*HEADER    ALLERGEN                                12-NOV-06   2JMH              
*TITLE     NMR SOLUTION STRUCTURE OF BLO T 5, A MAJOR MITE ALLERGEN              
*TITLE    2 FROM BLOMIA TROPICALIS                                               
*COMPND    MOL_ID: 1;                                                            
*COMPND   2 MOLECULE: MITE ALLERGEN BLO T 5;                                     
*COMPND   3 CHAIN: A;                                                            
*COMPND   4 FRAGMENT: RESIDUES 18-134;                                           
*COMPND   5 SYNONYM: BLO T 5;                                                    
*COMPND   6 ENGINEERED: YES                                                      
*SOURCE    MOL_ID: 1;                                                            
*SOURCE   2 ORGANISM_SCIENTIFIC: BLOMIA TROPICALIS;                              
*SOURCE   3 ORGANISM_COMMON: MITE;                                               
*SOURCE   4 GENE: BLOT5;                                                         
*SOURCE   5 EXPRESSION_SYSTEM: ESCHERICHIA COLI;                                 
*SOURCE   6 EXPRESSION_SYSTEM_STRAIN: BL21;                                      
*SOURCE   7 EXPRESSION_SYSTEM_VECTOR_TYPE: PLASMID;                              
*SOURCE   8 EXPRESSION_SYSTEM_PLASMID: PGEX4T-1                                  
*KEYWDS    ALLERGEN, DUST MITES, BLOMIA TROPICALIS, BLO T 5, GROUP 5             
*EXPDTA    NMR, 21 STRUCTURES                                                    
*AUTHOR    M.T.NAIK, C.CHANG, I.KUO, K.CHUA, T.HUANG                             
*REVDAT   1   13-NOV-07 2JMH    0                                                


Constrains/0000755000373300001320000000000010525573626012111 5ustar  mandarnmr1Constrains/readme.txt0000644000373300001320000000036610525574131014104 0ustar  mandarnmr1NMRSTAR format files:
Noe Distance, H-Bond and Dihedral file parsed using Wattos from BMRB.
HNHA J coupling conversion by Protein Coupling Constant Table Generator from BMRB.

Cyana format files:
Cyana2.1 format folder contain all original files.Constrains/BT5_dist.str0000644000373300001320000134175210525570705014270 0ustar  mandarnmr1data_n/a_MR_file_constraints


save_global_MR_file_characteristics
    _File_characteristics.Sf_category       file_characteristics 
    _File_characteristics.ID                1 
    _File_characteristics.NMR_STAR_version  3.0 
    _File_characteristics.PDB_ID            N/A 
    _File_characteristics.MR_file_name      n/a.mr 
    _File_characteristics.Conversion_date   2006-11-12 

    loop_
        _File_characteristic.File_characteristics_ID 
        _File_characteristic.MR_file_block_position 
        _File_characteristic.Program 
        _File_characteristic.Type 
        _File_characteristic.Subtype 
        _File_characteristic.Format 

        1   1   DYANA/DIANA   distance   NOE   simple   
    stop_

save_


save_DYANA/DIANA_distance_constraints_1
    _Distance_constraints.Sf_category             distance_constraints 
    _Distance_constraints.ID                      1 
    _Distance_constraints.MR_file_block_position  1 
    _Distance_constraints.Program                 DYANA/DIANA 
    _Distance_constraints.Type                    distance 
    _Distance_constraints.Subtype                 NOE 
    _Distance_constraints.Format                  simple 

    loop_
        _Dist_constraint_tree.Constraints_ID 
        _Dist_constraint_tree.ID 
        _Dist_constraint_tree.Node_ID 
        _Dist_constraint_tree.Down_node_ID 
        _Dist_constraint_tree.Right_node_ID 
        _Dist_constraint_tree.Logic_operation 

        1      1   1   .   .   .   
        1      2   1   .   .   .   
        1      3   1   .   .   .   
        1      4   1   .   .   .   
        1      5   1   .   .   .   
        1      6   1   .   .   .   
        1      7   1   .   .   .   
        1      8   1   .   .   .   
        1      9   1   .   .   .   
        1     10   1   .   .   .   
        1     11   1   .   .   .   
        1     12   1   .   .   .   
        1     13   1   .   .   .   
        1     14   1   .   .   .   
        1     15   1   .   .   .   
        1     16   1   .   .   .   
        1     17   1   .   .   .   
        1     18   1   .   .   .   
        1     19   1   .   .   .   
        1     20   1   .   .   .   
        1     21   1   .   .   .   
        1     22   1   .   .   .   
        1     23   1   .   .   .   
        1     24   1   .   .   .   
        1     25   1   .   .   .   
        1     26   1   .   .   .   
        1     27   1   .   .   .   
        1     28   1   .   .   .   
        1     29   1   .   .   .   
        1     30   1   .   .   .   
        1     31   1   .   .   .   
        1     32   1   .   .   .   
        1     33   1   .   .   .   
        1     34   1   .   .   .   
        1     35   1   .   .   .   
        1     36   1   .   .   .   
        1     37   1   .   .   .   
        1     38   1   .   .   .   
        1     39   1   .   .   .   
        1     40   1   .   .   .   
        1     41   1   .   .   .   
        1     42   1   .   .   .   
        1     43   1   .   .   .   
        1     44   1   .   .   .   
        1     45   1   .   .   .   
        1     46   1   .   .   .   
        1     47   1   .   .   .   
        1     48   1   .   .   .   
        1     49   1   .   .   .   
        1     50   1   .   .   .   
        1     51   1   .   .   .   
        1     52   1   .   .   .   
        1     53   1   .   .   .   
        1     54   1   .   .   .   
        1     55   1   .   .   .   
        1     56   1   .   .   .   
        1     57   1   .   .   .   
        1     58   1   .   .   .   
        1     59   1   .   .   .   
        1     60   1   .   .   .   
        1     61   1   .   .   .   
        1     62   1   .   .   .   
        1     63   1   .   .   .   
        1     64   1   .   .   .   
        1     65   1   .   .   .   
        1     66   1   .   .   .   
        1     67   1   .   .   .   
        1     68   1   .   .   .   
        1     69   1   .   .   .   
        1     70   1   .   .   .   
        1     71   1   .   .   .   
        1     72   1   .   .   .   
        1     73   1   .   .   .   
        1     74   1   .   .   .   
        1     75   1   .   .   .   
        1     76   1   .   .   .   
        1     77   1   .   .   .   
        1     78   1   .   .   .   
        1     79   1   .   .   .   
        1     80   1   .   .   .   
        1     81   1   .   .   .   
        1     82   1   .   .   .   
        1     83   1   .   .   .   
        1     84   1   .   .   .   
        1     85   1   .   .   .   
        1     86   1   .   .   .   
        1     87   1   .   .   .   
        1     88   1   .   .   .   
        1     89   1   .   .   .   
        1     90   1   .   .   .   
        1     91   1   .   .   .   
        1     92   1   .   .   .   
        1     93   1   .   .   .   
        1     94   1   .   .   .   
        1     95   1   .   .   .   
        1     96   1   .   .   .   
        1     97   1   .   .   .   
        1     98   1   .   .   .   
        1     99   1   .   .   .   
        1    100   1   .   .   .   
        1    101   1   .   .   .   
        1    102   1   .   .   .   
        1    103   1   .   .   .   
        1    104   1   .   .   .   
        1    105   1   .   .   .   
        1    106   1   .   .   .   
        1    107   1   .   .   .   
        1    108   1   .   .   .   
        1    109   1   .   .   .   
        1    110   1   .   .   .   
        1    111   1   .   .   .   
        1    112   1   .   .   .   
        1    113   1   .   .   .   
        1    114   1   .   .   .   
        1    115   1   .   .   .   
        1    116   1   .   .   .   
        1    117   1   .   .   .   
        1    118   1   .   .   .   
        1    119   1   .   .   .   
        1    120   1   .   .   .   
        1    121   1   .   .   .   
        1    122   1   .   .   .   
        1    123   1   .   .   .   
        1    124   1   .   .   .   
        1    125   1   .   .   .   
        1    126   1   .   .   .   
        1    127   1   .   .   .   
        1    128   1   .   .   .   
        1    129   1   .   .   .   
        1    130   1   .   .   .   
        1    131   1   .   .   .   
        1    132   1   .   .   .   
        1    133   1   .   .   .   
        1    134   1   .   .   .   
        1    135   1   .   .   .   
        1    136   1   .   .   .   
        1    137   1   .   .   .   
        1    138   1   .   .   .   
        1    139   1   .   .   .   
        1    140   1   .   .   .   
        1    141   1   .   .   .   
        1    142   1   .   .   .   
        1    143   1   .   .   .   
        1    144   1   .   .   .   
        1    145   1   .   .   .   
        1    146   1   .   .   .   
        1    147   1   .   .   .   
        1    148   1   .   .   .   
        1    149   1   .   .   .   
        1    150   1   .   .   .   
        1    151   1   .   .   .   
        1    152   1   .   .   .   
        1    153   1   .   .   .   
        1    154   1   .   .   .   
        1    155   1   .   .   .   
        1    156   1   .   .   .   
        1    157   1   .   .   .   
        1    158   1   .   .   .   
        1    159   1   .   .   .   
        1    160   1   .   .   .   
        1    161   1   .   .   .   
        1    162   1   .   .   .   
        1    163   1   .   .   .   
        1    164   1   .   .   .   
        1    165   1   .   .   .   
        1    166   1   .   .   .   
        1    167   1   .   .   .   
        1    168   1   .   .   .   
        1    169   1   .   .   .   
        1    170   1   .   .   .   
        1    171   1   .   .   .   
        1    172   1   .   .   .   
        1    173   1   .   .   .   
        1    174   1   .   .   .   
        1    175   1   .   .   .   
        1    176   1   .   .   .   
        1    177   1   .   .   .   
        1    178   1   .   .   .   
        1    179   1   .   .   .   
        1    180   1   .   .   .   
        1    181   1   .   .   .   
        1    182   1   .   .   .   
        1    183   1   .   .   .   
        1    184   1   .   .   .   
        1    185   1   .   .   .   
        1    186   1   .   .   .   
        1    187   1   .   .   .   
        1    188   1   .   .   .   
        1    189   1   .   .   .   
        1    190   1   .   .   .   
        1    191   1   .   .   .   
        1    192   1   .   .   .   
        1    193   1   .   .   .   
        1    194   1   .   .   .   
        1    195   1   .   .   .   
        1    196   1   .   .   .   
        1    197   1   .   .   .   
        1    198   1   .   .   .   
        1    199   1   .   .   .   
        1    200   1   .   .   .   
        1    201   1   .   .   .   
        1    202   1   .   .   .   
        1    203   1   .   .   .   
        1    204   1   .   .   .   
        1    205   1   .   .   .   
        1    206   1   .   .   .   
        1    207   1   .   .   .   
        1    208   1   .   .   .   
        1    209   1   .   .   .   
        1    210   1   .   .   .   
        1    211   1   .   .   .   
        1    212   1   .   .   .   
        1    213   1   .   .   .   
        1    214   1   .   .   .   
        1    215   1   .   .   .   
        1    216   1   .   .   .   
        1    217   1   .   .   .   
        1    218   1   .   .   .   
        1    219   1   .   .   .   
        1    220   1   .   .   .   
        1    221   1   .   .   .   
        1    222   1   .   .   .   
        1    223   1   .   .   .   
        1    224   1   .   .   .   
        1    225   1   .   .   .   
        1    226   1   .   .   .   
        1    227   1   .   .   .   
        1    228   1   .   .   .   
        1    229   1   .   .   .   
        1    230   1   .   .   .   
        1    231   1   .   .   .   
        1    232   1   .   .   .   
        1    233   1   .   .   .   
        1    234   1   .   .   .   
        1    235   1   .   .   .   
        1    236   1   .   .   .   
        1    237   1   .   .   .   
        1    238   1   .   .   .   
        1    239   1   .   .   .   
        1    240   1   .   .   .   
        1    241   1   .   .   .   
        1    242   1   .   .   .   
        1    243   1   .   .   .   
        1    244   1   .   .   .   
        1    245   1   .   .   .   
        1    246   1   .   .   .   
        1    247   1   .   .   .   
        1    248   1   .   .   .   
        1    249   1   .   .   .   
        1    250   1   .   .   .   
        1    251   1   .   .   .   
        1    252   1   .   .   .   
        1    253   1   .   .   .   
        1    254   1   .   .   .   
        1    255   1   .   .   .   
        1    256   1   .   .   .   
        1    257   1   .   .   .   
        1    258   1   .   .   .   
        1    259   1   .   .   .   
        1    260   1   .   .   .   
        1    261   1   .   .   .   
        1    262   1   .   .   .   
        1    263   1   .   .   .   
        1    264   1   .   .   .   
        1    265   1   .   .   .   
        1    266   1   .   .   .   
        1    267   1   .   .   .   
        1    268   1   .   .   .   
        1    269   1   .   .   .   
        1    270   1   .   .   .   
        1    271   1   .   .   .   
        1    272   1   .   .   .   
        1    273   1   .   .   .   
        1    274   1   .   .   .   
        1    275   1   .   .   .   
        1    276   1   .   .   .   
        1    277   1   .   .   .   
        1    278   1   .   .   .   
        1    279   1   .   .   .   
        1    280   1   .   .   .   
        1    281   1   .   .   .   
        1    282   1   .   .   .   
        1    283   1   .   .   .   
        1    284   1   .   .   .   
        1    285   1   .   .   .   
        1    286   1   .   .   .   
        1    287   1   .   .   .   
        1    288   1   .   .   .   
        1    289   1   .   .   .   
        1    290   1   .   .   .   
        1    291   1   .   .   .   
        1    292   1   .   .   .   
        1    293   1   .   .   .   
        1    294   1   .   .   .   
        1    295   1   .   .   .   
        1    296   1   .   .   .   
        1    297   1   .   .   .   
        1    298   1   .   .   .   
        1    299   1   .   .   .   
        1    300   1   .   .   .   
        1    301   1   .   .   .   
        1    302   1   .   .   .   
        1    303   1   .   .   .   
        1    304   1   .   .   .   
        1    305   1   .   .   .   
        1    306   1   .   .   .   
        1    307   1   .   .   .   
        1    308   1   .   .   .   
        1    309   1   .   .   .   
        1    310   1   .   .   .   
        1    311   1   .   .   .   
        1    312   1   .   .   .   
        1    313   1   .   .   .   
        1    314   1   .   .   .   
        1    315   1   .   .   .   
        1    316   1   .   .   .   
        1    317   1   .   .   .   
        1    318   1   .   .   .   
        1    319   1   .   .   .   
        1    320   1   .   .   .   
        1    321   1   .   .   .   
        1    322   1   .   .   .   
        1    323   1   .   .   .   
        1    324   1   .   .   .   
        1    325   1   .   .   .   
        1    326   1   .   .   .   
        1    327   1   .   .   .   
        1    328   1   .   .   .   
        1    329   1   .   .   .   
        1    330   1   .   .   .   
        1    331   1   .   .   .   
        1    332   1   .   .   .   
        1    333   1   .   .   .   
        1    334   1   .   .   .   
        1    335   1   .   .   .   
        1    336   1   .   .   .   
        1    337   1   .   .   .   
        1    338   1   .   .   .   
        1    339   1   .   .   .   
        1    340   1   .   .   .   
        1    341   1   .   .   .   
        1    342   1   .   .   .   
        1    343   1   .   .   .   
        1    344   1   .   .   .   
        1    345   1   .   .   .   
        1    346   1   .   .   .   
        1    347   1   .   .   .   
        1    348   1   .   .   .   
        1    349   1   .   .   .   
        1    350   1   .   .   .   
        1    351   1   .   .   .   
        1    352   1   .   .   .   
        1    353   1   .   .   .   
        1    354   1   .   .   .   
        1    355   1   .   .   .   
        1    356   1   .   .   .   
        1    357   1   .   .   .   
        1    358   1   .   .   .   
        1    359   1   .   .   .   
        1    360   1   .   .   .   
        1    361   1   .   .   .   
        1    362   1   .   .   .   
        1    363   1   .   .   .   
        1    364   1   .   .   .   
        1    365   1   .   .   .   
        1    366   1   .   .   .   
        1    367   1   .   .   .   
        1    368   1   .   .   .   
        1    369   1   .   .   .   
        1    370   1   .   .   .   
        1    371   1   .   .   .   
        1    372   1   .   .   .   
        1    373   1   .   .   .   
        1    374   1   .   .   .   
        1    375   1   .   .   .   
        1    376   1   .   .   .   
        1    377   1   .   .   .   
        1    378   1   .   .   .   
        1    379   1   .   .   .   
        1    380   1   .   .   .   
        1    381   1   .   .   .   
        1    382   1   .   .   .   
        1    383   1   .   .   .   
        1    384   1   .   .   .   
        1    385   1   .   .   .   
        1    386   1   .   .   .   
        1    387   1   .   .   .   
        1    388   1   .   .   .   
        1    389   1   .   .   .   
        1    390   1   .   .   .   
        1    391   1   .   .   .   
        1    392   1   .   .   .   
        1    393   1   .   .   .   
        1    394   1   .   .   .   
        1    395   1   .   .   .   
        1    396   1   .   .   .   
        1    397   1   .   .   .   
        1    398   1   .   .   .   
        1    399   1   .   .   .   
        1    400   1   .   .   .   
        1    401   1   .   .   .   
        1    402   1   .   .   .   
        1    403   1   .   .   .   
        1    404   1   .   .   .   
        1    405   1   .   .   .   
        1    406   1   .   .   .   
        1    407   1   .   .   .   
        1    408   1   .   .   .   
        1    409   1   .   .   .   
        1    410   1   .   .   .   
        1    411   1   .   .   .   
        1    412   1   .   .   .   
        1    413   1   .   .   .   
        1    414   1   .   .   .   
        1    415   1   .   .   .   
        1    416   1   .   .   .   
        1    417   1   .   .   .   
        1    418   1   .   .   .   
        1    419   1   .   .   .   
        1    420   1   .   .   .   
        1    421   1   .   .   .   
        1    422   1   .   .   .   
        1    423   1   .   .   .   
        1    424   1   .   .   .   
        1    425   1   .   .   .   
        1    426   1   .   .   .   
        1    427   1   .   .   .   
        1    428   1   .   .   .   
        1    429   1   .   .   .   
        1    430   1   .   .   .   
        1    431   1   .   .   .   
        1    432   1   .   .   .   
        1    433   1   .   .   .   
        1    434   1   .   .   .   
        1    435   1   .   .   .   
        1    436   1   .   .   .   
        1    437   1   .   .   .   
        1    438   1   .   .   .   
        1    439   1   .   .   .   
        1    440   1   .   .   .   
        1    441   1   .   .   .   
        1    442   1   .   .   .   
        1    443   1   .   .   .   
        1    444   1   .   .   .   
        1    445   1   .   .   .   
        1    446   1   .   .   .   
        1    447   1   .   .   .   
        1    448   1   .   .   .   
        1    449   1   .   .   .   
        1    450   1   .   .   .   
        1    451   1   .   .   .   
        1    452   1   .   .   .   
        1    453   1   .   .   .   
        1    454   1   .   .   .   
        1    455   1   .   .   .   
        1    456   1   .   .   .   
        1    457   1   .   .   .   
        1    458   1   .   .   .   
        1    459   1   .   .   .   
        1    460   1   .   .   .   
        1    461   1   .   .   .   
        1    462   1   .   .   .   
        1    463   1   .   .   .   
        1    464   1   .   .   .   
        1    465   1   .   .   .   
        1    466   1   .   .   .   
        1    467   1   .   .   .   
        1    468   1   .   .   .   
        1    469   1   .   .   .   
        1    470   1   .   .   .   
        1    471   1   .   .   .   
        1    472   1   .   .   .   
        1    473   1   .   .   .   
        1    474   1   .   .   .   
        1    475   1   .   .   .   
        1    476   1   .   .   .   
        1    477   1   .   .   .   
        1    478   1   .   .   .   
        1    479   1   .   .   .   
        1    480   1   .   .   .   
        1    481   1   .   .   .   
        1    482   1   .   .   .   
        1    483   1   .   .   .   
        1    484   1   .   .   .   
        1    485   1   .   .   .   
        1    486   1   .   .   .   
        1    487   1   .   .   .   
        1    488   1   .   .   .   
        1    489   1   .   .   .   
        1    490   1   .   .   .   
        1    491   1   .   .   .   
        1    492   1   .   .   .   
        1    493   1   .   .   .   
        1    494   1   .   .   .   
        1    495   1   .   .   .   
        1    496   1   .   .   .   
        1    497   1   .   .   .   
        1    498   1   .   .   .   
        1    499   1   .   .   .   
        1    500   1   .   .   .   
        1    501   1   .   .   .   
        1    502   1   .   .   .   
        1    503   1   .   .   .   
        1    504   1   .   .   .   
        1    505   1   .   .   .   
        1    506   1   .   .   .   
        1    507   1   .   .   .   
        1    508   1   .   .   .   
        1    509   1   .   .   .   
        1    510   1   .   .   .   
        1    511   1   .   .   .   
        1    512   1   .   .   .   
        1    513   1   .   .   .   
        1    514   1   .   .   .   
        1    515   1   .   .   .   
        1    516   1   .   .   .   
        1    517   1   .   .   .   
        1    518   1   .   .   .   
        1    519   1   .   .   .   
        1    520   1   .   .   .   
        1    521   1   .   .   .   
        1    522   1   .   .   .   
        1    523   1   .   .   .   
        1    524   1   .   .   .   
        1    525   1   .   .   .   
        1    526   1   .   .   .   
        1    527   1   .   .   .   
        1    528   1   .   .   .   
        1    529   1   .   .   .   
        1    530   1   .   .   .   
        1    531   1   .   .   .   
        1    532   1   .   .   .   
        1    533   1   .   .   .   
        1    534   1   .   .   .   
        1    535   1   .   .   .   
        1    536   1   .   .   .   
        1    537   1   .   .   .   
        1    538   1   .   .   .   
        1    539   1   .   .   .   
        1    540   1   .   .   .   
        1    541   1   .   .   .   
        1    542   1   .   .   .   
        1    543   1   .   .   .   
        1    544   1   .   .   .   
        1    545   1   .   .   .   
        1    546   1   .   .   .   
        1    547   1   .   .   .   
        1    548   1   .   .   .   
        1    549   1   .   .   .   
        1    550   1   .   .   .   
        1    551   1   .   .   .   
        1    552   1   .   .   .   
        1    553   1   .   .   .   
        1    554   1   .   .   .   
        1    555   1   .   .   .   
        1    556   1   .   .   .   
        1    557   1   .   .   .   
        1    558   1   .   .   .   
        1    559   1   .   .   .   
        1    560   1   .   .   .   
        1    561   1   .   .   .   
        1    562   1   .   .   .   
        1    563   1   .   .   .   
        1    564   1   .   .   .   
        1    565   1   .   .   .   
        1    566   1   .   .   .   
        1    567   1   .   .   .   
        1    568   1   .   .   .   
        1    569   1   .   .   .   
        1    570   1   .   .   .   
        1    571   1   .   .   .   
        1    572   1   .   .   .   
        1    573   1   .   .   .   
        1    574   1   .   .   .   
        1    575   1   .   .   .   
        1    576   1   .   .   .   
        1    577   1   .   .   .   
        1    578   1   .   .   .   
        1    579   1   .   .   .   
        1    580   1   .   .   .   
        1    581   1   .   .   .   
        1    582   1   .   .   .   
        1    583   1   .   .   .   
        1    584   1   .   .   .   
        1    585   1   .   .   .   
        1    586   1   .   .   .   
        1    587   1   .   .   .   
        1    588   1   .   .   .   
        1    589   1   .   .   .   
        1    590   1   .   .   .   
        1    591   1   .   .   .   
        1    592   1   .   .   .   
        1    593   1   .   .   .   
        1    594   1   .   .   .   
        1    595   1   .   .   .   
        1    596   1   .   .   .   
        1    597   1   .   .   .   
        1    598   1   .   .   .   
        1    599   1   .   .   .   
        1    600   1   .   .   .   
        1    601   1   .   .   .   
        1    602   1   .   .   .   
        1    603   1   .   .   .   
        1    604   1   .   .   .   
        1    605   1   .   .   .   
        1    606   1   .   .   .   
        1    607   1   .   .   .   
        1    608   1   .   .   .   
        1    609   1   .   .   .   
        1    610   1   .   .   .   
        1    611   1   .   .   .   
        1    612   1   .   .   .   
        1    613   1   .   .   .   
        1    614   1   .   .   .   
        1    615   1   .   .   .   
        1    616   1   .   .   .   
        1    617   1   .   .   .   
        1    618   1   .   .   .   
        1    619   1   .   .   .   
        1    620   1   .   .   .   
        1    621   1   .   .   .   
        1    622   1   .   .   .   
        1    623   1   .   .   .   
        1    624   1   .   .   .   
        1    625   1   .   .   .   
        1    626   1   .   .   .   
        1    627   1   .   .   .   
        1    628   1   .   .   .   
        1    629   1   .   .   .   
        1    630   1   .   .   .   
        1    631   1   .   .   .   
        1    632   1   .   .   .   
        1    633   1   .   .   .   
        1    634   1   .   .   .   
        1    635   1   .   .   .   
        1    636   1   .   .   .   
        1    637   1   .   .   .   
        1    638   1   .   .   .   
        1    639   1   .   .   .   
        1    640   1   .   .   .   
        1    641   1   .   .   .   
        1    642   1   .   .   .   
        1    643   1   .   .   .   
        1    644   1   .   .   .   
        1    645   1   .   .   .   
        1    646   1   .   .   .   
        1    647   1   .   .   .   
        1    648   1   .   .   .   
        1    649   1   .   .   .   
        1    650   1   .   .   .   
        1    651   1   .   .   .   
        1    652   1   .   .   .   
        1    653   1   .   .   .   
        1    654   1   .   .   .   
        1    655   1   .   .   .   
        1    656   1   .   .   .   
        1    657   1   .   .   .   
        1    658   1   .   .   .   
        1    659   1   .   .   .   
        1    660   1   .   .   .   
        1    661   1   .   .   .   
        1    662   1   .   .   .   
        1    663   1   .   .   .   
        1    664   1   .   .   .   
        1    665   1   .   .   .   
        1    666   1   .   .   .   
        1    667   1   .   .   .   
        1    668   1   .   .   .   
        1    669   1   .   .   .   
        1    670   1   .   .   .   
        1    671   1   .   .   .   
        1    672   1   .   .   .   
        1    673   1   .   .   .   
        1    674   1   .   .   .   
        1    675   1   .   .   .   
        1    676   1   .   .   .   
        1    677   1   .   .   .   
        1    678   1   .   .   .   
        1    679   1   .   .   .   
        1    680   1   .   .   .   
        1    681   1   .   .   .   
        1    682   1   .   .   .   
        1    683   1   .   .   .   
        1    684   1   .   .   .   
        1    685   1   .   .   .   
        1    686   1   .   .   .   
        1    687   1   .   .   .   
        1    688   1   .   .   .   
        1    689   1   .   .   .   
        1    690   1   .   .   .   
        1    691   1   .   .   .   
        1    692   1   .   .   .   
        1    693   1   .   .   .   
        1    694   1   .   .   .   
        1    695   1   .   .   .   
        1    696   1   .   .   .   
        1    697   1   .   .   .   
        1    698   1   .   .   .   
        1    699   1   .   .   .   
        1    700   1   .   .   .   
        1    701   1   .   .   .   
        1    702   1   .   .   .   
        1    703   1   .   .   .   
        1    704   1   .   .   .   
        1    705   1   .   .   .   
        1    706   1   .   .   .   
        1    707   1   .   .   .   
        1    708   1   .   .   .   
        1    709   1   .   .   .   
        1    710   1   .   .   .   
        1    711   1   .   .   .   
        1    712   1   .   .   .   
        1    713   1   .   .   .   
        1    714   1   .   .   .   
        1    715   1   .   .   .   
        1    716   1   .   .   .   
        1    717   1   .   .   .   
        1    718   1   .   .   .   
        1    719   1   .   .   .   
        1    720   1   .   .   .   
        1    721   1   .   .   .   
        1    722   1   .   .   .   
        1    723   1   .   .   .   
        1    724   1   .   .   .   
        1    725   1   .   .   .   
        1    726   1   .   .   .   
        1    727   1   .   .   .   
        1    728   1   .   .   .   
        1    729   1   .   .   .   
        1    730   1   .   .   .   
        1    731   1   .   .   .   
        1    732   1   .   .   .   
        1    733   1   .   .   .   
        1    734   1   .   .   .   
        1    735   1   .   .   .   
        1    736   1   .   .   .   
        1    737   1   .   .   .   
        1    738   1   .   .   .   
        1    739   1   .   .   .   
        1    740   1   .   .   .   
        1    741   1   .   .   .   
        1    742   1   .   .   .   
        1    743   1   .   .   .   
        1    744   1   .   .   .   
        1    745   1   .   .   .   
        1    746   1   .   .   .   
        1    747   1   .   .   .   
        1    748   1   .   .   .   
        1    749   1   .   .   .   
        1    750   1   .   .   .   
        1    751   1   .   .   .   
        1    752   1   .   .   .   
        1    753   1   .   .   .   
        1    754   1   .   .   .   
        1    755   1   .   .   .   
        1    756   1   .   .   .   
        1    757   1   .   .   .   
        1    758   1   .   .   .   
        1    759   1   .   .   .   
        1    760   1   .   .   .   
        1    761   1   .   .   .   
        1    762   1   .   .   .   
        1    763   1   .   .   .   
        1    764   1   .   .   .   
        1    765   1   .   .   .   
        1    766   1   .   .   .   
        1    767   1   .   .   .   
        1    768   1   .   .   .   
        1    769   1   .   .   .   
        1    770   1   .   .   .   
        1    771   1   .   .   .   
        1    772   1   .   .   .   
        1    773   1   .   .   .   
        1    774   1   .   .   .   
        1    775   1   .   .   .   
        1    776   1   .   .   .   
        1    777   1   .   .   .   
        1    778   1   .   .   .   
        1    779   1   .   .   .   
        1    780   1   .   .   .   
        1    781   1   .   .   .   
        1    782   1   .   .   .   
        1    783   1   .   .   .   
        1    784   1   .   .   .   
        1    785   1   .   .   .   
        1    786   1   .   .   .   
        1    787   1   .   .   .   
        1    788   1   .   .   .   
        1    789   1   .   .   .   
        1    790   1   .   .   .   
        1    791   1   .   .   .   
        1    792   1   .   .   .   
        1    793   1   .   .   .   
        1    794   1   .   .   .   
        1    795   1   .   .   .   
        1    796   1   .   .   .   
        1    797   1   .   .   .   
        1    798   1   .   .   .   
        1    799   1   .   .   .   
        1    800   1   .   .   .   
        1    801   1   .   .   .   
        1    802   1   .   .   .   
        1    803   1   .   .   .   
        1    804   1   .   .   .   
        1    805   1   .   .   .   
        1    806   1   .   .   .   
        1    807   1   .   .   .   
        1    808   1   .   .   .   
        1    809   1   .   .   .   
        1    810   1   .   .   .   
        1    811   1   .   .   .   
        1    812   1   .   .   .   
        1    813   1   .   .   .   
        1    814   1   .   .   .   
        1    815   1   .   .   .   
        1    816   1   .   .   .   
        1    817   1   .   .   .   
        1    818   1   .   .   .   
        1    819   1   .   .   .   
        1    820   1   .   .   .   
        1    821   1   .   .   .   
        1    822   1   .   .   .   
        1    823   1   .   .   .   
        1    824   1   .   .   .   
        1    825   1   .   .   .   
        1    826   1   .   .   .   
        1    827   1   .   .   .   
        1    828   1   .   .   .   
        1    829   1   .   .   .   
        1    830   1   .   .   .   
        1    831   1   .   .   .   
        1    832   1   .   .   .   
        1    833   1   .   .   .   
        1    834   1   .   .   .   
        1    835   1   .   .   .   
        1    836   1   .   .   .   
        1    837   1   .   .   .   
        1    838   1   .   .   .   
        1    839   1   .   .   .   
        1    840   1   .   .   .   
        1    841   1   .   .   .   
        1    842   1   .   .   .   
        1    843   1   .   .   .   
        1    844   1   .   .   .   
        1    845   1   .   .   .   
        1    846   1   .   .   .   
        1    847   1   .   .   .   
        1    848   1   .   .   .   
        1    849   1   .   .   .   
        1    850   1   .   .   .   
        1    851   1   .   .   .   
        1    852   1   .   .   .   
        1    853   1   .   .   .   
        1    854   1   .   .   .   
        1    855   1   .   .   .   
        1    856   1   .   .   .   
        1    857   1   .   .   .   
        1    858   1   .   .   .   
        1    859   1   .   .   .   
        1    860   1   .   .   .   
        1    861   1   .   .   .   
        1    862   1   .   .   .   
        1    863   1   .   .   .   
        1    864   1   .   .   .   
        1    865   1   .   .   .   
        1    866   1   .   .   .   
        1    867   1   .   .   .   
        1    868   1   .   .   .   
        1    869   1   .   .   .   
        1    870   1   .   .   .   
        1    871   1   .   .   .   
        1    872   1   .   .   .   
        1    873   1   .   .   .   
        1    874   1   .   .   .   
        1    875   1   .   .   .   
        1    876   1   .   .   .   
        1    877   1   .   .   .   
        1    878   1   .   .   .   
        1    879   1   .   .   .   
        1    880   1   .   .   .   
        1    881   1   .   .   .   
        1    882   1   .   .   .   
        1    883   1   .   .   .   
        1    884   1   .   .   .   
        1    885   1   .   .   .   
        1    886   1   .   .   .   
        1    887   1   .   .   .   
        1    888   1   .   .   .   
        1    889   1   .   .   .   
        1    890   1   .   .   .   
        1    891   1   .   .   .   
        1    892   1   .   .   .   
        1    893   1   .   .   .   
        1    894   1   .   .   .   
        1    895   1   .   .   .   
        1    896   1   .   .   .   
        1    897   1   .   .   .   
        1    898   1   .   .   .   
        1    899   1   .   .   .   
        1    900   1   .   .   .   
        1    901   1   .   .   .   
        1    902   1   .   .   .   
        1    903   1   .   .   .   
        1    904   1   .   .   .   
        1    905   1   .   .   .   
        1    906   1   .   .   .   
        1    907   1   .   .   .   
        1    908   1   .   .   .   
        1    909   1   .   .   .   
        1    910   1   .   .   .   
        1    911   1   .   .   .   
        1    912   1   .   .   .   
        1    913   1   .   .   .   
        1    914   1   .   .   .   
        1    915   1   .   .   .   
        1    916   1   .   .   .   
        1    917   1   .   .   .   
        1    918   1   .   .   .   
        1    919   1   .   .   .   
        1    920   1   .   .   .   
        1    921   1   .   .   .   
        1    922   1   .   .   .   
        1    923   1   .   .   .   
        1    924   1   .   .   .   
        1    925   1   .   .   .   
        1    926   1   .   .   .   
        1    927   1   .   .   .   
        1    928   1   .   .   .   
        1    929   1   .   .   .   
        1    930   1   .   .   .   
        1    931   1   .   .   .   
        1    932   1   .   .   .   
        1    933   1   .   .   .   
        1    934   1   .   .   .   
        1    935   1   .   .   .   
        1    936   1   .   .   .   
        1    937   1   .   .   .   
        1    938   1   .   .   .   
        1    939   1   .   .   .   
        1    940   1   .   .   .   
        1    941   1   .   .   .   
        1    942   1   .   .   .   
        1    943   1   .   .   .   
        1    944   1   .   .   .   
        1    945   1   .   .   .   
        1    946   1   .   .   .   
        1    947   1   .   .   .   
        1    948   1   .   .   .   
        1    949   1   .   .   .   
        1    950   1   .   .   .   
        1    951   1   .   .   .   
        1    952   1   .   .   .   
        1    953   1   .   .   .   
        1    954   1   .   .   .   
        1    955   1   .   .   .   
        1    956   1   .   .   .   
        1    957   1   .   .   .   
        1    958   1   .   .   .   
        1    959   1   .   .   .   
        1    960   1   .   .   .   
        1    961   1   .   .   .   
        1    962   1   .   .   .   
        1    963   1   .   .   .   
        1    964   1   .   .   .   
        1    965   1   .   .   .   
        1    966   1   .   .   .   
        1    967   1   .   .   .   
        1    968   1   .   .   .   
        1    969   1   .   .   .   
        1    970   1   .   .   .   
        1    971   1   .   .   .   
        1    972   1   .   .   .   
        1    973   1   .   .   .   
        1    974   1   .   .   .   
        1    975   1   .   .   .   
        1    976   1   .   .   .   
        1    977   1   .   .   .   
        1    978   1   .   .   .   
        1    979   1   .   .   .   
        1    980   1   .   .   .   
        1    981   1   .   .   .   
        1    982   1   .   .   .   
        1    983   1   .   .   .   
        1    984   1   .   .   .   
        1    985   1   .   .   .   
        1    986   1   .   .   .   
        1    987   1   .   .   .   
        1    988   1   .   .   .   
        1    989   1   .   .   .   
        1    990   1   .   .   .   
        1    991   1   .   .   .   
        1    992   1   .   .   .   
        1    993   1   .   .   .   
        1    994   1   .   .   .   
        1    995   1   .   .   .   
        1    996   1   .   .   .   
        1    997   1   .   .   .   
        1    998   1   .   .   .   
        1    999   1   .   .   .   
        1   1000   1   .   .   .   
        1   1001   1   .   .   .   
        1   1002   1   .   .   .   
        1   1003   1   .   .   .   
        1   1004   1   .   .   .   
        1   1005   1   .   .   .   
        1   1006   1   .   .   .   
        1   1007   1   .   .   .   
        1   1008   1   .   .   .   
        1   1009   1   .   .   .   
        1   1010   1   .   .   .   
        1   1011   1   .   .   .   
        1   1012   1   .   .   .   
        1   1013   1   .   .   .   
        1   1014   1   .   .   .   
        1   1015   1   .   .   .   
        1   1016   1   .   .   .   
        1   1017   1   .   .   .   
        1   1018   1   .   .   .   
        1   1019   1   .   .   .   
        1   1020   1   .   .   .   
        1   1021   1   .   .   .   
        1   1022   1   .   .   .   
        1   1023   1   .   .   .   
        1   1024   1   .   .   .   
        1   1025   1   .   .   .   
        1   1026   1   .   .   .   
        1   1027   1   .   .   .   
        1   1028   1   .   .   .   
        1   1029   1   .   .   .   
        1   1030   1   .   .   .   
        1   1031   1   .   .   .   
        1   1032   1   .   .   .   
        1   1033   1   .   .   .   
        1   1034   1   .   .   .   
        1   1035   1   .   .   .   
        1   1036   1   .   .   .   
        1   1037   1   .   .   .   
        1   1038   1   .   .   .   
        1   1039   1   .   .   .   
        1   1040   1   .   .   .   
        1   1041   1   .   .   .   
        1   1042   1   .   .   .   
        1   1043   1   .   .   .   
        1   1044   1   .   .   .   
        1   1045   1   .   .   .   
        1   1046   1   .   .   .   
        1   1047   1   .   .   .   
        1   1048   1   .   .   .   
        1   1049   1   .   .   .   
        1   1050   1   .   .   .   
        1   1051   1   .   .   .   
        1   1052   1   .   .   .   
        1   1053   1   .   .   .   
        1   1054   1   .   .   .   
        1   1055   1   .   .   .   
        1   1056   1   .   .   .   
        1   1057   1   .   .   .   
        1   1058   1   .   .   .   
        1   1059   1   .   .   .   
        1   1060   1   .   .   .   
        1   1061   1   .   .   .   
        1   1062   1   .   .   .   
        1   1063   1   .   .   .   
        1   1064   1   .   .   .   
        1   1065   1   .   .   .   
        1   1066   1   .   .   .   
        1   1067   1   .   .   .   
        1   1068   1   .   .   .   
        1   1069   1   .   .   .   
        1   1070   1   .   .   .   
        1   1071   1   .   .   .   
        1   1072   1   .   .   .   
        1   1073   1   .   .   .   
        1   1074   1   .   .   .   
        1   1075   1   .   .   .   
        1   1076   1   .   .   .   
        1   1077   1   .   .   .   
        1   1078   1   .   .   .   
        1   1079   1   .   .   .   
        1   1080   1   .   .   .   
        1   1081   1   .   .   .   
        1   1082   1   .   .   .   
        1   1083   1   .   .   .   
        1   1084   1   .   .   .   
        1   1085   1   .   .   .   
        1   1086   1   .   .   .   
        1   1087   1   .   .   .   
        1   1088   1   .   .   .   
        1   1089   1   .   .   .   
        1   1090   1   .   .   .   
        1   1091   1   .   .   .   
        1   1092   1   .   .   .   
        1   1093   1   .   .   .   
        1   1094   1   .   .   .   
        1   1095   1   .   .   .   
        1   1096   1   .   .   .   
        1   1097   1   .   .   .   
        1   1098   1   .   .   .   
        1   1099   1   .   .   .   
        1   1100   1   .   .   .   
        1   1101   1   .   .   .   
        1   1102   1   .   .   .   
        1   1103   1   .   .   .   
        1   1104   1   .   .   .   
        1   1105   1   .   .   .   
    stop_


    loop_
        _Dist_constraint.Constraints_ID 
        _Dist_constraint.Dist_constraint_tree_ID 
        _Dist_constraint.Tree_node_member_node_ID 
        _Dist_constraint.Contribution_fractional_val 
        _Dist_constraint.Constraint_tree_node_member_ID 
        _Dist_constraint.Label_entity_assembly_ID 
        _Dist_constraint.Label_entity_ID 
        _Dist_constraint.Label_comp_index_ID 
        _Dist_constraint.Label_comp_ID 
        _Dist_constraint.Label_atom_ID 
        _Dist_constraint.Auth_segment_code 
        _Dist_constraint.Auth_seq_ID 
        _Dist_constraint.Auth_comp_ID 
        _Dist_constraint.Auth_atom_ID 

