZ3  1 1 
        4  6344 1 1  42 TRP N    N  -8.987  -2.454  -5.813 1.00 . A A .  42 TRP N    1 1 
        4  6345 1 1  42 TRP NE1  N -10.576  -4.540  -2.410 1.00 . A A .  42 TRP NE1  1 1 
        4  6346 1 1  42 TRP O    O  -7.532  -0.272  -6.517 1.00 . A A .  42 TRP O    1 1 
        4  6347 1 1  43 GLU C    C  -6.626   2.760  -3.729 1.00 . A A .  43 GLU C    1 1 
        4  6348 1 1  43 GLU CA   C  -7.069   2.005  -4.992 1.00 . A A .  43 GLU CA   1 1 
        4  6349 1 1  43 GLU CB   C  -7.675   2.980  -6.015 1.00 . A A .  43 GLU CB   1 1 
        4  6350 1 1  43 GLU CD   C  -7.182   4.848  -7.680 1.00 . A A .  43 GLU CD   1 1 
        4  6351 1 1  43 GLU CG   C  -6.685   4.043  -6.490 1.00 . A A .  43 GLU CG   1 1 
        4  6352 1 1  43 GLU H    H  -8.562   0.998  -3.863 1.00 . A A .  43 GLU H    1 1 
        4  6353 1 1  43 GLU HA   H  -6.190   1.550  -5.432 1.00 . A A .  43 GLU HA   1 1 
        4  6354 1 1  43 GLU HB2  H  -8.014   2.419  -6.875 1.00 . A A .  43 GLU HB2  1 1 
        4  6355 1 1  43 GLU HB3  H  -8.521   3.481  -5.567 1.00 . A A .  43 GLU HB3  1 1 
        4  6356 1 1  43 GLU HG2  H  -6.493   4.722  -5.671 1.00 . A A .  43 GLU HG2  1 1 
        4  6357 1 1  43 GLU HG3  H  -5.760   3.554  -6.766 1.00 . A A .  43 GLU HG3  1 1 
        4  6358 1 1  43 GLU N    N  -7.998   0.918  -4.663 1.00 . A A .  43 GLU N    1 1 
        4  6359 1 1  43 GLU O    O  -7.443   3.162  -2.899 1.00 . A A .  43 GLU O    1 1 
        4  6360 1 1  43 GLU OE1  O  -7.081   4.355  -8.822 1.00 . A A .  43 GLU OE1  1 1 
        4  6361 1 1  43 GLU OE2  O  -7.663   5.982  -7.485 1.00 . A A .  43 GLU OE2  1 1 
        4  6362 1 1  44 MET C    C  -4.406   5.076  -2.731 1.00 . A A .  44 MET C    1 1 
        4  6363 1 1  44 MET CA   C  -4.738   3.607  -2.429 1.00 . A A .  44 MET CA   1 1 
        4  6364 1 1  44 MET CB   C  -3.478   2.848  -1.989 1.00 . A A .  44 MET CB   1 1 
        4  6365 1 1  44 MET CE   C  -0.376   2.325  -1.640 1.00 . A A .  44 MET CE   1 1 
        4  6366 1 1  44 MET CG   C  -2.774   3.455  -0.786 1.00 . A A .  44 MET CG   1 1 
        4  6367 1 1  44 MET H    H  -4.723   2.611  -4.297 1.00 . A A .  44 MET H    1 1 
        4  6368 1 1  44 MET HA   H  -5.463   3.573  -1.626 1.00 . A A .  44 MET HA   1 1 
        4  6369 1 1  44 MET HB2  H  -3.753   1.833  -1.740 1.00 . A A .  44 MET HB2  1 1 
        4  6370 1 1  44 MET HB3  H  -2.780   2.826  -2.814 1.00 . A A .  44 MET HB3  1 1 
        4  6371 1 1  44 MET HE1  H  -0.916   1.837  -2.438 1.00 . A A .  44 MET HE1  1 1 
        4  6372 1 1  44 MET HE2  H   0.512   1.757  -1.407 1.00 . A A .  44 MET HE2  1 1 
        4  6373 1 1  44 MET HE3  H  -0.097   3.321  -1.951 1.00 . A A .  44 MET HE3  1 1 
        4  6374 1 1  44 MET HG2  H  -2.376   4.421  -1.064 1.00 . A A .  44 MET HG2  1 1 
        4  6375 1 1  44 MET HG3  H  -3.493   3.580   0.012 1.00 . A A .  44 MET HG3  1 1 
        4  6376 1 1  44 MET N    N  -5.319   2.941  -3.593 1.00 . A A .  44 MET N    1 1 
        4  6377 1 1  44 MET O    O  -3.503   5.364  -3.513 1.00 . A A .  44 MET O    1 1 
        4  6378 1 1  44 MET SD   S  -1.419   2.423  -0.186 1.00 . A A .  44 MET SD   1 1 
        4  6379 1 1  45 ILE C    C  -3.905   7.975  -1.284 1.00 . A A .  45 ILE C    1 1 
        4  6380 1 1  45 ILE CA   C  -4.926   7.438  -2.302 1.00 . A A .  45 ILE CA   1 1 
        4  6381 1 1  45 ILE CB   C  -6.255   8.249  -2.184 1.00 . A A .  45 ILE CB   1 1 
        4  6382 1 1  45 ILE CD1  C  -7.840   6.487  -3.203 1.00 . A A .  45 ILE CD1  1 1 
        4  6383 1 1  45 ILE CG1  C  -7.242   7.878  -3.317 1.00 . A A .  45 ILE CG1  1 1 
        4  6384 1 1  45 ILE CG2  C  -5.978   9.753  -2.192 1.00 . A A .  45 ILE CG2  1 1 
        4  6385 1 1  45 ILE H    H  -5.839   5.699  -1.484 1.00 . A A .  45 ILE H    1 1 
        4  6386 1 1  45 ILE HA   H  -4.528   7.584  -3.300 1.00 . A A .  45 ILE HA   1 1 
        4  6387 1 1  45 ILE HB   H  -6.709   8.004  -1.232 1.00 . A A .  45 ILE HB   1 1 
        4  6388 1 1  45 ILE HD11 H  -8.366   6.397  -2.263 1.00 . A A .  45 ILE HD11 1 1 
        4  6389 1 1  45 ILE HD12 H  -7.053   5.750  -3.247 1.00 . A A .  45 ILE HD12 1 1 
        4  6390 1 1  45 ILE HD13 H  -8.532   6.326  -4.017 1.00 . A A .  45 ILE HD13 1 1 
        4  6391 1 1  45 ILE HG12 H  -8.060   8.583  -3.318 1.00 . A A .  45 ILE HG12 1 1 
        4  6392 1 1  45 ILE HG13 H  -6.727   7.939  -4.265 1.00 . A A .  45 ILE HG13 1 1 
        4  6393 1 1  45 ILE HG21 H  -6.910  10.293  -2.104 1.00 . A A .  45 ILE HG21 1 1 
        4  6394 1 1  45 ILE HG22 H  -5.491  10.025  -3.118 1.00 . A A .  45 ILE HG22 1 1 
        4  6395 1 1  45 ILE HG23 H  -5.335  10.007  -1.361 1.00 . A A .  45 ILE HG23 1 1 
        4  6396 1 1  45 ILE N    N  -5.142   5.996  -2.108 1.00 . A A .  45 ILE N    1 1 
        4  6397 1 1  45 ILE O    O  -3.900   7.566  -0.128 1.00 . A A .  45 ILE O    1 1 
        4  6398 1 1  46 ARG C    C  -1.796  10.919  -0.981 1.00 . A A .  46 ARG C    1 1 
        4  6399 1 1  46 ARG CA   C  -1.968   9.395  -0.844 1.00 . A A .  46 ARG CA   1 1 
        4  6400 1 1  46 ARG CB   C  -0.662   8.679  -1.203 1.00 . A A .  46 ARG CB   1 1 
        4  6401 1 1  46 ARG CD   C   1.734   8.178  -0.646 1.00 . A A .  46 ARG CD   1 1 
        4  6402 1 1  46 ARG CG   C   0.463   8.886  -0.200 1.00 . A A .  46 ARG CG   1 1 
        4  6403 1 1  46 ARG CZ   C   3.928   7.616   0.253 1.00 . A A .  46 ARG CZ   1 1 
        4  6404 1 1  46 ARG H    H  -3.113   9.230  -2.628 1.00 . A A .  46 ARG H    1 1 
        4  6405 1 1  46 ARG HA   H  -2.227   9.163   0.180 1.00 . A A .  46 ARG HA   1 1 
        4  6406 1 1  46 ARG HB2  H  -0.857   7.618  -1.273 1.00 . A A .  46 ARG HB2  1 1 
        4  6407 1 1  46 ARG HB3  H  -0.324   9.034  -2.167 1.00 . A A .  46 ARG HB3  1 1 
        4  6408 1 1  46 ARG HD2  H   1.489   7.157  -0.907 1.00 . A A .  46 ARG HD2  1 1 
        4  6409 1 1  46 ARG HD3  H   2.127   8.685  -1.516 1.00 . A A .  46 ARG HD3  1 1 
        4  6410 1 1  46 ARG HE   H   2.533   8.575   1.253 1.00 . A A .  46 ARG HE   1 1 
        4  6411 1 1  46 ARG HG2  H   0.664   9.943  -0.107 1.00 . A A .  46 ARG HG2  1 1 
        4  6412 1 1  46 ARG HG3  H   0.157   8.489   0.759 1.00 . A A .  46 ARG HG3  1 1 
        4  6413 1 1  46 ARG HH11 H   3.645   7.129  -1.663 1.00 . A A .  46 ARG HH11 1 1 
        4  6414 1 1  46 ARG HH12 H   5.166   6.671  -0.987 1.00 . A A .  46 ARG HH12 1 1 
        4  6415 1 1  46 ARG HH21 H   4.508   8.008   2.116 1.00 . A A .  46 ARG HH21 1 1 
        4  6416 1 1  46 ARG HH22 H   5.660   7.181   1.132 1.00 . A A .  46 ARG HH22 1 1 
        4  6417 1 1  46 ARG N    N  -3.040   8.892  -1.710 1.00 . A A .  46 ARG N    1 1 
        4  6418 1 1  46 ARG NE   N   2.756   8.164   0.396 1.00 . A A .  46 ARG NE   1 1 
        4  6419 1 1  46 ARG NH1  N   4.277   7.101  -0.886 1.00 . A A .  46 ARG NH1  1 1 
        4  6420 1 1  46 ARG NH2  N   4.762   7.600   1.244 1.00 . A A .  46 ARG NH2  1 1 
        4  6421 1 1  46 ARG O    O  -1.620  11.434  -2.085 1.00 . A A .  46 ARG O    1 1 
        4  6422 1 1  47 LYS C    C  -0.386  13.525   0.821 1.00 . A A .  47 LYS C    1 1 
        4  6423 1 1  47 LYS CA   C  -1.702  13.095   0.152 1.00 . A A .  47 LYS CA   1 1 
        4  6424 1 1  47 LYS CB   C  -2.878  13.744   0.892 1.00 . A A .  47 LYS CB   1 1 
        4  6425 1 1  47 LYS CD   C  -5.368  14.143   1.048 1.00 . A A .  47 LYS CD   1 1 
        4  6426 1 1  47 LYS CE   C  -5.362  13.846   2.545 1.00 . A A .  47 LYS CE   1 1 
        4  6427 1 1  47 LYS CG   C  -4.251  13.403   0.315 1.00 . A A .  47 LYS CG   1 1 
        4  6428 1 1  47 LYS H    H  -1.962  11.159   1.001 1.00 . A A .  47 LYS H    1 1 
        4  6429 1 1  47 LYS HA   H  -1.700  13.438  -0.874 1.00 . A A .  47 LYS HA   1 1 
        4  6430 1 1  47 LYS HB2  H  -2.859  13.422   1.924 1.00 . A A .  47 LYS HB2  1 1 
        4  6431 1 1  47 LYS HB3  H  -2.758  14.819   0.861 1.00 . A A .  47 LYS HB3  1 1 
        4  6432 1 1  47 LYS HD2  H  -5.238  15.206   0.902 1.00 . A A .  47 LYS HD2  1 1 
        4  6433 1 1  47 LYS HD3  H  -6.321  13.839   0.633 1.00 . A A .  47 LYS HD3  1 1 
        4  6434 1 1  47 LYS HE2  H  -5.553  12.793   2.694 1.00 . A A .  47 LYS HE2  1 1 
        4  6435 1 1  47 LYS HE3  H  -4.390  14.096   2.951 1.00 . A A .  47 LYS HE3  1 1 
        4  6436 1 1  47 LYS HG2  H  -4.272  13.682  -0.729 1.00 . A A .  47 LYS HG2  1 1 
        4  6437 1 1  47 LYS HG3  H  -4.415  12.338   0.406 1.00 . A A .  47 LYS HG3  1 1 
        4  6438 1 1  47 LYS HZ1  H  -7.350  14.314   2.987 1.00 . A A .  47 LYS HZ1  1 1 
        4  6439 1 1  47 LYS HZ2  H  -6.301  15.640   3.057 1.00 . A A .  47 LYS HZ2  1 1 
        4  6440 1 1  47 LYS HZ3  H  -6.294  14.491   4.294 1.00 . A A .  47 LYS HZ3  1 1 
        4  6441 1 1  47 LYS N    N  -1.842  11.630   0.147 1.00 . A A .  47 LYS N    1 1 
        4  6442 1 1  47 LYS NZ   N  -6.399  14.627   3.270 1.00 . A A .  47 LYS NZ   1 1 
        4  6443 1 1  47 LYS O    O   0.068  12.895   1.777 1.00 . A A .  47 LYS O    1 1 
        4  6444 1 1  48 ILE C    C   1.452  16.657   1.017 1.00 . A A .  48 ILE C    1 1 
        4  6445 1 1  48 ILE CA   C   1.475  15.123   0.870 1.00 . A A .  48 ILE CA   1 1 
        4  6446 1 1  48 ILE CB   C   2.682  14.699  -0.012 1.00 . A A .  48 ILE CB   1 1 
        4  6447 1 1  48 ILE CD1  C   5.242  14.747  -0.148 1.00 . A A .  48 ILE CD1  1 1 
        4  6448 1 1  48 ILE CG1  C   4.002  15.234   0.576 1.00 . A A .  48 ILE CG1  1 1 
        4  6449 1 1  48 ILE CG2  C   2.499  15.168  -1.457 1.00 . A A .  48 ILE CG2  1 1 
        4  6450 1 1  48 ILE H    H  -0.198  15.063  -0.442 1.00 . A A .  48 ILE H    1 1 
        4  6451 1 1  48 ILE HA   H   1.610  14.686   1.852 1.00 . A A .  48 ILE HA   1 1 
        4  6452 1 1  48 ILE HB   H   2.720  13.618  -0.021 1.00 . A A .  48 ILE HB   1 1 
        4  6453 1 1  48 ILE HD11 H   5.213  15.073  -1.178 1.00 . A A .  48 ILE HD11 1 1 
        4  6454 1 1  48 ILE HD12 H   5.280  13.668  -0.112 1.00 . A A .  48 ILE HD12 1 1 
        4  6455 1 1  48 ILE HD13 H   6.119  15.153   0.332 1.00 . A A .  48 ILE HD13 1 1 
        4  6456 1 1  48 ILE HG12 H   4.001  16.313   0.532 1.00 . A A .  48 ILE HG12 1 1 
        4  6457 1 1  48 ILE HG13 H   4.079  14.923   1.609 1.00 . A A .  48 ILE HG13 1 1 
        4  6458 1 1  48 ILE HG21 H   3.336  14.838  -2.054 1.00 . A A .  48 ILE HG21 1 1 
        4  6459 1 1  48 ILE HG22 H   2.442  16.246  -1.484 1.00 . A A .  48 ILE HG22 1 1 
        4  6460 1 1  48 ILE HG23 H   1.585  14.751  -1.857 1.00 . A A .  48 ILE HG23 1 1 
        4  6461 1 1  48 ILE N    N   0.213  14.605   0.319 1.00 . A A .  48 ILE N    1 1 
        4  6462 1 1  48 ILE O    O   1.914  17.207   2.019 1.00 . A A .  48 ILE O    1 1 
        4  6463 1 1  49 GLY C    C   0.500  19.383  -1.320 1.00 . A A .  49 GLY C    1 1 
        4  6464 1 1  49 GLY CA   C   0.856  18.797   0.038 1.00 . A A .  49 GLY CA   1 1 
        4  6465 1 1  49 GLY H    H   0.516  16.854  -0.738 1.00 . A A .  49 GLY H    1 1 
        4  6466 1 1  49 GLY HA2  H   0.116  19.113   0.759 1.00 . A A .  49 GLY HA2  1 1 
        4  6467 1 1  49 GLY HA3  H   1.822  19.179   0.340 1.00 . A A .  49 GLY HA3  1 1 
        4  6468 1 1  49 GLY N    N   0.901  17.341   0.019 1.00 . A A .  49 GLY N    1 1 
        4  6469 1 1  49 GLY O    O   1.331  19.396  -2.232 1.00 . A A .  49 GLY O    1 1 
        4  6470 1 1  50 ASP C    C  -1.493  19.372  -3.815 1.00 . A A .  50 ASP C    1 1 
        4  6471 1 1  50 ASP CA   C  -1.271  20.424  -2.706 1.00 . A A .  50 ASP CA   1 1 
        4  6472 1 1  50 ASP CB   C  -0.357  21.553  -3.204 1.00 . A A .  50 ASP CB   1 1 
        4  6473 1 1  50 ASP CG   C  -0.211  22.659  -2.175 1.00 . A A .  50 ASP CG   1 1 
        4  6474 1 1  50 ASP H    H  -1.356  19.767  -0.687 1.00 . A A .  50 ASP H    1 1 
        4  6475 1 1  50 ASP HA   H  -2.235  20.852  -2.467 1.00 . A A .  50 ASP HA   1 1 
        4  6476 1 1  50 ASP HB2  H   0.620  21.147  -3.422 1.00 . A A .  50 ASP HB2  1 1 
        4  6477 1 1  50 ASP HB3  H  -0.775  21.977  -4.110 1.00 . A A .  50 ASP HB3  1 1 
        4  6478 1 1  50 ASP N    N  -0.752  19.832  -1.458 1.00 . A A .  50 ASP N    1 1 
        4  6479 1 1  50 ASP O    O  -2.446  19.473  -4.592 1.00 . A A .  50 ASP O    1 1 
        4  6480 1 1  50 ASP OD1  O  -1.225  23.306  -1.849 1.00 . A A .  50 ASP OD1  1 1 
        4  6481 1 1  50 ASP OD2  O   0.911  22.872  -1.669 1.00 . A A .  50 ASP OD2  1 1 
        4  6482 1 1  51 THR C    C  -1.015  15.934  -4.158 1.00 . A A .  51 THR C    1 1 
        4  6483 1 1  51 THR CA   C  -0.748  17.276  -4.860 1.00 . A A .  51 THR CA   1 1 
        4  6484 1 1  51 THR CB   C   0.519  17.139  -5.742 1.00 . A A .  51 THR CB   1 1 
        4  6485 1 1  51 THR CG2  C   1.767  16.924  -4.888 1.00 . A A .  51 THR CG2  1 1 
        4  6486 1 1  51 THR H    H   0.150  18.373  -3.284 1.00 . A A .  51 THR H    1 1 
        4  6487 1 1  51 THR HA   H  -1.586  17.502  -5.508 1.00 . A A .  51 THR HA   1 1 
        4  6488 1 1  51 THR HB   H   0.644  18.054  -6.305 1.00 . A A .  51 THR HB   1 1 
        4  6489 1 1  51 THR HG1  H   1.245  15.681  -6.872 1.00 . A A .  51 THR HG1  1 1 
        4  6490 1 1  51 THR HG21 H   2.634  16.839  -5.528 1.00 . A A .  51 THR HG21 1 1 
        4  6491 1 1  51 THR HG22 H   1.658  16.017  -4.308 1.00 . A A .  51 THR HG22 1 1 
        4  6492 1 1  51 THR HG23 H   1.897  17.762  -4.218 1.00 . A A .  51 THR HG23 1 1 
        4  6493 1 1  51 THR N    N  -0.613  18.373  -3.890 1.00 . A A .  51 THR N    1 1 
        4  6494 1 1  51 THR O    O  -0.551  15.701  -3.036 1.00 . A A .  51 THR O    1 1 
        4  6495 1 1  51 THR OG1  O   0.371  16.046  -6.664 1.00 . A A .  51 THR OG1  1 1 
        4  6496 1 1  52 SER C    C  -1.949  12.650  -5.371 1.00 . A A .  52 SER C    1 1 
        4  6497 1 1  52 SER CA   C  -2.081  13.726  -4.288 1.00 . A A .  52 SER CA   1 1 
        4  6498 1 1  52 SER CB   C  -3.504  13.695  -3.706 1.00 . A A .  52 SER CB   1 1 
        4  6499 1 1  52 SER H    H  -2.102  15.305  -5.709 1.00 . A A .  52 SER H    1 1 
        4  6500 1 1  52 SER HA   H  -1.374  13.507  -3.499 1.00 . A A .  52 SER HA   1 1 
        4  6501 1 1  52 SER HB2  H  -3.695  12.722  -3.272 1.00 . A A .  52 SER HB2  1 1 
        4  6502 1 1  52 SER HB3  H  -3.592  14.448  -2.937 1.00 . A A .  52 SER HB3  1 1 
        4  6503 1 1  52 SER HG   H  -4.138  14.570  -5.353 1.00 . A A .  52 SER HG   1 1 
        4  6504 1 1  52 SER N    N  -1.761  15.057  -4.825 1.00 . A A .  52 SER N    1 1 
        4  6505 1 1  52 SER O    O  -2.278  12.881  -6.534 1.00 . A A .  52 SER O    1 1 
        4  6506 1 1  52 SER OG   O  -4.491  13.945  -4.702 1.00 . A A .  52 SER OG   1 1 
        4  6507 1 1  53 VAL C    C  -1.960   9.081  -5.425 1.00 . A A .  53 VAL C    1 1 
        4  6508 1 1  53 VAL CA   C  -1.270  10.362  -5.925 1.00 . A A .  53 VAL CA   1 1 
        4  6509 1 1  53 VAL CB   C   0.244  10.097  -6.150 1.00 . A A .  53 VAL CB   1 1 
        4  6510 1 1  53 VAL CG1  C   0.941   9.761  -4.831 1.00 . A A .  53 VAL CG1  1 1 
        4  6511 1 1  53 VAL CG2  C   0.463   8.995  -7.189 1.00 . A A .  53 VAL CG2  1 1 
        4  6512 1 1  53 VAL H    H  -1.254  11.336  -4.038 1.00 . A A .  53 VAL H    1 1 
        4  6513 1 1  53 VAL HA   H  -1.710  10.643  -6.872 1.00 . A A .  53 VAL HA   1 1 
        4  6514 1 1  53 VAL HB   H   0.686  11.008  -6.533 1.00 . A A .  53 VAL HB   1 1 
        4  6515 1 1  53 VAL HG11 H   0.493   8.878  -4.399 1.00 . A A .  53 VAL HG11 1 1 
        4  6516 1 1  53 VAL HG12 H   0.833  10.589  -4.145 1.00 . A A .  53 VAL HG12 1 1 
        4  6517 1 1  53 VAL HG13 H   1.992   9.581  -5.011 1.00 . A A .  53 VAL HG13 1 1 
        4  6518 1 1  53 VAL HG21 H  -0.021   9.272  -8.115 1.00 . A A .  53 VAL HG21 1 1 
        4  6519 1 1  53 VAL HG22 H   0.043   8.067  -6.829 1.00 . A A .  53 VAL HG22 1 1 
        4  6520 1 1  53 VAL HG23 H   1.522   8.866  -7.365 1.00 . A A .  53 VAL HG23 1 1 
        4  6521 1 1  53 VAL N    N  -1.472  11.471  -4.984 1.00 . A A .  53 VAL N    1 1 
        4  6522 1 1  53 VAL O    O  -2.065   8.854  -4.220 1.00 . A A .  53 VAL O    1 1 
        4  6523 1 1  54 SER C    C  -2.627   5.803  -6.773 1.00 . A A .  54 SER C    1 1 
        4  6524 1 1  54 SER CA   C  -3.148   7.012  -5.983 1.00 . A A .  54 SER CA   1 1 
        4  6525 1 1  54 SER CB   C  -4.659   7.167  -6.202 1.00 . A A .  54 SER CB   1 1 
        4  6526 1 1  54 SER H    H  -2.338   8.478  -7.297 1.00 . A A .  54 SER H    1 1 
        4  6527 1 1  54 SER HA   H  -2.970   6.832  -4.932 1.00 . A A .  54 SER HA   1 1 
        4  6528 1 1  54 SER HB2  H  -5.166   6.279  -5.849 1.00 . A A .  54 SER HB2  1 1 
        4  6529 1 1  54 SER HB3  H  -5.015   8.023  -5.646 1.00 . A A .  54 SER HB3  1 1 
        4  6530 1 1  54 SER HG   H  -5.902   7.117  -7.720 1.00 . A A .  54 SER HG   1 1 
        4  6531 1 1  54 SER N    N  -2.447   8.252  -6.349 1.00 . A A .  54 SER N    1 1 
        4  6532 1 1  54 SER O    O  -2.164   5.936  -7.905 1.00 . A A .  54 SER O    1 1 