        1      1   1   .   1   .   .   .   .   .   .    19   ILE   QG2    
        1      1   1   .   2   .   .   .   .   .   .    23   ASN   HD22   
        1      2   1   .   1   .   .   .   .   .   .     1   GLN   QB     
        1      2   1   .   2   .   .   .   .   .   .     1   GLN   HE21   
        1      3   1   .   1   .   .   .   .   .   .    40   LEU   QD1    
        1      3   1   .   2   .   .   .   .   .   .    44   ASN   HD22   
        1      4   1   .   1   .   .   .   .   .   .    32   GLN   HE22   
        1      4   1   .   2   .   .   .   .   .   .    62   VAL   HB     
        1      5   1   .   1   .   .   .   .   .   .    32   GLN   HE22   
        1      5   1   .   2   .   .   .   .   .   .    36   LEU   QQD    
        1      6   1   .   1   .   .   .   .   .   .   115   GLN   QG     
        1      6   1   .   2   .   .   .   .   .   .   115   GLN   HE22   
        1      7   1   .   1   .   .   .   .   .   .   113   ASP   H      
        1      7   1   .   2   .   .   .   .   .   .   114   ILE   H      
        1      8   1   .   1   .   .   .   .   .   .   113   ASP   QB     
        1      8   1   .   2   .   .   .   .   .   .   114   ILE   H      
        1      9   1   .   1   .   .   .   .   .   .   114   ILE   H      
        1      9   1   .   2   .   .   .   .   .   .   114   ILE   HB     
        1     10   1   .   1   .   .   .   .   .   .   114   ILE   H      
        1     10   1   .   2   .   .   .   .   .   .   114   ILE   QG1    
        1     11   1   .   1   .   .   .   .   .   .   114   ILE   H      
        1     11   1   .   2   .   .   .   .   .   .   114   ILE   QD1    
        1     12   1   .   1   .   .   .   .   .   .    33   LEU   QD1    
        1     12   1   .   2   .   .   .   .   .   .    37   GLN   HE21   
        1     13   1   .   1   .   .   .   .   .   .    83   ASN   HA     
        1     13   1   .   2   .   .   .   .   .   .    83   ASN   HD22   
        1     14   1   .   1   .   .   .   .   .   .    82   LEU   H      
        1     14   1   .   2   .   .   .   .   .   .    82   LEU   QB     
        1     15   1   .   1   .   .   .   .   .   .    82   LEU   H      
        1     15   1   .   2   .   .   .   .   .   .    82   LEU   QQD    
        1     16   1   .   1   .   .   .   .   .   .    77   LEU   H      
        1     16   1   .   2   .   .   .   .   .   .    78   LYS   H      
        1     17   1   .   1   .   .   .   .   .   .    76   GLU   HA     
        1     17   1   .   2   .   .   .   .   .   .    78   LYS   H      
        1     18   1   .   1   .   .   .   .   .   .    78   LYS   H      
        1     18   1   .   2   .   .   .   .   .   .    78   LYS   QB     
        1     19   1   .   1   .   .   .   .   .   .    76   GLU   QB     
        1     19   1   .   2   .   .   .   .   .   .    78   LYS   H      
        1     20   1   .   1   .   .   .   .   .   .    78   LYS   H      
        1     20   1   .   2   .   .   .   .   .   .    78   LYS   QG     
        1     21   1   .   1   .   .   .   .   .   .    44   ASN   H      
        1     21   1   .   2   .   .   .   .   .   .    45   GLU   H      
        1     22   1   .   1   .   .   .   .   .   .    45   GLU   H      
        1     22   1   .   2   .   .   .   .   .   .    46   ASN   H      
        1     23   1   .   1   .   .   .   .   .   .    44   ASN   HB2    
        1     23   1   .   2   .   .   .   .   .   .    45   GLU   H      
        1     24   1   .   1   .   .   .   .   .   .    45   GLU   H      
        1     24   1   .   2   .   .   .   .   .   .    45   GLU   QG     
        1     25   1   .   1   .   .   .   .   .   .    45   GLU   H      
        1     25   1   .   2   .   .   .   .   .   .    45   GLU   QB     
        1     26   1   .   1   .   .   .   .   .   .    70   GLN   HE21   
        1     26   1   .   2   .   .   .   .   .   .   101   LEU   QQD    
        1     27   1   .   1   .   .   .   .   .   .    19   ILE   QG2    
        1     27   1   .   2   .   .   .   .   .   .    23   ASN   HD21   
        1     28   1   .   1   .   .   .   .   .   .    33   LEU   H      
        1     28   1   .   2   .   .   .   .   .   .    34   LEU   H      
        1     29   1   .   1   .   .   .   .   .   .    34   LEU   H      
        1     29   1   .   2   .   .   .   .   .   .    35   TYR   H      
        1     30   1   .   1   .   .   .   .   .   .    31   HIS   HA     
        1     30   1   .   2   .   .   .   .   .   .    34   LEU   H      
        1     31   1   .   1   .   .   .   .   .   .    33   LEU   QB     
        1     31   1   .   2   .   .   .   .   .   .    34   LEU   H      
        1     32   1   .   1   .   .   .   .   .   .    34   LEU   H      
        1     32   1   .   2   .   .   .   .   .   .    34   LEU   QB     
        1     33   1   .   1   .   .   .   .   .   .    34   LEU   H      
        1     33   1   .   2   .   .   .   .   .   .    34   LEU   HG     
        1     34   1   .   1   .   .   .   .   .   .    33   LEU   HG     
        1     34   1   .   2   .   .   .   .   .   .    34   LEU   H      
        1     35   1   .   1   .   .   .   .   .   .    33   LEU   QD1    
        1     35   1   .   2   .   .   .   .   .   .    34   LEU   H      
        1     36   1   .   1   .   .   .   .   .   .    42   GLU   H      
        1     36   1   .   2   .   .   .   .   .   .    43   LEU   H      
        1     37   1   .   1   .   .   .   .   .   .    41   ASP   H      
        1     37   1   .   2   .   .   .   .   .   .    42   GLU   H      
        1     38   1   .   1   .   .   .   .   .   .    41   ASP   HB2    
        1     38   1   .   2   .   .   .   .   .   .    42   GLU   H      
        1     39   1   .   1   .   .   .   .   .   .    41   ASP   HB3    
        1     39   1   .   2   .   .   .   .   .   .    42   GLU   H      
        1     40   1   .   1   .   .   .   .   .   .    42   GLU   H      
        1     40   1   .   2   .   .   .   .   .   .    42   GLU   QB     
        1     41   1   .   1   .   .   .   .   .   .    60   ASP   H      
        1     41   1   .   2   .   .   .   .   .   .    61   VAL   H      
        1     42   1   .   1   .   .   .   .   .   .    61   VAL   H      
        1     42   1   .   2   .   .   .   .   .   .    62   VAL   H      
        1     43   1   .   1   .   .   .   .   .   .    58   GLU   HA     
        1     43   1   .   2   .   .   .   .   .   .    61   VAL   H      
        1     44   1   .   1   .   .   .   .   .   .    61   VAL   H      
        1     44   1   .   2   .   .   .   .   .   .    61   VAL   HB     
        1     45   1   .   1   .   .   .   .   .   .    40   LEU   QD1    
        1     45   1   .   2   .   .   .   .   .   .    44   ASN   HD21   
        1     46   1   .   1   .   .   .   .   .   .    40   LEU   QD2    
        1     46   1   .   2   .   .   .   .   .   .    44   ASN   HD21   
        1     47   1   .   1   .   .   .   .   .   .    48   SER   QB     
        1     47   1   .   2   .   .   .   .   .   .    51   LEU   H      
        1     48   1   .   1   .   .   .   .   .   .    51   LEU   H      
        1     48   1   .   2   .   .   .   .   .   .    51   LEU   QB     
        1     49   1   .   1   .   .   .   .   .   .    51   LEU   H      
        1     49   1   .   2   .   .   .   .   .   .    54   LYS   QG     
        1     50   1   .   1   .   .   .   .   .   .    51   LEU   H      
        1     50   1   .   2   .   .   .   .   .   .    51   LEU   QD2    
        1     51   1   .   1   .   .   .   .   .   .   112   LYS   H      
        1     51   1   .   2   .   .   .   .   .   .   113   ASP   H      
        1     52   1   .   1   .   .   .   .   .   .   113   ASP   H      
        1     52   1   .   2   .   .   .   .   .   .   113   ASP   QB     
        1     53   1   .   1   .   .   .   .   .   .   109   GLN   QG     
        1     53   1   .   2   .   .   .   .   .   .   110   LYS   H      
        1     54   1   .   1   .   .   .   .   .   .   109   GLN   QB     
        1     54   1   .   2   .   .   .   .   .   .   110   LYS   H      
        1     55   1   .   1   .   .   .   .   .   .   110   LYS   H      
        1     55   1   .   2   .   .   .   .   .   .   110   LYS   QB     
        1     56   1   .   1   .   .   .   .   .   .   112   LYS   QB     
        1     56   1   .   2   .   .   .   .   .   .   113   ASP   H      
        1     57   1   .   1   .   .   .   .   .   .   110   LYS   H      
        1     57   1   .   2   .   .   .   .   .   .   110   LYS   QG     
        1     58   1   .   1   .   .   .   .   .   .    35   TYR   H      
        1     58   1   .   2   .   .   .   .   .   .    36   LEU   H      
        1     59   1   .   1   .   .   .   .   .   .    40   LEU   H      
        1     59   1   .   2   .   .   .   .   .   .    41   ASP   H      
        1     60   1   .   1   .   .   .   .   .   .    35   TYR   H      
        1     60   1   .   2   .   .   .   .   .   .    35   TYR   QB     
        1     61   1   .   1   .   .   .   .   .   .    41   ASP   H      
        1     61   1   .   2   .   .   .   .   .   .    41   ASP   HB2    
        1     62   1   .   1   .   .   .   .   .   .    41   ASP   H      
        1     62   1   .   2   .   .   .   .   .   .    41   ASP   HB3    
        1     63   1   .   1   .   .   .   .   .   .    40   LEU   QB     
        1     63   1   .   2   .   .   .   .   .   .    41   ASP   H      
        1     64   1   .   1   .   .   .   .   .   .    34   LEU   QB     
        1     64   1   .   2   .   .   .   .   .   .    35   TYR   H      
        1     65   1   .   1   .   .   .   .   .   .    34   LEU   HG     
        1     65   1   .   2   .   .   .   .   .   .    35   TYR   H      
        1     66   1   .   1   .   .   .   .   .   .    40   LEU   HG     
        1     66   1   .   2   .   .   .   .   .   .    41   ASP   H      
        1     67   1   .   1   .   .   .   .   .   .    34   LEU   QQD    
        1     67   1   .   2   .   .   .   .   .   .    35   TYR   H      
        1     68   1   .   1   .   .   .   .   .   .    40   LEU   QD1    
        1     68   1   .   2   .   .   .   .   .   .    41   ASP   H      
        1     69   1   .   1   .   .   .   .   .   .    83   ASN   HA     
        1     69   1   .   2   .   .   .   .   .   .    83   ASN   HD21   
        1     70   1   .   1   .   .   .   .   .   .    71   GLY   H      
        1     70   1   .   2   .   .   .   .   .   .    72   ALA   H      
        1     71   1   .   1   .   .   .   .   .   .    72   ALA   H      
        1     71   1   .   2   .   .   .   .   .   .    73   LEU   H      
        1     72   1   .   1   .   .   .   .   .   .    72   ALA   H      
        1     72   1   .   2   .   .   .   .   .   .    72   ALA   QB     
        1     73   1   .   1   .   .   .   .   .   .   108   GLU   H      
        1     73   1   .   2   .   .   .   .   .   .   109   GLN   H      
        1     74   1   .   1   .   .   .   .   .   .    74   GLU   H      
        1     74   1   .   2   .   .   .   .   .   .    75   ARG   H      
        1     75   1   .   1   .   .   .   .   .   .   106   GLU   HA     
        1     75   1   .   2   .   .   .   .   .   .   109   GLN   H      
        1     76   1   .   1   .   .   .   .   .   .   108   GLU   QB     
        1     76   1   .   2   .   .   .   .   .   .   109   GLN   H      
        1     77   1   .   1   .   .   .   .   .   .   109   GLN   H      
        1     77   1   .   2   .   .   .   .   .   .   109   GLN   QG     
        1     78   1   .   1   .   .   .   .   .   .   109   GLN   H      
        1     78   1   .   2   .   .   .   .   .   .   109   GLN   QB     
        1     79   1   .   1   .   .   .   .   .   .    75   ARG   H      
        1     79   1   .   2   .   .   .   .   .   .    75   ARG   QB     
        1     80   1   .   1   .   .   .   .   .   .    75   ARG   H      
        1     80   1   .   2   .   .   .   .   .   .    75   ARG   QG     
        1     81   1   .   1   .   .   .   .   .   .    93   ALA   H      
        1     81   1   .   2   .   .   .   .   .   .    93   ALA   QB     
        1     82   1   .   1   .   .   .   .   .   .    99   ILE   HA     
        1     82   1   .   2   .   .   .   .   .   .   102   LYS   H      
        1     83   1   .   1   .   .   .   .   .   .   102   LYS   H      
        1     83   1   .   2   .   .   .   .   .   .   102   LYS   HB3    
        1     84   1   .   1   .   .   .   .   .   .   102   LYS   H      
        1     84   1   .   2   .   .   .   .   .   .   102   LYS   HB2    
        1     85   1   .   1   .   .   .   .   .   .   101   LEU   QQD    
        1     85   1   .   2   .   .   .   .   .   .   102   LYS   H      
        1     86   1   .   1   .   .   .   .   .   .    32   GLN   HE21   
        1     86   1   .   2   .   .   .   .   .   .    62   VAL   HB     
        1     87   1   .   1   .   .   .   .   .   .    32   GLN   HE21   
        1     87   1   .   2   .   .   .   .   .   .    36   LEU   QQD    
        1     88   1   .   1   .   .   .   .   .   .    98   LYS   H      
        1     88   1   .   2   .   .   .   .   .   .    98   LYS   QB     
        1     89   1   .   1   .   .   .   .   .   .    99   ILE   H      
        1     89   1   .   2   .   .   .   .   .   .    99   ILE   HB     
        1     90   1   .   1   .   .   .   .   .   .    98   LYS   H      
        1     90   1   .   2   .   .   .   .   .   .    98   LYS   QG     
        1     91   1   .   1   .   .   .   .   .   .    99   ILE   H      
        1     91   1   .   2   .   .   .   .   .   .    99   ILE   HG13   
        1     92   1   .   1   .   .   .   .   .   .    99   ILE   H      
        1     92   1   .   2   .   .   .   .   .   .    99   ILE   QG2    
        1     93   1   .   1   .   .   .   .   .   .    54   LYS   H      
        1     93   1   .   2   .   .   .   .   .   .    55   ILE   H      
        1     94   1   .   1   .   .   .   .   .   .    53   GLU   H      
        1     94   1   .   2   .   .   .   .   .   .    54   LYS   H      
        1     95   1   .   1   .   .   .   .   .   .    51   LEU   HA     
        1     95   1   .   2   .   .   .   .   .   .    54   LYS   H      
        1     96   1   .   1   .   .   .   .   .   .    54   LYS   H      
        1     96   1   .   2   .   .   .   .   .   .    54   LYS   QB     
        1     97   1   .   1   .   .   .   .   .   .    76   GLU   H      
        1     97   1   .   2   .   .   .   .   .   .    76   GLU   QB     
        1     98   1   .   1   .   .   .   .   .   .    65   MET   H      
        1     98   1   .   2   .   .   .   .   .   .    66   ILE   H      
        1     99   1   .   1   .   .   .   .   .   .    78   LYS   H      
        1     99   1   .   2   .   .   .   .   .   .    79   ARG   H      
        1    100   1   .   1   .   .   .   .   .   .    36   LEU   HA     
        1    100   1   .   2   .   .   .   .   .   .    38   HIS   H      
        1    101   1   .   1   .   .   .   .   .   .    65   MET   H      
        1    101   1   .   2   .   .   .   .   .   .    65   MET   QG     
        1    102   1   .   1   .   .   .   .   .   .    79   ARG   H      
        1    102   1   .   2   .   .   .   .   .   .    79   ARG   QB     
        1    103   1   .   1   .   .   .   .   .   .    76   GLU   QB     
        1    103   1   .   2   .   .   .   .   .   .    79   ARG   H      
        1    104   1   .   1   .   .   .   .   .   .    78   LYS   QD     
        1    104   1   .   2   .   .   .   .   .   .    79   ARG   H      
        1    105   1   .   1   .   .   .   .   .   .   115   GLN   QG     
        1    105   1   .   2   .   .   .   .   .   .   115   GLN   HE21   
        1    106   1   .   1   .   .   .   .   .   .    63   CYS   H      
        1    106   1   .   2   .   .   .   .   .   .    64   ALA   H      
        1    107   1   .   1   .   .   .   .   .   .    61   VAL   HA     
        1    107   1   .   2   .   .   .   .   .   .    64   ALA   H      
        1    108   1   .   1   .   .   .   .   .   .    63   CYS   HB2    
        1    108   1   .   2   .   .   .   .   .   .    64   ALA   H      
        1    109   1   .   1   .   .   .   .   .   .    63   CYS   HB3    
        1    109   1   .   2   .   .   .   .   .   .    64   ALA   H      
        1    110   1   .   1   .   .   .   .   .   .    64   ALA   H      
        1    110   1   .   2   .   .   .   .   .   .    64   ALA   QB     
        1    111   1   .   1   .   .   .   .   .   .    37   GLN   H      
        1    111   1   .   2   .   .   .   .   .   .    38   HIS   H      
        1    112   1   .   1   .   .   .   .   .   .    56   ILE   H      
        1    112   1   .   2   .   .   .   .   .   .    57   ARG   H      
        1    113   1   .   1   .   .   .   .   .   .    57   ARG   H      
        1    113   1   .   2   .   .   .   .   .   .    58   GLU   H      
        1    114   1   .   1   .   .   .   .   .   .    38   HIS   H      
        1    114   1   .   2   .   .   .   .   .   .    38   HIS   QB     
        1    115   1   .   1   .   .   .   .   .   .    37   GLN   HB3    
        1    115   1   .   2   .   .   .   .   .   .    38   HIS   H      
        1    116   1   .   1   .   .   .   .   .   .    37   GLN   HB2    
        1    116   1   .   2   .   .   .   .   .   .    38   HIS   H      
        1    117   1   .   1   .   .   .   .   .   .    31   HIS   H      
        1    117   1   .   2   .   .   .   .   .   .    32   GLN   H      
        1    118   1   .   1   .   .   .   .   .   .    54   LYS   HA     
        1    118   1   .   2   .   .   .   .   .   .    57   ARG   H      
        1    119   1   .   1   .   .   .   .   .   .    55   ILE   HA     
        1    119   1   .   2   .   .   .   .   .   .    57   ARG   H      
        1    120   1   .   1   .   .   .   .   .   .    31   HIS   H      
        1    120   1   .   2   .   .   .   .   .   .    31   HIS   QB     
        1    121   1   .   1   .   .   .   .   .   .    30   GLU   QB     
        1    121   1   .   2   .   .   .   .   .   .    31   HIS   H      
        1    122   1   .   1   .   .   .   .   .   .    99   ILE   H      
        1    122   1   .   2   .   .   .   .   .   .   100   LEU   H      
        1    123   1   .   1   .   .   .   .   .   .   100   LEU   H      
        1    123   1   .   2   .   .   .   .   .   .   100   LEU   HG     
        1    124   1   .   1   .   .   .   .   .   .    99   ILE   QG2    
        1    124   1   .   2   .   .   .   .   .   .   100   LEU   H      
        1    125   1   .   1   .   .   .   .   .   .   100   LEU   H      
        1    125   1   .   2   .   .   .   .   .   .   100   LEU   QQD    
        1    126   1   .   1   .   .   .   .   .   .    84   ILE   H      
        1    126   1   .   2   .   .   .   .   .   .    85   LEU   H      
        1    127   1   .   1   .   .   .   .   .   .    85   LEU   H      
        1    127   1   .   2   .   .   .   .   .   .    88   PHE   H      
        1    128   1   .   1   .   .   .   .   .   .    83   ASN   HA     
        1    128   1   .   2   .   .   .   .   .   .    85   LEU   H      
        1    129   1   .   1   .   .   .   .   .   .    84   ILE   HB     
        1    129   1   .   2   .   .   .   .   .   .    85   LEU   H      
        1    130   1   .   1   .   .   .   .   .   .    85   LEU   H      
        1    130   1   .   2   .   .   .   .   .   .    85   LEU   QB     
        1    131   1   .   1   .   .   .   .   .   .    84   ILE   QG2    
        1    131   1   .   2   .   .   .   .   .   .    85   LEU   H      
        1    132   1   .   1   .   .   .   .   .   .    85   LEU   H      
        1    132   1   .   2   .   .   .   .   .   .    85   LEU   QQD    
        1    133   1   .   1   .   .   .   .   .   .    39   GLN   H      
        1    133   1   .   2   .   .   .   .   .   .    40   LEU   H      
        1    134   1   .   1   .   .   .   .   .   .    36   LEU   HA     
        1    134   1   .   2   .   .   .   .   .   .    39   GLN   H      
        1    135   1   .   1   .   .   .   .   .   .    38   HIS   QB     
        1    135   1   .   2   .   .   .   .   .   .    39   GLN   H      
        1    136   1   .   1   .   .   .   .   .   .    39   GLN   H      
        1    136   1   .   2   .   .   .   .   .   .    39   GLN   QB     
        1    137   1   .   1   .   .   .   .   .   .    24   HIS   H      
        1    137   1   .   2   .   .   .   .   .   .    25   ALA   H      
        1    138   1   .   1   .   .   .   .   .   .    24   HIS   QB     
        1    138   1   .   2   .   .   .   .   .   .    25   ALA   H      
        1    139   1   .   1   .   .   .   .   .   .    76   GLU   H      
        1    139   1   .   2   .   .   .   .   .   .    77   LEU   H      
        1    140   1   .   1   .   .   .   .   .   .    77   LEU   H      
        1    140   1   .   2   .   .   .   .   .   .    78   LYS   QB     
        1    141   1   .   1   .   .   .   .   .   .    77   LEU   H      
        1    141   1   .   2   .   .   .   .   .   .    77   LEU   QQD    
        1    142   1   .   1   .   .   .   .   .   .    62   VAL   H      
        1    142   1   .   2   .   .   .   .   .   .    63   CYS   H      
        1    143   1   .   1   .   .   .   .   .   .    62   VAL   H      
        1    143   1   .   2   .   .   .   .   .   .    62   VAL   HB     
        1    144   1   .   1   .   .   .   .   .   .    61   VAL   QG1    
        1    144   1   .   2   .   .   .   .   .   .    62   VAL   H      
        1    145   1   .   1   .   .   .   .   .   .   107   THR   H      
        1    145   1   .   2   .   .   .   .   .   .   108   GLU   H      
        1    146   1   .   1   .   .   .   .   .   .   106   GLU   H      
        1    146   1   .   2   .   .   .   .   .   .   107   THR   H      
        1    147   1   .   1   .   .   .   .   .   .   104   LEU   HA     
        1    147   1   .   2   .   .   .   .   .   .   107   THR   H      
        1    148   1   .   1   .   .   .   .   .   .   106   GLU   QB     
        1    148   1   .   2   .   .   .   .   .   .   107   THR   H      
        1    149   1   .   1   .   .   .   .   .   .    88   PHE   H      
        1    149   1   .   2   .   .   .   .   .   .    89   ASN   H      
        1    150   1   .   1   .   .   .   .   .   .    88   PHE   H      
        1    150   1   .   2   .   .   .   .   .   .    88   PHE   QB     
        1    151   1   .   1   .   .   .   .   .   .    26   ILE   H      
        1    151   1   .   2   .   .   .   .   .   .    26   ILE   QG1    
        1    152   1   .   1   .   .   .   .   .   .    25   ALA   QB     
        1    152   1   .   2   .   .   .   .   .   .    26   ILE   H      
        1    153   1   .   1   .   .   .   .   .   .    47   LYS   H      
        1    153   1   .   2   .   .   .   .   .   .    48   SER   H      
        1    154   1   .   1   .   .   .   .   .   .    48   SER   H      
        1    154   1   .   2   .   .   .   .   .   .    48   SER   QB     
        1    155   1   .   1   .   .   .   .   .   .    47   LYS   QB     
        1    155   1   .   2   .   .   .   .   .   .    48   SER   H      
        1    156   1   .   1   .   .   .   .   .   .    48   SER   H      
        1    156   1   .   2   .   .   .   .   .   .    51   LEU   QB     
        1    157   1   .   1   .   .   .   .   .   .    43   LEU   HG     
        1    157   1   .   2   .   .   .   .   .   .    48   SER   H      
        1    158   1   .   1   .   .   .   .   .   .    73   LEU   H      
        1    158   1   .   2   .   .   .   .   .   .    74   GLU   QB     
        1    159   1   .   1   .   .   .   .   .   .    18   LEU   H      
        1    159   1   .   2   .   .   .   .   .   .    18   LEU   HG     
        1    160   1   .   1   .   .   .   .   .   .   112   LYS   H      
        1    160   1   .   2   .   .   .   .   .   .   112   LYS   QD     
        1    161   1   .   1   .   .   .   .   .   .   112   LYS   H      
        1    161   1   .   2   .   .   .   .   .   .   112   LYS   QG     
        1    162   1   .   1   .   .   .   .   .   .   111   VAL   QG1    
        1    162   1   .   2   .   .   .   .   .   .   112   LYS   H      
        1    163   1   .   1   .   .   .   .   .   .    55   ILE   QG2    
        1    163   1   .   2   .   .   .   .   .   .    56   ILE   H      
        1    164   1   .   1   .   .   .   .   .   .   111   VAL   QG2    
        1    164   1   .   2   .   .   .   .   .   .   112   LYS   H      
        1    165   1   .   1   .   .   .   .   .   .   115   GLN   HA     
        1    165   1   .   2   .   .   .   .   .   .   116   THR   H      
        1    166   1   .   1   .   .   .   .   .   .   115   GLN   QG     
        1    166   1   .   2   .   .   .   .   .   .   116   THR   H      
        1    167   1   .   1   .   .   .   .   .   .   115   GLN   QB     
        1    167   1   .   2   .   .   .   .   .   .   116   THR   H      
        1    168   1   .   1   .   .   .   .   .   .    95   THR   H      
        1    168   1   .   2   .   .   .   .   .   .    96   LEU   H      
        1    169   1   .   1   .   .   .   .   .   .    96   LEU   H      
        1    169   1   .   2   .   .   .   .   .   .    96   LEU   QB     
        1    170   1   .   1   .   .   .   .   .   .    19   ILE   QG2    
        1    170   1   .   2   .   .   .   .   .   .    20   GLU   H      
        1    171   1   .   1   .   .   .   .   .   .    96   LEU   H      
        1    171   1   .   2   .   .   .   .   .   .    96   LEU   QQD    
        1    172   1   .   1   .   .   .   .   .   .     8   ASP   QB     
        1    172   1   .   2   .   .   .   .   .   .     9   ASP   H      
        1    173   1   .   1   .   .   .   .   .   .    59   LEU   H      
        1    173   1   .   2   .   .   .   .   .   .    60   ASP   H      
        1    174   1   .   1   .   .   .   .   .   .    83   ASN   HA     
        1    174   1   .   2   .   .   .   .   .   .    86   GLU   H      
        1    175   1   .   1   .   .   .   .   .   .    60   ASP   H      
        1    175   1   .   2   .   .   .   .   .   .    60   ASP   HB2    
        1    176   1   .   1   .   .   .   .   .   .    51   LEU   HG     
        1    176   1   .   2   .   .   .   .   .   .    52   GLN   H      
        1    177   1   .   1   .   .   .   .   .   .    58   GLU   H      
        1    177   1   .   2   .   .   .   .   .   .    59   LEU   H      
        1    178   1   .   1   .   .   .   .   .   .    55   ILE   H      
        1    178   1   .   2   .   .   .   .   .   .    56   ILE   H      
        1    179   1   .   1   .   .   .   .   .   .    55   ILE   HA     
        1    179   1   .   2   .   .   .   .   .   .    58   GLU   H      
        1    180   1   .   1   .   .   .   .   .   .    58   GLU   H      
        1    180   1   .   2   .   .   .   .   .   .    58   GLU   QG     
        1    181   1   .   1   .   .   .   .   .   .    58   GLU   H      
        1    181   1   .   2   .   .   .   .   .   .    58   GLU   QB     
        1    182   1   .   1   .   .   .   .   .   .    59   LEU   QB     
        1    182   1   .   2   .   .   .   .   .   .    60   ASP   H      
        1    183   1   .   1   .   .   .   .   .   .   103   ASP   H      
        1    183   1   .   2   .   .   .   .   .   .   104   LEU   H      
        1    184   1   .   1   .   .   .   .   .   .   102   LYS   H      
        1    184   1   .   2   .   .   .   .   .   .   103   ASP   H      
        1    185   1   .   1   .   .   .   .   .   .   100   LEU   HA     
        1    185   1   .   2   .   .   .   .   .   .   103   ASP   H      
        1    186   1   .   1   .   .   .   .   .   .   103   ASP   H      
        1    186   1   .   2   .   .   .   .   .   .   103   ASP   HB2    
        1    187   1   .   1   .   .   .   .   .   .   103   ASP   H      
        1    187   1   .   2   .   .   .   .   .   .   103   ASP   HB3    
        1    188   1   .   1   .   .   .   .   .   .   102   LYS   HB3    
        1    188   1   .   2   .   .   .   .   .   .   103   ASP   H      
        1    189   1   .   1   .   .   .   .   .   .   102   LYS   HB2    
        1    189   1   .   2   .   .   .   .   .   .   103   ASP   H      
        1    190   1   .   1   .   .   .   .   .   .    99   ILE   QG2    
        1    190   1   .   2   .   .   .   .   .   .   103   ASP   H      
        1    191   1   .   1   .   .   .   .   .   .    51   LEU   H      
        1    191   1   .   2   .   .   .   .   .   .    52   GLN   H      
        1    192   1   .   1   .   .   .   .   .   .    50   GLU   HA     
        1    192   1   .   2   .   .   .   .   .   .    52   GLN   H      
        1    193   1   .   1   .   .   .   .   .   .    52   GLN   H      
        1    193   1   .   2   .   .   .   .   .   .    52   GLN   QB     
        1    194   1   .   1   .   .   .   .   .   .    51   LEU   QD1    
        1    194   1   .   2   .   .   .   .   .   .    52   GLN   H      
        1    195   1   .   1   .   .   .   .   .   .    51   LEU   QD2    
        1    195   1   .   2   .   .   .   .   .   .    52   GLN   H      
        1    196   1   .   1   .   .   .   .   .   .    67   GLU   H      
        1    196   1   .   2   .   .   .   .   .   .    68   GLY   H      
        1    197   1   .   1   .   .   .   .   .   .    68   GLY   H      
        1    197   1   .   2   .   .   .   .   .   .    69   ALA   H      
        1    198   1   .   1   .   .   .   .   .   .    67   GLU   HB2    
        1    198   1   .   2   .   .   .   .   .   .    68   GLY   H      
        1    199   1   .   1   .   .   .   .   .   .    67   GLU   HB3    
        1    199   1   .   2   .   .   .   .   .   .    68   GLY   H      
        1    200   1   .   1   .   .   .   .   .   .    68   GLY   H      
        1    200   1   .   2   .   .   .   .   .   .    69   ALA   QB     
        1    201   1   .   1   .   .   .   .   .   .    87   ARG   H      
        1    201   1   .   2   .   .   .   .   .   .    88   PHE   H      
        1    202   1   .   1   .   .   .   .   .   .    88   PHE   QD     
        1    202   1   .   2   .   .   .   .   .   .    89   ASN   H      
        1    203   1   .   1   .   .   .   .   .   .    88   PHE   QB     
        1    203   1   .   2   .   .   .   .   .   .    89   ASN   H      
        1    204   1   .   1   .   .   .   .   .   .    89   ASN   H      
        1    204   1   .   2   .   .   .   .   .   .    89   ASN   HB2    
        1    205   1   .   1   .   .   .   .   .   .    89   ASN   H      
        1    205   1   .   2   .   .   .   .   .   .    89   ASN   HB3    
        1    206   1   .   1   .   .   .   .   .   .    28   LYS   H      
        1    206   1   .   2   .   .   .   .   .   .    29   GLY   H      
        1    207   1   .   1   .   .   .   .   .   .    27   GLU   H      
        1    207   1   .   2   .   .   .   .   .   .    28   LYS   H      
        1    208   1   .   1   .   .   .   .   .   .    83   ASN   HA     
        1    208   1   .   2   .   .   .   .   .   .    84   ILE   H      
        1    209   1   .   1   .   .   .   .   .   .    83   ASN   HB3    
        1    209   1   .   2   .   .   .   .   .   .    84   ILE   H      
        1    210   1   .   1   .   .   .   .   .   .    27   GLU   QB     
        1    210   1   .   2   .   .   .   .   .   .    28   LYS   H      
        1    211   1   .   1   .   .   .   .   .   .    28   LYS   H      
        1    211   1   .   2   .   .   .   .   .   .    28   LYS   QB     
        1    212   1   .   1   .   .   .   .   .   .    84   ILE   H      
        1    212   1   .   2   .   .   .   .   .   .    84   ILE   QG2    
        1    213   1   .   1   .   .   .   .   .   .    84   ILE   H      
        1    213   1   .   2   .   .   .   .   .   .    84   ILE   QD1    
        1    214   1   .   1   .   .   .   .   .   .   110   LYS   H      
        1    214   1   .   2   .   .   .   .   .   .   111   VAL   H      
        1    215   1   .   1   .   .   .   .   .   .   111   VAL   H      
        1    215   1   .   2   .   .   .   .   .   .   111   VAL   HB     
        1    216   1   .   1   .   .   .   .   .   .   110   LYS   QB     
        1    216   1   .   2   .   .   .   .   .   .   111   VAL   H      
        1    217   1   .   1   .   .   .   .   .   .   111   VAL   H      
        1    217   1   .   2   .   .   .   .   .   .   111   VAL   QG2    
        1    218   1   .   1   .   .   .   .   .   .    40   LEU   H      
        1    218   1   .   2   .   .   .   .   .   .    40   LEU   QB     
        1    219   1   .   1   .   .   .   .   .   .    40   LEU   H      
        1    219   1   .   2   .   .   .   .   .   .    40   LEU   HG     
        1    220   1   .   1   .   .   .   .   .   .    40   LEU   H      
        1    220   1   .   2   .   .   .   .   .   .    40   LEU   QD2    
        1    221   1   .   1   .   .   .   .   .   .    23   ASN   H      
        1    221   1   .   2   .   .   .   .   .   .    24   HIS   H      
        1    222   1   .   1   .   .   .   .   .   .    24   HIS   H      
        1    222   1   .   2   .   .   .   .   .   .    24   HIS   QB     
        1    223   1   .   1   .   .   .   .   .   .    66   ILE   H      
        1    223   1   .   2   .   .   .   .   .   .    66   ILE   HB     
        1    224   1   .   1   .   .   .   .   .   .    24   HIS   H      
        1    224   1   .   2   .   .   .   .   .   .    25   ALA   QB     
        1    225   1   .   1   .   .   .   .   .   .    64   ALA   QB     
        1    225   1   .   2   .   .   .   .   .   .    66   ILE   H      
        1    226   1   .   1   .   .   .   .   .   .    66   ILE   H      
        1    226   1   .   2   .   .   .   .   .   .    66   ILE   QG2    
        1    227   1   .   1   .   .   .   .   .   .   100   LEU   H      
        1    227   1   .   2   .   .   .   .   .   .   101   LEU   H      
        1    228   1   .   1   .   .   .   .   .   .   101   LEU   H      
        1    228   1   .   2   .   .   .   .   .   .   102   LYS   H      
        1    229   1   .   1   .   .   .   .   .   .   101   LEU   H      
        1    229   1   .   2   .   .   .   .   .   .   101   LEU   QB     
        1    230   1   .   1   .   .   .   .   .   .   100   LEU   QQD    
        1    230   1   .   2   .   .   .   .   .   .   101   LEU   H      
        1    231   1   .   1   .   .   .   .   .   .   101   LEU   H      
        1    231   1   .   2   .   .   .   .   .   .   101   LEU   QQD    
        1    232   1   .   1   .   .   .   .   .   .    70   GLN   QB     
        1    232   1   .   2   .   .   .   .   .   .    71   GLY   H      
        1    233   1   .   1   .   .   .   .   .   .    52   GLN   QG     
        1    233   1   .   2   .   .   .   .   .   .    53   GLU   H      
        1    234   1   .   1   .   .   .   .   .   .    49   LYS   H      
        1    234   1   .   2   .   .   .   .   .   .    50   GLU   H      
        1    235   1   .   1   .   .   .   .   .   .    50   GLU   H      
        1    235   1   .   2   .   .   .   .   .   .    51   LEU   H      
        1    236   1   .   1   .   .   .   .   .   .    50   GLU   H      
        1    236   1   .   2   .   .   .   .   .   .    50   GLU   QB     
        1    237   1   .   1   .   .   .   .   .   .    49   LYS   QG     
        1    237   1   .   2   .   .   .   .   .   .    50   GLU   H      
        1    238   1   .   1   .   .   .   .   .   .    73   LEU   H      
        1    238   1   .   2   .   .   .   .   .   .    74   GLU   H      
        1    239   1   .   1   .   .   .   .   .   .    74   GLU   H      
        1    239   1   .   2   .   .   .   .   .   .    74   GLU   QB     
        1    240   1   .   1   .   .   .   .   .   .    74   GLU   H      
        1    240   1   .   2   .   .   .   .   .   .    77   LEU   HG     
        1    241   1   .   1   .   .   .   .   .   .    74   GLU   H      
        1    241   1   .   2   .   .   .   .   .   .    77   LEU   QQD    
        1    242   1   .   1   .   .   .   .   .   .    91   GLU   H      
        1    242   1   .   2   .   .   .   .   .   .    92   GLU   H      
        1    243   1   .   1   .   .   .   .   .   .    92   GLU   H      
        1    243   1   .   2   .   .   .   .   .   .    93   ALA   H      
        1    244   1   .   1   .   .   .   .   .   .    89   ASN   HA     
        1    244   1   .   2   .   .   .   .   .   .    92   GLU   H      
        1    245   1   .   1   .   .   .   .   .   .    92   GLU   H      
        1    245   1   .   2   .   .   .   .   .   .    92   GLU   QB     
        1    246   1   .   1   .   .   .   .   .   .    90   TYR   H      
        1    246   1   .   2   .   .   .   .   .   .    90   TYR   QB     
        1    247   1   .   1   .   .   .   .   .   .    49   LYS   H      
        1    247   1   .   2   .   .   .   .   .   .   117   GLN   H      
        1    248   1   .   1   .   .   .   .   .   .   105   LYS   H      
        1    248   1   .   2   .   .   .   .   .   .   106   GLU   H      
        1    249   1   .   1   .   .   .   .   .   .   116   THR   HA     
        1    249   1   .   2   .   .   .   .   .   .   117   GLN   H      
        1    250   1   .   1   .   .   .   .   .   .   116   THR   HB     
        1    250   1   .   2   .   .   .   .   .   .   117   GLN   H      
        1    251   1   .   1   .   .   .   .   .   .   106   GLU   H      
        1    251   1   .   2   .   .   .   .   .   .   106   GLU   QG     
        1    252   1   .   1   .   .   .   .   .   .   106   GLU   H      
        1    252   1   .   2   .   .   .   .   .   .   106   GLU   QB     
        1    253   1   .   1   .   .   .   .   .   .    49   LYS   QB     
        1    253   1   .   2   .   .   .   .   .   .   117   GLN   H      
        1    254   1   .   1   .   .   .   .   .   .   117   GLN   H      
        1    254   1   .   2   .   .   .   .   .   .   117   GLN   QG     
        1    255   1   .   1   .   .   .   .   .   .    46   ASN   H      
        1    255   1   .   2   .   .   .   .   .   .    47   LYS   H      
        1    256   1   .   1   .   .   .   .   .   .    43   LEU   H      
        1    256   1   .   2   .   .   .   .   .   .    44   ASN   H      
        1    257   1   .   1   .   .   .   .   .   .    43   LEU   HA     
        1    257   1   .   2   .   .   .   .   .   .    46   ASN   H      
        1    258   1   .   1   .   .   .   .   .   .    44   ASN   H      
        1    258   1   .   2   .   .   .   .   .   .    44   ASN   HB2    
        1    259   1   .   1   .   .   .   .   .   .    45   GLU   QG     
        1    259   1   .   2   .   .   .   .   .   .    46   ASN   H      
        1    260   1   .   1   .   .   .   .   .   .    43   LEU   QB     
        1    260   1   .   2   .   .   .   .   .   .    44   ASN   H      
        1    261   1   .   1   .   .   .   .   .   .    45   GLU   QB     
        1    261   1   .   2   .   .   .   .   .   .    46   ASN   H      
        1    262   1   .   1   .   .   .   .   .   .    44   ASN   H      
        1    262   1   .   2   .   .   .   .   .   .   114   ILE   QD1    
        1    263   1   .   1   .   .   .   .   .   .    37   GLN   H      
        1    263   1   .   2   .   .   .   .   .   .    37   GLN   HB3    
        1    264   1   .   1   .   .   .   .   .   .    54   LYS   QB     
        1    264   1   .   2   .   .   .   .   .   .    55   ILE   H      
        1    265   1   .   1   .   .   .   .   .   .    37   GLN   H      
        1    265   1   .   2   .   .   .   .   .   .    37   GLN   HB2    
        1    266   1   .   1   .   .   .   .   .   .    33   LEU   QD1    
        1    266   1   .   2   .   .   .   .   .   .    37   GLN   H      
        1    267   1   .   1   .   .   .   .   .   .    33   LEU   QD2    
        1    267   1   .   2   .   .   .   .   .   .    37   GLN   H      
        1    268   1   .   1   .   .   .   .   .   .    55   ILE   H      
        1    268   1   .   2   .   .   .   .   .   .    55   ILE   QG1    
        1    269   1   .   1   .   .   .   .   .   .    36   LEU   QQD    
        1    269   1   .   2   .   .   .   .   .   .    37   GLN   H      
        1    270   1   .   1   .   .   .   .   .   .    55   ILE   H      
        1    270   1   .   2   .   .   .   .   .   .    55   ILE   QD1    
        1    271   1   .   1   .   .   .   .   .   .   101   LEU   HA     
        1    271   1   .   2   .   .   .   .   .   .   105   LYS   H      
        1    272   1   .   1   .   .   .   .   .   .   104   LEU   QB     
        1    272   1   .   2   .   .   .   .   .   .   105   LYS   H      
        1    273   1   .   1   .   .   .   .   .   .   105   LYS   H      
        1    273   1   .   2   .   .   .   .   .   .   105   LYS   QD     
        1    274   1   .   1   .   .   .   .   .   .   105   LYS   H      
        1    274   1   .   2   .   .   .   .   .   .   105   LYS   QG     
        1    275   1   .   1   .   .   .   .   .   .   101   LEU   QQD    
        1    275   1   .   2   .   .   .   .   .   .   105   LYS   H      
        1    276   1   .   1   .   .   .   .   .   .   104   LEU   QQD    
        1    276   1   .   2   .   .   .   .   .   .   105   LYS   H      
        1    277   1   .   1   .   .   .   .   .   .   114   ILE   HA     
        1    277   1   .   2   .   .   .   .   .   .   115   GLN   H      
        1    278   1   .   1   .   .   .   .   .   .   115   GLN   H      
        1    278   1   .   2   .   .   .   .   .   .   115   GLN   QB     
        1    279   1   .   1   .   .   .   .   .   .   114   ILE   QG2    
        1    279   1   .   2   .   .   .   .   .   .   115   GLN   H      
        1    280   1   .   1   .   .   .   .   .   .    96   LEU   H      
        1    280   1   .   2   .   .   .   .   .   .    97   SER   H      
        1    281   1   .   1   .   .   .   .   .   .    97   SER   H      
        1    281   1   .   2   .   .   .   .   .   .    98   LYS   H      
        1    282   1   .   1   .   .   .   .   .   .    96   LEU   QB     
        1    282   1   .   2   .   .   .   .   .   .    97   SER   H      
        1    283   1   .   1   .   .   .   .   .   .    26   ILE   QG2    
        1    283   1   .   2   .   .   .   .   .   .    97   SER   H      
        1    284   1   .   1   .   .   .   .   .   .    40   LEU   HA     
        1    284   1   .   2   .   .   .   .   .   .    43   LEU   H      
        1    285   1   .   1   .   .   .   .   .   .    43   LEU   H      
        1    285   1   .   2   .   .   .   .   .   .    43   LEU   QB     
        1    286   1   .   1   .   .   .   .   .   .   106   GLU   HA     
        1    286   1   .   2   .   .   .   .   .   .   108   GLU   H      
        1    287   1   .   1   .   .   .   .   .   .   107   THR   HB     
        1    287   1   .   2   .   .   .   .   .   .   108   GLU   H      
        1    288   1   .   1   .   .   .   .   .   .   108   GLU   H      
        1    288   1   .   2   .   .   .   .   .   .   108   GLU   QB     
        1    289   1   .   1   .   .   .   .   .   .    93   ALA   H      
        1    289   1   .   2   .   .   .   .   .   .    94   GLN   H      
        1    290   1   .   1   .   .   .   .   .   .    92   GLU   HA     
        1    290   1   .   2   .   .   .   .   .   .    95   THR   H      
        1    291   1   .   1   .   .   .   .   .   .    95   THR   H      
        1    291   1   .   2   .   .   .   .   .   .    95   THR   HB     
        1    292   1   .   1   .   .   .   .   .   .    94   GLN   QB     
        1    292   1   .   2   .   .   .   .   .   .    95   THR   H      
        1    293   1   .   1   .   .   .   .   .   .    95   THR   H      
        1    293   1   .   2   .   .   .   .   .   .    95   THR   QG2    
        1    294   1   .   1   .   .   .   .   .   .    31   HIS   QB     
        1    294   1   .   2   .   .   .   .   .   .    32   GLN   H      
        1    295   1   .   1   .   .   .   .   .   .    30   GLU   H      
        1    295   1   .   2   .   .   .   .   .   .    31   HIS   H      
        1    296   1   .   1   .   .   .   .   .   .    30   GLU   H      
        1    296   1   .   2   .   .   .   .   .   .    32   GLN   QG     
        1    297   1   .   1   .   .   .   .   .   .    30   GLU   H      
        1    297   1   .   2   .   .   .   .   .   .   100   LEU   QQD    
        1    298   1   .   1   .   .   .   .   .   .    25   ALA   HA     
        1    298   1   .   2   .   .   .   .   .   .    29   GLY   H      
        1    299   1   .   1   .   .   .   .   .   .    27   GLU   QB     
        1    299   1   .   2   .   .   .   .   .   .    29   GLY   H      
        1    300   1   .   1   .   .   .   .   .   .    28   LYS   QB     
        1    300   1   .   2   .   .   .   .   .   .    29   GLY   H      
        1    301   1   .   1   .   .   .   .   .   .    29   GLY   H      
        1    301   1   .   2   .   .   .   .   .   .   100   LEU   QQD    
        1    302   1   .   1   .   .   .   .   .   .    32   GLN   QG     
        1    302   1   .   2   .   .   .   .   .   .    33   LEU   H      
        1    303   1   .   1   .   .   .   .   .   .    32   GLN   HB2    
        1    303   1   .   2   .   .   .   .   .   .    33   LEU   H      
        1    304   1   .   1   .   .   .   .   .   .    33   LEU   H      
        1    304   1   .   2   .   .   .   .   .   .    33   LEU   QB     
        1    305   1   .   1   .   .   .   .   .   .    94   GLN   H      
        1    305   1   .   2   .   .   .   .   .   .    94   GLN   QB     
        1    306   1   .   1   .   .   .   .   .   .    93   ALA   QB     
        1    306   1   .   2   .   .   .   .   .   .    94   GLN   H      
        1    307   1   .   1   .   .   .   .   .   .    33   LEU   H      
        1    307   1   .   2   .   .   .   .   .   .    33   LEU   QD1    
        1    308   1   .   1   .   .   .   .   .   .    33   LEU   H      
        1    308   1   .   2   .   .   .   .   .   .    33   LEU   QD2    
        1    309   1   .   1   .   .   .   .   .   .    36   LEU   H      
        1    309   1   .   2   .   .   .   .   .   .    37   GLN   H      
        1    310   1   .   1   .   .   .   .   .   .    35   TYR   QB     
        1    310   1   .   2   .   .   .   .   .   .    36   LEU   H      
        1    311   1   .   1   .   .   .   .   .   .    36   LEU   H      
        1    311   1   .   2   .   .   .   .   .   .    36   LEU   QB     
        1    312   1   .   1   .   .   .   .   .   .    33   LEU   QD2    
        1    312   1   .   2   .   .   .   .   .   .    36   LEU   H      
        1    313   1   .   1   .   .   .   .   .   .    70   GLN   H      
        1    313   1   .   2   .   .   .   .   .   .    71   GLY   H      
        1    314   1   .   1   .   .   .   .   .   .    69   ALA   H      
        1    314   1   .   2   .   .   .   .   .   .    70   GLN   H      
        1    315   1   .   1   .   .   .   .   .   .    70   GLN   H      
        1    315   1   .   2   .   .   .   .   .   .    70   GLN   QB     
        1    316   1   .   1   .   .   .   .   .   .    69   ALA   QB     
        1    316   1   .   2   .   .   .   .   .   .    70   GLN   H      
        1    317   1   .   1   .   .   .   .   .   .    90   TYR   H      
        1    317   1   .   2   .   .   .   .   .   .    91   GLU   H      
        1    318   1   .   1   .   .   .   .   .   .    90   TYR   QB     
        1    318   1   .   2   .   .   .   .   .   .    91   GLU   H      
        1    319   1   .   1   .   .   .   .   .   .    62   VAL   HB     
        1    319   1   .   2   .   .   .   .   .   .    63   CYS   H      
        1    320   1   .   1   .   .   .   .   .   .    62   VAL   QG1    
        1    320   1   .   2   .   .   .   .   .   .    63   CYS   H      
        1    321   1   .   1   .   .   .   .   .   .    55   ILE   HA     
        1    321   1   .   2   .   .   .   .   .   .    59   LEU   H      
        1    322   1   .   1   .   .   .   .   .   .    58   GLU   QB     
        1    322   1   .   2   .   .   .   .   .   .    59   LEU   H      
        1    323   1   .   1   .   .   .   .   .   .    59   LEU   H      
        1    323   1   .   2   .   .   .   .   .   .    59   LEU   QB     
        1    324   1   .   1   .   .   .   .   .   .    59   LEU   H      
        1    324   1   .   2   .   .   .   .   .   .    59   LEU   HG     
        1    325   1   .   1   .   .   .   .   .   .    59   LEU   H      
        1    325   1   .   2   .   .   .   .   .   .    59   LEU   QD2    
        1    326   1   .   1   .   .   .   .   .   .    47   LYS   H      
        1    326   1   .   2   .   .   .   .   .   .    47   LYS   QB     
        1    327   1   .   1   .   .   .   .   .   .    47   LYS   H      
        1    327   1   .   2   .   .   .   .   .   .   114   ILE   QG1    
        1    328   1   .   1   .   .   .   .   .   .   104   LEU   H      
        1    328   1   .   2   .   .   .   .   .   .   105   LYS   H      
        1    329   1   .   1   .   .   .   .   .   .   101   LEU   HA     
        1    329   1   .   2   .   .   .   .   .   .   104   LEU   H      
        1    330   1   .   1   .   .   .   .   .   .   103   ASP   HB2    
        1    330   1   .   2   .   .   .   .   .   .   104   LEU   H      
        1    331   1   .   1   .   .   .   .   .   .   104   LEU   H      
        1    331   1   .   2   .   .   .   .   .   .   104   LEU   QB     
        1    332   1   .   1   .   .   .   .   .   .    33   LEU   HG     
        1    332   1   .   2   .   .   .   .   .   .   104   LEU   H      
        1    333   1   .   1   .   .   .   .   .   .    33   LEU   QD2    
        1    333   1   .   2   .   .   .   .   .   .   104   LEU   H      
        1    334   1   .   1   .   .   .   .   .   .   104   LEU   H      
        1    334   1   .   2   .   .   .   .   .   .   104   LEU   QQD    
        1    335   1   .   1   .   .   .   .   .   .    66   ILE   H      
        1    335   1   .   2   .   .   .   .   .   .    67   GLU   H      
        1    336   1   .   1   .   .   .   .   .   .    67   GLU   H      
        1    336   1   .   2   .   .   .   .   .   .    67   GLU   HB2    
        1    337   1   .   1   .   .   .   .   .   .    67   GLU   H      
        1    337   1   .   2   .   .   .   .   .   .    67   GLU   HB3    
        1    338   1   .   1   .   .   .   .   .   .    66   ILE   QG2    
        1    338   1   .   2   .   .   .   .   .   .    67   GLU   H      
        1    339   1   .   1   .   .   .   .   .   .    83   ASN   H      
        1    339   1   .   2   .   .   .   .   .   .    86   GLU   QB     
        1    340   1   .   1   .   .   .   .   .   .    82   LEU   QQD    
        1    340   1   .   2   .   .   .   .   .   .    83   ASN   H      
        1    341   1   .   1   .   .   .   .   .   .     1   GLN   QB     
        1    341   1   .   2   .   .   .   .   .   .     1   GLN   HE22   
        1    342   1   .   1   .   .   .   .   .   .    19   ILE   HA     
        1    342   1   .   2   .   .   .   .   .   .    19   ILE   QD1    
        1    343   1   .   1   .   .   .   .   .   .    19   ILE   HB     
        1    343   1   .   2   .   .   .   .   .   .    19   ILE   QD1    
        1    344   1   .   1   .   .   .   .   .   .    19   ILE   QG2    
        1    344   1   .   2   .   .   .   .   .   .    19   ILE   QD1    
        1    345   1   .   1   .   .   .   .   .   .    19   ILE   QD1    
        1    345   1   .   2   .   .   .   .   .   .    77   LEU   QQD    
        1    346   1   .   1   .   .   .   .   .   .    29   GLY   H      
        1    346   1   .   2   .   .   .   .   .   .    66   ILE   QD1    
        1    347   1   .   1   .   .   .   .   .   .    66   ILE   H      
        1    347   1   .   2   .   .   .   .   .   .    66   ILE   QD1    
        1    348   1   .   1   .   .   .   .   .   .    65   MET   H      
        1    348   1   .   2   .   .   .   .   .   .    66   ILE   QD1    
        1    349   1   .   1   .   .   .   .   .   .    25   ALA   HA     
        1    349   1   .   2   .   .   .   .   .   .    66   ILE   QD1    
        1    350   1   .   1   .   .   .   .   .   .    65   MET   HA     
        1    350   1   .   2   .   .   .   .   .   .    66   ILE   QD1    
        1    351   1   .   1   .   .   .   .   .   .    63   CYS   HA     
        1    351   1   .   2   .   .   .   .   .   .    66   ILE   QD1    
        1    352   1   .   1   .   .   .   .   .   .    66   ILE   HA     
        1    352   1   .   2   .   .   .   .   .   .    66   ILE   QD1    
        1    353   1   .   1   .   .   .   .   .   .    65   MET   HB2    
        1    353   1   .   2   .   .   .   .   .   .    66   ILE   QD1    
        1    354   1   .   1   .   .   .   .   .   .    66   ILE   HB     
        1    354   1   .   2   .   .   .   .   .   .    66   ILE   QD1    
        1    355   1   .   1   .   .   .   .   .   .    28   LYS   QB     
        1    355   1   .   2   .   .   .   .   .   .    66   ILE   QD1    
        1    356   1   .   1   .   .   .   .   .   .    28   LYS   QD     
        1    356   1   .   2   .   .   .   .   .   .    66   ILE   QD1    
        1    357   1   .   1   .   .   .   .   .   .    66   ILE   QG2    
        1    357   1   .   2   .   .   .   .   .   .    66   ILE   QD1    
        1    358   1   .   1   .   .   .   .   .   .   114   ILE   QG2    
        1    358   1   .   2   .   .   .   .   .   .   116   THR   H      
        1    359   1   .   1   .   .   .   .   .   .   114   ILE   H      
        1    359   1   .   2   .   .   .   .   .   .   114   ILE   QG2    
        1    360   1   .   1   .   .   .   .   .   .    44   ASN   HA     
        1    360   1   .   2   .   .   .   .   .   .   114   ILE   QG2    
        1    361   1   .   1   .   .   .   .   .   .   114   ILE   HA     
        1    361   1   .   2   .   .   .   .   .   .   114   ILE   QG2    
        1    362   1   .   1   .   .   .   .   .   .   111   VAL   HA     
        1    362   1   .   2   .   .   .   .   .   .   114   ILE   QG2    
        1    363   1   .   1   .   .   .   .   .   .    47   LYS   HD2    
        1    363   1   .   2   .   .   .   .   .   .   114   ILE   QG2    
        1    364   1   .   1   .   .   .   .   .   .    47   LYS   HD3    
        1    364   1   .   2   .   .   .   .   .   .   114   ILE   QG2    
        1    365   1   .   1   .   .   .   .   .   .   114   ILE   QG2    
        1    365   1   .   2   .   .   .   .   .   .   114   ILE   QG1    
        1    366   1   .   1   .   .   .   .   .   .    75   ARG   H      
        1    366   1   .   2   .   .   .   .   .   .    77   LEU   QQD    
        1    367   1   .   1   .   .   .   .   .   .    19   ILE   HA     
        1    367   1   .   2   .   .   .   .   .   .    77   LEU   QQD    
        1    368   1   .   1   .   .   .   .   .   .    77   LEU   QQD    
        1    368   1   .   2   .   .   .   .   .   .    90   TYR   QB     
        1    369   1   .   1   .   .   .   .   .   .    77   LEU   QQD    
        1    369   1   .   2   .   .   .   .   .   .    78   LYS   QE     
        1    370   1   .   1   .   .   .   .   .   .    74   GLU   QB     
        1    370   1   .   2   .   .   .   .   .   .    77   LEU   QQD    
        1    371   1   .   1   .   .   .   .   .   .    77   LEU   QQD    
        1    371   1   .   2   .   .   .   .   .   .    78   LYS   QG     
        1    372   1   .   1   .   .   .   .   .   .    19   ILE   HG12   
        1    372   1   .   2   .   .   .   .   .   .    77   LEU   QQD    
        1    373   1   .   1   .   .   .   .   .   .   114   ILE   HA     
        1    373   1   .   2   .   .   .   .   .   .   114   ILE   QD1    
        1    374   1   .   1   .   .   .   .   .   .   111   VAL   HA     
        1    374   1   .   2   .   .   .   .   .   .   114   ILE   QD1    
        1    375   1   .   1   .   .   .   .   .   .    47   LYS   QE     
        1    375   1   .   2   .   .   .   .   .   .   114   ILE   QD1    
        1    376   1   .   1   .   .   .   .   .   .    44   ASN   HB2    
        1    376   1   .   2   .   .   .   .   .   .   114   ILE   QD1    
        1    377   1   .   1   .   .   .   .   .   .   114   ILE   HB     
        1    377   1   .   2   .   .   .   .   .   .   114   ILE   QD1    
        1    378   1   .   1   .   .   .   .   .   .    49   LYS   H      
        1    378   1   .   2   .   .   .   .   .   .   116   THR   QG2    
        1    379   1   .   1   .   .   .   .   .   .   116   THR   QG2    
        1    379   1   .   2   .   .   .   .   .   .   117   GLN   H      
        1    380   1   .   1   .   .   .   .   .   .   116   THR   H      
        1    380   1   .   2   .   .   .   .   .   .   116   THR   QG2    
        1    381   1   .   1   .   .   .   .   .   .   116   THR   HA     
        1    381   1   .   2   .   .   .   .   .   .   116   THR   QG2    
        1    382   1   .   1   .   .   .   .   .   .    47   LYS   QB     
        1    382   1   .   2   .   .   .   .   .   .   116   THR   QG2    
        1    383   1   .   1   .   .   .   .   .   .    84   ILE   QD1    
        1    383   1   .   2   .   .   .   .   .   .    85   LEU   H      
        1    384   1   .   1   .   .   .   .   .   .    99   ILE   QD1    
        1    384   1   .   2   .   .   .   .   .   .   100   LEU   H      
        1    385   1   .   1   .   .   .   .   .   .    99   ILE   H      
        1    385   1   .   2   .   .   .   .   .   .    99   ILE   QD1    
        1    386   1   .   1   .   .   .   .   .   .    96   LEU   HA     
        1    386   1   .   2   .   .   .   .   .   .    99   ILE   QD1    
        1    387   1   .   1   .   .   .   .   .   .    99   ILE   HA     
        1    387   1   .   2   .   .   .   .   .   .    99   ILE   QD1    
        1    388   1   .   1   .   .   .   .   .   .    26   ILE   HB     
        1    388   1   .   2   .   .   .   .   .   .    26   ILE   QD1    
        1    389   1   .   1   .   .   .   .   .   .    99   ILE   HB     
        1    389   1   .   2   .   .   .   .   .   .    99   ILE   QD1    
        1    390   1   .   1   .   .   .   .   .   .    40   LEU   QD2    
        1    390   1   .   2   .   .   .   .   .   .    41   ASP   H      
        1    391   1   .   1   .   .   .   .   .   .   101   LEU   HA     
        1    391   1   .   2   .   .   .   .   .   .   104   LEU   QQD    
        1    392   1   .   1   .   .   .   .   .   .    22   ALA   HA     
        1    392   1   .   2   .   .   .   .   .   .    73   LEU   QQD    
        1    393   1   .   1   .   .   .   .   .   .    33   LEU   QD2    
        1    393   1   .   2   .   .   .   .   .   .    37   GLN   HA     
        1    394   1   .   1   .   .   .   .   .   .    33   LEU   QD2    
        1    394   1   .   2   .   .   .   .   .   .   103   ASP   HB2    
        1    395   1   .   1   .   .   .   .   .   .    33   LEU   QD2    
        1    395   1   .   2   .   .   .   .   .   .   103   ASP   HB3    
        1    396   1   .   1   .   .   .   .   .   .    73   LEU   QB     
        1    396   1   .   2   .   .   .   .   .   .    73   LEU   QQD    
        1    397   1   .   1   .   .   .   .   .   .    26   ILE   H      
        1    397   1   .   2   .   .   .   .   .   .    26   ILE   QG2    
        1    398   1   .   1   .   .   .   .   .   .    26   ILE   QG2    
        1    398   1   .   2   .   .   .   .   .   .    97   SER   HA     
        1    399   1   .   1   .   .   .   .   .   .    26   ILE   QD1    
        1    399   1   .   2   .   .   .   .   .   .    97   SER   H      
        1    400   1   .   1   .   .   .   .   .   .    82   LEU   QQD    
        1    400   1   .   2   .   .   .   .   .   .    83   ASN   HA     
        1    401   1   .   1   .   .   .   .   .   .    33   LEU   QD2    
        1    401   1   .   2   .   .   .   .   .   .    37   GLN   HE21   
        1    402   1   .   1   .   .   .   .   .   .    18   LEU   H      
        1    402   1   .   2   .   .   .   .   .   .    18   LEU   QQD    
        1    403   1   .   1   .   .   .   .   .   .    34   LEU   H      
        1    403   1   .   2   .   .   .   .   .   .    34   LEU   QQD    
        1    404   1   .   1   .   .   .   .   .   .    31   HIS   HA     
        1    404   1   .   2   .   .   .   .   .   .    34   LEU   QQD    
        1    405   1   .   1   .   .   .   .   .   .    31   HIS   QB     
        1    405   1   .   2   .   .   .   .   .   .    34   LEU   QQD    
        1    406   1   .   1   .   .   .   .   .   .   101   LEU   QB     
        1    406   1   .   2   .   .   .   .   .   .   101   LEU   QQD    
        1    407   1   .   1   .   .   .   .   .   .    55   ILE   H      
        1    407   1   .   2   .   .   .   .   .   .    55   ILE   QG2    
        1    408   1   .   1   .   .   .   .   .   .    55   ILE   HA     
        1    408   1   .   2   .   .   .   .   .   .    55   ILE   QG2    
        1    409   1   .   1   .   .   .   .   .   .    56   ILE   QG2    
        1    409   1   .   2   .   .   .   .   .   .    57   ARG   H      
        1    410   1   .   1   .   .   .   .   .   .    56   ILE   QG2    
        1    410   1   .   2   .   .   .   .   .   .    57   ARG   HA     
        1    411   1   .   1   .   .   .   .   .   .    84   ILE   QG2    
        1    411   1   .   2   .   .   .   .   .   .    85   LEU   HA     
        1    412   1   .   1   .   .   .   .   .   .    56   ILE   HA     
        1    412   1   .   2   .   .   .   .   .   .    56   ILE   QG2    
        1    413   1   .   1   .   .   .   .   .   .    84   ILE   HA     
        1    413   1   .   2   .   .   .   .   .   .    84   ILE   QG2    
        1    414   1   .   1   .   .   .   .   .   .    56   ILE   QG2    
        1    414   1   .   2   .   .   .   .   .   .    57   ARG   QD     
        1    415   1   .   1   .   .   .   .   .   .    99   ILE   QG2    
        1    415   1   .   2   .   .   .   .   .   .   103   ASP   HB2    
        1    416   1   .   1   .   .   .   .   .   .    18   LEU   QQD    
        1    416   1   .   2   .   .   .   .   .   .    19   ILE   H      
        1    417   1   .   1   .   .   .   .   .   .    17   LEU   HA     
        1    417   1   .   2   .   .   .   .   .   .    17   LEU   QQD    
        1    418   1   .   1   .   .   .   .   .   .    30   GLU   HA     
        1    418   1   .   2   .   .   .   .   .   .   100   LEU   QQD    
        1    419   1   .   1   .   .   .   .   .   .    30   GLU   QG     
        1    419   1   .   2   .   .   .   .   .   .   100   LEU   QQD    
        1    420   1   .   1   .   .   .   .   .   .    70   GLN   QG     
        1    420   1   .   2   .   .   .   .   .   .   101   LEU   QQD    
        1    421   1   .   1   .   .   .   .   .   .   101   LEU   QQD    
        1    421   1   .   2   .   .   .   .   .   .   104   LEU   QB     
        1    422   1   .   1   .   .   .   .   .   .    70   GLN   HE22   
        1    422   1   .   2   .   .   .   .   .   .   101   LEU   QQD    
        1    423   1   .   1   .   .   .   .   .   .    63   CYS   HA     
        1    423   1   .   2   .   .   .   .   .   .    66   ILE   QG2    
        1    424   1   .   1   .   .   .   .   .   .    66   ILE   HA     
        1    424   1   .   2   .   .   .   .   .   .    66   ILE   QG2    
        1    425   1   .   1   .   .   .   .   .   .    66   ILE   QG2    
        1    425   1   .   2   .   .   .   .   .   .    70   GLN   QG     
        1    426   1   .   1   .   .   .   .   .   .    66   ILE   QG2    
        1    426   1   .   2   .   .   .   .   .   .    70   GLN   QB     
        1    427   1   .   1   .   .   .   .   .   .    66   ILE   QG2    
        1    427   1   .   2   .   .   .   .   .   .    66   ILE   QG1    
        1    428   1   .   1   .   .   .   .   .   .    61   VAL   QG2    
        1    428   1   .   2   .   .   .   .   .   .    62   VAL   H      
        1    429   1   .   1   .   .   .   .   .   .    61   VAL   H      
        1    429   1   .   2   .   .   .   .   .   .    61   VAL   QG2    
        1    430   1   .   1   .   .   .   .   .   .    58   GLU   HA     
        1    430   1   .   2   .   .   .   .   .   .    61   VAL   QG2    
        1    431   1   .   1   .   .   .   .   .   .    61   VAL   HA     
        1    431   1   .   2   .   .   .   .   .   .    61   VAL   QG2    
        1    432   1   .   1   .   .   .   .   .   .    51   LEU   HA     
        1    432   1   .   2   .   .   .   .   .   .    51   LEU   QD2    
        1    433   1   .   1   .   .   .   .   .   .   111   VAL   H      
        1    433   1   .   2   .   .   .   .   .   .   111   VAL   QG1    
        1    434   1   .   1   .   .   .   .   .   .   111   VAL   HA     
        1    434   1   .   2   .   .   .   .   .   .   111   VAL   QG1    
        1    435   1   .   1   .   .   .   .   .   .   107   THR   QG2    
        1    435   1   .   2   .   .   .   .   .   .   108   GLU   H      
        1    436   1   .   1   .   .   .   .   .   .   107   THR   H      
        1    436   1   .   2   .   .   .   .   .   .   107   THR   QG2    
        1    437   1   .   1   .   .   .   .   .   .   107   THR   HA     
        1    437   1   .   2   .   .   .   .   .   .   107   THR   QG2    
        1    438   1   .   1   .   .   .   .   .   .    19   ILE   QG2    
        1    438   1   .   2   .   .   .   .   .   .    19   ILE   HG13   
        1    439   1   .   1   .   .   .   .   .   .    62   VAL   H      
        1    439   1   .   2   .   .   .   .   .   .    62   VAL   QG2    
        1    440   1   .   1   .   .   .   .   .   .    32   GLN   QG     
        1    440   1   .   2   .   .   .   .   .   .    62   VAL   QG1    
        1    441   1   .   1   .   .   .   .   .   .    61   VAL   H      
        1    441   1   .   2   .   .   .   .   .   .    61   VAL   QG1    
        1    442   1   .   1   .   .   .   .   .   .    58   GLU   HA     
        1    442   1   .   2   .   .   .   .   .   .    61   VAL   QG1    
        1    443   1   .   1   .   .   .   .   .   .    61   VAL   HA     
        1    443   1   .   2   .   .   .   .   .   .    61   VAL   QG1    
        1    444   1   .   1   .   .   .   .   .   .    84   ILE   HA     
        1    444   1   .   2   .   .   .   .   .   .    84   ILE   HG13   
        1    445   1   .   1   .   .   .   .   .   .    80   THR   H      
        1    445   1   .   2   .   .   .   .   .   .    80   THR   QG2    
        1    446   1   .   1   .   .   .   .   .   .    95   THR   QG2    
        1    446   1   .   2   .   .   .   .   .   .    96   LEU   H      
        1    447   1   .   1   .   .   .   .   .   .    95   THR   QG2    
        1    447   1   .   2   .   .   .   .   .   .    99   ILE   H      
        1    448   1   .   1   .   .   .   .   .   .    80   THR   HA     
        1    448   1   .   2   .   .   .   .   .   .    80   THR   QG2    
        1    449   1   .   1   .   .   .   .   .   .    92   GLU   HA     
        1    449   1   .   2   .   .   .   .   .   .    95   THR   QG2    
        1    450   1   .   1   .   .   .   .   .   .    95   THR   QG2    
        1    450   1   .   2   .   .   .   .   .   .    99   ILE   HA     
        1    451   1   .   1   .   .   .   .   .   .    92   GLU   QG     
        1    451   1   .   2   .   .   .   .   .   .    95   THR   QG2    
        1    452   1   .   1   .   .   .   .   .   .    95   THR   QG2    
        1    452   1   .   2   .   .   .   .   .   .    96   LEU   HG     
        1    453   1   .   1   .   .   .   .   .   .    95   THR   QG2    
        1    453   1   .   2   .   .   .   .   .   .    99   ILE   QD1    
        1    454   1   .   1   .   .   .   .   .   .    47   LYS   H      
        1    454   1   .   2   .   .   .   .   .   .    47   LYS   QG     
        1    455   1   .   1   .   .   .   .   .   .    28   LYS   H      
        1    455   1   .   2   .   .   .   .   .   .    28   LYS   QG     
        1    456   1   .   1   .   .   .   .   .   .    28   LYS   HA     
        1    456   1   .   2   .   .   .   .   .   .    28   LYS   QG     
        1    457   1   .   1   .   .   .   .   .   .    28   LYS   QG     
        1    457   1   .   2   .   .   .   .   .   .    28   LYS   QE     
        1    458   1   .   1   .   .   .   .   .   .    28   LYS   QG     
        1    458   1   .   2   .   .   .   .   .   .    28   LYS   QD     
        1    459   1   .   1   .   .   .   .   .   .   109   GLN   HA     
        1    459   1   .   2   .   .   .   .   .   .   112   LYS   QG     
        1    460   1   .   1   .   .   .   .   .   .    49   LYS   HA     
        1    460   1   .   2   .   .   .   .   .   .    49   LYS   QG     
        1    461   1   .   1   .   .   .   .   .   .     7   LYS   QG     
        1    461   1   .   2   .   .   .   .   .   .     8   ASP   QB     
        1    462   1   .   1   .   .   .   .   .   .    49   LYS   QG     
        1    462   1   .   2   .   .   .   .   .   .    50   GLU   QG     
        1    463   1   .   1   .   .   .   .   .   .    49   LYS   QG     
        1    463   1   .   2   .   .   .   .   .   .    49   LYS   QD     
        1    464   1   .   1   .   .   .   .   .   .   102   LYS   QG     
        1    464   1   .   2   .   .   .   .   .   .   102   LYS   QD     
        1    465   1   .   1   .   .   .   .   .   .    49   LYS   H      
        1    465   1   .   2   .   .   .   .   .   .    49   LYS   QG     
        1    466   1   .   1   .   .   .   .   .   .   102   LYS   H      
        1    466   1   .   2   .   .   .   .   .   .   102   LYS   QG     
        1    467   1   .   1   .   .   .   .   .   .    66   ILE   QG1    
        1    467   1   .   2   .   .   .   .   .   .    70   GLN   QB     
        1    468   1   .   1   .   .   .   .   .   .    22   ALA   QB     
        1    468   1   .   2   .   .   .   .   .   .    23   ASN   H      
        1    469   1   .   1   .   .   .   .   .   .    22   ALA   H      
        1    469   1   .   2   .   .   .   .   .   .    22   ALA   QB     
        1    470   1   .   1   .   .   .   .   .   .    22   ALA   QB     
        1    470   1   .   2   .   .   .   .   .   .    24   HIS   H      
        1    471   1   .   1   .   .   .   .   .   .    66   ILE   H      
        1    471   1   .   2   .   .   .   .   .   .    69   ALA   QB     
        1    472   1   .   1   .   .   .   .   .   .    69   ALA   H      
        1    472   1   .   2   .   .   .   .   .   .    69   ALA   QB     
        1    473   1   .   1   .   .   .   .   .   .    19   ILE   HA     
        1    473   1   .   2   .   .   .   .   .   .    22   ALA   QB     
        1    474   1   .   1   .   .   .   .   .   .    66   ILE   HA     
        1    474   1   .   2   .   .   .   .   .   .    69   ALA   QB     
        1    475   1   .   1   .   .   .   .   .   .    25   ALA   QB     
        1    475   1   .   2   .   .   .   .   .   .    26   ILE   QG1    
        1    476   1   .   1   .   .   .   .   .   .    19   ILE   HG12   
        1    476   1   .   2   .   .   .   .   .   .    22   ALA   QB     
        1    477   1   .   1   .   .   .   .   .   .    19   ILE   HG13   
        1    477   1   .   2   .   .   .   .   .   .    22   ALA   QB     
        1    478   1   .   1   .   .   .   .   .   .    22   ALA   QB     
        1    478   1   .   2   .   .   .   .   .   .    73   LEU   QQD    
        1    479   1   .   1   .   .   .   .   .   .    19   ILE   QD1    
        1    479   1   .   2   .   .   .   .   .   .    22   ALA   QB     
        1    480   1   .   1   .   .   .   .   .   .    25   ALA   H      
        1    480   1   .   2   .   .   .   .   .   .    25   ALA   QB     
        1    481   1   .   1   .   .   .   .   .   .    64   ALA   QB     
        1    481   1   .   2   .   .   .   .   .   .    65   MET   HB3    
        1    482   1   .   1   .   .   .   .   .   .    64   ALA   QB     
        1    482   1   .   2   .   .   .   .   .   .    65   MET   QE     
        1    483   1   .   1   .   .   .   .   .   .    92   GLU   QB     
        1    483   1   .   2   .   .   .   .   .   .    93   ALA   QB     
        1    484   1   .   1   .   .   .   .   .   .    25   ALA   QB     
        1    484   1   .   2   .   .   .   .   .   .    26   ILE   QG2    
        1    485   1   .   1   .   .   .   .   .   .    78   LYS   QG     
        1    485   1   .   2   .   .   .   .   .   .    78   LYS   QD     
        1    486   1   .   1   .   .   .   .   .   .    71   GLY   H      
        1    486   1   .   2   .   .   .   .   .   .    72   ALA   QB     
        1    487   1   .   1   .   .   .   .   .   .    92   GLU   H      
        1    487   1   .   2   .   .   .   .   .   .    93   ALA   QB     
        1    488   1   .   1   .   .   .   .   .   .    62   VAL   H      
        1    488   1   .   2   .   .   .   .   .   .    64   ALA   QB     
        1    489   1   .   1   .   .   .   .   .   .    64   ALA   QB     
        1    489   1   .   2   .   .   .   .   .   .    65   MET   H      
        1    490   1   .   1   .   .   .   .   .   .    90   TYR   HA     
        1    490   1   .   2   .   .   .   .   .   .    93   ALA   QB     
        1    491   1   .   1   .   .   .   .   .   .    60   ASP   HA     
        1    491   1   .   2   .   .   .   .   .   .    64   ALA   QB     
        1    492   1   .   1   .   .   .   .   .   .    89   ASN   HA     
        1    492   1   .   2   .   .   .   .   .   .    93   ALA   QB     
        1    493   1   .   1   .   .   .   .   .   .    61   VAL   HA     
        1    493   1   .   2   .   .   .   .   .   .    64   ALA   QB     
        1    494   1   .   1   .   .   .   .   .   .    64   ALA   QB     
        1    494   1   .   2   .   .   .   .   .   .    65   MET   QG     
        1    495   1   .   1   .   .   .   .   .   .    19   ILE   HG12   
        1    495   1   .   2   .   .   .   .   .   .    93   ALA   QB     
        1    496   1   .   1   .   .   .   .   .   .    19   ILE   QD1    
        1    496   1   .   2   .   .   .   .   .   .    93   ALA   QB     
        1    497   1   .   1   .   .   .   .   .   .    11   ARG   HA     
        1    497   1   .   2   .   .   .   .   .   .    11   ARG   QG     
        1    498   1   .   1   .   .   .   .   .   .    43   LEU   HG     
        1    498   1   .   2   .   .   .   .   .   .    52   GLN   H      
        1    499   1   .   1   .   .   .   .   .   .    42   GLU   QG     
        1    499   1   .   2   .   .   .   .   .   .    51   LEU   HG     
        1    500   1   .   1   .   .   .   .   .   .    51   LEU   HG     
        1    500   1   .   2   .   .   .   .   .   .    54   LYS   QB     
        1    501   1   .   1   .   .   .   .   .   .    47   LYS   HD3    
        1    501   1   .   2   .   .   .   .   .   .   114   ILE   HA     
        1    502   1   .   1   .   .   .   .   .   .    47   LYS   HA     
        1    502   1   .   2   .   .   .   .   .   .    47   LYS   HD3    
        1    503   1   .   1   .   .   .   .   .   .    47   LYS   HD3    
        1    503   1   .   2   .   .   .   .   .   .   115   GLN   QG     
        1    504   1   .   1   .   .   .   .   .   .    49   LYS   QD     
        1    504   1   .   2   .   .   .   .   .   .    50   GLU   QG     
        1    505   1   .   1   .   .   .   .   .   .    85   LEU   QB     
        1    505   1   .   2   .   .   .   .   .   .    88   PHE   H      
        1    506   1   .   1   .   .   .   .   .   .    83   ASN   HB3    
        1    506   1   .   2   .   .   .   .   .   .    85   LEU   QB     
        1    507   1   .   1   .   .   .   .   .   .    85   LEU   QB     
        1    507   1   .   2   .   .   .   .   .   .    86   GLU   QB     
        1    508   1   .   1   .   .   .   .   .   .    18   LEU   QB     
        1    508   1   .   2   .   .   .   .   .   .    18   LEU   QQD    
        1    509   1   .   1   .   .   .   .   .   .    85   LEU   QB     
        1    509   1   .   2   .   .   .   .   .   .    85   LEU   QQD    
        1    510   1   .   1   .   .   .   .   .   .   110   LYS   H      
        1    510   1   .   2   .   .   .   .   .   .   112   LYS   QD     
        1    511   1   .   1   .   .   .   .   .   .   112   LYS   QD     
        1    511   1   .   2   .   .   .   .   .   .   113   ASP   H      
        1    512   1   .   1   .   .   .   .   .   .    49   LYS   QD     
        1    512   1   .   2   .   .   .   .   .   .   117   GLN   HA     
        1    513   1   .   1   .   .   .   .   .   .    49   LYS   HA     
        1    513   1   .   2   .   .   .   .   .   .    49   LYS   QD     
        1    514   1   .   1   .   .   .   .   .   .    99   ILE   HA     
        1    514   1   .   2   .   .   .   .   .   .   102   LYS   QD     
        1    515   1   .   1   .   .   .   .   .   .    78   LYS   QB     
        1    515   1   .   2   .   .   .   .   .   .    78   LYS   QD     
        1    516   1   .   1   .   .   .   .   .   .   112   LYS   QB     
        1    516   1   .   2   .   .   .   .   .   .   112   LYS   QD     
        1    517   1   .   1   .   .   .   .   .   .     4   LYS   QG     
        1    517   1   .   2   .   .   .   .   .   .     4   LYS   QD     
        1    518   1   .   1   .   .   .   .   .   .   109   GLN   H      
        1    518   1   .   2   .   .   .   .   .   .   112   LYS   QD     
        1    519   1   .   1   .   .   .   .   .   .    57   ARG   H      
        1    519   1   .   2   .   .   .   .   .   .    57   ARG   HG3    
        1    520   1   .   1   .   .   .   .   .   .    18   LEU   QB     
        1    520   1   .   2   .   .   .   .   .   .    19   ILE   H      
        1    521   1   .   1   .   .   .   .   .   .    18   LEU   QB     
        1    521   1   .   2   .   .   .   .   .   .    19   ILE   HA     
        1    522   1   .   1   .   .   .   .   .   .    82   LEU   QB     
        1    522   1   .   2   .   .   .   .   .   .    83   ASN   HA     
        1    523   1   .   1   .   .   .   .   .   .    78   LYS   H      
        1    523   1   .   2   .   .   .   .   .   .    78   LYS   QD     
        1    524   1   .   1   .   .   .   .   .   .    47   LYS   HD2    
        1    524   1   .   2   .   .   .   .   .   .   115   GLN   QG     
        1    525   1   .   1   .   .   .   .   .   .    47   LYS   HD2    
        1    525   1   .   2   .   .   .   .   .   .   114   ILE   HA     
        1    526   1   .   1   .   .   .   .   .   .    47   LYS   HA     
        1    526   1   .   2   .   .   .   .   .   .    47   LYS   HD2    
        1    527   1   .   1   .   .   .   .   .   .    49   LYS   H      
        1    527   1   .   2   .   .   .   .   .   .    49   LYS   QB     
        1    528   1   .   1   .   .   .   .   .   .    49   LYS   QB     
        1    528   1   .   2   .   .   .   .   .   .   116   THR   HB     
        1    529   1   .   1   .   .   .   .   .   .   100   LEU   QB     
        1    529   1   .   2   .   .   .   .   .   .   101   LEU   H      
        1    530   1   .   1   .   .   .   .   .   .   101   LEU   QB     
        1    530   1   .   2   .   .   .   .   .   .   102   LYS   H      
        1    531   1   .   1   .   .   .   .   .   .    31   HIS   HA     
        1    531   1   .   2   .   .   .   .   .   .    34   LEU   QB     
        1    532   1   .   1   .   .   .   .   .   .   100   LEU   HA     
        1    532   1   .   2   .   .   .   .   .   .   101   LEU   QB     
        1    533   1   .   1   .   .   .   .   .   .    97   SER   HA     
        1    533   1   .   2   .   .   .   .   .   .   100   LEU   QB     
        1    534   1   .   1   .   .   .   .   .   .   101   LEU   QB     
        1    534   1   .   2   .   .   .   .   .   .   105   LYS   QB     
        1    535   1   .   1   .   .   .   .   .   .    17   LEU   QB     
        1    535   1   .   2   .   .   .   .   .   .    17   LEU   QQD    
        1    536   1   .   1   .   .   .   .   .   .    34   LEU   QB     
        1    536   1   .   2   .   .   .   .   .   .    34   LEU   QQD    
        1    537   1   .   1   .   .   .   .   .   .    26   ILE   QG2    
        1    537   1   .   2   .   .   .   .   .   .    26   ILE   QG1    
        1    538   1   .   1   .   .   .   .   .   .   101   LEU   QB     
        1    538   1   .   2   .   .   .   .   .   .   104   LEU   QB     
        1    539   1   .   1   .   .   .   .   .   .    99   ILE   H      
        1    539   1   .   2   .   .   .   .   .   .    99   ILE   HG12   
        1    540   1   .   1   .   .   .   .   .   .    84   ILE   H      
        1    540   1   .   2   .   .   .   .   .   .    84   ILE   HB     
        1    541   1   .   1   .   .   .   .   .   .    83   ASN   HA     
        1    541   1   .   2   .   .   .   .   .   .    84   ILE   HB     
        1    542   1   .   1   .   .   .   .   .   .    84   ILE   HB     
        1    542   1   .   2   .   .   .   .   .   .    85   LEU   HA     
        1    543   1   .   1   .   .   .   .   .   .    54   LYS   QB     
        1    543   1   .   2   .   .   .   .   .   .    55   ILE   HB     
        1    544   1   .   1   .   .   .   .   .   .    52   GLN   HA     
        1    544   1   .   2   .   .   .   .   .   .    55   ILE   HB     
        1    545   1   .   1   .   .   .   .   .   .   105   LYS   QB     
        1    545   1   .   2   .   .   .   .   .   .   105   LYS   QD     
        1    546   1   .   1   .   .   .   .   .   .    76   GLU   H      
        1    546   1   .   2   .   .   .   .   .   .    78   LYS   QB     
        1    547   1   .   1   .   .   .   .   .   .    91   GLU   QB     
        1    547   1   .   2   .   .   .   .   .   .    92   GLU   H      
        1    548   1   .   1   .   .   .   .   .   .   110   LYS   H      
        1    548   1   .   2   .   .   .   .   .   .   110   LYS   QD     
        1    549   1   .   1   .   .   .   .   .   .   110   LYS   HA     
        1    549   1   .   2   .   .   .   .   .   .   110   LYS   QD     
        1    550   1   .   1   .   .   .   .   .   .    93   ALA   HA     
        1    550   1   .   2   .   .   .   .   .   .    96   LEU   QB     
        1    551   1   .   1   .   .   .   .   .   .    96   LEU   QB     
        1    551   1   .   2   .   .   .   .   .   .    96   LEU   QQD    
        1    552   1   .   1   .   .   .   .   .   .    96   LEU   HA     
        1    552   1   .   2   .   .   .   .   .   .    99   ILE   HB     
        1    553   1   .   1   .   .   .   .   .   .    39   GLN   H      
        1    553   1   .   2   .   .   .   .   .   .    39   GLN   QG     
        1    554   1   .   1   .   .   .   .   .   .    39   GLN   HA     
        1    554   1   .   2   .   .   .   .   .   .    39   GLN   QG     
        1    555   1   .   1   .   .   .   .   .   .    92   GLU   QB     
        1    555   1   .   2   .   .   .   .   .   .    93   ALA   H      
        1    556   1   .   1   .   .   .   .   .   .    47   LYS   QB     
        1    556   1   .   2   .   .   .   .   .   .    48   SER   HA     
        1    557   1   .   1   .   .   .   .   .   .    47   LYS   QB     
        1    557   1   .   2   .   .   .   .   .   .   116   THR   HA     
        1    558   1   .   1   .   .   .   .   .   .    13   GLU   HA     
        1    558   1   .   2   .   .   .   .   .   .    13   GLU   QG     
        1    559   1   .   1   .   .   .   .   .   .    42   GLU   QG     
        1    559   1   .   2   .   .   .   .   .   .    51   LEU   QB     
        1    560   1   .   1   .   .   .   .   .   .    30   GLU   H      
        1    560   1   .   2   .   .   .   .   .   .    30   GLU   QB     
        1    561   1   .   1   .   .   .   .   .   .    30   GLU   QB     
        1    561   1   .   2   .   .   .   .   .   .   100   LEU   QQD    
        1    562   1   .   1   .   .   .   .   .   .    43   LEU   QB     
        1    562   1   .   2   .   .   .   .   .   .    51   LEU   HG     
        1    563   1   .   1   .   .   .   .   .   .    73   LEU   QB     
        1    563   1   .   2   .   .   .   .   .   .    77   LEU   QQD    
        1    564   1   .   1   .   .   .   .   .   .    64   ALA   HA     
        1    564   1   .   2   .   .   .   .   .   .    66   ILE   HB     
        1    565   1   .   1   .   .   .   .   .   .   108   GLU   QG     
        1    565   1   .   2   .   .   .   .   .   .   112   LYS   QD     
        1    566   1   .   1   .   .   .   .   .   .    52   GLN   QG     
        1    566   1   .   2   .   .   .   .   .   .   116   THR   QG2    
        1    567   1   .   1   .   .   .   .   .   .    40   LEU   HA     
        1    567   1   .   2   .   .   .   .   .   .    43   LEU   QB     
        1    568   1   .   1   .   .   .   .   .   .    65   MET   QE     
        1    568   1   .   2   .   .   .   .   .   .    66   ILE   H      
        1    569   1   .   1   .   .   .   .   .   .    62   VAL   H      
        1    569   1   .   2   .   .   .   .   .   .    65   MET   QE     
        1    570   1   .   1   .   .   .   .   .   .    65   MET   H      
        1    570   1   .   2   .   .   .   .   .   .    65   MET   QE     
        1    571   1   .   1   .   .   .   .   .   .    65   MET   HB2    
        1    571   1   .   2   .   .   .   .   .   .    65   MET   QE     
        1    572   1   .   1   .   .   .   .   .   .    62   VAL   QG2    
        1    572   1   .   2   .   .   .   .   .   .    65   MET   QE     
        1    573   1   .   1   .   .   .   .   .   .    65   MET   QE     
        1    573   1   .   2   .   .   .   .   .   .    66   ILE   QD1    
        1    574   1   .   1   .   .   .   .   .   .    32   GLN   HB3    
        1    574   1   .   2   .   .   .   .   .   .    33   LEU   H      
        1    575   1   .   1   .   .   .   .   .   .    42   GLU   QB     
        1    575   1   .   2   .   .   .   .   .   .    43   LEU   H      
        1    576   1   .   1   .   .   .   .   .   .    27   GLU   H      
        1    576   1   .   2   .   .   .   .   .   .    27   GLU   QB     
        1    577   1   .   1   .   .   .   .   .   .    55   ILE   HA     
        1    577   1   .   2   .   .   .   .   .   .    59   LEU   QB     
        1    578   1   .   1   .   .   .   .   .   .    65   MET   QG     
        1    578   1   .   2   .   .   .   .   .   .    66   ILE   QG1    
        1    579   1   .   1   .   .   .   .   .   .    54   LYS   QB     
        1    579   1   .   2   .   .   .   .   .   .    55   ILE   QG1    
        1    580   1   .   1   .   .   .   .   .   .   104   LEU   QB     
        1    580   1   .   2   .   .   .   .   .   .   105   LYS   QD     
        1    581   1   .   1   .   .   .   .   .   .    74   GLU   QB     
        1    581   1   .   2   .   .   .   .   .   .    75   ARG   H      
        1    582   1   .   1   .   .   .   .   .   .     2   GLU   H      
        1    582   1   .   2   .   .   .   .   .   .     2   GLU   QG     
        1    583   1   .   1   .   .   .   .   .   .     2   GLU   QG     
        1    583   1   .   2   .   .   .   .   .   .     3   HIS   H      
        1    584   1   .   1   .   .   .   .   .   .   109   GLN   QB     
        1    584   1   .   2   .   .   .   .   .   .   109   GLN   QG     
        1    585   1   .   1   .   .   .   .   .   .   109   GLN   QB     
        1    585   1   .   2   .   .   .   .   .   .   112   LYS   QB     
        1    586   1   .   1   .   .   .   .   .   .   103   ASP   HA     
        1    586   1   .   2   .   .   .   .   .   .   106   GLU   QB     
        1    587   1   .   1   .   .   .   .   .   .    21   GLN   QB     
        1    587   1   .   2   .   .   .   .   .   .    22   ALA   QB     
        1    588   1   .   1   .   .   .   .   .   .    69   ALA   QB     
        1    588   1   .   2   .   .   .   .   .   .    70   GLN   QB     
        1    589   1   .   1   .   .   .   .   .   .    61   VAL   H      
        1    589   1   .   2   .   .   .   .   .   .    62   VAL   HB     
        1    590   1   .   1   .   .   .   .   .   .   108   GLU   HA     
        1    590   1   .   2   .   .   .   .   .   .   111   VAL   HB     
        1    591   1   .   1   .   .   .   .   .   .    42   GLU   QG     
        1    591   1   .   2   .   .   .   .   .   .    43   LEU   H      
        1    592   1   .   1   .   .   .   .   .   .    50   GLU   H      
        1    592   1   .   2   .   .   .   .   .   .    50   GLU   QG     
        1    593   1   .   1   .   .   .   .   .   .    20   GLU   H      
        1    593   1   .   2   .   .   .   .   .   .    20   GLU   QG     
        1    594   1   .   1   .   .   .   .   .   .    42   GLU   H      
        1    594   1   .   2   .   .   .   .   .   .    42   GLU   QG     
        1    595   1   .   1   .   .   .   .   .   .    42   GLU   HA     
        1    595   1   .   2   .   .   .   .   .   .    42   GLU   QG     
        1    596   1   .   1   .   .   .   .   .   .    17   LEU   HG     
        1    596   1   .   2   .   .   .   .   .   .    20   GLU   QG     
        1    597   1   .   1   .   .   .   .   .   .    17   LEU   QQD    
        1    597   1   .   2   .   .   .   .   .   .    20   GLU   QG     
        1    598   1   .   1   .   .   .   .   .   .    17   LEU   H      
        1    598   1   .   2   .   .   .   .   .   .    20   GLU   QG     
        1    599   1   .   1   .   .   .   .   .   .    17   LEU   QB     
        1    599   1   .   2   .   .   .   .   .   .    20   GLU   QG     
        1    600   1   .   1   .   .   .   .   .   .    45   GLU   QB     
        1    600   1   .   2   .   .   .   .   .   .    45   GLU   QG     
        1    601   1   .   1   .   .   .   .   .   .    61   VAL   HB     
        1    601   1   .   2   .   .   .   .   .   .    62   VAL   H      
        1    602   1   .   1   .   .   .   .   .   .    61   VAL   HB     
        1    602   1   .   2   .   .   .   .   .   .    64   ALA   QB     
        1    603   1   .   1   .   .   .   .   .   .    50   GLU   QG     
        1    603   1   .   2   .   .   .   .   .   .    51   LEU   H      
        1    604   1   .   1   .   .   .   .   .   .    49   LYS   QE     
        1    604   1   .   2   .   .   .   .   .   .    50   GLU   QG     
        1    605   1   .   1   .   .   .   .   .   .    49   LYS   QB     
        1    605   1   .   2   .   .   .   .   .   .    50   GLU   QG     
        1    606   1   .   1   .   .   .   .   .   .    92   GLU   QG     
        1    606   1   .   2   .   .   .   .   .   .    96   LEU   HG     
        1    607   1   .   1   .   .   .   .   .   .    85   LEU   QQD    
        1    607   1   .   2   .   .   .   .   .   .    86   GLU   QG     
        1    608   1   .   1   .   .   .   .   .   .    49   LYS   QD     
        1    608   1   .   2   .   .   .   .   .   .   117   GLN   QG     
        1    609   1   .   1   .   .   .   .   .   .    74   GLU   H      
        1    609   1   .   2   .   .   .   .   .   .    74   GLU   QG     
        1    610   1   .   1   .   .   .   .   .   .    74   GLU   QG     
        1    610   1   .   2   .   .   .   .   .   .    75   ARG   H      
        1    611   1   .   1   .   .   .   .   .   .    74   GLU   HA     
        1    611   1   .   2   .   .   .   .   .   .    74   GLU   QG     
        1    612   1   .   1   .   .   .   .   .   .    74   GLU   QB     
        1    612   1   .   2   .   .   .   .   .   .    74   GLU   QG     
        1    613   1   .   1   .   .   .   .   .   .    73   LEU   QQD    
        1    613   1   .   2   .   .   .   .   .   .    74   GLU   QG     
        1    614   1   .   1   .   .   .   .   .   .   108   GLU   QB     
        1    614   1   .   2   .   .   .   .   .   .   112   LYS   QD     
        1    615   1   .   1   .   .   .   .   .   .    21   GLN   H      
        1    615   1   .   2   .   .   .   .   .   .    21   GLN   QG     
        1    616   1   .   1   .   .   .   .   .   .   115   GLN   QB     
        1    616   1   .   2   .   .   .   .   .   .   115   GLN   QG     
        1    617   1   .   1   .   .   .   .   .   .   109   GLN   QG     
        1    617   1   .   2   .   .   .   .   .   .   112   LYS   QD     
        1    618   1   .   1   .   .   .   .   .   .   115   GLN   QG     
        1    618   1   .   2   .   .   .   .   .   .   116   THR   QG2    
        1    619   1   .   1   .   .   .   .   .   .   115   GLN   H      
        1    619   1   .   2   .   .   .   .   .   .   115   GLN   QG     
        1    620   1   .   1   .   .   .   .   .   .   115   GLN   HA     
        1    620   1   .   2   .   .   .   .   .   .   115   GLN   QG     
        1    621   1   .   1   .   .   .   .   .   .    21   GLN   QB     
        1    621   1   .   2   .   .   .   .   .   .    21   GLN   QG     
        1    622   1   .   1   .   .   .   .   .   .    94   GLN   QG     
        1    622   1   .   2   .   .   .   .   .   .    98   LYS   QG     
        1    623   1   .   1   .   .   .   .   .   .    70   GLN   H      
        1    623   1   .   2   .   .   .   .   .   .    70   GLN   QG     
        1    624   1   .   1   .   .   .   .   .   .    32   GLN   H      
        1    624   1   .   2   .   .   .   .   .   .    32   GLN   QG     
        1    625   1   .   1   .   .   .   .   .   .    32   GLN   HA     
        1    625   1   .   2   .   .   .   .   .   .    32   GLN   QG     
        1    626   1   .   1   .   .   .   .   .   .    70   GLN   HA     
        1    626   1   .   2   .   .   .   .   .   .    70   GLN   QG     
        1    627   1   .   1   .   .   .   .   .   .    66   ILE   QG1    
        1    627   1   .   2   .   .   .   .   .   .    70   GLN   QG     
        1    628   1   .   1   .   .   .   .   .   .    69   ALA   QB     
        1    628   1   .   2   .   .   .   .   .   .    70   GLN   QG     
        1    629   1   .   1   .   .   .   .   .   .    30   GLU   H      
        1    629   1   .   2   .   .   .   .   .   .    30   GLU   QG     
        1    630   1   .   1   .   .   .   .   .   .    53   GLU   H      
        1    630   1   .   2   .   .   .   .   .   .    53   GLU   QG     
        1    631   1   .   1   .   .   .   .   .   .   106   GLU   QG     
        1    631   1   .   2   .   .   .   .   .   .   107   THR   H      
        1    632   1   .   1   .   .   .   .   .   .    24   HIS   HA     
        1    632   1   .   2   .   .   .   .   .   .    27   GLU   QG     
        1    633   1   .   1   .   .   .   .   .   .   103   ASP   HA     
        1    633   1   .   2   .   .   .   .   .   .   106   GLU   QG     
        1    634   1   .   1   .   .   .   .   .   .   106   GLU   HA     
        1    634   1   .   2   .   .   .   .   .   .   106   GLU   QG     
        1    635   1   .   1   .   .   .   .   .   .    53   GLU   HA     
        1    635   1   .   2   .   .   .   .   .   .    53   GLU   QG     
        1    636   1   .   1   .   .   .   .   .   .   106   GLU   QG     
        1    636   1   .   2   .   .   .   .   .   .   110   LYS   QE     
        1    637   1   .   1   .   .   .   .   .   .   106   GLU   QB     
        1    637   1   .   2   .   .   .   .   .   .   106   GLU   QG     
        1    638   1   .   1   .   .   .   .   .   .    30   GLU   QG     
        1    638   1   .   2   .   .   .   .   .   .    34   LEU   QQD    
        1    639   1   .   1   .   .   .   .   .   .     7   LYS   QD     
        1    639   1   .   2   .   .   .   .   .   .     8   ASP   QB     
        1    640   1   .   1   .   .   .   .   .   .    67   GLU   H      
        1    640   1   .   2   .   .   .   .   .   .    67   GLU   QG     
        1    641   1   .   1   .   .   .   .   .   .    67   GLU   HA     
        1    641   1   .   2   .   .   .   .   .   .    67   GLU   QG     
        1    642   1   .   1   .   .   .   .   .   .    66   ILE   QG2    
        1    642   1   .   2   .   .   .   .   .   .    67   GLU   QG     
        1    643   1   .   1   .   .   .   .   .   .    58   GLU   HA     
        1    643   1   .   2   .   .   .   .   .   .    58   GLU   QG     
        1    644   1   .   1   .   .   .   .   .   .    58   GLU   QG     
        1    644   1   .   2   .   .   .   .   .   .    61   VAL   QG1    
        1    645   1   .   1   .   .   .   .   .   .    58   GLU   QG     
        1    645   1   .   2   .   .   .   .   .   .    61   VAL   QG2    
        1    646   1   .   1   .   .   .   .   .   .   100   LEU   HA     
        1    646   1   .   2   .   .   .   .   .   .   103   ASP   HB3    
        1    647   1   .   1   .   .   .   .   .   .    33   LEU   QD1    
        1    647   1   .   2   .   .   .   .   .   .   103   ASP   HB3    
        1    648   1   .   1   .   .   .   .   .   .   113   ASP   QB     
        1    648   1   .   2   .   .   .   .   .   .   114   ILE   HA     
        1    649   1   .   1   .   .   .   .   .   .   113   ASP   QB     
        1    649   1   .   2   .   .   .   .   .   .   114   ILE   HB     
        1    650   1   .   1   .   .   .   .   .   .    60   ASP   H      
        1    650   1   .   2   .   .   .   .   .   .    60   ASP   HB3    
        1    651   1   .   1   .   .   .   .   .   .    60   ASP   HB3    
        1    651   1   .   2   .   .   .   .   .   .    61   VAL   H      
        1    652   1   .   1   .   .   .   .   .   .    57   ARG   HA     
        1    652   1   .   2   .   .   .   .   .   .    60   ASP   HB3    
        1    653   1   .   1   .   .   .   .   .   .    44   ASN   H      
        1    653   1   .   2   .   .   .   .   .   .    44   ASN   HB3    
        1    654   1   .   1   .   .   .   .   .   .    44   ASN   HB3    
        1    654   1   .   2   .   .   .   .   .   .    45   GLU   H      
        1    655   1   .   1   .   .   .   .   .   .    44   ASN   HB3    
        1    655   1   .   2   .   .   .   .   .   .   114   ILE   QD1    
        1    656   1   .   1   .   .   .   .   .   .    83   ASN   HB2    
        1    656   1   .   2   .   .   .   .   .   .    86   GLU   QB     
        1    657   1   .   1   .   .   .   .   .   .    82   LEU   HA     
        1    657   1   .   2   .   .   .   .   .   .    83   ASN   HB2    
        1    658   1   .   1   .   .   .   .   .   .   109   GLN   H      
        1    658   1   .   2   .   .   .   .   .   .   112   LYS   QE     
        1    659   1   .   1   .   .   .   .   .   .   109   GLN   QG     
        1    659   1   .   2   .   .   .   .   .   .   112   LYS   QE     
        1    660   1   .   1   .   .   .   .   .   .   109   GLN   QB     
        1    660   1   .   2   .   .   .   .   .   .   112   LYS   QE     
        1    661   1   .   1   .   .   .   .   .   .   112   LYS   QB     
        1    661   1   .   2   .   .   .   .   .   .   112   LYS   QE     
        1    662   1   .   1   .   .   .   .   .   .   112   LYS   QD     
        1    662   1   .   2   .   .   .   .   .   .   112   LYS   QE     
        1    663   1   .   1   .   .   .   .   .   .   112   LYS   QG     
        1    663   1   .   2   .   .   .   .   .   .   112   LYS   QE     
        1    664   1   .   1   .   .   .   .   .   .    60   ASP   HB2    
        1    664   1   .   2   .   .   .   .   .   .    61   VAL   H      
        1    665   1   .   1   .   .   .   .   .   .    78   LYS   HA     
        1    665   1   .   2   .   .   .   .   .   .    78   LYS   QE     
        1    666   1   .   1   .   .   .   .   .   .    79   ARG   HA     
        1    666   1   .   2   .   .   .   .   .   .    79   ARG   QD     
        1    667   1   .   1   .   .   .   .   .   .    99   ILE   QG2    
        1    667   1   .   2   .   .   .   .   .   .   102   LYS   QE     
        1    668   1   .   1   .   .   .   .   .   .    48   SER   HA     
        1    668   1   .   2   .   .   .   .   .   .    49   LYS   QE     
        1    669   1   .   1   .   .   .   .   .   .    54   LYS   QB     
        1    669   1   .   2   .   .   .   .   .   .    54   LYS   QE     
        1    670   1   .   1   .   .   .   .   .   .    49   LYS   QE     
        1    670   1   .   2   .   .   .   .   .   .    50   GLU   H      
        1    671   1   .   1   .   .   .   .   .   .   102   LYS   H      
        1    671   1   .   2   .   .   .   .   .   .   102   LYS   QE     
        1    672   1   .   1   .   .   .   .   .   .     6   LYS   HA     
        1    672   1   .   2   .   .   .   .   .   .     6   LYS   QE     
        1    673   1   .   1   .   .   .   .   .   .    48   SER   QB     
        1    673   1   .   2   .   .   .   .   .   .    49   LYS   QE     
        1    674   1   .   1   .   .   .   .   .   .    49   LYS   QG     
        1    674   1   .   2   .   .   .   .   .   .    49   LYS   QE     
        1    675   1   .   1   .   .   .   .   .   .    99   ILE   HA     
        1    675   1   .   2   .   .   .   .   .   .   102   LYS   QE     
        1    676   1   .   1   .   .   .   .   .   .    47   LYS   H      
        1    676   1   .   2   .   .   .   .   .   .    47   LYS   QE     
        1    677   1   .   1   .   .   .   .   .   .    44   ASN   HA     
        1    677   1   .   2   .   .   .   .   .   .    47   LYS   QE     
        1    678   1   .   1   .   .   .   .   .   .    47   LYS   HA     
        1    678   1   .   2   .   .   .   .   .   .    47   LYS   QE     
        1    679   1   .   1   .   .   .   .   .   .    47   LYS   QE     
        1    679   1   .   2   .   .   .   .   .   .   114   ILE   QG1    
        1    680   1   .   1   .   .   .   .   .   .    47   LYS   QG     
        1    680   1   .   2   .   .   .   .   .   .    47   LYS   QE     
        1    681   1   .   1   .   .   .   .   .   .    47   LYS   QE     
        1    681   1   .   2   .   .   .   .   .   .   114   ILE   QG2    
        1    682   1   .   1   .   .   .   .   .   .    11   ARG   HA     
        1    682   1   .   2   .   .   .   .   .   .    11   ARG   QD     
        1    683   1   .   1   .   .   .   .   .   .    11   ARG   QB     
        1    683   1   .   2   .   .   .   .   .   .    11   ARG   QD     
        1    684   1   .   1   .   .   .   .   .   .    24   HIS   QB     
        1    684   1   .   2   .   .   .   .   .   .    25   ALA   HA     
        1    685   1   .   1   .   .   .   .   .   .    31   HIS   QB     
        1    685   1   .   2   .   .   .   .   .   .    32   GLN   QG     
        1    686   1   .   1   .   .   .   .   .   .    24   HIS   QB     
        1    686   1   .   2   .   .   .   .   .   .    27   GLU   QB     
        1    687   1   .   1   .   .   .   .   .   .    57   ARG   H      
        1    687   1   .   2   .   .   .   .   .   .    57   ARG   QD     
        1    688   1   .   1   .   .   .   .   .   .    57   ARG   HA     
        1    688   1   .   2   .   .   .   .   .   .    57   ARG   QD     
        1    689   1   .   1   .   .   .   .   .   .    54   LYS   HA     
        1    689   1   .   2   .   .   .   .   .   .    57   ARG   QD     
        1    690   1   .   1   .   .   .   .   .   .    75   ARG   QB     
        1    690   1   .   2   .   .   .   .   .   .    75   ARG   QD     
        1    691   1   .   1   .   .   .   .   .   .    87   ARG   H      
        1    691   1   .   2   .   .   .   .   .   .    88   PHE   QB     
        1    692   1   .   1   .   .   .   .   .   .    85   LEU   QB     
        1    692   1   .   2   .   .   .   .   .   .    88   PHE   QB     
        1    693   1   .   1   .   .   .   .   .   .    84   ILE   QG2    
        1    693   1   .   2   .   .   .   .   .   .    88   PHE   QB     
        1    694   1   .   1   .   .   .   .   .   .    85   LEU   QQD    
        1    694   1   .   2   .   .   .   .   .   .    88   PHE   QB     
        1    695   1   .   1   .   .   .   .   .   .    25   ALA   QB     
        1    695   1   .   2   .   .   .   .   .   .    26   ILE   HA     
        1    696   1   .   1   .   .   .   .   .   .    26   ILE   HA     
        1    696   1   .   2   .   .   .   .   .   .    26   ILE   QG2    
        1    697   1   .   1   .   .   .   .   .   .   111   VAL   HA     
        1    697   1   .   2   .   .   .   .   .   .   114   ILE   HB     
        1    698   1   .   1   .   .   .   .   .   .   111   VAL   HA     
        1    698   1   .   2   .   .   .   .   .   .   111   VAL   QG2    
        1    699   1   .   1   .   .   .   .   .   .   108   GLU   HA     
        1    699   1   .   2   .   .   .   .   .   .   111   VAL   H      
        1    700   1   .   1   .   .   .   .   .   .   107   THR   HB     
        1    700   1   .   2   .   .   .   .   .   .   108   GLU   HA     
        1    701   1   .   1   .   .   .   .   .   .   108   GLU   HA     
        1    701   1   .   2   .   .   .   .   .   .   112   LYS   QB     
        1    702   1   .   1   .   .   .   .   .   .    59   LEU   HG     
        1    702   1   .   2   .   .   .   .   .   .   108   GLU   HA     
        1    703   1   .   1   .   .   .   .   .   .   108   GLU   HA     
        1    703   1   .   2   .   .   .   .   .   .   112   LYS   QD     
        1    704   1   .   1   .   .   .   .   .   .     4   LYS   HA     
        1    704   1   .   2   .   .   .   .   .   .     5   PRO   HD3    
        1    705   1   .   1   .   .   .   .   .   .    55   ILE   HA     
        1    705   1   .   2   .   .   .   .   .   .    58   GLU   QB     
        1    706   1   .   1   .   .   .   .   .   .    99   ILE   HA     
        1    706   1   .   2   .   .   .   .   .   .    99   ILE   HG12   
        1    707   1   .   1   .   .   .   .   .   .    99   ILE   HA     
        1    707   1   .   2   .   .   .   .   .   .    99   ILE   HG13   
        1    708   1   .   1   .   .   .   .   .   .    99   ILE   HA     
        1    708   1   .   2   .   .   .   .   .   .    99   ILE   QG2    
        1    709   1   .   1   .   .   .   .   .   .    52   GLN   HA     
        1    709   1   .   2   .   .   .   .   .   .    52   GLN   QG     
        1    710   1   .   1   .   .   .   .   .   .    43   LEU   QD1    
        1    710   1   .   2   .   .   .   .   .   .    52   GLN   HA     
        1    711   1   .   1   .   .   .   .   .   .    43   LEU   QD2    
        1    711   1   .   2   .   .   .   .   .   .    52   GLN   HA     
        1    712   1   .   1   .   .   .   .   .   .    47   LYS   HA     
        1    712   1   .   2   .   .   .   .   .   .   114   ILE   QG1    
        1    713   1   .   1   .   .   .   .   .   .     4   LYS   HA     
        1    713   1   .   2   .   .   .   .   .   .     5   PRO   HD2    
        1    714   1   .   1   .   .   .   .   .   .    86   GLU   HA     
        1    714   1   .   2   .   .   .   .   .   .    89   ASN   H      
        1    715   1   .   1   .   .   .   .   .   .    86   GLU   HA     
        1    715   1   .   2   .   .   .   .   .   .    88   PHE   H      
        1    716   1   .   1   .   .   .   .   .   .    86   GLU   HA     
        1    716   1   .   2   .   .   .   .   .   .    86   GLU   QG     
        1    717   1   .   1   .   .   .   .   .   .    73   LEU   QQD    
        1    717   1   .   2   .   .   .   .   .   .    74   GLU   HA     
        1    718   1   .   1   .   .   .   .   .   .    85   LEU   QQD    
        1    718   1   .   2   .   .   .   .   .   .    86   GLU   HA     
        1    719   1   .   1   .   .   .   .   .   .    61   VAL   HA     
        1    719   1   .   2   .   .   .   .   .   .    65   MET   H      
        1    720   1   .   1   .   .   .   .   .   .    66   ILE   HA     
        1    720   1   .   2   .   .   .   .   .   .    69   ALA   H      
        1    721   1   .   1   .   .   .   .   .   .    66   ILE   HA     
        1    721   1   .   2   .   .   .   .   .   .    67   GLU   HA     
        1    722   1   .   1   .   .   .   .   .   .    65   MET   QG     
        1    722   1   .   2   .   .   .   .   .   .    66   ILE   HA     
        1    723   1   .   1   .   .   .   .   .   .    66   ILE   HA     
        1    723   1   .   2   .   .   .   .   .   .    66   ILE   QG1    
        1    724   1   .   1   .   .   .   .   .   .    74   GLU   HA     
        1    724   1   .   2   .   .   .   .   .   .    77   LEU   H      
        1    725   1   .   1   .   .   .   .   .   .    74   GLU   HA     
        1    725   1   .   2   .   .   .   .   .   .    77   LEU   QB     
        1    726   1   .   1   .   .   .   .   .   .    74   GLU   HA     
        1    726   1   .   2   .   .   .   .   .   .    77   LEU   HG     
        1    727   1   .   1   .   .   .   .   .   .    74   GLU   HA     
        1    727   1   .   2   .   .   .   .   .   .    77   LEU   QQD    
        1    728   1   .   1   .   .   .   .   .   .    92   GLU   QB     
        1    728   1   .   2   .   .   .   .   .   .    95   THR   HB     
        1    729   1   .   1   .   .   .   .   .   .    95   THR   HB     
        1    729   1   .   2   .   .   .   .   .   .    96   LEU   QB     
        1    730   1   .   1   .   .   .   .   .   .    59   LEU   HG     
        1    730   1   .   2   .   .   .   .   .   .   107   THR   HB     
        1    731   1   .   1   .   .   .   .   .   .    95   THR   HB     
        1    731   1   .   2   .   .   .   .   .   .    96   LEU   HG     
        1    732   1   .   1   .   .   .   .   .   .    59   LEU   QD2    
        1    732   1   .   2   .   .   .   .   .   .   107   THR   HB     
        1    733   1   .   1   .   .   .   .   .   .    33   LEU   QD2    
        1    733   1   .   2   .   .   .   .   .   .   107   THR   HB     
        1    734   1   .   1   .   .   .   .   .   .    92   GLU   HA     
        1    734   1   .   2   .   .   .   .   .   .    95   THR   HB     
        1    735   1   .   1   .   .   .   .   .   .    97   SER   H      
        1    735   1   .   2   .   .   .   .   .   .    97   SER   QB     
        1    736   1   .   1   .   .   .   .   .   .   114   ILE   HA     
        1    736   1   .   2   .   .   .   .   .   .   114   ILE   QG1    
        1    737   1   .   1   .   .   .   .   .   .    56   ILE   HA     