        4  6533 1 1  54 SER OG   O  -4.975   7.351  -7.575 1.00 . A A .  54 SER OG   1 1 
        4  6534 1 1  55 TYR C    C  -3.378   2.336  -6.875 1.00 . A A .  55 TYR C    1 1 
        4  6535 1 1  55 TYR CA   C  -2.245   3.376  -6.804 1.00 . A A .  55 TYR CA   1 1 
        4  6536 1 1  55 TYR CB   C  -1.046   2.795  -6.040 1.00 . A A .  55 TYR CB   1 1 
        4  6537 1 1  55 TYR CD1  C   0.097   1.721  -8.031 1.00 . A A .  55 TYR CD1  1 1 
        4  6538 1 1  55 TYR CD2  C  -0.254   0.384  -6.084 1.00 . A A .  55 TYR CD2  1 1 
        4  6539 1 1  55 TYR CE1  C   0.704   0.652  -8.660 1.00 . A A .  55 TYR CE1  1 1 
        4  6540 1 1  55 TYR CE2  C   0.351  -0.690  -6.710 1.00 . A A .  55 TYR CE2  1 1 
        4  6541 1 1  55 TYR CG   C  -0.393   1.609  -6.732 1.00 . A A .  55 TYR CG   1 1 
        4  6542 1 1  55 TYR CZ   C   0.827  -0.549  -7.997 1.00 . A A .  55 TYR CZ   1 1 
        4  6543 1 1  55 TYR H    H  -3.065   4.578  -5.252 1.00 . A A .  55 TYR H    1 1 
        4  6544 1 1  55 TYR HA   H  -1.933   3.616  -7.812 1.00 . A A .  55 TYR HA   1 1 
        4  6545 1 1  55 TYR HB2  H  -0.296   3.564  -5.927 1.00 . A A .  55 TYR HB2  1 1 
        4  6546 1 1  55 TYR HB3  H  -1.373   2.475  -5.060 1.00 . A A .  55 TYR HB3  1 1 
        4  6547 1 1  55 TYR HD1  H  -0.001   2.663  -8.552 1.00 . A A .  55 TYR HD1  1 1 
        4  6548 1 1  55 TYR HD2  H  -0.629   0.276  -5.076 1.00 . A A .  55 TYR HD2  1 1 
        4  6549 1 1  55 TYR HE1  H   1.078   0.760  -9.669 1.00 . A A .  55 TYR HE1  1 1 
        4  6550 1 1  55 TYR HE2  H   0.449  -1.634  -6.191 1.00 . A A .  55 TYR HE2  1 1 
        4  6551 1 1  55 TYR HH   H   2.218  -1.295  -9.095 1.00 . A A .  55 TYR HH   1 1 
        4  6552 1 1  55 TYR N    N  -2.700   4.619  -6.161 1.00 . A A .  55 TYR N    1 1 
        4  6553 1 1  55 TYR O    O  -3.919   1.922  -5.849 1.00 . A A .  55 TYR O    1 1 
        4  6554 1 1  55 TYR OH   O   1.440  -1.612  -8.624 1.00 . A A .  55 TYR OH   1 1 
        4  6555 1 1  56 LYS C    C  -4.331  -0.492  -8.176 1.00 . A A .  56 LYS C    1 1 
        4  6556 1 1  56 LYS CA   C  -4.813   0.965  -8.309 1.00 . A A .  56 LYS CA   1 1 
        4  6557 1 1  56 LYS CB   C  -5.424   1.195  -9.699 1.00 . A A .  56 LYS CB   1 1 
        4  6558 1 1  56 LYS CD   C  -7.247   0.662 -11.365 1.00 . A A .  56 LYS CD   1 1 
        4  6559 1 1  56 LYS CE   C  -7.639   2.130 -11.503 1.00 . A A .  56 LYS CE   1 1 
        4  6560 1 1  56 LYS CG   C  -6.665   0.353  -9.985 1.00 . A A .  56 LYS CG   1 1 
        4  6561 1 1  56 LYS H    H  -3.228   2.262  -8.864 1.00 . A A .  56 LYS H    1 1 
        4  6562 1 1  56 LYS HA   H  -5.571   1.150  -7.561 1.00 . A A .  56 LYS HA   1 1 
        4  6563 1 1  56 LYS HB2  H  -5.694   2.238  -9.792 1.00 . A A .  56 LYS HB2  1 1 
        4  6564 1 1  56 LYS HB3  H  -4.677   0.962 -10.448 1.00 . A A .  56 LYS HB3  1 1 
        4  6565 1 1  56 LYS HD2  H  -6.507   0.429 -12.116 1.00 . A A .  56 LYS HD2  1 1 
        4  6566 1 1  56 LYS HD3  H  -8.125   0.048 -11.521 1.00 . A A .  56 LYS HD3  1 1 
        4  6567 1 1  56 LYS HE2  H  -8.431   2.349 -10.799 1.00 . A A .  56 LYS HE2  1 1 
        4  6568 1 1  56 LYS HE3  H  -6.780   2.744 -11.276 1.00 . A A .  56 LYS HE3  1 1 
        4  6569 1 1  56 LYS HG2  H  -6.397  -0.694  -9.945 1.00 . A A .  56 LYS HG2  1 1 
        4  6570 1 1  56 LYS HG3  H  -7.413   0.563  -9.231 1.00 . A A .  56 LYS HG3  1 1 
        4  6571 1 1  56 LYS HZ1  H  -7.359   2.269 -13.569 1.00 . A A .  56 LYS HZ1  1 1 
        4  6572 1 1  56 LYS HZ2  H  -8.380   3.458 -12.934 1.00 . A A .  56 LYS HZ2  1 1 
        4  6573 1 1  56 LYS HZ3  H  -8.942   1.876 -13.120 1.00 . A A .  56 LYS HZ3  1 1 
        4  6574 1 1  56 LYS N    N  -3.720   1.919  -8.089 1.00 . A A .  56 LYS N    1 1 
        4  6575 1 1  56 LYS NZ   N  -8.113   2.455 -12.876 1.00 . A A .  56 LYS NZ   1 1 
        4  6576 1 1  56 LYS O    O  -3.342  -0.891  -8.792 1.00 . A A .  56 LYS O    1 1 
        4  6577 1 1  57 TYR C    C  -5.375  -3.606  -8.183 1.00 . A A .  57 TYR C    1 1 
        4  6578 1 1  57 TYR CA   C  -4.702  -2.689  -7.148 1.00 . A A .  57 TYR CA   1 1 
        4  6579 1 1  57 TYR CB   C  -5.103  -3.107  -5.727 1.00 . A A .  57 TYR CB   1 1 
        4  6580 1 1  57 TYR CD1  C  -4.612  -1.145  -4.193 1.00 . A A .  57 TYR CD1  1 1 
        4  6581 1 1  57 TYR CD2  C  -3.191  -3.056  -4.065 1.00 . A A .  57 TYR CD2  1 1 
        4  6582 1 1  57 TYR CE1  C  -3.867  -0.523  -3.208 1.00 . A A .  57 TYR CE1  1 1 
        4  6583 1 1  57 TYR CE2  C  -2.441  -2.440  -3.081 1.00 . A A .  57 TYR CE2  1 1 
        4  6584 1 1  57 TYR CG   C  -4.289  -2.423  -4.639 1.00 . A A .  57 TYR CG   1 1 
        4  6585 1 1  57 TYR CZ   C  -2.784  -1.174  -2.656 1.00 . A A .  57 TYR CZ   1 1 
        4  6586 1 1  57 TYR H    H  -5.826  -0.902  -6.917 1.00 . A A .  57 TYR H    1 1 
        4  6587 1 1  57 TYR HA   H  -3.629  -2.788  -7.247 1.00 . A A .  57 TYR HA   1 1 
        4  6588 1 1  57 TYR HB2  H  -6.145  -2.862  -5.568 1.00 . A A .  57 TYR HB2  1 1 
        4  6589 1 1  57 TYR HB3  H  -4.973  -4.175  -5.620 1.00 . A A .  57 TYR HB3  1 1 
        4  6590 1 1  57 TYR HD1  H  -5.462  -0.636  -4.627 1.00 . A A .  57 TYR HD1  1 1 
        4  6591 1 1  57 TYR HD2  H  -2.925  -4.049  -4.398 1.00 . A A .  57 TYR HD2  1 1 
        4  6592 1 1  57 TYR HE1  H  -4.135   0.469  -2.875 1.00 . A A .  57 TYR HE1  1 1 
        4  6593 1 1  57 TYR HE2  H  -1.593  -2.951  -2.649 1.00 . A A .  57 TYR HE2  1 1 
        4  6594 1 1  57 TYR HH   H  -2.618  -0.146  -1.030 1.00 . A A .  57 TYR HH   1 1 
        4  6595 1 1  57 TYR N    N  -5.043  -1.278  -7.371 1.00 . A A .  57 TYR N    1 1 
        4  6596 1 1  57 TYR O    O  -6.601  -3.622  -8.312 1.00 . A A .  57 TYR O    1 1 
        4  6597 1 1  57 TYR OH   O  -2.035  -0.558  -1.676 1.00 . A A .  57 TYR OH   1 1 
        4  6598 1 1  58 THR C    C  -5.593  -6.599  -9.429 1.00 . A A .  58 THR C    1 1 
        4  6599 1 1  58 THR CA   C  -5.060  -5.263  -9.974 1.00 . A A .  58 THR CA   1 1 
        4  6600 1 1  58 THR CB   C  -3.961  -5.560 -11.023 1.00 . A A .  58 THR CB   1 1 
        4  6601 1 1  58 THR CG2  C  -2.646  -5.953 -10.352 1.00 . A A .  58 THR CG2  1 1 
        4  6602 1 1  58 THR H    H  -3.601  -4.343  -8.726 1.00 . A A .  58 THR H    1 1 
        4  6603 1 1  58 THR HA   H  -5.869  -4.749 -10.477 1.00 . A A .  58 THR HA   1 1 
        4  6604 1 1  58 THR HB   H  -3.793  -4.662 -11.603 1.00 . A A .  58 THR HB   1 1 
        4  6605 1 1  58 THR HG1  H  -4.113  -6.392 -12.815 1.00 . A A .  58 THR HG1  1 1 
        4  6606 1 1  58 THR HG21 H  -2.795  -6.848  -9.763 1.00 . A A .  58 THR HG21 1 1 
        4  6607 1 1  58 THR HG22 H  -2.314  -5.151  -9.710 1.00 . A A .  58 THR HG22 1 1 
        4  6608 1 1  58 THR HG23 H  -1.898  -6.141 -11.108 1.00 . A A .  58 THR HG23 1 1 
        4  6609 1 1  58 THR N    N  -4.562  -4.374  -8.909 1.00 . A A .  58 THR N    1 1 
        4  6610 1 1  58 THR O    O  -5.005  -7.200  -8.530 1.00 . A A .  58 THR O    1 1 
        4  6611 1 1  58 THR OG1  O  -4.384  -6.609 -11.912 1.00 . A A .  58 THR OG1  1 1 
        4  6612 1 1  59 SER C    C  -6.738  -9.567 -10.221 1.00 . A A .  59 SER C    1 1 
        4  6613 1 1  59 SER CA   C  -7.349  -8.321  -9.562 1.00 . A A .  59 SER CA   1 1 
        4  6614 1 1  59 SER CB   C  -8.850  -8.276  -9.883 1.00 . A A .  59 SER CB   1 1 
        4  6615 1 1  59 SER H    H  -7.085  -6.580 -10.762 1.00 . A A .  59 SER H    1 1 
        4  6616 1 1  59 SER HA   H  -7.225  -8.399  -8.492 1.00 . A A .  59 SER HA   1 1 
        4  6617 1 1  59 SER HB2  H  -9.330  -9.157  -9.482 1.00 . A A .  59 SER HB2  1 1 
        4  6618 1 1  59 SER HB3  H  -9.287  -7.396  -9.435 1.00 . A A .  59 SER HB3  1 1 
        4  6619 1 1  59 SER HG   H  -9.111  -9.135 -11.633 1.00 . A A .  59 SER HG   1 1 
        4  6620 1 1  59 SER N    N  -6.694  -7.077 -10.009 1.00 . A A .  59 SER N    1 1 
        4  6621 1 1  59 SER O    O  -7.347 -10.635 -10.224 1.00 . A A .  59 SER O    1 1 
        4  6622 1 1  59 SER OG   O  -9.077  -8.233 -11.286 1.00 . A A .  59 SER OG   1 1 
        4  6623 1 1  60 ARG C    C  -4.469 -11.702 -10.547 1.00 . A A .  60 ARG C    1 1 
        4  6624 1 1  60 ARG CA   C  -4.879 -10.546 -11.482 1.00 . A A .  60 ARG CA   1 1 
        4  6625 1 1  60 ARG CB   C  -3.659 -10.032 -12.261 1.00 . A A .  60 ARG CB   1 1 
        4  6626 1 1  60 ARG CD   C  -1.461  -8.791 -12.207 1.00 . A A .  60 ARG CD   1 1 
        4  6627 1 1  60 ARG CG   C  -2.573  -9.427 -11.381 1.00 . A A .  60 ARG CG   1 1 
        4  6628 1 1  60 ARG CZ   C  -0.229  -9.508 -14.196 1.00 . A A .  60 ARG CZ   1 1 
        4  6629 1 1  60 ARG H    H  -5.064  -8.576 -10.693 1.00 . A A .  60 ARG H    1 1 
        4  6630 1 1  60 ARG HA   H  -5.597 -10.930 -12.193 1.00 . A A .  60 ARG HA   1 1 
        4  6631 1 1  60 ARG HB2  H  -3.227 -10.853 -12.817 1.00 . A A .  60 ARG HB2  1 1 
        4  6632 1 1  60 ARG HB3  H  -3.988  -9.275 -12.958 1.00 . A A .  60 ARG HB3  1 1 
        4  6633 1 1  60 ARG HD2  H  -1.895  -8.044 -12.855 1.00 . A A .  60 ARG HD2  1 1 
        4  6634 1 1  60 ARG HD3  H  -0.760  -8.316 -11.535 1.00 . A A .  60 ARG HD3  1 1 
        4  6635 1 1  60 ARG HE   H  -0.616 -10.664 -12.653 1.00 . A A .  60 ARG HE   1 1 
        4  6636 1 1  60 ARG HG2  H  -3.015  -8.670 -10.750 1.00 . A A .  60 ARG HG2  1 1 
        4  6637 1 1  60 ARG HG3  H  -2.149 -10.205 -10.762 1.00 . A A .  60 ARG HG3  1 1 
        4  6638 1 1  60 ARG HH11 H  -0.969  -7.663 -14.320 1.00 . A A .  60 ARG HH11 1 1 
        4  6639 1 1  60 ARG HH12 H  -0.015  -8.187 -15.667 1.00 . A A .  60 ARG HH12 1 1 
        4  6640 1 1  60 ARG HH21 H   0.599 -11.306 -14.396 1.00 . A A .  60 ARG HH21 1 1 
        4  6641 1 1  60 ARG HH22 H   0.855 -10.203 -15.706 1.00 . A A .  60 ARG HH22 1 1 
        4  6642 1 1  60 ARG N    N  -5.529  -9.437 -10.765 1.00 . A A .  60 ARG N    1 1 
        4  6643 1 1  60 ARG NE   N  -0.742  -9.768 -13.023 1.00 . A A .  60 ARG NE   1 1 
        4  6644 1 1  60 ARG NH1  N  -0.420  -8.363 -14.769 1.00 . A A .  60 ARG NH1  1 1 
        4  6645 1 1  60 ARG NH2  N   0.458 -10.409 -14.812 1.00 . A A .  60 ARG NH2  1 1 
        4  6646 1 1  60 ARG O    O  -4.076 -12.773 -11.017 1.00 . A A .  60 ARG O    1 1 
        4  6647 1 1  61 TYR C    C  -4.985 -12.381  -6.942 1.00 . A A .  61 TYR C    1 1 
        4  6648 1 1  61 TYR CA   C  -4.224 -12.552  -8.268 1.00 . A A .  61 TYR CA   1 1 
        4  6649 1 1  61 TYR CB   C  -2.707 -12.600  -8.005 1.00 . A A .  61 TYR CB   1 1 
        4  6650 1 1  61 TYR CD1  C  -1.766 -10.246  -8.017 1.00 . A A .  61 TYR CD1  1 1 
        4  6651 1 1  61 TYR CD2  C  -1.994 -11.354  -5.917 1.00 . A A .  61 TYR CD2  1 1 
        4  6652 1 1  61 TYR CE1  C  -1.250  -9.134  -7.378 1.00 . A A .  61 TYR CE1  1 1 
        4  6653 1 1  61 TYR CE2  C  -1.478 -10.246  -5.271 1.00 . A A .  61 TYR CE2  1 1 
        4  6654 1 1  61 TYR CG   C  -2.147 -11.375  -7.300 1.00 . A A .  61 TYR CG   1 1 
        4  6655 1 1  61 TYR CZ   C  -1.107  -9.139  -6.005 1.00 . A A .  61 TYR CZ   1 1 
        4  6656 1 1  61 TYR H    H  -4.845 -10.620  -8.903 1.00 . A A .  61 TYR H    1 1 
        4  6657 1 1  61 TYR HA   H  -4.526 -13.494  -8.708 1.00 . A A .  61 TYR HA   1 1 
        4  6658 1 1  61 TYR HB2  H  -2.483 -13.464  -7.396 1.00 . A A .  61 TYR HB2  1 1 
        4  6659 1 1  61 TYR HB3  H  -2.194 -12.700  -8.953 1.00 . A A .  61 TYR HB3  1 1 
        4  6660 1 1  61 TYR HD1  H  -1.880 -10.241  -9.092 1.00 . A A .  61 TYR HD1  1 1 
        4  6661 1 1  61 TYR HD2  H  -2.284 -12.224  -5.343 1.00 . A A .  61 TYR HD2  1 1 
        4  6662 1 1  61 TYR HE1  H  -0.958  -8.267  -7.953 1.00 . A A .  61 TYR HE1  1 1 
        4  6663 1 1  61 TYR HE2  H  -1.367 -10.252  -4.196 1.00 . A A .  61 TYR HE2  1 1 
        4  6664 1 1  61 TYR HH   H   0.030  -8.311  -4.691 1.00 . A A .  61 TYR HH   1 1 
        4  6665 1 1  61 TYR N    N  -4.553 -11.494  -9.233 1.00 . A A .  61 TYR N    1 1 
        4  6666 1 1  61 TYR O    O  -5.606 -11.346  -6.689 1.00 . A A .  61 TYR O    1 1 
        4  6667 1 1  61 TYR OH   O  -0.594  -8.033  -5.367 1.00 . A A .  61 TYR OH   1 1 
        4  6668 1 1  62 VAL C    C  -4.553 -13.051  -3.682 1.00 . A A .  62 VAL C    1 1 
        4  6669 1 1  62 VAL CA   C  -5.565 -13.400  -4.788 1.00 . A A .  62 VAL CA   1 1 
        4  6670 1 1  62 VAL CB   C  -6.212 -14.777  -4.475 1.00 . A A .  62 VAL CB   1 1 
        4  6671 1 1  62 VAL CG1  C  -5.167 -15.892  -4.519 1.00 . A A .  62 VAL CG1  1 1 
        4  6672 1 1  62 VAL CG2  C  -6.929 -14.759  -3.124 1.00 . A A .  62 VAL CG2  1 1 
        4  6673 1 1  62 VAL H    H  -4.453 -14.223  -6.393 1.00 . A A .  62 VAL H    1 1 
        4  6674 1 1  62 VAL HA   H  -6.346 -12.652  -4.796 1.00 . A A .  62 VAL HA   1 1 
        4  6675 1 1  62 VAL HB   H  -6.949 -14.981  -5.242 1.00 . A A .  62 VAL HB   1 1 
        4  6676 1 1  62 VAL HG11 H  -4.700 -15.913  -5.493 1.00 . A A .  62 VAL HG11 1 1 
        4  6677 1 1  62 VAL HG12 H  -5.645 -16.843  -4.332 1.00 . A A .  62 VAL HG12 1 1 
        4  6678 1 1  62 VAL HG13 H  -4.415 -15.714  -3.764 1.00 . A A .  62 VAL HG13 1 1 
        4  6679 1 1  62 VAL HG21 H  -7.362 -15.730  -2.930 1.00 . A A .  62 VAL HG21 1 1 
        4  6680 1 1  62 VAL HG22 H  -7.711 -14.014  -3.137 1.00 . A A .  62 VAL HG22 1 1 
        4  6681 1 1  62 VAL HG23 H  -6.221 -14.520  -2.341 1.00 . A A .  62 VAL HG23 1 1 
        4  6682 1 1  62 VAL N    N  -4.931 -13.416  -6.109 1.00 . A A .  62 VAL N    1 1 
        4  6683 1 1  62 VAL O    O  -3.402 -13.490  -3.716 1.00 . A A .  62 VAL O    1 1 
        4  6684 1 1  63 LEU C    C  -4.426 -12.912  -0.410 1.00 . A A .  63 LEU C    1 1 
        4  6685 1 1  63 LEU CA   C  -4.147 -11.917  -1.552 1.00 . A A .  63 LEU CA   1 1 
        4  6686 1 1  63 LEU CB   C  -4.419 -10.464  -1.106 1.00 . A A .  63 LEU CB   1 1 
        4  6687 1 1  63 LEU CD1  C  -2.805 -10.407   0.853 1.00 . A A .  63 LEU CD1  1 1 
        4  6688 1 1  63 LEU CD2  C  -2.058  -9.629  -1.408 1.00 . A A .  63 LEU CD2  1 1 
        4  6689 1 1  63 LEU CG   C  -3.237  -9.728  -0.443 1.00 . A A .  63 LEU CG   1 1 
        4  6690 1 1  63 LEU H    H  -5.893 -11.888  -2.757 1.00 . A A .  63 LEU H    1 1 
        4  6691 1 1  63 LEU HA   H  -3.111 -12.010  -1.852 1.00 . A A .  63 LEU HA   1 1 
        4  6692 1 1  63 LEU HB2  H  -4.721  -9.897  -1.977 1.00 . A A .  63 LEU HB2  1 1 
        4  6693 1 1  63 LEU HB3  H  -5.243 -10.471  -0.408 1.00 . A A .  63 LEU HB3  1 1 
        4  6694 1 1  63 LEU HD11 H  -3.646 -10.472   1.526 1.00 . A A .  63 LEU HD11 1 1 
        4  6695 1 1  63 LEU HD12 H  -2.017  -9.832   1.317 1.00 . A A .  63 LEU HD12 1 1 
        4  6696 1 1  63 LEU HD13 H  -2.439 -11.403   0.636 1.00 . A A .  63 LEU HD13 1 1 
        4  6697 1 1  63 LEU HD21 H  -2.366  -9.108  -2.302 1.00 . A A .  63 LEU HD21 1 1 
        4  6698 1 1  63 LEU HD22 H  -1.720 -10.623  -1.668 1.00 . A A .  63 LEU HD22 1 1 
        4  6699 1 1  63 LEU HD23 H  -1.252  -9.087  -0.936 1.00 . A A .  63 LEU HD23 1 1 
        4  6700 1 1  63 LEU HG   H  -3.546  -8.722  -0.199 1.00 . A A .  63 LEU HG   1 1 
        4  6701 1 1  63 LEU N    N  -4.986 -12.255  -2.706 1.00 . A A .  63 LEU N    1 1 
        4  6702 1 1  63 LEU O    O  -5.424 -12.801   0.306 1.00 . A A .  63 LEU O    1 1 
        4  6703 1 1  64 LYS C    C  -3.689 -14.598   2.148 1.00 . A A .  64 LYS C    1 1 
        4  6704 1 1  64 LYS CA   C  -3.757 -15.009   0.666 1.00 . A A .  64 LYS CA   1 1 
        4  6705 1 1  64 LYS CB   C  -2.742 -16.124   0.386 1.00 . A A .  64 LYS CB   1 1 
        4  6706 1 1  64 LYS CD   C  -1.970 -17.961  -1.192 1.00 . A A .  64 LYS CD   1 1 
        4  6707 1 1  64 LYS CE   C  -2.544 -19.206  -0.502 1.00 . A A .  64 LYS CE   1 1 
        4  6708 1 1  64 LYS CG   C  -2.856 -16.726  -1.013 1.00 . A A .  64 LYS CG   1 1 
        4  6709 1 1  64 LYS H    H  -2.713 -13.864  -0.786 1.00 . A A .  64 LYS H    1 1 
        4  6710 1 1  64 LYS HA   H  -4.748 -15.396   0.470 1.00 . A A .  64 LYS HA   1 1 
        4  6711 1 1  64 LYS HB2  H  -1.743 -15.727   0.506 1.00 . A A .  64 LYS HB2  1 1 
        4  6712 1 1  64 LYS HB3  H  -2.891 -16.917   1.107 1.00 . A A .  64 LYS HB3  1 1 
        4  6713 1 1  64 LYS HD2  H  -1.874 -18.166  -2.250 1.00 . A A .  64 LYS HD2  1 1 
        4  6714 1 1  64 LYS HD3  H  -0.993 -17.751  -0.781 1.00 . A A .  64 LYS HD3  1 1 
        4  6715 1 1  64 LYS HE2  H  -3.538 -19.386  -0.883 1.00 . A A .  64 LYS HE2  1 1 
        4  6716 1 1  64 LYS HE3  H  -1.916 -20.052  -0.741 1.00 . A A .  64 LYS HE3  1 1 
        4  6717 1 1  64 LYS HG2  H  -3.885 -17.009  -1.189 1.00 . A A .  64 LYS HG2  1 1 
        4  6718 1 1  64 LYS HG3  H  -2.564 -15.978  -1.737 1.00 . A A .  64 LYS HG3  1 1 
        4  6719 1 1  64 LYS HZ1  H  -2.867 -19.988   1.410 1.00 . A A .  64 LYS HZ1  1 1 
        4  6720 1 1  64 LYS HZ2  H  -3.351 -18.377   1.243 1.00 . A A .  64 LYS HZ2  1 1 
        4  6721 1 1  64 LYS HZ3  H  -1.707 -18.759   1.365 1.00 . A A .  64 LYS HZ3  1 1 
        4  6722 1 1  64 LYS N    N  -3.539 -13.891  -0.259 1.00 . A A .  64 LYS N    1 1 
        4  6723 1 1  64 LYS NZ   N  -2.622 -19.073   0.982 1.00 . A A .  64 LYS NZ   1 1 
        4  6724 1 1  64 LYS O    O  -3.179 -13.530   2.499 1.00 . A A .  64 LYS O    1 1 
        4  6725 1 1  65 ALA C    C  -2.776 -15.214   5.021 1.00 . A A .  65 ALA C    1 1 
        4  6726 1 1  65 ALA CA   C  -4.208 -15.224   4.464 1.00 . A A .  65 ALA CA   1 1 
        4  6727 1 1  65 ALA CB   C  -5.057 -16.275   5.174 1.00 . A A .  65 ALA CB   1 1 
        4  6728 1 1  65 ALA H    H  -4.614 -16.297   2.675 1.00 . A A .  65 ALA H    1 1 
        4  6729 1 1  65 ALA HA   H  -4.658 -14.255   4.639 1.00 . A A .  65 ALA HA   1 1 
        4  6730 1 1  65 ALA HB1  H  -4.624 -17.254   5.021 1.00 . A A .  65 ALA HB1  1 1 
        4  6731 1 1  65 ALA HB2  H  -6.060 -16.260   4.771 1.00 . A A .  65 ALA HB2  1 1 
        4  6732 1 1  65 ALA HB3  H  -5.091 -16.058   6.231 1.00 . A A .  65 ALA HB3  1 1 
        4  6733 1 1  65 ALA N    N  -4.212 -15.466   3.017 1.00 . A A .  65 ALA N    1 1 
        4  6734 1 1  65 ALA O    O  -2.029 -16.186   4.867 1.00 . A A .  65 ALA O    1 1 
        4  6735 1 1  66 GLY C    C  -0.027 -13.499   5.132 1.00 . A A .  66 GLY C    1 1 
        4  6736 1 1  66 GLY CA   C  -1.033 -13.979   6.177 1.00 . A A .  66 GLY CA   1 1 
        4  6737 1 1  66 GLY H    H  -3.038 -13.383   5.794 1.00 . A A .  66 GLY H    1 1 
        4  6738 1 1  66 GLY HA2  H  -1.043 -13.274   6.994 1.00 . A A .  66 GLY HA2  1 1 
        4  6739 1 1  66 GLY HA3  H  -0.710 -14.939   6.555 1.00 . A A .  66 GLY HA3  1 1 
        4  6740 1 1  66 GLY N    N  -2.391 -14.111   5.659 1.00 . A A .  66 GLY N    1 1 
        4  6741 1 1  66 GLY O    O   1.177 -13.452   5.391 1.00 . A A .  66 GLY O    1 1 
        4  6742 1 1  67 GLN C    C   0.506 -11.121   2.944 1.00 . A A .  67 GLN C    1 1 
        4  6743 1 1  67 GLN CA   C   0.342 -12.647   2.865 1.00 . A A .  67 GLN CA   1 1 
        4  6744 1 1  67 GLN CB   C  -0.236 -13.049   1.497 1.00 . A A .  67 GLN CB   1 1 
        4  6745 1 1  67 GLN CD   C   1.812 -13.467  -0.007 1.00 . A A .  67 GLN CD   1 1 
        4  6746 1 1  67 GLN CG   C   0.595 -12.590   0.293 1.00 . A A .  67 GLN CG   1 1 
        4  6747 1 1  67 GLN H    H  -1.484 -13.208   3.795 1.00 . A A .  67 GLN H    1 1 
        4  6748 1 1  67 GLN HA   H   1.314 -13.105   2.980 1.00 . A A .  67 GLN HA   1 1 
        4  6749 1 1  67 GLN HB2  H  -0.315 -14.127   1.457 1.00 . A A .  67 GLN HB2  1 1 
        4  6750 1 1  67 GLN HB3  H  -1.227 -12.627   1.403 1.00 . A A .  67 GLN HB3  1 1 
        4  6751 1 1  67 GLN HE21 H   2.037 -13.971   1.899 1.00 . A A .  67 GLN HE21 1 1 
        4  6752 1 1  67 GLN HE22 H   3.179 -14.648   0.803 1.00 . A A .  67 GLN HE22 1 1 
        4  6753 1 1  67 GLN HG2  H  -0.040 -12.589  -0.582 1.00 . A A .  67 GLN HG2  1 1 
        4  6754 1 1  67 GLN HG3  H   0.939 -11.580   0.478 1.00 . A A .  67 GLN HG3  1 1 
        4  6755 1 1  67 GLN N    N  -0.518 -13.141   3.946 1.00 . A A .  67 GLN N    1 1 
        4  6756 1 1  67 GLN NE2  N   2.398 -14.089   1.002 1.00 . A A .  67 GLN NE2  1 1 
        4  6757 1 1  67 GLN O    O  -0.470 -10.386   3.125 1.00 . A A .  67 GLN O    1 1 
        4  6758 1 1  67 GLN OE1  O   2.226 -13.586  -1.155 1.00 . A A .  67 GLN OE1  1 1 
        4  6759 1 1  68 THR C    C   2.604  -8.701   1.522 1.00 . A A .  68 THR C    1 1 
        4  6760 1 1  68 THR CA   C   2.048  -9.215   2.859 1.00 . A A .  68 THR CA   1 1 
        4  6761 1 1  68 THR CB   C   3.074  -8.898   3.973 1.00 . A A .  68 THR CB   1 1 
        4  6762 1 1  68 THR CG2  C   2.516  -9.247   5.349 1.00 . A A .  68 THR CG2  1 1 
        4  6763 1 1  68 THR H    H   2.479 -11.289   2.677 1.00 . A A .  68 THR H    1 1 
        4  6764 1 1  68 THR HA   H   1.132  -8.683   3.084 1.00 . A A .  68 THR HA   1 1 
        4  6765 1 1  68 THR HB   H   3.290  -7.837   3.950 1.00 . A A .  68 THR HB   1 1 
        4  6766 1 1  68 THR HG1  H   4.667  -9.366   2.894 1.00 . A A .  68 THR HG1  1 1 
        4  6767 1 1  68 THR HG21 H   1.631  -8.656   5.542 1.00 . A A .  68 THR HG21 1 1 
        4  6768 1 1  68 THR HG22 H   3.259  -9.036   6.104 1.00 . A A .  68 THR HG22 1 1 
        4  6769 1 1  68 THR HG23 H   2.260 -10.296   5.380 1.00 . A A .  68 THR HG23 1 1 
        4  6770 1 1  68 THR N    N   1.744 -10.653   2.808 1.00 . A A .  68 THR N    1 1 
        4  6771 1 1  68 THR O    O   3.781  -8.891   1.215 1.00 . A A .  68 THR O    1 1 
        4  6772 1 1  68 THR OG1  O   4.293  -9.624   3.749 1.00 . A A .  68 THR OG1  1 1 
        4  6773 1 1  69 VAL C    C   2.959  -6.164  -0.339 1.00 . A A .  69 VAL C    1 1 
        4  6774 1 1  69 VAL CA   C   2.181  -7.477  -0.553 1.00 . A A .  69 VAL CA   1 1 
        4  6775 1 1  69 VAL CB   C   0.968  -7.220  -1.492 1.00 . A A .  69 VAL CB   1 1 
        4  6776 1 1  69 VAL CG1  C  -0.048  -6.281  -0.842 1.00 . A A .  69 VAL CG1  1 1 
        4  6777 1 1  69 VAL CG2  C   1.434  -6.664  -2.838 1.00 . A A .  69 VAL CG2  1 1 
        4  6778 1 1  69 VAL H    H   0.821  -7.963   1.006 1.00 . A A .  69 VAL H    1 1 
        4  6779 1 1  69 VAL HA   H   2.835  -8.193  -1.036 1.00 . A A .  69 VAL HA   1 1 
        4  6780 1 1  69 VAL HB   H   0.478  -8.169  -1.674 1.00 . A A .  69 VAL HB   1 1 
        4  6781 1 1  69 VAL HG11 H   0.417  -5.324  -0.649 1.00 . A A .  69 VAL HG11 1 1 
        4  6782 1 1  69 VAL HG12 H  -0.392  -6.707   0.091 1.00 . A A .  69 VAL HG12 1 1 
        4  6783 1 1  69 VAL HG13 H  -0.892  -6.143  -1.503 1.00 . A A .  69 VAL HG13 1 1 
        4  6784 1 1  69 VAL HG21 H   0.577  -6.491  -3.473 1.00 . A A .  69 VAL HG21 1 1 
        4  6785 1 1  69 VAL HG22 H   2.096  -7.374  -3.315 1.00 . A A .  69 VAL HG22 1 1 
        4  6786 1 1  69 VAL HG23 H   1.960  -5.734  -2.681 1.00 . A A .  69 VAL HG23 1 1 
        4  6787 1 1  69 VAL N    N   1.754  -8.056   0.727 1.00 . A A .  69 VAL N    1 1 
        4  6788 1 1  69 VAL O    O   2.532  -5.290   0.422 1.00 . A A .  69 VAL O    1 1 
        4  6789 1 1  70 THR C    C   4.766  -3.891  -2.065 1.00 . A A .  70 THR C    1 1 
        4  6790 1 1  70 THR CA   C   4.941  -4.836  -0.869 1.00 . A A .  70 THR CA   1 1 
        4  6791 1 1  70 THR CB   C   6.437  -5.203  -0.739 1.00 . A A .  70 THR CB   1 1 
        4  6792 1 1  70 THR CG2  C   7.285  -3.961  -0.507 1.00 . A A .  70 THR CG2  1 1 
        4  6793 1 1  70 THR H    H   4.407  -6.767  -1.586 1.00 . A A .  70 THR H    1 1 
        4  6794 1 1  70 THR HA   H   4.643  -4.315   0.035 1.00 . A A .  70 THR HA   1 1 
        4  6795 1 1  70 THR HB   H   6.759  -5.672  -1.659 1.00 . A A .  70 THR HB   1 1 
        4  6796 1 1  70 THR HG1  H   6.377  -7.013   0.052 1.00 . A A .  70 THR HG1  1 1 
        4  6797 1 1  70 THR HG21 H   8.320  -4.249  -0.378 1.00 . A A .  70 THR HG21 1 1 
        4  6798 1 1  70 THR HG22 H   6.943  -3.448   0.382 1.00 . A A .  70 THR HG22 1 1 
        4  6799 1 1  70 THR HG23 H   7.200  -3.302  -1.357 1.00 . A A .  70 THR HG23 1 1 
        4  6800 1 1  70 THR N    N   4.106  -6.036  -0.999 1.00 . A A .  70 THR N    1 1 
        4  6801 1 1  70 THR O    O   4.943  -4.291  -3.217 1.00 . A A .  70 THR O    1 1 
        4  6802 1 1  70 THR OG1  O   6.633  -6.127   0.344 1.00 . A A .  70 THR OG1  1 1 
        4  6803 1 1  71 ILE C    C   5.609  -0.884  -3.053 1.00 . A A .  71 ILE C    1 1 
        4  6804 1 1  71 ILE CA   C   4.273  -1.618  -2.827 1.00 . A A .  71 ILE CA   1 1 
        4  6805 1 1  71 ILE CB   C   3.173  -0.585  -2.462 1.00 . A A .  71 ILE CB   1 1 
        4  6806 1 1  71 ILE CD1  C   1.290  -2.161  -3.220 1.00 . A A .  71 ILE CD1  1 1 
        4  6807 1 1  71 ILE CG1  C   1.852  -1.295  -2.110 1.00 . A A .  71 ILE CG1  1 1 
        4  6808 1 1  71 ILE CG2  C   2.961   0.407  -3.603 1.00 . A A .  71 ILE CG2  1 1 
        4  6809 1 1  71 ILE H    H   4.207  -2.403  -0.858 1.00 . A A .  71 ILE H    1 1 
        4  6810 1 1  71 ILE HA   H   3.987  -2.110  -3.746 1.00 . A A .  71 ILE HA   1 1 
        4  6811 1 1  71 ILE HB   H   3.512  -0.029  -1.600 1.00 . A A .  71 ILE HB   1 1 
        4  6812 1 1  71 ILE HD11 H   1.101  -1.554  -4.093 1.00 . A A .  71 ILE HD11 1 1 
        4  6813 1 1  71 ILE HD12 H   0.366  -2.612  -2.890 1.00 . A A .  71 ILE HD12 1 1 
        4  6814 1 1  71 ILE HD13 H   2.000  -2.938  -3.468 1.00 . A A .  71 ILE HD13 1 1 
        4  6815 1 1  71 ILE HG12 H   2.015  -1.932  -1.253 1.00 . A A .  71 ILE HG12 1 1 
        4  6816 1 1  71 ILE HG13 H   1.107  -0.554  -1.860 1.00 . A A .  71 ILE HG13 1 1 
        4  6817 1 1  71 ILE HG21 H   3.882   0.937  -3.798 1.00 . A A .  71 ILE HG21 1 1 
        4  6818 1 1  71 ILE HG22 H   2.192   1.115  -3.328 1.00 . A A .  71 ILE HG22 1 1 
        4  6819 1 1  71 ILE HG23 H   2.656  -0.125  -4.493 1.00 . A A .  71 ILE HG23 1 1 
        4  6820 1 1  71 ILE N    N   4.406  -2.642  -1.786 1.00 . A A .  71 ILE N    1 1 
        4  6821 1 1  71 ILE O    O   5.951   0.044  -2.323 1.00 . A A .  71 ILE O    1 1 
        4  6822 1 1  72 TRP C    C   7.565   0.534  -5.203 1.00 . A A .  72 TRP C    1 1 
        4  6823 1 1  72 TRP CA   C   7.688  -0.735  -4.346 1.00 . A A .  72 TRP CA   1 1 
        4  6824 1 1  72 TRP CB   C   8.579  -1.756  -5.073 1.00 . A A .  72 TRP CB   1 1 
        4  6825 1 1  72 TRP CD1  C   8.219  -4.173  -4.296 1.00 . A A .  72 TRP CD1  1 1 
        4  6826 1 1  72 TRP CD2  C   9.945  -3.140  -3.314 1.00 . A A .  72 TRP CD2  1 1 
        4  6827 1 1  72 TRP CE2  C   9.858  -4.448  -2.806 1.00 . A A .  72 TRP CE2  1 1 
        4  6828 1 1  72 TRP CE3  C  10.959  -2.303  -2.843 1.00 . A A .  72 TRP CE3  1 1 
        4  6829 1 1  72 TRP CG   C   8.886  -2.984  -4.268 1.00 . A A .  72 TRP CG   1 1 
        4  6830 1 1  72 TRP CH2  C  11.725  -4.098  -1.405 1.00 . A A .  72 TRP CH2  1 1 
        4  6831 1 1  72 TRP CZ2  C  10.741  -4.938  -1.849 1.00 . A A .  72 TRP CZ2  1 1 
        4  6832 1 1  72 TRP CZ3  C  11.839  -2.789  -1.892 1.00 . A A .  72 TRP CZ3  1 1 
        4  6833 1 1  72 TRP H    H   6.039  -2.057  -4.612 1.00 . A A .  72 TRP H    1 1 
        4  6834 1 1  72 TRP HA   H   8.151  -0.475  -3.404 1.00 . A A .  72 TRP HA   1 1 
        4  6835 1 1  72 TRP HB2  H   8.084  -2.071  -5.980 1.00 . A A .  72 TRP HB2  1 1 
        4  6836 1 1  72 TRP HB3  H   9.518  -1.284  -5.330 1.00 . A A .  72 TRP HB3  1 1 
        4  6837 1 1  72 TRP HD1  H   7.361  -4.376  -4.922 1.00 . A A .  72 TRP HD1  1 1 
        4  6838 1 1  72 TRP HE1  H   8.496  -5.982  -3.261 1.00 . A A .  72 TRP HE1  1 1 
        4  6839 1 1  72 TRP HE3  H  11.061  -1.293  -3.208 1.00 . A A .  72 TRP HE3  1 1 
        4  6840 1 1  72 TRP HH2  H  12.435  -4.437  -0.665 1.00 . A A .  72 TRP HH2  1 1 
        4  6841 1 1  72 TRP HZ2  H  10.666  -5.947  -1.466 1.00 . A A .  72 TRP HZ2  1 1 
        4  6842 1 1  72 TRP HZ3  H  12.629  -2.155  -1.518 1.00 . A A .  72 TRP HZ3  1 1 
        4  6843 1 1  72 TRP N    N   6.370  -1.323  -4.052 1.00 . A A .  72 TRP N    1 1 
        4  6844 1 1  72 TRP NE1  N   8.796  -5.059  -3.421 1.00 . A A .  72 TRP NE1  1 1 
        4  6845 1 1  72 TRP O    O   6.847   0.550  -6.194 1.00 . A A .  72 TRP O    1 1 
        4  6846 1 1  73 ALA C    C   8.819   2.681  -7.007 1.00 . A A .  73 ALA C    1 1 
        4  6847 1 1  73 ALA CA   C   8.257   2.852  -5.582 1.00 . A A .  73 ALA CA   1 1 
        4  6848 1 1  73 ALA CB   C   9.037   3.931  -4.835 1.00 . A A .  73 ALA CB   1 1 
        4  6849 1 1  73 ALA H    H   8.834   1.530  -4.022 1.00 . A A .  73 ALA H    1 1 
        4  6850 1 1  73 ALA HA   H   7.228   3.174  -5.653 1.00 . A A .  73 ALA HA   1 1 
        4  6851 1 1  73 ALA HB1  H   8.638   4.035  -3.836 1.00 . A A .  73 ALA HB1  1 1 
        4  6852 1 1  73 ALA HB2  H   8.945   4.873  -5.358 1.00 . A A .  73 ALA HB2  1 1 
        4  6853 1 1  73 ALA HB3  H  10.079   3.652  -4.778 1.00 . A A .  73 ALA HB3  1 1 
        4  6854 1 1  73 ALA N    N   8.281   1.592  -4.827 1.00 . A A .  73 ALA N    1 1 
        4  6855 1 1  73 ALA O    O   9.510   1.704  -7.305 1.00 . A A .  73 ALA O    1 1 
        4  6856 1 1  74 ALA C    C  10.500   3.367  -9.420 1.00 . A A .  74 ALA C    1 1 
        4  6857 1 1  74 ALA CA   C   8.984   3.607  -9.281 1.00 . A A .  74 ALA CA   1 1 
        4  6858 1 1  74 ALA CB   C   8.593   4.896  -9.997 1.00 . A A .  74 ALA CB   1 1 
        4  6859 1 1  74 ALA H    H   7.979   4.407  -7.581 1.00 . A A .  74 ALA H    1 1 
        4  6860 1 1  74 ALA HA   H   8.461   2.792  -9.765 1.00 . A A .  74 ALA HA   1 1 
        4  6861 1 1  74 ALA HB1  H   9.106   5.733  -9.544 1.00 . A A .  74 ALA HB1  1 1 
        4  6862 1 1  74 ALA HB2  H   7.526   5.042  -9.919 1.00 . A A .  74 ALA HB2  1 1 
        4  6863 1 1  74 ALA HB3  H   8.870   4.828 -11.039 1.00 . A A .  74 ALA HB3  1 1 
        4  6864 1 1  74 ALA N    N   8.532   3.650  -7.878 1.00 . A A .  74 ALA N    1 1 
        4  6865 1 1  74 ALA O    O  10.971   2.927 -10.470 1.00 . A A .  74 ALA O    1 1 
        4  6866 1 1  75 ASN C    C  13.119   2.037  -7.954 1.00 . A A .  75 ASN C    1 1 
        4  6867 1 1  75 ASN CA   C  12.719   3.466  -8.367 1.00 . A A .  75 ASN CA   1 1 
        4  6868 1 1  75 ASN CB   C  13.382   4.490  -7.436 1.00 . A A .  75 ASN CB   1 1 
        4  6869 1 1  75 ASN CG   C  13.342   5.905  -7.988 1.00 . A A .  75 ASN CG   1 1 
        4  6870 1 1  75 ASN H    H  10.827   3.999  -7.551 1.00 . A A .  75 ASN H    1 1 
        4  6871 1 1  75 ASN HA   H  13.070   3.641  -9.376 1.00 . A A .  75 ASN HA   1 1 
        4  6872 1 1  75 ASN HB2  H  12.872   4.485  -6.484 1.00 . A A .  75 ASN HB2  1 1 
        4  6873 1 1  75 ASN HB3  H  14.417   4.214  -7.284 1.00 . A A .  75 ASN HB3  1 1 
        4  6874 1 1  75 ASN HD21 H  11.692   5.527  -9.015 1.00 . A A .  75 ASN HD21 1 1 
        4  6875 1 1  75 ASN HD22 H  12.325   7.123  -9.168 1.00 . A A .  75 ASN HD22 1 1 
        4  6876 1 1  75 ASN N    N  11.259   3.656  -8.362 1.00 . A A .  75 ASN N    1 1 
        4  6877 1 1  75 ASN ND2  N  12.352   6.213  -8.804 1.00 . A A .  75 ASN ND2  1 1 
        4  6878 1 1  75 ASN O    O  14.275   1.784  -7.614 1.00 . A A .  75 ASN O    1 1 
        4  6879 1 1  75 ASN OD1  O  14.206   6.723  -7.689 1.00 . A A .  75 ASN OD1  1 1 
        4  6880 1 1  76 ALA C    C  13.451  -0.883  -8.718 1.00 . A A .  76 ALA C    1 1 
        4  6881 1 1  76 ALA CA   C  12.446  -0.303  -7.710 1.00 . A A .  76 ALA CA   1 1 
        4  6882 1 1  76 ALA CB   C  11.155  -1.113  -7.729 1.00 . A A .  76 ALA CB   1 1 
        4  6883 1 1  76 ALA H    H  11.239   1.379  -8.184 1.00 . A A .  76 ALA H    1 1 
        4  6884 1 1  76 ALA HA   H  12.869  -0.369  -6.715 1.00 . A A .  76 ALA HA   1 1 
        4  6885 1 1  76 ALA HB1  H  10.727  -1.084  -8.721 1.00 . A A .  76 ALA HB1  1 1 
        4  6886 1 1  76 ALA HB2  H  10.454  -0.691  -7.023 1.00 . A A .  76 ALA HB2  1 1 
        4  6887 1 1  76 ALA HB3  H  11.365  -2.138  -7.458 1.00 . A A .  76 ALA HB3  1 1 
        4  6888 1 1  76 ALA N    N  12.162   1.108  -7.986 1.00 . A A .  76 ALA N    1 1 
        4  6889 1 1  76 ALA O    O  14.285  -1.720  -8.373 1.00 . A A .  76 ALA O    1 1 
        4  6890 1 1  77 GLY C    C  13.912  -2.240 -11.616 1.00 . A A .  77 GLY C    1 1 
        4  6891 1 1  77 GLY CA   C  14.279  -0.886 -11.013 1.00 . A A .  77 GLY CA   1 1 
        4  6892 1 1  77 GLY H    H  12.654   0.209 -10.196 1.00 . A A .  77 GLY H    1 1 
        4  6893 1 1  77 GLY HA2  H  14.292  -0.151 -11.803 1.00 . A A .  77 GLY HA2  1 1 
        4  6894 1 1  77 GLY HA3  H  15.273  -0.953 -10.592 1.00 . A A .  77 GLY HA3  1 1 
        4  6895 1 1  77 GLY N    N  13.356  -0.437  -9.973 1.00 . A A .  77 GLY N    1 1 
        4  6896 1 1  77 GLY O    O  14.251  -2.525 -12.766 1.00 . A A .  77 GLY O    1 1 
        4  6897 1 1  78 VAL C    C  11.750  -4.338 -12.406 1.00 . A A .  78 VAL C    1 1 
        4  6898 1 1  78 VAL CA   C  12.815  -4.409 -11.297 1.00 . A A .  78 VAL CA   1 1 
        4  6899 1 1  78 VAL CB   C  12.270  -5.251 -10.116 1.00 . A A .  78 VAL CB   1 1 
        4  6900 1 1  78 VAL CG1  C  13.334  -5.400  -9.028 1.00 . A A .  78 VAL CG1  1 1 
        4  6901 1 1  78 VAL CG2  C  10.994  -4.626  -9.550 1.00 . A A .  78 VAL CG2  1 1 
        4  6902 1 1  78 VAL H    H  12.989  -2.792  -9.939 1.00 . A A .  78 VAL H    1 1 
        4  6903 1 1  78 VAL HA   H  13.693  -4.908 -11.687 1.00 . A A .  78 VAL HA   1 1 
        4  6904 1 1  78 VAL HB   H  12.029  -6.240 -10.485 1.00 . A A .  78 VAL HB   1 1 
        4  6905 1 1  78 VAL HG11 H  12.926  -5.954  -8.196 1.00 . A A .  78 VAL HG11 1 1 
        4  6906 1 1  78 VAL HG12 H  13.645  -4.422  -8.690 1.00 . A A .  78 VAL HG12 1 1 
        4  6907 1 1  78 VAL HG13 H  14.186  -5.930  -9.428 1.00 . A A .  78 VAL HG13 1 1 
        4  6908 1 1  78 VAL HG21 H  10.614  -5.243  -8.749 1.00 . A A .  78 VAL HG21 1 1 
        4  6909 1 1  78 VAL HG22 H  10.252  -4.555 -10.331 1.00 . A A .  78 VAL HG22 1 1 
        4  6910 1 1  78 VAL HG23 H  11.211  -3.637  -9.170 1.00 . A A .  78 VAL HG23 1 1 
        4  6911 1 1  78 VAL N    N  13.224  -3.075 -10.842 1.00 . A A .  78 VAL N    1 1 