        1    737   1   .   2   .   .   .   .   .   .    57   ARG   QD     
        1    738   1   .   1   .   .   .   .   .   .    84   ILE   HA     
        1    738   1   .   2   .   .   .   .   .   .    88   PHE   QB     
        1    739   1   .   1   .   .   .   .   .   .    84   ILE   HA     
        1    739   1   .   2   .   .   .   .   .   .    84   ILE   HG12   
        1    740   1   .   1   .   .   .   .   .   .    62   VAL   HA     
        1    740   1   .   2   .   .   .   .   .   .    65   MET   QG     
        1    741   1   .   1   .   .   .   .   .   .    62   VAL   HA     
        1    741   1   .   2   .   .   .   .   .   .    62   VAL   QG1    
        1    742   1   .   1   .   .   .   .   .   .    62   VAL   HA     
        1    742   1   .   2   .   .   .   .   .   .    62   VAL   QG2    
        1    743   1   .   1   .   .   .   .   .   .   104   LEU   HA     
        1    743   1   .   2   .   .   .   .   .   .   108   GLU   H      
        1    744   1   .   1   .   .   .   .   .   .    37   GLN   HA     
        1    744   1   .   2   .   .   .   .   .   .    37   GLN   HG2    
        1    745   1   .   1   .   .   .   .   .   .   109   GLN   HA     
        1    745   1   .   2   .   .   .   .   .   .   109   GLN   QG     
        1    746   1   .   1   .   .   .   .   .   .    37   GLN   HA     
        1    746   1   .   2   .   .   .   .   .   .    37   GLN   HG3    
        1    747   1   .   1   .   .   .   .   .   .   109   GLN   HA     
        1    747   1   .   2   .   .   .   .   .   .   109   GLN   QB     
        1    748   1   .   1   .   .   .   .   .   .   109   GLN   HA     
        1    748   1   .   2   .   .   .   .   .   .   112   LYS   QB     
        1    749   1   .   1   .   .   .   .   .   .   109   GLN   HA     
        1    749   1   .   2   .   .   .   .   .   .   112   LYS   QD     
        1    750   1   .   1   .   .   .   .   .   .   104   LEU   HA     
        1    750   1   .   2   .   .   .   .   .   .   104   LEU   HG     
        1    751   1   .   1   .   .   .   .   .   .   112   LYS   HA     
        1    751   1   .   2   .   .   .   .   .   .   112   LYS   QG     
        1    752   1   .   1   .   .   .   .   .   .    33   LEU   QD2    
        1    752   1   .   2   .   .   .   .   .   .   104   LEU   HA     
        1    753   1   .   1   .   .   .   .   .   .   104   LEU   HA     
        1    753   1   .   2   .   .   .   .   .   .   104   LEU   QQD    
        1    754   1   .   1   .   .   .   .   .   .    43   LEU   HA     
        1    754   1   .   2   .   .   .   .   .   .    48   SER   QB     
        1    755   1   .   1   .   .   .   .   .   .    48   SER   QB     
        1    755   1   .   2   .   .   .   .   .   .    51   LEU   HA     
        1    756   1   .   1   .   .   .   .   .   .    48   SER   QB     
        1    756   1   .   2   .   .   .   .   .   .    51   LEU   QB     
        1    757   1   .   1   .   .   .   .   .   .    19   ILE   HA     
        1    757   1   .   2   .   .   .   .   .   .    19   ILE   QG2    
        1    758   1   .   1   .   .   .   .   .   .    63   CYS   HA     
        1    758   1   .   2   .   .   .   .   .   .    66   ILE   HB     
        1    759   1   .   1   .   .   .   .   .   .    52   GLN   HA     
        1    759   1   .   2   .   .   .   .   .   .    53   GLU   HA     
        1    760   1   .   1   .   .   .   .   .   .    94   GLN   HA     
        1    760   1   .   2   .   .   .   .   .   .    98   LYS   QE     
        1    761   1   .   1   .   .   .   .   .   .    30   GLU   HA     
        1    761   1   .   2   .   .   .   .   .   .    30   GLU   QG     
        1    762   1   .   1   .   .   .   .   .   .    75   ARG   HA     
        1    762   1   .   2   .   .   .   .   .   .    75   ARG   QG     
        1    763   1   .   1   .   .   .   .   .   .    75   ARG   HA     
        1    763   1   .   2   .   .   .   .   .   .    75   ARG   QD     
        1    764   1   .   1   .   .   .   .   .   .    98   LYS   HA     
        1    764   1   .   2   .   .   .   .   .   .    98   LYS   QG     
        1    765   1   .   1   .   .   .   .   .   .    67   GLU   HB2    
        1    765   1   .   2   .   .   .   .   .   .    68   GLY   QA     
        1    766   1   .   1   .   .   .   .   .   .    97   SER   HA     
        1    766   1   .   2   .   .   .   .   .   .   100   LEU   HG     
        1    767   1   .   1   .   .   .   .   .   .    98   LYS   HA     
        1    767   1   .   2   .   .   .   .   .   .    98   LYS   QB     
        1    768   1   .   1   .   .   .   .   .   .    49   LYS   HA     
        1    768   1   .   2   .   .   .   .   .   .   116   THR   QG2    
        1    769   1   .   1   .   .   .   .   .   .    54   LYS   HA     
        1    769   1   .   2   .   .   .   .   .   .    55   ILE   HA     
        1    770   1   .   1   .   .   .   .   .   .    54   LYS   HA     
        1    770   1   .   2   .   .   .   .   .   .    54   LYS   QE     
        1    771   1   .   1   .   .   .   .   .   .   110   LYS   HA     
        1    771   1   .   2   .   .   .   .   .   .   113   ASP   QB     
        1    772   1   .   1   .   .   .   .   .   .    50   GLU   HA     
        1    772   1   .   2   .   .   .   .   .   .    50   GLU   QB     
        1    773   1   .   1   .   .   .   .   .   .   110   LYS   HA     
        1    773   1   .   2   .   .   .   .   .   .   110   LYS   QG     
        1    774   1   .   1   .   .   .   .   .   .    27   GLU   HA     
        1    774   1   .   2   .   .   .   .   .   .    27   GLU   QB     
        1    775   1   .   1   .   .   .   .   .   .    42   GLU   HA     
        1    775   1   .   2   .   .   .   .   .   .    42   GLU   QB     
        1    776   1   .   1   .   .   .   .   .   .    33   LEU   HA     
        1    776   1   .   2   .   .   .   .   .   .    33   LEU   QD2    
        1    777   1   .   1   .   .   .   .   .   .    25   ALA   HA     
        1    777   1   .   2   .   .   .   .   .   .    28   LYS   QG     
        1    778   1   .   1   .   .   .   .   .   .    28   LYS   HA     
        1    778   1   .   2   .   .   .   .   .   .    31   HIS   QB     
        1    779   1   .   1   .   .   .   .   .   .    95   THR   QG2    
        1    779   1   .   2   .   .   .   .   .   .    96   LEU   HA     
        1    780   1   .   1   .   .   .   .   .   .    22   ALA   HA     
        1    780   1   .   2   .   .   .   .   .   .    24   HIS   H      
        1    781   1   .   1   .   .   .   .   .   .    25   ALA   HA     
        1    781   1   .   2   .   .   .   .   .   .    28   LYS   H      
        1    782   1   .   1   .   .   .   .   .   .    25   ALA   HA     
        1    782   1   .   2   .   .   .   .   .   .    28   LYS   QB     
        1    783   1   .   1   .   .   .   .   .   .    77   LEU   HA     
        1    783   1   .   2   .   .   .   .   .   .    77   LEU   HG     
        1    784   1   .   1   .   .   .   .   .   .    34   LEU   HA     
        1    784   1   .   2   .   .   .   .   .   .    37   GLN   H      
        1    785   1   .   1   .   .   .   .   .   .    96   LEU   HA     
        1    785   1   .   2   .   .   .   .   .   .    96   LEU   QQD    
        1    786   1   .   1   .   .   .   .   .   .   101   LEU   HA     
        1    786   1   .   2   .   .   .   .   .   .   101   LEU   QQD    
        1    787   1   .   1   .   .   .   .   .   .    72   ALA   HA     
        1    787   1   .   2   .   .   .   .   .   .    75   ARG   QB     
        1    788   1   .   1   .   .   .   .   .   .    34   LEU   HA     
        1    788   1   .   2   .   .   .   .   .   .    34   LEU   HG     
        1    789   1   .   1   .   .   .   .   .   .    49   LYS   H      
        1    789   1   .   2   .   .   .   .   .   .   116   THR   HB     
        1    790   1   .   1   .   .   .   .   .   .    48   SER   HA     
        1    790   1   .   2   .   .   .   .   .   .   116   THR   HB     
        1    791   1   .   1   .   .   .   .   .   .    52   GLN   QB     
        1    791   1   .   2   .   .   .   .   .   .   116   THR   HB     
        1    792   1   .   1   .   .   .   .   .   .   106   GLU   HA     
        1    792   1   .   2   .   .   .   .   .   .   106   GLU   QB     
        1    793   1   .   1   .   .   .   .   .   .   106   GLU   HA     
        1    793   1   .   2   .   .   .   .   .   .   109   GLN   QB     
        1    794   1   .   1   .   .   .   .   .   .    21   GLN   HA     
        1    794   1   .   2   .   .   .   .   .   .    21   GLN   QG     
        1    795   1   .   1   .   .   .   .   .   .    57   ARG   HA     
        1    795   1   .   2   .   .   .   .   .   .    60   ASP   H      
        1    796   1   .   1   .   .   .   .   .   .    57   ARG   HA     
        1    796   1   .   2   .   .   .   .   .   .    60   ASP   HB2    
        1    797   1   .   1   .   .   .   .   .   .    85   LEU   HA     
        1    797   1   .   2   .   .   .   .   .   .    87   ARG   H      
        1    798   1   .   1   .   .   .   .   .   .    85   LEU   HA     
        1    798   1   .   2   .   .   .   .   .   .    89   ASN   H      
        1    799   1   .   1   .   .   .   .   .   .    78   LYS   HA     
        1    799   1   .   2   .   .   .   .   .   .    78   LYS   QD     
        1    800   1   .   1   .   .   .   .   .   .    85   LEU   HA     
        1    800   1   .   2   .   .   .   .   .   .    86   GLU   HA     
        1    801   1   .   1   .   .   .   .   .   .    85   LEU   HA     
        1    801   1   .   2   .   .   .   .   .   .    88   PHE   QB     
        1    802   1   .   1   .   .   .   .   .   .    85   LEU   HA     
        1    802   1   .   2   .   .   .   .   .   .    85   LEU   QQD    
        1    803   1   .   1   .   .   .   .   .   .    64   ALA   HA     
        1    803   1   .   2   .   .   .   .   .   .    67   GLU   H      
        1    804   1   .   1   .   .   .   .   .   .    63   CYS   HA     
        1    804   1   .   2   .   .   .   .   .   .    64   ALA   HA     
        1    805   1   .   1   .   .   .   .   .   .    92   GLU   HA     
        1    805   1   .   2   .   .   .   .   .   .    93   ALA   HA     
        1    806   1   .   1   .   .   .   .   .   .    93   ALA   HA     
        1    806   1   .   2   .   .   .   .   .   .    94   GLN   HA     
        1    807   1   .   1   .   .   .   .   .   .    64   ALA   HA     
        1    807   1   .   2   .   .   .   .   .   .    67   GLU   QG     
        1    808   1   .   1   .   .   .   .   .   .    64   ALA   HA     
        1    808   1   .   2   .   .   .   .   .   .    67   GLU   HB2    
        1    809   1   .   1   .   .   .   .   .   .    93   ALA   HA     
        1    809   1   .   2   .   .   .   .   .   .    96   LEU   QQD    
        1    810   1   .   1   .   .   .   .   .   .    51   LEU   HA     
        1    810   1   .   2   .   .   .   .   .   .    53   GLU   H      
        1    811   1   .   1   .   .   .   .   .   .    51   LEU   HA     
        1    811   1   .   2   .   .   .   .   .   .    54   LYS   QG     
        1    812   1   .   1   .   .   .   .   .   .    51   LEU   HA     
        1    812   1   .   2   .   .   .   .   .   .    55   ILE   QD1    
        1    813   1   .   1   .   .   .   .   .   .   100   LEU   HA     
        1    813   1   .   2   .   .   .   .   .   .   104   LEU   H      
        1    814   1   .   1   .   .   .   .   .   .    45   GLU   HA     
        1    814   1   .   2   .   .   .   .   .   .    45   GLU   QG     
        1    815   1   .   1   .   .   .   .   .   .   100   LEU   HA     
        1    815   1   .   2   .   .   .   .   .   .   100   LEU   QQD    
        1    816   1   .   1   .   .   .   .   .   .    32   GLN   HA     
        1    816   1   .   2   .   .   .   .   .   .    35   TYR   H      
        1    817   1   .   1   .   .   .   .   .   .     6   LYS   HA     
        1    817   1   .   2   .   .   .   .   .   .     6   LYS   QG     
        1    818   1   .   1   .   .   .   .   .   .    44   ASN   HA     
        1    818   1   .   2   .   .   .   .   .   .   114   ILE   QD1    
        1    819   1   .   1   .   .   .   .   .   .    32   GLN   HA     
        1    819   1   .   2   .   .   .   .   .   .    35   TYR   QB     
        1    820   1   .   1   .   .   .   .   .   .   116   THR   HB     
        1    820   1   .   2   .   .   .   .   .   .   117   GLN   HA     
        1    821   1   .   1   .   .   .   .   .   .   117   GLN   HA     
        1    821   1   .   2   .   .   .   .   .   .   117   GLN   QG     
        1    822   1   .   1   .   .   .   .   .   .    49   LYS   QB     
        1    822   1   .   2   .   .   .   .   .   .   117   GLN   HA     
        1    823   1   .   1   .   .   .   .   .   .    30   GLU   HA     
        1    823   1   .   2   .   .   .   .   .   .    31   HIS   HA     
        1    824   1   .   1   .   .   .   .   .   .    31   HIS   HA     
        1    824   1   .   2   .   .   .   .   .   .    34   LEU   HG     
        1    825   1   .   1   .   .   .   .   .   .    92   GLU   HA     
        1    825   1   .   2   .   .   .   .   .   .    95   THR   HA     
        1    826   1   .   1   .   .   .   .   .   .    95   THR   HA     
        1    826   1   .   2   .   .   .   .   .   .    98   LYS   QD     
        1    827   1   .   1   .   .   .   .   .   .    95   THR   HA     
        1    827   1   .   2   .   .   .   .   .   .    95   THR   QG2    
        1    828   1   .   1   .   .   .   .   .   .    95   THR   HA     
        1    828   1   .   2   .   .   .   .   .   .    99   ILE   QD1    
        1    829   1   .   1   .   .   .   .   .   .    88   PHE   QB     
        1    829   1   .   2   .   .   .   .   .   .    89   ASN   HA     
        1    830   1   .   1   .   .   .   .   .   .    89   ASN   HA     
        1    830   1   .   2   .   .   .   .   .   .    92   GLU   QB     
        1    831   1   .   1   .   .   .   .   .   .    60   ASP   HA     
        1    831   1   .   2   .   .   .   .   .   .    63   CYS   H      
        1    832   1   .   1   .   .   .   .   .   .    42   GLU   HA     
        1    832   1   .   2   .   .   .   .   .   .    43   LEU   HA     
        1    833   1   .   1   .   .   .   .   .   .    43   LEU   HA     
        1    833   1   .   2   .   .   .   .   .   .    51   LEU   HG     
        1    834   1   .   1   .   .   .   .   .   .    43   LEU   HA     
        1    834   1   .   2   .   .   .   .   .   .    43   LEU   QD1    
        1    835   1   .   1   .   .   .   .   .   .    43   LEU   HA     
        1    835   1   .   2   .   .   .   .   .   .    43   LEU   QD2    
        1    836   1   .   1   .   .   .   .   .   .    43   LEU   HA     
        1    836   1   .   2   .   .   .   .   .   .    55   ILE   QD1    
        1    837   1   .   1   .   .   .   .   .   .     8   ASP   HA     
        1    837   1   .   2   .   .   .   .   .   .     8   ASP   QB     
        1    838   1   .   1   .   .   .   .   .   .    82   LEU   HA     
        1    838   1   .   2   .   .   .   .   .   .    82   LEU   HG     
        1    839   1   .   1   .   .   .   .   .   .    82   LEU   HA     
        1    839   1   .   2   .   .   .   .   .   .    82   LEU   QQD    
        1    840   1   .   1   .   .   .   .   .   .    24   HIS   HA     
        1    840   1   .   2   .   .   .   .   .   .    28   LYS   H      
        1    841   1   .   1   .   .   .   .   .   .    24   HIS   HA     
        1    841   1   .   2   .   .   .   .   .   .    27   GLU   QB     
        1    842   1   .   1   .   .   .   .   .   .    33   LEU   QD1    
        1    842   1   .   2   .   .   .   .   .   .   103   ASP   HA     
        1    843   1   .   1   .   .   .   .   .   .    33   LEU   QD2    
        1    843   1   .   2   .   .   .   .   .   .   103   ASP   HA     
        1    844   1   .   1   .   .   .   .   .   .   112   LYS   QB     
        1    844   1   .   2   .   .   .   .   .   .   113   ASP   HA     
        1    845   1   .   1   .   .   .   .   .   .   113   ASP   HA     
        1    845   1   .   2   .   .   .   .   .   .   114   ILE   QD1    
        1    846   1   .   1   .   .   .   .   .   .    38   HIS   HA     
        1    846   1   .   2   .   .   .   .   .   .    38   HIS   HE1    
        1    847   1   .   1   .   .   .   .   .   .     4   LYS   HA     
        1    847   1   .   2   .   .   .   .   .   .     4   LYS   QD     
        1    848   1   .   1   .   .   .   .   .   .    52   GLN   H      
        1    848   1   .   2   .   .   .   .   .   .    55   ILE   QD1    
        1    849   1   .   1   .   .   .   .   .   .    55   ILE   QD1    
        1    849   1   .   2   .   .   .   .   .   .    56   ILE   H      
        1    850   1   .   1   .   .   .   .   .   .    39   GLN   HA     
        1    850   1   .   2   .   .   .   .   .   .    55   ILE   QD1    
        1    851   1   .   1   .   .   .   .   .   .    52   GLN   HA     
        1    851   1   .   2   .   .   .   .   .   .    55   ILE   QD1    
        1    852   1   .   1   .   .   .   .   .   .    39   GLN   QB     
        1    852   1   .   2   .   .   .   .   .   .    55   ILE   QD1    
        1    853   1   .   1   .   .   .   .   .   .    51   LEU   QD1    
        1    853   1   .   2   .   .   .   .   .   .    55   ILE   QD1    
        1    854   1   .   1   .   .   .   .   .   .    51   LEU   QD2    
        1    854   1   .   2   .   .   .   .   .   .    55   ILE   QD1    
        1    855   1   .   1   .   .   .   .   .   .    40   LEU   H      
        1    855   1   .   2   .   .   .   .   .   .    40   LEU   QD1    
        1    856   1   .   1   .   .   .   .   .   .    33   LEU   QD1    
        1    856   1   .   2   .   .   .   .   .   .   103   ASP   HB2    
        1    857   1   .   1   .   .   .   .   .   .    33   LEU   QB     
        1    857   1   .   2   .   .   .   .   .   .    33   LEU   QD1    
        1    858   1   .   1   .   .   .   .   .   .    59   LEU   H      
        1    858   1   .   2   .   .   .   .   .   .    59   LEU   QD1    
        1    859   1   .   1   .   .   .   .   .   .    59   LEU   QD1    
        1    859   1   .   2   .   .   .   .   .   .   108   GLU   H      
        1    860   1   .   1   .   .   .   .   .   .    59   LEU   QD1    
        1    860   1   .   2   .   .   .   .   .   .    60   ASP   H      
        1    861   1   .   1   .   .   .   .   .   .    59   LEU   QD1    
        1    861   1   .   2   .   .   .   .   .   .   107   THR   HB     
        1    862   1   .   1   .   .   .   .   .   .    59   LEU   QB     
        1    862   1   .   2   .   .   .   .   .   .    59   LEU   QD1    
        1    863   1   .   1   .   .   .   .   .   .    36   LEU   H      
        1    863   1   .   2   .   .   .   .   .   .    36   LEU   HG     
        1    864   1   .   1   .   .   .   .   .   .    59   LEU   QD2    
        1    864   1   .   2   .   .   .   .   .   .   108   GLU   H      
        1    865   1   .   1   .   .   .   .   .   .    59   LEU   QD2    
        1    865   1   .   2   .   .   .   .   .   .    60   ASP   H      
        1    866   1   .   1   .   .   .   .   .   .    59   LEU   QB     
        1    866   1   .   2   .   .   .   .   .   .    59   LEU   QD2    
        1    867   1   .   1   .   .   .   .   .   .    62   VAL   QG2    
        1    867   1   .   2   .   .   .   .   .   .    63   CYS   H      
        1    868   1   .   1   .   .   .   .   .   .    51   LEU   H      
        1    868   1   .   2   .   .   .   .   .   .    51   LEU   QD1    
        1    869   1   .   1   .   .   .   .   .   .    51   LEU   HA     
        1    869   1   .   2   .   .   .   .   .   .    51   LEU   QD1    
        1    870   1   .   1   .   .   .   .   .   .    59   LEU   HG     
        1    870   1   .   2   .   .   .   .   .   .    63   CYS   H      
        1    871   1   .   1   .   .   .   .   .   .    57   ARG   H      
        1    871   1   .   2   .   .   .   .   .   .    57   ARG   HG2    
        1    872   1   .   1   .   .   .   .   .   .    39   GLN   QG     
        1    872   1   .   2   .   .   .   .   .   .    40   LEU   H      
        1    873   1   .   1   .   .   .   .   .   .    36   LEU   HA     
        1    873   1   .   2   .   .   .   .   .   .    39   GLN   QG     
        1    874   1   .   1   .   .   .   .   .   .    39   GLN   QG     
        1    874   1   .   2   .   .   .   .   .   .    55   ILE   QG1    
        1    875   1   .   1   .   .   .   .   .   .    36   LEU   QQD    
        1    875   1   .   2   .   .   .   .   .   .    39   GLN   QG     
        1    876   1   .   1   .   .   .   .   .   .    39   GLN   QG     
        1    876   1   .   2   .   .   .   .   .   .    55   ILE   QD1    
        1    877   1   .   1   .   .   .   .   .   .    91   GLU   HA     
        1    877   1   .   2   .   .   .   .   .   .    91   GLU   QG     
        1    878   1   .   1   .   .   .   .   .   .    20   GLU   QG     
        1    878   1   .   2   .   .   .   .   .   .    21   GLN   H      
        1    879   1   .   1   .   .   .   .   .   .    96   LEU   H      
        1    879   1   .   2   .   .   .   .   .   .    96   LEU   HG     
        1    880   1   .   1   .   .   .   .   .   .    93   ALA   HA     
        1    880   1   .   2   .   .   .   .   .   .    96   LEU   HG     
        1    881   1   .   1   .   .   .   .   .   .    49   LYS   HA     
        1    881   1   .   2   .   .   .   .   .   .   116   THR   HA     
        1    882   1   .   1   .   .   .   .   .   .   115   GLN   QB     
        1    882   1   .   2   .   .   .   .   .   .   116   THR   HA     
        1    883   1   .   1   .   .   .   .   .   .    10   PHE   HA     
        1    883   1   .   2   .   .   .   .   .   .    10   PHE   HD1    
        1    884   1   .   1   .   .   .   .   .   .    10   PHE   HA     
        1    884   1   .   2   .   .   .   .   .   .    10   PHE   QE     
        1    885   1   .   1   .   .   .   .   .   .    10   PHE   HA     
        1    885   1   .   2   .   .   .   .   .   .    10   PHE   HD2    
        1    886   1   .   1   .   .   .   .   .   .    14   PHE   HA     
        1    886   1   .   2   .   .   .   .   .   .    14   PHE   QD     
        1    887   1   .   1   .   .   .   .   .   .    24   HIS   HA     
        1    887   1   .   2   .   .   .   .   .   .    24   HIS   HD2    
        1    888   1   .   1   .   .   .   .   .   .    31   HIS   HA     
        1    888   1   .   2   .   .   .   .   .   .    31   HIS   HD2    
        1    889   1   .   1   .   .   .   .   .   .    35   TYR   HA     
        1    889   1   .   2   .   .   .   .   .   .    35   TYR   QD     
        1    890   1   .   1   .   .   .   .   .   .    38   HIS   HA     
        1    890   1   .   2   .   .   .   .   .   .    38   HIS   HD2    
        1    891   1   .   1   .   .   .   .   .   .    88   PHE   HA     
        1    891   1   .   2   .   .   .   .   .   .    88   PHE   QB     
        1    892   1   .   1   .   .   .   .   .   .    88   PHE   HA     
        1    892   1   .   2   .   .   .   .   .   .    88   PHE   QD     
        1    893   1   .   1   .   .   .   .   .   .    90   TYR   HA     
        1    893   1   .   2   .   .   .   .   .   .    90   TYR   QD     
        1    894   1   .   1   .   .   .   .   .   .    90   TYR   HA     
        1    894   1   .   2   .   .   .   .   .   .    90   TYR   QE     
        1    895   1   .   1   .   .   .   .   .   .    10   PHE   QB     
        1    895   1   .   2   .   .   .   .   .   .    10   PHE   HD1    
        1    896   1   .   1   .   .   .   .   .   .    24   HIS   QB     
        1    896   1   .   2   .   .   .   .   .   .    24   HIS   HD2    
        1    897   1   .   1   .   .   .   .   .   .    31   HIS   QB     
        1    897   1   .   2   .   .   .   .   .   .    31   HIS   HD2    
        1    898   1   .   1   .   .   .   .   .   .    38   HIS   QB     
        1    898   1   .   2   .   .   .   .   .   .    38   HIS   HD2    
        1    899   1   .   1   .   .   .   .   .   .    19   ILE   HA     
        1    899   1   .   2   .   .   .   .   .   .    90   TYR   QD     
        1    900   1   .   1   .   .   .   .   .   .    19   ILE   HA     
        1    900   1   .   2   .   .   .   .   .   .    90   TYR   QE     
        1    901   1   .   1   .   .   .   .   .   .    35   TYR   QE     
        1    901   1   .   2   .   .   .   .   .   .    36   LEU   HA     
        1    902   1   .   1   .   .   .   .   .   .    86   GLU   HA     
        1    902   1   .   2   .   .   .   .   .   .    90   TYR   QE     
        1    903   1   .   1   .   .   .   .   .   .    86   GLU   HA     
        1    903   1   .   2   .   .   .   .   .   .    90   TYR   QD     
        1    904   1   .   1   .   .   .   .   .   .    78   LYS   QE     
        1    904   1   .   2   .   .   .   .   .   .    90   TYR   QD     
        1    905   1   .   1   .   .   .   .   .   .    78   LYS   QE     
        1    905   1   .   2   .   .   .   .   .   .    90   TYR   QE     
        1    906   1   .   1   .   .   .   .   .   .    78   LYS   QG     
        1    906   1   .   2   .   .   .   .   .   .    90   TYR   QD     
        1    907   1   .   1   .   .   .   .   .   .    90   TYR   QD     
        1    907   1   .   2   .   .   .   .   .   .    93   ALA   QB     
        1    908   1   .   1   .   .   .   .   .   .    19   ILE   HB     
        1    908   1   .   2   .   .   .   .   .   .    90   TYR   QE     
        1    909   1   .   1   .   .   .   .   .   .    19   ILE   HG12   
        1    909   1   .   2   .   .   .   .   .   .    90   TYR   QE     
        1    910   1   .   1   .   .   .   .   .   .    19   ILE   HG13   
        1    910   1   .   2   .   .   .   .   .   .    90   TYR   QE     
        1    911   1   .   1   .   .   .   .   .   .    33   LEU   QD1    
        1    911   1   .   2   .   .   .   .   .   .    37   GLN   HE22   
        1    912   1   .   1   .   .   .   .   .   .    40   LEU   QD2    
        1    912   1   .   2   .   .   .   .   .   .    44   ASN   HD22   
        1    913   1   .   1   .   .   .   .   .   .    33   LEU   QD2    
        1    913   1   .   2   .   .   .   .   .   .    37   GLN   HE22   
        1    914   1   .   1   .   .   .   .   .   .    77   LEU   QQD    
        1    914   1   .   2   .   .   .   .   .   .    90   TYR   QD     
        1    915   1   .   1   .   .   .   .   .   .    77   LEU   QQD    
        1    915   1   .   2   .   .   .   .   .   .    90   TYR   QE     
        1    916   1   .   1   .   .   .   .   .   .    19   ILE   QD1    
        1    916   1   .   2   .   .   .   .   .   .    90   TYR   QD     
        1    917   1   .   1   .   .   .   .   .   .    19   ILE   QD1    
        1    917   1   .   2   .   .   .   .   .   .    90   TYR   QE     
        1    918   1   .   1   .   .   .   .   .   .    18   LEU   QQD    
        1    918   1   .   2   .   .   .   .   .   .    90   TYR   QE     
        1    919   1   .   1   .   .   .   .   .   .    78   LYS   QG     
        1    919   1   .   2   .   .   .   .   .   .    90   TYR   QE     
        1    920   1   .   1   .   .   .   .   .   .    18   LEU   QB     
        1    920   1   .   2   .   .   .   .   .   .    90   TYR   QE     
        1    921   1   .   1   .   .   .   .   .   .    86   GLU   QB     
        1    921   1   .   2   .   .   .   .   .   .    90   TYR   QE     
        1    922   1   .   1   .   .   .   .   .   .    78   LYS   QD     
        1    922   1   .   2   .   .   .   .   .   .    90   TYR   QE     
        1    923   1   .   1   .   .   .   .   .   .    78   LYS   QD     
        1    923   1   .   2   .   .   .   .   .   .    90   TYR   QD     
        1    924   1   .   1   .   .   .   .   .   .    19   ILE   QG2    
        1    924   1   .   2   .   .   .   .   .   .    90   TYR   QD     
        1    925   1   .   1   .   .   .   .   .   .    35   TYR   QE     
        1    925   1   .   2   .   .   .   .   .   .    36   LEU   QB     
        1    926   1   .   1   .   .   .   .   .   .    35   TYR   QE     
        1    926   1   .   2   .   .   .   .   .   .    39   GLN   QG     
        1    927   1   .   1   .   .   .   .   .   .    85   LEU   HA     
        1    927   1   .   2   .   .   .   .   .   .    88   PHE   QD     
        1    928   1   .   1   .   .   .   .   .   .    88   PHE   QE     
        1    928   1   .   2   .   .   .   .   .   .    89   ASN   HA     
        1    929   1   .   1   .   .   .   .   .   .    88   PHE   QD     
        1    929   1   .   2   .   .   .   .   .   .    89   ASN   HA     
        1    930   1   .   1   .   .   .   .   .   .    85   LEU   QQD    
        1    930   1   .   2   .   .   .   .   .   .    88   PHE   QD     
        1    931   1   .   1   .   .   .   .   .   .     1   GLN   HA     
        1    931   1   .   2   .   .   .   .   .   .     1   GLN   QE2    
        1    932   1   .   1   .   .   .   .   .   .     1   GLN   QB     
        1    932   1   .   2   .   .   .   .   .   .     1   GLN   QE2    
        1    933   1   .   1   .   .   .   .   .   .     4   LYS   QB     
        1    933   1   .   2   .   .   .   .   .   .     5   PRO   HA     
        1    934   1   .   1   .   .   .   .   .   .     4   LYS   QB     
        1    934   1   .   2   .   .   .   .   .   .     5   PRO   QG     
        1    935   1   .   1   .   .   .   .   .   .     4   LYS   QB     
        1    935   1   .   2   .   .   .   .   .   .     5   PRO   QD     
        1    936   1   .   1   .   .   .   .   .   .     4   LYS   QG     
        1    936   1   .   2   .   .   .   .   .   .     5   PRO   QD     
        1    937   1   .   1   .   .   .   .   .   .    12   ASN   HA     
        1    937   1   .   2   .   .   .   .   .   .    12   ASN   QD2    
        1    938   1   .   1   .   .   .   .   .   .    19   ILE   HG13   
        1    938   1   .   2   .   .   .   .   .   .    89   ASN   QB     
        1    939   1   .   1   .   .   .   .   .   .    19   ILE   QD1    
        1    939   1   .   2   .   .   .   .   .   .    89   ASN   QB     
        1    940   1   .   1   .   .   .   .   .   .    29   GLY   QA     
        1    940   1   .   2   .   .   .   .   .   .    32   GLN   QG     
        1    941   1   .   1   .   .   .   .   .   .    29   GLY   QA     
        1    941   1   .   2   .   .   .   .   .   .   100   LEU   QQD    
        1    942   1   .   1   .   .   .   .   .   .    31   HIS   QB     
        1    942   1   .   2   .   .   .   .   .   .    32   GLN   QB     
        1    943   1   .   1   .   .   .   .   .   .    32   GLN   H      
        1    943   1   .   2   .   .   .   .   .   .    32   GLN   QB     
        1    944   1   .   1   .   .   .   .   .   .    32   GLN   QB     
        1    944   1   .   2   .   .   .   .   .   .    32   GLN   QE2    
        1    945   1   .   1   .   .   .   .   .   .    32   GLN   QB     
        1    945   1   .   2   .   .   .   .   .   .    33   LEU   H      
        1    946   1   .   1   .   .   .   .   .   .    32   GLN   QB     
        1    946   1   .   2   .   .   .   .   .   .    62   VAL   QG1    
        1    947   1   .   1   .   .   .   .   .   .    32   GLN   QB     
        1    947   1   .   2   .   .   .   .   .   .    62   VAL   QG2    
        1    948   1   .   1   .   .   .   .   .   .    32   GLN   QE2    
        1    948   1   .   2   .   .   .   .   .   .    36   LEU   HG     
        1    949   1   .   1   .   .   .   .   .   .    32   GLN   QE2    
        1    949   1   .   2   .   .   .   .   .   .    36   LEU   QQD    
        1    950   1   .   1   .   .   .   .   .   .    32   GLN   QE2    
        1    950   1   .   2   .   .   .   .   .   .    62   VAL   HB     
        1    951   1   .   1   .   .   .   .   .   .    32   GLN   QE2    
        1    951   1   .   2   .   .   .   .   .   .    62   VAL   QG1    
        1    952   1   .   1   .   .   .   .   .   .    32   GLN   QE2    
        1    952   1   .   2   .   .   .   .   .   .    62   VAL   QG2    
        1    953   1   .   1   .   .   .   .   .   .    33   LEU   QD1    
        1    953   1   .   2   .   .   .   .   .   .    37   GLN   QB     
        1    954   1   .   1   .   .   .   .   .   .    33   LEU   QD1    
        1    954   1   .   2   .   .   .   .   .   .    37   GLN   QE2    
        1    955   1   .   1   .   .   .   .   .   .    33   LEU   QD2    
        1    955   1   .   2   .   .   .   .   .   .    37   GLN   QB     
        1    956   1   .   1   .   .   .   .   .   .    33   LEU   QD2    
        1    956   1   .   2   .   .   .   .   .   .    37   GLN   QG     
        1    957   1   .   1   .   .   .   .   .   .    33   LEU   QD2    
        1    957   1   .   2   .   .   .   .   .   .    37   GLN   QE2    
        1    958   1   .   1   .   .   .   .   .   .    34   LEU   HA     
        1    958   1   .   2   .   .   .   .   .   .    37   GLN   QB     
        1    959   1   .   1   .   .   .   .   .   .    34   LEU   HA     
        1    959   1   .   2   .   .   .   .   .   .    37   GLN   QG     
        1    960   1   .   1   .   .   .   .   .   .    34   LEU   QQD    
        1    960   1   .   2   .   .   .   .   .   .    37   GLN   QB     
        1    961   1   .   1   .   .   .   .   .   .    37   GLN   H      
        1    961   1   .   2   .   .   .   .   .   .    37   GLN   QG     
        1    962   1   .   1   .   .   .   .   .   .    37   GLN   HA     
        1    962   1   .   2   .   .   .   .   .   .    37   GLN   QG     
        1    963   1   .   1   .   .   .   .   .   .    37   GLN   QB     
        1    963   1   .   2   .   .   .   .   .   .    37   GLN   QE2    
        1    964   1   .   1   .   .   .   .   .   .    37   GLN   QB     
        1    964   1   .   2   .   .   .   .   .   .    38   HIS   H      
        1    965   1   .   1   .   .   .   .   .   .    37   GLN   QE2    
        1    965   1   .   2   .   .   .   .   .   .   103   ASP   HB3    
        1    966   1   .   1   .   .   .   .   .   .    39   GLN   HA     
        1    966   1   .   2   .   .   .   .   .   .    51   LEU   QQD    
        1    967   1   .   1   .   .   .   .   .   .    39   GLN   QB     
        1    967   1   .   2   .   .   .   .   .   .    51   LEU   QQD    
        1    968   1   .   1   .   .   .   .   .   .    39   GLN   QE2    
        1    968   1   .   2   .   .   .   .   .   .    51   LEU   QQD    
        1    969   1   .   1   .   .   .   .   .   .    40   LEU   H      
        1    969   1   .   2   .   .   .   .   .   .    40   LEU   QQD    
        1    970   1   .   1   .   .   .   .   .   .    40   LEU   HA     
        1    970   1   .   2   .   .   .   .   .   .    40   LEU   QQD    
        1    971   1   .   1   .   .   .   .   .   .    40   LEU   HA     
        1    971   1   .   2   .   .   .   .   .   .    43   LEU   QQD    
        1    972   1   .   1   .   .   .   .   .   .    40   LEU   HA     
        1    972   1   .   2   .   .   .   .   .   .    44   ASN   QD2    
        1    973   1   .   1   .   .   .   .   .   .    40   LEU   HG     
        1    973   1   .   2   .   .   .   .   .   .    44   ASN   QD2    
        1    974   1   .   1   .   .   .   .   .   .    40   LEU   QQD    
        1    974   1   .   2   .   .   .   .   .   .    41   ASP   H      
        1    975   1   .   1   .   .   .   .   .   .    40   LEU   QQD    
        1    975   1   .   2   .   .   .   .   .   .    41   ASP   HA     
        1    976   1   .   1   .   .   .   .   .   .    40   LEU   QQD    
        1    976   1   .   2   .   .   .   .   .   .    44   ASN   H      
        1    977   1   .   1   .   .   .   .   .   .    40   LEU   QQD    
        1    977   1   .   2   .   .   .   .   .   .    44   ASN   QB     
        1    978   1   .   1   .   .   .   .   .   .    40   LEU   QQD    
        1    978   1   .   2   .   .   .   .   .   .    44   ASN   QD2    
        1    979   1   .   1   .   .   .   .   .   .    40   LEU   QQD    
        1    979   1   .   2   .   .   .   .   .   .   107   THR   HB     
        1    980   1   .   1   .   .   .   .   .   .    41   ASP   H      
        1    980   1   .   2   .   .   .   .   .   .    41   ASP   QB     
        1    981   1   .   1   .   .   .   .   .   .    41   ASP   QB     
        1    981   1   .   2   .   .   .   .   .   .    42   GLU   H      
        1    982   1   .   1   .   .   .   .   .   .    42   GLU   H      
        1    982   1   .   2   .   .   .   .   .   .    51   LEU   QQD    
        1    983   1   .   1   .   .   .   .   .   .    42   GLU   QB     
        1    983   1   .   2   .   .   .   .   .   .    51   LEU   QQD    
        1    984   1   .   1   .   .   .   .   .   .    42   GLU   QG     
        1    984   1   .   2   .   .   .   .   .   .    46   ASN   QD2    
        1    985   1   .   1   .   .   .   .   .   .    42   GLU   QG     
        1    985   1   .   2   .   .   .   .   .   .    51   LEU   QQD    
        1    986   1   .   1   .   .   .   .   .   .    43   LEU   H      
        1    986   1   .   2   .   .   .   .   .   .    51   LEU   QQD    
        1    987   1   .   1   .   .   .   .   .   .    43   LEU   HA     
        1    987   1   .   2   .   .   .   .   .   .    43   LEU   QQD    
        1    988   1   .   1   .   .   .   .   .   .    43   LEU   HA     
        1    988   1   .   2   .   .   .   .   .   .    46   ASN   QB     
        1    989   1   .   1   .   .   .   .   .   .    43   LEU   HA     
        1    989   1   .   2   .   .   .   .   .   .    51   LEU   QQD    
        1    990   1   .   1   .   .   .   .   .   .    43   LEU   QB     
        1    990   1   .   2   .   .   .   .   .   .    46   ASN   QB     
        1    991   1   .   1   .   .   .   .   .   .    43   LEU   HG     
        1    991   1   .   2   .   .   .   .   .   .    51   LEU   QQD    
        1    992   1   .   1   .   .   .   .   .   .    43   LEU   QQD    
        1    992   1   .   2   .   .   .   .   .   .    44   ASN   H      
        1    993   1   .   1   .   .   .   .   .   .    43   LEU   QQD    
        1    993   1   .   2   .   .   .   .   .   .    44   ASN   QB     
        1    994   1   .   1   .   .   .   .   .   .    43   LEU   QQD    
        1    994   1   .   2   .   .   .   .   .   .    51   LEU   HG     
        1    995   1   .   1   .   .   .   .   .   .    43   LEU   QQD    
        1    995   1   .   2   .   .   .   .   .   .    52   GLN   H      
        1    996   1   .   1   .   .   .   .   .   .    43   LEU   QQD    
        1    996   1   .   2   .   .   .   .   .   .    52   GLN   HA     
        1    997   1   .   1   .   .   .   .   .   .    43   LEU   QQD    
        1    997   1   .   2   .   .   .   .   .   .    52   GLN   QG     
        1    998   1   .   1   .   .   .   .   .   .    43   LEU   QQD    
        1    998   1   .   2   .   .   .   .   .   .   111   VAL   HA     
        1    999   1   .   1   .   .   .   .   .   .    43   LEU   QQD    
        1    999   1   .   2   .   .   .   .   .   .   114   ILE   HB     
        1   1000   1   .   1   .   .   .   .   .   .    43   LEU   QQD    
        1   1000   1   .   2   .   .   .   .   .   .   114   ILE   QG2    
        1   1001   1   .   1   .   .   .   .   .   .    44   ASN   H      
        1   1001   1   .   2   .   .   .   .   .   .    44   ASN   QB     
        1   1002   1   .   1   .   .   .   .   .   .    44   ASN   HA     
        1   1002   1   .   2   .   .   .   .   .   .    47   LYS   QD     
        1   1003   1   .   1   .   .   .   .   .   .    44   ASN   QB     
        1   1003   1   .   2   .   .   .   .   .   .    44   ASN   QD2    
        1   1004   1   .   1   .   .   .   .   .   .    44   ASN   QB     
        1   1004   1   .   2   .   .   .   .   .   .    45   GLU   QB     
        1   1005   1   .   1   .   .   .   .   .   .    44   ASN   QB     
        1   1005   1   .   2   .   .   .   .   .   .   114   ILE   QD1    
        1   1006   1   .   1   .   .   .   .   .   .    44   ASN   QD2    
        1   1006   1   .   2   .   .   .   .   .   .   114   ILE   QD1    
        1   1007   1   .   1   .   .   .   .   .   .    45   GLU   H      
        1   1007   1   .   2   .   .   .   .   .   .    46   ASN   QB     
        1   1008   1   .   1   .   .   .   .   .   .    46   ASN   H      
        1   1008   1   .   2   .   .   .   .   .   .    46   ASN   QB     
        1   1009   1   .   1   .   .   .   .   .   .    46   ASN   QB     
        1   1009   1   .   2   .   .   .   .   .   .    46   ASN   QD2    
        1   1010   1   .   1   .   .   .   .   .   .    46   ASN   QD2    
        1   1010   1   .   2   .   .   .   .   .   .    51   LEU   QQD    
        1   1011   1   .   1   .   .   .   .   .   .    47   LYS   QB     
        1   1011   1   .   2   .   .   .   .   .   .    47   LYS   QD     
        1   1012   1   .   1   .   .   .   .   .   .    47   LYS   QD     
        1   1012   1   .   2   .   .   .   .   .   .   114   ILE   HA     
        1   1013   1   .   1   .   .   .   .   .   .    47   LYS   QD     
        1   1013   1   .   2   .   .   .   .   .   .   114   ILE   QG2    
        1   1014   1   .   1   .   .   .   .   .   .    47   LYS   QD     
        1   1014   1   .   2   .   .   .   .   .   .   114   ILE   QD1    
        1   1015   1   .   1   .   .   .   .   .   .    47   LYS   QD     
        1   1015   1   .   2   .   .   .   .   .   .   115   GLN   H      
        1   1016   1   .   1   .   .   .   .   .   .    47   LYS   QD     
        1   1016   1   .   2   .   .   .   .   .   .   116   THR   QG2    
        1   1017   1   .   1   .   .   .   .   .   .    48   SER   H      
        1   1017   1   .   2   .   .   .   .   .   .    51   LEU   QQD    
        1   1018   1   .   1   .   .   .   .   .   .    48   SER   QB     
        1   1018   1   .   2   .   .   .   .   .   .    51   LEU   QQD    
        1   1019   1   .   1   .   .   .   .   .   .    49   LYS   QB     
        1   1019   1   .   2   .   .   .   .   .   .   117   GLN   QB     
        1   1020   1   .   1   .   .   .   .   .   .    49   LYS   QD     
        1   1020   1   .   2   .   .   .   .   .   .   117   GLN   QB     
        1   1021   1   .   1   .   .   .   .   .   .    51   LEU   H      
        1   1021   1   .   2   .   .   .   .   .   .    51   LEU   QQD    
        1   1022   1   .   1   .   .   .   .   .   .    51   LEU   HA     
        1   1022   1   .   2   .   .   .   .   .   .    51   LEU   QQD    
        1   1023   1   .   1   .   .   .   .   .   .    51   LEU   QQD    
        1   1023   1   .   2   .   .   .   .   .   .    52   GLN   H      
        1   1024   1   .   1   .   .   .   .   .   .    51   LEU   QQD    
        1   1024   1   .   2   .   .   .   .   .   .    54   LYS   H      
        1   1025   1   .   1   .   .   .   .   .   .    51   LEU   QQD    
        1   1025   1   .   2   .   .   .   .   .   .    54   LYS   QB     
        1   1026   1   .   1   .   .   .   .   .   .    51   LEU   QQD    
        1   1026   1   .   2   .   .   .   .   .   .    54   LYS   QG     
        1   1027   1   .   1   .   .   .   .   .   .    51   LEU   QQD    
        1   1027   1   .   2   .   .   .   .   .   .    55   ILE   H      
        1   1028   1   .   1   .   .   .   .   .   .    51   LEU   QQD    
        1   1028   1   .   2   .   .   .   .   .   .    55   ILE   HB     
        1   1029   1   .   1   .   .   .   .   .   .    51   LEU   QQD    
        1   1029   1   .   2   .   .   .   .   .   .    55   ILE   QD1    
        1   1030   1   .   1   .   .   .   .   .   .    52   GLN   HA     
        1   1030   1   .   2   .   .   .   .   .   .   111   VAL   QQG    
        1   1031   1   .   1   .   .   .   .   .   .    52   GLN   QB     
        1   1031   1   .   2   .   .   .   .   .   .    52   GLN   QE2    
        1   1032   1   .   1   .   .   .   .   .   .    52   GLN   QE2    
        1   1032   1   .   2   .   .   .   .   .   .   116   THR   QG2    
        1   1033   1   .   1   .   .   .   .   .   .    53   GLU   QB     
        1   1033   1   .   2   .   .   .   .   .   .    54   LYS   H      
        1   1034   1   .   1   .   .   .   .   .   .    53   GLU   QB     
        1   1034   1   .   2   .   .   .   .   .   .    54   LYS   QG     
        1   1035   1   .   1   .   .   .   .   .   .    56   ILE   QG2    
        1   1035   1   .   2   .   .   .   .   .   .    60   ASP   QB     
        1   1036   1   .   1   .   .   .   .   .   .    57   ARG   HA     
        1   1036   1   .   2   .   .   .   .   .   .    57   ARG   QG     
        1   1037   1   .   1   .   .   .   .   .   .    57   ARG   QB     
        1   1037   1   .   2   .   .   .   .   .   .    58   GLU   H      
        1   1038   1   .   1   .   .   .   .   .   .    57   ARG   QG     
        1   1038   1   .   2   .   .   .   .   .   .    58   GLU   H      
        1   1039   1   .   1   .   .   .   .   .   .    58   GLU   H      
        1   1039   1   .   2   .   .   .   .   .   .    61   VAL   QQG    
        1   1040   1   .   1   .   .   .   .   .   .    58   GLU   HA     
        1   1040   1   .   2   .   .   .   .   .   .    61   VAL   QQG    
        1   1041   1   .   1   .   .   .   .   .   .    58   GLU   QG     
        1   1041   1   .   2   .   .   .   .   .   .    61   VAL   QQG    
        1   1042   1   .   1   .   .   .   .   .   .    59   LEU   H      
        1   1042   1   .   2   .   .   .   .   .   .    59   LEU   QQD    
        1   1043   1   .   1   .   .   .   .   .   .    59   LEU   HA     
        1   1043   1   .   2   .   .   .   .   .   .    59   LEU   QQD    
        1   1044   1   .   1   .   .   .   .   .   .    59   LEU   QB     
        1   1044   1   .   2   .   .   .   .   .   .    59   LEU   QQD    
        1   1045   1   .   1   .   .   .   .   .   .    59   LEU   QQD    
        1   1045   1   .   2   .   .   .   .   .   .    60   ASP   H      
        1   1046   1   .   1   .   .   .   .   .   .    59   LEU   QQD    
        1   1046   1   .   2   .   .   .   .   .   .    60   ASP   HA     
        1   1047   1   .   1   .   .   .   .   .   .    59   LEU   QQD    
        1   1047   1   .   2   .   .   .   .   .   .    62   VAL   H      
        1   1048   1   .   1   .   .   .   .   .   .    59   LEU   QQD    
        1   1048   1   .   2   .   .   .   .   .   .    63   CYS   H      
        1   1049   1   .   1   .   .   .   .   .   .    59   LEU   QQD    
        1   1049   1   .   2   .   .   .   .   .   .   107   THR   H      
        1   1050   1   .   1   .   .   .   .   .   .    59   LEU   QQD    
        1   1050   1   .   2   .   .   .   .   .   .   107   THR   HB     
        1   1051   1   .   1   .   .   .   .   .   .    59   LEU   QQD    
        1   1051   1   .   2   .   .   .   .   .   .   107   THR   QG2    
        1   1052   1   .   1   .   .   .   .   .   .    59   LEU   QQD    
        1   1052   1   .   2   .   .   .   .   .   .   108   GLU   HA     
        1   1053   1   .   1   .   .   .   .   .   .    59   LEU   QQD    
        1   1053   1   .   2   .   .   .   .   .   .   108   GLU   QB     
        1   1054   1   .   1   .   .   .   .   .   .    59   LEU   QQD    
        1   1054   1   .   2   .   .   .   .   .   .   108   GLU   QG     
        1   1055   1   .   1   .   .   .   .   .   .    60   ASP   H      
        1   1055   1   .   2   .   .   .   .   .   .    61   VAL   QQG    
        1   1056   1   .   1   .   .   .   .   .   .    60   ASP   HA     
        1   1056   1   .   2   .   .   .   .   .   .    63   CYS   QB     
        1   1057   1   .   1   .   .   .   .   .   .    60   ASP   QB     
        1   1057   1   .   2   .   .   .   .   .   .    61   VAL   H      
        1   1058   1   .   1   .   .   .   .   .   .    60   ASP   QB     
        1   1058   1   .   2   .   .   .   .   .   .    61   VAL   QQG    
        1   1059   1   .   1   .   .   .   .   .   .    61   VAL   H      
        1   1059   1   .   2   .   .   .   .   .   .    61   VAL   QQG    
        1   1060   1   .   1   .   .   .   .   .   .    61   VAL   HA     
        1   1060   1   .   2   .   .   .   .   .   .    61   VAL   QQG    
        1   1061   1   .   1   .   .   .   .   .   .    61   VAL   QQG    
        1   1061   1   .   2   .   .   .   .   .   .    62   VAL   H      
        1   1062   1   .   1   .   .   .   .   .   .    61   VAL   QQG    
        1   1062   1   .   2   .   .   .   .   .   .    64   ALA   QB     
        1   1063   1   .   1   .   .   .   .   .   .    61   VAL   QQG    
        1   1063   1   .   2   .   .   .   .   .   .    65   MET   H      
        1   1064   1   .   1   .   .   .   .   .   .    61   VAL   QQG    
        1   1064   1   .   2   .   .   .   .   .   .    65   MET   QE     
        1   1065   1   .   1   .   .   .   .   .   .    63   CYS   H      
        1   1065   1   .   2   .   .   .   .   .   .    63   CYS   QB     
        1   1066   1   .   1   .   .   .   .   .   .    63   CYS   QB     
        1   1066   1   .   2   .   .   .   .   .   .    64   ALA   H      
        1   1067   1   .   1   .   .   .   .   .   .    63   CYS   QB     
        1   1067   1   .   2   .   .   .   .   .   .    64   ALA   QB     
        1   1068   1   .   1   .   .   .   .   .   .    66   ILE   QG2    
        1   1068   1   .   2   .   .   .   .   .   .    70   GLN   QE2    
        1   1069   1   .   1   .   .   .   .   .   .    70   GLN   HA     
        1   1069   1   .   2   .   .   .   .   .   .    70   GLN   QE2    
        1   1070   1   .   1   .   .   .   .   .   .    70   GLN   QE2    
        1   1070   1   .   2   .   .   .   .   .   .    74   GLU   QB     
        1   1071   1   .   1   .   .   .   .   .   .    70   GLN   QE2    
        1   1071   1   .   2   .   .   .   .   .   .    74   GLU   QG     
        1   1072   1   .   1   .   .   .   .   .   .    70   GLN   QE2    
        1   1072   1   .   2   .   .   .   .   .   .    98   LYS   HA     
        1   1073   1   .   1   .   .   .   .   .   .    70   GLN   QE2    
        1   1073   1   .   2   .   .   .   .   .   .    98   LYS   QG     
        1   1074   1   .   1   .   .   .   .   .   .    70   GLN   QE2    
        1   1074   1   .   2   .   .   .   .   .   .   101   LEU   HG     
        1   1075   1   .   1   .   .   .   .   .   .    70   GLN   QE2    
        1   1075   1   .   2   .   .   .   .   .   .   101   LEU   QQD    
        1   1076   1   .   1   .   .   .   .   .   .    83   ASN   QD2    
        1   1076   1   .   2   .   .   .   .   .   .    85   LEU   QB     
        1   1077   1   .   1   .   .   .   .   .   .    84   ILE   H      
        1   1077   1   .   2   .   .   .   .   .   .    84   ILE   QG1    
        1   1078   1   .   1   .   .   .   .   .   .    84   ILE   HA     
        1   1078   1   .   2   .   .   .   .   .   .    84   ILE   QG1    
        1   1079   1   .   1   .   .   .   .   .   .    84   ILE   QG2    
        1   1079   1   .   2   .   .   .   .   .   .    84   ILE   QG1    
        1   1080   1   .   1   .   .   .   .   .   .    85   LEU   QQD    
        1   1080   1   .   2   .   .   .   .   .   .    89   ASN   QB     
        1   1081   1   .   1   .   .   .   .   .   .    85   LEU   QQD    
        1   1081   1   .   2   .   .   .   .   .   .    89   ASN   QD2    
        1   1082   1   .   1   .   .   .   .   .   .    86   GLU   HA     
        1   1082   1   .   2   .   .   .   .   .   .    89   ASN   QB     
        1   1083   1   .   1   .   .   .   .   .   .    89   ASN   HA     
        1   1083   1   .   2   .   .   .   .   .   .    89   ASN   QD2    
        1   1084   1   .   1   .   .   .   .   .   .    89   ASN   QB     
        1   1084   1   .   2   .   .   .   .   .   .    90   TYR   H      
        1   1085   1   .   1   .   .   .   .   .   .    95   THR   QG2    
        1   1085   1   .   2   .   .   .   .   .   .    99   ILE   QG1    
        1   1086   1   .   1   .   .   .   .   .   .    99   ILE   H      
        1   1086   1   .   2   .   .   .   .   .   .    99   ILE   QG1    
        1   1087   1   .   1   .   .   .   .   .   .    99   ILE   HA     
        1   1087   1   .   2   .   .   .   .   .   .   102   LYS   QB     
        1   1088   1   .   1   .   .   .   .   .   .    99   ILE   QG2    
        1   1088   1   .   2   .   .   .   .   .   .    99   ILE   QG1    
        1   1089   1   .   1   .   .   .   .   .   .    99   ILE   QG2    
        1   1089   1   .   2   .   .   .   .   .   .   102   LYS   QB     
        1   1090   1   .   1   .   .   .   .   .   .   101   LEU   QB     
        1   1090   1   .   2   .   .   .   .   .   .   102   LYS   QB     
        1   1091   1   .   1   .   .   .   .   .   .   101   LEU   QQD    
        1   1091   1   .   2   .   .   .   .   .   .   102   LYS   QB     
        1   1092   1   .   1   .   .   .   .   .   .   102   LYS   H      
        1   1092   1   .   2   .   .   .   .   .   .   102   LYS   QB     
        1   1093   1   .   1   .   .   .   .   .   .   102   LYS   QB     
        1   1093   1   .   2   .   .   .   .   .   .   102   LYS   QD     
        1   1094   1   .   1   .   .   .   .   .   .   102   LYS   QB     
        1   1094   1   .   2   .   .   .   .   .   .   102   LYS   QE     
        1   1095   1   .   1   .   .   .   .   .   .   102   LYS   QB     
        1   1095   1   .   2   .   .   .   .   .   .   103   ASP   H      
        1   1096   1   .   1   .   .   .   .   .   .   108   GLU   HA     
        1   1096   1   .   2   .   .   .   .   .   .   111   VAL   QQG    
        1   1097   1   .   1   .   .   .   .   .   .   110   LYS   H      
        1   1097   1   .   2   .   .   .   .   .   .   111   VAL   QQG    
        1   1098   1   .   1   .   .   .   .   .   .   110   LYS   QB     
        1   1098   1   .   2   .   .   .   .   .   .   111   VAL   QQG    
        1   1099   1   .   1   .   .   .   .   .   .   111   VAL   HA     
        1   1099   1   .   2   .   .   .   .   .   .   111   VAL   QQG    
        1   1100   1   .   1   .   .   .   .   .   .   111   VAL   QQG    
        1   1100   1   .   2   .   .   .   .   .   .   112   LYS   H      
        1   1101   1   .   1   .   .   .   .   .   .   111   VAL   QQG    
        1   1101   1   .   2   .   .   .   .   .   .   112   LYS   HA     
        1   1102   1   .   1   .   .   .   .   .   .   111   VAL   QQG    
        1   1102   1   .   2   .   .   .   .   .   .   113   ASP   H      
        1   1103   1   .   1   .   .   .   .   .   .   115   GLN   QG     
        1   1103   1   .   2   .   .   .   .   .   .   115   GLN   QE2    
        1   1104   1   .   1   .   .   .   .   .   .   117   GLN   H      
        1   1104   1   .   2   .   .   .   .   .   .   117   GLN   QB     
        1   1105   1   .   1   .   .   .   .   .   .   117   GLN   HA     
        1   1105   1   .   2   .   .   .   .   .   .   117   GLN   QE2    
    stop_