        4  6912 1 1  78 VAL O    O  11.115  -3.299 -12.612 1.00 . A A .  78 VAL O    1 1 
        4  6913 1 1  79 THR C    C   9.134  -5.683 -13.627 1.00 . A A .  79 THR C    1 1 
        4  6914 1 1  79 THR CA   C  10.550  -5.511 -14.190 1.00 . A A .  79 THR CA   1 1 
        4  6915 1 1  79 THR CB   C  10.831  -6.663 -15.189 1.00 . A A .  79 THR CB   1 1 
        4  6916 1 1  79 THR CG2  C  10.879  -8.018 -14.484 1.00 . A A .  79 THR CG2  1 1 
        4  6917 1 1  79 THR H    H  12.099  -6.242 -12.923 1.00 . A A .  79 THR H    1 1 
        4  6918 1 1  79 THR HA   H  10.594  -4.577 -14.736 1.00 . A A .  79 THR HA   1 1 
        4  6919 1 1  79 THR HB   H  11.788  -6.483 -15.657 1.00 . A A .  79 THR HB   1 1 
        4  6920 1 1  79 THR HG1  H  10.124  -7.217 -16.951 1.00 . A A .  79 THR HG1  1 1 
        4  6921 1 1  79 THR HG21 H  11.089  -8.792 -15.209 1.00 . A A .  79 THR HG21 1 1 
        4  6922 1 1  79 THR HG22 H   9.926  -8.213 -14.015 1.00 . A A .  79 THR HG22 1 1 
        4  6923 1 1  79 THR HG23 H  11.655  -8.009 -13.732 1.00 . A A .  79 THR HG23 1 1 
        4  6924 1 1  79 THR N    N  11.556  -5.447 -13.119 1.00 . A A .  79 THR N    1 1 
        4  6925 1 1  79 THR O    O   8.925  -6.382 -12.631 1.00 . A A .  79 THR O    1 1 
        4  6926 1 1  79 THR OG1  O   9.817  -6.688 -16.203 1.00 . A A .  79 THR OG1  1 1 
        4  6927 1 1  80 ALA C    C   6.127  -6.468 -14.206 1.00 . A A .  80 ALA C    1 1 
        4  6928 1 1  80 ALA CA   C   6.768  -5.123 -13.820 1.00 . A A .  80 ALA CA   1 1 
        4  6929 1 1  80 ALA CB   C   5.964  -3.955 -14.388 1.00 . A A .  80 ALA CB   1 1 
        4  6930 1 1  80 ALA H    H   8.377  -4.530 -15.071 1.00 . A A .  80 ALA H    1 1 
        4  6931 1 1  80 ALA HA   H   6.765  -5.036 -12.740 1.00 . A A .  80 ALA HA   1 1 
        4  6932 1 1  80 ALA HB1  H   4.963  -3.974 -13.984 1.00 . A A .  80 ALA HB1  1 1 
        4  6933 1 1  80 ALA HB2  H   5.920  -4.036 -15.465 1.00 . A A .  80 ALA HB2  1 1 
        4  6934 1 1  80 ALA HB3  H   6.443  -3.023 -14.120 1.00 . A A .  80 ALA HB3  1 1 
        4  6935 1 1  80 ALA N    N   8.158  -5.051 -14.270 1.00 . A A .  80 ALA N    1 1 
        4  6936 1 1  80 ALA O    O   5.379  -6.559 -15.184 1.00 . A A .  80 ALA O    1 1 
        4  6937 1 1  81 SER C    C   5.451  -9.564 -12.426 1.00 . A A .  81 SER C    1 1 
        4  6938 1 1  81 SER CA   C   5.908  -8.861 -13.718 1.00 . A A .  81 SER CA   1 1 
        4  6939 1 1  81 SER CB   C   6.958  -9.726 -14.441 1.00 . A A .  81 SER CB   1 1 
        4  6940 1 1  81 SER H    H   7.057  -7.389 -12.690 1.00 . A A .  81 SER H    1 1 
        4  6941 1 1  81 SER HA   H   5.050  -8.749 -14.368 1.00 . A A .  81 SER HA   1 1 
        4  6942 1 1  81 SER HB2  H   7.289  -9.214 -15.333 1.00 . A A .  81 SER HB2  1 1 
        4  6943 1 1  81 SER HB3  H   7.804  -9.888 -13.786 1.00 . A A .  81 SER HB3  1 1 
        4  6944 1 1  81 SER HG   H   6.504 -11.605 -14.079 1.00 . A A .  81 SER HG   1 1 
        4  6945 1 1  81 SER N    N   6.442  -7.517 -13.446 1.00 . A A .  81 SER N    1 1 
        4  6946 1 1  81 SER O    O   6.262 -10.149 -11.708 1.00 . A A .  81 SER O    1 1 
        4  6947 1 1  81 SER OG   O   6.422 -10.986 -14.817 1.00 . A A .  81 SER OG   1 1 
        4  6948 1 1  82 PRO C    C   3.412 -11.709 -11.194 1.00 . A A .  82 PRO C    1 1 
        4  6949 1 1  82 PRO CA   C   3.548 -10.186 -10.938 1.00 . A A .  82 PRO CA   1 1 
        4  6950 1 1  82 PRO CB   C   2.156  -9.518 -10.795 1.00 . A A .  82 PRO CB   1 1 
        4  6951 1 1  82 PRO CD   C   3.146  -8.650 -12.786 1.00 . A A .  82 PRO CD   1 1 
        4  6952 1 1  82 PRO CG   C   2.202  -8.306 -11.672 1.00 . A A .  82 PRO CG   1 1 
        4  6953 1 1  82 PRO HA   H   4.126 -10.026 -10.036 1.00 . A A .  82 PRO HA   1 1 
        4  6954 1 1  82 PRO HB2  H   1.385 -10.206 -11.118 1.00 . A A .  82 PRO HB2  1 1 
        4  6955 1 1  82 PRO HB3  H   1.989  -9.250  -9.763 1.00 . A A .  82 PRO HB3  1 1 
        4  6956 1 1  82 PRO HD2  H   2.640  -9.215 -13.558 1.00 . A A .  82 PRO HD2  1 1 
        4  6957 1 1  82 PRO HD3  H   3.595  -7.756 -13.197 1.00 . A A .  82 PRO HD3  1 1 
        4  6958 1 1  82 PRO HG2  H   1.216  -8.093 -12.063 1.00 . A A .  82 PRO HG2  1 1 
        4  6959 1 1  82 PRO HG3  H   2.574  -7.459 -11.111 1.00 . A A .  82 PRO HG3  1 1 
        4  6960 1 1  82 PRO N    N   4.144  -9.473 -12.093 1.00 . A A .  82 PRO N    1 1 
        4  6961 1 1  82 PRO O    O   3.727 -12.179 -12.289 1.00 . A A .  82 PRO O    1 1 
        4  6962 1 1  83 PRO C    C   3.528 -12.307  -7.764 1.00 . A A .  83 PRO C    1 1 
        4  6963 1 1  83 PRO CA   C   2.490 -12.068  -8.884 1.00 . A A .  83 PRO CA   1 1 
        4  6964 1 1  83 PRO CB   C   1.252 -12.941  -8.663 1.00 . A A .  83 PRO CB   1 1 
        4  6965 1 1  83 PRO CD   C   2.688 -13.960 -10.352 1.00 . A A .  83 PRO CD   1 1 
        4  6966 1 1  83 PRO CG   C   1.552 -14.232  -9.379 1.00 . A A .  83 PRO CG   1 1 
        4  6967 1 1  83 PRO HA   H   2.194 -11.027  -8.885 1.00 . A A .  83 PRO HA   1 1 
        4  6968 1 1  83 PRO HB2  H   1.096 -13.100  -7.606 1.00 . A A .  83 PRO HB2  1 1 
        4  6969 1 1  83 PRO HB3  H   0.385 -12.451  -9.087 1.00 . A A .  83 PRO HB3  1 1 
        4  6970 1 1  83 PRO HD2  H   3.571 -14.517 -10.070 1.00 . A A .  83 PRO HD2  1 1 
        4  6971 1 1  83 PRO HD3  H   2.391 -14.210 -11.361 1.00 . A A .  83 PRO HD3  1 1 
        4  6972 1 1  83 PRO HG2  H   1.849 -14.984  -8.662 1.00 . A A .  83 PRO HG2  1 1 
        4  6973 1 1  83 PRO HG3  H   0.672 -14.562  -9.916 1.00 . A A .  83 PRO HG3  1 1 
        4  6974 1 1  83 PRO N    N   2.916 -12.513 -10.214 1.00 . A A .  83 PRO N    1 1 
        4  6975 1 1  83 PRO O    O   3.906 -13.440  -7.470 1.00 . A A .  83 PRO O    1 1 
        4  6976 1 1  84 THR C    C   4.672 -10.004  -5.123 1.00 . A A .  84 THR C    1 1 
        4  6977 1 1  84 THR CA   C   4.833 -11.283  -5.948 1.00 . A A .  84 THR CA   1 1 
        4  6978 1 1  84 THR CB   C   6.335 -11.498  -6.298 1.00 . A A .  84 THR CB   1 1 
        4  6979 1 1  84 THR CG2  C   6.805 -10.554  -7.406 1.00 . A A .  84 THR CG2  1 1 
        4  6980 1 1  84 THR H    H   3.716 -10.344  -7.489 1.00 . A A .  84 THR H    1 1 
        4  6981 1 1  84 THR HA   H   4.502 -12.120  -5.348 1.00 . A A .  84 THR HA   1 1 
        4  6982 1 1  84 THR HB   H   6.459 -12.516  -6.643 1.00 . A A .  84 THR HB   1 1 
        4  6983 1 1  84 THR HG1  H   7.331 -10.367  -5.003 1.00 . A A .  84 THR HG1  1 1 
        4  6984 1 1  84 THR HG21 H   6.218 -10.721  -8.295 1.00 . A A .  84 THR HG21 1 1 
        4  6985 1 1  84 THR HG22 H   7.848 -10.741  -7.621 1.00 . A A .  84 THR HG22 1 1 
        4  6986 1 1  84 THR HG23 H   6.685  -9.529  -7.082 1.00 . A A .  84 THR HG23 1 1 
        4  6987 1 1  84 THR N    N   3.973 -11.220  -7.141 1.00 . A A .  84 THR N    1 1 
        4  6988 1 1  84 THR O    O   4.316 -10.044  -3.945 1.00 . A A .  84 THR O    1 1 
        4  6989 1 1  84 THR OG1  O   7.150 -11.312  -5.126 1.00 . A A .  84 THR OG1  1 1 
        4  6990 1 1  85 ASP C    C   4.133  -6.586  -6.207 1.00 . A A .  85 ASP C    1 1 
        4  6991 1 1  85 ASP CA   C   4.708  -7.552  -5.161 1.00 . A A .  85 ASP CA   1 1 
        4  6992 1 1  85 ASP CB   C   6.027  -7.003  -4.608 1.00 . A A .  85 ASP CB   1 1 
        4  6993 1 1  85 ASP CG   C   6.624  -7.895  -3.537 1.00 . A A .  85 ASP CG   1 1 
        4  6994 1 1  85 ASP H    H   5.248  -8.908  -6.683 1.00 . A A .  85 ASP H    1 1 
        4  6995 1 1  85 ASP HA   H   3.997  -7.658  -4.353 1.00 . A A .  85 ASP HA   1 1 
        4  6996 1 1  85 ASP HB2  H   6.740  -6.909  -5.414 1.00 . A A .  85 ASP HB2  1 1 
        4  6997 1 1  85 ASP HB3  H   5.851  -6.025  -4.178 1.00 . A A .  85 ASP HB3  1 1 
        4  6998 1 1  85 ASP N    N   4.916  -8.867  -5.766 1.00 . A A .  85 ASP N    1 1 
        4  6999 1 1  85 ASP O    O   3.970  -6.952  -7.374 1.00 . A A .  85 ASP O    1 1 
        4  7000 1 1  85 ASP OD1  O   6.165  -7.832  -2.377 1.00 . A A .  85 ASP OD1  1 1 
        4  7001 1 1  85 ASP OD2  O   7.558  -8.665  -3.850 1.00 . A A .  85 ASP OD2  1 1 
        4  7002 1 1  86 LEU C    C   4.151  -3.097  -6.740 1.00 . A A .  86 LEU C    1 1 
        4  7003 1 1  86 LEU CA   C   3.276  -4.357  -6.716 1.00 . A A .  86 LEU CA   1 1 
        4  7004 1 1  86 LEU CB   C   1.840  -3.995  -6.316 1.00 . A A .  86 LEU CB   1 1 
        4  7005 1 1  86 LEU CD1  C  -0.558  -4.683  -5.933 1.00 . A A .  86 LEU CD1  1 1 
        4  7006 1 1  86 LEU CD2  C   0.736  -5.679  -7.843 1.00 . A A .  86 LEU CD2  1 1 
        4  7007 1 1  86 LEU CG   C   0.816  -5.141  -6.412 1.00 . A A .  86 LEU CG   1 1 
        4  7008 1 1  86 LEU H    H   3.980  -5.115  -4.857 1.00 . A A .  86 LEU H    1 1 
        4  7009 1 1  86 LEU HA   H   3.264  -4.786  -7.709 1.00 . A A .  86 LEU HA   1 1 
        4  7010 1 1  86 LEU HB2  H   1.855  -3.640  -5.295 1.00 . A A .  86 LEU HB2  1 1 
        4  7011 1 1  86 LEU HB3  H   1.504  -3.188  -6.952 1.00 . A A .  86 LEU HB3  1 1 
        4  7012 1 1  86 LEU HD11 H  -0.913  -3.876  -6.559 1.00 . A A .  86 LEU HD11 1 1 
        4  7013 1 1  86 LEU HD12 H  -0.487  -4.338  -4.911 1.00 . A A .  86 LEU HD12 1 1 
        4  7014 1 1  86 LEU HD13 H  -1.251  -5.511  -5.983 1.00 . A A .  86 LEU HD13 1 1 
        4  7015 1 1  86 LEU HD21 H   0.448  -4.883  -8.514 1.00 . A A .  86 LEU HD21 1 1 
        4  7016 1 1  86 LEU HD22 H   0.006  -6.473  -7.890 1.00 . A A .  86 LEU HD22 1 1 
        4  7017 1 1  86 LEU HD23 H   1.703  -6.064  -8.136 1.00 . A A .  86 LEU HD23 1 1 
        4  7018 1 1  86 LEU HG   H   1.134  -5.951  -5.771 1.00 . A A .  86 LEU HG   1 1 
        4  7019 1 1  86 LEU N    N   3.826  -5.361  -5.796 1.00 . A A .  86 LEU N    1 1 
        4  7020 1 1  86 LEU O    O   4.408  -2.488  -5.705 1.00 . A A .  86 LEU O    1 1 
        4  7021 1 1  87 ILE C    C   4.675  -0.272  -8.384 1.00 . A A .  87 ILE C    1 1 
        4  7022 1 1  87 ILE CA   C   5.484  -1.541  -8.063 1.00 . A A .  87 ILE CA   1 1 
        4  7023 1 1  87 ILE CB   C   6.575  -1.751  -9.156 1.00 . A A .  87 ILE CB   1 1 
        4  7024 1 1  87 ILE CD1  C   6.790  -4.320  -9.037 1.00 . A A .  87 ILE CD1  1 1 
        4  7025 1 1  87 ILE CG1  C   7.463  -2.974  -8.836 1.00 . A A .  87 ILE CG1  1 1 
        4  7026 1 1  87 ILE CG2  C   7.441  -0.498  -9.293 1.00 . A A .  87 ILE CG2  1 1 
        4  7027 1 1  87 ILE H    H   4.356  -3.213  -8.724 1.00 . A A .  87 ILE H    1 1 
        4  7028 1 1  87 ILE HA   H   5.990  -1.395  -7.115 1.00 . A A .  87 ILE HA   1 1 
        4  7029 1 1  87 ILE HB   H   6.074  -1.916 -10.102 1.00 . A A .  87 ILE HB   1 1 
        4  7030 1 1  87 ILE HD11 H   5.909  -4.378  -8.415 1.00 . A A .  87 ILE HD11 1 1 
        4  7031 1 1  87 ILE HD12 H   7.475  -5.108  -8.763 1.00 . A A .  87 ILE HD12 1 1 
        4  7032 1 1  87 ILE HD13 H   6.508  -4.433 -10.073 1.00 . A A .  87 ILE HD13 1 1 
        4  7033 1 1  87 ILE HG12 H   8.338  -2.951  -9.469 1.00 . A A .  87 ILE HG12 1 1 
        4  7034 1 1  87 ILE HG13 H   7.778  -2.917  -7.803 1.00 . A A .  87 ILE HG13 1 1 
        4  7035 1 1  87 ILE HG21 H   8.191  -0.658 -10.055 1.00 . A A .  87 ILE HG21 1 1 
        4  7036 1 1  87 ILE HG22 H   7.925  -0.290  -8.351 1.00 . A A .  87 ILE HG22 1 1 
        4  7037 1 1  87 ILE HG23 H   6.821   0.344  -9.572 1.00 . A A .  87 ILE HG23 1 1 
        4  7038 1 1  87 ILE N    N   4.610  -2.709  -7.925 1.00 . A A .  87 ILE N    1 1 
        4  7039 1 1  87 ILE O    O   4.093  -0.142  -9.464 1.00 . A A .  87 ILE O    1 1 
        4  7040 1 1  88 TRP C    C   4.733   2.835  -8.583 1.00 . A A .  88 TRP C    1 1 
        4  7041 1 1  88 TRP CA   C   3.951   1.938  -7.607 1.00 . A A .  88 TRP CA   1 1 
        4  7042 1 1  88 TRP CB   C   3.793   2.638  -6.246 1.00 . A A .  88 TRP CB   1 1 
        4  7043 1 1  88 TRP CD1  C   2.229   4.399  -7.300 1.00 . A A .  88 TRP CD1  1 1 
        4  7044 1 1  88 TRP CD2  C   2.238   4.392  -5.062 1.00 . A A .  88 TRP CD2  1 1 
        4  7045 1 1  88 TRP CE2  C   1.349   5.388  -5.506 1.00 . A A .  88 TRP CE2  1 1 
        4  7046 1 1  88 TRP CE3  C   2.405   4.208  -3.687 1.00 . A A .  88 TRP CE3  1 1 
        4  7047 1 1  88 TRP CG   C   2.793   3.766  -6.226 1.00 . A A .  88 TRP CG   1 1 
        4  7048 1 1  88 TRP CH2  C   0.812   5.989  -3.291 1.00 . A A .  88 TRP CH2  1 1 
        4  7049 1 1  88 TRP CZ2  C   0.631   6.191  -4.628 1.00 . A A .  88 TRP CZ2  1 1 
        4  7050 1 1  88 TRP CZ3  C   1.691   5.009  -2.817 1.00 . A A .  88 TRP CZ3  1 1 
        4  7051 1 1  88 TRP H    H   5.072   0.470  -6.573 1.00 . A A .  88 TRP H    1 1 
        4  7052 1 1  88 TRP HA   H   2.969   1.743  -8.021 1.00 . A A .  88 TRP HA   1 1 
        4  7053 1 1  88 TRP HB2  H   3.476   1.910  -5.516 1.00 . A A .  88 TRP HB2  1 1 
        4  7054 1 1  88 TRP HB3  H   4.751   3.039  -5.946 1.00 . A A .  88 TRP HB3  1 1 
        4  7055 1 1  88 TRP HD1  H   2.442   4.157  -8.331 1.00 . A A .  88 TRP HD1  1 1 
        4  7056 1 1  88 TRP HE1  H   0.832   5.960  -7.455 1.00 . A A .  88 TRP HE1  1 1 
        4  7057 1 1  88 TRP HE3  H   3.076   3.456  -3.302 1.00 . A A .  88 TRP HE3  1 1 
        4  7058 1 1  88 TRP HH2  H   0.276   6.592  -2.575 1.00 . A A .  88 TRP HH2  1 1 
        4  7059 1 1  88 TRP HZ2  H  -0.053   6.952  -4.978 1.00 . A A .  88 TRP HZ2  1 1 
        4  7060 1 1  88 TRP HZ3  H   1.807   4.879  -1.751 1.00 . A A .  88 TRP HZ3  1 1 
        4  7061 1 1  88 TRP N    N   4.631   0.655  -7.429 1.00 . A A .  88 TRP N    1 1 
        4  7062 1 1  88 TRP NE1  N   1.360   5.370  -6.873 1.00 . A A .  88 TRP NE1  1 1 
        4  7063 1 1  88 TRP O    O   5.450   3.751  -8.174 1.00 . A A .  88 TRP O    1 1 
        4  7064 1 1  89 LYS C    C   4.596   4.683 -11.160 1.00 . A A .  89 LYS C    1 1 
        4  7065 1 1  89 LYS CA   C   5.287   3.331 -10.913 1.00 . A A .  89 LYS CA   1 1 
        4  7066 1 1  89 LYS CB   C   5.365   2.514 -12.212 1.00 . A A .  89 LYS CB   1 1 
        4  7067 1 1  89 LYS CD   C   6.195   0.379 -13.345 1.00 . A A .  89 LYS CD   1 1 
        4  7068 1 1  89 LYS CE   C   7.128   0.986 -14.394 1.00 . A A .  89 LYS CE   1 1 
        4  7069 1 1  89 LYS CG   C   6.130   1.202 -12.053 1.00 . A A .  89 LYS CG   1 1 
        4  7070 1 1  89 LYS H    H   4.035   1.795 -10.140 1.00 . A A .  89 LYS H    1 1 
        4  7071 1 1  89 LYS HA   H   6.293   3.522 -10.563 1.00 . A A .  89 LYS HA   1 1 
        4  7072 1 1  89 LYS HB2  H   4.362   2.287 -12.543 1.00 . A A .  89 LYS HB2  1 1 
        4  7073 1 1  89 LYS HB3  H   5.860   3.106 -12.969 1.00 . A A .  89 LYS HB3  1 1 
        4  7074 1 1  89 LYS HD2  H   6.545  -0.615 -13.105 1.00 . A A .  89 LYS HD2  1 1 
        4  7075 1 1  89 LYS HD3  H   5.199   0.312 -13.762 1.00 . A A .  89 LYS HD3  1 1 
        4  7076 1 1  89 LYS HE2  H   8.049   1.279 -13.914 1.00 . A A .  89 LYS HE2  1 1 
        4  7077 1 1  89 LYS HE3  H   7.343   0.234 -15.141 1.00 . A A .  89 LYS HE3  1 1 
        4  7078 1 1  89 LYS HG2  H   7.139   1.425 -11.737 1.00 . A A .  89 LYS HG2  1 1 
        4  7079 1 1  89 LYS HG3  H   5.643   0.611 -11.289 1.00 . A A .  89 LYS HG3  1 1 
        4  7080 1 1  89 LYS HZ1  H   5.662   1.911 -15.559 1.00 . A A .  89 LYS HZ1  1 1 
        4  7081 1 1  89 LYS HZ2  H   7.209   2.557 -15.769 1.00 . A A .  89 LYS HZ2  1 1 
        4  7082 1 1  89 LYS HZ3  H   6.326   2.919 -14.379 1.00 . A A .  89 LYS HZ3  1 1 
        4  7083 1 1  89 LYS N    N   4.599   2.554  -9.875 1.00 . A A .  89 LYS N    1 1 
        4  7084 1 1  89 LYS NZ   N   6.541   2.175 -15.070 1.00 . A A .  89 LYS NZ   1 1 
        4  7085 1 1  89 LYS O    O   5.018   5.467 -12.018 1.00 . A A .  89 LYS O    1 1 
        4  7086 1 1  90 ASN C    C   3.312   7.260  -9.483 1.00 . A A .  90 ASN C    1 1 
        4  7087 1 1  90 ASN CA   C   2.798   6.217 -10.493 1.00 . A A .  90 ASN CA   1 1 
        4  7088 1 1  90 ASN CB   C   1.304   5.963 -10.274 1.00 . A A .  90 ASN CB   1 1 
        4  7089 1 1  90 ASN CG   C   0.738   4.980 -11.280 1.00 . A A .  90 ASN CG   1 1 
        4  7090 1 1  90 ASN H    H   3.238   4.279  -9.753 1.00 . A A .  90 ASN H    1 1 
        4  7091 1 1  90 ASN HA   H   2.942   6.608 -11.492 1.00 . A A .  90 ASN HA   1 1 
        4  7092 1 1  90 ASN HB2  H   1.151   5.564  -9.281 1.00 . A A .  90 ASN HB2  1 1 
        4  7093 1 1  90 ASN HB3  H   0.766   6.895 -10.367 1.00 . A A .  90 ASN HB3  1 1 
        4  7094 1 1  90 ASN HD21 H   0.246   6.462 -12.494 1.00 . A A .  90 ASN HD21 1 1 
        4  7095 1 1  90 ASN HD22 H  -0.137   4.872 -13.045 1.00 . A A .  90 ASN HD22 1 1 
        4  7096 1 1  90 ASN N    N   3.538   4.953 -10.396 1.00 . A A .  90 ASN N    1 1 
        4  7097 1 1  90 ASN ND2  N   0.231   5.489 -12.383 1.00 . A A .  90 ASN ND2  1 1 
        4  7098 1 1  90 ASN O    O   2.853   8.403  -9.477 1.00 . A A .  90 ASN O    1 1 
        4  7099 1 1  90 ASN OD1  O   0.755   3.773 -11.067 1.00 . A A .  90 ASN OD1  1 1 
        4  7100 1 1  91 GLN C    C   6.401   7.587  -7.595 1.00 . A A .  91 GLN C    1 1 