    loop_
        _Dist_constraint_value.Constraints_ID 
        _Dist_constraint_value.Constraint_ID 
        _Dist_constraint_value.Tree_node_ID 
        _Dist_constraint_value.Source_experiment_ID 
        _Dist_constraint_value.Spectral_peak_ID 
        _Dist_constraint_value.Intensity_val 
        _Dist_constraint_value.Intensity_lower_val_err 
        _Dist_constraint_value.Intensity_upper_val_err 
        _Dist_constraint_value.Distance_val 
        _Dist_constraint_value.Distance_lower_bound_val 
        _Dist_constraint_value.Distance_upper_bound_val 
        _Dist_constraint_value.Weight 
        _Dist_constraint_value.Spectral_peak_ppm_1 
        _Dist_constraint_value.Spectral_peak_ppm_2 

        1      1   1   .   .   .   .   .   .   .   4.50   .   .   .   
        1      2   1   .   .   .   .   .   .   .   4.20   .   .   .   
        1      3   1   .   .   .   .   .   .   .   5.46   .   .   .   
        1      4   1   .   .   .   .   .   .   .   4.87   .   .   .   
        1      5   1   .   .   .   .   .   .   .   4.37   .   .   .   
        1      6   1   .   .   .   .   .   .   .   3.76   .   .   .   
        1      7   1   .   .   .   .   .   .   .   3.55   .   .   .   
        1      8   1   .   .   .   .   .   .   .   3.83   .   .   .   
        1      9   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1     10   1   .   .   .   .   .   .   .   3.73   .   .   .   
        1     11   1   .   .   .   .   .   .   .   3.58   .   .   .   
        1     12   1   .   .   .   .   .   .   .   4.28   .   .   .   
        1     13   1   .   .   .   .   .   .   .   3.67   .   .   .   
        1     14   1   .   .   .   .   .   .   .   3.67   .   .   .   
        1     15   1   .   .   .   .   .   .   .   4.08   .   .   .   
        1     16   1   .   .   .   .   .   .   .   4.21   .   .   .   
        1     17   1   .   .   .   .   .   .   .   4.46   .   .   .   
        1     18   1   .   .   .   .   .   .   .   3.45   .   .   .   
        1     19   1   .   .   .   .   .   .   .   4.99   .   .   .   
        1     20   1   .   .   .   .   .   .   .   4.08   .   .   .   
        1     21   1   .   .   .   .   .   .   .   3.57   .   .   .   
        1     22   1   .   .   .   .   .   .   .   3.68   .   .   .   
        1     23   1   .   .   .   .   .   .   .   3.87   .   .   .   
        1     24   1   .   .   .   .   .   .   .   4.12   .   .   .   
        1     25   1   .   .   .   .   .   .   .   3.04   .   .   .   
        1     26   1   .   .   .   .   .   .   .   4.54   .   .   .   
        1     27   1   .   .   .   .   .   .   .   4.50   .   .   .   
        1     28   1   .   .   .   .   .   .   .   4.01   .   .   .   
        1     29   1   .   .   .   .   .   .   .   4.11   .   .   .   
        1     30   1   .   .   .   .   .   .   .   4.24   .   .   .   
        1     31   1   .   .   .   .   .   .   .   3.97   .   .   .   
        1     32   1   .   .   .   .   .   .   .   3.65   .   .   .   
        1     33   1   .   .   .   .   .   .   .   3.44   .   .   .   
        1     34   1   .   .   .   .   .   .   .   4.81   .   .   .   
        1     35   1   .   .   .   .   .   .   .   3.76   .   .   .   
        1     36   1   .   .   .   .   .   .   .   3.76   .   .   .   
        1     37   1   .   .   .   .   .   .   .   3.88   .   .   .   
        1     38   1   .   .   .   .   .   .   .   3.93   .   .   .   
        1     39   1   .   .   .   .   .   .   .   3.93   .   .   .   
        1     40   1   .   .   .   .   .   .   .   3.14   .   .   .   
        1     41   1   .   .   .   .   .   .   .   3.89   .   .   .   
        1     42   1   .   .   .   .   .   .   .   3.84   .   .   .   
        1     43   1   .   .   .   .   .   .   .   4.25   .   .   .   
        1     44   1   .   .   .   .   .   .   .   3.78   .   .   .   
        1     45   1   .   .   .   .   .   .   .   5.46   .   .   .   
        1     46   1   .   .   .   .   .   .   .   5.46   .   .   .   
        1     47   1   .   .   .   .   .   .   .   4.24   .   .   .   
        1     48   1   .   .   .   .   .   .   .   3.61   .   .   .   
        1     49   1   .   .   .   .   .   .   .   4.74   .   .   .   
        1     50   1   .   .   .   .   .   .   .   5.02   .   .   .   
        1     51   1   .   .   .   .   .   .   .   3.53   .   .   .   
        1     52   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1     53   1   .   .   .   .   .   .   .   4.42   .   .   .   
        1     54   1   .   .   .   .   .   .   .   3.68   .   .   .   
        1     55   1   .   .   .   .   .   .   .   3.90   .   .   .   
        1     56   1   .   .   .   .   .   .   .   3.54   .   .   .   
        1     57   1   .   .   .   .   .   .   .   4.44   .   .   .   
        1     58   1   .   .   .   .   .   .   .   4.09   .   .   .   
        1     59   1   .   .   .   .   .   .   .   3.96   .   .   .   
        1     60   1   .   .   .   .   .   .   .   3.32   .   .   .   
        1     61   1   .   .   .   .   .   .   .   3.63   .   .   .   
        1     62   1   .   .   .   .   .   .   .   3.63   .   .   .   
        1     63   1   .   .   .   .   .   .   .   3.71   .   .   .   
        1     64   1   .   .   .   .   .   .   .   4.18   .   .   .   
        1     65   1   .   .   .   .   .   .   .   5.06   .   .   .   
        1     66   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1     67   1   .   .   .   .   .   .   .   4.81   .   .   .   
        1     68   1   .   .   .   .   .   .   .   4.57   .   .   .   
        1     69   1   .   .   .   .   .   .   .   3.67   .   .   .   
        1     70   1   .   .   .   .   .   .   .   3.82   .   .   .   
        1     71   1   .   .   .   .   .   .   .   4.00   .   .   .   
        1     72   1   .   .   .   .   .   .   .   3.24   .   .   .   
        1     73   1   .   .   .   .   .   .   .   3.99   .   .   .   
        1     74   1   .   .   .   .   .   .   .   4.00   .   .   .   
        1     75   1   .   .   .   .   .   .   .   3.89   .   .   .   
        1     76   1   .   .   .   .   .   .   .   3.72   .   .   .   
        1     77   1   .   .   .   .   .   .   .   4.04   .   .   .   
        1     78   1   .   .   .   .   .   .   .   3.03   .   .   .   
        1     79   1   .   .   .   .   .   .   .   3.37   .   .   .   
        1     80   1   .   .   .   .   .   .   .   4.34   .   .   .   
        1     81   1   .   .   .   .   .   .   .   3.53   .   .   .   
        1     82   1   .   .   .   .   .   .   .   4.53   .   .   .   
        1     83   1   .   .   .   .   .   .   .   3.65   .   .   .   
        1     84   1   .   .   .   .   .   .   .   3.65   .   .   .   
        1     85   1   .   .   .   .   .   .   .   4.31   .   .   .   
        1     86   1   .   .   .   .   .   .   .   4.87   .   .   .   
        1     87   1   .   .   .   .   .   .   .   4.37   .   .   .   
        1     88   1   .   .   .   .   .   .   .   3.82   .   .   .   
        1     89   1   .   .   .   .   .   .   .   3.55   .   .   .   
        1     90   1   .   .   .   .   .   .   .   3.80   .   .   .   
        1     91   1   .   .   .   .   .   .   .   4.50   .   .   .   
        1     92   1   .   .   .   .   .   .   .   3.99   .   .   .   
        1     93   1   .   .   .   .   .   .   .   3.92   .   .   .   
        1     94   1   .   .   .   .   .   .   .   3.84   .   .   .   
        1     95   1   .   .   .   .   .   .   .   4.36   .   .   .   
        1     96   1   .   .   .   .   .   .   .   3.43   .   .   .   
        1     97   1   .   .   .   .   .   .   .   3.79   .   .   .   
        1     98   1   .   .   .   .   .   .   .   4.04   .   .   .   
        1     99   1   .   .   .   .   .   .   .   3.78   .   .   .   
        1    100   1   .   .   .   .   .   .   .   4.94   .   .   .   
        1    101   1   .   .   .   .   .   .   .   3.63   .   .   .   
        1    102   1   .   .   .   .   .   .   .   3.65   .   .   .   
        1    103   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    104   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    105   1   .   .   .   .   .   .   .   3.76   .   .   .   
        1    106   1   .   .   .   .   .   .   .   3.81   .   .   .   
        1    107   1   .   .   .   .   .   .   .   4.45   .   .   .   
        1    108   1   .   .   .   .   .   .   .   4.30   .   .   .   
        1    109   1   .   .   .   .   .   .   .   4.30   .   .   .   
        1    110   1   .   .   .   .   .   .   .   3.08   .   .   .   
        1    111   1   .   .   .   .   .   .   .   4.21   .   .   .   
        1    112   1   .   .   .   .   .   .   .   3.87   .   .   .   
        1    113   1   .   .   .   .   .   .   .   4.15   .   .   .   
        1    114   1   .   .   .   .   .   .   .   3.57   .   .   .   
        1    115   1   .   .   .   .   .   .   .   4.24   .   .   .   
        1    116   1   .   .   .   .   .   .   .   4.24   .   .   .   
        1    117   1   .   .   .   .   .   .   .   3.56   .   .   .   
        1    118   1   .   .   .   .   .   .   .   4.15   .   .   .   
        1    119   1   .   .   .   .   .   .   .   4.79   .   .   .   
        1    120   1   .   .   .   .   .   .   .   3.33   .   .   .   
        1    121   1   .   .   .   .   .   .   .   3.28   .   .   .   
        1    122   1   .   .   .   .   .   .   .   4.32   .   .   .   
        1    123   1   .   .   .   .   .   .   .   4.65   .   .   .   
        1    124   1   .   .   .   .   .   .   .   4.11   .   .   .   
        1    125   1   .   .   .   .   .   .   .   4.41   .   .   .   
        1    126   1   .   .   .   .   .   .   .   4.56   .   .   .   
        1    127   1   .   .   .   .   .   .   .   4.82   .   .   .   
        1    128   1   .   .   .   .   .   .   .   4.77   .   .   .   
        1    129   1   .   .   .   .   .   .   .   4.04   .   .   .   
        1    130   1   .   .   .   .   .   .   .   3.18   .   .   .   
        1    131   1   .   .   .   .   .   .   .   3.85   .   .   .   
        1    132   1   .   .   .   .   .   .   .   4.28   .   .   .   
        1    133   1   .   .   .   .   .   .   .   4.11   .   .   .   
        1    134   1   .   .   .   .   .   .   .   4.05   .   .   .   
        1    135   1   .   .   .   .   .   .   .   3.91   .   .   .   
        1    136   1   .   .   .   .   .   .   .   3.70   .   .   .   
        1    137   1   .   .   .   .   .   .   .   4.09   .   .   .   
        1    138   1   .   .   .   .   .   .   .   3.76   .   .   .   
        1    139   1   .   .   .   .   .   .   .   4.40   .   .   .   
        1    140   1   .   .   .   .   .   .   .   4.46   .   .   .   
        1    141   1   .   .   .   .   .   .   .   4.44   .   .   .   
        1    142   1   .   .   .   .   .   .   .   4.04   .   .   .   
        1    143   1   .   .   .   .   .   .   .   3.65   .   .   .   
        1    144   1   .   .   .   .   .   .   .   4.14   .   .   .   
        1    145   1   .   .   .   .   .   .   .   4.05   .   .   .   
        1    146   1   .   .   .   .   .   .   .   3.89   .   .   .   
        1    147   1   .   .   .   .   .   .   .   4.46   .   .   .   
        1    148   1   .   .   .   .   .   .   .   3.89   .   .   .   
        1    149   1   .   .   .   .   .   .   .   4.68   .   .   .   
        1    150   1   .   .   .   .   .   .   .   3.39   .   .   .   
        1    151   1   .   .   .   .   .   .   .   4.22   .   .   .   
        1    152   1   .   .   .   .   .   .   .   4.11   .   .   .   
        1    153   1   .   .   .   .   .   .   .   4.02   .   .   .   
        1    154   1   .   .   .   .   .   .   .   3.49   .   .   .   
        1    155   1   .   .   .   .   .   .   .   4.57   .   .   .   
        1    156   1   .   .   .   .   .   .   .   4.78   .   .   .   
        1    157   1   .   .   .   .   .   .   .   5.00   .   .   .   
        1    158   1   .   .   .   .   .   .   .   4.87   .   .   .   
        1    159   1   .   .   .   .   .   .   .   4.50   .   .   .   
        1    160   1   .   .   .   .   .   .   .   3.83   .   .   .   
        1    161   1   .   .   .   .   .   .   .   4.46   .   .   .   
        1    162   1   .   .   .   .   .   .   .   3.94   .   .   .   
        1    163   1   .   .   .   .   .   .   .   3.72   .   .   .   
        1    164   1   .   .   .   .   .   .   .   3.94   .   .   .   
        1    165   1   .   .   .   .   .   .   .   3.04   .   .   .   
        1    166   1   .   .   .   .   .   .   .   4.36   .   .   .   
        1    167   1   .   .   .   .   .   .   .   3.79   .   .   .   
        1    168   1   .   .   .   .   .   .   .   4.15   .   .   .   
        1    169   1   .   .   .   .   .   .   .   3.68   .   .   .   
        1    170   1   .   .   .   .   .   .   .   4.11   .   .   .   
        1    171   1   .   .   .   .   .   .   .   4.34   .   .   .   
        1    172   1   .   .   .   .   .   .   .   3.84   .   .   .   
        1    173   1   .   .   .   .   .   .   .   3.89   .   .   .   
        1    174   1   .   .   .   .   .   .   .   5.01   .   .   .   
        1    175   1   .   .   .   .   .   .   .   3.41   .   .   .   
        1    176   1   .   .   .   .   .   .   .   4.22   .   .   .   
        1    177   1   .   .   .   .   .   .   .   3.81   .   .   .   
        1    178   1   .   .   .   .   .   .   .   4.17   .   .   .   
        1    179   1   .   .   .   .   .   .   .   4.16   .   .   .   
        1    180   1   .   .   .   .   .   .   .   3.84   .   .   .   
        1    181   1   .   .   .   .   .   .   .   3.51   .   .   .   
        1    182   1   .   .   .   .   .   .   .   3.97   .   .   .   
        1    183   1   .   .   .   .   .   .   .   3.93   .   .   .   
        1    184   1   .   .   .   .   .   .   .   3.80   .   .   .   
        1    185   1   .   .   .   .   .   .   .   4.49   .   .   .   
        1    186   1   .   .   .   .   .   .   .   3.62   .   .   .   
        1    187   1   .   .   .   .   .   .   .   3.83   .   .   .   
        1    188   1   .   .   .   .   .   .   .   4.04   .   .   .   
        1    189   1   .   .   .   .   .   .   .   4.04   .   .   .   
        1    190   1   .   .   .   .   .   .   .   3.98   .   .   .   
        1    191   1   .   .   .   .   .   .   .   4.10   .   .   .   
        1    192   1   .   .   .   .   .   .   .   4.27   .   .   .   
        1    193   1   .   .   .   .   .   .   .   3.67   .   .   .   
        1    194   1   .   .   .   .   .   .   .   5.44   .   .   .   
        1    195   1   .   .   .   .   .   .   .   5.44   .   .   .   
        1    196   1   .   .   .   .   .   .   .   4.09   .   .   .   
        1    197   1   .   .   .   .   .   .   .   4.01   .   .   .   
        1    198   1   .   .   .   .   .   .   .   3.95   .   .   .   
        1    199   1   .   .   .   .   .   .   .   4.47   .   .   .   
        1    200   1   .   .   .   .   .   .   .   4.48   .   .   .   
        1    201   1   .   .   .   .   .   .   .   4.27   .   .   .   
        1    202   1   .   .   .   .   .   .   .   4.52   .   .   .   
        1    203   1   .   .   .   .   .   .   .   3.60   .   .   .   
        1    204   1   .   .   .   .   .   .   .   3.89   .   .   .   
        1    205   1   .   .   .   .   .   .   .   3.89   .   .   .   
        1    206   1   .   .   .   .   .   .   .   3.92   .   .   .   
        1    207   1   .   .   .   .   .   .   .   4.09   .   .   .   
        1    208   1   .   .   .   .   .   .   .   3.42   .   .   .   
        1    209   1   .   .   .   .   .   .   .   4.42   .   .   .   
        1    210   1   .   .   .   .   .   .   .   3.66   .   .   .   
        1    211   1   .   .   .   .   .   .   .   3.32   .   .   .   
        1    212   1   .   .   .   .   .   .   .   4.66   .   .   .   
        1    213   1   .   .   .   .   .   .   .   4.82   .   .   .   
        1    214   1   .   .   .   .   .   .   .   3.93   .   .   .   
        1    215   1   .   .   .   .   .   .   .   3.53   .   .   .   
        1    216   1   .   .   .   .   .   .   .   4.13   .   .   .   
        1    217   1   .   .   .   .   .   .   .   3.89   .   .   .   
        1    218   1   .   .   .   .   .   .   .   3.38   .   .   .   
        1    219   1   .   .   .   .   .   .   .   4.77   .   .   .   
        1    220   1   .   .   .   .   .   .   .   5.05   .   .   .   
        1    221   1   .   .   .   .   .   .   .   4.44   .   .   .   
        1    222   1   .   .   .   .   .   .   .   3.56   .   .   .   
        1    223   1   .   .   .   .   .   .   .   3.73   .   .   .   
        1    224   1   .   .   .   .   .   .   .   4.70   .   .   .   
        1    225   1   .   .   .   .   .   .   .   5.03   .   .   .   
        1    226   1   .   .   .   .   .   .   .   4.07   .   .   .   
        1    227   1   .   .   .   .   .   .   .   4.35   .   .   .   
        1    228   1   .   .   .   .   .   .   .   4.08   .   .   .   
        1    229   1   .   .   .   .   .   .   .   3.27   .   .   .   
        1    230   1   .   .   .   .   .   .   .   4.16   .   .   .   
        1    231   1   .   .   .   .   .   .   .   4.36   .   .   .   
        1    232   1   .   .   .   .   .   .   .   4.02   .   .   .   
        1    233   1   .   .   .   .   .   .   .   3.81   .   .   .   
        1    234   1   .   .   .   .   .   .   .   4.11   .   .   .   
        1    235   1   .   .   .   .   .   .   .   3.78   .   .   .   
        1    236   1   .   .   .   .   .   .   .   3.27   .   .   .   
        1    237   1   .   .   .   .   .   .   .   4.43   .   .   .   
        1    238   1   .   .   .   .   .   .   .   4.25   .   .   .   
        1    239   1   .   .   .   .   .   .   .   3.49   .   .   .   
        1    240   1   .   .   .   .   .   .   .   4.44   .   .   .   
        1    241   1   .   .   .   .   .   .   .   4.35   .   .   .   
        1    242   1   .   .   .   .   .   .   .   4.09   .   .   .   
        1    243   1   .   .   .   .   .   .   .   4.07   .   .   .   
        1    244   1   .   .   .   .   .   .   .   4.36   .   .   .   
        1    245   1   .   .   .   .   .   .   .   3.22   .   .   .   
        1    246   1   .   .   .   .   .   .   .   4.03   .   .   .   
        1    247   1   .   .   .   .   .   .   .   4.30   .   .   .   
        1    248   1   .   .   .   .   .   .   .   4.09   .   .   .   
        1    249   1   .   .   .   .   .   .   .   3.13   .   .   .   
        1    250   1   .   .   .   .   .   .   .   3.26   .   .   .   
        1    251   1   .   .   .   .   .   .   .   4.19   .   .   .   
        1    252   1   .   .   .   .   .   .   .   3.37   .   .   .   
        1    253   1   .   .   .   .   .   .   .   4.18   .   .   .   
        1    254   1   .   .   .   .   .   .   .   4.12   .   .   .   
        1    255   1   .   .   .   .   .   .   .   3.79   .   .   .   
        1    256   1   .   .   .   .   .   .   .   4.45   .   .   .   
        1    257   1   .   .   .   .   .   .   .   4.75   .   .   .   
        1    258   1   .   .   .   .   .   .   .   3.83   .   .   .   
        1    259   1   .   .   .   .   .   .   .   4.44   .   .   .   
        1    260   1   .   .   .   .   .   .   .   3.82   .   .   .   
        1    261   1   .   .   .   .   .   .   .   3.99   .   .   .   
        1    262   1   .   .   .   .   .   .   .   4.79   .   .   .   
        1    263   1   .   .   .   .   .   .   .   3.94   .   .   .   
        1    264   1   .   .   .   .   .   .   .   4.50   .   .   .   
        1    265   1   .   .   .   .   .   .   .   3.94   .   .   .   
        1    266   1   .   .   .   .   .   .   .   4.83   .   .   .   
        1    267   1   .   .   .   .   .   .   .   5.01   .   .   .   
        1    268   1   .   .   .   .   .   .   .   3.96   .   .   .   
        1    269   1   .   .   .   .   .   .   .   4.93   .   .   .   
        1    270   1   .   .   .   .   .   .   .   5.11   .   .   .   
        1    271   1   .   .   .   .   .   .   .   4.36   .   .   .   
        1    272   1   .   .   .   .   .   .   .   4.12   .   .   .   
        1    273   1   .   .   .   .   .   .   .   4.25   .   .   .   
        1    274   1   .   .   .   .   .   .   .   3.80   .   .   .   
        1    275   1   .   .   .   .   .   .   .   5.05   .   .   .   
        1    276   1   .   .   .   .   .   .   .   5.26   .   .   .   
        1    277   1   .   .   .   .   .   .   .   3.43   .   .   .   
        1    278   1   .   .   .   .   .   .   .   3.71   .   .   .   
        1    279   1   .   .   .   .   .   .   .   3.90   .   .   .   
        1    280   1   .   .   .   .   .   .   .   4.53   .   .   .   
        1    281   1   .   .   .   .   .   .   .   4.36   .   .   .   
        1    282   1   .   .   .   .   .   .   .   4.47   .   .   .   
        1    283   1   .   .   .   .   .   .   .   4.17   .   .   .   
        1    284   1   .   .   .   .   .   .   .   4.38   .   .   .   
        1    285   1   .   .   .   .   .   .   .   3.64   .   .   .   
        1    286   1   .   .   .   .   .   .   .   5.01   .   .   .   
        1    287   1   .   .   .   .   .   .   .   4.56   .   .   .   
        1    288   1   .   .   .   .   .   .   .   3.95   .   .   .   
        1    289   1   .   .   .   .   .   .   .   4.06   .   .   .   
        1    290   1   .   .   .   .   .   .   .   4.42   .   .   .   
        1    291   1   .   .   .   .   .   .   .   4.11   .   .   .   
        1    292   1   .   .   .   .   .   .   .   4.42   .   .   .   
        1    293   1   .   .   .   .   .   .   .   4.43   .   .   .   
        1    294   1   .   .   .   .   .   .   .   3.97   .   .   .   
        1    295   1   .   .   .   .   .   .   .   4.32   .   .   .   
        1    296   1   .   .   .   .   .   .   .   5.05   .   .   .   
        1    297   1   .   .   .   .   .   .   .   4.18   .   .   .   
        1    298   1   .   .   .   .   .   .   .   5.17   .   .   .   
        1    299   1   .   .   .   .   .   .   .   4.79   .   .   .   
        1    300   1   .   .   .   .   .   .   .   4.11   .   .   .   
        1    301   1   .   .   .   .   .   .   .   4.52   .   .   .   
        1    302   1   .   .   .   .   .   .   .   3.85   .   .   .   
        1    303   1   .   .   .   .   .   .   .   4.54   .   .   .   
        1    304   1   .   .   .   .   .   .   .   3.70   .   .   .   
        1    305   1   .   .   .   .   .   .   .   3.98   .   .   .   
        1    306   1   .   .   .   .   .   .   .   3.43   .   .   .   
        1    307   1   .   .   .   .   .   .   .   4.40   .   .   .   
        1    308   1   .   .   .   .   .   .   .   4.74   .   .   .   
        1    309   1   .   .   .   .   .   .   .   4.47   .   .   .   
        1    310   1   .   .   .   .   .   .   .   4.11   .   .   .   
        1    311   1   .   .   .   .   .   .   .   3.53   .   .   .   
        1    312   1   .   .   .   .   .   .   .   4.97   .   .   .   
        1    313   1   .   .   .   .   .   .   .   4.17   .   .   .   
        1    314   1   .   .   .   .   .   .   .   4.00   .   .   .   
        1    315   1   .   .   .   .   .   .   .   3.50   .   .   .   
        1    316   1   .   .   .   .   .   .   .   3.63   .   .   .   
        1    317   1   .   .   .   .   .   .   .   4.12   .   .   .   
        1    318   1   .   .   .   .   .   .   .   4.53   .   .   .   
        1    319   1   .   .   .   .   .   .   .   4.19   .   .   .   
        1    320   1   .   .   .   .   .   .   .   4.31   .   .   .   
        1    321   1   .   .   .   .   .   .   .   4.45   .   .   .   
        1    322   1   .   .   .   .   .   .   .   4.42   .   .   .   
        1    323   1   .   .   .   .   .   .   .   3.72   .   .   .   
        1    324   1   .   .   .   .   .   .   .   4.80   .   .   .   
        1    325   1   .   .   .   .   .   .   .   4.68   .   .   .   
        1    326   1   .   .   .   .   .   .   .   4.16   .   .   .   
        1    327   1   .   .   .   .   .   .   .   4.70   .   .   .   
        1    328   1   .   .   .   .   .   .   .   4.23   .   .   .   
        1    329   1   .   .   .   .   .   .   .   4.42   .   .   .   
        1    330   1   .   .   .   .   .   .   .   4.49   .   .   .   
        1    331   1   .   .   .   .   .   .   .   3.84   .   .   .   
        1    332   1   .   .   .   .   .   .   .   4.07   .   .   .   
        1    333   1   .   .   .   .   .   .   .   4.08   .   .   .   
        1    334   1   .   .   .   .   .   .   .   4.25   .   .   .   
        1    335   1   .   .   .   .   .   .   .   4.00   .   .   .   
        1    336   1   .   .   .   .   .   .   .   3.55   .   .   .   
        1    337   1   .   .   .   .   .   .   .   3.90   .   .   .   
        1    338   1   .   .   .   .   .   .   .   4.11   .   .   .   
        1    339   1   .   .   .   .   .   .   .   4.42   .   .   .   
        1    340   1   .   .   .   .   .   .   .   4.37   .   .   .   
        1    341   1   .   .   .   .   .   .   .   4.20   .   .   .   
        1    342   1   .   .   .   .   .   .   .   3.79   .   .   .   
        1    343   1   .   .   .   .   .   .   .   3.99   .   .   .   
        1    344   1   .   .   .   .   .   .   .   3.49   .   .   .   
        1    345   1   .   .   .   .   .   .   .   3.56   .   .   .   
        1    346   1   .   .   .   .   .   .   .   4.91   .   .   .   
        1    347   1   .   .   .   .   .   .   .   4.09   .   .   .   
        1    348   1   .   .   .   .   .   .   .   4.71   .   .   .   
        1    349   1   .   .   .   .   .   .   .   5.11   .   .   .   
        1    350   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    351   1   .   .   .   .   .   .   .   4.20   .   .   .   
        1    352   1   .   .   .   .   .   .   .   3.38   .   .   .   
        1    353   1   .   .   .   .   .   .   .   4.80   .   .   .   
        1    354   1   .   .   .   .   .   .   .   3.50   .   .   .   
        1    355   1   .   .   .   .   .   .   .   4.45   .   .   .   
        1    356   1   .   .   .   .   .   .   .   3.78   .   .   .   
        1    357   1   .   .   .   .   .   .   .   3.27   .   .   .   
        1    358   1   .   .   .   .   .   .   .   4.44   .   .   .   
        1    359   1   .   .   .   .   .   .   .   4.05   .   .   .   
        1    360   1   .   .   .   .   .   .   .   4.28   .   .   .   
        1    361   1   .   .   .   .   .   .   .   3.50   .   .   .   
        1    362   1   .   .   .   .   .   .   .   4.68   .   .   .   
        1    363   1   .   .   .   .   .   .   .   3.39   .   .   .   
        1    364   1   .   .   .   .   .   .   .   3.39   .   .   .   
        1    365   1   .   .   .   .   .   .   .   3.40   .   .   .   
        1    366   1   .   .   .   .   .   .   .   4.49   .   .   .   
        1    367   1   .   .   .   .   .   .   .   3.95   .   .   .   
        1    368   1   .   .   .   .   .   .   .   4.75   .   .   .   
        1    369   1   .   .   .   .   .   .   .   4.64   .   .   .   
        1    370   1   .   .   .   .   .   .   .   3.68   .   .   .   
        1    371   1   .   .   .   .   .   .   .   3.19   .   .   .   
        1    372   1   .   .   .   .   .   .   .   4.44   .   .   .   
        1    373   1   .   .   .   .   .   .   .   3.50   .   .   .   
        1    374   1   .   .   .   .   .   .   .   3.52   .   .   .   
        1    375   1   .   .   .   .   .   .   .   4.64   .   .   .   
        1    376   1   .   .   .   .   .   .   .   4.47   .   .   .   
        1    377   1   .   .   .   .   .   .   .   2.85   .   .   .   
        1    378   1   .   .   .   .   .   .   .   4.49   .   .   .   
        1    379   1   .   .   .   .   .   .   .   3.86   .   .   .   
        1    380   1   .   .   .   .   .   .   .   3.62   .   .   .   
        1    381   1   .   .   .   .   .   .   .   3.28   .   .   .   
        1    382   1   .   .   .   .   .   .   .   3.49   .   .   .   
        1    383   1   .   .   .   .   .   .   .   4.95   .   .   .   
        1    384   1   .   .   .   .   .   .   .   5.26   .   .   .   
        1    385   1   .   .   .   .   .   .   .   4.03   .   .   .   
        1    386   1   .   .   .   .   .   .   .   3.67   .   .   .   
        1    387   1   .   .   .   .   .   .   .   4.00   .   .   .   
        1    388   1   .   .   .   .   .   .   .   3.63   .   .   .   
        1    389   1   .   .   .   .   .   .   .   3.84   .   .   .   
        1    390   1   .   .   .   .   .   .   .   4.57   .   .   .   
        1    391   1   .   .   .   .   .   .   .   3.44   .   .   .   
        1    392   1   .   .   .   .   .   .   .   2.87   .   .   .   
        1    393   1   .   .   .   .   .   .   .   4.08   .   .   .   
        1    394   1   .   .   .   .   .   .   .   4.81   .   .   .   
        1    395   1   .   .   .   .   .   .   .   4.26   .   .   .   
        1    396   1   .   .   .   .   .   .   .   3.13   .   .   .   
        1    397   1   .   .   .   .   .   .   .   3.92   .   .   .   
        1    398   1   .   .   .   .   .   .   .   4.19   .   .   .   
        1    399   1   .   .   .   .   .   .   .   4.83   .   .   .   
        1    400   1   .   .   .   .   .   .   .   3.85   .   .   .   
        1    401   1   .   .   .   .   .   .   .   4.30   .   .   .   
        1    402   1   .   .   .   .   .   .   .   4.48   .   .   .   
        1    403   1   .   .   .   .   .   .   .   4.12   .   .   .   
        1    404   1   .   .   .   .   .   .   .   3.74   .   .   .   
        1    405   1   .   .   .   .   .   .   .   4.48   .   .   .   
        1    406   1   .   .   .   .   .   .   .   2.67   .   .   .   
        1    407   1   .   .   .   .   .   .   .   4.53   .   .   .   
        1    408   1   .   .   .   .   .   .   .   3.52   .   .   .   
        1    409   1   .   .   .   .   .   .   .   3.58   .   .   .   
        1    410   1   .   .   .   .   .   .   .   3.71   .   .   .   
        1    411   1   .   .   .   .   .   .   .   4.11   .   .   .   
        1    412   1   .   .   .   .   .   .   .   3.68   .   .   .   
        1    413   1   .   .   .   .   .   .   .   3.83   .   .   .   
        1    414   1   .   .   .   .   .   .   .   4.38   .   .   .   
        1    415   1   .   .   .   .   .   .   .   3.93   .   .   .   
        1    416   1   .   .   .   .   .   .   .   4.81   .   .   .   
        1    417   1   .   .   .   .   .   .   .   3.71   .   .   .   
        1    418   1   .   .   .   .   .   .   .   3.19   .   .   .   
        1    419   1   .   .   .   .   .   .   .   3.86   .   .   .   
        1    420   1   .   .   .   .   .   .   .   4.24   .   .   .   
        1    421   1   .   .   .   .   .   .   .   3.65   .   .   .   
        1    422   1   .   .   .   .   .   .   .   4.54   .   .   .   
        1    423   1   .   .   .   .   .   .   .   3.41   .   .   .   
        1    424   1   .   .   .   .   .   .   .   3.74   .   .   .   
        1    425   1   .   .   .   .   .   .   .   4.56   .   .   .   
        1    426   1   .   .   .   .   .   .   .   4.53   .   .   .   
        1    427   1   .   .   .   .   .   .   .   3.62   .   .   .   
        1    428   1   .   .   .   .   .   .   .   4.14   .   .   .   
        1    429   1   .   .   .   .   .   .   .   3.94   .   .   .   
        1    430   1   .   .   .   .   .   .   .   4.71   .   .   .   
        1    431   1   .   .   .   .   .   .   .   3.37   .   .   .   
        1    432   1   .   .   .   .   .   .   .   4.67   .   .   .   
        1    433   1   .   .   .   .   .   .   .   3.89   .   .   .   
        1    434   1   .   .   .   .   .   .   .   3.77   .   .   .   
        1    435   1   .   .   .   .   .   .   .   4.33   .   .   .   
        1    436   1   .   .   .   .   .   .   .   4.16   .   .   .   
        1    437   1   .   .   .   .   .   .   .   3.26   .   .   .   
        1    438   1   .   .   .   .   .   .   .   4.24   .   .   .   
        1    439   1   .   .   .   .   .   .   .   3.20   .   .   .   
        1    440   1   .   .   .   .   .   .   .   3.54   .   .   .   
        1    441   1   .   .   .   .   .   .   .   3.94   .   .   .   
        1    442   1   .   .   .   .   .   .   .   4.71   .   .   .   
        1    443   1   .   .   .   .   .   .   .   3.37   .   .   .   
        1    444   1   .   .   .   .   .   .   .   4.17   .   .   .   
        1    445   1   .   .   .   .   .   .   .   3.90   .   .   .   
        1    446   1   .   .   .   .   .   .   .   3.93   .   .   .   
        1    447   1   .   .   .   .   .   .   .   4.46   .   .   .   
        1    448   1   .   .   .   .   .   .   .   2.86   .   .   .   
        1    449   1   .   .   .   .   .   .   .   4.03   .   .   .   
        1    450   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    451   1   .   .   .   .   .   .   .   4.37   .   .   .   
        1    452   1   .   .   .   .   .   .   .   3.98   .   .   .   
        1    453   1   .   .   .   .   .   .   .   2.95   .   .   .   
        1    454   1   .   .   .   .   .   .   .   4.68   .   .   .   
        1    455   1   .   .   .   .   .   .   .   4.76   .   .   .   
        1    456   1   .   .   .   .   .   .   .   3.81   .   .   .   
        1    457   1   .   .   .   .   .   .   .   4.01   .   .   .   
        1    458   1   .   .   .   .   .   .   .   2.83   .   .   .   
        1    459   1   .   .   .   .   .   .   .   4.75   .   .   .   
        1    460   1   .   .   .   .   .   .   .   3.39   .   .   .   
        1    461   1   .   .   .   .   .   .   .   3.81   .   .   .   
        1    462   1   .   .   .   .   .   .   .   4.00   .   .   .   
        1    463   1   .   .   .   .   .   .   .   2.83   .   .   .   
        1    464   1   .   .   .   .   .   .   .   2.78   .   .   .   
        1    465   1   .   .   .   .   .   .   .   4.73   .   .   .   
        1    466   1   .   .   .   .   .   .   .   4.73   .   .   .   
        1    467   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    468   1   .   .   .   .   .   .   .   3.94   .   .   .   
        1    469   1   .   .   .   .   .   .   .   3.50   .   .   .   
        1    470   1   .   .   .   .   .   .   .   5.13   .   .   .   
        1    471   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    472   1   .   .   .   .   .   .   .   3.42   .   .   .   
        1    473   1   .   .   .   .   .   .   .   3.16   .   .   .   
        1    474   1   .   .   .   .   .   .   .   3.50   .   .   .   
        1    475   1   .   .   .   .   .   .   .   3.97   .   .   .   
        1    476   1   .   .   .   .   .   .   .   5.04   .   .   .   
        1    477   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    478   1   .   .   .   .   .   .   .   3.16   .   .   .   
        1    479   1   .   .   .   .   .   .   .   3.86   .   .   .   
        1    480   1   .   .   .   .   .   .   .   3.21   .   .   .   
        1    481   1   .   .   .   .   .   .   .   3.83   .   .   .   
        1    482   1   .   .   .   .   .   .   .   4.90   .   .   .   
        1    483   1   .   .   .   .   .   .   .   4.08   .   .   .   
        1    484   1   .   .   .   .   .   .   .   3.16   .   .   .   
        1    485   1   .   .   .   .   .   .   .   2.86   .   .   .   
        1    486   1   .   .   .   .   .   .   .   4.98   .   .   .   
        1    487   1   .   .   .   .   .   .   .   5.30   .   .   .   
        1    488   1   .   .   .   .   .   .   .   4.68   .   .   .   
        1    489   1   .   .   .   .   .   .   .   3.30   .   .   .   
        1    490   1   .   .   .   .   .   .   .   3.71   .   .   .   
        1    491   1   .   .   .   .   .   .   .   4.64   .   .   .   
        1    492   1   .   .   .   .   .   .   .   5.03   .   .   .   
        1    493   1   .   .   .   .   .   .   .   3.40   .   .   .   
        1    494   1   .   .   .   .   .   .   .   4.18   .   .   .   
        1    495   1   .   .   .   .   .   .   .   5.28   .   .   .   
        1    496   1   .   .   .   .   .   .   .   3.98   .   .   .   
        1    497   1   .   .   .   .   .   .   .   3.81   .   .   .   
        1    498   1   .   .   .   .   .   .   .   5.09   .   .   .   
        1    499   1   .   .   .   .   .   .   .   5.42   .   .   .   
        1    500   1   .   .   .   .   .   .   .   5.20   .   .   .   
        1    501   1   .   .   .   .   .   .   .   4.47   .   .   .   
        1    502   1   .   .   .   .   .   .   .   4.31   .   .   .   
        1    503   1   .   .   .   .   .   .   .   4.91   .   .   .   
        1    504   1   .   .   .   .   .   .   .   4.94   .   .   .   
        1    505   1   .   .   .   .   .   .   .   5.30   .   .   .   
        1    506   1   .   .   .   .   .   .   .   4.26   .   .   .   
        1    507   1   .   .   .   .   .   .   .   4.53   .   .   .   
        1    508   1   .   .   .   .   .   .   .   3.21   .   .   .   
        1    509   1   .   .   .   .   .   .   .   3.50   .   .   .   
        1    510   1   .   .   .   .   .   .   .   5.44   .   .   .   
        1    511   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    512   1   .   .   .   .   .   .   .   4.23   .   .   .   
        1    513   1   .   .   .   .   .   .   .   4.07   .   .   .   
        1    514   1   .   .   .   .   .   .   .   4.53   .   .   .   
        1    515   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    516   1   .   .   .   .   .   .   .   3.17   .   .   .   
        1    517   1   .   .   .   .   .   .   .   2.69   .   .   .   
        1    518   1   .   .   .   .   .   .   .   4.33   .   .   .   
        1    519   1   .   .   .   .   .   .   .   4.47   .   .   .   
        1    520   1   .   .   .   .   .   .   .   4.15   .   .   .   
        1    521   1   .   .   .   .   .   .   .   4.20   .   .   .   
        1    522   1   .   .   .   .   .   .   .   4.81   .   .   .   
        1    523   1   .   .   .   .   .   .   .   4.53   .   .   .   
        1    524   1   .   .   .   .   .   .   .   4.91   .   .   .   
        1    525   1   .   .   .   .   .   .   .   4.47   .   .   .   
        1    526   1   .   .   .   .   .   .   .   4.31   .   .   .   
        1    527   1   .   .   .   .   .   .   .   4.20   .   .   .   
        1    528   1   .   .   .   .   .   .   .   3.90   .   .   .   
        1    529   1   .   .   .   .   .   .   .   4.74   .   .   .   
        1    530   1   .   .   .   .   .   .   .   4.46   .   .   .   
        1    531   1   .   .   .   .   .   .   .   4.41   .   .   .   
        1    532   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    533   1   .   .   .   .   .   .   .   4.84   .   .   .   
        1    534   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    535   1   .   .   .   .   .   .   .   3.73   .   .   .   
        1    536   1   .   .   .   .   .   .   .   4.10   .   .   .   
        1    537   1   .   .   .   .   .   .   .   3.39   .   .   .   
        1    538   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    539   1   .   .   .   .   .   .   .   4.50   .   .   .   
        1    540   1   .   .   .   .   .   .   .   3.72   .   .   .   
        1    541   1   .   .   .   .   .   .   .   5.11   .   .   .   
        1    542   1   .   .   .   .   .   .   .   4.74   .   .   .   
        1    543   1   .   .   .   .   .   .   .   4.66   .   .   .   
        1    544   1   .   .   .   .   .   .   .   4.68   .   .   .   
        1    545   1   .   .   .   .   .   .   .   3.39   .   .   .   
        1    546   1   .   .   .   .   .   .   .   4.48   .   .   .   
        1    547   1   .   .   .   .   .   .   .   4.24   .   .   .   
        1    548   1   .   .   .   .   .   .   .   4.15   .   .   .   
        1    549   1   .   .   .   .   .   .   .   4.43   .   .   .   
        1    550   1   .   .   .   .   .   .   .   4.79   .   .   .   
        1    551   1   .   .   .   .   .   .   .   3.80   .   .   .   
        1    552   1   .   .   .   .   .   .   .   4.22   .   .   .   
        1    553   1   .   .   .   .   .   .   .   3.81   .   .   .   
        1    554   1   .   .   .   .   .   .   .   3.67   .   .   .   
        1    555   1   .   .   .   .   .   .   .   3.75   .   .   .   
        1    556   1   .   .   .   .   .   .   .   5.38   .   .   .   
        1    557   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    558   1   .   .   .   .   .   .   .   4.25   .   .   .   
        1    559   1   .   .   .   .   .   .   .   5.25   .   .   .   
        1    560   1   .   .   .   .   .   .   .   4.06   .   .   .   
        1    561   1   .   .   .   .   .   .   .   4.17   .   .   .   
        1    562   1   .   .   .   .   .   .   .   4.70   .   .   .   
        1    563   1   .   .   .   .   .   .   .   4.66   .   .   .   
        1    564   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    565   1   .   .   .   .   .   .   .   4.09   .   .   .   
        1    566   1   .   .   .   .   .   .   .   4.64   .   .   .   
        1    567   1   .   .   .   .   .   .   .   4.70   .   .   .   
        1    568   1   .   .   .   .   .   .   .   4.39   .   .   .   
        1    569   1   .   .   .   .   .   .   .   4.30   .   .   .   
        1    570   1   .   .   .   .   .   .   .   4.02   .   .   .   
        1    571   1   .   .   .   .   .   .   .   3.75   .   .   .   
        1    572   1   .   .   .   .   .   .   .   2.85   .   .   .   
        1    573   1   .   .   .   .   .   .   .   3.76   .   .   .   
        1    574   1   .   .   .   .   .   .   .   4.54   .   .   .   
        1    575   1   .   .   .   .   .   .   .   4.31   .   .   .   
        1    576   1   .   .   .   .   .   .   .   3.62   .   .   .   
        1    577   1   .   .   .   .   .   .   .   4.79   .   .   .   
        1    578   1   .   .   .   .   .   .   .   4.21   .   .   .   
        1    579   1   .   .   .   .   .   .   .   4.57   .   .   .   
        1    580   1   .   .   .   .   .   .   .   4.94   .   .   .   
        1    581   1   .   .   .   .   .   .   .   3.99   .   .   .   
        1    582   1   .   .   .   .   .   .   .   4.24   .   .   .   
        1    583   1   .   .   .   .   .   .   .   4.66   .   .   .   
        1    584   1   .   .   .   .   .   .   .   2.86   .   .   .   
        1    585   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    586   1   .   .   .   .   .   .   .   3.74   .   .   .   
        1    587   1   .   .   .   .   .   .   .   4.83   .   .   .   
        1    588   1   .   .   .   .   .   .   .   5.12   .   .   .   
        1    589   1   .   .   .   .   .   .   .   5.00   .   .   .   
        1    590   1   .   .   .   .   .   .   .   4.66   .   .   .   
        1    591   1   .   .   .   .   .   .   .   4.78   .   .   .   
        1    592   1   .   .   .   .   .   .   .   3.70   .   .   .   
        1    593   1   .   .   .   .   .   .   .   4.38   .   .   .   
        1    594   1   .   .   .   .   .   .   .   3.93   .   .   .   
        1    595   1   .   .   .   .   .   .   .   3.42   .   .   .   
        1    596   1   .   .   .   .   .   .   .   4.34   .   .   .   
        1    597   1   .   .   .   .   .   .   .   3.83   .   .   .   
        1    598   1   .   .   .   .   .   .   .   4.84   .   .   .   
        1    599   1   .   .   .   .   .   .   .   4.07   .   .   .   
        1    600   1   .   .   .   .   .   .   .   2.53   .   .   .   
        1    601   1   .   .   .   .   .   .   .   4.33   .   .   .   
        1    602   1   .   .   .   .   .   .   .   5.08   .   .   .   
        1    603   1   .   .   .   .   .   .   .   4.79   .   .   .   
        1    604   1   .   .   .   .   .   .   .   4.43   .   .   .   
        1    605   1   .   .   .   .   .   .   .   4.87   .   .   .   
        1    606   1   .   .   .   .   .   .   .   4.53   .   .   .   
        1    607   1   .   .   .   .   .   .   .   4.25   .   .   .   
        1    608   1   .   .   .   .   .   .   .   4.28   .   .   .   
        1    609   1   .   .   .   .   .   .   .   3.95   .   .   .   
        1    610   1   .   .   .   .   .   .   .   4.54   .   .   .   
        1    611   1   .   .   .   .   .   .   .   3.59   .   .   .   
        1    612   1   .   .   .   .   .   .   .   2.40   .   .   .   
        1    613   1   .   .   .   .   .   .   .   4.63   .   .   .   
        1    614   1   .   .   .   .   .   .   .   4.26   .   .   .   
        1    615   1   .   .   .   .   .   .   .   4.18   .   .   .   
        1    616   1   .   .   .   .   .   .   .   2.85   .   .   .   
        1    617   1   .   .   .   .   .   .   .   4.42   .   .   .   
        1    618   1   .   .   .   .   .   .   .   4.39   .   .   .   
        1    619   1   .   .   .   .   .   .   .   3.97   .   .   .   
        1    620   1   .   .   .   .   .   .   .   3.65   .   .   .   
        1    621   1   .   .   .   .   .   .   .   2.94   .   .   .   
        1    622   1   .   .   .   .   .   .   .   4.86   .   .   .   
        1    623   1   .   .   .   .   .   .   .   4.07   .   .   .   
        1    624   1   .   .   .   .   .   .   .   3.53   .   .   .   
        1    625   1   .   .   .   .   .   .   .   3.61   .   .   .   
        1    626   1   .   .   .   .   .   .   .   3.58   .   .   .   
        1    627   1   .   .   .   .   .   .   .   5.35   .   .   .   
        1    628   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    629   1   .   .   .   .   .   .   .   4.24   .   .   .   
        1    630   1   .   .   .   .   .   .   .   3.61   .   .   .   
        1    631   1   .   .   .   .   .   .   .   4.72   .   .   .   
        1    632   1   .   .   .   .   .   .   .   4.46   .   .   .   
        1    633   1   .   .   .   .   .   .   .   4.93   .   .   .   
        1    634   1   .   .   .   .   .   .   .   3.53   .   .   .   
        1    635   1   .   .   .   .   .   .   .   4.25   .   .   .   
        1    636   1   .   .   .   .   .   .   .   4.01   .   .   .   
        1    637   1   .   .   .   .   .   .   .   2.40   .   .   .   
        1    638   1   .   .   .   .   .   .   .   3.90   .   .   .   
        1    639   1   .   .   .   .   .   .   .   4.67   .   .   .   
        1    640   1   .   .   .   .   .   .   .   3.84   .   .   .   
        1    641   1   .   .   .   .   .   .   .   3.59   .   .   .   
        1    642   1   .   .   .   .   .   .   .   3.64   .   .   .   
        1    643   1   .   .   .   .   .   .   .   3.89   .   .   .   
        1    644   1   .   .   .   .   .   .   .   4.94   .   .   .   
        1    645   1   .   .   .   .   .   .   .   4.94   .   .   .   
        1    646   1   .   .   .   .   .   .   .   4.48   .   .   .   
        1    647   1   .   .   .   .   .   .   .   3.96   .   .   .   
        1    648   1   .   .   .   .   .   .   .   4.72   .   .   .   
        1    649   1   .   .   .   .   .   .   .   4.79   .   .   .   
        1    650   1   .   .   .   .   .   .   .   3.41   .   .   .   
        1    651   1   .   .   .   .   .   .   .   3.98   .   .   .   
        1    652   1   .   .   .   .   .   .   .   3.79   .   .   .   
        1    653   1   .   .   .   .   .   .   .   3.83   .   .   .   
        1    654   1   .   .   .   .   .   .   .   3.87   .   .   .   
        1    655   1   .   .   .   .   .   .   .   4.47   .   .   .   
        1    656   1   .   .   .   .   .   .   .   4.42   .   .   .   
        1    657   1   .   .   .   .   .   .   .   4.53   .   .   .   
        1    658   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    659   1   .   .   .   .   .   .   .   4.59   .   .   .   
        1    660   1   .   .   .   .   .   .   .   5.24   .   .   .   
        1    661   1   .   .   .   .   .   .   .   4.08   .   .   .   
        1    662   1   .   .   .   .   .   .   .   2.68   .   .   .   
        1    663   1   .   .   .   .   .   .   .   3.52   .   .   .   
        1    664   1   .   .   .   .   .   .   .   3.98   .   .   .   
        1    665   1   .   .   .   .   .   .   .   4.33   .   .   .   
        1    666   1   .   .   .   .   .   .   .   4.68   .   .   .   
        1    667   1   .   .   .   .   .   .   .   3.61   .   .   .   
        1    668   1   .   .   .   .   .   .   .   4.45   .   .   .   
        1    669   1   .   .   .   .   .   .   .   3.79   .   .   .   
        1    670   1   .   .   .   .   .   .   .   4.67   .   .   .   
        1    671   1   .   .   .   .   .   .   .   4.68   .   .   .   
        1    672   1   .   .   .   .   .   .   .   3.95   .   .   .   
        1    673   1   .   .   .   .   .   .   .   5.19   .   .   .   
        1    674   1   .   .   .   .   .   .   .   3.07   .   .   .   
        1    675   1   .   .   .   .   .   .   .   4.57   .   .   .   
        1    676   1   .   .   .   .   .   .   .   5.46   .   .   .   
        1    677   1   .   .   .   .   .   .   .   4.47   .   .   .   
        1    678   1   .   .   .   .   .   .   .   4.67   .   .   .   
        1    679   1   .   .   .   .   .   .   .   3.49   .   .   .   
        1    680   1   .   .   .   .   .   .   .   3.44   .   .   .   
        1    681   1   .   .   .   .   .   .   .   3.62   .   .   .   
        1    682   1   .   .   .   .   .   .   .   4.53   .   .   .   
        1    683   1   .   .   .   .   .   .   .   3.47   .   .   .   
        1    684   1   .   .   .   .   .   .   .   4.49   .   .   .   
        1    685   1   .   .   .   .   .   .   .   4.84   .   .   .   
        1    686   1   .   .   .   .   .   .   .   4.68   .   .   .   
        1    687   1   .   .   .   .   .   .   .   4.66   .   .   .   
        1    688   1   .   .   .   .   .   .   .   4.34   .   .   .   
        1    689   1   .   .   .   .   .   .   .   4.49   .   .   .   
        1    690   1   .   .   .   .   .   .   .   3.46   .   .   .   
        1    691   1   .   .   .   .   .   .   .   4.62   .   .   .   
        1    692   1   .   .   .   .   .   .   .   4.78   .   .   .   
        1    693   1   .   .   .   .   .   .   .   5.00   .   .   .   
        1    694   1   .   .   .   .   .   .   .   5.29   .   .   .   
        1    695   1   .   .   .   .   .   .   .   4.83   .   .   .   
        1    696   1   .   .   .   .   .   .   .   3.39   .   .   .   
        1    697   1   .   .   .   .   .   .   .   4.13   .   .   .   
        1    698   1   .   .   .   .   .   .   .   3.77   .   .   .   
        1    699   1   .   .   .   .   .   .   .   4.68   .   .   .   
        1    700   1   .   .   .   .   .   .   .   4.64   .   .   .   
        1    701   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    702   1   .   .   .   .   .   .   .   4.93   .   .   .   
        1    703   1   .   .   .   .   .   .   .   4.95   .   .   .   
        1    704   1   .   .   .   .   .   .   .   3.05   .   .   .   
        1    705   1   .   .   .   .   .   .   .   4.17   .   .   .   
        1    706   1   .   .   .   .   .   .   .   3.66   .   .   .   
        1    707   1   .   .   .   .   .   .   .   3.66   .   .   .   
        1    708   1   .   .   .   .   .   .   .   3.11   .   .   .   
        1    709   1   .   .   .   .   .   .   .   4.08   .   .   .   
        1    710   1   .   .   .   .   .   .   .   4.22   .   .   .   
        1    711   1   .   .   .   .   .   .   .   4.22   .   .   .   
        1    712   1   .   .   .   .   .   .   .   4.41   .   .   .   
        1    713   1   .   .   .   .   .   .   .   3.05   .   .   .   
        1    714   1   .   .   .   .   .   .   .   5.12   .   .   .   
        1    715   1   .   .   .   .   .   .   .   4.65   .   .   .   
        1    716   1   .   .   .   .   .   .   .   4.04   .   .   .   
        1    717   1   .   .   .   .   .   .   .   4.44   .   .   .   
        1    718   1   .   .   .   .   .   .   .   4.46   .   .   .   
        1    719   1   .   .   .   .   .   .   .   5.01   .   .   .   
        1    720   1   .   .   .   .   .   .   .   4.83   .   .   .   
        1    721   1   .   .   .   .   .   .   .   5.00   .   .   .   
        1    722   1   .   .   .   .   .   .   .   4.48   .   .   .   
        1    723   1   .   .   .   .   .   .   .   3.77   .   .   .   
        1    724   1   .   .   .   .   .   .   .   4.50   .   .   .   
        1    725   1   .   .   .   .   .   .   .   4.19   .   .   .   
        1    726   1   .   .   .   .   .   .   .   4.35   .   .   .   
        1    727   1   .   .   .   .   .   .   .   3.73   .   .   .   
        1    728   1   .   .   .   .   .   .   .   4.94   .   .   .   
        1    729   1   .   .   .   .   .   .   .   5.29   .   .   .   
        1    730   1   .   .   .   .   .   .   .   4.88   .   .   .   
        1    731   1   .   .   .   .   .   .   .   4.13   .   .   .   
        1    732   1   .   .   .   .   .   .   .   4.96   .   .   .   
        1    733   1   .   .   .   .   .   .   .   4.71   .   .   .   
        1    734   1   .   .   .   .   .   .   .   4.50   .   .   .   
        1    735   1   .   .   .   .   .   .   .   3.95   .   .   .   
        1    736   1   .   .   .   .   .   .   .   4.22   .   .   .   
        1    737   1   .   .   .   .   .   .   .   5.45   .   .   .   
        1    738   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    739   1   .   .   .   .   .   .   .   4.17   .   .   .   
        1    740   1   .   .   .   .   .   .   .   3.81   .   .   .   
        1    741   1   .   .   .   .   .   .   .   3.78   .   .   .   
        1    742   1   .   .   .   .   .   .   .   4.04   .   .   .   
        1    743   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    744   1   .   .   .   .   .   .   .   4.09   .   .   .   
        1    745   1   .   .   .   .   .   .   .   3.49   .   .   .   
        1    746   1   .   .   .   .   .   .   .   4.09   .   .   .   
        1    747   1   .   .   .   .   .   .   .   2.99   .   .   .   
        1    748   1   .   .   .   .   .   .   .   3.90   .   .   .   
        1    749   1   .   .   .   .   .   .   .   3.30   .   .   .   
        1    750   1   .   .   .   .   .   .   .   3.81   .   .   .   
        1    751   1   .   .   .   .   .   .   .   4.06   .   .   .   
        1    752   1   .   .   .   .   .   .   .   3.46   .   .   .   
        1    753   1   .   .   .   .   .   .   .   3.60   .   .   .   
        1    754   1   .   .   .   .   .   .   .   4.30   .   .   .   
        1    755   1   .   .   .   .   .   .   .   4.59   .   .   .   
        1    756   1   .   .   .   .   .   .   .   4.62   .   .   .   
        1    757   1   .   .   .   .   .   .   .   3.82   .   .   .   
        1    758   1   .   .   .   .   .   .   .   4.24   .   .   .   
        1    759   1   .   .   .   .   .   .   .   5.03   .   .   .   
        1    760   1   .   .   .   .   .   .   .   5.36   .   .   .   
        1    761   1   .   .   .   .   .   .   .   3.87   .   .   .   
        1    762   1   .   .   .   .   .   .   .   3.40   .   .   .   
        1    763   1   .   .   .   .   .   .   .   4.53   .   .   .   
        1    764   1   .   .   .   .   .   .   .   3.12   .   .   .   
        1    765   1   .   .   .   .   .   .   .   4.75   .   .   .   
        1    766   1   .   .   .   .   .   .   .   4.89   .   .   .   
        1    767   1   .   .   .   .   .   .   .   2.81   .   .   .   
        1    768   1   .   .   .   .   .   .   .   3.69   .   .   .   
        1    769   1   .   .   .   .   .   .   .   4.87   .   .   .   
        1    770   1   .   .   .   .   .   .   .   4.37   .   .   .   
        1    771   1   .   .   .   .   .   .   .   3.53   .   .   .   
        1    772   1   .   .   .   .   .   .   .   2.81   .   .   .   
        1    773   1   .   .   .   .   .   .   .   3.20   .   .   .   
        1    774   1   .   .   .   .   .   .   .   2.83   .   .   .   
        1    775   1   .   .   .   .   .   .   .   2.97   .   .   .   
        1    776   1   .   .   .   .   .   .   .   3.09   .   .   .   
        1    777   1   .   .   .   .   .   .   .   5.31   .   .   .   
        1    778   1   .   .   .   .   .   .   .   3.85   .   .   .   
        1    779   1   .   .   .   .   .   .   .   4.65   .   .   .   
        1    780   1   .   .   .   .   .   .   .   4.99   .   .   .   
        1    781   1   .   .   .   .   .   .   .   5.16   .   .   .   
        1    782   1   .   .   .   .   .   .   .   3.50   .   .   .   
        1    783   1   .   .   .   .   .   .   .   4.14   .   .   .   
        1    784   1   .   .   .   .   .   .   .   4.63   .   .   .   
        1    785   1   .   .   .   .   .   .   .   3.15   .   .   .   
        1    786   1   .   .   .   .   .   .   .   3.02   .   .   .   
        1    787   1   .   .   .   .   .   .   .   3.73   .   .   .   
        1    788   1   .   .   .   .   .   .   .   4.13   .   .   .   
        1    789   1   .   .   .   .   .   .   .   4.70   .   .   .   
        1    790   1   .   .   .   .   .   .   .   5.14   .   .   .   
        1    791   1   .   .   .   .   .   .   .   4.75   .   .   .   
        1    792   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    793   1   .   .   .   .   .   .   .   3.35   .   .   .   
        1    794   1   .   .   .   .   .   .   .   3.62   .   .   .   
        1    795   1   .   .   .   .   .   .   .   4.55   .   .   .   
        1    796   1   .   .   .   .   .   .   .   3.79   .   .   .   
        1    797   1   .   .   .   .   .   .   .   4.87   .   .   .   
        1    798   1   .   .   .   .   .   .   .   5.09   .   .   .   
        1    799   1   .   .   .   .   .   .   .   3.27   .   .   .   
        1    800   1   .   .   .   .   .   .   .   5.03   .   .   .   
        1    801   1   .   .   .   .   .   .   .   3.34   .   .   .   
        1    802   1   .   .   .   .   .   .   .   3.43   .   .   .   
        1    803   1   .   .   .   .   .   .   .   4.37   .   .   .   
        1    804   1   .   .   .   .   .   .   .   5.45   .   .   .   
        1    805   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    806   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    807   1   .   .   .   .   .   .   .   4.44   .   .   .   
        1    808   1   .   .   .   .   .   .   .   3.44   .   .   .   
        1    809   1   .   .   .   .   .   .   .   3.45   .   .   .   
        1    810   1   .   .   .   .   .   .   .   4.97   .   .   .   
        1    811   1   .   .   .   .   .   .   .   3.68   .   .   .   
        1    812   1   .   .   .   .   .   .   .   4.78   .   .   .   
        1    813   1   .   .   .   .   .   .   .   4.84   .   .   .   
        1    814   1   .   .   .   .   .   .   .   3.41   .   .   .   
        1    815   1   .   .   .   .   .   .   .   3.36   .   .   .   
        1    816   1   .   .   .   .   .   .   .   4.45   .   .   .   
        1    817   1   .   .   .   .   .   .   .   3.53   .   .   .   
        1    818   1   .   .   .   .   .   .   .   3.45   .   .   .   
        1    819   1   .   .   .   .   .   .   .   3.60   .   .   .   
        1    820   1   .   .   .   .   .   .   .   4.96   .   .   .   
        1    821   1   .   .   .   .   .   .   .   3.38   .   .   .   
        1    822   1   .   .   .   .   .   .   .   4.28   .   .   .   
        1    823   1   .   .   .   .   .   .   .   5.11   .   .   .   
        1    824   1   .   .   .   .   .   .   .   4.44   .   .   .   
        1    825   1   .   .   .   .   .   .   .   5.04   .   .   .   
        1    826   1   .   .   .   .   .   .   .   4.92   .   .   .   
        1    827   1   .   .   .   .   .   .   .   3.69   .   .   .   
        1    828   1   .   .   .   .   .   .   .   4.57   .   .   .   
        1    829   1   .   .   .   .   .   .   .   4.70   .   .   .   
        1    830   1   .   .   .   .   .   .   .   3.59   .   .   .   
        1    831   1   .   .   .   .   .   .   .   4.30   .   .   .   
        1    832   1   .   .   .   .   .   .   .   5.03   .   .   .   
        1    833   1   .   .   .   .   .   .   .   4.32   .   .   .   
        1    834   1   .   .   .   .   .   .   .   4.26   .   .   .   
        1    835   1   .   .   .   .   .   .   .   4.26   .   .   .   
        1    836   1   .   .   .   .   .   .   .   4.79   .   .   .   
        1    837   1   .   .   .   .   .   .   .   2.94   .   .   .   
        1    838   1   .   .   .   .   .   .   .   4.20   .   .   .   
        1    839   1   .   .   .   .   .   .   .   3.48   .   .   .   
        1    840   1   .   .   .   .   .   .   .   4.12   .   .   .   
        1    841   1   .   .   .   .   .   .   .   3.59   .   .   .   
        1    842   1   .   .   .   .   .   .   .   5.09   .   .   .   
        1    843   1   .   .   .   .   .   .   .   5.44   .   .   .   
        1    844   1   .   .   .   .   .   .   .   4.81   .   .   .   
        1    845   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    846   1   .   .   .   .   .   .   .   4.80   .   .   .   
        1    847   1   .   .   .   .   .   .   .   4.38   .   .   .   
        1    848   1   .   .   .   .   .   .   .   4.95   .   .   .   
        1    849   1   .   .   .   .   .   .   .   5.39   .   .   .   
        1    850   1   .   .   .   .   .   .   .   4.40   .   .   .   
        1    851   1   .   .   .   .   .   .   .   3.91   .   .   .   
        1    852   1   .   .   .   .   .   .   .   3.19   .   .   .   
        1    853   1   .   .   .   .   .   .   .   3.80   .   .   .   
        1    854   1   .   .   .   .   .   .   .   3.80   .   .   .   
        1    855   1   .   .   .   .   .   .   .   5.05   .   .   .   
        1    856   1   .   .   .   .   .   .   .   3.97   .   .   .   
        1    857   1   .   .   .   .   .   .   .   3.25   .   .   .   
        1    858   1   .   .   .   .   .   .   .   4.68   .   .   .   
        1    859   1   .   .   .   .   .   .   .   4.61   .   .   .   
        1    860   1   .   .   .   .   .   .   .   5.10   .   .   .   
        1    861   1   .   .   .   .   .   .   .   4.96   .   .   .   
        1    862   1   .   .   .   .   .   .   .   3.43   .   .   .   
        1    863   1   .   .   .   .   .   .   .   4.51   .   .   .   
        1    864   1   .   .   .   .   .   .   .   4.61   .   .   .   
        1    865   1   .   .   .   .   .   .   .   5.10   .   .   .   
        1    866   1   .   .   .   .   .   .   .   3.43   .   .   .   
        1    867   1   .   .   .   .   .   .   .   4.26   .   .   .   
        1    868   1   .   .   .   .   .   .   .   5.02   .   .   .   
        1    869   1   .   .   .   .   .   .   .   4.67   .   .   .   
        1    870   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    871   1   .   .   .   .   .   .   .   4.47   .   .   .   
        1    872   1   .   .   .   .   .   .   .   4.83   .   .   .   
        1    873   1   .   .   .   .   .   .   .   3.96   .   .   .   
        1    874   1   .   .   .   .   .   .   .   4.37   .   .   .   
        1    875   1   .   .   .   .   .   .   .   4.48   .   .   .   
        1    876   1   .   .   .   .   .   .   .   5.08   .   .   .   
        1    877   1   .   .   .   .   .   .   .   3.34   .   .   .   
        1    878   1   .   .   .   .   .   .   .   4.44   .   .   .   
        1    879   1   .   .   .   .   .   .   .   4.53   .   .   .   
        1    880   1   .   .   .   .   .   .   .   4.41   .   .   .   
        1    881   1   .   .   .   .   .   .   .   4.62   .   .   .   
        1    882   1   .   .   .   .   .   .   .   4.43   .   .   .   
        1    883   1   .   .   .   .   .   .   .   3.48   .   .   .   
        1    884   1   .   .   .   .   .   .   .   5.33   .   .   .   
        1    885   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    886   1   .   .   .   .   .   .   .   4.23   .   .   .   
        1    887   1   .   .   .   .   .   .   .   4.24   .   .   .   
        1    888   1   .   .   .   .   .   .   .   3.56   .   .   .   
        1    889   1   .   .   .   .   .   .   .   3.26   .   .   .   
        1    890   1   .   .   .   .   .   .   .   4.08   .   .   .   
        1    891   1   .   .   .   .   .   .   .   2.93   .   .   .   
        1    892   1   .   .   .   .   .   .   .   3.40   .   .   .   
        1    893   1   .   .   .   .   .   .   .   3.19   .   .   .   
        1    894   1   .   .   .   .   .   .   .   4.38   .   .   .   
        1    895   1   .   .   .   .   .   .   .   3.52   .   .   .   
        1    896   1   .   .   .   .   .   .   .   3.69   .   .   .   
        1    897   1   .   .   .   .   .   .   .   3.82   .   .   .   
        1    898   1   .   .   .   .   .   .   .   3.63   .   .   .   
        1    899   1   .   .   .   .   .   .   .   5.26   .   .   .   
        1    900   1   .   .   .   .   .   .   .   4.88   .   .   .   
        1    901   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    902   1   .   .   .   .   .   .   .   4.58   .   .   .   
        1    903   1   .   .   .   .   .   .   .   4.07   .   .   .   
        1    904   1   .   .   .   .   .   .   .   4.00   .   .   .   
        1    905   1   .   .   .   .   .   .   .   4.82   .   .   .   
        1    906   1   .   .   .   .   .   .   .   4.60   .   .   .   
        1    907   1   .   .   .   .   .   .   .   4.85   .   .   .   
        1    908   1   .   .   .   .   .   .   .   4.73   .   .   .   
        1    909   1   .   .   .   .   .   .   .   4.82   .   .   .   
        1    910   1   .   .   .   .   .   .   .   4.22   .   .   .   
        1    911   1   .   .   .   .   .   .   .   4.28   .   .   .   
        1    912   1   .   .   .   .   .   .   .   5.46   .   .   .   
        1    913   1   .   .   .   .   .   .   .   4.30   .   .   .   
        1    914   1   .   .   .   .   .   .   .   3.53   .   .   .   
        1    915   1   .   .   .   .   .   .   .   3.50   .   .   .   
        1    916   1   .   .   .   .   .   .   .   4.06   .   .   .   
        1    917   1   .   .   .   .   .   .   .   4.09   .   .   .   
        1    918   1   .   .   .   .   .   .   .   3.77   .   .   .   
        1    919   1   .   .   .   .   .   .   .   4.74   .   .   .   
        1    920   1   .   .   .   .   .   .   .   4.09   .   .   .   
        1    921   1   .   .   .   .   .   .   .   4.13   .   .   .   
        1    922   1   .   .   .   .   .   .   .   4.60   .   .   .   
        1    923   1   .   .   .   .   .   .   .   4.55   .   .   .   
        1    924   1   .   .   .   .   .   .   .   4.40   .   .   .   
        1    925   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    926   1   .   .   .   .   .   .   .   3.76   .   .   .   
        1    927   1   .   .   .   .   .   .   .   3.91   .   .   .   
        1    928   1   .   .   .   .   .   .   .   5.50   .   .   .   
        1    929   1   .   .   .   .   .   .   .   4.22   .   .   .   
        1    930   1   .   .   .   .   .   .   .   3.77   .   .   .   
        1    931   1   .   .   .   .   .   .   .   5.27   .   .   .   
        1    932   1   .   .   .   .   .   .   .   3.62   .   .   .   
        1    933   1   .   .   .   .   .   .   .   4.64   .   .   .   
        1    934   1   .   .   .   .   .   .   .   3.78   .   .   .   
        1    935   1   .   .   .   .   .   .   .   3.72   .   .   .   
        1    936   1   .   .   .   .   .   .   .   4.62   .   .   .   
        1    937   1   .   .   .   .   .   .   .   4.18   .   .   .   
        1    938   1   .   .   .   .   .   .   .   4.16   .   .   .   
        1    939   1   .   .   .   .   .   .   .   4.56   .   .   .   
        1    940   1   .   .   .   .   .   .   .   4.44   .   .   .   
        1    941   1   .   .   .   .   .   .   .   4.51   .   .   .   
        1    942   1   .   .   .   .   .   .   .   5.23   .   .   .   
        1    943   1   .   .   .   .   .   .   .   3.62   .   .   .   
        1    944   1   .   .   .   .   .   .   .   3.59   .   .   .   
        1    945   1   .   .   .   .   .   .   .   3.85   .   .   .   
        1    946   1   .   .   .   .   .   .   .   4.94   .   .   .   
        1    947   1   .   .   .   .   .   .   .   5.28   .   .   .   
        1    948   1   .   .   .   .   .   .   .   5.07   .   .   .   
        1    949   1   .   .   .   .   .   .   .   3.70   .   .   .   
        1    950   1   .   .   .   .   .   .   .   4.03   .   .   .   
        1    951   1   .   .   .   .   .   .   .   4.07   .   .   .   
        1    952   1   .   .   .   .   .   .   .   4.05   .   .   .   
        1    953   1   .   .   .   .   .   .   .   4.22   .   .   .   
        1    954   1   .   .   .   .   .   .   .   3.48   .   .   .   
        1    955   1   .   .   .   .   .   .   .   5.34   .   .   .   
        1    956   1   .   .   .   .   .   .   .   4.03   .   .   .   
        1    957   1   .   .   .   .   .   .   .   3.71   .   .   .   
        1    958   1   .   .   .   .   .   .   .   3.13   .   .   .   
        1    959   1   .   .   .   .   .   .   .   4.72   .   .   .   
        1    960   1   .   .   .   .   .   .   .   5.34   .   .   .   
        1    961   1   .   .   .   .   .   .   .   4.65   .   .   .   
        1    962   1   .   .   .   .   .   .   .   3.50   .   .   .   
        1    963   1   .   .   .   .   .   .   .   4.03   .   .   .   
        1    964   1   .   .   .   .   .   .   .   3.69   .   .   .   
        1    965   1   .   .   .   .   .   .   .   4.88   .   .   .   
        1    966   1   .   .   .   .   .   .   .   4.55   .   .   .   
        1    967   1   .   .   .   .   .   .   .   3.57   .   .   .   
        1    968   1   .   .   .   .   .   .   .   4.61   .   .   .   
        1    969   1   .   .   .   .   .   .   .   4.11   .   .   .   
        1    970   1   .   .   .   .   .   .   .   3.57   .   .   .   
        1    971   1   .   .   .   .   .   .   .   4.09   .   .   .   
        1    972   1   .   .   .   .   .   .   .   5.34   .   .   .   
        1    973   1   .   .   .   .   .   .   .   4.61   .   .   .   
        1    974   1   .   .   .   .   .   .   .   3.95   .   .   .   
        1    975   1   .   .   .   .   .   .   .   4.34   .   .   .   
        1    976   1   .   .   .   .   .   .   .   4.60   .   .   .   
        1    977   1   .   .   .   .   .   .   .   4.87   .   .   .   
        1    978   1   .   .   .   .   .   .   .   3.35   .   .   .   
        1    979   1   .   .   .   .   .   .   .   4.61   .   .   .   
        1    980   1   .   .   .   .   .   .   .   3.16   .   .   .   
        1    981   1   .   .   .   .   .   .   .   3.42   .   .   .   
        1    982   1   .   .   .   .   .   .   .   4.95   .   .   .   
        1    983   1   .   .   .   .   .   .   .   4.11   .   .   .   
        1    984   1   .   .   .   .   .   .   .   4.53   .   .   .   
        1    985   1   .   .   .   .   .   .   .   3.72   .   .   .   
        1    986   1   .   .   .   .   .   .   .   4.08   .   .   .   
        1    987   1   .   .   .   .   .   .   .   3.52   .   .   .   
        1    988   1   .   .   .   .   .   .   .   3.54   .   .   .   
        1    989   1   .   .   .   .   .   .   .   3.72   .   .   .   
        1    990   1   .   .   .   .   .   .   .   4.83   .   .   .   
        1    991   1   .   .   .   .   .   .   .   3.96   .   .   .   
        1    992   1   .   .   .   .   .   .   .   5.28   .   .   .   
        1    993   1   .   .   .   .   .   .   .   5.28   .   .   .   
        1    994   1   .   .   .   .   .   .   .   3.08   .   .   .   
        1    995   1   .   .   .   .   .   .   .   4.31   .   .   .   
        1    996   1   .   .   .   .   .   .   .   3.47   .   .   .   
        1    997   1   .   .   .   .   .   .   .   4.75   .   .   .   
        1    998   1   .   .   .   .   .   .   .   3.40   .   .   .   
        1    999   1   .   .   .   .   .   .   .   4.20   .   .   .   
        1   1000   1   .   .   .   .   .   .   .   3.29   .   .   .   
        1   1001   1   .   .   .   .   .   .   .   3.30   .   .   .   
        1   1002   1   .   .   .   .   .   .   .   3.95   .   .   .   
        1   1003   1   .   .   .   .   .   .   .   3.13   .   .   .   
        1   1004   1   .   .   .   .   .   .   .   5.11   .   .   .   
        1   1005   1   .   .   .   .   .   .   .   3.85   .   .   .   
        1   1006   1   .   .   .   .   .   .   .   3.78   .   .   .   
        1   1007   1   .   .   .   .   .   .   .   4.59   .   .   .   
        1   1008   1   .   .   .   .   .   .   .   3.54   .   .   .   
        1   1009   1   .   .   .   .   .   .   .   3.22   .   .   .   
        1   1010   1   .   .   .   .   .   .   .   3.48   .   .   .   
        1   1011   1   .   .   .   .   .   .   .   3.34   .   .   .   
        1   1012   1   .   .   .   .   .   .   .   3.91   .   .   .   
        1   1013   1   .   .   .   .   .   .   .   2.87   .   .   .   
        1   1014   1   .   .   .   .   .   .   .   4.06   .   .   .   
        1   1015   1   .   .   .   .   .   .   .   4.44   .   .   .   
        1   1016   1   .   .   .   .   .   .   .   3.70   .   .   .   
        1   1017   1   .   .   .   .   .   .   .   3.92   .   .   .   
        1   1018   1   .   .   .   .   .   .   .   3.77   .   .   .   
        1   1019   1   .   .   .   .   .   .   .   3.74   .   .   .   
        1   1020   1   .   .   .   .   .   .   .   3.37   .   .   .   
        1   1021   1   .   .   .   .   .   .   .   3.91   .   .   .   
        1   1022   1   .   .   .   .   .   .   .   3.30   .   .   .   
        1   1023   1   .   .   .   .   .   .   .   4.68   .   .   .   
        1   1024   1   .   .   .   .   .   .   .   5.02   .   .   .   
        1   1025   1   .   .   .   .   .   .   .   4.28   .   .   .   
        1   1026   1   .   .   .   .   .   .   .   4.14   .   .   .   
        1   1027   1   .   .   .   .   .   .   .   4.50   .   .   .   
        1   1028   1   .   .   .   .   .   .   .   5.06   .   .   .   
        1   1029   1   .   .   .   .   .   .   .   3.33   .   .   .   
        1   1030   1   .   .   .   .   .   .   .   4.90   .   .   .   
        1   1031   1   .   .   .   .   .   .   .   4.07   .   .   .   
        1   1032   1   .   .   .   .   .   .   .   4.28   .   .   .   
        1   1033   1   .   .   .   .   .   .   .   3.23   .   .   .   
        1   1034   1   .   .   .   .   .   .   .   4.24   .   .   .   
        1   1035   1   .   .   .   .   .   .   .   4.64   .   .   .   
        1   1036   1   .   .   .   .   .   .   .   3.31   .   .   .   
        1   1037   1   .   .   .   .   .   .   .   3.41   .   .   .   
        1   1038   1   .   .   .   .   .   .   .   4.86   .   .   .   
        1   1039   1   .   .   .   .   .   .   .   4.93   .   .   .   
        1   1040   1   .   .   .   .   .   .   .   3.58   .   .   .   
        1   1041   1   .   .   .   .   .   .   .   4.26   .   .   .   
        1   1042   1   .   .   .   .   .   .   .   4.06   .   .   .   
        1   1043   1   .   .   .   .   .   .   .   3.02   .   .   .   
        1   1044   1   .   .   .   .   .   .   .   2.77   .   .   .   
        1   1045   1   .   .   .   .   .   .   .   4.46   .   .   .   
        1   1046   1   .   .   .   .   .   .   .   4.87   .   .   .   
        1   1047   1   .   .   .   .   .   .   .   5.13   .   .   .   
        1   1048   1   .   .   .   .   .   .   .   4.39   .   .   .   
        1   1049   1   .   .   .   .   .   .   .   5.44   .   .   .   
        1   1050   1   .   .   .   .   .   .   .   4.27   .   .   .   
        1   1051   1   .   .   .   .   .   .   .   3.50   .   .   .   
        1   1052   1   .   .   .   .   .   .   .   3.53   .   .   .   
        1   1053   1   .   .   .   .   .   .   .   4.19   .   .   .   
        1   1054   1   .   .   .   .   .   .   .   4.34   .   .   .   
        1   1055   1   .   .   .   .   .   .   .   5.14   .   .   .   
        1   1056   1   .   .   .   .   .   .   .   4.04   .   .   .   
        1   1057   1   .   .   .   .   .   .   .   3.49   .   .   .   
        1   1058   1   .   .   .   .   .   .   .   4.09   .   .   .   
        1   1059   1   .   .   .   .   .   .   .   2.96   .   .   .   
        1   1060   1   .   .   .   .   .   .   .   2.93   .   .   .   
        1   1061   1   .   .   .   .   .   .   .   3.47   .   .   .   
        1   1062   1   .   .   .   .   .   .   .   4.70   .   .   .   
        1   1063   1   .   .   .   .   .   .   .   5.44   .   .   .   
        1   1064   1   .   .   .   .   .   .   .   4.10   .   .   .   
        1   1065   1   .   .   .   .   .   .   .   3.68   .   .   .   
        1   1066   1   .   .   .   .   .   .   .   3.67   .   .   .   
        1   1067   1   .   .   .   .   .   .   .   5.03   .   .   .   
        1   1068   1   .   .   .   .   .   .   .   5.03   .   .   .   
        1   1069   1   .   .   .   .   .   .   .   4.38   .   .   .   
        1   1070   1   .   .   .   .   .   .   .   5.16   .   .   .   
        1   1071   1   .   .   .   .   .   .   .   3.89   .   .   .   
        1   1072   1   .   .   .   .   .   .   .   4.58   .   .   .   
        1   1073   1   .   .   .   .   .   .   .   5.34   .   .   .   
        1   1074   1   .   .   .   .   .   .   .   4.25   .   .   .   
        1   1075   1   .   .   .   .   .   .   .   3.94   .   .   .   
        1   1076   1   .   .   .   .   .   .   .   4.67   .   .   .   
        1   1077   1   .   .   .   .   .   .   .   4.39   .   .   .   
        1   1078   1   .   .   .   .   .   .   .   3.64   .   .   .   
        1   1079   1   .   .   .   .   .   .   .   3.18   .   .   .   
        1   1080   1   .   .   .   .   .   .   .   4.22   .   .   .   
        1   1081   1   .   .   .   .   .   .   .   4.01   .   .   .   
        1   1082   1   .   .   .   .   .   .   .   4.40   .   .   .   
        1   1083   1   .   .   .   .   .   .   .   4.87   .   .   .   
        1   1084   1   .   .   .   .   .   .   .   4.41   .   .   .   
        1   1085   1   .   .   .   .   .   .   .   3.56   .   .   .   
        1   1086   1   .   .   .   .   .   .   .   3.89   .   .   .   
        1   1087   1   .   .   .   .   .   .   .   3.53   .   .   .   
        1   1088   1   .   .   .   .   .   .   .   2.77   .   .   .   
        1   1089   1   .   .   .   .   .   .   .   3.86   .   .   .   
        1   1090   1   .   .   .   .   .   .   .   5.15   .   .   .   
        1   1091   1   .   .   .   .   .   .   .   5.34   .   .   .   
        1   1092   1   .   .   .   .   .   .   .   3.19   .   .   .   
        1   1093   1   .   .   .   .   .   .   .   3.30   .   .   .   
        1   1094   1   .   .   .   .   .   .   .   3.87   .   .   .   
        1   1095   1   .   .   .   .   .   .   .   3.42   .   .   .   
        1   1096   1   .   .   .   .   .   .   .   4.58   .   .   .   
        1   1097   1   .   .   .   .   .   .   .   4.41   .   .   .   
        1   1098   1   .   .   .   .   .   .   .   4.73   .   .   .   
        1   1099   1   .   .   .   .   .   .   .   3.13   .   .   .   
        1   1100   1   .   .   .   .   .   .   .   3.42   .   .   .   
        1   1101   1   .   .   .   .   .   .   .   3.87   .   .   .   
        1   1102   1   .   .   .   .   .   .   .   5.03   .   .   .   
        1   1103   1   .   .   .   .   .   .   .   3.17   .   .   .   
        1   1104   1   .   .   .   .   .   .   .   3.37   .   .   .   
        1   1105   1   .   .   .   .   .   .   .   5.01   .   .   .   
    stop_