        4  7101 1 1  91 GLN CA   C   4.882   7.805  -7.683 1.00 . A A .  91 GLN CA   1 1 
        4  7102 1 1  91 GLN CB   C   4.278   7.676  -6.272 1.00 . A A .  91 GLN CB   1 1 
        4  7103 1 1  91 GLN CD   C   4.438   8.547  -3.865 1.00 . A A .  91 GLN CD   1 1 
        4  7104 1 1  91 GLN CG   C   4.698   8.814  -5.340 1.00 . A A .  91 GLN CG   1 1 
        4  7105 1 1  91 GLN H    H   4.544   5.929  -8.628 1.00 . A A .  91 GLN H    1 1 
        4  7106 1 1  91 GLN HA   H   4.702   8.808  -8.049 1.00 . A A .  91 GLN HA   1 1 
        4  7107 1 1  91 GLN HB2  H   3.198   7.679  -6.351 1.00 . A A .  91 GLN HB2  1 1 
        4  7108 1 1  91 GLN HB3  H   4.598   6.740  -5.836 1.00 . A A .  91 GLN HB3  1 1 
        4  7109 1 1  91 GLN HE21 H   5.939   9.741  -3.377 1.00 . A A .  91 GLN HE21 1 1 
        4  7110 1 1  91 GLN HE22 H   5.089   9.015  -2.061 1.00 . A A .  91 GLN HE22 1 1 
        4  7111 1 1  91 GLN HG2  H   5.757   8.987  -5.468 1.00 . A A .  91 GLN HG2  1 1 
        4  7112 1 1  91 GLN HG3  H   4.159   9.708  -5.625 1.00 . A A .  91 GLN HG3  1 1 
        4  7113 1 1  91 GLN N    N   4.258   6.867  -8.627 1.00 . A A .  91 GLN N    1 1 
        4  7114 1 1  91 GLN NE2  N   5.236   9.159  -3.012 1.00 . A A .  91 GLN NE2  1 1 
        4  7115 1 1  91 GLN O    O   6.896   6.468  -7.755 1.00 . A A .  91 GLN O    1 1 
        4  7116 1 1  91 GLN OE1  O   3.529   7.813  -3.488 1.00 . A A .  91 GLN OE1  1 1 
        4  7117 1 1  92 ASN C    C   8.912   8.424  -5.636 1.00 . A A .  92 ASN C    1 1 
        4  7118 1 1  92 ASN CA   C   8.581   8.602  -7.133 1.00 . A A .  92 ASN CA   1 1 
        4  7119 1 1  92 ASN CB   C   9.234   9.876  -7.679 1.00 . A A .  92 ASN CB   1 1 
        4  7120 1 1  92 ASN CG   C   8.891  10.119  -9.141 1.00 . A A .  92 ASN CG   1 1 
        4  7121 1 1  92 ASN H    H   6.685   9.540  -7.293 1.00 . A A .  92 ASN H    1 1 
        4  7122 1 1  92 ASN HA   H   8.960   7.748  -7.679 1.00 . A A .  92 ASN HA   1 1 
        4  7123 1 1  92 ASN HB2  H   8.893  10.726  -7.103 1.00 . A A .  92 ASN HB2  1 1 
        4  7124 1 1  92 ASN HB3  H  10.308   9.793  -7.587 1.00 . A A .  92 ASN HB3  1 1 
        4  7125 1 1  92 ASN HD21 H  10.468   9.080  -9.726 1.00 . A A .  92 ASN HD21 1 1 
        4  7126 1 1  92 ASN HD22 H   9.489   9.736 -10.987 1.00 . A A .  92 ASN HD22 1 1 
        4  7127 1 1  92 ASN N    N   7.132   8.668  -7.341 1.00 . A A .  92 ASN N    1 1 
        4  7128 1 1  92 ASN ND2  N   9.697   9.592 -10.039 1.00 . A A .  92 ASN ND2  1 1 
        4  7129 1 1  92 ASN O    O   8.013   8.261  -4.807 1.00 . A A .  92 ASN O    1 1 
        4  7130 1 1  92 ASN OD1  O   7.905  10.776  -9.463 1.00 . A A .  92 ASN OD1  1 1 
        4  7131 1 1  93 SER C    C  10.110   9.465  -3.022 1.00 . A A .  93 SER C    1 1 
        4  7132 1 1  93 SER CA   C  10.620   8.299  -3.886 1.00 . A A .  93 SER CA   1 1 
        4  7133 1 1  93 SER CB   C  12.151   8.200  -3.781 1.00 . A A .  93 SER CB   1 1 
        4  7134 1 1  93 SER H    H  10.879   8.589  -5.981 1.00 . A A .  93 SER H    1 1 
        4  7135 1 1  93 SER HA   H  10.186   7.379  -3.517 1.00 . A A .  93 SER HA   1 1 
        4  7136 1 1  93 SER HB2  H  12.429   8.002  -2.756 1.00 . A A .  93 SER HB2  1 1 
        4  7137 1 1  93 SER HB3  H  12.500   7.391  -4.408 1.00 . A A .  93 SER HB3  1 1 
        4  7138 1 1  93 SER HG   H  13.147   9.282  -5.085 1.00 . A A .  93 SER HG   1 1 
        4  7139 1 1  93 SER N    N  10.199   8.455  -5.289 1.00 . A A .  93 SER N    1 1 
        4  7140 1 1  93 SER O    O  10.424  10.630  -3.274 1.00 . A A .  93 SER O    1 1 
        4  7141 1 1  93 SER OG   O  12.783   9.403  -4.197 1.00 . A A .  93 SER OG   1 1 
        4  7142 1 1  94 TRP C    C   9.730  10.703  -0.102 1.00 . A A .  94 TRP C    1 1 
        4  7143 1 1  94 TRP CA   C   8.719  10.160  -1.128 1.00 . A A .  94 TRP CA   1 1 
        4  7144 1 1  94 TRP CB   C   7.468   9.600  -0.425 1.00 . A A .  94 TRP CB   1 1 
        4  7145 1 1  94 TRP CD1  C   7.973   8.101   1.617 1.00 . A A .  94 TRP CD1  1 1 
        4  7146 1 1  94 TRP CD2  C   7.581   6.975  -0.281 1.00 . A A .  94 TRP CD2  1 1 
        4  7147 1 1  94 TRP CE2  C   7.829   6.047   0.750 1.00 . A A .  94 TRP CE2  1 1 
        4  7148 1 1  94 TRP CE3  C   7.311   6.495  -1.567 1.00 . A A .  94 TRP CE3  1 1 
        4  7149 1 1  94 TRP CG   C   7.676   8.287   0.293 1.00 . A A .  94 TRP CG   1 1 
        4  7150 1 1  94 TRP CH2  C   7.544   4.233  -0.737 1.00 . A A .  94 TRP CH2  1 1 
        4  7151 1 1  94 TRP CZ2  C   7.813   4.671   0.531 1.00 . A A .  94 TRP CZ2  1 1 
        4  7152 1 1  94 TRP CZ3  C   7.297   5.131  -1.781 1.00 . A A .  94 TRP CZ3  1 1 
        4  7153 1 1  94 TRP H    H   9.121   8.200  -1.834 1.00 . A A .  94 TRP H    1 1 
        4  7154 1 1  94 TRP HA   H   8.410  10.981  -1.763 1.00 . A A .  94 TRP HA   1 1 
        4  7155 1 1  94 TRP HB2  H   7.120  10.321   0.302 1.00 . A A .  94 TRP HB2  1 1 
        4  7156 1 1  94 TRP HB3  H   6.693   9.453  -1.165 1.00 . A A .  94 TRP HB3  1 1 
        4  7157 1 1  94 TRP HD1  H   8.111   8.901   2.327 1.00 . A A .  94 TRP HD1  1 1 
        4  7158 1 1  94 TRP HE1  H   8.268   6.367   2.782 1.00 . A A .  94 TRP HE1  1 1 
        4  7159 1 1  94 TRP HE3  H   7.116   7.174  -2.387 1.00 . A A .  94 TRP HE3  1 1 
        4  7160 1 1  94 TRP HH2  H   7.524   3.175  -0.951 1.00 . A A .  94 TRP HH2  1 1 
        4  7161 1 1  94 TRP HZ2  H   8.003   3.963   1.327 1.00 . A A .  94 TRP HZ2  1 1 
        4  7162 1 1  94 TRP HZ3  H   7.089   4.745  -2.768 1.00 . A A .  94 TRP HZ3  1 1 
        4  7163 1 1  94 TRP N    N   9.314   9.142  -2.003 1.00 . A A .  94 TRP N    1 1 
        4  7164 1 1  94 TRP NE1  N   8.062   6.757   1.897 1.00 . A A .  94 TRP NE1  1 1 
        4  7165 1 1  94 TRP O    O  10.256   9.963   0.729 1.00 . A A .  94 TRP O    1 1 
        4  7166 1 1  95 GLY C    C  11.209  14.100   0.359 1.00 . A A .  95 GLY C    1 1 
        4  7167 1 1  95 GLY CA   C  10.929  12.650   0.739 1.00 . A A .  95 GLY CA   1 1 
        4  7168 1 1  95 GLY H    H   9.576  12.532  -0.892 1.00 . A A .  95 GLY H    1 1 
        4  7169 1 1  95 GLY HA2  H  10.509  12.623   1.734 1.00 . A A .  95 GLY HA2  1 1 
        4  7170 1 1  95 GLY HA3  H  11.863  12.102   0.739 1.00 . A A .  95 GLY HA3  1 1 
        4  7171 1 1  95 GLY N    N  10.001  12.004  -0.184 1.00 . A A .  95 GLY N    1 1 
        4  7172 1 1  95 GLY O    O  11.969  14.367  -0.571 1.00 . A A .  95 GLY O    1 1 
        4  7173 1 1  96 THR C    C  10.420  17.364   1.969 1.00 . A A .  96 THR C    1 1 
        4  7174 1 1  96 THR CA   C  10.731  16.474   0.751 1.00 . A A .  96 THR CA   1 1 
        4  7175 1 1  96 THR CB   C   9.803  16.870  -0.432 1.00 . A A .  96 THR CB   1 1 
        4  7176 1 1  96 THR CG2  C   8.329  16.739  -0.049 1.00 . A A .  96 THR CG2  1 1 
        4  7177 1 1  96 THR H    H  10.027  14.771   1.828 1.00 . A A .  96 THR H    1 1 
        4  7178 1 1  96 THR HA   H  11.756  16.647   0.449 1.00 . A A .  96 THR HA   1 1 
        4  7179 1 1  96 THR HB   H  10.000  16.198  -1.255 1.00 . A A .  96 THR HB   1 1 
        4  7180 1 1  96 THR HG1  H  10.217  18.783  -0.092 1.00 . A A .  96 THR HG1  1 1 
        4  7181 1 1  96 THR HG21 H   8.116  17.378   0.797 1.00 . A A .  96 THR HG21 1 1 
        4  7182 1 1  96 THR HG22 H   8.113  15.713   0.213 1.00 . A A .  96 THR HG22 1 1 
        4  7183 1 1  96 THR HG23 H   7.710  17.034  -0.884 1.00 . A A .  96 THR HG23 1 1 
        4  7184 1 1  96 THR N    N  10.588  15.042   1.071 1.00 . A A .  96 THR N    1 1 
        4  7185 1 1  96 THR O    O  10.039  18.529   1.823 1.00 . A A .  96 THR O    1 1 
        4  7186 1 1  96 THR OG1  O  10.071  18.217  -0.866 1.00 . A A .  96 THR OG1  1 1 
        4  7187 1 1  97 GLY C    C   8.785  17.536   4.723 1.00 . A A .  97 GLY C    1 1 
        4  7188 1 1  97 GLY CA   C  10.279  17.556   4.394 1.00 . A A .  97 GLY CA   1 1 
        4  7189 1 1  97 GLY H    H  10.998  15.923   3.234 1.00 . A A .  97 GLY H    1 1 
        4  7190 1 1  97 GLY HA2  H  10.822  17.115   5.218 1.00 . A A .  97 GLY HA2  1 1 
        4  7191 1 1  97 GLY HA3  H  10.596  18.584   4.282 1.00 . A A .  97 GLY HA3  1 1 
        4  7192 1 1  97 GLY N    N  10.608  16.821   3.170 1.00 . A A .  97 GLY N    1 1 
        4  7193 1 1  97 GLY O    O   8.386  17.159   5.828 1.00 . A A .  97 GLY O    1 1 
        4  7194 1 1  98 GLU C    C   5.967  16.513   4.120 1.00 . A A .  98 GLU C    1 1 
        4  7195 1 1  98 GLU CA   C   6.498  17.943   3.915 1.00 . A A .  98 GLU CA   1 1 
        4  7196 1 1  98 GLU CB   C   5.836  18.581   2.682 1.00 . A A .  98 GLU CB   1 1 
        4  7197 1 1  98 GLU CD   C   5.838  21.012   3.451 1.00 . A A .  98 GLU CD   1 1 
        4  7198 1 1  98 GLU CG   C   6.295  20.011   2.396 1.00 . A A .  98 GLU CG   1 1 
        4  7199 1 1  98 GLU H    H   8.346  18.281   2.923 1.00 . A A .  98 GLU H    1 1 
        4  7200 1 1  98 GLU HA   H   6.255  18.534   4.788 1.00 . A A .  98 GLU HA   1 1 
        4  7201 1 1  98 GLU HB2  H   6.060  17.975   1.814 1.00 . A A .  98 GLU HB2  1 1 
        4  7202 1 1  98 GLU HB3  H   4.765  18.594   2.829 1.00 . A A .  98 GLU HB3  1 1 
        4  7203 1 1  98 GLU HG2  H   7.375  20.025   2.355 1.00 . A A .  98 GLU HG2  1 1 
        4  7204 1 1  98 GLU HG3  H   5.902  20.317   1.435 1.00 . A A .  98 GLU HG3  1 1 
        4  7205 1 1  98 GLU N    N   7.961  17.950   3.760 1.00 . A A .  98 GLU N    1 1 
        4  7206 1 1  98 GLU O    O   6.135  15.650   3.257 1.00 . A A .  98 GLU O    1 1 
        4  7207 1 1  98 GLU OE1  O   6.516  21.150   4.489 1.00 . A A .  98 GLU OE1  1 1 
        4  7208 1 1  98 GLU OE2  O   4.798  21.674   3.236 1.00 . A A .  98 GLU OE2  1 1 
        4  7209 1 1  99 ASP C    C   3.766  14.409   4.685 1.00 . A A .  99 ASP C    1 1 
        4  7210 1 1  99 ASP CA   C   4.851  14.941   5.640 1.00 . A A .  99 ASP CA   1 1 
        4  7211 1 1  99 ASP CB   C   4.322  14.973   7.075 1.00 . A A .  99 ASP CB   1 1 
        4  7212 1 1  99 ASP CG   C   3.842  13.615   7.546 1.00 . A A .  99 ASP CG   1 1 
        4  7213 1 1  99 ASP H    H   5.181  17.018   5.885 1.00 . A A .  99 ASP H    1 1 
        4  7214 1 1  99 ASP HA   H   5.701  14.271   5.602 1.00 . A A .  99 ASP HA   1 1 
        4  7215 1 1  99 ASP HB2  H   5.111  15.304   7.735 1.00 . A A .  99 ASP HB2  1 1 
        4  7216 1 1  99 ASP HB3  H   3.498  15.672   7.131 1.00 . A A .  99 ASP HB3  1 1 
        4  7217 1 1  99 ASP N    N   5.328  16.277   5.266 1.00 . A A .  99 ASP N    1 1 
        4  7218 1 1  99 ASP O    O   2.932  15.167   4.181 1.00 . A A .  99 ASP O    1 1 
        4  7219 1 1  99 ASP OD1  O   4.684  12.715   7.731 1.00 . A A .  99 ASP OD1  1 1 
        4  7220 1 1  99 ASP OD2  O   2.620  13.443   7.730 1.00 . A A .  99 ASP OD2  1 1 
        4  7221 1 1 100 VAL C    C   2.072  11.281   4.203 1.00 . A A . 100 VAL C    1 1 
        4  7222 1 1 100 VAL CA   C   2.859  12.431   3.532 1.00 . A A . 100 VAL CA   1 1 
        4  7223 1 1 100 VAL CB   C   3.639  11.886   2.301 1.00 . A A . 100 VAL CB   1 1 
        4  7224 1 1 100 VAL CG1  C   4.713  10.888   2.728 1.00 . A A . 100 VAL CG1  1 1 
        4  7225 1 1 100 VAL CG2  C   2.690  11.257   1.283 1.00 . A A . 100 VAL CG2  1 1 
        4  7226 1 1 100 VAL H    H   4.400  12.539   4.986 1.00 . A A . 100 VAL H    1 1 
        4  7227 1 1 100 VAL HA   H   2.153  13.174   3.180 1.00 . A A . 100 VAL HA   1 1 
        4  7228 1 1 100 VAL HB   H   4.134  12.721   1.823 1.00 . A A . 100 VAL HB   1 1 
        4  7229 1 1 100 VAL HG11 H   5.230  10.517   1.856 1.00 . A A . 100 VAL HG11 1 1 
        4  7230 1 1 100 VAL HG12 H   4.251  10.064   3.251 1.00 . A A . 100 VAL HG12 1 1 
        4  7231 1 1 100 VAL HG13 H   5.419  11.377   3.384 1.00 . A A . 100 VAL HG13 1 1 
        4  7232 1 1 100 VAL HG21 H   2.173  10.425   1.738 1.00 . A A . 100 VAL HG21 1 1 
        4  7233 1 1 100 VAL HG22 H   3.255  10.906   0.431 1.00 . A A . 100 VAL HG22 1 1 
        4  7234 1 1 100 VAL HG23 H   1.970  11.993   0.957 1.00 . A A . 100 VAL HG23 1 1 
        4  7235 1 1 100 VAL N    N   3.772  13.090   4.476 1.00 . A A . 100 VAL N    1 1 
        4  7236 1 1 100 VAL O    O   2.655  10.389   4.825 1.00 . A A . 100 VAL O    1 1 
        4  7237 1 1 101 LYS C    C  -0.830   9.414   3.626 1.00 . A A . 101 LYS C    1 1 
        4  7238 1 1 101 LYS CA   C  -0.126  10.288   4.679 1.00 . A A . 101 LYS CA   1 1 
        4  7239 1 1 101 LYS CB   C  -1.160  10.977   5.582 1.00 . A A . 101 LYS CB   1 1 
        4  7240 1 1 101 LYS CD   C  -2.812  10.736   7.486 1.00 . A A . 101 LYS CD   1 1 
        4  7241 1 1 101 LYS CE   C  -3.598   9.761   8.354 1.00 . A A . 101 LYS CE   1 1 
        4  7242 1 1 101 LYS CG   C  -2.015  10.011   6.403 1.00 . A A . 101 LYS CG   1 1 
        4  7243 1 1 101 LYS H    H   0.340  12.009   3.512 1.00 . A A . 101 LYS H    1 1 
        4  7244 1 1 101 LYS HA   H   0.496   9.648   5.292 1.00 . A A . 101 LYS HA   1 1 
        4  7245 1 1 101 LYS HB2  H  -0.637  11.631   6.267 1.00 . A A . 101 LYS HB2  1 1 
        4  7246 1 1 101 LYS HB3  H  -1.819  11.575   4.966 1.00 . A A . 101 LYS HB3  1 1 
        4  7247 1 1 101 LYS HD2  H  -2.127  11.288   8.114 1.00 . A A . 101 LYS HD2  1 1 
        4  7248 1 1 101 LYS HD3  H  -3.503  11.422   7.015 1.00 . A A . 101 LYS HD3  1 1 
        4  7249 1 1 101 LYS HE2  H  -4.396   9.334   7.764 1.00 . A A . 101 LYS HE2  1 1 
        4  7250 1 1 101 LYS HE3  H  -2.935   8.973   8.681 1.00 . A A . 101 LYS HE3  1 1 
        4  7251 1 1 101 LYS HG2  H  -2.704   9.503   5.741 1.00 . A A . 101 LYS HG2  1 1 
        4  7252 1 1 101 LYS HG3  H  -1.366   9.284   6.872 1.00 . A A . 101 LYS HG3  1 1 
        4  7253 1 1 101 LYS HZ1  H  -4.653   9.714  10.154 1.00 . A A . 101 LYS HZ1  1 1 
        4  7254 1 1 101 LYS HZ2  H  -4.889  11.132   9.260 1.00 . A A . 101 LYS HZ2  1 1 
        4  7255 1 1 101 LYS HZ3  H  -3.440  10.894  10.102 1.00 . A A . 101 LYS HZ3  1 1 
        4  7256 1 1 101 LYS N    N   0.746  11.299   4.055 1.00 . A A . 101 LYS N    1 1 
        4  7257 1 1 101 LYS NZ   N  -4.187  10.422   9.550 1.00 . A A . 101 LYS NZ   1 1 
        4  7258 1 1 101 LYS O    O  -1.236   9.899   2.566 1.00 . A A . 101 LYS O    1 1 
        4  7259 1 1 102 VAL C    C  -2.976   6.726   3.410 1.00 . A A . 102 VAL C    1 1 
        4  7260 1 1 102 VAL CA   C  -1.553   7.150   2.996 1.00 . A A . 102 VAL CA   1 1 
        4  7261 1 1 102 VAL CB   C  -0.658   5.888   2.893 1.00 . A A . 102 VAL CB   1 1 
        4  7262 1 1 102 VAL CG1  C  -1.212   4.904   1.867 1.00 . A A . 102 VAL CG1  1 1 
        4  7263 1 1 102 VAL CG2  C   0.780   6.274   2.551 1.00 . A A . 102 VAL CG2  1 1 
        4  7264 1 1 102 VAL H    H  -0.688   7.809   4.818 1.00 . A A . 102 VAL H    1 1 
        4  7265 1 1 102 VAL HA   H  -1.598   7.613   2.018 1.00 . A A . 102 VAL HA   1 1 
        4  7266 1 1 102 VAL HB   H  -0.653   5.399   3.858 1.00 . A A . 102 VAL HB   1 1 
        4  7267 1 1 102 VAL HG11 H  -1.283   5.386   0.902 1.00 . A A . 102 VAL HG11 1 1 
        4  7268 1 1 102 VAL HG12 H  -2.195   4.574   2.176 1.00 . A A . 102 VAL HG12 1 1 
        4  7269 1 1 102 VAL HG13 H  -0.555   4.049   1.792 1.00 . A A . 102 VAL HG13 1 1 
        4  7270 1 1 102 VAL HG21 H   1.383   5.381   2.462 1.00 . A A . 102 VAL HG21 1 1 
        4  7271 1 1 102 VAL HG22 H   1.181   6.902   3.334 1.00 . A A . 102 VAL HG22 1 1 
        4  7272 1 1 102 VAL HG23 H   0.797   6.812   1.615 1.00 . A A . 102 VAL HG23 1 1 
        4  7273 1 1 102 VAL N    N  -0.974   8.122   3.933 1.00 . A A . 102 VAL N    1 1 
        4  7274 1 1 102 VAL O    O  -3.243   6.464   4.588 1.00 . A A . 102 VAL O    1 1 
        4  7275 1 1 103 ILE C    C  -5.701   5.078   1.773 1.00 . A A . 103 ILE C    1 1 
        4  7276 1 1 103 ILE CA   C  -5.285   6.280   2.651 1.00 . A A . 103 ILE CA   1 1 
        4  7277 1 1 103 ILE CB   C  -6.241   7.466   2.333 1.00 . A A . 103 ILE CB   1 1 
        4  7278 1 1 103 ILE CD1  C  -5.836   8.677   4.563 1.00 . A A . 103 ILE CD1  1 1 
        4  7279 1 1 103 ILE CG1  C  -5.795   8.755   3.051 1.00 . A A . 103 ILE CG1  1 1 
        4  7280 1 1 103 ILE CG2  C  -7.682   7.113   2.709 1.00 . A A . 103 ILE CG2  1 1 
        4  7281 1 1 103 ILE H    H  -3.587   6.855   1.512 1.00 . A A . 103 ILE H    1 1 
        4  7282 1 1 103 ILE HA   H  -5.403   6.013   3.692 1.00 . A A . 103 ILE HA   1 1 
        4  7283 1 1 103 ILE HB   H  -6.214   7.639   1.264 1.00 . A A . 103 ILE HB   1 1 
        4  7284 1 1 103 ILE HD11 H  -5.201   7.870   4.900 1.00 . A A . 103 ILE HD11 1 1 
        4  7285 1 1 103 ILE HD12 H  -6.850   8.498   4.887 1.00 . A A . 103 ILE HD12 1 1 
        4  7286 1 1 103 ILE HD13 H  -5.485   9.609   4.979 1.00 . A A . 103 ILE HD13 1 1 
        4  7287 1 1 103 ILE HG12 H  -4.780   8.984   2.765 1.00 . A A . 103 ILE HG12 1 1 
        4  7288 1 1 103 ILE HG13 H  -6.439   9.569   2.745 1.00 . A A . 103 ILE HG13 1 1 
        4  7289 1 1 103 ILE HG21 H  -7.737   6.880   3.763 1.00 . A A . 103 ILE HG21 1 1 
        4  7290 1 1 103 ILE HG22 H  -8.006   6.255   2.136 1.00 . A A . 103 ILE HG22 1 1 
        4  7291 1 1 103 ILE HG23 H  -8.328   7.951   2.492 1.00 . A A . 103 ILE HG23 1 1 
        4  7292 1 1 103 ILE N    N  -3.876   6.651   2.424 1.00 . A A . 103 ILE N    1 1 
        4  7293 1 1 103 ILE O    O  -5.599   5.127   0.544 1.00 . A A . 103 ILE O    1 1 
        4  7294 1 1 104 LEU C    C  -8.164   2.941   1.365 1.00 . A A . 104 LEU C    1 1 
        4  7295 1 1 104 LEU CA   C  -6.665   2.819   1.678 1.00 . A A . 104 LEU CA   1 1 
        4  7296 1 1 104 LEU CB   C  -6.438   1.546   2.508 1.00 . A A . 104 LEU CB   1 1 
        4  7297 1 1 104 LEU CD1  C  -4.906  -0.059   3.692 1.00 . A A . 104 LEU CD1  1 1 
        4  7298 1 1 104 LEU CD2  C  -4.170   1.010   1.540 1.00 . A A . 104 LEU CD2  1 1 
        4  7299 1 1 104 LEU CG   C  -4.976   1.195   2.825 1.00 . A A . 104 LEU CG   1 1 
        4  7300 1 1 104 LEU H    H  -6.203   4.009   3.383 1.00 . A A . 104 LEU H    1 1 
        4  7301 1 1 104 LEU HA   H  -6.116   2.740   0.749 1.00 . A A . 104 LEU HA   1 1 
        4  7302 1 1 104 LEU HB2  H  -6.966   1.661   3.445 1.00 . A A . 104 LEU HB2  1 1 
        4  7303 1 1 104 LEU HB3  H  -6.875   0.714   1.974 1.00 . A A . 104 LEU HB3  1 1 
        4  7304 1 1 104 LEU HD11 H  -5.407   0.124   4.632 1.00 . A A . 104 LEU HD11 1 1 
        4  7305 1 1 104 LEU HD12 H  -3.872  -0.309   3.883 1.00 . A A . 104 LEU HD12 1 1 
        4  7306 1 1 104 LEU HD13 H  -5.386  -0.883   3.183 1.00 . A A . 104 LEU HD13 1 1 
        4  7307 1 1 104 LEU HD21 H  -3.139   0.804   1.789 1.00 . A A . 104 LEU HD21 1 1 
        4  7308 1 1 104 LEU HD22 H  -4.222   1.913   0.949 1.00 . A A . 104 LEU HD22 1 1 
        4  7309 1 1 104 LEU HD23 H  -4.574   0.183   0.972 1.00 . A A . 104 LEU HD23 1 1 
        4  7310 1 1 104 LEU HG   H  -4.531   2.007   3.383 1.00 . A A . 104 LEU HG   1 1 
        4  7311 1 1 104 LEU N    N  -6.176   4.006   2.404 1.00 . A A . 104 LEU N    1 1 
        4  7312 1 1 104 LEU O    O  -8.958   3.252   2.253 1.00 . A A . 104 LEU O    1 1 
        4  7313 1 1 105 LYS C    C -10.320   1.593  -1.278 1.00 . A A . 105 LYS C    1 1 
        4  7314 1 1 105 LYS CA   C  -9.971   2.717  -0.283 1.00 . A A . 105 LYS CA   1 1 
        4  7315 1 1 105 LYS CB   C -10.336   4.092  -0.873 1.00 . A A . 105 LYS CB   1 1 
        4  7316 1 1 105 LYS CD   C -10.785   6.545  -0.424 1.00 . A A . 105 LYS CD   1 1 
        4  7317 1 1 105 LYS CE   C -10.746   7.657   0.617 1.00 . A A . 105 LYS CE   1 1 
        4  7318 1 1 105 LYS CG   C -10.263   5.230   0.143 1.00 . A A . 105 LYS CG   1 1 
        4  7319 1 1 105 LYS H    H  -7.875   2.476  -0.566 1.00 . A A . 105 LYS H    1 1 
        4  7320 1 1 105 LYS HA   H -10.559   2.564   0.614 1.00 . A A . 105 LYS HA   1 1 
        4  7321 1 1 105 LYS HB2  H  -9.658   4.316  -1.685 1.00 . A A . 105 LYS HB2  1 1 
        4  7322 1 1 105 LYS HB3  H -11.346   4.049  -1.261 1.00 . A A . 105 LYS HB3  1 1 
        4  7323 1 1 105 LYS HD2  H -10.174   6.834  -1.267 1.00 . A A . 105 LYS HD2  1 1 
        4  7324 1 1 105 LYS HD3  H -11.808   6.407  -0.751 1.00 . A A . 105 LYS HD3  1 1 
        4  7325 1 1 105 LYS HE2  H -11.298   7.337   1.489 1.00 . A A . 105 LYS HE2  1 1 
        4  7326 1 1 105 LYS HE3  H  -9.717   7.841   0.892 1.00 . A A . 105 LYS HE3  1 1 
        4  7327 1 1 105 LYS HG2  H -10.858   4.963   1.005 1.00 . A A . 105 LYS HG2  1 1 
        4  7328 1 1 105 LYS HG3  H  -9.232   5.363   0.448 1.00 . A A . 105 LYS HG3  1 1 
        4  7329 1 1 105 LYS HZ1  H -12.368   8.813  -0.003 1.00 . A A . 105 LYS HZ1  1 1 
        4  7330 1 1 105 LYS HZ2  H -10.923   9.176  -0.804 1.00 . A A . 105 LYS HZ2  1 1 
        4  7331 1 1 105 LYS HZ3  H -11.159   9.691   0.787 1.00 . A A . 105 LYS HZ3  1 1 
        4  7332 1 1 105 LYS N    N  -8.553   2.685   0.112 1.00 . A A . 105 LYS N    1 1 
        4  7333 1 1 105 LYS NZ   N -11.342   8.921   0.112 1.00 . A A . 105 LYS NZ   1 1 
        4  7334 1 1 105 LYS O    O  -9.500   1.199  -2.110 1.00 . A A . 105 LYS O    1 1 
        4  7335 1 1 106 ASN C    C -12.647   0.553  -3.347 1.00 . A A . 106 ASN C    1 1 
        4  7336 1 1 106 ASN CA   C -12.008  -0.007  -2.062 1.00 . A A . 106 ASN CA   1 1 
        4  7337 1 1 106 ASN CB   C -13.023  -0.907  -1.339 1.00 . A A . 106 ASN CB   1 1 
        4  7338 1 1 106 ASN CG   C -12.536  -1.378   0.017 1.00 . A A . 106 ASN CG   1 1 
        4  7339 1 1 106 ASN H    H -12.149   1.407  -0.475 1.00 . A A . 106 ASN H    1 1 
        4  7340 1 1 106 ASN HA   H -11.149  -0.604  -2.339 1.00 . A A . 106 ASN HA   1 1 
        4  7341 1 1 106 ASN HB2  H -13.945  -0.359  -1.196 1.00 . A A . 106 ASN HB2  1 1 
        4  7342 1 1 106 ASN HB3  H -13.222  -1.776  -1.950 1.00 . A A . 106 ASN HB3  1 1 
        4  7343 1 1 106 ASN HD21 H -11.621  -2.932  -0.798 1.00 . A A . 106 ASN HD21 1 1 
        4  7344 1 1 106 ASN HD22 H -11.489  -2.792   0.916 1.00 . A A . 106 ASN HD22 1 1 
        4  7345 1 1 106 ASN N    N -11.545   1.068  -1.173 1.00 . A A . 106 ASN N    1 1 
        4  7346 1 1 106 ASN ND2  N -11.810  -2.478   0.045 1.00 . A A . 106 ASN ND2  1 1 
        4  7347 1 1 106 ASN O    O -12.646   1.762  -3.583 1.00 . A A . 106 ASN O    1 1 
        4  7348 1 1 106 ASN OD1  O -12.805  -0.756   1.034 1.00 . A A . 106 ASN OD1  1 1 
        4  7349 1 1 107 SER C    C -14.830   1.179  -5.335 1.00 . A A . 107 SER C    1 1 
        4  7350 1 1 107 SER CA   C -13.823   0.019  -5.450 1.00 . A A . 107 SER CA   1 1 
        4  7351 1 1 107 SER CB   C -14.534  -1.201  -6.055 1.00 . A A . 107 SER CB   1 1 
        4  7352 1 1 107 SER H    H -13.230  -1.283  -3.879 1.00 . A A . 107 SER H    1 1 
        4  7353 1 1 107 SER HA   H -13.022   0.317  -6.113 1.00 . A A . 107 SER HA   1 1 
        4  7354 1 1 107 SER HB2  H -15.399  -1.444  -5.456 1.00 . A A . 107 SER HB2  1 1 
        4  7355 1 1 107 SER HB3  H -14.850  -0.970  -7.064 1.00 . A A . 107 SER HB3  1 1 
        4  7356 1 1 107 SER HG   H -12.813  -2.073  -6.432 1.00 . A A . 107 SER HG   1 1 
        4  7357 1 1 107 SER N    N -13.220  -0.343  -4.154 1.00 . A A . 107 SER N    1 1 
        4  7358 1 1 107 SER O    O -14.849   2.079  -6.174 1.00 . A A . 107 SER O    1 1 
        4  7359 1 1 107 SER OG   O -13.679  -2.337  -6.095 1.00 . A A . 107 SER OG   1 1 
        4  7360 1 1 108 GLN C    C -16.206   3.496  -3.536 1.00 . A A . 108 GLN C    1 1 
        4  7361 1 1 108 GLN CA   C -16.724   2.171  -4.135 1.00 . A A . 108 GLN CA   1 1 
        4  7362 1 1 108 GLN CB   C -17.862   1.617  -3.265 1.00 . A A . 108 GLN CB   1 1 
        4  7363 1 1 108 GLN CD   C -19.824   0.020  -3.076 1.00 . A A . 108 GLN CD   1 1 
        4  7364 1 1 108 GLN CG   C -18.635   0.471  -3.911 1.00 . A A . 108 GLN CG   1 1 
        4  7365 1 1 108 GLN H    H -15.567   0.459  -3.618 1.00 . A A . 108 GLN H    1 1 
        4  7366 1 1 108 GLN HA   H -17.121   2.380  -5.118 1.00 . A A . 108 GLN HA   1 1 
        4  7367 1 1 108 GLN HB2  H -17.449   1.258  -2.331 1.00 . A A . 108 GLN HB2  1 1 
        4  7368 1 1 108 GLN HB3  H -18.560   2.417  -3.053 1.00 . A A . 108 GLN HB3  1 1 
        4  7369 1 1 108 GLN HE21 H -19.707  -1.805  -3.824 1.00 . A A . 108 GLN HE21 1 1 
        4  7370 1 1 108 GLN HE22 H -20.962  -1.538  -2.672 1.00 . A A . 108 GLN HE22 1 1 
        4  7371 1 1 108 GLN HG2  H -18.998   0.794  -4.877 1.00 . A A . 108 GLN HG2  1 1 
        4  7372 1 1 108 GLN HG3  H -17.966  -0.369  -4.043 1.00 . A A . 108 GLN HG3  1 1 
        4  7373 1 1 108 GLN N    N -15.664   1.161  -4.294 1.00 . A A . 108 GLN N    1 1 
        4  7374 1 1 108 GLN NE2  N -20.201  -1.232  -3.204 1.00 . A A . 108 GLN NE2  1 1 
        4  7375 1 1 108 GLN O    O -16.974   4.442  -3.365 1.00 . A A . 108 GLN O    1 1 
        4  7376 1 1 108 GLN OE1  O -20.413   0.801  -2.335 1.00 . A A . 108 GLN OE1  1 1 
        4  7377 1 1 109 GLY C    C -14.414   4.757  -1.091 1.00 . A A . 109 GLY C    1 1 
        4  7378 1 1 109 GLY CA   C -14.347   4.778  -2.616 1.00 . A A . 109 GLY CA   1 1 
        4  7379 1 1 109 GLY H    H -14.324   2.806  -3.425 1.00 . A A . 109 GLY H    1 1 
        4  7380 1 1 109 GLY HA2  H -13.314   4.873  -2.916 1.00 . A A . 109 GLY HA2  1 1 
        4  7381 1 1 109 GLY HA3  H -14.892   5.640  -2.975 1.00 . A A . 109 GLY HA3  1 1 
        4  7382 1 1 109 GLY N    N -14.909   3.569  -3.228 1.00 . A A . 109 GLY N    1 1 
        4  7383 1 1 109 GLY O    O -14.002   5.708  -0.423 1.00 . A A . 109 GLY O    1 1 
        4  7384 1 1 110 GLU C    C -13.623   3.309   1.522 1.00 . A A . 110 GLU C    1 1 
        4  7385 1 1 110 GLU CA   C -15.026   3.471   0.906 1.00 . A A . 110 GLU CA   1 1 
        4  7386 1 1 110 GLU CB   C -15.883   2.232   1.198 1.00 . A A . 110 GLU CB   1 1 
        4  7387 1 1 110 GLU CD   C -16.280  -0.225   0.651 1.00 . A A . 110 GLU CD   1 1 
        4  7388 1 1 110 GLU CG   C -15.349   0.969   0.532 1.00 . A A . 110 GLU CG   1 1 
        4  7389 1 1 110 GLU H    H -15.303   2.978  -1.134 1.00 . A A . 110 GLU H    1 1 
        4  7390 1 1 110 GLU HA   H -15.503   4.340   1.336 1.00 . A A . 110 GLU HA   1 1 
        4  7391 1 1 110 GLU HB2  H -15.914   2.069   2.267 1.00 . A A . 110 GLU HB2  1 1 
        4  7392 1 1 110 GLU HB3  H -16.889   2.407   0.838 1.00 . A A . 110 GLU HB3  1 1 
        4  7393 1 1 110 GLU HG2  H -15.186   1.176  -0.517 1.00 . A A . 110 GLU HG2  1 1 
        4  7394 1 1 110 GLU HG3  H -14.403   0.715   0.991 1.00 . A A . 110 GLU HG3  1 1 
        4  7395 1 1 110 GLU N    N -14.946   3.671  -0.545 1.00 . A A . 110 GLU N    1 1 
        4  7396 1 1 110 GLU O    O -12.761   2.636   0.953 1.00 . A A . 110 GLU O    1 1 
        4  7397 1 1 110 GLU OE1  O -16.447  -0.745   1.772 1.00 . A A . 110 GLU OE1  1 1 
        4  7398 1 1 110 GLU OE2  O -16.848  -0.647  -0.379 1.00 . A A . 110 GLU OE2  1 1 
        4  7399 1 1 111 GLU C    C -11.880   2.619   4.165 1.00 . A A . 111 GLU C    1 1 
        4  7400 1 1 111 GLU CA   C -12.080   3.897   3.328 1.00 . A A . 111 GLU CA   1 1 
        4  7401 1 1 111 GLU CB   C -11.897   5.138   4.216 1.00 . A A . 111 GLU CB   1 1 
        4  7402 1 1 111 GLU CD   C -10.355   6.470   5.739 1.00 . A A . 111 GLU CD   1 1 
        4  7403 1 1 111 GLU CG   C -10.492   5.275   4.804 1.00 . A A . 111 GLU CG   1 1 
        4  7404 1 1 111 GLU H    H -14.132   4.416   3.109 1.00 . A A . 111 GLU H    1 1 
        4  7405 1 1 111 GLU HA   H -11.331   3.918   2.550 1.00 . A A . 111 GLU HA   1 1 
        4  7406 1 1 111 GLU HB2  H -12.105   6.019   3.627 1.00 . A A . 111 GLU HB2  1 1 
        4  7407 1 1 111 GLU HB3  H -12.604   5.089   5.033 1.00 . A A . 111 GLU HB3  1 1 
        4  7408 1 1 111 GLU HG2  H -10.257   4.376   5.354 1.00 . A A . 111 GLU HG2  1 1 
        4  7409 1 1 111 GLU HG3  H  -9.784   5.390   3.993 1.00 . A A . 111 GLU HG3  1 1 
        4  7410 1 1 111 GLU N    N -13.398   3.928   2.679 1.00 . A A . 111 GLU N    1 1 
        4  7411 1 1 111 GLU O    O -12.754   2.219   4.939 1.00 . A A . 111 GLU O    1 1 
        4  7412 1 1 111 GLU OE1  O -10.390   7.623   5.255 1.00 . A A . 111 GLU OE1  1 1 
        4  7413 1 1 111 GLU OE2  O -10.223   6.263   6.966 1.00 . A A . 111 GLU OE2  1 1 
        4  7414 1 1 112 VAL C    C  -9.513   1.155   5.994 1.00 . A A . 112 VAL C    1 1 
        4  7415 1 1 112 VAL CA   C -10.352   0.787   4.763 1.00 . A A . 112 VAL CA   1 1 
        4  7416 1 1 112 VAL CB   C  -9.535  -0.212   3.901 1.00 . A A . 112 VAL CB   1 1 
        4  7417 1 1 112 VAL CG1  C  -9.246  -1.497   4.678 1.00 . A A . 112 VAL CG1  1 1 
        4  7418 1 1 112 VAL CG2  C -10.257  -0.516   2.591 1.00 . A A . 112 VAL CG2  1 1 
        4  7419 1 1 112 VAL H    H -10.095   2.329   3.326 1.00 . A A . 112 VAL H    1 1 
        4  7420 1 1 112 VAL HA   H -11.260   0.296   5.087 1.00 . A A . 112 VAL HA   1 1 
        4  7421 1 1 112 VAL HB   H  -8.585   0.250   3.659 1.00 . A A . 112 VAL HB   1 1 
        4  7422 1 1 112 VAL HG11 H  -8.676  -2.176   4.059 1.00 . A A . 112 VAL HG11 1 1 
        4  7423 1 1 112 VAL HG12 H -10.179  -1.968   4.958 1.00 . A A . 112 VAL HG12 1 1 
        4  7424 1 1 112 VAL HG13 H  -8.681  -1.263   5.568 1.00 . A A . 112 VAL HG13 1 1 
        4  7425 1 1 112 VAL HG21 H -10.408   0.403   2.041 1.00 . A A . 112 VAL HG21 1 1 
        4  7426 1 1 112 VAL HG22 H -11.215  -0.968   2.803 1.00 . A A . 112 VAL HG22 1 1 
        4  7427 1 1 112 VAL HG23 H  -9.663  -1.196   1.998 1.00 . A A . 112 VAL HG23 1 1 
        4  7428 1 1 112 VAL N    N -10.720   1.985   3.994 1.00 . A A . 112 VAL N    1 1 
        4  7429 1 1 112 VAL O    O  -9.805   0.730   7.114 1.00 . A A . 112 VAL O    1 1 
        4  7430 1 1 113 ALA C    C  -6.624   3.492   6.395 1.00 . A A . 113 ALA C    1 1 
        4  7431 1 1 113 ALA CA   C  -7.531   2.333   6.833 1.00 . A A . 113 ALA CA   1 1 
        4  7432 1 1 113 ALA CB   C  -6.681   1.136   7.251 1.00 . A A . 113 ALA CB   1 1 
        4  7433 1 1 113 ALA H    H  -8.319   2.293   4.866 1.00 . A A . 113 ALA H    1 1 
        4  7434 1 1 113 ALA HA   H  -8.114   2.650   7.689 1.00 . A A . 113 ALA HA   1 1 
        4  7435 1 1 113 ALA HB1  H  -6.082   0.808   6.412 1.00 . A A . 113 ALA HB1  1 1 
        4  7436 1 1 113 ALA HB2  H  -7.323   0.328   7.569 1.00 . A A . 113 ALA HB2  1 1 
        4  7437 1 1 113 ALA HB3  H  -6.030   1.420   8.065 1.00 . A A . 113 ALA HB3  1 1 
        4  7438 1 1 113 ALA N    N  -8.464   1.947   5.770 1.00 . A A . 113 ALA N    1 1 
        4  7439 1 1 113 ALA O    O  -6.491   3.777   5.204 1.00 . A A . 113 ALA O    1 1 
        4  7440 1 1 114 GLN C    C  -3.801   5.164   7.940 1.00 . A A . 114 GLN C    1 1 
        4  7441 1 1 114 GLN CA   C  -5.083   5.264   7.095 1.00 . A A . 114 GLN CA   1 1 
        4  7442 1 1 114 GLN CB   C  -5.808   6.590   7.372 1.00 . A A . 114 GLN CB   1 1 
        4  7443 1 1 114 GLN CD   C  -7.263   7.941   8.955 1.00 . A A . 114 GLN CD   1 1 
        4  7444 1 1 114 GLN CG   C  -6.535   6.629   8.714 1.00 . A A . 114 GLN CG   1 1 
        4  7445 1 1 114 GLN H    H  -6.119   3.849   8.294 1.00 . A A . 114 GLN H    1 1 
        4  7446 1 1 114 GLN HA   H  -4.809   5.227   6.049 1.00 . A A . 114 GLN HA   1 1 
        4  7447 1 1 114 GLN HB2  H  -5.086   7.394   7.351 1.00 . A A . 114 GLN HB2  1 1 
        4  7448 1 1 114 GLN HB3  H  -6.536   6.754   6.588 1.00 . A A . 114 GLN HB3  1 1 
        4  7449 1 1 114 GLN HE21 H  -8.874   7.254   8.025 1.00 . A A . 114 GLN HE21 1 1 
        4  7450 1 1 114 GLN HE22 H  -8.984   8.862   8.647 1.00 . A A . 114 GLN HE22 1 1 
        4  7451 1 1 114 GLN HG2  H  -7.257   5.826   8.739 1.00 . A A . 114 GLN HG2  1 1 
        4  7452 1 1 114 GLN HG3  H  -5.811   6.485   9.504 1.00 . A A . 114 GLN HG3  1 1 
        4  7453 1 1 114 GLN N    N  -5.984   4.136   7.365 1.00 . A A . 114 GLN N    1 1 
        4  7454 1 1 114 GLN NE2  N  -8.495   8.029   8.497 1.00 . A A . 114 GLN NE2  1 1 
        4  7455 1 1 114 GLN O    O  -3.855   4.863   9.135 1.00 . A A . 114 GLN O    1 1 
        4  7456 1 1 114 GLN OE1  O  -6.716   8.876   9.535 1.00 . A A . 114 GLN OE1  1 1 
        4  7457 1 1 115 ARG C    C  -0.251   6.086   7.281 1.00 . A A . 115 ARG C    1 1 
        4  7458 1 1 115 ARG CA   C  -1.358   5.306   8.015 1.00 . A A . 115 ARG CA   1 1 
        4  7459 1 1 115 ARG CB   C  -0.974   3.820   8.161 1.00 . A A . 115 ARG CB   1 1 
        4  7460 1 1 115 ARG CD   C   0.355   2.061   9.396 1.00 . A A . 115 ARG CD   1 1 
        4  7461 1 1 115 ARG CG   C   0.178   3.555   9.129 1.00 . A A . 115 ARG CG   1 1 
        4  7462 1 1 115 ARG CZ   C  -0.981   0.213  10.305 1.00 . A A . 115 ARG CZ   1 1 
        4  7463 1 1 115 ARG H    H  -2.661   5.690   6.374 1.00 . A A . 115 ARG H    1 1 
        4  7464 1 1 115 ARG HA   H  -1.479   5.732   9.003 1.00 . A A . 115 ARG HA   1 1 
        4  7465 1 1 115 ARG HB2  H  -1.839   3.276   8.515 1.00 . A A . 115 ARG HB2  1 1 
        4  7466 1 1 115 ARG HB3  H  -0.696   3.434   7.190 1.00 . A A . 115 ARG HB3  1 1 
        4  7467 1 1 115 ARG HD2  H   0.636   1.574   8.473 1.00 . A A . 115 ARG HD2  1 1 
        4  7468 1 1 115 ARG HD3  H   1.141   1.927  10.127 1.00 . A A . 115 ARG HD3  1 1 
        4  7469 1 1 115 ARG HE   H  -1.681   2.009   9.927 1.00 . A A . 115 ARG HE   1 1 
        4  7470 1 1 115 ARG HG2  H   1.090   3.947   8.705 1.00 . A A . 115 ARG HG2  1 1 
        4  7471 1 1 115 ARG HG3  H  -0.029   4.057  10.066 1.00 . A A . 115 ARG HG3  1 1 
        4  7472 1 1 115 ARG HH11 H   0.938  -0.254  10.017 1.00 . A A . 115 ARG HH11 1 1 
        4  7473 1 1 115 ARG HH12 H  -0.063  -1.525  10.618 1.00 . A A . 115 ARG HH12 1 1 
        4  7474 1 1 115 ARG HH21 H  -2.920   0.385  10.701 1.00 . A A . 115 ARG HH21 1 1 
        4  7475 1 1 115 ARG HH22 H  -2.223  -1.168  11.017 1.00 . A A . 115 ARG HH22 1 1 
        4  7476 1 1 115 ARG N    N  -2.647   5.419   7.320 1.00 . A A . 115 ARG N    1 1 
        4  7477 1 1 115 ARG NE   N  -0.876   1.450   9.900 1.00 . A A . 115 ARG NE   1 1 
        4  7478 1 1 115 ARG NH1  N   0.045  -0.581  10.317 1.00 . A A . 115 ARG NH1  1 1 
        4  7479 1 1 115 ARG NH2  N  -2.129  -0.224  10.705 1.00 . A A . 115 ARG NH2  1 1 