    loop_
        _Dist_constraint_comment_org.Constraints_ID 
        _Dist_constraint_comment_org.ID 
        _Dist_constraint_comment_org.Comment_begin_line 
        _Dist_constraint_comment_org.Comment_begin_column 
        _Dist_constraint_comment_org.Comment_end_line 
        _Dist_constraint_comment_org.Comment_end_column 
        _Dist_constraint_comment_org.Comment 

        1      1      1   49      1   81   "peak    12 #SUP  0.92  #QF  0.92"    
        1      2      2   49      2   81   "peak    22 #SUP  0.71  #QF  0.71"    
        1      3      3   49      3   81   "peak    38 #SUP  0.84  #QF  0.40"    
        1      4      4   49      4   81   "peak    43 #SUP  0.59  #QF  0.59"    
        1      5      5   49      5   81   "peak    44 #SUP  0.68  #QF  0.68"    
        1      6      6   49      6   81   "peak    48 #SUP  0.78  #QF  0.78"    
        1      7      7   49      7   81   "peak    53 #SUP  0.81  #QF  0.81"    
        1      8      8   49      8   81   "peak    57 #SUP  0.83  #QF  0.83"    
        1      9      9   49      9   81   "peak    58 #SUP  0.70  #QF  0.70"    
        1     10     10   49     10   81   "peak    59 #SUP  0.85  #QF  0.85"    
        1     11     11   49     11   81   "peak    61 #SUP  0.76  #QF  0.24"    
        1     12     12   49     12   81   "peak    70 #SUP  0.82  #QF  0.48"    
        1     13     13   49     13   81   "peak    73 #SUP  0.73  #QF  0.73"    
        1     14     14   49     14   81   "peak    78 #SUP  0.91  #QF  0.91"    
        1     15     15   49     15   81   "peak    79 #SUP  0.74  #QF  0.74"    
        1     16     16   49     16   81   "peak    83 #SUP  0.87  #QF  0.87"    
        1     17     17   49     17   81   "peak    87 #SUP  0.56  #QF  0.56"    
        1     18     18   49     18   81   "peak    88 #SUP  0.96  #QF  0.96"    
        1     19     19   49     19   81   "peak    89 #SUP  0.99  #QF  0.88"    
        1     20     20   49     20   81   "peak    90 #SUP  0.89  #QF  0.89"    
        1     21     21   49     21   81   "peak    91 #SUP  0.90  #QF  0.56"    
        1     22     22   49     22   81   "peak    91 #SUP  0.90  #QF  0.56"    
        1     23     23   49     23   81   "peak    95 #SUP  0.84  #QF  0.70"    
        1     24     24   49     24   81   "peak    96 #SUP  0.98  #QF  0.98"    
        1     25     25   49     25   81   "peak    97 #SUP  0.94  #QF  0.94"    
        1     26     26   49     26   81   "peak   105 #SUP  0.60  #QF  0.60"    
        1     27     27   49     27   81   "peak   112 #SUP  0.77  #QF  0.77"    
        1     28     28   49     28   81   "peak   113 #SUP  0.85  #QF  0.85"    
        1     29     29   49     29   81   "peak   114 #SUP  0.82  #QF  0.82"    
        1     30     30   49     30   81   "peak   116 #SUP  0.85  #QF  0.85"    
        1     31     31   49     31   81   "peak   118 #SUP  0.95  #QF  0.95"    
        1     32     32   49     32   81   "peak   119 #SUP  0.93  #QF  0.93"    
        1     33     33   49     33   81   "peak   120 #SUP  0.90  #QF  0.90"    
        1     34     34   49     34   81   "peak   121 #SUP  0.92  #QF  0.92"    
        1     35     35   49     35   81   "peak   122 #SUP  0.95  #QF  0.55"    
        1     36     36   49     36   81   "peak   126 #SUP  0.86  #QF  0.86"    
        1     37     37   49     37   81   "peak   127 #SUP  0.82  #QF  0.82"    
        1     38     38   49     38   81   "peak   131 #SUP  0.82  #QF  0.82"    
        1     39     39   49     39   81   "peak   132 #SUP  0.82  #QF  0.82"    
        1     40     40   49     40   81   "peak   133 #SUP  0.73  #QF  0.73"    
        1     41     41   49     41   81   "peak   139 #SUP  0.86  #QF  0.86"    
        1     42     42   49     42   81   "peak   140 #SUP  0.86  #QF  0.86"    
        1     43     43   49     43   81   "peak   143 #SUP  0.78  #QF  0.78"    
        1     44     44   49     44   81   "peak   147 #SUP  0.87  #QF  0.87"    
        1     45     45   49     45   81   "peak   161 #SUP  0.93  #QF  0.39"    
        1     46     46   49     46   81   "peak   161 #SUP  0.93  #QF  0.39"    
        1     47     47   49     47   81   "peak   172 #SUP  0.65  #QF  0.65"    
        1     48     48   49     48   81   "peak   173 #SUP  0.67  #QF  0.67"    
        1     49     49   49     49   81   "peak   174 #SUP  0.73  #QF  0.73"    
        1     50     50   49     50   81   "peak   175 #SUP  0.82  #QF  0.82"    
        1     51     51   49     51   81   "peak   176 #SUP  0.63  #QF  0.63"    
        1     52     52   49     52   81   "peak   182 #SUP  0.83  #QF  0.83"    
        1     53     53   49     53   81   "peak   183 #SUP  0.98  #QF  0.98"    
        1     54     54   49     54   81   "peak   184 #SUP  0.76  #QF  0.76"    
        1     55     55   49     55   81   "peak   185 #SUP  0.96  #QF  0.96"    
        1     56     56   49     56   81   "peak   186 #SUP  0.90  #QF  0.90"    
        1     57     57   49     57   81   "peak   188 #SUP  0.91  #QF  0.91"    
        1     58     58   49     58   81   "peak   190 #SUP  0.82  #QF  0.82"    
        1     59     59   49     59   81   "peak   191 #SUP  0.92  #QF  0.92"    
        1     60     60   49     60   81   "peak   199 #SUP  0.87  #QF  0.87"    
        1     61     61   49     61   81   "peak   200 #SUP  0.83  #QF  0.83"    
        1     62     62   49     62   81   "peak   201 #SUP  0.84  #QF  0.84"    
        1     63     63   49     63   81   "peak   202 #SUP  0.90  #QF  0.90"    
        1     64     64   49     64   81   "peak   203 #SUP  0.88  #QF  0.88"    
        1     65     65   49     65   81   "peak   205 #SUP  0.94  #QF  0.23"    
        1     66     66   49     66   81   "peak   205 #SUP  0.94  #QF  0.23"    
        1     67     67   49     67   81   "peak   207 #SUP  0.97  #QF  0.85"    
        1     68     68   49     68   81   "peak   208 #SUP  0.96  #QF  0.63"    
        1     69     69   49     69   81   "peak   211 #SUP  0.62  #QF  0.62"    
        1     70     70   49     70   81   "peak   212 #SUP  0.62  #QF  0.62"    
        1     71     71   49     71   81   "peak   213 #SUP  0.50  #QF  0.50"    
        1     72     72   49     72   81   "peak   217 #SUP  0.76  #QF  0.76"    
        1     73     73   49     73   81   "peak   218 #SUP  0.78  #QF  0.78"    
        1     74     74   49     74   81   "peak   219 #SUP  0.74  #QF  0.74"    
        1     75     75   49     75   81   "peak   222 #SUP  0.35  #QF  0.35"    
        1     76     76   49     76   81   "peak   225 #SUP  0.73  #QF  0.48"    
        1     77     77   49     77   81   "peak   225 #SUP  0.73  #QF  0.48"    
        1     78     78   49     78   81   "peak   226 #SUP  0.77  #QF  0.77"    
        1     79     79   49     79   81   "peak   227 #SUP  0.84  #QF  0.84"    
        1     80     80   49     80   81   "peak   228 #SUP  0.84  #QF  0.84"    
        1     81     81   49     81   81   "peak   235 #SUP  0.85  #QF  0.85"    
        1     82     82   49     82   81   "peak   240 #SUP  0.76  #QF  0.76"    
        1     83     83   49     83   81   "peak   241 #SUP  0.88  #QF  0.88"    
        1     84     84   49     84   81   "peak   242 #SUP  0.81  #QF  0.81"    
        1     85     85   49     85   81   "peak   244 #SUP  0.89  #QF  0.89"    
        1     86     86   49     86   81   "peak   252 #SUP  0.49  #QF  0.49"    
        1     87     87   49     87   81   "peak   253 #SUP  0.79  #QF  0.79"    
        1     88     88   49     88   81   "peak   262 #SUP  0.73  #QF  0.73"    
        1     89     89   49     89   81   "peak   263 #SUP  0.80  #QF  0.80"    
        1     90     90   49     90   81   "peak   264 #SUP  0.57  #QF  0.57"    
        1     91     91   49     91   81   "peak   265 #SUP  0.68  #QF  0.68"    
        1     92     92   49     92   81   "peak   266 #SUP  0.67  #QF  0.67"    
        1     93     93   49     93   81   "peak   267 #SUP  0.80  #QF  0.80"    
        1     94     94   49     94   81   "peak   268 #SUP  0.85  #QF  0.85"    
        1     95     95   49     95   81   "peak   270 #SUP  0.73  #QF  0.73"    
        1     96     96   49     96   81   "peak   272 #SUP  0.90  #QF  0.45"    
        1     97     97   49     97   81   "peak   275 #SUP  0.62  #QF  0.62"    
        1     98     98   49     98   81   "peak   282 #SUP  0.89  #QF  0.89"    
        1     99     99   49     99   81   "peak   284 #SUP  0.90  #QF  0.90"    
        1    100    100   49    100   81   "peak   287 #SUP  0.74  #QF  0.38"    
        1    101    101   49    101   81   "peak   290 #SUP  0.82  #QF  0.82"    
        1    102    102   49    102   81   "peak   291 #SUP  0.93  #QF  0.93"    
        1    103    103   49    103   81   "peak   292 #SUP  0.64  #QF  0.40"    
        1    104    104   49    104   81   "peak   292 #SUP  0.64  #QF  0.40"    
        1    105    105   49    105   81   "peak   298 #SUP  0.58  #QF  0.58"    
        1    106    106   49    106   81   "peak   299 #SUP  0.79  #QF  0.79"    
        1    107    107   49    107   81   "peak   303 #SUP  0.94  #QF  0.94"    
        1    108    108   49    108   81   "peak   304 #SUP  0.89  #QF  0.89"    
        1    109    109   49    109   81   "peak   305 #SUP  0.86  #QF  0.86"    
        1    110    110   49    110   81   "peak   306 #SUP  0.82  #QF  0.82"    
        1    111    111   49    111   81   "peak   307 #SUP  0.80  #QF  0.80"    
        1    112    112   49    112   81   "peak   308 #SUP  0.96  #QF  0.75"    
        1    113    113   49    113   81   "peak   308 #SUP  0.96  #QF  0.75"    
        1    114    114   49    114   81   "peak   313 #SUP  0.87  #QF  0.87"    
        1    115    115   49    115   81   "peak   314 #SUP  0.92  #QF  0.92"    
        1    116    116   49    116   81   "peak   315 #SUP  0.86  #QF  0.86"    
        1    117    117   49    117   81   "peak   316 #SUP  0.34  #QF  0.34"    
        1    118    118   49    118   81   "peak   319 #SUP  0.34  #QF  0.34"    
        1    119    119   49    119   81   "peak   320 #SUP  0.59  #QF  0.59"    
        1    120    120   49    120   81   "peak   321 #SUP  0.95  #QF  0.95"    
        1    121    121   49    121   81   "peak   323 #SUP  0.43  #QF  0.43"    
        1    122    122   49    122   81   "peak   326 #SUP  0.77  #QF  0.77"    
        1    123    123   49    123   81   "peak   329 #SUP  0.60  #QF  0.60"    
        1    124    124   49    124   81   "peak   330 #SUP  0.98  #QF  0.88"    
        1    125    125   49    125   81   "peak   330 #SUP  0.98  #QF  0.88"    
        1    126    126   49    126   81   "peak   331 #SUP  0.66  #QF  0.43"    
        1    127    127   49    127   81   "peak   332 #SUP  0.70  #QF  0.70"    
        1    128    128   49    128   81   "peak   334 #SUP  0.57  #QF  0.57"    
        1    129    129   49    129   81   "peak   336 #SUP  0.68  #QF  0.68"    
        1    130    130   49    130   81   "peak   337 #SUP  0.68  #QF  0.68"    
        1    131    131   49    131   81   "peak   338 #SUP  0.92  #QF  0.72"    
        1    132    132   49    132   81   "peak   338 #SUP  0.92  #QF  0.72"    
        1    133    133   49    133   81   "peak   339 #SUP  0.86  #QF  0.86"    
        1    134    134   49    134   81   "peak   344 #SUP  0.76  #QF  0.76"    
        1    135    135   49    135   81   "peak   345 #SUP  0.75  #QF  0.75"    
        1    136    136   49    136   81   "peak   346 #SUP  0.92  #QF  0.76"    
        1    137    137   49    137   81   "peak   353 #SUP  0.78  #QF  0.78"    
        1    138    138   49    138   81   "peak   358 #SUP  0.76  #QF  0.76"    
        1    139    139   49    139   81   "peak   362 #SUP  0.79  #QF  0.55"    
        1    140    140   49    140   81   "peak   364 #SUP  0.74  #QF  0.74"    
        1    141    141   49    141   81   "peak   366 #SUP  0.92  #QF  0.92"    
        1    142    142   49    142   81   "peak   367 #SUP  0.91  #QF  0.91"    
        1    143    143   49    143   81   "peak   373 #SUP  0.74  #QF  0.27"    
        1    144    144   49    144   81   "peak   374 #SUP  0.92  #QF  0.36"    
        1    145    145   49    145   81   "peak   375 #SUP  0.85  #QF  0.85"    
        1    146    146   49    146   81   "peak   376 #SUP  0.96  #QF  0.96"    
        1    147    147   49    147   81   "peak   384 #SUP  0.93  #QF  0.25"    
        1    148    148   49    148   81   "peak   385 #SUP  0.82  #QF  0.82"    
        1    149    149   49    149   81   "peak   389 #SUP  0.96  #QF  0.90"    
        1    150    150   49    150   81   "peak   393 #SUP  0.96  #QF  0.96"    
        1    151    151   49    151   81   "peak   394 #SUP  0.68  #QF  0.68"    
        1    152    152   49    152   81   "peak   395 #SUP  0.63  #QF  0.63"    
        1    153    153   49    153   81   "peak   403 #SUP  0.78  #QF  0.78"    
        1    154    154   49    154   81   "peak   407 #SUP  0.98  #QF  0.98"    
        1    155    155   49    155   81   "peak   409 #SUP  0.98  #QF  0.83"    
        1    156    156   49    156   81   "peak   409 #SUP  0.98  #QF  0.83"    
        1    157    157   49    157   81   "peak   410 #SUP  0.41  #QF  0.41"    
        1    158    158   49    158   81   "peak   418 #SUP  0.41  #QF  0.41"    
        1    159    159   49    159   81   "peak   427 #SUP  0.36  #QF  0.36"    
        1    160    160   49    160   81   "peak   433 #SUP  0.56  #QF  0.56"    
        1    161    161   49    161   81   "peak   434 #SUP  0.89  #QF  0.89"    
        1    162    162   49    162   81   "peak   435 #SUP  0.94  #QF  0.94"    
        1    163    163   49    163   81   "peak   436 #SUP  0.70  #QF  0.49"    
        1    164    164   49    164   81   "peak   436 #SUP  0.70  #QF  0.49"    
        1    165    165   49    165   81   "peak   439 #SUP  0.91  #QF  0.91"    
        1    166    166   49    166   81   "peak   440 #SUP  0.90  #QF  0.90"    
        1    167    167   49    167   81   "peak   441 #SUP  0.92  #QF  0.92"    
        1    168    168   49    168   81   "peak   443 #SUP  0.47  #QF  0.47"    
        1    169    169   49    169   81   "peak   447 #SUP  0.64  #QF  0.64"    
        1    170    170   49    170   81   "peak   451 #SUP  0.88  #QF  0.42"    
        1    171    171   49    171   81   "peak   451 #SUP  0.88  #QF  0.42"    
        1    172    172   49    172   81   "peak   452 #SUP  0.76  #QF  0.76"    
        1    173    173   49    173   81   "peak   453 #SUP  0.74  #QF  0.74"    
        1    174    174   49    174   81   "peak   456 #SUP  0.38  #QF  0.38"    
        1    175    175   49    175   81   "peak   459 #SUP  0.91  #QF  0.91"    
        1    176    176   49    176   81   "peak   461 #SUP  0.34  #QF  0.34"    
        1    177    177   49    177   81   "peak   462 #SUP  0.64  #QF  0.64"    
        1    178    178   49    178   81   "peak   463 #SUP  0.79  #QF  0.79"    
        1    179    179   49    179   81   "peak   466 #SUP  0.96  #QF  0.93"    
        1    180    180   49    180   81   "peak   467 #SUP  0.86  #QF  0.86"    
        1    181    181   49    181   81   "peak   468 #SUP  0.74  #QF  0.61"    
        1    182    182   49    182   81   "peak   469 #SUP  0.79  #QF  0.79"    
        1    183    183   49    183   81   "peak   473 #SUP  0.76  #QF  0.76"    
        1    184    184   49    184   81   "peak   475 #SUP  0.79  #QF  0.79"    
        1    185    185   49    185   81   "peak   477 #SUP  0.43  #QF  0.43"    
        1    186    186   49    186   81   "peak   479 #SUP  0.78  #QF  0.78"    
        1    187    187   49    187   81   "peak   480 #SUP  0.85  #QF  0.85"    
        1    188    188   49    188   81   "peak   481 #SUP  0.79  #QF  0.79"    
        1    189    189   49    189   81   "peak   482 #SUP  0.69  #QF  0.69"    
        1    190    190   49    190   81   "peak   483 #SUP  0.76  #QF  0.76"    
        1    191    191   49    191   81   "peak   485 #SUP  0.73  #QF  0.73"    
        1    192    192   49    192   81   "peak   486 #SUP  0.34  #QF  0.34"    
        1    193    193   49    193   81   "peak   489 #SUP  0.87  #QF  0.87"    
        1    194    194   49    194   81   "peak   490 #SUP  0.76  #QF  0.36"    
        1    195    195   49    195   81   "peak   490 #SUP  0.76  #QF  0.36"    
        1    196    196   49    196   81   "peak   491 #SUP  0.95  #QF  0.95"    
        1    197    197   49    197   81   "peak   493 #SUP  0.94  #QF  0.94"    
        1    198    198   49    198   81   "peak   495 #SUP  0.94  #QF  0.94"    
        1    199    199   49    199   81   "peak   496 #SUP  0.99  #QF  0.99"    
        1    200    200   49    200   81   "peak   497 #SUP  0.72  #QF  0.72"    
        1    201    201   49    201   81   "peak   501 #SUP  0.94  #QF  0.94"    
        1    202    202   49    202   81   "peak   502 #SUP  0.80  #QF  0.61"    
        1    203    203   49    203   81   "peak   506 #SUP  0.75  #QF  0.75"    
        1    204    204   49    204   81   "peak   507 #SUP  0.57  #QF  0.57"    
        1    205    205   49    205   81   "peak   508 #SUP  0.57  #QF  0.57"    
        1    206    206   49    206   81   "peak   511 #SUP  0.81  #QF  0.81"    
        1    207    207   49    207   81   "peak   513 #SUP  0.65  #QF  0.65"    
        1    208    208   49    208   81   "peak   514 #SUP  0.82  #QF  0.82"    
        1    209    209   49    209   81   "peak   517 #SUP  0.84  #QF  0.84"    
        1    210    210   49    210   81   "peak   518 #SUP  0.82  #QF  0.82"    
        1    211    211   49    211   81   "peak   520 #SUP  0.83  #QF  0.83"    
        1    212    212   49    212   81   "peak   521 #SUP  0.99  #QF  0.98"    
        1    213    213   49    213   81   "peak   521 #SUP  0.99  #QF  0.98"    
        1    214    214   49    214   81   "peak   523 #SUP  0.75  #QF  0.66"    
        1    215    215   49    215   81   "peak   525 #SUP  0.91  #QF  0.91"    
        1    216    216   49    216   81   "peak   526 #SUP  0.98  #QF  0.98"    
        1    217    217   49    217   81   "peak   528 #SUP  0.91  #QF  0.91"    
        1    218    218   49    218   81   "peak   533 #SUP  0.80  #QF  0.80"    
        1    219    219   49    219   81   "peak   534 #SUP  0.55  #QF  0.55"    
        1    220    220   49    220   81   "peak   536 #SUP  0.93  #QF  0.67"    
        1    221    221   49    221   81   "peak   538 #SUP  0.80  #QF  0.80"    
        1    222    222   49    222   81   "peak   547 #SUP  0.87  #QF  0.87"    
        1    223    223   49    223   81   "peak   551 #SUP  0.66  #QF  0.66"    
        1    224    224   49    224   81   "peak   553 #SUP  0.94  #QF  0.87"    
        1    225    225   49    225   81   "peak   553 #SUP  0.94  #QF  0.87"    
        1    226    226   49    226   81   "peak   554 #SUP  0.94  #QF  0.94"    
        1    227    227   49    227   81   "peak   557 #SUP  0.82  #QF  0.82"    
        1    228    228   49    228   81   "peak   558 #SUP  0.93  #QF  0.93"    
        1    229    229   49    229   81   "peak   559 #SUP  0.76  #QF  0.76"    
        1    230    230   49    230   81   "peak   560 #SUP  0.80  #QF  0.35"    
        1    231    231   49    231   81   "peak   560 #SUP  0.80  #QF  0.35"    
        1    232    232   49    232   81   "peak   565 #SUP  0.68  #QF  0.68"    
        1    233    233   49    233   81   "peak   571 #SUP  0.73  #QF  0.73"    
        1    234    234   49    234   81   "peak   572 #SUP  0.69  #QF  0.69"    
        1    235    235   49    235   81   "peak   574 #SUP  0.68  #QF  0.68"    
        1    236    236   49    236   81   "peak   578 #SUP  0.64  #QF  0.64"    
        1    237    237   49    237   81   "peak   579 #SUP  0.97  #QF  0.97"    
        1    238    238   49    238   81   "peak   581 #SUP  0.73  #QF  0.73"    
        1    239    239   49    239   81   "peak   585 #SUP  0.72  #QF  0.72"    
        1    240    240   49    240   81   "peak   586 #SUP  0.92  #QF  0.92"    
        1    241    241   49    241   81   "peak   587 #SUP  0.68  #QF  0.68"    
        1    242    242   49    242   81   "peak   588 #SUP  0.59  #QF  0.59"    
        1    243    243   49    243   81   "peak   590 #SUP  0.88  #QF  0.88"    
        1    244    244   49    244   81   "peak   591 #SUP  0.68  #QF  0.68"    
        1    245    245   49    245   81   "peak   594 #SUP  0.86  #QF  0.86"    
        1    246    246   49    246   81   "peak   598 #SUP  0.76  #QF  0.76"    
        1    247    247   49    247   81   "peak   601 #SUP  0.77  #QF  0.77"    
        1    248    248   49    248   81   "peak   602 #SUP  0.72  #QF  0.72"    
        1    249    249   49    249   81   "peak   606 #SUP  0.77  #QF  0.77"    
        1    250    250   49    250   81   "peak   608 #SUP  0.90  #QF  0.61"    
        1    251    251   49    251   81   "peak   609 #SUP  0.87  #QF  0.87"    
        1    252    252   49    252   81   "peak   610 #SUP  0.87  #QF  0.87"    
        1    253    253   49    253   81   "peak   613 #SUP  0.78  #QF  0.78"    
        1    254    254   49    254   81   "peak   616 #SUP  0.81  #QF  0.81"    
        1    255    255   49    255   81   "peak   619 #SUP  0.89  #QF  0.89"    
        1    256    256   49    256   81   "peak   620 #SUP  0.79  #QF  0.79"    
        1    257    257   49    257   81   "peak   624 #SUP  0.88  #QF  0.65"    
        1    258    258   49    258   81   "peak   627 #SUP  0.81  #QF  0.42"    
        1    259    259   49    259   81   "peak   628 #SUP  0.95  #QF  0.95"    
        1    260    260   49    260   81   "peak   629 #SUP  0.84  #QF  0.35"    
        1    261    261   49    261   81   "peak   629 #SUP  0.84  #QF  0.35"    
        1    262    262   49    262   81   "peak   633 #SUP  0.84  #QF  0.84"    
        1    263    263   49    263   81   "peak   645 #SUP  0.86  #QF  0.81"    
        1    264    264   49    264   81   "peak   646 #SUP  0.94  #QF  0.66"    
        1    265    265   49    265   81   "peak   647 #SUP  0.76  #QF  0.76"    
        1    266    266   49    266   81   "peak   650 #SUP  0.81  #QF  0.37"    
        1    267    267   49    267   81   "peak   650 #SUP  0.81  #QF  0.37"    
        1    268    268   49    268   81   "peak   651 #SUP  0.91  #QF  0.69"    
        1    269    269   49    269   81   "peak   652 #SUP  0.97  #QF  0.90"    
        1    270    270   49    270   81   "peak   652 #SUP  0.97  #QF  0.90"    
        1    271    271   49    271   81   "peak   657 #SUP  0.36  #QF  0.36"    
        1    272    272   49    272   81   "peak   658 #SUP  0.94  #QF  0.76"    
        1    273    273   49    273   81   "peak   659 #SUP  0.76  #QF  0.76"    
        1    274    274   49    274   81   "peak   660 #SUP  0.76  #QF  0.76"    
        1    275    275   49    275   81   "peak   661 #SUP  0.95  #QF  0.53"    
        1    276    276   49    276   81   "peak   661 #SUP  0.95  #QF  0.53"    
        1    277    277   49    277   81   "peak   666 #SUP  0.57  #QF  0.57"    
        1    278    278   49    278   81   "peak   668 #SUP  0.55  #QF  0.55"    
        1    279    279   49    279   81   "peak   670 #SUP  0.49  #QF  0.49"    
        1    280    280   49    280   81   "peak   674 #SUP  0.87  #QF  0.87"    
        1    281    281   49    281   81   "peak   675 #SUP  0.87  #QF  0.87"    
        1    282    282   49    282   81   "peak   682 #SUP  0.94  #QF  0.69"    
        1    283    283   49    283   81   "peak   684 #SUP  0.91  #QF  0.43"    
        1    284    284   49    284   81   "peak   688 #SUP  0.57  #QF  0.57"    
        1    285    285   49    285   81   "peak   689 #SUP  0.83  #QF  0.37"    
        1    286    286   49    286   81   "peak   696 #SUP  0.62  #QF  0.62"    
        1    287    287   49    287   81   "peak   697 #SUP  0.84  #QF  0.44"    
        1    288    288   49    288   81   "peak   699 #SUP  0.70  #QF  0.70"    
        1    289    289   49    289   81   "peak   706 #SUP  0.71  #QF  0.23"    
        1    290    290   49    290   81   "peak   709 #SUP  0.89  #QF  0.70"    
        1    291    291   49    291   81   "peak   710 #SUP  0.87  #QF  0.87"    
        1    292    292   49    292   81   "peak   711 #SUP  0.90  #QF  0.90"    
        1    293    293   49    293   81   "peak   712 #SUP  0.91  #QF  0.91"    
        1    294    294   49    294   81   "peak   715 #SUP  0.88  #QF  0.88"    
        1    295    295   49    295   81   "peak   719 #SUP  0.79  #QF  0.79"    
        1    296    296   49    296   81   "peak   721 #SUP  0.83  #QF  0.78"    
        1    297    297   49    297   81   "peak   724 #SUP  0.75  #QF  0.75"    
        1    298    298   49    298   81   "peak   727 #SUP  1.00  #QF  0.88"    
        1    299    299   49    299   81   "peak   730 #SUP  0.74  #QF  0.74"    
        1    300    300   49    300   70   "peak   731 #SUP  1.00"               
        1    301    301   49    301   81   "peak   732 #SUP  0.79  #QF  0.79"    
        1    302    302   49    302   81   "peak   736 #SUP  0.80  #QF  0.80"    
        1    303    303   49    303   81   "peak   737 #SUP  0.50  #QF  0.50"    
        1    304    304   49    304   81   "peak   738 #SUP  0.93  #QF  0.83"    
        1    305    305   49    305   81   "peak   738 #SUP  0.93  #QF  0.83"    
        1    306    306   49    306   81   "peak   739 #SUP  0.69  #QF  0.69"    
        1    307    307   49    307   81   "peak   740 #SUP  0.82  #QF  0.61"    
        1    308    308   49    308   81   "peak   740 #SUP  0.82  #QF  0.61"    
        1    309    309   49    309   81   "peak   742 #SUP  0.68  #QF  0.68"    
        1    310    310   49    310   81   "peak   745 #SUP  0.75  #QF  0.75"    
        1    311    311   49    311   81   "peak   746 #SUP  0.78  #QF  0.78"    
        1    312    312   49    312   81   "peak   748 #SUP  0.75  #QF  0.37"    
        1    313    313   49    313   81   "peak   750 #SUP  0.80  #QF  0.80"    
        1    314    314   49    314   81   "peak   751 #SUP  0.80  #QF  0.80"    
        1    315    315   49    315   81   "peak   755 #SUP  0.82  #QF  0.82"    
        1    316    316   49    316   81   "peak   756 #SUP  0.94  #QF  0.94"    
        1    317    317   49    317   81   "peak   758 #SUP  0.76  #QF  0.39"    
        1    318    318   49    318   81   "peak   760 #SUP  0.88  #QF  0.88"    
        1    319    319   49    319   81   "peak   771 #SUP  0.79  #QF  0.79"    
        1    320    320   49    320   81   "peak   772 #SUP  0.96  #QF  0.72"    
        1    321    321   49    321   81   "peak   777 #SUP  0.61  #QF  0.61"    
        1    322    322   49    322   81   "peak   778 #SUP  0.67  #QF  0.67"    
        1    323    323   49    323   81   "peak   779 #SUP  0.75  #QF  0.75"    
        1    324    324   49    324   81   "peak   780 #SUP  0.73  #QF  0.73"    
        1    325    325   49    325   81   "peak   782 #SUP  0.51  #QF  0.51"    
        1    326    326   49    326   81   "peak   792 #SUP  0.56  #QF  0.56"    
        1    327    327   49    327   81   "peak   793 #SUP  0.48  #QF  0.48"    
        1    328    328   49    328   81   "peak   796 #SUP  0.64  #QF  0.64"    
        1    329    329   49    329   81   "peak   798 #SUP  0.44  #QF  0.44"    
        1    330    330   49    330   81   "peak   800 #SUP  0.72  #QF  0.72"    
        1    331    331   49    331   81   "peak   801 #SUP  0.56  #QF  0.56"    
        1    332    332   49    332   81   "peak   803 #SUP  0.28  #QF  0.28"    
        1    333    333   49    333   81   "peak   804 #SUP  0.69  #QF  0.26"    
        1    334    334   49    334   81   "peak   804 #SUP  0.69  #QF  0.26"    
        1    335    335   49    335   81   "peak   806 #SUP  0.74  #QF  0.41"    
        1    336    336   49    336   81   "peak   809 #SUP  0.73  #QF  0.73"    
        1    337    337   49    337   81   "peak   810 #SUP  0.81  #QF  0.81"    
        1    338    338   49    338   81   "peak   811 #SUP  0.83  #QF  0.83"    
        1    339    339   49    339   81   "peak   815 #SUP  0.32  #QF  0.32"    
        1    340    340   49    340   81   "peak   816 #SUP  0.60  #QF  0.60"    
        1    341    341   49    341   81   "peak   826 #SUP  0.89  #QF  0.89"    
        1    342    342   49    342   81   "peak     2 #SUP  0.89  #QF  0.89"    
        1    343    343   49    343   81   "peak     5 #SUP  0.92  #QF  0.92"    
        1    344    344   49    344   81   "peak    10 #SUP  0.57  #QF  0.57"    
        1    345    345   49    345   81   "peak    11 #SUP  0.63  #QF  0.63"    
        1    346    346   49    346   81   "peak    13 #SUP  0.68  #QF  0.68"    
        1    347    347   49    347   81   "peak    14 #SUP  0.96  #QF  0.96"    
        1    348    348   49    348   81   "peak    15 #SUP  0.90  #QF  0.90"    
        1    349    349   49    349   81   "peak    16 #SUP  0.99  #QF  0.61"    
        1    350    350   49    350   81   "peak    16 #SUP  0.99  #QF  0.61"    
        1    351    351   49    351   81   "peak    17 #SUP  0.81  #QF  0.81"    
        1    352    352   49    352   81   "peak    18 #SUP  0.80  #QF  0.80"    
        1    353    353   49    353   81   "peak    20 #SUP  0.91  #QF  0.91"    
        1    354    354   49    354   81   "peak    23 #SUP  0.87  #QF  0.50"    
        1    355    355   49    355   81   "peak    24 #SUP  0.92  #QF  0.92"    
        1    356    356   49    356   81   "peak    25 #SUP  0.42  #QF  0.42"    
        1    357    357   49    357   81   "peak    28 #SUP  0.85  #QF  0.85"    
        1    358    358   49    358   81   "peak    31 #SUP  0.38  #QF  0.38"    
        1    359    359   49    359   70   "peak    32 #SUP  1.00"               
        1    360    360   49    360   81   "peak    36 #SUP  0.90  #QF  0.90"    
        1    361    361   49    361   81   "peak    37 #SUP  0.94  #QF  0.94"    
        1    362    362   49    362   81   "peak    38 #SUP  0.70  #QF  0.70"    
        1    363    363   49    363   81   "peak    40 #SUP  1.00  #QF  0.83"    
        1    364    364   49    364   81   "peak    41 #SUP  0.76  #QF  0.23"    
        1    365    365   49    365   81   "peak    42 #SUP  0.96  #QF  0.96"    
        1    366    366   49    366   81   "peak    48 #SUP  0.89  #QF  0.89"    
        1    367    367   49    367   81   "peak    51 #SUP  0.71  #QF  0.71"    
        1    368    368   49    368   81   "peak    53 #SUP  0.63  #QF  0.63"    
        1    369    369   49    369   81   "peak    54 #SUP  0.94  #QF  0.94"    
        1    370    370   49    370   81   "peak    57 #SUP  0.91  #QF  0.91"    
        1    371    371   49    371   81   "peak    60 #SUP  0.60  #QF  0.60"    
        1    372    372   49    372   81   "peak    61 #SUP  0.64  #QF  0.64"    
        1    373    373   49    373   81   "peak    70 #SUP  0.38  #QF  0.38"    
        1    374    374   49    374   81   "peak    72 #SUP  0.88  #QF  0.88"    
        1    375    375   49    375   81   "peak    73 #SUP  0.39  #QF  0.39"    
        1    376    376   49    376   81   "peak    74 #SUP  0.97  #QF  0.97"    
        1    377    377   49    377   81   "peak    75 #SUP  0.83  #QF  0.83"    
        1    378    378   49    378   81   "peak    85 #SUP  0.71  #QF  0.71"    
        1    379    379   49    379   81   "peak    86 #SUP  0.91  #QF  0.91"    
        1    380    380   49    380   81   "peak    87 #SUP  0.79  #QF  0.79"    
        1    381    381   49    381   81   "peak    90 #SUP  0.98  #QF  0.98"    
        1    382    382   49    382   81   "peak    93 #SUP  0.48  #QF  0.48"    
        1    383    383   49    383   81   "peak    96 #SUP  0.88  #QF  0.26"    
        1    384    384   49    384   81   "peak    96 #SUP  0.88  #QF  0.26"    
        1    385    385   49    385   81   "peak    97 #SUP  0.95  #QF  0.95"    
        1    386    386   49    386   81   "peak    98 #SUP  0.59  #QF  0.59"    
        1    387    387   49    387   81   "peak    99 #SUP  0.94  #QF  0.94"    
        1    388    388   49    388   81   "peak   100 #SUP  1.00  #QF  0.89"    
        1    389    389   49    389   81   "peak   100 #SUP  1.00  #QF  0.89"    
        1    390    390   49    390   81   "peak   107 #SUP  0.75  #QF  0.75"    
        1    391    391   49    391   81   "peak   110 #SUP  0.22  #QF  0.22"    
        1    392    392   49    392   81   "peak   111 #SUP  0.22  #QF  0.22"    
        1    393    393   49    393   81   "peak   113 #SUP  0.35  #QF  0.35"    
        1    394    394   49    394   81   "peak   115 #SUP  0.45  #QF  0.30"    
        1    395    395   49    395   81   "peak   116 #SUP  0.91  #QF  0.32"    
        1    396    396   49    396   81   "peak   117 #SUP  0.94  #QF  0.84"    
        1    397    397   49    397   81   "peak   125 #SUP  0.88  #QF  0.88"    
        1    398    398   49    398   81   "peak   128 #SUP  0.35  #QF  0.35"    
        1    399    399   49    399   81   "peak   138 #SUP  0.21  #QF  0.21"    
        1    400    400   49    400   81   "peak   147 #SUP  0.75  #QF  0.75"    
        1    401    401   49    401   81   "peak   150 #SUP  0.76  #QF  0.76"    
        1    402    402   49    402   81   "peak   157 #SUP  0.73  #QF  0.44"    
        1    403    403   49    403   81   "peak   160 #SUP  0.59  #QF  0.59"    
        1    404    404   49    404   81   "peak   162 #SUP  0.88  #QF  0.88"    
        1    405    405   49    405   81   "peak   164 #SUP  0.51  #QF  0.51"    
        1    406    406   49    406   81   "peak   165 #SUP  0.69  #QF  0.69"    
        1    407    407   49    407   81   "peak   169 #SUP  0.74  #QF  0.74"    
        1    408    408   49    408   81   "peak   171 #SUP  0.90  #QF  0.90"    
        1    409    409   49    409   81   "peak   176 #SUP  0.97  #QF  0.74"    
        1    410    410   49    410   81   "peak   178 #SUP  0.76  #QF  0.41"    
        1    411    411   49    411   81   "peak   178 #SUP  0.76  #QF  0.41"    
        1    412    412   49    412   81   "peak   179 #SUP  0.99  #QF  0.71"    
        1    413    413   49    413   81   "peak   179 #SUP  0.99  #QF  0.71"    
        1    414    414   49    414   81   "peak   181 #SUP  0.91  #QF  0.76"    
        1    415    415   49    415   81   "peak   182 #SUP  0.66  #QF  0.66"    
        1    416    416   49    416   81   "peak   191 #SUP  0.98  #QF  0.43"    
        1    417    417   49    417   81   "peak   193 #SUP  0.78  #QF  0.22"    
        1    418    418   49    418   81   "peak   194 #SUP  0.61  #QF  0.61"    
        1    419    419   49    419   81   "peak   196 #SUP  0.85  #QF  0.78"    
        1    420    420   49    420   81   "peak   196 #SUP  0.85  #QF  0.78"    
        1    421    421   49    421   81   "peak   197 #SUP  0.33  #QF  0.33"    
        1    422    422   49    422   81   "peak   198 #SUP  0.92  #QF  0.92"    
        1    423    423   49    423   81   "peak   204 #SUP  0.69  #QF  0.69"    
        1    424    424   49    424   81   "peak   205 #SUP  0.94  #QF  0.94"    
        1    425    425   49    425   81   "peak   206 #SUP  0.48  #QF  0.48"    
        1    426    426   49    426   81   "peak   207 #SUP  0.78  #QF  0.78"    
        1    427    427   49    427   81   "peak   210 #SUP  0.94  #QF  0.94"    
        1    428    428   49    428   81   "peak   215 #SUP  0.99  #QF  0.99"    
        1    429    429   49    429   70   "peak   217 #SUP  1.00"               
        1    430    430   49    430   81   "peak   219 #SUP  0.97  #QF  0.97"    
        1    431    431   49    431   81   "peak   220 #SUP  0.98  #QF  0.98"    
        1    432    432   49    432   81   "peak   230 #SUP  0.93  #QF  0.93"    
        1    433    433   49    433   81   "peak   236 #SUP  0.81  #QF  0.81"    
        1    434    434   49    434   81   "peak   238 #SUP  0.90  #QF  0.90"    
        1    435    435   49    435   81   "peak   247 #SUP  0.85  #QF  0.85"    
        1    436    436   49    436   81   "peak   248 #SUP  0.89  #QF  0.89"    
        1    437    437   49    437   81   "peak   252 #SUP  0.95  #QF  0.95"    
        1    438    438   49    438   81   "peak   262 #SUP  0.89  #QF  0.80"    
        1    439    439   49    439   81   "peak   266 #SUP  0.77  #QF  0.77"    
        1    440    440   49    440   81   "peak   267 #SUP  0.85  #QF  0.79"    
        1    441    441   49    441   81   "peak   273 #SUP  0.98  #QF  0.98"    
        1    442    442   49    442   81   "peak   275 #SUP  0.93  #QF  0.93"    
        1    443    443   49    443   81   "peak   276 #SUP  0.97  #QF  0.97"    
        1    444    444   49    444   81   "peak   285 #SUP  0.93  #QF  0.93"    
        1    445    445   49    445   81   "peak   293 #SUP  0.93  #QF  0.56"    
        1    446    446   49    446   81   "peak   294 #SUP  0.92  #QF  0.92"    
        1    447    447   49    447   81   "peak   295 #SUP  0.43  #QF  0.43"    
        1    448    448   49    448   81   "peak   298 #SUP  0.64  #QF  0.64"    
        1    449    449   49    449   81   "peak   301 #SUP  0.83  #QF  0.83"    
        1    450    450   49    450   81   "peak   303 #SUP  0.82  #QF  0.82"    
        1    451    451   49    451   81   "peak   304 #SUP  0.39  #QF  0.39"    
        1    452    452   49    452   81   "peak   307 #SUP  0.80  #QF  0.80"    
        1    453    453   49    453   81   "peak   311 #SUP  0.61  #QF  0.61"    
        1    454    454   49    454   81   "peak   313 #SUP  0.70  #QF  0.70"    
        1    455    455   49    455   81   "peak   330 #SUP  0.69  #QF  0.69"    
        1    456    456   49    456   81   "peak   333 #SUP  0.86  #QF  0.86"    
        1    457    457   49    457   81   "peak   335 #SUP  0.87  #QF  0.87"    
        1    458    458   49    458   81   "peak   338 #SUP  0.67  #QF  0.67"    
        1    459    459   49    459   81   "peak   342 #SUP  0.95  #QF  0.77"    
        1    460    460   49    460   81   "peak   347 #SUP  0.70  #QF  0.70"    
        1    461    461   49    461   81   "peak   350 #SUP  0.30  #QF  0.30"    
        1    462    462   49    462   81   "peak   351 #SUP  0.80  #QF  0.80"    
        1    463    463   49    463   81   "peak   354 #SUP  0.99  #QF  0.68"    
        1    464    464   49    464   81   "peak   354 #SUP  0.99  #QF  0.68"    
        1    465    465   49    465   81   "peak   357 #SUP  0.98  #QF  0.98"    
        1    466    466   49    466   81   "peak   360 #SUP  0.72  #QF  0.72"    
        1    467    467   49    467   81   "peak   368 #SUP  0.70  #QF  0.58"    
        1    468    468   49    468   81   "peak   376 #SUP  0.94  #QF  0.94"    
        1    469    469   49    469   81   "peak   377 #SUP  0.85  #QF  0.85"    
        1    470    470   49    470   81   "peak   378 #SUP  0.86  #QF  0.70"    
        1    471    471   49    471   81   "peak   378 #SUP  0.86  #QF  0.70"    
        1    472    472   49    472   81   "peak   379 #SUP  0.91  #QF  0.91"    
        1    473    473   49    473   81   "peak   383 #SUP  0.44  #QF  0.44"    
        1    474    474   49    474   81   "peak   384 #SUP  0.55  #QF  0.55"    
        1    475    475   49    475   81   "peak   385 #SUP  0.67  #QF  0.67"    
        1    476    476   49    476   81   "peak   387 #SUP  0.66  #QF  0.66"    
        1    477    477   49    477   81   "peak   388 #SUP  0.95  #QF  0.95"    
        1    478    478   49    478   81   "peak   390 #SUP  0.75  #QF  0.59"    
        1    479    479   49    479   81   "peak   392 #SUP  0.77  #QF  0.77"    
        1    480    480   49    480   81   "peak   393 #SUP  0.97  #QF  0.97"    
        1    481    481   49    481   81   "peak   396 #SUP  0.30  #QF  0.30"    
        1    482    482   49    482   81   "peak   397 #SUP  0.52  #QF  0.24"    
        1    483    483   49    483   81   "peak   400 #SUP  0.75  #QF  0.75"    
        1    484    484   49    484   81   "peak   401 #SUP  0.47  #QF  0.47"    
        1    485    485   49    485   81   "peak   408 #SUP  0.68  #QF  0.68"    
        1    486    486   49    486   81   "peak   410 #SUP  0.80  #QF  0.26"    
        1    487    487   49    487   81   "peak   410 #SUP  0.80  #QF  0.26"    
        1    488    488   49    488   81   "peak   411 #SUP  0.77  #QF  0.77"    
        1    489    489   49    489   81   "peak   412 #SUP  0.89  #QF  0.80"    
        1    490    490   49    490   81   "peak   413 #SUP  0.33  #QF  0.33"    
        1    491    491   49    491   81   "peak   414 #SUP  0.54  #QF  0.24"    
        1    492    492   49    492   81   "peak   414 #SUP  0.54  #QF  0.24"    
        1    493    493   49    493   81   "peak   416 #SUP  0.86  #QF  0.86"    
        1    494    494   49    494   81   "peak   418 #SUP  0.64  #QF  0.64"    
        1    495    495   49    495   81   "peak   421 #SUP  0.27  #QF  0.27"    
        1    496    496   49    496   81   "peak   424 #SUP  0.52  #QF  0.52"    
        1    497    497   49    497   81   "peak   425 #SUP  0.21  #QF  0.21"    
        1    498    498   49    498   81   "peak   435 #SUP  0.46  #QF  0.46"    
        1    499    499   49    499   81   "peak   436 #SUP  0.66  #QF  0.66"    
        1    500    500   49    500   81   "peak   437 #SUP  0.93  #QF  0.93"    
        1    501    501   49    501   81   "peak   446 #SUP  0.90  #QF  0.90"    
        1    502    502   49    502   81   "peak   447 #SUP  0.74  #QF  0.74"    
        1    503    503   49    503   81   "peak   450 #SUP  0.67  #QF  0.67"    
        1    504    504   49    504   81   "peak   451 #SUP  0.54  #QF  0.54"    
        1    505    505   49    505   81   "peak   467 #SUP  0.98  #QF  0.98"    
        1    506    506   49    506   81   "peak   474 #SUP  0.26  #QF  0.26"    
        1    507    507   49    507   81   "peak   475 #SUP  0.65  #QF  0.65"    
        1    508    508   49    508   81   "peak   482 #SUP  0.94  #QF  0.70"    
        1    509    509   49    509   81   "peak   482 #SUP  0.94  #QF  0.70"    
        1    510    510   49    510   81   "peak   483 #SUP  0.75  #QF  0.29"    
        1    511    511   49    511   81   "peak   483 #SUP  0.75  #QF  0.29"    
        1    512    512   49    512   81   "peak   486 #SUP  0.56  #QF  0.56"    
        1    513    513   49    513   81   "peak   487 #SUP  0.42  #QF  0.42"    
        1    514    514   49    514   81   "peak   488 #SUP  0.53  #QF  0.53"    
        1    515    515   49    515   81   "peak   494 #SUP  0.66  #QF  0.42"    
        1    516    516   49    516   81   "peak   494 #SUP  0.66  #QF  0.42"    
        1    517    517   49    517   81   "peak   496 #SUP  0.98  #QF  0.56"    
        1    518    518   49    518   81   "peak   498 #SUP  0.77  #QF  0.77"    
        1    519    519   49    519   81   "peak   516 #SUP  0.77  #QF  0.77"    
        1    520    520   49    520   81   "peak   526 #SUP  0.96  #QF  0.96"    
        1    521    521   49    521   81   "peak   529 #SUP  0.23  #QF  0.23"    
        1    522    522   49    522   81   "peak   531 #SUP  0.99  #QF  0.99"    
        1    523    523   49    523   81   "peak   540 #SUP  0.86  #QF  0.86"    
        1    524    524   49    524   81   "peak   542 #SUP  0.46  #QF  0.46"    
        1    525    525   49    525   81   "peak   553 #SUP  0.79  #QF  0.79"    
        1    526    526   49    526   81   "peak   554 #SUP  0.88  #QF  0.70"    
        1    527    527   49    527   81   "peak   556 #SUP  0.91  #QF  0.91"    
        1    528    528   49    528   81   "peak   560 #SUP  0.98  #QF  0.98"    
        1    529    529   49    529   81   "peak   576 #SUP  0.96  #QF  0.43"    
        1    530    530   49    530   81   "peak   577 #SUP  0.96  #QF  0.96"    
        1    531    531   49    531   81   "peak   581 #SUP  0.64  #QF  0.64"    
        1    532    532   49    532   81   "peak   582 #SUP  0.80  #QF  0.80"    
        1    533    533   49    533   81   "peak   586 #SUP  0.68  #QF  0.56"    
        1    534    534   49    534   81   "peak   587 #SUP  0.96  #QF  0.70"    
        1    535    535   49    535   81   "peak   593 #SUP  1.00  #QF  0.77"    
        1    536    536   49    536   81   "peak   593 #SUP  1.00  #QF  0.77"    
        1    537    537   49    537   81   "peak   598 #SUP  0.67  #QF  0.67"    
        1    538    538   49    538   81   "peak   603 #SUP  0.72  #QF  0.43"    
        1    539    539   49    539   81   "peak   605 #SUP  0.70  #QF  0.70"    
        1    540    540   49    540   81   "peak   613 #SUP  0.97  #QF  0.97"    
        1    541    541   49    541   81   "peak   615 #SUP  0.92  #QF  0.92"    
        1    542    542   49    542   81   "peak   616 #SUP  0.85  #QF  0.85"    
        1    543    543   49    543   81   "peak   618 #SUP  0.59  #QF  0.59"    
        1    544    544   49    544   81   "peak   625 #SUP  0.96  #QF  0.69"    
        1    545    545   49    545   81   "peak   636 #SUP  0.91  #QF  0.60"    
        1    546    546   49    546   81   "peak   639 #SUP  0.33  #QF  0.33"    
        1    547    547   49    547   81   "peak   647 #SUP  0.77  #QF  0.64"    
        1    548    548   49    548   81   "peak   653 #SUP  0.48  #QF  0.48"    
        1    549    549   49    549   81   "peak   655 #SUP  0.88  #QF  0.50"    
        1    550    550   49    550   81   "peak   657 #SUP  0.38  #QF  0.38"    
        1    551    551   49    551   81   "peak   664 #SUP  0.88  #QF  0.88"    
        1    552    552   49    552   81   "peak   670 #SUP  0.60  #QF  0.60"    
        1    553    553   49    553   81   "peak   681 #SUP  0.90  #QF  0.90"    
        1    554    554   49    554   81   "peak   684 #SUP  0.94  #QF  0.94"    
        1    555    555   49    555   81   "peak   695 #SUP  0.57  #QF  0.57"    
        1    556    556   49    556   81   "peak   704 #SUP  0.82  #QF  0.49"    
        1    557    557   49    557   81   "peak   704 #SUP  0.82  #QF  0.49"    
        1    558    558   49    558   81   "peak   722 #SUP  0.87  #QF  0.87"    
        1    559    559   49    559   81   "peak   739 #SUP  0.72  #QF  0.72"    
        1    560    560   49    560   81   "peak   742 #SUP  0.97  #QF  0.97"    
        1    561    561   49    561   81   "peak   748 #SUP  0.89  #QF  0.35"    
        1    562    562   49    562   81   "peak   759 #SUP  0.93  #QF  0.84"    
        1    563    563   49    563   81   "peak   763 #SUP  0.32  #QF  0.32"    
        1    564    564   49    564   81   "peak   765 #SUP  0.33  #QF  0.33"    
        1    565    565   49    565   81   "peak   773 #SUP  0.34  #QF  0.34"    
        1    566    566   49    566   81   "peak   787 #SUP  0.51  #QF  0.51"    
        1    567    567   49    567   81   "peak   789 #SUP  0.42  #QF  0.42"    
        1    568    568   49    568   81   "peak   800 #SUP  0.74  #QF  0.74"    
        1    569    569   49    569   81   "peak   801 #SUP  0.86  #QF  0.86"    
        1    570    570   49    570   81   "peak   802 #SUP  0.98  #QF  0.98"    
        1    571    571   49    571   81   "peak   809 #SUP  0.91  #QF  0.91"    
        1    572    572   49    572   81   "peak   816 #SUP  0.61  #QF  0.61"    
        1    573    573   49    573   81   "peak   818 #SUP  0.94  #QF  0.94"    
        1    574    574   49    574   81   "peak   820 #SUP  0.95  #QF  0.95"    
        1    575    575   49    575   81   "peak   822 #SUP  0.73  #QF  0.57"    
        1    576    576   49    576   81   "peak   845 #SUP  0.79  #QF  0.79"    
        1    577    577   49    577   81   "peak   848 #SUP  0.55  #QF  0.55"    
        1    578    578   49    578   81   "peak   856 #SUP  0.32  #QF  0.32"    
        1    579    579   49    579   81   "peak   858 #SUP  0.56  #QF  0.56"    
        1    580    580   49    580   81   "peak   859 #SUP  0.68  #QF  0.68"    
        1    581    581   49    581   81   "peak   861 #SUP  0.98  #QF  0.98"    
        1    582    582   49    582   81   "peak   865 #SUP  0.58  #QF  0.45"    
        1    583    583   49    583   81   "peak   865 #SUP  0.58  #QF  0.45"    
        1    584    584   49    584   81   "peak   895 #SUP  0.96  #QF  0.96"    
        1    585    585   49    585   81   "peak   896 #SUP  0.61  #QF  0.61"    
        1    586    586   49    586   81   "peak   901 #SUP  0.90  #QF  0.90"    
        1    587    587   49    587   81   "peak   906 #SUP  0.71  #QF  0.37"    
        1    588    588   49    588   81   "peak   906 #SUP  0.71  #QF  0.37"    
        1    589    589   49    589   81   "peak   908 #SUP  0.73  #QF  0.73"    
        1    590    590   49    590   81   "peak   909 #SUP  0.99  #QF  0.74"    
        1    591    591   49    591   81   "peak   914 #SUP  0.94  #QF  0.94"    
        1    592    592   49    592   81   "peak   916 #SUP  0.68  #QF  0.68"    
        1    593    593   49    593   81   "peak   917 #SUP  0.72  #QF  0.63"    
        1    594    594   49    594   81   "peak   918 #SUP  0.92  #QF  0.92"    
        1    595    595   49    595   81   "peak   922 #SUP  0.93  #QF  0.93"    
        1    596    596   49    596   81   "peak   927 #SUP  0.83  #QF  0.83"    
        1    597    597   49    597   81   "peak   930 #SUP  0.81  #QF  0.81"    
        1    598    598   49    598   81   "peak   933 #SUP  0.33  #QF  0.33"    
        1    599    599   49    599   81   "peak   935 #SUP  0.68  #QF  0.60"    
        1    600    600   49    600   81   "peak   947 #SUP  0.85  #QF  0.85"    
        1    601    601   49    601   81   "peak   949 #SUP  0.93  #QF  0.93"    
        1    602    602   49    602   81   "peak   958 #SUP  0.92  #QF  0.92"    
        1    603    603   49    603   81   "peak   962 #SUP  0.56  #QF  0.56"    
        1    604    604   49    604   81   "peak   963 #SUP  0.41  #QF  0.41"    
        1    605    605   49    605   81   "peak   968 #SUP  0.71  #QF  0.71"    
        1    606    606   49    606   81   "peak   970 #SUP  0.47  #QF  0.25"    
        1    607    607   49    607   81   "peak   971 #SUP  0.25  #QF  0.25"    
        1    608    608   49    608   81   "peak  1000 #SUP  0.88  #QF  0.88"    
        1    609    609   49    609   81   "peak  1004 #SUP  0.83  #QF  0.83"    
        1    610    610   49    610   81   "peak  1006 #SUP  0.97  #QF  0.97"    
        1    611    611   49    611   81   "peak  1009 #SUP  0.89  #QF  0.89"    
        1    612    612   49    612   81   "peak  1011 #SUP  0.92  #QF  0.92"    
        1    613    613   49    613   81   "peak  1012 #SUP  0.57  #QF  0.57"    
        1    614    614   49    614   81   "peak  1015 #SUP  0.79  #QF  0.79"    
        1    615    615   49    615   81   "peak  1017 #SUP  0.72  #QF  0.72"    
        1    616    616   49    616   81   "peak  1022 #SUP  0.70  #QF  0.70"    
        1    617    617   49    617   81   "peak  1024 #SUP  0.65  #QF  0.65"    
        1    618    618   49    618   81   "peak  1026 #SUP  0.53  #QF  0.53"    
        1    619    619   49    619   81   "peak  1027 #SUP  0.75  #QF  0.75"    
        1    620    620   49    620   81   "peak  1033 #SUP  0.93  #QF  0.93"    
        1    621    621   49    621   81   "peak  1039 #SUP  0.96  #QF  0.80"    
        1    622    622   49    622   81   "peak  1041 #SUP  0.27  #QF  0.27"    
        1    623    623   49    623   81   "peak  1043 #SUP  0.72  #QF  0.72"    
        1    624    624   49    624   81   "peak  1044 #SUP  0.92  #QF  0.92"    
        1    625    625   49    625   81   "peak  1048 #SUP  0.96  #QF  0.96"    
        1    626    626   49    626   81   "peak  1050 #SUP  0.90  #QF  0.90"    
        1    627    627   49    627   81   "peak  1059 #SUP  0.72  #QF  0.40"    
        1    628    628   49    628   81   "peak  1059 #SUP  0.72  #QF  0.40"    
        1    629    629   49    629   81   "peak  1062 #SUP  0.93  #QF  0.93"    
        1    630    630   49    630   81   "peak  1063 #SUP  0.35  #QF  0.35"    
        1    631    631   49    631   81   "peak  1064 #SUP  0.89  #QF  0.89"    
        1    632    632   49    632   81   "peak  1065 #SUP  0.72  #QF  0.61"    
        1    633    633   49    633   81   "peak  1065 #SUP  0.72  #QF  0.61"    
        1    634    634   49    634   81   "peak  1066 #SUP  0.95  #QF  0.95"    
        1    635    635   49    635   81   "peak  1067 #SUP  0.99  #QF  0.96"    
        1    636    636   49    636   81   "peak  1068 #SUP  0.25  #QF  0.25"    
        1    637    637   49    637   81   "peak  1071 #SUP  0.98  #QF  0.98"    
        1    638    638   49    638   81   "peak  1074 #SUP  0.92  #QF  0.25"    
        1    639    639   49    639   81   "peak  1084 #SUP  0.93  #QF  0.93"    
        1    640    640   49    640   81   "peak  1090 #SUP  0.98  #QF  0.98"    
        1    641    641   49    641   81   "peak  1091 #SUP  0.62  #QF  0.62"    
        1    642    642   49    642   81   "peak  1093 #SUP  0.39  #QF  0.39"    
        1    643    643   49    643   81   "peak  1095 #SUP  0.99  #QF  0.99"    
        1    644    644   49    644   81   "peak  1100 #SUP  0.95  #QF  0.95"    
        1    645    645   49    645   81   "peak  1101 #SUP  0.82  #QF  0.82"    
        1    646    646   49    646   81   "peak  1105 #SUP  0.62  #QF  0.62"    
        1    647    647   49    647   81   "peak  1108 #SUP  0.95  #QF  0.83"    
        1    648    648   49    648   81   "peak  1126 #SUP  0.74  #QF  0.74"    
        1    649    649   49    649   81   "peak  1130 #SUP  0.68  #QF  0.68"    
        1    650    650   49    650   81   "peak  1131 #SUP  0.92  #QF  0.92"    
        1    651    651   49    651   81   "peak  1132 #SUP  0.94  #QF  0.94"    
        1    652    652   49    652   81   "peak  1134 #SUP  0.96  #QF  0.96"    
        1    653    653   49    653   81   "peak  1138 #SUP  0.64  #QF  0.39"    
        1    654    654   49    654   81   "peak  1140 #SUP  0.75  #QF  0.75"    
        1    655    655   49    655   81   "peak  1150 #SUP  0.96  #QF  0.96"    
        1    656    656   49    656   81   "peak  1153 #SUP  0.72  #QF  0.24"    
        1    657    657   49    657   81   "peak  1167 #SUP  0.44  #QF  0.44"    
        1    658    658   49    658   81   "peak  1171 #SUP  0.98  #QF  0.98"    
        1    659    659   49    659   81   "peak  1181 #SUP  0.60  #QF  0.60"    
        1    660    660   49    660   81   "peak  1185 #SUP  0.75  #QF  0.75"    
        1    661    661   49    661   81   "peak  1187 #SUP  0.88  #QF  0.88"    
        1    662    662   49    662   81   "peak  1188 #SUP  0.93  #QF  0.93"    
        1    663    663   49    663   81   "peak  1189 #SUP  0.98  #QF  0.98"    
        1    664    664   49    664   81   "peak  1196 #SUP  0.96  #QF  0.96"    
        1    665    665   49    665   81   "peak  1202 #SUP  0.65  #QF  0.48"    
        1    666    666   49    666   81   "peak  1202 #SUP  0.65  #QF  0.48"    
        1    667    667   49    667   81   "peak  1215 #SUP  0.28  #QF  0.28"    
        1    668    668   49    668   81   "peak  1229 #SUP  0.46  #QF  0.46"    
        1    669    669   49    669   81   "peak  1230 #SUP  0.88  #QF  0.53"    
        1    670    670   49    670   81   "peak  1244 #SUP  0.31  #QF  0.31"    
        1    671    671   49    671   81   "peak  1246 #SUP  0.90  #QF  0.90"    
        1    672    672   49    672   81   "peak  1252 #SUP  0.29  #QF  0.29"    
        1    673    673   49    673   81   "peak  1253 #SUP  0.26  #QF  0.26"    
        1    674    674   49    674   81   "peak  1261 #SUP  1.00  #QF  0.76"    
        1    675    675   49    675   81   "peak  1265 #SUP  0.31  #QF  0.31"    
        1    676    676   49    676   81   "peak  1279 #SUP  0.96  #QF  0.96"    
        1    677    677   49    677   81   "peak  1281 #SUP  0.94  #QF  0.94"    
        1    678    678   49    678   81   "peak  1282 #SUP  0.94  #QF  0.94"    
        1    679    679   49    679   81   "peak  1289 #SUP  0.58  #QF  0.58"    
        1    680    680   49    680   81   "peak  1290 #SUP  0.92  #QF  0.92"    
        1    681    681   49    681   81   "peak  1292 #SUP  0.91  #QF  0.91"    
        1    682    682   49    682   81   "peak  1308 #SUP  0.98  #QF  0.98"    
        1    683    683   49    683   81   "peak  1311 #SUP  0.85  #QF  0.85"    
        1    684    684   49    684   81   "peak  1330 #SUP  0.31  #QF  0.31"    
        1    685    685   49    685   81   "peak  1334 #SUP  0.25  #QF  0.25"    
        1    686    686   49    686   81   "peak  1336 #SUP  0.62  #QF  0.62"    
        1    687    687   49    687   81   "peak  1337 #SUP  0.53  #QF  0.53"    
        1    688    688   49    688   81   "peak  1339 #SUP  0.95  #QF  0.95"    
        1    689    689   49    689   81   "peak  1340 #SUP  0.39  #QF  0.39"    
        1    690    690   49    690   81   "peak  1344 #SUP  0.88  #QF  0.82"    
        1    691    691   49    691   81   "peak  1350 #SUP  0.56  #QF  0.56"    
        1    692    692   49    692   81   "peak  1356 #SUP  0.90  #QF  0.90"    
        1    693    693   49    693   81   "peak  1357 #SUP  0.97  #QF  0.64"    
        1    694    694   49    694   81   "peak  1357 #SUP  0.97  #QF  0.64"    
        1    695    695   49    695   81   "peak  1373 #SUP  0.98  #QF  0.98"    
        1    696    696   49    696   81   "peak  1374 #SUP  0.92  #QF  0.92"    
        1    697    697   49    697   81   "peak  1380 #SUP  0.86  #QF  0.86"    
        1    698    698   49    698   81   "peak  1383 #SUP  1.00  #QF  0.24"    
        1    699    699   49    699   81   "peak  1386 #SUP  0.80  #QF  0.80"    
        1    700    700   49    700   81   "peak  1389 #SUP  0.55  #QF  0.55"    
        1    701    701   49    701   81   "peak  1394 #SUP  0.82  #QF  0.48"    
        1    702    702   49    702   81   "peak  1395 #SUP  0.83  #QF  0.83"    
        1    703    703   49    703   81   "peak  1396 #SUP  0.85  #QF  0.85"    
        1    704    704   49    704   81   "peak  1406 #SUP  0.91  #QF  0.91"    
        1    705    705   49    705   81   "peak  1423 #SUP  0.48  #QF  0.48"    
        1    706    706   49    706   81   "peak  1426 #SUP  0.74  #QF  0.74"    
        1    707    707   49    707   81   "peak  1429 #SUP  0.90  #QF  0.90"    
        1    708    708   49    708   81   "peak  1430 #SUP  0.95  #QF  0.95"    
        1    709    709   49    709   81   "peak  1438 #SUP  0.61  #QF  0.61"    
        1    710    710   49    710   81   "peak  1442 #SUP  0.80  #QF  0.72"    
        1    711    711   49    711   81   "peak  1442 #SUP  0.80  #QF  0.72"    
        1    712    712   49    712   81   "peak  1450 #SUP  0.47  #QF  0.47"    
        1    713    713   49    713   81   "peak  1453 #SUP  0.86  #QF  0.86"    
        1    714    714   49    714   81   "peak  1466 #SUP  0.88  #QF  0.78"    
        1    715    715   49    715   81   "peak  1467 #SUP  0.61  #QF  0.61"    
        1    716    716   49    716   81   "peak  1470 #SUP  0.58  #QF  0.58"    
        1    717    717   49    717   81   "peak  1473 #SUP  0.24  #QF  0.24"    
        1    718    718   49    718   81   "peak  1474 #SUP  0.43  #QF  0.43"    
        1    719    719   49    719   81   "peak  1476 #SUP  0.95  #QF  0.81"    
        1    720    720   49    720   81   "peak  1485 #SUP  0.63  #QF  0.63"    
        1    721    721   49    721   81   "peak  1486 #SUP  0.45  #QF  0.45"    
        1    722    722   49    722   81   "peak  1488 #SUP  0.40  #QF  0.40"    
        1    723    723   49    723   81   "peak  1490 #SUP  0.97  #QF  0.71"    
        1    724    724   49    724   81   "peak  1494 #SUP  0.56  #QF  0.56"    
        1    725    725   49    725   81   "peak  1503 #SUP  0.83  #QF  0.83"    
        1    726    726   49    726   81   "peak  1504 #SUP  0.85  #QF  0.85"    
        1    727    727   49    727   81   "peak  1505 #SUP  0.96  #QF  0.96"    
        1    728    728   49    728   81   "peak  1509 #SUP  0.83  #QF  0.63"    
        1    729    729   49    729   81   "peak  1509 #SUP  0.83  #QF  0.63"    
        1    730    730   49    730   81   "peak  1510 #SUP  0.48  #QF  0.48"    
        1    731    731   49    731   81   "peak  1512 #SUP  0.65  #QF  0.65"    
        1    732    732   49    732   81   "peak  1514 #SUP  0.76  #QF  0.25"    
        1    733    733   49    733   81   "peak  1515 #SUP  0.87  #QF  0.38"    
        1    734    734   49    734   81   "peak  1518 #SUP  0.65  #QF  0.65"    
        1    735    735   49    735   81   "peak  1520 #SUP  0.99  #QF  0.74"    
        1    736    736   49    736   81   "peak  1524 #SUP  0.74  #QF  0.74"    
        1    737    737   49    737   81   "peak  1529 #SUP  0.70  #QF  0.62"    
        1    738    738   49    738   81   "peak  1529 #SUP  0.70  #QF  0.62"    
        1    739    739   49    739   81   "peak  1531 #SUP  0.60  #QF  0.60"    
        1    740    740   49    740   81   "peak  1539 #SUP  0.82  #QF  0.74"    
        1    741    741   49    741   81   "peak  1540 #SUP  0.96  #QF  0.73"    
        1    742    742   49    742   81   "peak  1540 #SUP  0.96  #QF  0.73"    
        1    743    743   49    743   81   "peak  1542 #SUP  0.87  #QF  0.72"    
        1    744    744   49    744   81   "peak  1551 #SUP  1.00  #QF  0.99"    
        1    745    745   49    745   81   "peak  1552 #SUP  0.97  #QF  0.97"    
        1    746    746   49    746   81   "peak  1553 #SUP  0.96  #QF  0.91"    
        1    747    747   49    747   81   "peak  1554 #SUP  0.94  #QF  0.94"    
        1    748    748   49    748   81   "peak  1556 #SUP  0.72  #QF  0.72"    
        1    749    749   49    749   81   "peak  1557 #SUP  0.52  #QF  0.52"    
        1    750    750   49    750   81   "peak  1558 #SUP  0.87  #QF  0.47"    
        1    751    751   49    751   81   "peak  1558 #SUP  0.87  #QF  0.47"    
        1    752    752   49    752   81   "peak  1561 #SUP  0.64  #QF  0.35"    
        1    753    753   49    753   81   "peak  1561 #SUP  0.64  #QF  0.35"    
        1    754    754   49    754   81   "peak  1572 #SUP  0.21  #QF  0.21"    
        1    755    755   49    755   81   "peak  1573 #SUP  0.90  #QF  0.90"    
        1    756    756   49    756   81   "peak  1580 #SUP  0.64  #QF  0.64"    
        1    757    757   49    757   81   "peak  1598 #SUP  0.64  #QF  0.64"    
        1    758    758   49    758   81   "peak  1603 #SUP  0.63  #QF  0.63"    
        1    759    759   49    759   81   "peak  1611 #SUP  0.34  #QF  0.34"    
        1    760    760   49    760   81   "peak  1613 #SUP  0.48  #QF  0.48"    
        1    761    761   49    761   81   "peak  1619 #SUP  0.75  #QF  0.43"    
        1    762    762   49    762   81   "peak  1620 #SUP  0.46  #QF  0.46"    
        1    763    763   49    763   81   "peak  1625 #SUP  0.47  #QF  0.47"    
        1    764    764   49    764   81   "peak  1642 #SUP  0.44  #QF  0.44"    
        1    765    765   49    765   81   "peak  1644 #SUP  0.45  #QF  0.45"    
        1    766    766   49    766   81   "peak  1655 #SUP  0.22  #QF  0.22"    
        1    767    767   49    767   81   "peak  1657 #SUP  0.93  #QF  0.93"    
        1    768    768   49    768   81   "peak  1658 #SUP  0.34  #QF  0.34"    
        1    769    769   49    769   81   "peak  1664 #SUP  0.75  #QF  0.75"    
        1    770    770   49    770   81   "peak  1665 #SUP  0.52  #QF  0.52"    
        1    771    771   49    771   81   "peak  1666 #SUP  0.67  #QF  0.67"    
        1    772    772   49    772   81   "peak  1667 #SUP  0.98  #QF  0.95"    
        1    773    773   49    773   81   "peak  1676 #SUP  0.82  #QF  0.82"    
        1    774    774   49    774   81   "peak  1682 #SUP  1.00  #QF  0.65"    
        1    775    775   49    775   81   "peak  1682 #SUP  1.00  #QF  0.65"    
        1    776    776   49    776   81   "peak  1687 #SUP  0.55  #QF  0.55"    
        1    777    777   49    777   81   "peak  1692 #SUP  0.65  #QF  0.65"    
        1    778    778   49    778   81   "peak  1699 #SUP  0.54  #QF  0.54"    
        1    779    779   49    779   81   "peak  1701 #SUP  0.76  #QF  0.76"    
        1    780    780   49    780   81   "peak  1706 #SUP  0.78  #QF  0.34"    
        1    781    781   49    781   81   "peak  1706 #SUP  0.78  #QF  0.34"    
        1    782    782   49    782   81   "peak  1709 #SUP  0.60  #QF  0.60"    
        1    783    783   49    783   81   "peak  1714 #SUP  0.58  #QF  0.58"    
        1    784    784   49    784   81   "peak  1721 #SUP  0.74  #QF  0.48"    
        1    785    785   49    785   81   "peak  1724 #SUP  0.88  #QF  0.35"    
        1    786    786   49    786   81   "peak  1724 #SUP  0.88  #QF  0.35"    
        1    787    787   49    787   81   "peak  1728 #SUP  0.34  #QF  0.34"    
        1    788    788   49    788   81   "peak  1732 #SUP  0.98  #QF  0.94"    
        1    789    789   49    789   81   "peak  1733 #SUP  0.98  #QF  0.98"    
        1    790    790   49    790   81   "peak  1737 #SUP  0.51  #QF  0.51"    
        1    791    791   49    791   81   "peak  1741 #SUP  0.69  #QF  0.69"    
        1    792    792   49    792   81   "peak  1757 #SUP  0.98  #QF  0.97"    
        1    793    793   49    793   81   "peak  1757 #SUP  0.98  #QF  0.97"    
        1    794    794   49    794   81   "peak  1769 #SUP  0.98  #QF  0.98"    
        1    795    795   49    795   81   "peak  1771 #SUP  0.80  #QF  0.46"    
        1    796    796   49    796   81   "peak  1773 #SUP  0.96  #QF  0.96"    
        1    797    797   49    797   81   "peak  1776 #SUP  0.76  #QF  0.33"    
        1    798    798   49    798   81   "peak  1776 #SUP  0.76  #QF  0.33"    
        1    799    799   49    799   81   "peak  1786 #SUP  0.83  #QF  0.58"    
        1    800    800   49    800   81   "peak  1788 #SUP  0.56  #QF  0.56"    
        1    801    801   49    801   81   "peak  1789 #SUP  0.59  #QF  0.59"    
        1    802    802   49    802   81   "peak  1791 #SUP  0.91  #QF  0.37"    
        1    803    803   49    803   81   "peak  1792 #SUP  0.85  #QF  0.85"    
        1    804    804   49    804   81   "peak  1797 #SUP  0.96  #QF  0.69"    
        1    805    805   49    805   81   "peak  1797 #SUP  0.96  #QF  0.69"    
        1    806    806   49    806   81   "peak  1797 #SUP  0.96  #QF  0.69"    
        1    807    807   49    807   81   "peak  1798 #SUP  0.84  #QF  0.84"    
        1    808    808   49    808   81   "peak  1799 #SUP  0.53  #QF  0.53"    
        1    809    809   49    809   81   "peak  1801 #SUP  0.61  #QF  0.61"    
        1    810    810   49    810   81   "peak  1802 #SUP  0.25  #QF  0.25"    
        1    811    811   49    811   81   "peak  1809 #SUP  0.53  #QF  0.53"    
        1    812    812   49    812   81   "peak  1811 #SUP  0.71  #QF  0.71"    
        1    813    813   49    813   81   "peak  1812 #SUP  0.40  #QF  0.40"    
        1    814    814   49    814   70   "peak  1819 #SUP  1.00"               
        1    815    815   49    815   81   "peak  1821 #SUP  0.70  #QF  0.70"    
        1    816    816   49    816   81   "peak  1822 #SUP  0.67  #QF  0.67"    
        1    817    817   49    817   81   "peak  1836 #SUP  0.96  #QF  0.96"    
        1    818    818   49    818   81   "peak  1837 #SUP  0.90  #QF  0.90"    
        1    819    819   49    819   81   "peak  1840 #SUP  0.37  #QF  0.37"    
        1    820    820   49    820   81   "peak  1855 #SUP  0.90  #QF  0.90"    
        1    821    821   49    821   81   "peak  1858 #SUP  0.97  #QF  0.97"    
        1    822    822   49    822   81   "peak  1861 #SUP  0.72  #QF  0.72"    
        1    823    823   49    823   81   "peak  1878 #SUP  0.82  #QF  0.82"    
        1    824    824   49    824   81   "peak  1881 #SUP  0.75  #QF  0.75"    
        1    825    825   49    825   81   "peak  1889 #SUP  0.77  #QF  0.77"    
        1    826    826   49    826   81   "peak  1891 #SUP  0.42  #QF  0.42"    
        1    827    827   49    827   81   "peak  1892 #SUP  0.88  #QF  0.88"    
        1    828    828   49    828   81   "peak  1893 #SUP  0.78  #QF  0.78"    
        1    829    829   49    829   81   "peak  1896 #SUP  0.97  #QF  0.97"    
        1    830    830   49    830   81   "peak  1899 #SUP  0.76  #QF  0.76"    
        1    831    831   49    831   81   "peak  1905 #SUP  0.65  #QF  0.65"    
        1    832    832   49    832   81   "peak  1931 #SUP  0.83  #QF  0.83"    
        1    833    833   49    833   81   "peak  1933 #SUP  0.91  #QF  0.91"    
        1    834    834   49    834   81   "peak  1936 #SUP  0.75  #QF  0.64"    
        1    835    835   49    835   81   "peak  1936 #SUP  0.75  #QF  0.64"    
        1    836    836   49    836   81   "peak  1937 #SUP  0.25  #QF  0.25"    
        1    837    837   49    837   81   "peak  1943 #SUP  0.75  #QF  0.75"    
        1    838    838   49    838   81   "peak  1945 #SUP  0.84  #QF  0.84"    
        1    839    839   49    839   81   "peak  1946 #SUP  0.71  #QF  0.71"    
        1    840    840   49    840   81   "peak  1952 #SUP  0.46  #QF  0.46"    
        1    841    841   49    841   81   "peak  1958 #SUP  0.65  #QF  0.65"    
        1    842    842   49    842   81   "peak  1975 #SUP  0.87  #QF  0.68"    
        1    843    843   49    843   81   "peak  1975 #SUP  0.87  #QF  0.68"    
        1    844    844   49    844   81   "peak  1989 #SUP  0.88  #QF  0.88"    
        1    845    845   49    845   81   "peak  1991 #SUP  0.72  #QF  0.72"    
        1    846    846   49    846   81   "peak  2013 #SUP  0.57  #QF  0.57"    
        1    847    847   49    847   81   "peak  2029 #SUP  0.97  #QF  0.92"    
        1    848    848   49    848   81   "peak  2127 #SUP  0.76  #QF  0.59"    
        1    849    849   49    849   81   "peak  2127 #SUP  0.76  #QF  0.59"    
        1    850    850   49    850   81   "peak  2128 #SUP  0.60  #QF  0.60"    
        1    851    851   49    851   81   "peak  2130 #SUP  0.97  #QF  0.83"    
        1    852    852   49    852   81   "peak  2131 #SUP  0.71  #QF  0.71"    
        1    853    853   49    853   81   "peak  2132 #SUP  0.76  #QF  0.44"    
        1    854    854   49    854   81   "peak  2132 #SUP  0.76  #QF  0.44"    
        1    855    855   49    855   81   "peak  2135 #SUP  0.73  #QF  0.73"    
        1    856    856   49    856   81   "peak  2139 #SUP  0.81  #QF  0.81"    
        1    857    857   49    857   81   "peak  2141 #SUP  0.88  #QF  0.88"    
        1    858    858   49    858   81   "peak  2153 #SUP  0.92  #QF  0.92"    
        1    859    859   49    859   81   "peak  2154 #SUP  0.90  #QF  0.90"    
        1    860    860   49    860   81   "peak  2155 #SUP  0.78  #QF  0.78"    
        1    861    861   49    861   81   "peak  2157 #SUP  0.55  #QF  0.55"    
        1    862    862   49    862   81   "peak  2160 #SUP  0.92  #QF  0.92"    
        1    863    863   49    863   81   "peak  2165 #SUP  0.54  #QF  0.54"    
        1    864    864   49    864   81   "peak  2166 #SUP  0.74  #QF  0.74"    
        1    865    865   49    865   81   "peak  2167 #SUP  0.70  #QF  0.70"    
        1    866    866   49    866   81   "peak  2172 #SUP  0.39  #QF  0.39"    
        1    867    867   49    867   81   "peak  2233 #SUP  0.61  #QF  0.61"    
        1    868    868   49    868   81   "peak  2248 #SUP  0.99  #QF  0.95"    
        1    869    869   49    869   81   "peak  2251 #SUP  0.99  #QF  0.99"    
        1    870    870   49    870   81   "peak  2271 #SUP  0.94  #QF  0.93"    
        1    871    871   49    871   81   "peak  2273 #SUP  0.94  #QF  0.94"    
        1    872    872   49    872   70   "peak  2288 #SUP  1.00"               
        1    873    873   49    873   81   "peak  2290 #SUP  0.63  #QF  0.63"    
        1    874    874   49    874   81   "peak  2292 #SUP  0.76  #QF  0.76"    
        1    875    875   49    875   81   "peak  2294 #SUP  0.98  #QF  0.42"    
        1    876    876   49    876   81   "peak  2294 #SUP  0.98  #QF  0.42"    
        1    877    877   49    877   81   "peak  2325 #SUP  0.52  #QF  0.52"    
        1    878    878   49    878   81   "peak  2328 #SUP  0.50  #QF  0.50"    
        1    879    879   49    879   81   "peak  2378 #SUP  0.63  #QF  0.35"    
        1    880    880   49    880   81   "peak  2380 #SUP  0.70  #QF  0.70"    
        1    881    881   49    881   81   "peak  2492 #SUP  0.61  #QF  0.61"    
        1    882    882   49    882   81   "peak  2495 #SUP  0.69  #QF  0.69"    
        1    883    883   49    883   81   "peak     5 #SUP  0.51  #QF  0.51"    
        1    884    884   49    884   81   "peak     6 #SUP  0.98  #QF  0.61"    
        1    885    885   49    885   81   "peak     6 #SUP  0.98  #QF  0.61"    
        1    886    886   49    886   81   "peak     7 #SUP  0.55  #QF  0.55"    
        1    887    887   49    887   81   "peak    11 #SUP  0.61  #QF  0.47"    
        1    888    888   49    888   81   "peak    13 #SUP  0.42  #QF  0.42"    
        1    889    889   49    889   81   "peak    18 #SUP  0.78  #QF  0.78"    
        1    890    890   49    890   81   "peak    20 #SUP  0.77  #QF  0.77"    
        1    891    891   49    891   81   "peak    23 #SUP  0.95  #QF  0.95"    
        1    892    892   49    892   81   "peak    24 #SUP  0.78  #QF  0.78"    
        1    893    893   49    893   81   "peak    25 #SUP  0.77  #QF  0.77"    
        1    894    894   49    894   81   "peak    26 #SUP  0.94  #QF  0.94"    
        1    895    895   49    895   81   "peak    27 #SUP  0.56  #QF  0.56"    
        1    896    896   49    896   81   "peak    31 #SUP  1.00  #QF  0.99"    
        1    897    897   49    897   81   "peak    33 #SUP  0.98  #QF  0.98"    
        1    898    898   49    898   81   "peak    43 #SUP  0.98  #QF  0.98"    
        1    899    899   49    899   81   "peak    56 #SUP  0.74  #QF  0.74"    
        1    900    900   49    900   81   "peak    57 #SUP  0.90  #QF  0.90"    
        1    901    901   49    901   81   "peak    58 #SUP  0.58  #QF  0.23"    
        1    902    902   49    902   81   "peak    60 #SUP  0.90  #QF  0.90"    
        1    903    903   49    903   81   "peak    61 #SUP  0.96  #QF  0.96"    
        1    904    904   49    904   81   "peak    65 #SUP  0.46  #QF  0.46"    
        1    905    905   49    905   81   "peak    66 #SUP  0.48  #QF  0.48"    
        1    906    906   49    906   81   "peak    71 #SUP  0.92  #QF  0.35"    
        1    907    907   49    907   81   "peak    71 #SUP  0.92  #QF  0.35"    
        1    908    908   49    908   70   "peak    73 #SUP  1.00"               
        1    909    909   49    909   81   "peak    76 #SUP  0.97  #QF  0.97"    
        1    910    910   49    910   81   "peak    78 #SUP  0.88  #QF  0.88"    
        1    911    911   49    911   81   "peak    79 #SUP  0.33  #QF  0.33"    
        1    912    912   49    912   81   "peak    80 #SUP  0.22  #QF  0.22"    
        1    913    913   49    913   81   "peak    81 #SUP  0.64  #QF  0.64"    
        1    914    914   49    914   81   "peak    83 #SUP  0.62  #QF  0.45"    
        1    915    915   49    915   81   "peak    85 #SUP  0.42  #QF  0.42"    
        1    916    916   49    916   81   "peak    86 #SUP  0.65  #QF  0.65"    
        1    917    917   49    917   81   "peak    87 #SUP  0.61  #QF  0.61"    
        1    918    918   49    918   81   "peak    97 #SUP  0.49  #QF  0.49"    
        1    919    919   49    919   81   "peak   101 #SUP  0.97  #QF  0.97"    
        1    920    920   49    920   81   "peak   102 #SUP  0.82  #QF  0.82"    
        1    921    921   49    921   81   "peak   103 #SUP  0.91  #QF  0.91"    
        1    922    922   49    922   81   "peak   106 #SUP  0.55  #QF  0.44"    
        1    923    923   49    923   81   "peak   109 #SUP  0.78  #QF  0.78"    
        1    924    924   49    924   81   "peak   111 #SUP  0.54  #QF  0.54"    
        1    925    925   49    925   81   "peak   117 #SUP  0.66  #QF  0.66"    
        1    926    926   49    926   81   "peak   119 #SUP  0.46  #QF  0.46"    
        1    927    927   49    927   81   "peak   139 #SUP  0.96  #QF  0.96"    
        1    928    928   49    928   81   "peak   140 #SUP  0.95  #QF  0.90"    
        1    929    929   49    929   81   "peak   142 #SUP  0.88  #QF  0.88"    
        1    930    930   49    930   81   "peak   160 #SUP  0.75  #QF  0.75"    
        1    931    931   49    931   59   "peak    58"                          
        1    932    932   49    932   59   "peak   826"                          
        1    933    933   49    933   59   "peak  1873"                          
        1    934    934   49    934   59   "peak   514"                          
        1    935    935   49    935   59   "peak  1414"                          
        1    936    936   49    936   59   "peak  1415"                          
        1    937    937   49    937   59   "peak  2082"                          
        1    938    938   49    938   59   "peak  1114"                          
        1    939    939   49    939   59   "peak     4"                          
        1    940    940   49    940   59   "peak  1051"                          
        1    941    941   49    941   59   "peak  1405"                          
        1    942    942   49    942   59   "peak  1335"                          
        1    943    943   49    943   59   "peak   717"                          
        1    944    944   49    944   59   "peak   251"                          
        1    945    945   49    945   59   "peak   737"                          
        1    946    946   49    946   59   "peak   944"                          
        1    947    947   49    947   59   "peak   944"                          
        1    948    948   49    948   59   "peak    90"                          
        1    949    949   49    949   59   "peak    44"                          
        1    950    950   49    950   59   "peak   252"                          
        1    951    951   49    951   59   "peak    77"                          
        1    952    952   49    952   59   "peak    77"                          
        1    953    953   49    953   59   "peak   702"                          
        1    954    954   49    954   59   "peak    79"                          
        1    955    955   49    955   59   "peak   979"                          
        1    956    956   49    956   59   "peak   116"                          
        1    957    957   49    957   59   "peak    81"                          
        1    958    958   49    958   59   "peak  1749"                          
        1    959    959   49    959   59   "peak  1731"                          
        1    960    960   49    960   59   "peak   979"                          
        1    961    961   49    961   59   "peak   644"                          
        1    962    962   49    962   59   "peak  1553"                          
        1    963    963   49    963   59   "peak    69"                          
        1    964    964   49    964   59   "peak   315"                          
        1    965    965   49    965   59   "peak    19"                          
        1    966    966   49    966   59   "peak   231"                          
        1    967    967   49    967   59   "peak   232"                          
        1    968    968   49    968   59   "peak   229"                          
        1    969    969   49    969   59   "peak  2135"                          
        1    970    970   49    970   59   "peak   112"                          
        1    971    971   49    971   59   "peak   112"                          
        1    972    972   49    972   59   "peak    64"                          
        1    973    973   49    973   59   "peak    70"                          
        1    974    974   49    974   59   "peak   107"                          
        1    975    975   49    975   59   "peak  1914"                          
        1    976    976   49    976   59   "peak   632"                          
        1    977    977   49    977   59   "peak  1161"                          
        1    978    978   49    978   59   "peak    80"                          
        1    979    979   49    979   59   "peak  1514"                          
        1    980    980   49    980   59   "peak   200"                          
        1    981    981   49    981   59   "peak   131"                          
        1    982    982   49    982   59   "peak   134"                          
        1    983    983   49    983   59   "peak   830"                          
        1    984    984   49    984   59   "peak   919"                          
        1    985    985   49    985   59   "peak   929"                          
        1    986    986   49    986   59   "peak   691"                          
        1    987    987   49    987   59   "peak  1936"                          
        1    988    988   49    988   59   "peak  1932"                          
        1    989    989   49    989   59   "peak  1935"                          
        1    990    990   49    990   59   "peak  1148"                          
        1    991    991   49    991   59   "peak  2381"                          
        1    992    992   49    992   59   "peak   632"                          
        1    993    993   49    993   59   "peak  1149"                          
        1    994    994   49    994   59   "peak  2147"                          
        1    995    995   49    995   59   "peak   471"                          
        1    996    996   49    996   59   "peak  1442"                          
        1    997    997   49    997   59   "peak   786"                          
        1    998    998   49    998   59   "peak  1383"                          
        1    999    999   49    999   59   "peak   551"                          
        1   1000   1000   49   1000   59   "peak   123"                          
        1   1001   1001   49   1001   59   "peak   627"                          
        1   1002   1002   49   1002   59   "peak  1805"                          
        1   1003   1003   49   1003   59   "peak   159"                          
        1   1004   1004   49   1004   59   "peak  1148"                          
        1   1005   1005   49   1005   59   "peak    74"                          
        1   1006   1006   49   1006   59   "peak    83"                          
        1   1007   1007   49   1007   59   "peak  1164"                          
        1   1008   1008   49   1008   59   "peak   627"                          
        1   1009   1009   49   1009   59   "peak   165"                          
        1   1010   1010   49   1010   59   "peak   820"                          
        1   1011   1011   49   1011   59   "peak   452"                          
        1   1012   1012   49   1012   59   "peak   553"                          
        1   1013   1013   49   1013   59   "peak    40"                          
        1   1014   1014   49   1014   59   "peak    76"                          
        1   1015   1015   49   1015   59   "peak   669"                          
        1   1016   1016   49   1016   59   "peak   599"                          
        1   1017   1017   49   1017   59   "peak   411"                          
        1   1018   1018   49   1018   59   "peak  1582"                          
        1   1019   1019   49   1019   59   "peak   565"                          
        1   1020   1020   49   1020   59   "peak   493"                          
        1   1021   1021   49   1021   59   "peak   175"                          
        1   1022   1022   49   1022   59   "peak   230"                          
        1   1023   1023   49   1023   59   "peak   490"                          
        1   1024   1024   49   1024   59   "peak   274"                          
        1   1025   1025   49   1025   59   "peak   857"                          
        1   1026   1026   49   1026   59   "peak   443"                          
        1   1027   1027   49   1027   59   "peak   649"                          
        1   1028   1028   49   1028   59   "peak  2242"                          
        1   1029   1029   49   1029   59   "peak  2132"                          
        1   1030   1030   49   1030   59   "peak   152"                          
        1   1031   1031   49   1031   59   "peak   153"                          
        1   1032   1032   49   1032   59   "peak    88"                          
        1   1033   1033   49   1033   59   "peak   273"                          
        1   1034   1034   49   1034   59   "peak   747"                          
        1   1035   1035   49   1035   59   "peak  1137"                          
        1   1036   1036   49   1036   59   "peak   535"                          
        1   1037   1037   49   1037   59   "peak   470"                          
        1   1038   1038   49   1038   59   "peak  2272"                          
        1   1039   1039   49   1039   59   "peak   271"                          
        1   1040   1040   49   1040   59   "peak   275"                          
        1   1041   1041   49   1041   59   "peak  1100"                          
        1   1042   1042   49   1042   59   "peak   782"                          
        1   1043   1043   49   1043   59   "peak  1636"                          
        1   1044   1044   49   1044   59   "peak  2172"                          
        1   1045   1045   49   1045   59   "peak  2167"                          
        1   1046   1046   49   1046   59   "peak  1914"                          
        1   1047   1047   49   1047   59   "peak   158"                          
        1   1048   1048   49   1048   59   "peak   773"                          
        1   1049   1049   49   1049   59   "peak  2168"                          
        1   1050   1050   49   1050   59   "peak  2157"                          
        1   1051   1051   49   1051   59   "peak  2163"                          
        1   1052   1052   49   1052   59   "peak  1399"                          
        1   1053   1053   49   1053   59   "peak  2159"                          
        1   1054   1054   49   1054   59   "peak   726"                          
        1   1055   1055   49   1055   59   "peak   271"                          
        1   1056   1056   49   1056   59   "peak  1909"                          
        1   1057   1057   49   1057   59   "peak  1196"                          
        1   1058   1058   49   1058   59   "peak   277"                          
        1   1059   1059   49   1059   59   "peak   273"                          
        1   1060   1060   49   1060   59   "peak   276"                          
        1   1061   1061   49   1061   59   "peak   374"                          
        1   1062   1062   49   1062   59   "peak   223"                          
        1   1063   1063   49   1063   59   "peak   216"                          
        1   1064   1064   49   1064   59   "peak   222"                          
        1   1065   1065   49   1065   59   "peak   769"                          
        1   1066   1066   49   1066   59   "peak   304"                          
        1   1067   1067   49   1067   59   "peak   417"                          
        1   1068   1068   49   1068   59   "peak     6"                          
        1   1069   1069   49   1069   59   "peak  1624"                          
        1   1070   1070   49   1070   59   "peak   103"                          
        1   1071   1071   49   1071   59   "peak   102"                          
        1   1072   1072   49   1072   59   "peak     3"                          
        1   1073   1073   49   1073   59   "peak   104"                          
        1   1074   1074   49   1074   59   "peak     5"                          
        1   1075   1075   49   1075   59   "peak   105"                          
        1   1076   1076   49   1076   59   "peak   469"                          
        1   1077   1077   49   1077   59   "peak   284"                          
        1   1078   1078   49   1078   59   "peak  1531"                          
        1   1079   1079   49   1079   59   "peak   187"                          
        1   1080   1080   49   1080   59   "peak   115"                          
        1   1081   1081   49   1081   59   "peak   159"                          
        1   1082   1082   49   1082   59   "peak  1468"                          
        1   1083   1083   49   1083   59   "peak  1895"                          
        1   1084   1084   49   1084   59   "peak   600"                          
        1   1085   1085   49   1085   59   "peak   306"                          
        1   1086   1086   49   1086   59   "peak   265"                          
        1   1087   1087   49   1087   59   "peak  1424"                          
        1   1088   1088   49   1088   59   "peak   188"                          
        1   1089   1089   49   1089   59   "peak   183"                          
        1   1090   1090   49   1090   59   "peak   603"                          
        1   1091   1091   49   1091   59   "peak   646"                          
        1   1092   1092   49   1092   59   "peak   241"                          
        1   1093   1093   49   1093   59   "peak   543"                          
        1   1094   1094   49   1094   59   "peak  1230"                          
        1   1095   1095   49   1095   59   "peak   481"                          
        1   1096   1096   49   1096   59   "peak  1398"                          
        1   1097   1097   49   1097   59   "peak   189"                          
        1   1098   1098   49   1098   59   "peak   749"                          
        1   1099   1099   49   1099   59   "peak   238"                          
        1   1100   1100   49   1100   59   "peak   435"                          
        1   1101   1101   49   1101   59   "peak  1559"                          
        1   1102   1102   49   1102   59   "peak   189"                          
        1   1103   1103   49   1103   59   "peak   298"                          
        1   1104   1104   49   1104   59   "peak   611"                          
        1   1105   1105   49   1105   59   "peak    19"                          
    stop_

save_



Constrains/BT5_dihe.str0000644000373300001320000011666010525570752014235 0ustar  mandarnmr1data_n/a_MR_file_constraints


save_global_MR_file_characteristics
    _File_characteristics.Sf_category       file_characteristics 
    _File_characteristics.ID                1 
    _File_characteristics.NMR_STAR_version  3.0 
    _File_characteristics.PDB_ID            N/A 
    _File_characteristics.MR_file_name      n/a.mr 
    _File_characteristics.Conversion_date   2006-11-12 

    loop_
        _File_characteristic.File_characteristics_ID 
        _File_characteristic.MR_file_block_position 
        _File_characteristic.Program 
        _File_characteristic.Type 
        _File_characteristic.Subtype 
        _File_characteristic.Format 

        1   1   DYANA/DIANA   "dihedral angle"    n/a   n/a   
    stop_

save_


save_DYANA/DIANA_dihedral_1
    _Torsion_angle_constraints.Sf_category             torsion_angle_constraints 
    _Torsion_angle_constraints.ID                      1 
    _Torsion_angle_constraints.MR_file_block_position  1 
    _Torsion_angle_constraints.Program                 DYANA/DIANA 
    _Torsion_angle_constraints.Type                   "dihedral angle" 
    _Torsion_angle_constraints.Subtype                 n/a 
    _Torsion_angle_constraints.Format                  n/a 

    loop_
        _Torsion_angle_constraint.Constraints_ID 
        _Torsion_angle_constraint.ID 
        _Torsion_angle_constraint.Torsion_angle_name 
        _Torsion_angle_constraint.Label_entity_assembly_ID_1 
        _Torsion_angle_constraint.Label_entity_ID_1 
        _Torsion_angle_constraint.Label_comp_index_ID_1 
        _Torsion_angle_constraint.Label_comp_ID_1 
        _Torsion_angle_constraint.Label_atom_ID_1 
        _Torsion_angle_constraint.Label_entity_assembly_ID_2 
        _Torsion_angle_constraint.Label_entity_ID_2 
        _Torsion_angle_constraint.Label_comp_index_ID_2 
        _Torsion_angle_constraint.Label_comp_ID_2 
        _Torsion_angle_constraint.Label_atom_ID_2 
        _Torsion_angle_constraint.Label_entity_assembly_ID_3 
        _Torsion_angle_constraint.Label_entity_ID_3 
        _Torsion_angle_constraint.Label_comp_index_ID_3 
        _Torsion_angle_constraint.Label_comp_ID_3 
        _Torsion_angle_constraint.Label_atom_ID_3 
        _Torsion_angle_constraint.Label_entity_assembly_ID_4 
        _Torsion_angle_constraint.Label_entity_ID_4 
        _Torsion_angle_constraint.Label_comp_index_ID_4 
        _Torsion_angle_constraint.Label_comp_ID_4 
        _Torsion_angle_constraint.Label_atom_ID_4 
        _Torsion_angle_constraint.Auth_segment_code_1 
        _Torsion_angle_constraint.Auth_seq_ID_1 
        _Torsion_angle_constraint.Auth_comp_ID_1 
        _Torsion_angle_constraint.Auth_atom_ID_1 
        _Torsion_angle_constraint.Auth_segment_code_2 
        _Torsion_angle_constraint.Auth_seq_ID_2 
        _Torsion_angle_constraint.Auth_comp_ID_2 
        _Torsion_angle_constraint.Auth_atom_ID_2 
        _Torsion_angle_constraint.Auth_segment_code_3 
        _Torsion_angle_constraint.Auth_seq_ID_3 
        _Torsion_angle_constraint.Auth_comp_ID_3 
        _Torsion_angle_constraint.Auth_atom_ID_3 
        _Torsion_angle_constraint.Auth_segment_code_4 
        _Torsion_angle_constraint.Auth_seq_ID_4 
        _Torsion_angle_constraint.Auth_comp_ID_4 
        _Torsion_angle_constraint.Auth_atom_ID_4 
        _Torsion_angle_constraint.Angle_upper_bound_val 
        _Torsion_angle_constraint.Angle_lower_bound_val 
        _Torsion_angle_constraint.Force_constant_value 
        _Torsion_angle_constraint.Potential_function_exponent 

        1     1   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .     4   LYS   .   .   .   .   .   .   .   .   .   .   .   .   .   -56.3   -121.4   .   .   
        1     2   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .     4   LYS   .   .   .   .   .   .   .   .   .   .   .   .   .   180.0     72.0   .   .   
        1     3   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .     9   ASP   .   .   .   .   .   .   .   .   .   .   .   .   .   -28.6   -107.4   .   .   
        1     4   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .     9   ASP   .   .   .   .   .   .   .   .   .   .   .   .   .    32.2    -64.2   .   .   
        1     5   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    15   ASP   .   .   .   .   .   .   .   .   .   .   .   .   .   -51.6    -72.2   .   .   
        1     6   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    15   ASP   .   .   .   .   .   .   .   .   .   .   .   .   .   -21.9    -56.4   .   .   
        1     7   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    19   ILE   .   .   .   .   .   .   .   .   .   .   .   .   .   -47.1    -87.7   .   .   
        1     8   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    19   ILE   .   .   .   .   .   .   .   .   .   .   .   .   .    -7.7    -68.1   .   .   
        1     9   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    20   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -51.9    -78.6   .   .   
        1    10   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    20   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -24.6    -53.0   .   .   
        1    11   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    21   GLN   .   .   .   .   .   .   .   .   .   .   .   .   .   -55.4    -75.4   .   .   
        1    12   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    21   GLN   .   .   .   .   .   .   .   .   .   .   .   .   .   -26.2    -51.2   .   .   
        1    13   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    22   ALA   .   .   .   .   .   .   .   .   .   .   .   .   .   -55.5    -75.5   .   .   
        1    14   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    22   ALA   .   .   .   .   .   .   .   .   .   .   .   .   .   -28.6    -49.1   .   .   
        1    15   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    23   ASN   .   .   .   .   .   .   .   .   .   .   .   .   .   -49.9    -86.6   .   .   
        1    16   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    23   ASN   .   .   .   .   .   .   .   .   .   .   .   .   .   -26.1    -48.9   .   .   
        1    17   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    24   HIS   .   .   .   .   .   .   .   .   .   .   .   .   .   -58.5    -78.5   .   .   
        1    18   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    24   HIS   .   .   .   .   .   .   .   .   .   .   .   .   .   -16.8    -63.0   .   .   
        1    19   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    25   ALA   .   .   .   .   .   .   .   .   .   .   .   .   .   -55.5    -82.0   .   .   
        1    20   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    25   ALA   .   .   .   .   .   .   .   .   .   .   .   .   .   -21.1    -50.4   .   .   
        1    21   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    26   ILE   .   .   .   .   .   .   .   .   .   .   .   .   .   -51.6    -72.7   .   .   
        1    22   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    26   ILE   .   .   .   .   .   .   .   .   .   .   .   .   .   -31.9    -56.9   .   .   
        1    23   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    27   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -50.7    -73.1   .   .   
        1    24   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    27   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -18.5    -58.7   .   .   
        1    25   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    28   LYS   .   .   .   .   .   .   .   .   .   .   .   .   .   -55.7    -75.7   .   .   
        1    26   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    28   LYS   .   .   .   .   .   .   .   .   .   .   .   .   .   -28.1    -51.6   .   .   
        1    27   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    29   GLY   .   .   .   .   .   .   .   .   .   .   .   .   .   -52.1    -83.9   .   .   
        1    28   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    29   GLY   .   .   .   .   .   .   .   .   .   .   .   .   .   -27.9    -53.6   .   .   
        1    29   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    30   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -50.0    -77.6   .   .   
        1    30   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    30   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -16.9    -63.9   .   .   
        1    31   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    31   HIS   .   .   .   .   .   .   .   .   .   .   .   .   .   -55.2    -77.3   .   .   
        1    32   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    31   HIS   .   .   .   .   .   .   .   .   .   .   .   .   .   -32.6    -52.6   .   .   
        1    33   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    32   GLN   .   .   .   .   .   .   .   .   .   .   .   .   .   -57.7    -77.9   .   .   
        1    34   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    32   GLN   .   .   .   .   .   .   .   .   .   .   .   .   .   -14.1    -61.0   .   .   
        1    35   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    33   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -50.7    -76.8   .   .   
        1    36   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    33   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -31.8    -51.8   .   .   
        1    37   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    34   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -53.1    -73.2   .   .   
        1    38   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    34   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -24.7    -51.2   .   .   
        1    39   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    35   TYR   .   .   .   .   .   .   .   .   .   .   .   .   .   -56.3    -76.3   .   .   
        1    40   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    35   TYR   .   .   .   .   .   .   .   .   .   .   .   .   .   -31.8    -57.6   .   .   
        1    41   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    36   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -45.9    -76.5   .   .   
        1    42   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    36   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -31.3    -51.3   .   .   
        1    43   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    37   GLN   .   .   .   .   .   .   .   .   .   .   .   .   .   -53.2    -76.4   .   .   
        1    44   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    37   GLN   .   .   .   .   .   .   .   .   .   .   .   .   .   -23.6    -56.0   .   .   
        1    45   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    38   HIS   .   .   .   .   .   .   .   .   .   .   .   .   .   -52.3    -80.1   .   .   
        1    46   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    38   HIS   .   .   .   .   .   .   .   .   .   .   .   .   .   -28.0    -54.5   .   .   
        1    47   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    39   GLN   .   .   .   .   .   .   .   .   .   .   .   .   .   -47.9    -79.6   .   .   
        1    48   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    39   GLN   .   .   .   .   .   .   .   .   .   .   .   .   .   -26.9    -54.4   .   .   
        1    49   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    40   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -50.5    -77.5   .   .   
        1    50   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    40   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -27.8    -55.5   .   .   
        1    51   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    41   ASP   .   .   .   .   .   .   .   .   .   .   .   .   .   -54.2    -74.2   .   .   
        1    52   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    41   ASP   .   .   .   .   .   .   .   .   .   .   .   .   .   -27.4    -51.5   .   .   
        1    53   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    42   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -56.2    -76.2   .   .   
        1    54   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    42   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -29.0    -54.7   .   .   
        1    55   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    43   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -51.4    -77.6   .   .   
        1    56   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    43   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -30.9    -51.1   .   .   
        1    57   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    44   ASN   .   .   .   .   .   .   .   .   .   .   .   .   .   -48.2    -84.5   .   .   
        1    58   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    44   ASN   .   .   .   .   .   .   .   .   .   .   .   .   .   -19.0    -52.2   .   .   
        1    59   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    45   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -54.7    -89.9   .   .   
        1    60   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    45   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -18.6    -47.3   .   .   
        1    61   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    46   ASN   .   .   .   .   .   .   .   .   .   .   .   .   .   -44.9   -135.0   .   .   
        1    62   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    46   ASN   .   .   .   .   .   .   .   .   .   .   .   .   .    17.5    -35.8   .   .   
        1    63   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    48   SER   .   .   .   .   .   .   .   .   .   .   .   .   .   -27.6   -146.5   .   .   
        1    64   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    48   SER   .   .   .   .   .   .   .   .   .   .   .   .   .   164.6     97.4   .   .   
        1    65   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    49   LYS   .   .   .   .   .   .   .   .   .   .   .   .   .   -47.6    -67.6   .   .   
        1    66   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    49   LYS   .   .   .   .   .   .   .   .   .   .   .   .   .    -9.3    -56.3   .   .   
        1    67   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    50   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -52.0    -75.2   .   .   
        1    68   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    50   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -19.5    -52.9   .   .   
        1    69   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    51   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -54.1    -74.1   .   .   
        1    70   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    51   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -32.8    -52.8   .   .   
        1    71   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    52   GLN   .   .   .   .   .   .   .   .   .   .   .   .   .   -49.1    -69.1   .   .   
        1    72   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    52   GLN   .   .   .   .   .   .   .   .   .   .   .   .   .   -33.1    -61.2   .   .   
        1    73   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    53   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -53.1    -73.2   .   .   
        1    74   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    53   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -30.1    -50.1   .   .   
        1    75   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    54   LYS   .   .   .   .   .   .   .   .   .   .   .   .   .   -54.5    -74.5   .   .   
        1    76   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    54   LYS   .   .   .   .   .   .   .   .   .   .   .   .   .   -31.3    -55.4   .   .   
        1    77   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    55   ILE   .   .   .   .   .   .   .   .   .   .   .   .   .   -52.5    -77.1   .   .   
        1    78   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    55   ILE   .   .   .   .   .   .   .   .   .   .   .   .   .   -32.6    -56.2   .   .   
        1    79   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    56   ILE   .   .   .   .   .   .   .   .   .   .   .   .   .   -54.5    -74.5   .   .   
        1    80   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    56   ILE   .   .   .   .   .   .   .   .   .   .   .   .   .   -32.9    -53.4   .   .   
        1    81   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    57   ARG   .   .   .   .   .   .   .   .   .   .   .   .   .   -53.4    -73.4   .   .   
        1    82   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    57   ARG   .   .   .   .   .   .   .   .   .   .   .   .   .   -26.6    -52.3   .   .   
        1    83   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    58   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -56.3    -76.3   .   .   
        1    84   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    58   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -29.0    -52.6   .   .   
        1    85   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    59   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -54.4    -74.4   .   .   
        1    86   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    59   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -31.3    -51.3   .   .   
        1    87   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    60   ASP   .   .   .   .   .   .   .   .   .   .   .   .   .   -55.0    -75.0   .   .   
        1    88   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    60   ASP   .   .   .   .   .   .   .   .   .   .   .   .   .   -28.7    -53.2   .   .   
        1    89   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    61   VAL   .   .   .   .   .   .   .   .   .   .   .   .   .   -57.0    -77.0   .   .   
        1    90   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    61   VAL   .   .   .   .   .   .   .   .   .   .   .   .   .   -32.7    -52.7   .   .   
        1    91   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    62   VAL   .   .   .   .   .   .   .   .   .   .   .   .   .   -53.5    -74.2   .   .   
        1    92   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    62   VAL   .   .   .   .   .   .   .   .   .   .   .   .   .   -34.1    -55.8   .   .   
        1    93   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    63   CYS   .   .   .   .   .   .   .   .   .   .   .   .   .   -50.6    -70.6   .   .   
        1    94   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    63   CYS   .   .   .   .   .   .   .   .   .   .   .   .   .   -28.1    -53.4   .   .   
        1    95   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    64   ALA   .   .   .   .   .   .   .   .   .   .   .   .   .   -51.1    -72.2   .   .   
        1    96   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    64   ALA   .   .   .   .   .   .   .   .   .   .   .   .   .   -25.7    -58.0   .   .   
        1    97   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    65   MET   .   .   .   .   .   .   .   .   .   .   .   .   .   -57.8    -77.8   .   .   
        1    98   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    65   MET   .   .   .   .   .   .   .   .   .   .   .   .   .   -24.7    -56.5   .   .   
        1    99   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    66   ILE   .   .   .   .   .   .   .   .   .   .   .   .   .   -44.6    -88.8   .   .   
        1   100   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    66   ILE   .   .   .   .   .   .   .   .   .   .   .   .   .   -28.7    -52.8   .   .   
        1   101   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    67   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -49.3    -74.1   .   .   
        1   102   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    67   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -22.7    -52.5   .   .   
        1   103   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    68   GLY   .   .   .   .   .   .   .   .   .   .   .   .   .   -54.0    -84.0   .   .   
        1   104   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    68   GLY   .   .   .   .   .   .   .   .   .   .   .   .   .   -28.4    -52.4   .   .   
        1   105   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    69   ALA   .   .   .   .   .   .   .   .   .   .   .   .   .   -52.1    -73.5   .   .   
        1   106   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    69   ALA   .   .   .   .   .   .   .   .   .   .   .   .   .   -28.7    -55.9   .   .   
        1   107   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    70   GLN   .   .   .   .   .   .   .   .   .   .   .   .   .   -53.4    -73.4   .   .   
        1   108   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    70   GLN   .   .   .   .   .   .   .   .   .   .   .   .   .   -23.4    -52.6   .   .   
        1   109   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    71   GLY   .   .   .   .   .   .   .   .   .   .   .   .   .   -52.2    -84.7   .   .   
        1   110   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    71   GLY   .   .   .   .   .   .   .   .   .   .   .   .   .   -26.4    -51.5   .   .   
        1   111   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    72   ALA   .   .   .   .   .   .   .   .   .   .   .   .   .   -51.8    -79.2   .   .   
        1   112   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    72   ALA   .   .   .   .   .   .   .   .   .   .   .   .   .   -16.7    -61.5   .   .   
        1   113   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    73   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -50.3    -71.0   .   .   
        1   114   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    73   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -35.1    -55.5   .   .   
        1   115   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    74   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -54.3    -76.3   .   .   
        1   116   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    74   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -30.7    -52.0   .   .   
        1   117   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    75   ARG   .   .   .   .   .   .   .   .   .   .   .   .   .   -54.3    -74.3   .   .   
        1   118   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    75   ARG   .   .   .   .   .   .   .   .   .   .   .   .   .   -26.9    -53.7   .   .   
        1   119   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    76   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -52.9    -77.5   .   .   
        1   120   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    76   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -23.4    -54.2   .   .   
        1   121   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    77   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -50.2    -83.4   .   .   
        1   122   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    77   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -10.4    -46.8   .   .   
        1   123   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    78   LYS   .   .   .   .   .   .   .   .   .   .   .   .   .   -47.8    -98.4   .   .   
        1   124   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    78   LYS   .   .   .   .   .   .   .   .   .   .   .   .   .   -10.7    -65.5   .   .   
        1   125   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    79   ARG   .   .   .   .   .   .   .   .   .   .   .   .   .   -51.2    -91.5   .   .   
        1   126   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    79   ARG   .   .   .   .   .   .   .   .   .   .   .   .   .   -13.6    -58.6   .   .   
        1   127   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    84   ILE   .   .   .   .   .   .   .   .   .   .   .   .   .   -52.1    -72.1   .   .   
        1   128   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    84   ILE   .   .   .   .   .   .   .   .   .   .   .   .   .    -8.8    -56.5   .   .   
        1   129   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    85   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -47.3    -79.1   .   .   
        1   130   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    85   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -25.4    -50.8   .   .   
        1   131   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    86   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -50.8    -72.8   .   .   
        1   132   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    86   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -27.6    -55.2   .   .   
        1   133   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    87   ARG   .   .   .   .   .   .   .   .   .   .   .   .   .   -50.1    -70.1   .   .   
        1   134   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    87   ARG   .   .   .   .   .   .   .   .   .   .   .   .   .   -33.1    -53.1   .   .   
        1   135   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    88   PHE   .   .   .   .   .   .   .   .   .   .   .   .   .   -54.7    -74.7   .   .   
        1   136   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    88   PHE   .   .   .   .   .   .   .   .   .   .   .   .   .   -30.0    -55.4   .   .   
        1   137   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    89   ASN   .   .   .   .   .   .   .   .   .   .   .   .   .   -52.3    -72.3   .   .   
        1   138   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    89   ASN   .   .   .   .   .   .   .   .   .   .   .   .   .   -32.8    -52.8   .   .   
        1   139   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    90   TYR   .   .   .   .   .   .   .   .   .   .   .   .   .   -56.1    -76.1   .   .   
        1   140   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    90   TYR   .   .   .   .   .   .   .   .   .   .   .   .   .   -30.3    -53.7   .   .   
        1   141   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    91   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -51.2    -83.6   .   .   
        1   142   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    91   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -18.9    -54.2   .   .   
        1   143   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    92   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -57.8    -77.8   .   .   
        1   144   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    92   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -26.5    -55.1   .   .   
        1   145   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    93   ALA   .   .   .   .   .   .   .   .   .   .   .   .   .   -51.6    -78.7   .   .   
        1   146   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    93   ALA   .   .   .   .   .   .   .   .   .   .   .   .   .   -27.4    -56.9   .   .   
        1   147   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    94   GLN   .   .   .   .   .   .   .   .   .   .   .   .   .   -54.4    -77.7   .   .   
        1   148   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    94   GLN   .   .   .   .   .   .   .   .   .   .   .   .   .   -25.4    -55.3   .   .   
        1   149   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    95   THR   .   .   .   .   .   .   .   .   .   .   .   .   .   -49.0    -81.0   .   .   
        1   150   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    95   THR   .   .   .   .   .   .   .   .   .   .   .   .   .   -31.2    -51.2   .   .   
        1   151   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    96   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -54.1    -75.3   .   .   
        1   152   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    96   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -29.3    -49.3   .   .   
        1   153   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    97   SER   .   .   .   .   .   .   .   .   .   .   .   .   .   -49.6    -84.7   .   .   
        1   154   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    97   SER   .   .   .   .   .   .   .   .   .   .   .   .   .   -23.7    -52.0   .   .   
        1   155   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    98   LYS   .   .   .   .   .   .   .   .   .   .   .   .   .   -56.2    -76.2   .   .   
        1   156   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    98   LYS   .   .   .   .   .   .   .   .   .   .   .   .   .   -26.1    -50.1   .   .   
        1   157   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    99   ILE   .   .   .   .   .   .   .   .   .   .   .   .   .   -56.9    -76.9   .   .   
        1   158   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .    99   ILE   .   .   .   .   .   .   .   .   .   .   .   .   .   -34.9    -55.4   .   .   
        1   159   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   100   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -50.2    -70.2   .   .   
        1   160   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   100   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -31.1    -51.1   .   .   
        1   161   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   101   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -54.5    -74.5   .   .   
        1   162   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   101   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -27.7    -55.2   .   .   
        1   163   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   102   LYS   .   .   .   .   .   .   .   .   .   .   .   .   .   -54.9    -74.9   .   .   
        1   164   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   102   LYS   .   .   .   .   .   .   .   .   .   .   .   .   .   -27.3    -56.1   .   .   
        1   165   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   103   ASP   .   .   .   .   .   .   .   .   .   .   .   .   .   -54.4    -74.4   .   .   
        1   166   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   103   ASP   .   .   .   .   .   .   .   .   .   .   .   .   .   -23.7    -57.0   .   .   
        1   167   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   104   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -50.2    -73.9   .   .   
        1   168   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   104   LEU   .   .   .   .   .   .   .   .   .   .   .   .   .   -32.2    -56.0   .   .   
        1   169   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   105   LYS   .   .   .   .   .   .   .   .   .   .   .   .   .   -51.9    -81.3   .   .   
        1   170   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   105   LYS   .   .   .   .   .   .   .   .   .   .   .   .   .   -13.6    -57.2   .   .   
        1   171   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   106   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -54.9    -75.1   .   .   
        1   172   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   106   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -12.9    -68.2   .   .   
        1   173   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   107   THR   .   .   .   .   .   .   .   .   .   .   .   .   .   -50.6    -76.0   .   .   
        1   174   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   107   THR   .   .   .   .   .   .   .   .   .   .   .   .   .   -33.0    -53.0   .   .   
        1   175   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   108   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -51.5    -71.5   .   .   
        1   176   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   108   GLU   .   .   .   .   .   .   .   .   .   .   .   .   .   -27.3    -56.9   .   .   
        1   177   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   109   GLN   .   .   .   .   .   .   .   .   .   .   .   .   .   -50.0    -70.0   .   .   
        1   178   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   109   GLN   .   .   .   .   .   .   .   .   .   .   .   .   .   -31.4    -55.0   .   .   
        1   179   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   110   LYS   .   .   .   .   .   .   .   .   .   .   .   .   .   -53.3    -73.3   .   .   
        1   180   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   110   LYS   .   .   .   .   .   .   .   .   .   .   .   .   .   -28.2    -48.2   .   .   
        1   181   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   111   VAL   .   .   .   .   .   .   .   .   .   .   .   .   .   -56.2    -76.2   .   .   
        1   182   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   111   VAL   .   .   .   .   .   .   .   .   .   .   .   .   .   -27.3    -60.1   .   .   
        1   183   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   112   LYS   .   .   .   .   .   .   .   .   .   .   .   .   .   -48.9    -77.3   .   .   
        1   184   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   112   LYS   .   .   .   .   .   .   .   .   .   .   .   .   .   -14.9    -55.2   .   .   
        1   185   PHI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   116   THR   .   .   .   .   .   .   .   .   .   .   .   .   .   -48.0   -149.4   .   .   
        1   186   PSI   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   .   116   THR   .   .   .   .   .   .   .   .   .   .   .   .   .   202.3    105.5   .   .   
    stop_

save_



Constrains/BT5_hb.str0000644000373300001320000012067410525571021013703 0ustar  mandarnmr1data_n/a_MR_file_constraints


save_global_MR_file_characteristics
    _File_characteristics.Sf_category       file_characteristics 
    _File_characteristics.ID                1 
    _File_characteristics.NMR_STAR_version  3.0 
    _File_characteristics.PDB_ID            N/A 
    _File_characteristics.MR_file_name      n/a.mr 
    _File_characteristics.Conversion_date   2006-11-12 

    loop_
        _File_characteristic.File_characteristics_ID 
        _File_characteristic.MR_file_block_position 
        _File_characteristic.Program 
        _File_characteristic.Type 
        _File_characteristic.Subtype 
        _File_characteristic.Format 

        1   1   DYANA/DIANA   distance   "hydrogen bond"    simple   
    stop_

save_


save_DYANA/DIANA_distance_constraints_1
    _Distance_constraints.Sf_category             distance_constraints 
    _Distance_constraints.ID                      1 
    _Distance_constraints.MR_file_block_position  1 
    _Distance_constraints.Program                 DYANA/DIANA 
    _Distance_constraints.Type                    distance 
    _Distance_constraints.Subtype                "hydrogen bond" 
    _Distance_constraints.Format                  simple 

    loop_
        _Dist_constraint_tree.Constraints_ID 
        _Dist_constraint_tree.ID 
        _Dist_constraint_tree.Node_ID 
        _Dist_constraint_tree.Down_node_ID 
        _Dist_constraint_tree.Right_node_ID 
        _Dist_constraint_tree.Logic_operation 

        1     1   1   .   .   .   
        1     2   1   .   .   .   
        1     3   1   .   .   .   
        1     4   1   .   .   .   
        1     5   1   .   .   .   
        1     6   1   .   .   .   
        1     7   1   .   .   .   
        1     8   1   .   .   .   
        1     9   1   .   .   .   
        1    10   1   .   .   .   
        1    11   1   .   .   .   
        1    12   1   .   .   .   
        1    13   1   .   .   .   
        1    14   1   .   .   .   
        1    15   1   .   .   .   
        1    16   1   .   .   .   
        1    17   1   .   .   .   
        1    18   1   .   .   .   
        1    19   1   .   .   .   
        1    20   1   .   .   .   
        1    21   1   .   .   .   
        1    22   1   .   .   .   
        1    23   1   .   .   .   
        1    24   1   .   .   .   
        1    25   1   .   .   .   
        1    26   1   .   .   .   
        1    27   1   .   .   .   
        1    28   1   .   .   .   
        1    29   1   .   .   .   
        1    30   1   .   .   .   
        1    31   1   .   .   .   
        1    32   1   .   .   .   
        1    33   1   .   .   .   
        1    34   1   .   .   .   
        1    35   1   .   .   .   
        1    36   1   .   .   .   
        1    37   1   .   .   .   
        1    38   1   .   .   .   
        1    39   1   .   .   .   
        1    40   1   .   .   .   
        1    41   1   .   .   .   
        1    42   1   .   .   .   
        1    43   1   .   .   .   
        1    44   1   .   .   .   
        1    45   1   .   .   .   
        1    46   1   .   .   .   
        1    47   1   .   .   .   
        1    48   1   .   .   .   
        1    49   1   .   .   .   
        1    50   1   .   .   .   
        1    51   1   .   .   .   
        1    52   1   .   .   .   
        1    53   1   .   .   .   
        1    54   1   .   .   .   
        1    55   1   .   .   .   
        1    56   1   .   .   .   
        1    57   1   .   .   .   
        1    58   1   .   .   .   
        1    59   1   .   .   .   
        1    60   1   .   .   .   
        1    61   1   .   .   .   
        1    62   1   .   .   .   
        1    63   1   .   .   .   
        1    64   1   .   .   .   
        1    65   1   .   .   .   
        1    66   1   .   .   .   
        1    67   1   .   .   .   
        1    68   1   .   .   .   
        1    69   1   .   .   .   
        1    70   1   .   .   .   
        1    71   1   .   .   .   
        1    72   1   .   .   .   
        1    73   1   .   .   .   
        1    74   1   .   .   .   
        1    75   1   .   .   .   
        1    76   1   .   .   .   
        1    77   1   .   .   .   
        1    78   1   .   .   .   
        1    79   1   .   .   .   
        1    80   1   .   .   .   
        1    81   1   .   .   .   
        1    82   1   .   .   .   
        1    83   1   .   .   .   
        1    84   1   .   .   .   
        1    85   1   .   .   .   
        1    86   1   .   .   .   
        1    87   1   .   .   .   
        1    88   1   .   .   .   
        1    89   1   .   .   .   
        1    90   1   .   .   .   
        1    91   1   .   .   .   
        1    92   1   .   .   .   
        1    93   1   .   .   .   
        1    94   1   .   .   .   
        1    95   1   .   .   .   
        1    96   1   .   .   .   
        1    97   1   .   .   .   
        1    98   1   .   .   .   
        1    99   1   .   .   .   
        1   100   1   .   .   .   
        1   101   1   .   .   .   
        1   102   1   .   .   .   
        1   103   1   .   .   .   
        1   104   1   .   .   .   
        1   105   1   .   .   .   
        1   106   1   .   .   .   
        1   107   1   .   .   .   
        1   108   1   .   .   .   
        1   109   1   .   .   .   
        1   110   1   .   .   .   
        1   111   1   .   .   .   
        1   112   1   .   .   .   
        1   113   1   .   .   .   
        1   114   1   .   .   .   
        1   115   1   .   .   .   
        1   116   1   .   .   .   
        1   117   1   .   .   .   
        1   118   1   .   .   .   
        1   119   1   .   .   .   
        1   120   1   .   .   .   
        1   121   1   .   .   .   
        1   122   1   .   .   .   
        1   123   1   .   .   .   
        1   124   1   .   .   .   
        1   125   1   .   .   .   
        1   126   1   .   .   .   
        1   127   1   .   .   .   
        1   128   1   .   .   .   
        1   129   1   .   .   .   
        1   130   1   .   .   .   
        1   131   1   .   .   .   
        1   132   1   .   .   .   
        1   133   1   .   .   .   
        1   134   1   .   .   .   
        1   135   1   .   .   .   
        1   136   1   .   .   .   
        1   137   1   .   .   .   
        1   138   1   .   .   .   
        1   139   1   .   .   .   
        1   140   1   .   .   .   
        1   141   1   .   .   .   
        1   142   1   .   .   .   
        1   143   1   .   .   .   
        1   144   1   .   .   .   
        1   145   1   .   .   .   
        1   146   1   .   .   .   
        1   147   1   .   .   .   
        1   148   1   .   .   .   
        1   149   1   .   .   .   
        1   150   1   .   .   .   
        1   151   1   .   .   .   
        1   152   1   .   .   .   
        1   153   1   .   .   .   
        1   154   1   .   .   .   
        1   155   1   .   .   .   
        1   156   1   .   .   .   
    stop_


    loop_
        _Dist_constraint.Constraints_ID 
        _Dist_constraint.Dist_constraint_tree_ID 
        _Dist_constraint.Tree_node_member_node_ID 
        _Dist_constraint.Contribution_fractional_val 
        _Dist_constraint.Constraint_tree_node_member_ID 
        _Dist_constraint.Label_entity_assembly_ID 
        _Dist_constraint.Label_entity_ID 
        _Dist_constraint.Label_comp_index_ID 
        _Dist_constraint.Label_comp_ID 
        _Dist_constraint.Label_atom_ID 
        _Dist_constraint.Auth_segment_code 
        _Dist_constraint.Auth_seq_ID 
        _Dist_constraint.Auth_comp_ID 
        _Dist_constraint.Auth_atom_ID 

        1     1   1   .   1   .   .   .   .   .   .    17   LEU   O   
        1     1   1   .   2   .   .   .   .   .   .    21   GLN   H   
        1     2   1   .   1   .   .   .   .   .   .    17   LEU   O   
        1     2   1   .   2   .   .   .   .   .   .    21   GLN   N   
        1     3   1   .   1   .   .   .   .   .   .    18   LEU   O   
        1     3   1   .   2   .   .   .   .   .   .    22   ALA   H   
        1     4   1   .   1   .   .   .   .   .   .    18   LEU   O   
        1     4   1   .   2   .   .   .   .   .   .    22   ALA   N   
        1     5   1   .   1   .   .   .   .   .   .    19   ILE   O   
        1     5   1   .   2   .   .   .   .   .   .    23   ASN   H   
        1     6   1   .   1   .   .   .   .   .   .    19   ILE   O   
        1     6   1   .   2   .   .   .   .   .   .    23   ASN   N   
        1     7   1   .   1   .   .   .   .   .   .    20   GLU   O   
        1     7   1   .   2   .   .   .   .   .   .    24   HIS   H   
        1     8   1   .   1   .   .   .   .   .   .    20   GLU   O   
        1     8   1   .   2   .   .   .   .   .   .    24   HIS   N   
        1     9   1   .   1   .   .   .   .   .   .    21   GLN   O   
        1     9   1   .   2   .   .   .   .   .   .    25   ALA   H   
        1    10   1   .   1   .   .   .   .   .   .    21   GLN   O   
        1    10   1   .   2   .   .   .   .   .   .    25   ALA   N   
        1    11   1   .   1   .   .   .   .   .   .    22   ALA   O   
        1    11   1   .   2   .   .   .   .   .   .    26   ILE   H   
        1    12   1   .   1   .   .   .   .   .   .    22   ALA   O   
        1    12   1   .   2   .   .   .   .   .   .    26   ILE   N   
        1    13   1   .   1   .   .   .   .   .   .    23   ASN   O   
        1    13   1   .   2   .   .   .   .   .   .    27   GLU   H   
        1    14   1   .   1   .   .   .   .   .   .    23   ASN   O   
        1    14   1   .   2   .   .   .   .   .   .    27   GLU   N   
        1    15   1   .   1   .   .   .   .   .   .    24   HIS   O   
        1    15   1   .   2   .   .   .   .   .   .    28   LYS   H   
        1    16   1   .   1   .   .   .   .   .   .    24   HIS   O   
        1    16   1   .   2   .   .   .   .   .   .    28   LYS   N   
        1    17   1   .   1   .   .   .   .   .   .    25   ALA   O   
        1    17   1   .   2   .   .   .   .   .   .    29   GLY   H   
        1    18   1   .   1   .   .   .   .   .   .    25   ALA   O   
        1    18   1   .   2   .   .   .   .   .   .    29   GLY   N   
        1    19   1   .   1   .   .   .   .   .   .    26   ILE   O   
        1    19   1   .   2   .   .   .   .   .   .    30   GLU   H   
        1    20   1   .   1   .   .   .   .   .   .    26   ILE   O   
        1    20   1   .   2   .   .   .   .   .   .    30   GLU   N   
        1    21   1   .   1   .   .   .   .   .   .    27   GLU   O   
        1    21   1   .   2   .   .   .   .   .   .    31   HIS   H   
        1    22   1   .   1   .   .   .   .   .   .    27   GLU   O   
        1    22   1   .   2   .   .   .   .   .   .    31   HIS   N   
        1    23   1   .   1   .   .   .   .   .   .    28   LYS   O   
        1    23   1   .   2   .   .   .   .   .   .    32   GLN   H   
        1    24   1   .   1   .   .   .   .   .   .    28   LYS   O   
        1    24   1   .   2   .   .   .   .   .   .    32   GLN   N   
        1    25   1   .   1   .   .   .   .   .   .    29   GLY   O   
        1    25   1   .   2   .   .   .   .   .   .    33   LEU   H   
        1    26   1   .   1   .   .   .   .   .   .    29   GLY   O   
        1    26   1   .   2   .   .   .   .   .   .    33   LEU   N   
        1    27   1   .   1   .   .   .   .   .   .    30   GLU   O   
        1    27   1   .   2   .   .   .   .   .   .    34   LEU   H   
        1    28   1   .   1   .   .   .   .   .   .    30   GLU   O   
        1    28   1   .   2   .   .   .   .   .   .    34   LEU   N   
        1    29   1   .   1   .   .   .   .   .   .    31   HIS   O   
        1    29   1   .   2   .   .   .   .   .   .    35   TYR   H   
        1    30   1   .   1   .   .   .   .   .   .    31   HIS   O   
        1    30   1   .   2   .   .   .   .   .   .    35   TYR   N   
        1    31   1   .   1   .   .   .   .   .   .    32   GLN   O   
        1    31   1   .   2   .   .   .   .   .   .    36   LEU   H   
        1    32   1   .   1   .   .   .   .   .   .    32   GLN   O   
        1    32   1   .   2   .   .   .   .   .   .    36   LEU   N   
        1    33   1   .   1   .   .   .   .   .   .    33   LEU   O   
        1    33   1   .   2   .   .   .   .   .   .    37   GLN   H   
        1    34   1   .   1   .   .   .   .   .   .    33   LEU   O   
        1    34   1   .   2   .   .   .   .   .   .    37   GLN   N   
        1    35   1   .   1   .   .   .   .   .   .    36   LEU   O   
        1    35   1   .   2   .   .   .   .   .   .    40   LEU   H   
        1    36   1   .   1   .   .   .   .   .   .    36   LEU   O   
        1    36   1   .   2   .   .   .   .   .   .    40   LEU   N   
        1    37   1   .   1   .   .   .   .   .   .    37   GLN   O   
        1    37   1   .   2   .   .   .   .   .   .    41   ASP   H   
        1    38   1   .   1   .   .   .   .   .   .    37   GLN   O   
        1    38   1   .   2   .   .   .   .   .   .    41   ASP   N   
        1    39   1   .   1   .   .   .   .   .   .    38   HIS   O   
        1    39   1   .   2   .   .   .   .   .   .    42   GLU   H   
        1    40   1   .   1   .   .   .   .   .   .    38   HIS   O   
        1    40   1   .   2   .   .   .   .   .   .    42   GLU   N   
        1    41   1   .   1   .   .   .   .   .   .    39   GLN   O   
        1    41   1   .   2   .   .   .   .   .   .    43   LEU   H   
        1    42   1   .   1   .   .   .   .   .   .    39   GLN   O   
        1    42   1   .   2   .   .   .   .   .   .    43   LEU   N   
        1    43   1   .   1   .   .   .   .   .   .    40   LEU   O   
        1    43   1   .   2   .   .   .   .   .   .    44   ASN   H   
        1    44   1   .   1   .   .   .   .   .   .    40   LEU   O   
        1    44   1   .   2   .   .   .   .   .   .    44   ASN   N   
        1    45   1   .   1   .   .   .   .   .   .    42   GLU   O   
        1    45   1   .   2   .   .   .   .   .   .    46   ASN   H   
        1    46   1   .   1   .   .   .   .   .   .    42   GLU   O   
        1    46   1   .   2   .   .   .   .   .   .    46   ASN   N   
        1    47   1   .   1   .   .   .   .   .   .    43   LEU   O   
        1    47   1   .   2   .   .   .   .   .   .    47   LYS   H   
        1    48   1   .   1   .   .   .   .   .   .    43   LEU   O   
        1    48   1   .   2   .   .   .   .   .   .    47   LYS   N   
        1    49   1   .   1   .   .   .   .   .   .    48   SER   O   
        1    49   1   .   2   .   .   .   .   .   .    52   GLN   H   
        1    50   1   .   1   .   .   .   .   .   .    48   SER   O   
        1    50   1   .   2   .   .   .   .   .   .    52   GLN   N   
        1    51   1   .   1   .   .   .   .   .   .    49   LYS   O   
        1    51   1   .   2   .   .   .   .   .   .    53   GLU   H   
        1    52   1   .   1   .   .   .   .   .   .    49   LYS   O   
        1    52   1   .   2   .   .   .   .   .   .    53   GLU   N   
        1    53   1   .   1   .   .   .   .   .   .    50   GLU   O   
        1    53   1   .   2   .   .   .   .   .   .    54   LYS   H   
        1    54   1   .   1   .   .   .   .   .   .    50   GLU   O   
        1    54   1   .   2   .   .   .   .   .   .    54   LYS   N   
        1    55   1   .   1   .   .   .   .   .   .    51   LEU   O   
        1    55   1   .   2   .   .   .   .   .   .    55   ILE   H   
        1    56   1   .   1   .   .   .   .   .   .    51   LEU   O   
        1    56   1   .   2   .   .   .   .   .   .    55   ILE   N   
        1    57   1   .   1   .   .   .   .   .   .    52   GLN   O   
        1    57   1   .   2   .   .   .   .   .   .    56   ILE   H   
        1    58   1   .   1   .   .   .   .   .   .    52   GLN   O   
        1    58   1   .   2   .   .   .   .   .   .    56   ILE   N   
        1    59   1   .   1   .   .   .   .   .   .    54   LYS   O   
        1    59   1   .   2   .   .   .   .   .   .    58   GLU   H   
        1    60   1   .   1   .   .   .   .   .   .    54   LYS   O   
        1    60   1   .   2   .   .   .   .   .   .    58   GLU   N   
        1    61   1   .   1   .   .   .   .   .   .    55   ILE   O   
        1    61   1   .   2   .   .   .   .   .   .    59   LEU   H   
        1    62   1   .   1   .   .   .   .   .   .    55   ILE   O   
        1    62   1   .   2   .   .   .   .   .   .    59   LEU   N   
        1    63   1   .   1   .   .   .   .   .   .    56   ILE   O   
        1    63   1   .   2   .   .   .   .   .   .    60   ASP   H   
        1    64   1   .   1   .   .   .   .   .   .    56   ILE   O   
        1    64   1   .   2   .   .   .   .   .   .    60   ASP   N   
        1    65   1   .   1   .   .   .   .   .   .    57   ARG   O   
        1    65   1   .   2   .   .   .   .   .   .    61   VAL   H   
        1    66   1   .   1   .   .   .   .   .   .    57   ARG   O   
        1    66   1   .   2   .   .   .   .   .   .    61   VAL   N   
        1    67   1   .   1   .   .   .   .   .   .    58   GLU   O   
        1    67   1   .   2   .   .   .   .   .   .    62   VAL   H   
        1    68   1   .   1   .   .   .   .   .   .    58   GLU   O   
        1    68   1   .   2   .   .   .   .   .   .    62   VAL   N   
        1    69   1   .   1   .   .   .   .   .   .    59   LEU   O   
        1    69   1   .   2   .   .   .   .   .   .    63   CYS   H   
        1    70   1   .   1   .   .   .   .   .   .    59   LEU   O   
        1    70   1   .   2   .   .   .   .   .   .    63   CYS   N   
        1    71   1   .   1   .   .   .   .   .   .    60   ASP   O   
        1    71   1   .   2   .   .   .   .   .   .    64   ALA   H   
        1    72   1   .   1   .   .   .   .   .   .    60   ASP   O   
        1    72   1   .   2   .   .   .   .   .   .    64   ALA   N   
        1    73   1   .   1   .   .   .   .   .   .    61   VAL   O   
        1    73   1   .   2   .   .   .   .   .   .    65   MET   H   
        1    74   1   .   1   .   .   .   .   .   .    61   VAL   O   
        1    74   1   .   2   .   .   .   .   .   .    65   MET   N   
        1    75   1   .   1   .   .   .   .   .   .    62   VAL   O   
        1    75   1   .   2   .   .   .   .   .   .    66   ILE   H   
        1    76   1   .   1   .   .   .   .   .   .    62   VAL   O   
        1    76   1   .   2   .   .   .   .   .   .    66   ILE   N   
        1    77   1   .   1   .   .   .   .   .   .    63   CYS   O   
        1    77   1   .   2   .   .   .   .   .   .    67   GLU   H   
        1    78   1   .   1   .   .   .   .   .   .    63   CYS   O   
        1    78   1   .   2   .   .   .   .   .   .    67   GLU   N   
        1    79   1   .   1   .   .   .   .   .   .    64   ALA   O   
        1    79   1   .   2   .   .   .   .   .   .    68   GLY   H   
        1    80   1   .   1   .   .   .   .   .   .    64   ALA   O   
        1    80   1   .   2   .   .   .   .   .   .    68   GLY   N   
        1    81   1   .   1   .   .   .   .   .   .    65   MET   O   
        1    81   1   .   2   .   .   .   .   .   .    69   ALA   H   
        1    82   1   .   1   .   .   .   .   .   .    65   MET   O   
        1    82   1   .   2   .   .   .   .   .   .    69   ALA   N   
        1    83   1   .   1   .   .   .   .   .   .    66   ILE   O   
        1    83   1   .   2   .   .   .   .   .   .    70   GLN   H   
        1    84   1   .   1   .   .   .   .   .   .    66   ILE   O   
        1    84   1   .   2   .   .   .   .   .   .    70   GLN   N   
        1    85   1   .   1   .   .   .   .   .   .    67   GLU   O   
        1    85   1   .   2   .   .   .   .   .   .    71   GLY   H   
        1    86   1   .   1   .   .   .   .   .   .    67   GLU   O   
        1    86   1   .   2   .   .   .   .   .   .    71   GLY   N   
        1    87   1   .   1   .   .   .   .   .   .    68   GLY   O   
        1    87   1   .   2   .   .   .   .   .   .    72   ALA   H   
        1    88   1   .   1   .   .   .   .   .   .    68   GLY   O   
        1    88   1   .   2   .   .   .   .   .   .    72   ALA   N   
        1    89   1   .   1   .   .   .   .   .   .    69   ALA   O   
        1    89   1   .   2   .   .   .   .   .   .    73   LEU   H   
        1    90   1   .   1   .   .   .   .   .   .    69   ALA   O   
        1    90   1   .   2   .   .   .   .   .   .    73   LEU   N   
        1    91   1   .   1   .   .   .   .   .   .    70   GLN   O   
        1    91   1   .   2   .   .   .   .   .   .    74   GLU   H   
        1    92   1   .   1   .   .   .   .   .   .    70   GLN   O   
        1    92   1   .   2   .   .   .   .   .   .    74   GLU   N   
        1    93   1   .   1   .   .   .   .   .   .    71   GLY   O   
        1    93   1   .   2   .   .   .   .   .   .    75   ARG   H   
        1    94   1   .   1   .   .   .   .   .   .    71   GLY   O   
        1    94   1   .   2   .   .   .   .   .   .    75   ARG   N   
        1    95   1   .   1   .   .   .   .   .   .    72   ALA   O   
        1    95   1   .   2   .   .   .   .   .   .    76   GLU   H   
        1    96   1   .   1   .   .   .   .   .   .    72   ALA   O   
        1    96   1   .   2   .   .   .   .   .   .    76   GLU   N   
        1    97   1   .   1   .   .   .   .   .   .    73   LEU   O   
        1    97   1   .   2   .   .   .   .   .   .    77   LEU   H   
        1    98   1   .   1   .   .   .   .   .   .    73   LEU   O   
        1    98   1   .   2   .   .   .   .   .   .    77   LEU   N   
        1    99   1   .   1   .   .   .   .   .   .    74   GLU   O   
        1    99   1   .   2   .   .   .   .   .   .    78   LYS   H   
        1   100   1   .   1   .   .   .   .   .   .    74   GLU   O   
        1   100   1   .   2   .   .   .   .   .   .    78   LYS   N   
        1   101   1   .   1   .   .   .   .   .   .    83   ASN   O   
        1   101   1   .   2   .   .   .   .   .   .    87   ARG   H   
        1   102   1   .   1   .   .   .   .   .   .    83   ASN   O   
        1   102   1   .   2   .   .   .   .   .   .    87   ARG   N   
        1   103   1   .   1   .   .   .   .   .   .    84   ILE   O   
        1   103   1   .   2   .   .   .   .   .   .    88   PHE   H   
        1   104   1   .   1   .   .   .   .   .   .    84   ILE   O   
        1   104   1   .   2   .   .   .   .   .   .    88   PHE   N   
        1   105   1   .   1   .   .   .   .   .   .    85   LEU   O   
        1   105   1   .   2   .   .   .   .   .   .    89   ASN   H   
        1   106   1   .   1   .   .   .   .   .   .    85   LEU   O   
        1   106   1   .   2   .   .   .   .   .   .    89   ASN   N   
        1   107   1   .   1   .   .   .   .   .   .    86   GLU   O   
        1   107   1   .   2   .   .   .   .   .   .    90   TYR   H   
        1   108   1   .   1   .   .   .   .   .   .    86   GLU   O   
        1   108   1   .   2   .   .   .   .   .   .    90   TYR   N   
        1   109   1   .   1   .   .   .   .   .   .    87   ARG   O   
        1   109   1   .   2   .   .   .   .   .   .    91   GLU   H   
        1   110   1   .   1   .   .   .   .   .   .    87   ARG   O   
        1   110   1   .   2   .   .   .   .   .   .    91   GLU   N   
        1   111   1   .   1   .   .   .   .   .   .    88   PHE   O   
        1   111   1   .   2   .   .   .   .   .   .    92   GLU   H   
        1   112   1   .   1   .   .   .   .   .   .    88   PHE   O   
        1   112   1   .   2   .   .   .   .   .   .    92   GLU   N   
        1   113   1   .   1   .   .   .   .   .   .    89   ASN   O   
        1   113   1   .   2   .   .   .   .   .   .    93   ALA   H   
        1   114   1   .   1   .   .   .   .   .   .    89   ASN   O   
        1   114   1   .   2   .   .   .   .   .   .    93   ALA   N   
        1   115   1   .   1   .   .   .   .   .   .    90   TYR   O   
        1   115   1   .   2   .   .   .   .   .   .    94   GLN   H   
        1   116   1   .   1   .   .   .   .   .   .    90   TYR   O   
        1   116   1   .   2   .   .   .   .   .   .    94   GLN   N   
        1   117   1   .   1   .   .   .   .   .   .    91   GLU   O   
        1   117   1   .   2   .   .   .   .   .   .    95   THR   H   
        1   118   1   .   1   .   .   .   .   .   .    91   GLU   O   
        1   118   1   .   2   .   .   .   .   .   .    95   THR   N   
        1   119   1   .   1   .   .   .   .   .   .    92   GLU   O   
        1   119   1   .   2   .   .   .   .   .   .    96   LEU   H   
        1   120   1   .   1   .   .   .   .   .   .    92   GLU   O   
        1   120   1   .   2   .   .   .   .   .   .    96   LEU   N   
        1   121   1   .   1   .   .   .   .   .   .    93   ALA   O   
        1   121   1   .   2   .   .   .   .   .   .    97   SER   H   
        1   122   1   .   1   .   .   .   .   .   .    93   ALA   O   
        1   122   1   .   2   .   .   .   .   .   .    97   SER   N   
        1   123   1   .   1   .   .   .   .   .   .    94   GLN   O   
        1   123   1   .   2   .   .   .   .   .   .    98   LYS   H   
        1   124   1   .   1   .   .   .   .   .   .    94   GLN   O   
        1   124   1   .   2   .   .   .   .   .   .    98   LYS   N   
        1   125   1   .   1   .   .   .   .   .   .    95   THR   O   
        1   125   1   .   2   .   .   .   .   .   .    99   ILE   H   
        1   126   1   .   1   .   .   .   .   .   .    95   THR   O   
        1   126   1   .   2   .   .   .   .   .   .    99   ILE   N   
        1   127   1   .   1   .   .   .   .   .   .    96   LEU   O   
        1   127   1   .   2   .   .   .   .   .   .   100   LEU   H   
        1   128   1   .   1   .   .   .   .   .   .    96   LEU   O   
        1   128   1   .   2   .   .   .   .   .   .   100   LEU   N   
        1   129   1   .   1   .   .   .   .   .   .    97   SER   O   
        1   129   1   .   2   .   .   .   .   .   .   101   LEU   H   
        1   130   1   .   1   .   .   .   .   .   .    97   SER   O   
        1   130   1   .   2   .   .   .   .   .   .   101   LEU   N   
        1   131   1   .   1   .   .   .   .   .   .    98   LYS   O   
        1   131   1   .   2   .   .   .   .   .   .   102   LYS   H   
        1   132   1   .   1   .   .   .   .   .   .    98   LYS   O   
        1   132   1   .   2   .   .   .   .   .   .   102   LYS   N   
        1   133   1   .   1   .   .   .   .   .   .    99   ILE   O   
        1   133   1   .   2   .   .   .   .   .   .   103   ASP   H   
        1   134   1   .   1   .   .   .   .   .   .    99   ILE   O   
        1   134   1   .   2   .   .   .   .   .   .   103   ASP   N   
        1   135   1   .   1   .   .   .   .   .   .   100   LEU   O   
        1   135   1   .   2   .   .   .   .   .   .   104   LEU   H   
        1   136   1   .   1   .   .   .   .   .   .   100   LEU   O   
        1   136   1   .   2   .   .   .   .   .   .   104   LEU   N   
        1   137   1   .   1   .   .   .   .   .   .   101   LEU   O   
        1   137   1   .   2   .   .   .   .   .   .   105   LYS   H   
        1   138   1   .   1   .   .   .   .   .   .   101   LEU   O   
        1   138   1   .   2   .   .   .   .   .   .   105   LYS   N   
        1   139   1   .   1   .   .   .   .   .   .   102   LYS   O   
        1   139   1   .   2   .   .   .   .   .   .   106   GLU   H   
        1   140   1   .   1   .   .   .   .   .   .   102   LYS   O   
        1   140   1   .   2   .   .   .   .   .   .   106   GLU   N   
        1   141   1   .   1   .   .   .   .   .   .   103   ASP   O   
        1   141   1   .   2   .   .   .   .   .   .   107   THR   H   
        1   142   1   .   1   .   .   .   .   .   .   103   ASP   O   
        1   142   1   .   2   .   .   .   .   .   .   107   THR   N   
        1   143   1   .   1   .   .   .   .   .   .   104   LEU   O   
        1   143   1   .   2   .   .   .   .   .   .   108   GLU   H   
        1   144   1   .   1   .   .   .   .   .   .   104   LEU   O   
        1   144   1   .   2   .   .   .   .   .   .   108   GLU   N   
        1   145   1   .   1   .   .   .   .   .   .   105   LYS   O   
        1   145   1   .   2   .   .   .   .   .   .   109   GLN   H   
        1   146   1   .   1   .   .   .   .   .   .   105   LYS   O   
        1   146   1   .   2   .   .   .   .   .   .   109   GLN   N   
        1   147   1   .   1   .   .   .   .   .   .   106   GLU   O   
        1   147   1   .   2   .   .   .   .   .   .   110   LYS   H   
        1   148   1   .   1   .   .   .   .   .   .   106   GLU   O   
        1   148   1   .   2   .   .   .   .   .   .   110   LYS   N   
        1   149   1   .   1   .   .   .   .   .   .   107   THR   O   
        1   149   1   .   2   .   .   .   .   .   .   111   VAL   H   
        1   150   1   .   1   .   .   .   .   .   .   107   THR   O   
        1   150   1   .   2   .   .   .   .   .   .   111   VAL   N   
        1   151   1   .   1   .   .   .   .   .   .   108   GLU   O   
        1   151   1   .   2   .   .   .   .   .   .   112   LYS   H   
        1   152   1   .   1   .   .   .   .   .   .   108   GLU   O   
        1   152   1   .   2   .   .   .   .   .   .   112   LYS   N   
        1   153   1   .   1   .   .   .   .   .   .   109   GLN   O   
        1   153   1   .   2   .   .   .   .   .   .   113   ASP   H   
        1   154   1   .   1   .   .   .   .   .   .   109   GLN   O   
        1   154   1   .   2   .   .   .   .   .   .   113   ASP   N   
        1   155   1   .   1   .   .   .   .   .   .   110   LYS   O   
        1   155   1   .   2   .   .   .   .   .   .   114   ILE   H   
        1   156   1   .   1   .   .   .   .   .   .   110   LYS   O   
        1   156   1   .   2   .   .   .   .   .   .   114   ILE   N   
    stop_


    loop_
        _Dist_constraint_value.Constraints_ID 
        _Dist_constraint_value.Constraint_ID 
        _Dist_constraint_value.Tree_node_ID 
        _Dist_constraint_value.Source_experiment_ID 
        _Dist_constraint_value.Spectral_peak_ID 
        _Dist_constraint_value.Intensity_val 
        _Dist_constraint_value.Intensity_lower_val_err 
        _Dist_constraint_value.Intensity_upper_val_err 
        _Dist_constraint_value.Distance_val 
        _Dist_constraint_value.Distance_lower_bound_val 
        _Dist_constraint_value.Distance_upper_bound_val 
        _Dist_constraint_value.Weight 
        _Dist_constraint_value.Spectral_peak_ppm_1 
        _Dist_constraint_value.Spectral_peak_ppm_2 

        1     1   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1     2   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1     3   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1     4   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1     5   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1     6   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1     7   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1     8   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1     9   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    10   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    11   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    12   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    13   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    14   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    15   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    16   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    17   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    18   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    19   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    20   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    21   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    22   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    23   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    24   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    25   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    26   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    27   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    28   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    29   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    30   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    31   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    32   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    33   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    34   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    35   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    36   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    37   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    38   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    39   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    40   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    41   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    42   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    43   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    44   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    45   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    46   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    47   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    48   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    49   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    50   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    51   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    52   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    53   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    54   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    55   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    56   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    57   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    58   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    59   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    60   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    61   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    62   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    63   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    64   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    65   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    66   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    67   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    68   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    69   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    70   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    71   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    72   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    73   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    74   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    75   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    76   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    77   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    78   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    79   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    80   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    81   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    82   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    83   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    84   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    85   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    86   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    87   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    88   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    89   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    90   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    91   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    92   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    93   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    94   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    95   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    96   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    97   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1    98   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1    99   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   100   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   101   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   102   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   103   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   104   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   105   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   106   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   107   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   108   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   109   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   110   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   111   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   112   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   113   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   114   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   115   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   116   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   117   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   118   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   119   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   120   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   121   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   122   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   123   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   124   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   125   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   126   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   127   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   128   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   129   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   130   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   131   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   132   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   133   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   134   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   135   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   136   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   137   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   138   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   139   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   140   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   141   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   142   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   143   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   144   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   145   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   146   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   147   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   148   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   149   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   150   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   151   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   152   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   153   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   154   1   .   .   .   .   .   .   .   3.00   .   .   .   
        1   155   1   .   .   .   .   .   .   .   2.00   .   .   .   
        1   156   1   .   .   .   .   .   .   .   3.00   .   .   .   
    stop_

save_



Constrains/BT5_HNHA.str0000644000373300001320000004263110525573171014034 0ustar  mandarnmr1#
# The original sequence entered was:
# QEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRT
# DLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
#


# Expressed in NMR-STAR 3.0 format, this sequence is:

_Entity.Polymer_seq_one_letter_code
;
QEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRT
DLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
;

loop_
    _Entity_comp_index.ID
    _Entity_comp_index.Comp_index_ID
    _Entity_comp_index.Comp_ID

1    @   GLN
2    @   GLU
3    @   HIS
4    @   LYS
5    @   PRO
6    @   LYS
7    @   LYS
8    @   ASP
9    @   ASP
10   @   PHE
11   @   ARG
12   @   ASN
13   @   GLU
14   @   PHE
15   @   ASP
16   @   HIS
17   @   LEU
18   @   LEU
19   @   ILE
20   @   GLU
21   @   GLN
22   @   ALA
23   @   ASN
24   @   HIS
25   @   ALA
26   @   ILE
27   @   GLU
28   @   LYS
29   @   GLY
30   @   GLU
31   @   HIS
32   @   GLN
33   @   LEU
34   @   LEU
35   @   TYR
36   @   LEU
37   @   GLN
38   @   HIS
39   @   GLN
40   @   LEU
41   @   ASP
42   @   GLU
43   @   LEU
44   @   ASN
45   @   GLU
46   @   ASN
47   @   LYS
48   @   SER
49   @   LYS
50   @   GLU
51   @   LEU
52   @   GLN
53   @   GLU
54   @   LYS
55   @   ILE
56   @   ILE
57   @   ARG
58   @   GLU
59   @   LEU
60   @   ASP
61   @   VAL
62   @   VAL
63   @   CYS
64   @   ALA
65   @   MET
66   @   ILE
67   @   GLU
68   @   GLY
69   @   ALA
70   @   GLN
71   @   GLY
72   @   ALA
73   @   LEU
74   @   GLU
75   @   ARG
76   @   GLU
77   @   LEU
78   @   LYS
79   @   ARG
80   @   THR
81   @   ASP
82   @   LEU
83   @   ASN
84   @   ILE
85   @   LEU
86   @   GLU
87   @   ARG
88   @   PHE
89   @   ASN
90   @   TYR
91   @   GLU
92   @   GLU
93   @   ALA
94   @   GLN
95   @   THR
96   @   LEU
97   @   SER
98   @   LYS
99   @   ILE
100  @   LEU
101  @   LEU
102  @   LYS
103  @   ASP
104  @   LEU
105  @   LYS
106  @   GLU
107  @   THR
108  @   GLU
109  @   GLN
110  @   LYS
111  @   VAL
112  @   LYS
113  @   ASP
114  @   ILE
115  @   GLN
116  @   THR
117  @   GLN

stop_

# INSTRUCTIONS
# 1) Replace the @-signs with appropriate values.
# 2) Text comments concerning the constants can be
#    supplied in the full deposition.
# 3) Feel free to add or delete rows to the table as needed.