        4  7480 1 1 115 ARG O    O  -0.346   6.349   6.083 1.00 . A A . 115 ARG O    1 1 
        4  7481 1 1 116 SER C    C   3.253   6.775   8.066 1.00 . A A . 116 SER C    1 1 
        4  7482 1 1 116 SER CA   C   1.922   7.219   7.444 1.00 . A A . 116 SER CA   1 1 
        4  7483 1 1 116 SER CB   C   1.716   8.727   7.660 1.00 . A A . 116 SER CB   1 1 
        4  7484 1 1 116 SER H    H   0.801   6.256   8.973 1.00 . A A . 116 SER H    1 1 
        4  7485 1 1 116 SER HA   H   1.954   7.017   6.382 1.00 . A A . 116 SER HA   1 1 
        4  7486 1 1 116 SER HB2  H   2.589   9.263   7.315 1.00 . A A . 116 SER HB2  1 1 
        4  7487 1 1 116 SER HB3  H   0.852   9.054   7.098 1.00 . A A . 116 SER HB3  1 1 
        4  7488 1 1 116 SER HG   H   2.101   9.749   9.295 1.00 . A A . 116 SER HG   1 1 
        4  7489 1 1 116 SER N    N   0.791   6.470   8.015 1.00 . A A . 116 SER N    1 1 
        4  7490 1 1 116 SER O    O   3.308   5.785   8.799 1.00 . A A . 116 SER O    1 1 
        4  7491 1 1 116 SER OG   O   1.513   9.028   9.032 1.00 . A A . 116 SER OG   1 1 
        4  7492 1 1 117 THR C    C   6.463   8.494   8.493 1.00 . A A . 117 THR C    1 1 
        4  7493 1 1 117 THR CA   C   5.654   7.202   8.320 1.00 . A A . 117 THR CA   1 1 
        4  7494 1 1 117 THR CB   C   6.455   6.208   7.436 1.00 . A A . 117 THR CB   1 1 
        4  7495 1 1 117 THR CG2  C   6.832   6.831   6.093 1.00 . A A . 117 THR CG2  1 1 
        4  7496 1 1 117 THR H    H   4.236   8.244   7.128 1.00 . A A . 117 THR H    1 1 
        4  7497 1 1 117 THR HA   H   5.506   6.749   9.292 1.00 . A A . 117 THR HA   1 1 
        4  7498 1 1 117 THR HB   H   5.837   5.341   7.251 1.00 . A A . 117 THR HB   1 1 
        4  7499 1 1 117 THR HG1  H   7.810   4.852   7.925 1.00 . A A . 117 THR HG1  1 1 
        4  7500 1 1 117 THR HG21 H   5.937   7.135   5.569 1.00 . A A . 117 THR HG21 1 1 
        4  7501 1 1 117 THR HG22 H   7.367   6.104   5.498 1.00 . A A . 117 THR HG22 1 1 
        4  7502 1 1 117 THR HG23 H   7.462   7.692   6.258 1.00 . A A . 117 THR HG23 1 1 
        4  7503 1 1 117 THR N    N   4.329   7.494   7.751 1.00 . A A . 117 THR N    1 1 
        4  7504 1 1 117 THR O    O   6.347   9.420   7.689 1.00 . A A . 117 THR O    1 1 
        4  7505 1 1 117 THR OG1  O   7.649   5.787   8.116 1.00 . A A . 117 THR OG1  1 1 
        4  7506 1 1 118 VAL C    C   9.433   9.755   9.199 1.00 . A A . 118 VAL C    1 1 
        4  7507 1 1 118 VAL CA   C   8.041   9.771   9.855 1.00 . A A . 118 VAL CA   1 1 
        4  7508 1 1 118 VAL CB   C   8.198   9.960  11.387 1.00 . A A . 118 VAL CB   1 1 
        4  7509 1 1 118 VAL CG1  C   8.829  11.316  11.703 1.00 . A A . 118 VAL CG1  1 1 
        4  7510 1 1 118 VAL CG2  C   6.850   9.802  12.094 1.00 . A A . 118 VAL CG2  1 1 
        4  7511 1 1 118 VAL H    H   7.371   7.775  10.126 1.00 . A A . 118 VAL H    1 1 
        4  7512 1 1 118 VAL HA   H   7.487  10.619   9.471 1.00 . A A . 118 VAL HA   1 1 
        4  7513 1 1 118 VAL HB   H   8.863   9.188  11.754 1.00 . A A . 118 VAL HB   1 1 
        4  7514 1 1 118 VAL HG11 H   8.212  12.107  11.302 1.00 . A A . 118 VAL HG11 1 1 
        4  7515 1 1 118 VAL HG12 H   9.813  11.368  11.256 1.00 . A A . 118 VAL HG12 1 1 
        4  7516 1 1 118 VAL HG13 H   8.916  11.436  12.773 1.00 . A A . 118 VAL HG13 1 1 
        4  7517 1 1 118 VAL HG21 H   6.152  10.530  11.709 1.00 . A A . 118 VAL HG21 1 1 
        4  7518 1 1 118 VAL HG22 H   6.977   9.950  13.158 1.00 . A A . 118 VAL HG22 1 1 
        4  7519 1 1 118 VAL HG23 H   6.465   8.807  11.915 1.00 . A A . 118 VAL HG23 1 1 
        4  7520 1 1 118 VAL N    N   7.278   8.559   9.544 1.00 . A A . 118 VAL N    1 1 
        4  7521 1 1 118 VAL O    O  10.352   9.084   9.675 1.00 . A A . 118 VAL O    1 1 
        4  7522 1 1 119 PHE C    C  11.606  11.907   7.889 1.00 . A A . 119 PHE C    1 1 
        4  7523 1 1 119 PHE CA   C  10.889  10.624   7.436 1.00 . A A . 119 PHE CA   1 1 
        4  7524 1 1 119 PHE CB   C  10.743  10.565   5.900 1.00 . A A . 119 PHE CB   1 1 
        4  7525 1 1 119 PHE CD1  C   8.367  11.177   5.320 1.00 . A A . 119 PHE CD1  1 1 
        4  7526 1 1 119 PHE CD2  C  10.097  12.728   4.764 1.00 . A A . 119 PHE CD2  1 1 
        4  7527 1 1 119 PHE CE1  C   7.426  12.035   4.784 1.00 . A A . 119 PHE CE1  1 1 
        4  7528 1 1 119 PHE CE2  C   9.156  13.588   4.225 1.00 . A A . 119 PHE CE2  1 1 
        4  7529 1 1 119 PHE CG   C   9.715  11.511   5.319 1.00 . A A . 119 PHE CG   1 1 
        4  7530 1 1 119 PHE CZ   C   7.820  13.239   4.238 1.00 . A A . 119 PHE CZ   1 1 
        4  7531 1 1 119 PHE H    H   8.807  10.961   7.729 1.00 . A A . 119 PHE H    1 1 
        4  7532 1 1 119 PHE HA   H  11.491   9.780   7.751 1.00 . A A . 119 PHE HA   1 1 
        4  7533 1 1 119 PHE HB2  H  11.697  10.796   5.448 1.00 . A A . 119 PHE HB2  1 1 
        4  7534 1 1 119 PHE HB3  H  10.462   9.558   5.617 1.00 . A A . 119 PHE HB3  1 1 
        4  7535 1 1 119 PHE HD1  H   8.053  10.235   5.747 1.00 . A A . 119 PHE HD1  1 1 
        4  7536 1 1 119 PHE HD2  H  11.141  13.003   4.756 1.00 . A A . 119 PHE HD2  1 1 
        4  7537 1 1 119 PHE HE1  H   6.379  11.764   4.798 1.00 . A A . 119 PHE HE1  1 1 
        4  7538 1 1 119 PHE HE2  H   9.465  14.531   3.797 1.00 . A A . 119 PHE HE2  1 1 
        4  7539 1 1 119 PHE HZ   H   7.083  13.907   3.817 1.00 . A A . 119 PHE HZ   1 1 
        4  7540 1 1 119 PHE N    N   9.586  10.492   8.099 1.00 . A A . 119 PHE N    1 1 
        4  7541 1 1 119 PHE O    O  11.289  13.011   7.447 1.00 . A A . 119 PHE O    1 1 
        4  7542 1 1 120 LYS C    C  14.757  12.762   9.466 1.00 . A A . 120 LYS C    1 1 
        4  7543 1 1 120 LYS CA   C  13.227  12.898   9.427 1.00 . A A . 120 LYS CA   1 1 
        4  7544 1 1 120 LYS CB   C  12.673  13.066  10.850 1.00 . A A . 120 LYS CB   1 1 
        4  7545 1 1 120 LYS CD   C  12.081  11.969  13.053 1.00 . A A . 120 LYS CD   1 1 
        4  7546 1 1 120 LYS CE   C  12.158  10.703  13.899 1.00 . A A . 120 LYS CE   1 1 
        4  7547 1 1 120 LYS CG   C  12.825  11.821  11.727 1.00 . A A . 120 LYS CG   1 1 
        4  7548 1 1 120 LYS H    H  12.867  10.843   9.019 1.00 . A A . 120 LYS H    1 1 
        4  7549 1 1 120 LYS HA   H  12.977  13.780   8.855 1.00 . A A . 120 LYS HA   1 1 
        4  7550 1 1 120 LYS HB2  H  13.189  13.885  11.333 1.00 . A A . 120 LYS HB2  1 1 
        4  7551 1 1 120 LYS HB3  H  11.621  13.307  10.785 1.00 . A A . 120 LYS HB3  1 1 
        4  7552 1 1 120 LYS HD2  H  12.519  12.786  13.612 1.00 . A A . 120 LYS HD2  1 1 
        4  7553 1 1 120 LYS HD3  H  11.044  12.192  12.849 1.00 . A A . 120 LYS HD3  1 1 
        4  7554 1 1 120 LYS HE2  H  11.529  10.826  14.768 1.00 . A A . 120 LYS HE2  1 1 
        4  7555 1 1 120 LYS HE3  H  11.799   9.870  13.313 1.00 . A A . 120 LYS HE3  1 1 
        4  7556 1 1 120 LYS HG2  H  12.426  10.968  11.196 1.00 . A A . 120 LYS HG2  1 1 
        4  7557 1 1 120 LYS HG3  H  13.875  11.661  11.928 1.00 . A A . 120 LYS HG3  1 1 
        4  7558 1 1 120 LYS HZ1  H  14.184  10.369  13.534 1.00 . A A . 120 LYS HZ1  1 1 
        4  7559 1 1 120 LYS HZ2  H  13.576   9.509  14.855 1.00 . A A . 120 LYS HZ2  1 1 
        4  7560 1 1 120 LYS HZ3  H  13.872  11.167  14.991 1.00 . A A . 120 LYS HZ3  1 1 
        4  7561 1 1 120 LYS N    N  12.577  11.750   8.785 1.00 . A A . 120 LYS N    1 1 
        4  7562 1 1 120 LYS NZ   N  13.543  10.417  14.349 1.00 . A A . 120 LYS NZ   1 1 
        4  7563 1 1 120 LYS O    O  15.308  11.670   9.326 1.00 . A A . 120 LYS O    1 1 
        4  7564 1 1 121 THR C    C  17.298  14.689  11.063 1.00 . A A . 121 THR C    1 1 
        4  7565 1 1 121 THR CA   C  16.894  13.949   9.781 1.00 . A A . 121 THR CA   1 1 
        4  7566 1 1 121 THR CB   C  17.542  14.659   8.564 1.00 . A A . 121 THR CB   1 1 
        4  7567 1 1 121 THR CG2  C  17.470  13.792   7.313 1.00 . A A . 121 THR CG2  1 1 
        4  7568 1 1 121 THR H    H  14.924  14.735   9.718 1.00 . A A . 121 THR H    1 1 
        4  7569 1 1 121 THR HA   H  17.269  12.936   9.829 1.00 . A A . 121 THR HA   1 1 
        4  7570 1 1 121 THR HB   H  18.583  14.848   8.789 1.00 . A A . 121 THR HB   1 1 
        4  7571 1 1 121 THR HG1  H  17.238  16.588   8.909 1.00 . A A . 121 THR HG1  1 1 
        4  7572 1 1 121 THR HG21 H  16.439  13.554   7.098 1.00 . A A . 121 THR HG21 1 1 
        4  7573 1 1 121 THR HG22 H  18.024  12.877   7.474 1.00 . A A . 121 THR HG22 1 1 
        4  7574 1 1 121 THR HG23 H  17.897  14.328   6.477 1.00 . A A . 121 THR HG23 1 1 
        4  7575 1 1 121 THR N    N  15.429  13.894   9.657 1.00 . A A . 121 THR N    1 1 
        4  7576 1 1 121 THR O    O  16.941  15.854  11.255 1.00 . A A . 121 THR O    1 1 
        4  7577 1 1 121 THR OG1  O  16.886  15.914   8.311 1.00 . A A . 121 THR OG1  1 1 
        4  7578 1 1 122 THR C    C  19.853  14.291  13.671 1.00 . A A . 122 THR C    1 1 
        4  7579 1 1 122 THR CA   C  18.391  14.594  13.254 1.00 . A A . 122 THR CA   1 1 
        4  7580 1 1 122 THR CB   C  17.388  14.108  14.339 1.00 . A A . 122 THR CB   1 1 
        4  7581 1 1 122 THR CG2  C  17.213  12.589  14.315 1.00 . A A . 122 THR CG2  1 1 
        4  7582 1 1 122 THR H    H  18.377  13.124  11.705 1.00 . A A . 122 THR H    1 1 
        4  7583 1 1 122 THR HA   H  18.285  15.670  13.173 1.00 . A A . 122 THR HA   1 1 
        4  7584 1 1 122 THR HB   H  16.426  14.558  14.126 1.00 . A A . 122 THR HB   1 1 
        4  7585 1 1 122 THR HG1  H  18.617  14.080  15.892 1.00 . A A . 122 THR HG1  1 1 
        4  7586 1 1 122 THR HG21 H  18.169  12.113  14.468 1.00 . A A . 122 THR HG21 1 1 
        4  7587 1 1 122 THR HG22 H  16.809  12.287  13.361 1.00 . A A . 122 THR HG22 1 1 
        4  7588 1 1 122 THR HG23 H  16.533  12.291  15.102 1.00 . A A . 122 THR HG23 1 1 
        4  7589 1 1 122 THR N    N  18.045  14.020  11.941 1.00 . A A . 122 THR N    1 1 
        4  7590 1 1 122 THR O    O  20.767  14.945  13.125 1.00 . A A . 122 THR O    1 1 
        4  7591 1 1 122 THR OXT  O  20.088  13.432  14.555 1.00 . A A . 122 THR OXT  1 1 
        4  7592 1 1 122 THR OG1  O  17.797  14.534  15.650 1.00 . A A . 122 THR OG1  1 1 
        5  7593 1 1   1 MET C    C -13.185  -7.631 -13.648 1.00 . A A .   1 MET C    1 1 
        5  7594 1 1   1 MET CA   C -11.991  -6.670 -13.716 1.00 . A A .   1 MET CA   1 1 
        5  7595 1 1   1 MET CB   C -10.739  -7.346 -13.137 1.00 . A A .   1 MET CB   1 1 
        5  7596 1 1   1 MET CE   C  -7.603  -5.308 -14.994 1.00 . A A .   1 MET CE   1 1 
        5  7597 1 1   1 MET CG   C  -9.460  -6.551 -13.347 1.00 . A A .   1 MET CG   1 1 
        5  7598 1 1   1 MET H1   H -12.464  -5.598 -11.984 1.00 . A A .   1 MET H1   1 1 
        5  7599 1 1   1 MET H2   H -13.119  -4.946 -13.399 1.00 . A A .   1 MET H2   1 1 
        5  7600 1 1   1 MET H3   H -11.476  -4.750 -13.066 1.00 . A A .   1 MET H3   1 1 
        5  7601 1 1   1 MET HA   H -11.807  -6.422 -14.753 1.00 . A A .   1 MET HA   1 1 
        5  7602 1 1   1 MET HB2  H -10.880  -7.488 -12.076 1.00 . A A .   1 MET HB2  1 1 
        5  7603 1 1   1 MET HB3  H -10.617  -8.312 -13.606 1.00 . A A .   1 MET HB3  1 1 
        5  7604 1 1   1 MET HE1  H  -7.783  -4.409 -14.422 1.00 . A A .   1 MET HE1  1 1 
        5  7605 1 1   1 MET HE2  H  -7.281  -5.042 -15.989 1.00 . A A .   1 MET HE2  1 1 
        5  7606 1 1   1 MET HE3  H  -6.835  -5.894 -14.512 1.00 . A A .   1 MET HE3  1 1 
        5  7607 1 1   1 MET HG2  H  -9.557  -5.594 -12.854 1.00 . A A .   1 MET HG2  1 1 
        5  7608 1 1   1 MET HG3  H  -8.634  -7.098 -12.914 1.00 . A A .   1 MET HG3  1 1 
        5  7609 1 1   1 MET N    N -12.281  -5.405 -12.990 1.00 . A A .   1 MET N    1 1 
        5  7610 1 1   1 MET O    O -13.322  -8.392 -12.694 1.00 . A A .   1 MET O    1 1 
        5  7611 1 1   1 MET SD   S  -9.113  -6.268 -15.094 1.00 . A A .   1 MET SD   1 1 
        5  7612 1 1   2 GLY C    C -16.251  -8.120 -13.604 1.00 . A A .   2 GLY C    1 1 
        5  7613 1 1   2 GLY CA   C -15.233  -8.438 -14.698 1.00 . A A .   2 GLY CA   1 1 
        5  7614 1 1   2 GLY H    H -13.905  -6.930 -15.380 1.00 . A A .   2 GLY H    1 1 
        5  7615 1 1   2 GLY HA2  H -15.710  -8.324 -15.660 1.00 . A A .   2 GLY HA2  1 1 
        5  7616 1 1   2 GLY HA3  H -14.915  -9.466 -14.591 1.00 . A A .   2 GLY HA3  1 1 
        5  7617 1 1   2 GLY N    N -14.057  -7.573 -14.655 1.00 . A A .   2 GLY N    1 1 
        5  7618 1 1   2 GLY O    O -16.360  -8.851 -12.618 1.00 . A A .   2 GLY O    1 1 
        5  7619 1 1   3 HIS C    C -19.120  -7.622 -12.613 1.00 . A A .   3 HIS C    1 1 
        5  7620 1 1   3 HIS CA   C -17.984  -6.597 -12.777 1.00 . A A .   3 HIS CA   1 1 
        5  7621 1 1   3 HIS CB   C -18.566  -5.233 -13.165 1.00 . A A .   3 HIS CB   1 1 
        5  7622 1 1   3 HIS CD2  C -19.007  -3.587 -11.210 1.00 . A A .   3 HIS CD2  1 1 
        5  7623 1 1   3 HIS CE1  C -21.052  -4.197 -10.727 1.00 . A A .   3 HIS CE1  1 1 
        5  7624 1 1   3 HIS CG   C -19.345  -4.579 -12.064 1.00 . A A .   3 HIS CG   1 1 
        5  7625 1 1   3 HIS H    H -16.900  -6.514 -14.607 1.00 . A A .   3 HIS H    1 1 
        5  7626 1 1   3 HIS HA   H -17.464  -6.500 -11.835 1.00 . A A .   3 HIS HA   1 1 
        5  7627 1 1   3 HIS HB2  H -17.758  -4.568 -13.439 1.00 . A A .   3 HIS HB2  1 1 
        5  7628 1 1   3 HIS HB3  H -19.225  -5.356 -14.014 1.00 . A A .   3 HIS HB3  1 1 
        5  7629 1 1   3 HIS HD1  H -21.168  -5.633 -12.171 1.00 . A A .   3 HIS HD1  1 1 
        5  7630 1 1   3 HIS HD2  H -18.062  -3.062 -11.179 1.00 . A A .   3 HIS HD2  1 1 
        5  7631 1 1   3 HIS HE1  H -22.022  -4.264 -10.256 1.00 . A A .   3 HIS HE1  1 1 
        5  7632 1 1   3 HIS HE2  H -20.064  -2.844  -9.564 1.00 . A A .   3 HIS HE2  1 1 
        5  7633 1 1   3 HIS N    N -17.004  -7.035 -13.782 1.00 . A A .   3 HIS N    1 1 
        5  7634 1 1   3 HIS ND1  N -20.633  -4.938 -11.732 1.00 . A A .   3 HIS ND1  1 1 
        5  7635 1 1   3 HIS NE2  N -20.086  -3.369 -10.390 1.00 . A A .   3 HIS NE2  1 1 
        5  7636 1 1   3 HIS O    O -19.427  -8.054 -11.501 1.00 . A A .   3 HIS O    1 1 
        5  7637 1 1   4 HIS C    C -20.209 -10.396 -14.005 1.00 . A A .   4 HIS C    1 1 
        5  7638 1 1   4 HIS CA   C -20.806  -9.010 -13.725 1.00 . A A .   4 HIS CA   1 1 
        5  7639 1 1   4 HIS CB   C -21.871  -8.674 -14.779 1.00 . A A .   4 HIS CB   1 1 
        5  7640 1 1   4 HIS CD2  C -23.278 -10.794 -15.327 1.00 . A A .   4 HIS CD2  1 1 
        5  7641 1 1   4 HIS CE1  C -25.084 -10.272 -14.205 1.00 . A A .   4 HIS CE1  1 1 
        5  7642 1 1   4 HIS CG   C -23.064  -9.588 -14.748 1.00 . A A .   4 HIS CG   1 1 
        5  7643 1 1   4 HIS H    H -19.513  -7.550 -14.573 1.00 . A A .   4 HIS H    1 1 
        5  7644 1 1   4 HIS HA   H -21.266  -9.019 -12.746 1.00 . A A .   4 HIS HA   1 1 
        5  7645 1 1   4 HIS HB2  H -22.222  -7.665 -14.614 1.00 . A A .   4 HIS HB2  1 1 
        5  7646 1 1   4 HIS HB3  H -21.427  -8.736 -15.763 1.00 . A A .   4 HIS HB3  1 1 
        5  7647 1 1   4 HIS HD1  H -24.377  -8.481 -13.528 1.00 . A A .   4 HIS HD1  1 1 
        5  7648 1 1   4 HIS HD2  H -22.584 -11.337 -15.953 1.00 . A A .   4 HIS HD2  1 1 
        5  7649 1 1   4 HIS HE1  H -26.075 -10.310 -13.775 1.00 . A A .   4 HIS HE1  1 1 
        5  7650 1 1   4 HIS HE2  H -24.901 -12.100 -15.095 1.00 . A A .   4 HIS HE2  1 1 
        5  7651 1 1   4 HIS N    N -19.754  -7.985 -13.726 1.00 . A A .   4 HIS N    1 1 
        5  7652 1 1   4 HIS ND1  N -24.217  -9.293 -14.055 1.00 . A A .   4 HIS ND1  1 1 
        5  7653 1 1   4 HIS NE2  N -24.542 -11.195 -14.972 1.00 . A A .   4 HIS NE2  1 1 
        5  7654 1 1   4 HIS O    O -20.763 -11.420 -13.605 1.00 . A A .   4 HIS O    1 1 
        5  7655 1 1   5 HIS C    C -17.866 -12.374 -13.792 1.00 . A A .   5 HIS C    1 1 
        5  7656 1 1   5 HIS CA   C -18.377 -11.650 -15.054 1.00 . A A .   5 HIS CA   1 1 
        5  7657 1 1   5 HIS CB   C -17.215 -11.329 -16.005 1.00 . A A .   5 HIS CB   1 1 
        5  7658 1 1   5 HIS CD2  C -15.955 -13.427 -16.899 1.00 . A A .   5 HIS CD2  1 1 
        5  7659 1 1   5 HIS CE1  C -17.009 -13.623 -18.806 1.00 . A A .   5 HIS CE1  1 1 
        5  7660 1 1   5 HIS CG   C -16.878 -12.435 -16.960 1.00 . A A .   5 HIS CG   1 1 
        5  7661 1 1   5 HIS H    H -18.689  -9.553 -14.990 1.00 . A A .   5 HIS H    1 1 
        5  7662 1 1   5 HIS HA   H -19.085 -12.293 -15.563 1.00 . A A .   5 HIS HA   1 1 
        5  7663 1 1   5 HIS HB2  H -17.470 -10.458 -16.592 1.00 . A A .   5 HIS HB2  1 1 
        5  7664 1 1   5 HIS HB3  H -16.329 -11.110 -15.421 1.00 . A A .   5 HIS HB3  1 1 
        5  7665 1 1   5 HIS HD1  H -18.253 -12.034 -18.505 1.00 . A A .   5 HIS HD1  1 1 
        5  7666 1 1   5 HIS HD2  H -15.269 -13.616 -16.087 1.00 . A A .   5 HIS HD2  1 1 
        5  7667 1 1   5 HIS HE1  H -17.320 -13.981 -19.776 1.00 . A A .   5 HIS HE1  1 1 
        5  7668 1 1   5 HIS HE2  H -15.650 -15.023 -18.222 1.00 . A A .   5 HIS HE2  1 1 
        5  7669 1 1   5 HIS N    N -19.072 -10.408 -14.699 1.00 . A A .   5 HIS N    1 1 
        5  7670 1 1   5 HIS ND1  N -17.520 -12.593 -18.168 1.00 . A A .   5 HIS ND1  1 1 
        5  7671 1 1   5 HIS NE2  N -16.060 -14.147 -18.062 1.00 . A A .   5 HIS NE2  1 1 
        5  7672 1 1   5 HIS O    O -17.582 -13.573 -13.815 1.00 . A A .   5 HIS O    1 1 
        5  7673 1 1   6 HIS C    C -18.588 -12.077 -10.418 1.00 . A A .   6 HIS C    1 1 
        5  7674 1 1   6 HIS CA   C -17.403 -12.194 -11.387 1.00 . A A .   6 HIS CA   1 1 
        5  7675 1 1   6 HIS CB   C -16.181 -11.500 -10.773 1.00 . A A .   6 HIS CB   1 1 
        5  7676 1 1   6 HIS CD2  C -14.339 -12.964 -11.865 1.00 . A A .   6 HIS CD2  1 1 
        5  7677 1 1   6 HIS CE1  C -12.949 -11.366 -12.416 1.00 . A A .   6 HIS CE1  1 1 
        5  7678 1 1   6 HIS CG   C -14.893 -11.791 -11.478 1.00 . A A .   6 HIS CG   1 1 
        5  7679 1 1   6 HIS H    H -17.868 -10.654 -12.769 1.00 . A A .   6 HIS H    1 1 
        5  7680 1 1   6 HIS HA   H -17.175 -13.243 -11.529 1.00 . A A .   6 HIS HA   1 1 
        5  7681 1 1   6 HIS HB2  H -16.334 -10.431 -10.793 1.00 . A A .   6 HIS HB2  1 1 
        5  7682 1 1   6 HIS HB3  H -16.074 -11.820  -9.744 1.00 . A A .   6 HIS HB3  1 1 
        5  7683 1 1   6 HIS HD1  H -14.106  -9.845 -11.688 1.00 . A A .   6 HIS HD1  1 1 
        5  7684 1 1   6 HIS HD2  H -14.769 -13.948 -11.739 1.00 . A A .   6 HIS HD2  1 1 
        5  7685 1 1   6 HIS HE1  H -12.087 -10.838 -12.801 1.00 . A A .   6 HIS HE1  1 1 
        5  7686 1 1   6 HIS HE2  H -12.612 -13.291 -13.003 1.00 . A A .   6 HIS HE2  1 1 
        5  7687 1 1   6 HIS N    N -17.735 -11.623 -12.697 1.00 . A A .   6 HIS N    1 1 
        5  7688 1 1   6 HIS ND1  N -13.994 -10.812 -11.838 1.00 . A A .   6 HIS ND1  1 1 
        5  7689 1 1   6 HIS NE2  N -13.130 -12.671 -12.447 1.00 . A A .   6 HIS NE2  1 1 
        5  7690 1 1   6 HIS O    O -19.235 -11.033 -10.323 1.00 . A A .   6 HIS O    1 1 
        5  7691 1 1   7 HIS C    C -19.600 -14.197  -7.578 1.00 . A A .   7 HIS C    1 1 
        5  7692 1 1   7 HIS CA   C -19.917 -13.177  -8.683 1.00 . A A .   7 HIS CA   1 1 
        5  7693 1 1   7 HIS CB   C -21.294 -13.447  -9.322 1.00 . A A .   7 HIS CB   1 1 
        5  7694 1 1   7 HIS CD2  C -20.973 -14.415 -11.708 1.00 . A A .   7 HIS CD2  1 1 
        5  7695 1 1   7 HIS CE1  C -21.575 -16.480 -11.304 1.00 . A A .   7 HIS CE1  1 1 
        5  7696 1 1   7 HIS CG   C -21.288 -14.496 -10.392 1.00 . A A .   7 HIS CG   1 1 
        5  7697 1 1   7 HIS H    H -18.326 -13.972  -9.847 1.00 . A A .   7 HIS H    1 1 
        5  7698 1 1   7 HIS HA   H -19.940 -12.194  -8.230 1.00 . A A .   7 HIS HA   1 1 
        5  7699 1 1   7 HIS HB2  H -21.985 -13.763  -8.556 1.00 . A A .   7 HIS HB2  1 1 
        5  7700 1 1   7 HIS HB3  H -21.658 -12.529  -9.764 1.00 . A A .   7 HIS HB3  1 1 
        5  7701 1 1   7 HIS HD1  H -21.952 -16.189  -9.316 1.00 . A A .   7 HIS HD1  1 1 
        5  7702 1 1   7 HIS HD2  H -20.628 -13.534 -12.233 1.00 . A A .   7 HIS HD2  1 1 
        5  7703 1 1   7 HIS HE1  H -21.804 -17.528 -11.433 1.00 . A A .   7 HIS HE1  1 1 
        5  7704 1 1   7 HIS HE2  H -20.976 -15.918 -13.174 1.00 . A A .   7 HIS HE2  1 1 
        5  7705 1 1   7 HIS N    N -18.860 -13.160  -9.700 1.00 . A A .   7 HIS N    1 1 
        5  7706 1 1   7 HIS ND1  N -21.661 -15.806 -10.175 1.00 . A A .   7 HIS ND1  1 1 
        5  7707 1 1   7 HIS NE2  N -21.162 -15.661 -12.246 1.00 . A A .   7 HIS NE2  1 1 
        5  7708 1 1   7 HIS O    O -19.864 -15.392  -7.716 1.00 . A A .   7 HIS O    1 1 
        5  7709 1 1   8 HIS C    C -18.722 -13.798  -4.033 1.00 . A A .   8 HIS C    1 1 
        5  7710 1 1   8 HIS CA   C -18.593 -14.552  -5.367 1.00 . A A .   8 HIS CA   1 1 
        5  7711 1 1   8 HIS CB   C -17.142 -15.016  -5.565 1.00 . A A .   8 HIS CB   1 1 
        5  7712 1 1   8 HIS CD2  C -16.758 -17.152  -4.134 1.00 . A A .   8 HIS CD2  1 1 
        5  7713 1 1   8 HIS CE1  C -15.461 -16.285  -2.597 1.00 . A A .   8 HIS CE1  1 1 
        5  7714 1 1   8 HIS CG   C -16.603 -15.839  -4.430 1.00 . A A .   8 HIS CG   1 1 
        5  7715 1 1   8 HIS H    H -18.843 -12.743  -6.440 1.00 . A A .   8 HIS H    1 1 
        5  7716 1 1   8 HIS HA   H -19.240 -15.419  -5.343 1.00 . A A .   8 HIS HA   1 1 
        5  7717 1 1   8 HIS HB2  H -17.086 -15.616  -6.461 1.00 . A A .   8 HIS HB2  1 1 
        5  7718 1 1   8 HIS HB3  H -16.506 -14.149  -5.681 1.00 . A A .   8 HIS HB3  1 1 
        5  7719 1 1   8 HIS HD1  H -15.486 -14.395  -3.367 1.00 . A A .   8 HIS HD1  1 1 
        5  7720 1 1   8 HIS HD2  H -17.343 -17.870  -4.690 1.00 . A A .   8 HIS HD2  1 1 
        5  7721 1 1   8 HIS HE1  H -14.833 -16.175  -1.726 1.00 . A A .   8 HIS HE1  1 1 
        5  7722 1 1   8 HIS HE2  H -15.920 -18.280  -2.571 1.00 . A A .   8 HIS HE2  1 1 
        5  7723 1 1   8 HIS N    N -19.006 -13.707  -6.491 1.00 . A A .   8 HIS N    1 1 
        5  7724 1 1   8 HIS ND1  N -15.785 -15.326  -3.441 1.00 . A A .   8 HIS ND1  1 1 
        5  7725 1 1   8 HIS NE2  N -16.038 -17.399  -2.994 1.00 . A A .   8 HIS NE2  1 1 
        5  7726 1 1   8 HIS O    O -18.119 -12.741  -3.846 1.00 . A A .   8 HIS O    1 1 
        5  7727 1 1   9 SER C    C -18.655 -14.279  -0.779 1.00 . A A .   9 SER C    1 1 
        5  7728 1 1   9 SER CA   C -19.691 -13.746  -1.784 1.00 . A A .   9 SER CA   1 1 
        5  7729 1 1   9 SER CB   C -21.113 -14.015  -1.274 1.00 . A A .   9 SER CB   1 1 
        5  7730 1 1   9 SER H    H -19.988 -15.176  -3.332 1.00 . A A .   9 SER H    1 1 
        5  7731 1 1   9 SER HA   H -19.553 -12.677  -1.882 1.00 . A A .   9 SER HA   1 1 
        5  7732 1 1   9 SER HB2  H -21.201 -13.668  -0.254 1.00 . A A .   9 SER HB2  1 1 
        5  7733 1 1   9 SER HB3  H -21.822 -13.485  -1.893 1.00 . A A .   9 SER HB3  1 1 
        5  7734 1 1   9 SER HG   H -22.209 -15.566  -0.776 1.00 . A A .   9 SER HG   1 1 
        5  7735 1 1   9 SER N    N -19.510 -14.346  -3.115 1.00 . A A .   9 SER N    1 1 
        5  7736 1 1   9 SER O    O -17.806 -15.103  -1.129 1.00 . A A .   9 SER O    1 1 
        5  7737 1 1   9 SER OG   O -21.422 -15.400  -1.312 1.00 . A A .   9 SER OG   1 1 
        5  7738 1 1  10 HIS C    C -16.374 -13.571   1.264 1.00 . A A .  10 HIS C    1 1 
        5  7739 1 1  10 HIS CA   C -17.770 -14.162   1.527 1.00 . A A .  10 HIS CA   1 1 
        5  7740 1 1  10 HIS CB   C -17.681 -15.687   1.705 1.00 . A A .  10 HIS CB   1 1 
        5  7741 1 1  10 HIS CD2  C -19.899 -17.002   2.023 1.00 . A A .  10 HIS CD2  1 1 
        5  7742 1 1  10 HIS CE1  C -20.093 -16.751   4.189 1.00 . A A .  10 HIS CE1  1 1 
        5  7743 1 1  10 HIS CG   C -18.841 -16.272   2.447 1.00 . A A .  10 HIS CG   1 1 
        5  7744 1 1  10 HIS H    H -19.462 -13.181   0.692 1.00 . A A .  10 HIS H    1 1 
        5  7745 1 1  10 HIS HA   H -18.142 -13.734   2.450 1.00 . A A .  10 HIS HA   1 1 
        5  7746 1 1  10 HIS HB2  H -17.638 -16.156   0.734 1.00 . A A .  10 HIS HB2  1 1 
        5  7747 1 1  10 HIS HB3  H -16.781 -15.930   2.255 1.00 . A A .  10 HIS HB3  1 1 
        5  7748 1 1  10 HIS HD1  H -18.391 -15.646   4.406 1.00 . A A .  10 HIS HD1  1 1 
        5  7749 1 1  10 HIS HD2  H -20.109 -17.296   1.003 1.00 . A A .  10 HIS HD2  1 1 
        5  7750 1 1  10 HIS HE1  H -20.468 -16.802   5.201 1.00 . A A .  10 HIS HE1  1 1 
        5  7751 1 1  10 HIS HE2  H -21.594 -17.600   3.100 1.00 . A A .  10 HIS HE2  1 1 
        5  7752 1 1  10 HIS N    N -18.733 -13.802   0.470 1.00 . A A .  10 HIS N    1 1 
        5  7753 1 1  10 HIS ND1  N -18.997 -16.135   3.806 1.00 . A A .  10 HIS ND1  1 1 
        5  7754 1 1  10 HIS NE2  N -20.663 -17.286   3.128 1.00 . A A .  10 HIS NE2  1 1 
        5  7755 1 1  10 HIS O    O -15.353 -14.158   1.631 1.00 . A A .  10 HIS O    1 1 
        5  7756 1 1  11 MET C    C -14.675 -10.896   1.707 1.00 . A A .  11 MET C    1 1 
        5  7757 1 1  11 MET CA   C -15.075 -11.676   0.439 1.00 . A A .  11 MET CA   1 1 
        5  7758 1 1  11 MET CB   C -15.196 -10.726  -0.761 1.00 . A A .  11 MET CB   1 1 
        5  7759 1 1  11 MET CE   C -12.962 -11.771  -2.817 1.00 . A A .  11 MET CE   1 1 
        5  7760 1 1  11 MET CG   C -15.616 -11.423  -2.051 1.00 . A A .  11 MET CG   1 1 
        5  7761 1 1  11 MET H    H -17.176 -11.989   0.342 1.00 . A A .  11 MET H    1 1 
        5  7762 1 1  11 MET HA   H -14.310 -12.411   0.228 1.00 . A A .  11 MET HA   1 1 
        5  7763 1 1  11 MET HB2  H -15.929  -9.965  -0.533 1.00 . A A .  11 MET HB2  1 1 
        5  7764 1 1  11 MET HB3  H -14.239 -10.251  -0.929 1.00 . A A .  11 MET HB3  1 1 
        5  7765 1 1  11 MET HE1  H -13.132 -11.028  -3.583 1.00 . A A .  11 MET HE1  1 1 
        5  7766 1 1  11 MET HE2  H -12.167 -12.432  -3.126 1.00 . A A .  11 MET HE2  1 1 
        5  7767 1 1  11 MET HE3  H -12.683 -11.281  -1.895 1.00 . A A .  11 MET HE3  1 1 
        5  7768 1 1  11 MET HG2  H -16.589 -11.868  -1.906 1.00 . A A .  11 MET HG2  1 1 
        5  7769 1 1  11 MET HG3  H -15.676 -10.686  -2.840 1.00 . A A .  11 MET HG3  1 1 
        5  7770 1 1  11 MET N    N -16.337 -12.392   0.654 1.00 . A A .  11 MET N    1 1 
        5  7771 1 1  11 MET O    O -15.100  -9.759   1.913 1.00 . A A .  11 MET O    1 1 
        5  7772 1 1  11 MET SD   S -14.462 -12.720  -2.559 1.00 . A A .  11 MET SD   1 1 
        5  7773 1 1  12 THR C    C -12.168 -10.131   3.755 1.00 . A A .  12 THR C    1 1 
        5  7774 1 1  12 THR CA   C -13.471 -10.939   3.854 1.00 . A A .  12 THR CA   1 1 
        5  7775 1 1  12 THR CB   C -13.291 -12.045   4.924 1.00 . A A .  12 THR CB   1 1 
        5  7776 1 1  12 THR CG2  C -14.611 -12.759   5.197 1.00 . A A .  12 THR CG2  1 1 
        5  7777 1 1  12 THR H    H -13.532 -12.414   2.321 1.00 . A A .  12 THR H    1 1 
        5  7778 1 1  12 THR HA   H -14.266 -10.280   4.183 1.00 . A A .  12 THR HA   1 1 
        5  7779 1 1  12 THR HB   H -12.952 -11.585   5.844 1.00 . A A .  12 THR HB   1 1 
        5  7780 1 1  12 THR HG1  H -12.666 -13.889   4.568 1.00 . A A .  12 THR HG1  1 1 
        5  7781 1 1  12 THR HG21 H -14.977 -13.206   4.284 1.00 . A A .  12 THR HG21 1 1 
        5  7782 1 1  12 THR HG22 H -15.337 -12.047   5.564 1.00 . A A .  12 THR HG22 1 1 
        5  7783 1 1  12 THR HG23 H -14.460 -13.530   5.938 1.00 . A A .  12 THR HG23 1 1 
        5  7784 1 1  12 THR N    N -13.869 -11.525   2.560 1.00 . A A .  12 THR N    1 1 
        5  7785 1 1  12 THR O    O -11.405 -10.042   4.717 1.00 . A A .  12 THR O    1 1 
        5  7786 1 1  12 THR OG1  O -12.305 -13.001   4.494 1.00 . A A .  12 THR OG1  1 1 
        5  7787 1 1  13 GLY C    C -10.493  -7.588   3.334 1.00 . A A .  13 GLY C    1 1 
        5  7788 1 1  13 GLY CA   C -10.710  -8.756   2.369 1.00 . A A .  13 GLY CA   1 1 
        5  7789 1 1  13 GLY H    H -12.611  -9.567   1.890 1.00 . A A .  13 GLY H    1 1 
        5  7790 1 1  13 GLY HA2  H  -9.870  -9.431   2.455 1.00 . A A .  13 GLY HA2  1 1 
        5  7791 1 1  13 GLY HA3  H -10.735  -8.368   1.361 1.00 . A A .  13 GLY HA3  1 1 
        5  7792 1 1  13 GLY N    N -11.938  -9.510   2.601 1.00 . A A .  13 GLY N    1 1 
        5  7793 1 1  13 GLY O    O -10.955  -6.472   3.083 1.00 . A A .  13 GLY O    1 1 
        5  7794 1 1  14 ASN C    C  -7.893  -6.532   5.300 1.00 . A A .  14 ASN C    1 1 
        5  7795 1 1  14 ASN CA   C  -9.408  -6.802   5.394 1.00 . A A .  14 ASN CA   1 1 
        5  7796 1 1  14 ASN CB   C  -9.791  -7.192   6.831 1.00 . A A .  14 ASN CB   1 1 
        5  7797 1 1  14 ASN CG   C -11.294  -7.328   7.023 1.00 . A A .  14 ASN CG   1 1 
        5  7798 1 1  14 ASN H    H  -9.554  -8.779   4.633 1.00 . A A .  14 ASN H    1 1 
        5  7799 1 1  14 ASN HA   H  -9.935  -5.893   5.128 1.00 . A A .  14 ASN HA   1 1 
        5  7800 1 1  14 ASN HB2  H  -9.330  -8.139   7.074 1.00 . A A .  14 ASN HB2  1 1 
        5  7801 1 1  14 ASN HB3  H  -9.427  -6.435   7.514 1.00 . A A .  14 ASN HB3  1 1 
        5  7802 1 1  14 ASN HD21 H -11.211  -9.278   6.674 1.00 . A A .  14 ASN HD21 1 1 
        5  7803 1 1  14 ASN HD22 H -12.776  -8.638   7.020 1.00 . A A .  14 ASN HD22 1 1 
        5  7804 1 1  14 ASN N    N  -9.802  -7.850   4.443 1.00 . A A .  14 ASN N    1 1 
        5  7805 1 1  14 ASN ND2  N -11.812  -8.534   6.890 1.00 . A A .  14 ASN ND2  1 1 
        5  7806 1 1  14 ASN O    O  -7.080  -7.246   5.894 1.00 . A A .  14 ASN O    1 1 
        5  7807 1 1  14 ASN OD1  O -11.990  -6.352   7.294 1.00 . A A .  14 ASN OD1  1 1 
        5  7808 1 1  15 VAL C    C  -5.680  -3.918   5.072 1.00 . A A .  15 VAL C    1 1 
        5  7809 1 1  15 VAL CA   C  -6.105  -5.183   4.305 1.00 . A A .  15 VAL CA   1 1 
        5  7810 1 1  15 VAL CB   C  -5.815  -4.987   2.792 1.00 . A A .  15 VAL CB   1 1 
        5  7811 1 1  15 VAL CG1  C  -4.341  -4.661   2.547 1.00 . A A .  15 VAL CG1  1 1 
        5  7812 1 1  15 VAL CG2  C  -6.233  -6.228   2.001 1.00 . A A .  15 VAL CG2  1 1 
        5  7813 1 1  15 VAL H    H  -8.211  -4.962   4.106 1.00 . A A .  15 VAL H    1 1 
        5  7814 1 1  15 VAL HA   H  -5.509  -6.017   4.655 1.00 . A A .  15 VAL HA   1 1 
        5  7815 1 1  15 VAL HB   H  -6.407  -4.150   2.441 1.00 . A A .  15 VAL HB   1 1 
        5  7816 1 1  15 VAL HG11 H  -4.168  -4.545   1.486 1.00 . A A .  15 VAL HG11 1 1 
        5  7817 1 1  15 VAL HG12 H  -3.723  -5.464   2.925 1.00 . A A .  15 VAL HG12 1 1 
        5  7818 1 1  15 VAL HG13 H  -4.084  -3.742   3.054 1.00 . A A .  15 VAL HG13 1 1 
        5  7819 1 1  15 VAL HG21 H  -5.672  -7.083   2.349 1.00 . A A .  15 VAL HG21 1 1 
        5  7820 1 1  15 VAL HG22 H  -6.034  -6.071   0.951 1.00 . A A .  15 VAL HG22 1 1 
        5  7821 1 1  15 VAL HG23 H  -7.288  -6.407   2.146 1.00 . A A .  15 VAL HG23 1 1 
        5  7822 1 1  15 VAL N    N  -7.520  -5.511   4.531 1.00 . A A .  15 VAL N    1 1 
        5  7823 1 1  15 VAL O    O  -6.430  -2.946   5.157 1.00 . A A .  15 VAL O    1 1 
        5  7824 1 1  16 CYS C    C  -2.430  -2.585   6.003 1.00 . A A .  16 CYS C    1 1 
        5  7825 1 1  16 CYS CA   C  -3.907  -2.799   6.366 1.00 . A A .  16 CYS CA   1 1 
        5  7826 1 1  16 CYS CB   C  -4.044  -3.024   7.878 1.00 . A A .  16 CYS CB   1 1 
        5  7827 1 1  16 CYS H    H  -3.924  -4.756   5.530 1.00 . A A .  16 CYS H    1 1 
        5  7828 1 1  16 CYS HA   H  -4.463  -1.913   6.088 1.00 . A A .  16 CYS HA   1 1 
        5  7829 1 1  16 CYS HB2  H  -3.627  -2.176   8.401 1.00 . A A .  16 CYS HB2  1 1 
        5  7830 1 1  16 CYS HB3  H  -5.092  -3.111   8.128 1.00 . A A .  16 CYS HB3  1 1 
        5  7831 1 1  16 CYS HG   H  -3.088  -5.359   7.477 1.00 . A A .  16 CYS HG   1 1 
        5  7832 1 1  16 CYS N    N  -4.465  -3.944   5.625 1.00 . A A .  16 CYS N    1 1 
        5  7833 1 1  16 CYS O    O  -1.792  -3.468   5.433 1.00 . A A .  16 CYS O    1 1 
        5  7834 1 1  16 CYS SG   S  -3.205  -4.509   8.490 1.00 . A A .  16 CYS SG   1 1 
        5  7835 1 1  17 ILE C    C   0.473  -1.586   7.104 1.00 . A A .  17 ILE C    1 1 
        5  7836 1 1  17 ILE CA   C  -0.484  -1.099   6.003 1.00 . A A .  17 ILE CA   1 1 
        5  7837 1 1  17 ILE CB   C  -0.261   0.425   5.782 1.00 . A A .  17 ILE CB   1 1 
        5  7838 1 1  17 ILE CD1  C  -2.615   1.240   5.156 1.00 . A A .  17 ILE CD1  1 1 
        5  7839 1 1  17 ILE CG1  C  -1.196   0.980   4.686 1.00 . A A .  17 ILE CG1  1 1 
        5  7840 1 1  17 ILE CG2  C   1.202   0.710   5.431 1.00 . A A .  17 ILE CG2  1 1 
        5  7841 1 1  17 ILE H    H  -2.426  -0.750   6.808 1.00 . A A .  17 ILE H    1 1 
        5  7842 1 1  17 ILE HA   H  -0.241  -1.611   5.080 1.00 . A A .  17 ILE HA   1 1 
        5  7843 1 1  17 ILE HB   H  -0.476   0.930   6.715 1.00 . A A .  17 ILE HB   1 1 
        5  7844 1 1  17 ILE HD11 H  -3.196   1.634   4.336 1.00 . A A .  17 ILE HD11 1 1 
        5  7845 1 1  17 ILE HD12 H  -2.601   1.957   5.965 1.00 . A A .  17 ILE HD12 1 1 
        5  7846 1 1  17 ILE HD13 H  -3.057   0.317   5.500 1.00 . A A .  17 ILE HD13 1 1 
        5  7847 1 1  17 ILE HG12 H  -0.799   1.915   4.321 1.00 . A A .  17 ILE HG12 1 1 
        5  7848 1 1  17 ILE HG13 H  -1.242   0.273   3.869 1.00 . A A .  17 ILE HG13 1 1 
        5  7849 1 1  17 ILE HG21 H   1.837   0.411   6.253 1.00 . A A .  17 ILE HG21 1 1 
        5  7850 1 1  17 ILE HG22 H   1.330   1.768   5.247 1.00 . A A .  17 ILE HG22 1 1 
        5  7851 1 1  17 ILE HG23 H   1.478   0.158   4.543 1.00 . A A .  17 ILE HG23 1 1 
        5  7852 1 1  17 ILE N    N  -1.884  -1.414   6.334 1.00 . A A .  17 ILE N    1 1 
        5  7853 1 1  17 ILE O    O   0.384  -1.145   8.252 1.00 . A A .  17 ILE O    1 1 
        5  7854 1 1  18 GLU C    C   3.382  -1.935   8.121 1.00 . A A .  18 GLU C    1 1 
        5  7855 1 1  18 GLU CA   C   2.367  -3.010   7.707 1.00 . A A .  18 GLU CA   1 1 
        5  7856 1 1  18 GLU CB   C   3.119  -4.221   7.132 1.00 . A A .  18 GLU CB   1 1 
        5  7857 1 1  18 GLU CD   C   5.019  -5.884   7.486 1.00 . A A .  18 GLU CD   1 1 
        5  7858 1 1  18 G