# The coupling constant table for this sequence is:

loop_
    _Coupling_constant.ID
    _Coupling_constant.Code
    _Coupling_constant.Auth_seq_ID_1
    _Coupling_constant.Auth_comp_ID_1
    _Coupling_constant.Auth_atom_ID_1
    _Coupling_constant.Atom_type_1
    _Coupling_constant.Ambiguity_code_1
    _Coupling_constant.Auth_seq_ID_2
    _Coupling_constant.Auth_comp_ID_2
    _Coupling_constant.Auth_atom_ID_2
    _Coupling_constant.Atom_type_2
    _Coupling_constant.Ambiguity_code_2
    _Coupling_constant.Val
    _Coupling_constant.Min_val
    _Coupling_constant.Max_val
    _Coupling_constant.Val_err
#                    Auth    Auth     Auth                   Auth     Auth   Auth
#                    seq     comp     atom    Atom   Ambig   seq      comp   atom   Atom    Ambig          Min    Max     Val
#ID    code          ID 1    ID 1     ID 1    type 1 code 1  ID 2     ID 2   ID 2   type 2  code 2  val    val    val     err
#--------------------------------------------------------------------------------------------------------------------------------
#
 1     3JHNHA        1       GLN      H       H      @       1       GLN      HA     H      @       @      @      @       @
 2     3JHNHA        2       GLU      H       H      @       2       GLU      HA     H      @       @      @      @       @
 3     3JHNHA        3       HIS      H       H      @       3       HIS      HA     H      @       @      @      @       @
 4     3JHNHA        4       LYS      H       H      @       4       LYS      HA     H      @       @      @      @       @
 5     3JHNHA        5       PRO      H       H      @       5       PRO      HA     H      @       @      @      @       @
 6     3JHNHA        6       LYS      H       H      @       6       LYS      HA     H      @       @      @      @       @
 7     3JHNHA        7       LYS      H       H      @       7       LYS      HA     H      @       @      @      @       @
 8     3JHNHA        8       ASP      H       H      @       8       ASP      HA     H      @       @      @      @       @
 9     3JHNHA        9       ASP      H       H      @       9       ASP      HA     H      @       @      @      @       @
 10    3JHNHA        10      PHE      H       H      @       10      PHE      HA     H      @       @      @      @       @
 11    3JHNHA        11      ARG      H       H      @       11      ARG      HA     H      @       @      @      @       @
 12    3JHNHA        12      ASN      H       H      @       12      ASN      HA     H      @       @      @      @       @
 13    3JHNHA        13      GLU      H       H      @       13      GLU      HA     H      @       @      @      @       @
 14    3JHNHA        14      PHE      H       H      @       14      PHE      HA     H      @       @      @      @       @
 15    3JHNHA        15      ASP      H       H      @       15      ASP      HA     H      @       @      @      @       @
 16    3JHNHA        16      HIS      H       H      @       16      HIS      HA     H      @       @      @      @       @
 17    3JHNHA        17      LEU      H       H      @       17      LEU      HA     H      @       @      @      @       @
 18    3JHNHA        18      LEU      H       H      @       18      LEU      HA     H      @       @      @      @       @
 19    3JHNHA        19      ILE      H       H      @       19      ILE      HA     H      @       @      @      @       @
 20    3JHNHA        20      GLU      H       H      @       20      GLU      HA     H      @       @      @      @       @
 21    3JHNHA        21      GLN      H       H      @       21      GLN      HA     H      @       @      @      @       @
 22    3JHNHA        22      ALA      H       H      @       22      ALA      HA     H      @       @      @      @       @
 23    3JHNHA        23      ASN      H       H      @       23      ASN      HA     H      @       @      @      @       @
 24    3JHNHA        24      HIS      H       H      @       24      HIS      HA     H      @       @      @      @       @
 25    3JHNHA        25      ALA      H       H      @       25      ALA      HA     H      @       @      @      @       @
 26    3JHNHA        26      ILE      H       H      @       26      ILE      HA     H      @       @      @      @       @
 27    3JHNHA        27      GLU      H       H      @       27      GLU      HA     H      @       @      @      @       @
 28    3JHNHA        28      LYS      H       H      @       28      LYS      HA     H      @       @      @      @       @
 29    3JHNHA        29      GLY      H       H      @       29      GLY      HA     H      @       @      @      @       @
 30    3JHNHA        30      GLU      H       H      @       30      GLU      HA     H      @       @      @      @       @
 31    3JHNHA        31      HIS      H       H      @       31      HIS      HA     H      @       @      @      @       @
 32    3JHNHA        32      GLN      H       H      @       32      GLN      HA     H      @       @      @      @       @
 33    3JHNHA        33      LEU      H       H      @       33      LEU      HA     H      @       @      @      @       @
 34    3JHNHA        34      LEU      H       H      @       34      LEU      HA     H      @    4.69      @      @       @
 35    3JHNHA        35      TYR      H       H      @       35      TYR      HA     H      @    4.11      @      @       @
 36    3JHNHA        36      LEU      H       H      @       36      LEU      HA     H      @    3.46      @      @       @
 37    3JHNHA        37      GLN      H       H      @       37      GLN      HA     H      @       @      @      @       @
 38    3JHNHA        38      HIS      H       H      @       38      HIS      HA     H      @       @      @      @       @
 39    3JHNHA        39      GLN      H       H      @       39      GLN      HA     H      @       @      @      @       @
 40    3JHNHA        40      LEU      H       H      @       40      LEU      HA     H      @    2.89      @      @       @
 41    3JHNHA        41      ASP      H       H      @       41      ASP      HA     H      @    3.66      @      @       @
 42    3JHNHA        42      GLU      H       H      @       42      GLU      HA     H      @    4.36      @      @       @
 43    3JHNHA        43      LEU      H       H      @       43      LEU      HA     H      @    3.68      @      @       @
 44    3JHNHA        44      ASN      H       H      @       44      ASN      HA     H      @    3.44      @      @       @
 45    3JHNHA        45      GLU      H       H      @       45      GLU      HA     H      @    7.88      @      @       @
 46    3JHNHA        46      ASN      H       H      @       46      ASN      HA     H      @    5.06      @      @       @
 47    3JHNHA        47      LYS      H       H      @       47      LYS      HA     H      @       @      @      @       @
 48    3JHNHA        48      SER      H       H      @       48      SER      HA     H      @    4.30      @      @       @
 49    3JHNHA        49      LYS      H       H      @       49      LYS      HA     H      @       @      @      @       @
 50    3JHNHA        50      GLU      H       H      @       50      GLU      HA     H      @       @      @      @       @
 51    3JHNHA        51      LEU      H       H      @       51      LEU      HA     H      @    5.22      @      @       @
 52    3JHNHA        52      GLN      H       H      @       52      GLN      HA     H      @       @      @      @       @
 53    3JHNHA        53      GLU      H       H      @       53      GLU      HA     H      @       @      @      @       @
 54    3JHNHA        54      LYS      H       H      @       54      LYS      HA     H      @       @      @      @       @
 55    3JHNHA        55      ILE      H       H      @       55      ILE      HA     H      @       @      @      @       @
 56    3JHNHA        56      ILE      H       H      @       56      ILE      HA     H      @       @      @      @       @
 57    3JHNHA        57      ARG      H       H      @       57      ARG      HA     H      @       @      @      @       @
 58    3JHNHA        58      GLU      H       H      @       58      GLU      HA     H      @       @      @      @       @
 59    3JHNHA        59      LEU      H       H      @       59      LEU      HA     H      @    3.52      @      @       @
 60    3JHNHA        60      ASP      H       H      @       60      ASP      HA     H      @       @      @      @       @
 61    3JHNHA        61      VAL      H       H      @       61      VAL      HA     H      @    4.53      @      @       @
 62    3JHNHA        62      VAL      H       H      @       62      VAL      HA     H      @       @      @      @       @
 63    3JHNHA        63      CYS      H       H      @       63      CYS      HA     H      @       @      @      @       @
 64    3JHNHA        64      ALA      H       H      @       64      ALA      HA     H      @       @      @      @       @
 65    3JHNHA        65      MET      H       H      @       65      MET      HA     H      @       @      @      @       @
 66    3JHNHA        66      ILE      H       H      @       66      ILE      HA     H      @       @      @      @       @
 67    3JHNHA        67      GLU      H       H      @       67      GLU      HA     H      @       @      @      @       @
 68    3JHNHA        68      GLY      H       H      @       68      GLY      HA     H      @       @      @      @       @
 69    3JHNHA        69      ALA      H       H      @       69      ALA      HA     H      @       @      @      @       @
 70    3JHNHA        70      GLN      H       H      @       70      GLN      HA     H      @    2.90      @      @       @
 71    3JHNHA        71      GLY      H       H      @       71      GLY      HA     H      @       @      @      @       @
 72    3JHNHA        72      ALA      H       H      @       72      ALA      HA     H      @    3.91      @      @       @
 73    3JHNHA        73      LEU      H       H      @       73      LEU      HA     H      @       @      @      @       @
 74    3JHNHA        74      GLU      H       H      @       74      GLU      HA     H      @       @      @      @       @
 75    3JHNHA        75      ARG      H       H      @       75      ARG      HA     H      @    3.78      @      @       @
 76    3JHNHA        76      GLU      H       H      @       76      GLU      HA     H      @       @      @      @       @
 77    3JHNHA        77      LEU      H       H      @       77      LEU      HA     H      @    3.96      @      @       @
 78    3JHNHA        78      LYS      H       H      @       78      LYS      HA     H      @    3.12      @      @       @
 79    3JHNHA        79      ARG      H       H      @       79      ARG      HA     H      @       @      @      @       @
 80    3JHNHA        80      THR      H       H      @       80      THR      HA     H      @       @      @      @       @
 81    3JHNHA        81      ASP      H       H      @       81      ASP      HA     H      @       @      @      @       @
 82    3JHNHA        82      LEU      H       H      @       82      LEU      HA     H      @    6.88      @      @       @
 83    3JHNHA        83      ASN      H       H      @       83      ASN      HA     H      @       @      @      @       @
 84    3JHNHA        84      ILE      H       H      @       84      ILE      HA     H      @       @      @      @       @
 85    3JHNHA        85      LEU      H       H      @       85      LEU      HA     H      @       @      @      @       @
 86    3JHNHA        86      GLU      H       H      @       86      GLU      HA     H      @       @      @      @       @
 87    3JHNHA        87      ARG      H       H      @       87      ARG      HA     H      @       @      @      @       @
 88    3JHNHA        88      PHE      H       H      @       88      PHE      HA     H      @       @      @      @       @
 89    3JHNHA        89      ASN      H       H      @       89      ASN      HA     H      @       @      @      @       @
 90    3JHNHA        90      TYR      H       H      @       90      TYR      HA     H      @    2.94      @      @       @
 91    3JHNHA        91      GLU      H       H      @       91      GLU      HA     H      @    3.13      @      @       @
 92    3JHNHA        92      GLU      H       H      @       92      GLU      HA     H      @       @      @      @       @
 93    3JHNHA        93      ALA      H       H      @       93      ALA      HA     H      @    3.60      @      @       @
 94    3JHNHA        94      GLN      H       H      @       94      GLN      HA     H      @       @      @      @       @
 95    3JHNHA        95      THR      H       H      @       95      THR      HA     H      @       @      @      @       @
 96    3JHNHA        96      LEU      H       H      @       96      LEU      HA     H      @       @      @      @       @
 97    3JHNHA        97      SER      H       H      @       97      SER      HA     H      @       @      @      @       @
 98    3JHNHA        98      LYS      H       H      @       98      LYS      HA     H      @       @      @      @       @
 99    3JHNHA        99      ILE      H       H      @       99      ILE      HA     H      @       @      @      @       @
 100   3JHNHA        100     LEU      H       H      @       100     LEU      HA     H      @       @      @      @       @
 101   3JHNHA        101     LEU      H       H      @       101     LEU      HA     H      @       @      @      @       @
 102   3JHNHA        102     LYS      H       H      @       102     LYS      HA     H      @       @      @      @       @
 103   3JHNHA        103     ASP      H       H      @       103     ASP      HA     H      @       @      @      @       @
 104   3JHNHA        104     LEU      H       H      @       104     LEU      HA     H      @    4.03      @      @       @
 105   3JHNHA        105     LYS      H       H      @       105     LYS      HA     H      @       @      @      @       @
 106   3JHNHA        106     GLU      H       H      @       106     GLU      HA     H      @       @      @      @       @
 107   3JHNHA        107     THR      H       H      @       107     THR      HA     H      @       @      @      @       @
 108   3JHNHA        108     GLU      H       H      @       108     GLU      HA     H      @       @      @      @       @
 109   3JHNHA        109     GLN      H       H      @       109     GLN      HA     H      @    3.71      @      @       @
 110   3JHNHA        110     LYS      H       H      @       110     LYS      HA     H      @       @      @      @       @
 111   3JHNHA        111     VAL      H       H      @       111     VAL      HA     H      @       @      @      @       @
 112   3JHNHA        112     LYS      H       H      @       112     LYS      HA     H      @       @      @      @       @
 113   3JHNHA        113     ASP      H       H      @       113     ASP      HA     H      @       @      @      @       @
 114   3JHNHA        114     ILE      H       H      @       114     ILE      HA     H      @    5.93      @      @       @
 115   3JHNHA        115     GLN      H       H      @       115     GLN      HA     H      @       @      @      @       @
 116   3JHNHA        116     THR      H       H      @       116     THR      HA     H      @       @      @      @       @
 117   3JHNHA        117     GLN      H       H      @       117     GLN      HA     H      @       @      @      @       @

stop_
Constrains/Cyana2.1 format/0000755000373300001320000000000010525573626014636 5ustar  mandarnmr1Constrains/Cyana2.1 format/BT5.aco0000600000373300001320000001377210525552616015712 0ustar  mandarnmr1   4 LYS   PHI    -121.4   -56.3
   4 LYS   PSI      72.0   180.0
   9 ASP   PHI    -107.4   -28.6
   9 ASP   PSI     -64.2    32.2
  15 ASP   PHI     -72.2   -51.6
  15 ASP   PSI     -56.4   -21.9
  19 ILE   PHI     -87.7   -47.1
  19 ILE   PSI     -68.1    -7.7
  20 GLU   PHI     -78.6   -51.9
  20 GLU   PSI     -53.0   -24.6
  21 GLN   PHI     -75.4   -55.4
  21 GLN   PSI     -51.2   -26.2
  22 ALA   PHI     -75.5   -55.5
  22 ALA   PSI     -49.1   -28.6
  23 ASN   PHI     -86.6   -49.9
  23 ASN   PSI     -48.9   -26.1
  24 HIS   PHI     -78.5   -58.5
  24 HIS   PSI     -63.0   -16.8
  25 ALA   PHI     -82.0   -55.5
  25 ALA   PSI     -50.4   -21.1
  26 ILE   PHI     -72.7   -51.6
  26 ILE   PSI     -56.9   -31.9
  27 GLU   PHI     -73.1   -50.7
  27 GLU   PSI     -58.7   -18.5
  28 LYS   PHI     -75.7   -55.7
  28 LYS   PSI     -51.6   -28.1
  29 GLY   PHI     -83.9   -52.1
  29 GLY   PSI     -53.6   -27.9
  30 GLU   PHI     -77.6   -50.0
  30 GLU   PSI     -63.9   -16.9
  31 HIS   PHI     -77.3   -55.2
  31 HIS   PSI     -52.6   -32.6
  32 GLN   PHI     -77.9   -57.7
  32 GLN   PSI     -61.0   -14.1
  33 LEU   PHI     -76.8   -50.7
  33 LEU   PSI     -51.8   -31.8
  34 LEU   PHI     -73.2   -53.1
  34 LEU   PSI     -51.2   -24.7
  35 TYR   PHI     -76.3   -56.3
  35 TYR   PSI     -57.6   -31.8
  36 LEU   PHI     -76.5   -45.9
  36 LEU   PSI     -51.3   -31.3
  37 GLN   PHI     -76.4   -53.2
  37 GLN   PSI     -56.0   -23.6
  38 HIS   PHI     -80.1   -52.3
  38 HIS   PSI     -54.5   -28.0
  39 GLN   PHI     -79.6   -47.9
  39 GLN   PSI     -54.4   -26.9
  40 LEU   PHI     -77.5   -50.5
  40 LEU   PSI     -55.5   -27.8
  41 ASP   PHI     -74.2   -54.2
  41 ASP   PSI     -51.5   -27.4
  42 GLU   PHI     -76.2   -56.2
  42 GLU   PSI     -54.7   -29.0
  43 LEU   PHI     -77.6   -51.4
  43 LEU   PSI     -51.1   -30.9
  44 ASN   PHI     -84.5   -48.2
  44 ASN   PSI     -52.2   -19.0
  45 GLU   PHI     -89.9   -54.7
  45 GLU   PSI     -47.3   -18.6
  46 ASN   PHI    -135.0   -44.9
  46 ASN   PSI     -35.8    17.5
  48 SER   PHI    -146.5   -27.6
  48 SER   PSI      97.4   164.6
  49 LYS   PHI     -67.6   -47.6
  49 LYS   PSI     -56.3    -9.3
  50 GLU   PHI     -75.2   -52.0
  50 GLU   PSI     -52.9   -19.5
  51 LEU   PHI     -74.1   -54.1
  51 LEU   PSI     -52.8   -32.8
  52 GLN   PHI     -69.1   -49.1
  52 GLN   PSI     -61.2   -33.1
  53 GLU   PHI     -73.2   -53.1
  53 GLU   PSI     -50.1   -30.1
  54 LYS   PHI     -74.5   -54.5
  54 LYS   PSI     -55.4   -31.3
  55 ILE   PHI     -77.1   -52.5
  55 ILE   PSI     -56.2   -32.6
  56 ILE   PHI     -74.5   -54.5
  56 ILE   PSI     -53.4   -32.9
  57 ARG   PHI     -73.4   -53.4
  57 ARG   PSI     -52.3   -26.6
  58 GLU   PHI     -76.3   -56.3
  58 GLU   PSI     -52.6   -29.0
  59 LEU   PHI     -74.4   -54.4
  59 LEU   PSI     -51.3   -31.3
  60 ASP   PHI     -75.0   -55.0
  60 ASP   PSI     -53.2   -28.7
  61 VAL   PHI     -77.0   -57.0
  61 VAL   PSI     -52.7   -32.7
  62 VAL   PHI     -74.2   -53.5
  62 VAL   PSI     -55.8   -34.1
  63 CYS   PHI     -70.6   -50.6
  63 CYS   PSI     -53.4   -28.1
  64 ALA   PHI     -72.2   -51.1
  64 ALA   PSI     -58.0   -25.7
  65 MET   PHI     -77.8   -57.8
  65 MET   PSI     -56.5   -24.7
  66 ILE   PHI     -88.8   -44.6
  66 ILE   PSI     -52.8   -28.7
  67 GLU   PHI     -74.1   -49.3
  67 GLU   PSI     -52.5   -22.7
  68 GLY   PHI     -84.0   -54.0
  68 GLY   PSI     -52.4   -28.4
  69 ALA   PHI     -73.5   -52.1
  69 ALA   PSI     -55.9   -28.7
  70 GLN   PHI     -73.4   -53.4
  70 GLN   PSI     -52.6   -23.4
  71 GLY   PHI     -84.7   -52.2
  71 GLY   PSI     -51.5   -26.4
  72 ALA   PHI     -79.2   -51.8
  72 ALA   PSI     -61.5   -16.7
  73 LEU   PHI     -71.0   -50.3
  73 LEU   PSI     -55.5   -35.1
  74 GLU   PHI     -76.3   -54.3
  74 GLU   PSI     -52.0   -30.7
  75 ARG   PHI     -74.3   -54.3
  75 ARG   PSI     -53.7   -26.9
  76 GLU   PHI     -77.5   -52.9
  76 GLU   PSI     -54.2   -23.4
  77 LEU   PHI     -83.4   -50.2
  77 LEU   PSI     -46.8   -10.4
  78 LYS   PHI     -98.4   -47.8
  78 LYS   PSI     -65.5   -10.7
  79 ARG   PHI     -91.5   -51.2
  79 ARG   PSI     -58.6   -13.6
  84 ILE   PHI     -72.1   -52.1
  84 ILE   PSI     -56.5    -8.8
  85 LEU   PHI     -79.1   -47.3
  85 LEU   PSI     -50.8   -25.4
  86 GLU   PHI     -72.8   -50.8
  86 GLU   PSI     -55.2   -27.6
  87 ARG   PHI     -70.1   -50.1
  87 ARG   PSI     -53.1   -33.1
  88 PHE   PHI     -74.7   -54.7
  88 PHE   PSI     -55.4   -30.0
  89 ASN   PHI     -72.3   -52.3
  89 ASN   PSI     -52.8   -32.8
  90 TYR   PHI     -76.1   -56.1
  90 TYR   PSI     -53.7   -30.3
  91 GLU   PHI     -83.6   -51.2
  91 GLU   PSI     -54.2   -18.9
  92 GLU   PHI     -77.8   -57.8
  92 GLU   PSI     -55.1   -26.5
  93 ALA   PHI     -78.7   -51.6
  93 ALA   PSI     -56.9   -27.4
  94 GLN   PHI     -77.7   -54.4
  94 GLN   PSI     -55.3   -25.4
  95 THR   PHI     -81.0   -49.0
  95 THR   PSI     -51.2   -31.2
  96 LEU   PHI     -75.3   -54.1
  96 LEU   PSI     -49.3   -29.3
  97 SER   PHI     -84.7   -49.6
  97 SER   PSI     -52.0   -23.7
  98 LYS   PHI     -76.2   -56.2
  98 LYS   PSI     -50.1   -26.1
  99 ILE   PHI     -76.9   -56.9
  99 ILE   PSI     -55.4   -34.9
 100 LEU   PHI     -70.2   -50.2
 100 LEU   PSI     -51.1   -31.1
 101 LEU   PHI     -74.5   -54.5
 101 LEU   PSI     -55.2   -27.7
 102 LYS   PHI     -74.9   -54.9
 102 LYS   PSI     -56.1   -27.3
 103 ASP   PHI     -74.4   -54.4
 103 ASP   PSI     -57.0   -23.7
 104 LEU   PHI     -73.9   -50.2
 104 LEU   PSI     -56.0   -32.2
 105 LYS   PHI     -81.3   -51.9
 105 LYS   PSI     -57.2   -13.6
 106 GLU   PHI     -75.1   -54.9
 106 GLU   PSI     -68.2   -12.9
 107 THR   PHI     -76.0   -50.6
 107 THR   PSI     -53.0   -33.0
 108 GLU   PHI     -71.5   -51.5
 108 GLU   PSI     -56.9   -27.3
 109 GLN   PHI     -70.0   -50.0
 109 GLN   PSI     -55.0   -31.4
 110 LYS   PHI     -73.3   -53.3
 110 LYS   PSI     -48.2   -28.2
 111 VAL   PHI     -76.2   -56.2
 111 VAL   PSI     -60.1   -27.3
 112 LYS   PHI     -77.3   -48.9
 112 LYS   PSI     -55.2   -14.9
 116 THR   PHI    -149.4   -48.0
 116 THR   PSI     105.5   202.3
Constrains/Cyana2.1 format/BT5.cco0000600000373300001320000000352010525573463015705 0ustar  mandarnmr1  34 LEU   H    HA       4.69    2.00  1.00E+00    1.72   -1.38    6.98
  35 TYR   H    HA       4.11    2.00  1.00E+00    1.72   -1.38    6.98
  36 LEU   H    HA       3.46    2.00  1.00E+00    1.72   -1.38    6.98
  40 LEU   H    HA       2.89    2.00  1.00E+00    1.72   -1.38    6.98
  41 ASP   H    HA       3.66    2.00  1.00E+00    1.72   -1.38    6.98
  42 GLU   H    HA       4.36    2.00  1.00E+00    1.72   -1.38    6.98
  43 LEU   H    HA       3.68    2.00  1.00E+00    1.72   -1.38    6.98
  44 ASN   H    HA       3.44    2.00  1.00E+00    1.72   -1.38    6.98
  45 GLU   H    HA       7.88    2.00  1.00E+00    1.72   -1.38    6.98
  46 ASN   H    HA       5.06    2.00  1.00E+00    1.72   -1.38    6.98
  48 SER   H    HA       4.30    2.00  1.00E+00    1.72   -1.38    6.98
  51 LEU   H    HA       5.22    2.00  1.00E+00    1.72   -1.38    6.98
  59 LEU   H    HA       3.52    2.00  1.00E+00    1.72   -1.38    6.98
  61 VAL   H    HA       4.53    2.00  1.00E+00    1.72   -1.38    6.98
  70 GLN   H    HA       2.90    2.00  1.00E+00    1.72   -1.38    6.98
  72 ALA   H    HA       3.91    2.00  1.00E+00    1.72   -1.38    6.98
  75 ARG   H    HA       3.78    2.00  1.00E+00    1.72   -1.38    6.98
  77 LEU   H    HA       3.96    2.00  1.00E+00    1.72   -1.38    6.98
  78 LYS   H    HA       3.12    2.00  1.00E+00    1.72   -1.38    6.98
  82 LEU   H    HA       6.88    2.00  1.00E+00    1.72   -1.38    6.98
  90 TYR   H    HA       2.94    2.00  1.00E+00    1.72   -1.38    6.98
  91 GLU   H    HA       3.13    2.00  1.00E+00    1.72   -1.38    6.98
  93 ALA   H    HA       3.60    2.00  1.00E+00    1.72   -1.38    6.98
 104 LEU   H    HA       4.03    2.00  1.00E+00    1.72   -1.38    6.98
 109 GLN   H    HA       3.71    2.00  1.00E+00    1.72   -1.38    6.98
 114 ILE   H    HA       5.93    2.00  1.00E+00    1.72   -1.38    6.98
Constrains/Cyana2.1 format/BT5.seq0000600000373300001320000000147410525505364015732 0ustar  mandarnmr1GLN 1
GLU 2
HIS 3
LYS 4
PRO 5
LYS 6
LYS 7
ASP 8
ASP 9
PHE 10
ARG 11
ASN 12
GLU 13
PHE 14
ASP 15
HIS 16
LEU 17
LEU 18
ILE 19
GLU 20
GLN 21
ALA 22
ASN 23
HIS 24
ALA 25
ILE 26
GLU 27
LYS 28
GLY 29
GLU 30
HIS 31
GLN 32
LEU 33
LEU 34
TYR 35
LEU 36
GLN 37
HIS 38
GLN 39
LEU 40
ASP 41
GLU 42
LEU 43
ASN 44
GLU 45
ASN 46
LYS 47
SER 48
LYS 49
GLU 50
LEU 51
GLN 52
GLU 53
LYS 54
ILE 55
ILE 56
ARG 57
GLU 58
LEU 59
ASP 60
VAL 61
VAL 62
CYS 63
ALA 64
MET 65
ILE 66
GLU 67
GLY 68
ALA 69
GLN 70
GLY 71
ALA 72
LEU 73
GLU 74
ARG 75
GLU 76
LEU 77
LYS 78
ARG 79
THR 80
ASP 81
LEU 82
ASN 83
ILE 84
LEU 85
GLU 86
ARG 87
PHE 88
ASN 89
TYR 90
GLU 91
GLU 92
ALA 93
GLN 94
THR 95
LEU 96
SER 97
LYS 98
ILE 99
LEU 100
LEU 101
LYS 102
ASP 103
LEU 104
LYS 105
GLU 106
THR 107
GLU 108
GLN 109
LYS 110
VAL 111
LYS 112
ASP 113
ILE 114
GLN 115
THR 116
GLN 117
Constrains/Cyana2.1 format/BT5.upl0000600000373300001320000025124610525552616015750 0ustar  mandarnmr1 19 ILE  QG2    23 ASN  HD22    4.50            #peak    12 #SUP  0.92  #QF  0.92
  1 GLN  QB      1 GLN  HE21    4.20            #peak    22 #SUP  0.71  #QF  0.71
 40 LEU  QD1    44 ASN  HD22    5.46            #peak    38 #SUP  0.84  #QF  0.40
 32 GLN  HE22   62 VAL  HB      4.87            #peak    43 #SUP  0.59  #QF  0.59
 32 GLN  HE22   36 LEU  QQD     4.37            #peak    44 #SUP  0.68  #QF  0.68
115 GLN  QG    115 GLN  HE22    3.76            #peak    48 #SUP  0.78  #QF  0.78
113 ASP  H     114 ILE  H       3.55            #peak    53 #SUP  0.81  #QF  0.81
113 ASP  QB    114 ILE  H       3.83            #peak    57 #SUP  0.83  #QF  0.83
114 ILE  H     114 ILE  HB      3.00            #peak    58 #SUP  0.70  #QF  0.70
114 ILE  H     114 ILE  QG1     3.73            #peak    59 #SUP  0.85  #QF  0.85
114 ILE  H     114 ILE  QD1     3.58            #peak    61 #SUP  0.76  #QF  0.24
 33 LEU  QD1    37 GLN  HE21    4.28            #peak    70 #SUP  0.82  #QF  0.48
 83 ASN  HA     83 ASN  HD22    3.67            #peak    73 #SUP  0.73  #QF  0.73
 82 LEU  H      82 LEU  QB      3.67            #peak    78 #SUP  0.91  #QF  0.91
 82 LEU  H      82 LEU  QQD     4.08            #peak    79 #SUP  0.74  #QF  0.74
 77 LEU  H      78 LYS  H       4.21            #peak    83 #SUP  0.87  #QF  0.87
 76 GLU  HA     78 LYS  H       4.46            #peak    87 #SUP  0.56  #QF  0.56
 78 LYS  H      78 LYS  QB      3.45            #peak    88 #SUP  0.96  #QF  0.96
 76 GLU  QB     78 LYS  H       4.99            #peak    89 #SUP  0.99  #QF  0.88
 78 LYS  H      78 LYS  QG      4.08            #peak    90 #SUP  0.89  #QF  0.89
 44 ASN  H      45 GLU  H       3.57            #peak    91 #SUP  0.90  #QF  0.56
 45 GLU  H      46 ASN  H       3.68            #peak    91 #SUP  0.90  #QF  0.56
 44 ASN  HB2    45 GLU  H       3.87            #peak    95 #SUP  0.84  #QF  0.70
 45 GLU  H      45 GLU  QG      4.12            #peak    96 #SUP  0.98  #QF  0.98
 45 GLU  H      45 GLU  QB      3.04            #peak    97 #SUP  0.94  #QF  0.94
 70 GLN  HE21  101 LEU  QQD     4.54            #peak   105 #SUP  0.60  #QF  0.60
 19 ILE  QG2    23 ASN  HD21    4.50            #peak   112 #SUP  0.77  #QF  0.77
 33 LEU  H      34 LEU  H       4.01            #peak   113 #SUP  0.85  #QF  0.85
 34 LEU  H      35 TYR  H       4.11            #peak   114 #SUP  0.82  #QF  0.82
 31 HIS  HA     34 LEU  H       4.24            #peak   116 #SUP  0.85  #QF  0.85
 33 LEU  QB     34 LEU  H       3.97            #peak   118 #SUP  0.95  #QF  0.95
 34 LEU  H      34 LEU  QB      3.65            #peak   119 #SUP  0.93  #QF  0.93
 34 LEU  H      34 LEU  HG      3.44            #peak   120 #SUP  0.90  #QF  0.90
 33 LEU  HG     34 LEU  H       4.81            #peak   121 #SUP  0.92  #QF  0.92
 33 LEU  QD1    34 LEU  H       3.76            #peak   122 #SUP  0.95  #QF  0.55
 42 GLU  H      43 LEU  H       3.76            #peak   126 #SUP  0.86  #QF  0.86
 41 ASP  H      42 GLU  H       3.88            #peak   127 #SUP  0.82  #QF  0.82
 41 ASP  HB2    42 GLU  H       3.93            #peak   131 #SUP  0.82  #QF  0.82
 41 ASP  HB3    42 GLU  H       3.93            #peak   132 #SUP  0.82  #QF  0.82
 42 GLU  H      42 GLU  QB      3.14            #peak   133 #SUP  0.73  #QF  0.73
 60 ASP  H      61 VAL  H       3.89            #peak   139 #SUP  0.86  #QF  0.86
 61 VAL  H      62 VAL  H       3.84            #peak   140 #SUP  0.86  #QF  0.86
 58 GLU  HA     61 VAL  H       4.25            #peak   143 #SUP  0.78  #QF  0.78
 61 VAL  H      61 VAL  HB      3.78            #peak   147 #SUP  0.87  #QF  0.87
 40 LEU  QD1    44 ASN  HD21    5.46            #peak   161 #SUP  0.93  #QF  0.39
 40 LEU  QD2    44 ASN  HD21    5.46            #peak   161 #SUP  0.93  #QF  0.39
 48 SER  QB     51 LEU  H       4.24            #peak   172 #SUP  0.65  #QF  0.65
 51 LEU  H      51 LEU  QB      3.61            #peak   173 #SUP  0.67  #QF  0.67
 51 LEU  H      54 LYS  QG      4.74            #peak   174 #SUP  0.73  #QF  0.73
 51 LEU  H      51 LEU  QD2     5.02            #peak   175 #SUP  0.82  #QF  0.82
112 LYS  H     113 ASP  H       3.53            #peak   176 #SUP  0.63  #QF  0.63
113 ASP  H     113 ASP  QB      3.00            #peak   182 #SUP  0.83  #QF  0.83
109 GLN  QG    110 LYS  H       4.42            #peak   183 #SUP  0.98  #QF  0.98
109 GLN  QB    110 LYS  H       3.68            #peak   184 #SUP  0.76  #QF  0.76
110 LYS  H     110 LYS  QB      3.90            #peak   185 #SUP  0.96  #QF  0.96
112 LYS  QB    113 ASP  H       3.54            #peak   186 #SUP  0.90  #QF  0.90
110 LYS  H     110 LYS  QG      4.44            #peak   188 #SUP  0.91  #QF  0.91
 35 TYR  H      36 LEU  H       4.09            #peak   190 #SUP  0.82  #QF  0.82
 40 LEU  H      41 ASP  H       3.96            #peak   191 #SUP  0.92  #QF  0.92
 35 TYR  H      35 TYR  QB      3.32            #peak   199 #SUP  0.87  #QF  0.87
 41 ASP  H      41 ASP  HB2     3.63            #peak   200 #SUP  0.83  #QF  0.83
 41 ASP  H      41 ASP  HB3     3.63            #peak   201 #SUP  0.84  #QF  0.84
 40 LEU  QB     41 ASP  H       3.71            #peak   202 #SUP  0.90  #QF  0.90
 34 LEU  QB     35 TYR  H       4.18            #peak   203 #SUP  0.88  #QF  0.88
 34 LEU  HG     35 TYR  H       5.06            #peak   205 #SUP  0.94  #QF  0.23
 40 LEU  HG     41 ASP  H       5.50            #peak   205 #SUP  0.94  #QF  0.23
 34 LEU  QQD    35 TYR  H       4.81            #peak   207 #SUP  0.97  #QF  0.85
 40 LEU  QD1    41 ASP  H       4.57            #peak   208 #SUP  0.96  #QF  0.63
 83 ASN  HA     83 ASN  HD21    3.67            #peak   211 #SUP  0.62  #QF  0.62
 71 GLY  H      72 ALA  H       3.82            #peak   212 #SUP  0.62  #QF  0.62
 72 ALA  H      73 LEU  H       4.00            #peak   213 #SUP  0.50  #QF  0.50
 72 ALA  H      72 ALA  QB      3.24            #peak   217 #SUP  0.76  #QF  0.76
108 GLU  H     109 GLN  H       3.99            #peak   218 #SUP  0.78  #QF  0.78
 74 GLU  H      75 ARG  H       4.00            #peak   219 #SUP  0.74  #QF  0.74
106 GLU  HA    109 GLN  H       3.89            #peak   222 #SUP  0.35  #QF  0.35
108 GLU  QB    109 GLN  H       3.72            #peak   225 #SUP  0.73  #QF  0.48
109 GLN  H     109 GLN  QG      4.04            #peak   225 #SUP  0.73  #QF  0.48
109 GLN  H     109 GLN  QB      3.03            #peak   226 #SUP  0.77  #QF  0.77
 75 ARG  H      75 ARG  QB      3.37            #peak   227 #SUP  0.84  #QF  0.84
 75 ARG  H      75 ARG  QG      4.34            #peak   228 #SUP  0.84  #QF  0.84
 93 ALA  H      93 ALA  QB      3.53            #peak   235 #SUP  0.85  #QF  0.85
 99 ILE  HA    102 LYS  H       4.53            #peak   240 #SUP  0.76  #QF  0.76
102 LYS  H     102 LYS  HB3     3.65            #peak   241 #SUP  0.88  #QF  0.88
102 LYS  H     102 LYS  HB2     3.65            #peak   242 #SUP  0.81  #QF  0.81
101 LEU  QQD   102 LYS  H       4.31            #peak   244 #SUP  0.89  #QF  0.89
 32 GLN  HE21   62 VAL  HB      4.87            #peak   252 #SUP  0.49  #QF  0.49
 32 GLN  HE21   36 LEU  QQD     4.37            #peak   253 #SUP  0.79  #QF  0.79
 98 LYS  H      98 LYS  QB      3.82            #peak   262 #SUP  0.73  #QF  0.73
 99 ILE  H      99 ILE  HB      3.55            #peak   263 #SUP  0.80  #QF  0.80
 98 LYS  H      98 LYS  QG      3.80            #peak   264 #SUP  0.57  #QF  0.57
 99 ILE  H      99 ILE  HG13    4.50            #peak   265 #SUP  0.68  #QF  0.68
 99 ILE  H      99 ILE  QG2     3.99            #peak   266 #SUP  0.67  #QF  0.67
 54 LYS  H      55 ILE  H       3.92            #peak   267 #SUP  0.80  #QF  0.80
 53 GLU  H      54 LYS  H       3.84            #peak   268 #SUP  0.85  #QF  0.85
 51 LEU  HA     54 LYS  H       4.36            #peak   270 #SUP  0.73  #QF  0.73
 54 LYS  H      54 LYS  QB      3.43            #peak   272 #SUP  0.90  #QF  0.45
 76 GLU  H      76 GLU  QB      3.79            #peak   275 #SUP  0.62  #QF  0.62
 65 MET  H      66 ILE  H       4.04            #peak   282 #SUP  0.89  #QF  0.89
 78 LYS  H      79 ARG  H       3.78            #peak   284 #SUP  0.90  #QF  0.90
 36 LEU  HA     38 HIS  H       4.94            #peak   287 #SUP  0.74  #QF  0.38
 65 MET  H      65 MET  QG      3.63            #peak   290 #SUP  0.82  #QF  0.82
 79 ARG  H      79 ARG  QB      3.65            #peak   291 #SUP  0.93  #QF  0.93
 76 GLU  QB     79 ARG  H       5.50            #peak   292 #SUP  0.64  #QF  0.40
 78 LYS  QD     79 ARG  H       5.50            #peak   292 #SUP  0.64  #QF  0.40
115 GLN  QG    115 GLN  HE21    3.76            #peak   298 #SUP  0.58  #QF  0.58
 63 CYS  H      64 ALA  H       3.81            #peak   299 #SUP  0.79  #QF  0.79
 61 VAL  HA     64 ALA  H       4.45            #peak   303 #SUP  0.94  #QF  0.94
 63 CYS  HB2    64 ALA  H       4.30            #peak   304 #SUP  0.89  #QF  0.89
 63 CYS  HB3    64 ALA  H       4.30            #peak   305 #SUP  0.86  #QF  0.86
 64 ALA  H      64 ALA  QB      3.08            #peak   306 #SUP  0.82  #QF  0.82
 37 GLN  H      38 HIS  H       4.21            #peak   307 #SUP  0.80  #QF  0.80
 56 ILE  H      57 ARG  H       3.87            #peak   308 #SUP  0.96  #QF  0.75
 57 ARG  H      58 GLU  H       4.15            #peak   308 #SUP  0.96  #QF  0.75
 38 HIS  H      38 HIS  QB      3.57            #peak   313 #SUP  0.87  #QF  0.87
 37 GLN  HB3    38 HIS  H       4.24            #peak   314 #SUP  0.92  #QF  0.92
 37 GLN  HB2    38 HIS  H       4.24            #peak   315 #SUP  0.86  #QF  0.86
 31 HIS  H      32 GLN  H       3.56            #peak   316 #SUP  0.34  #QF  0.34
 54 LYS  HA     57 ARG  H       4.15            #peak   319 #SUP  0.34  #QF  0.34
 55 ILE  HA     57 ARG  H       4.79            #peak   320 #SUP  0.59  #QF  0.59
 31 HIS  H      31 HIS  QB      3.33            #peak   321 #SUP  0.95  #QF  0.95
 30 GLU  QB     31 HIS  H       3.28            #peak   323 #SUP  0.43  #QF  0.43
 99 ILE  H     100 LEU  H       4.32            #peak   326 #SUP  0.77  #QF  0.77
100 LEU  H     100 LEU  HG      4.65            #peak   329 #SUP  0.60  #QF  0.60
 99 ILE  QG2   100 LEU  H       4.11            #peak   330 #SUP  0.98  #QF  0.88
100 LEU  H     100 LEU  QQD     4.41            #peak   330 #SUP  0.98  #QF  0.88
 84 ILE  H      85 LEU  H       4.56            #peak   331 #SUP  0.66  #QF  0.43
 85 LEU  H      88 PHE  H       4.82            #peak   332 #SUP  0.70  #QF  0.70
 83 ASN  HA     85 LEU  H       4.77            #peak   334 #SUP  0.57  #QF  0.57
 84 ILE  HB     85 LEU  H       4.04            #peak   336 #SUP  0.68  #QF  0.68
 85 LEU  H      85 LEU  QB      3.18            #peak   337 #SUP  0.68  #QF  0.68
 84 ILE  QG2    85 LEU  H       3.85            #peak   338 #SUP  0.92  #QF  0.72
 85 LEU  H      85 LEU  QQD     4.28            #peak   338 #SUP  0.92  #QF  0.72
 39 GLN  H      40 LEU  H       4.11            #peak   339 #SUP  0.86  #QF  0.86
 36 LEU  HA     39 GLN  H       4.05            #peak   344 #SUP  0.76  #QF  0.76
 38 HIS  QB     39 GLN  H       3.91            #peak   345 #SUP  0.75  #QF  0.75
 39 GLN  H      39 GLN  QB      3.70            #peak   346 #SUP  0.92  #QF  0.76
 24 HIS  H      25 ALA  H       4.09            #peak   353 #SUP  0.78  #QF  0.78
 24 HIS  QB     25 ALA  H       3.76            #peak   358 #SUP  0.76  #QF  0.76
 76 GLU  H      77 LEU  H       4.40            #peak   362 #SUP  0.79  #QF  0.55
 77 LEU  H      78 LYS  QB      4.46            #peak   364 #SUP  0.74  #QF  0.74
 77 LEU  H      77 LEU  QQD     4.44            #peak   366 #SUP  0.92  #QF  0.92
 62 VAL  H      63 CYS  H       4.04            #peak   367 #SUP  0.91  #QF  0.91
 62 VAL  H      62 VAL  HB      3.65            #peak   373 #SUP  0.74  #QF  0.27
 61 VAL  QG1    62 VAL  H       4.14            #peak   374 #SUP  0.92  #QF  0.36
107 THR  H     108 GLU  H       4.05            #peak   375 #SUP  0.85  #QF  0.85
106 GLU  H     107 THR  H       3.89            #peak   376 #SUP  0.96  #QF  0.96
104 LEU  HA    107 THR  H       4.46            #peak   384 #SUP  0.93  #QF  0.25
106 GLU  QB    107 THR  H       3.89            #peak   385 #SUP  0.82  #QF  0.82
 88 PHE  H      89 ASN  H       4.68            #peak   389 #SUP  0.96  #QF  0.90
 88 PHE  H      88 PHE  QB      3.39            #peak   393 #SUP  0.96  #QF  0.96
 26 ILE  H      26 ILE  QG1     4.22            #peak   394 #SUP  0.68  #QF  0.68
 25 ALA  QB     26 ILE  H       4.11            #peak   395 #SUP  0.63  #QF  0.63
 47 LYS  H      48 SER  H       4.02            #peak   403 #SUP  0.78  #QF  0.78
 48 SER  H      48 SER  QB      3.49            #peak   407 #SUP  0.98  #QF  0.98
 47 LYS  QB     48 SER  H       4.57            #peak   409 #SUP  0.98  #QF  0.83
 48 SER  H      51 LEU  QB      4.78            #peak   409 #SUP  0.98  #QF  0.83
 43 LEU  HG     48 SER  H       5.00            #peak   410 #SUP  0.41  #QF  0.41
 73 LEU  H      74 GLU  QB      4.87            #peak   418 #SUP  0.41  #QF  0.41
 18 LEU  H      18 LEU  HG      4.50            #peak   427 #SUP  0.36  #QF  0.36
112 LYS  H     112 LYS  QD      3.83            #peak   433 #SUP  0.56  #QF  0.56
112 LYS  H     112 LYS  QG      4.46            #peak   434 #SUP  0.89  #QF  0.89
111 VAL  QG1   112 LYS  H       3.94            #peak   435 #SUP  0.94  #QF  0.94
 55 ILE  QG2    56 ILE  H       3.72            #peak   436 #SUP  0.70  #QF  0.49
111 VAL  QG2   112 LYS  H       3.94            #peak   436 #SUP  0.70  #QF  0.49
115 GLN  HA    116 THR  H       3.04            #peak   439 #SUP  0.91  #QF  0.91
115 GLN  QG    116 THR  H       4.36            #peak   440 #SUP  0.90  #QF  0.90
115 GLN  QB    116 THR  H       3.79            #peak   441 #SUP  0.92  #QF  0.92
 95 THR  H      96 LEU  H       4.15            #peak   443 #SUP  0.47  #QF  0.47
 96 LEU  H      96 LEU  QB      3.68            #peak   447 #SUP  0.64  #QF  0.64
 19 ILE  QG2    20 GLU  H       4.11            #peak   451 #SUP  0.88  #QF  0.42
 96 LEU  H      96 LEU  QQD     4.34            #peak   451 #SUP  0.88  #QF  0.42
  8 ASP  QB      9 ASP  H       3.84            #peak   452 #SUP  0.76  #QF  0.76
 59 LEU  H      60 ASP  H       3.89            #peak   453 #SUP  0.74  #QF  0.74
 83 ASN  HA     86 GLU  H       5.01            #peak   456 #SUP  0.38  #QF  0.38
 60 ASP  H      60 ASP  HB2     3.41            #peak   459 #SUP  0.91  #QF  0.91
 51 LEU  HG     52 GLN  H       4.22            #peak   461 #SUP  0.34  #QF  0.34
 58 GLU  H      59 LEU  H       3.81            #peak   462 #SUP  0.64  #QF  0.64
 55 ILE  H      56 ILE  H       4.17            #peak   463 #SUP  0.79  #QF  0.79
 55 ILE  HA     58 GLU  H       4.16            #peak   466 #SUP  0.96  #QF  0.93
 58 GLU  H      58 GLU  QG      3.84            #peak   467 #SUP  0.86  #QF  0.86
 58 GLU  H      58 GLU  QB      3.51            #peak   468 #SUP  0.74  #QF  0.61
 59 LEU  QB     60 ASP  H       3.97            #peak   469 #SUP  0.79  #QF  0.79
103 ASP  H     104 LEU  H       3.93            #peak   473 #SUP  0.76  #QF  0.76
102 LYS  H     103 ASP  H       3.80            #peak   475 #SUP  0.79  #QF  0.79
100 LEU  HA    103 ASP  H       4.49            #peak   477 #SUP  0.43  #QF  0.43
103 ASP  H     103 ASP  HB2     3.62            #peak   479 #SUP  0.78  #QF  0.78
103 ASP  H     103 ASP  HB3     3.83            #peak   480 #SUP  0.85  #QF  0.85
102 LYS  HB3   103 ASP  H       4.04            #peak   481 #SUP  0.79  #QF  0.79
102 LYS  HB2   103 ASP  H       4.04            #peak   482 #SUP  0.69  #QF  0.69
 99 ILE  QG2   103 ASP  H       3.98            #peak   483 #SUP  0.76  #QF  0.76
 51 LEU  H      52 GLN  H       4.10            #peak   485 #SUP  0.73  #QF  0.73
 50 GLU  HA     52 GLN  H       4.27            #peak   486 #SUP  0.34  #QF  0.34
 52 GLN  H      52 GLN  QB      3.67            #peak   489 #SUP  0.87  #QF  0.87
 51 LEU  QD1    52 GLN  H       5.44            #peak   490 #SUP  0.76  #QF  0.36
 51 LEU  QD2    52 GLN  H       5.44            #peak   490 #SUP  0.76  #QF  0.36
 67 GLU  H      68 GLY  H       4.09            #peak   491 #SUP  0.95  #QF  0.95
 68 GLY  H      69 ALA  H       4.01            #peak   493 #SUP  0.94  #QF  0.94
 67 GLU  HB2    68 GLY  H       3.95            #peak   495 #SUP  0.94  #QF  0.94
 67 GLU  HB3    68 GLY  H       4.47            #peak   496 #SUP  0.99  #QF  0.99
 68 GLY  H      69 ALA  QB      4.48            #peak   497 #SUP  0.72  #QF  0.72
 87 ARG  H      88 PHE  H       4.27            #peak   501 #SUP  0.94  #QF  0.94
 88 PHE  QD     89 ASN  H       4.52            #peak   502 #SUP  0.80  #QF  0.61
 88 PHE  QB     89 ASN  H       3.60            #peak   506 #SUP  0.75  #QF  0.75
 89 ASN  H      89 ASN  HB2     3.89            #peak   507 #SUP  0.57  #QF  0.57
 89 ASN  H      89 ASN  HB3     3.89            #peak   508 #SUP  0.57  #QF  0.57
 28 LYS  H      29 GLY  H       3.92            #peak   511 #SUP  0.81  #QF  0.81
 27 GLU  H      28 LYS  H       4.09            #peak   513 #SUP  0.65  #QF  0.65
 83 ASN  HA     84 ILE  H       3.42            #peak   514 #SUP  0.82  #QF  0.82
 83 ASN  HB3    84 ILE  H       4.42            #peak   517 #SUP  0.84  #QF  0.84
 27 GLU  QB     28 LYS  H       3.66            #peak   518 #SUP  0.82  #QF  0.82
 28 LYS  H      28 LYS  QB      3.32            #peak   520 #SUP  0.83  #QF  0.83
 84 ILE  H      84 ILE  QG2     4.66            #peak   521 #SUP  0.99  #QF  0.98
 84 ILE  H      84 ILE  QD1     4.82            #peak   521 #SUP  0.99  #QF  0.98
110 LYS  H     111 VAL  H       3.93            #peak   523 #SUP  0.75  #QF  0.66
111 VAL  H     111 VAL  HB      3.53            #peak   525 #SUP  0.91  #QF  0.91
110 LYS  QB    111 VAL  H       4.13            #peak   526 #SUP  0.98  #QF  0.98
111 VAL  H     111 VAL  QG2     3.89            #peak   528 #SUP  0.91  #QF  0.91
 40 LEU  H      40 LEU  QB      3.38            #peak   533 #SUP  0.80  #QF  0.80
 40 LEU  H      40 LEU  HG      4.77            #peak   534 #SUP  0.55  #QF  0.55
 40 LEU  H      40 LEU  QD2     5.05            #peak   536 #SUP  0.93  #QF  0.67
 23 ASN  H      24 HIS  H       4.44            #peak   538 #SUP  0.80  #QF  0.80
 24 HIS  H      24 HIS  QB      3.56            #peak   547 #SUP  0.87  #QF  0.87
 66 ILE  H      66 ILE  HB      3.73            #peak   551 #SUP  0.66  #QF  0.66
 24 HIS  H      25 ALA  QB      4.70            #peak   553 #SUP  0.94  #QF  0.87
 64 ALA  QB     66 ILE  H       5.03            #peak   553 #SUP  0.94  #QF  0.87
 66 ILE  H      66 ILE  QG2     4.07            #peak   554 #SUP  0.94  #QF  0.94
100 LEU  H     101 LEU  H       4.35            #peak   557 #SUP  0.82  #QF  0.82
101 LEU  H     102 LYS  H       4.08            #peak   558 #SUP  0.93  #QF  0.93
101 LEU  H     101 LEU  QB      3.27            #peak   559 #SUP  0.76  #QF  0.76
100 LEU  QQD   101 LEU  H       4.16            #peak   560 #SUP  0.80  #QF  0.35
101 LEU  H     101 LEU  QQD     4.36            #peak   560 #SUP  0.80  #QF  0.35
 70 GLN  QB     71 GLY  H       4.02            #peak   565 #SUP  0.68  #QF  0.68
 52 GLN  QG     53 GLU  H       3.81            #peak   571 #SUP  0.73  #QF  0.73
 49 LYS  H      50 GLU  H       4.11            #peak   572 #SUP  0.69  #QF  0.69
 50 GLU  H      51 LEU  H       3.78            #peak   574 #SUP  0.68  #QF  0.68
 50 GLU  H      50 GLU  QB      3.27            #peak   578 #SUP  0.64  #QF  0.64
 49 LYS  QG     50 GLU  H       4.43            #peak   579 #SUP  0.97  #QF  0.97
 73 LEU  H      74 GLU  H       4.25            #peak   581 #SUP  0.73  #QF  0.73
 74 GLU  H      74 GLU  QB      3.49            #peak   585 #SUP  0.72  #QF  0.72
 74 GLU  H      77 LEU  HG      4.44            #peak   586 #SUP  0.92  #QF  0.92
 74 GLU  H      77 LEU  QQD     4.35            #peak   587 #SUP  0.68  #QF  0.68
 91 GLU  H      92 GLU  H       4.09            #peak   588 #SUP  0.59  #QF  0.59
 92 GLU  H      93 ALA  H       4.07            #peak   590 #SUP  0.88  #QF  0.88
 89 ASN  HA     92 GLU  H       4.36            #peak   591 #SUP  0.68  #QF  0.68
 92 GLU  H      92 GLU  QB      3.22            #peak   594 #SUP  0.86  #QF  0.86
 90 TYR  H      90 TYR  QB      4.03            #peak   598 #SUP  0.76  #QF  0.76
 49 LYS  H     117 GLN  H       4.30            #peak   601 #SUP  0.77  #QF  0.77
105 LYS  H     106 GLU  H       4.09            #peak   602 #SUP  0.72  #QF  0.72
116 THR  HA    117 GLN  H       3.13            #peak   606 #SUP  0.77  #QF  0.77
116 THR  HB    117 GLN  H       3.26            #peak   608 #SUP  0.90  #QF  0.61
106 GLU  H     106 GLU  QG      4.19            #peak   609 #SUP  0.87  #QF  0.87
106 GLU  H     106 GLU  QB      3.37            #peak   610 #SUP  0.87  #QF  0.87
 49 LYS  QB    117 GLN  H       4.18            #peak   613 #SUP  0.78  #QF  0.78
117 GLN  H     117 GLN  QG      4.12            #peak   616 #SUP  0.81  #QF  0.81
 46 ASN  H      47 LYS  H       3.79            #peak   619 #SUP  0.89  #QF  0.89
 43 LEU  H      44 ASN  H       4.45            #peak   620 #SUP  0.79  #QF  0.79
 43 LEU  HA     46 ASN  H       4.75            #peak   624 #SUP  0.88  #QF  0.65
 44 ASN  H      44 ASN  HB2     3.83            #peak   627 #SUP  0.81  #QF  0.42
 45 GLU  QG     46 ASN  H       4.44            #peak   628 #SUP  0.95  #QF  0.95
 43 LEU  QB     44 ASN  H       3.82            #peak   629 #SUP  0.84  #QF  0.35
 45 GLU  QB     46 ASN  H       3.99            #peak   629 #SUP  0.84  #QF  0.35
 44 ASN  H     114 ILE  QD1     4.79            #peak   633 #SUP  0.84  #QF  0.84
 37 GLN  H      37 GLN  HB3     3.94            #peak   645 #SUP  0.86  #QF  0.81
 54 LYS  QB     55 ILE  H       4.50            #peak   646 #SUP  0.94  #QF  0.66
 37 GLN  H      37 GLN  HB2     3.94            #peak   647 #SUP  0.76  #QF  0.76
 33 LEU  QD1    37 GLN  H       4.83            #peak   650 #SUP  0.81  #QF  0.37
 33 LEU  QD2    37 GLN  H       5.01            #peak   650 #SUP  0.81  #QF  0.37
 55 ILE  H      55 ILE  QG1     3.96            #peak   651 #SUP  0.91  #QF  0.69
 36 LEU  QQD    37 GLN  H       4.93            #peak   652 #SUP  0.97  #QF  0.90
 55 ILE  H      55 ILE  QD1     5.11            #peak   652 #SUP  0.97  #QF  0.90
101 LEU  HA    105 LYS  H       4.36            #peak   657 #SUP  0.36  #QF  0.36
104 LEU  QB    105 LYS  H       4.12            #peak   658 #SUP  0.94  #QF  0.76
105 LYS  H     105 LYS  QD      4.25            #peak   659 #SUP  0.76  #QF  0.76
105 LYS  H     105 LYS  QG      3.80            #peak   660 #SUP  0.76  #QF  0.76
101 LEU  QQD   105 LYS  H       5.05            #peak   661 #SUP  0.95  #QF  0.53
104 LEU  QQD   105 LYS  H       5.26            #peak   661 #SUP  0.95  #QF  0.53
114 ILE  HA    115 GLN  H       3.43            #peak   666 #SUP  0.57  #QF  0.57
115 GLN  H     115 GLN  QB      3.71            #peak   668 #SUP  0.55  #QF  0.55
114 ILE  QG2   115 GLN  H       3.90            #peak   670 #SUP  0.49  #QF  0.49
 96 LEU  H      97 SER  H       4.53            #peak   674 #SUP  0.87  #QF  0.87
 97 SER  H      98 LYS  H       4.36            #peak   675 #SUP  0.87  #QF  0.87
 96 LEU  QB     97 SER  H       4.47            #peak   682 #SUP  0.94  #QF  0.69
 26 ILE  QG2    97 SER  H       4.17            #peak   684 #SUP  0.91  #QF  0.43
 40 LEU  HA     43 LEU  H       4.38            #peak   688 #SUP  0.57  #QF  0.57
 43 LEU  H      43 LEU  QB      3.64            #peak   689 #SUP  0.83  #QF  0.37
106 GLU  HA    108 GLU  H       5.01            #peak   696 #SUP  0.62  #QF  0.62
107 THR  HB    108 GLU  H       4.56            #peak   697 #SUP  0.84  #QF  0.44
108 GLU  H     108 GLU  QB      3.95            #peak   699 #SUP  0.70  #QF  0.70
 93 ALA  H      94 GLN  H       4.06            #peak   706 #SUP  0.71  #QF  0.23
 92 GLU  HA     95 THR  H       4.42            #peak   709 #SUP  0.89  #QF  0.70
 95 THR  H      95 THR  HB      4.11            #peak   710 #SUP  0.87  #QF  0.87
 94 GLN  QB     95 THR  H       4.42            #peak   711 #SUP  0.90  #QF  0.90
 95 THR  H      95 THR  QG2     4.43            #peak   712 #SUP  0.91  #QF  0.91
 31 HIS  QB     32 GLN  H       3.97            #peak   715 #SUP  0.88  #QF  0.88
 30 GLU  H      31 HIS  H       4.32            #peak   719 #SUP  0.79  #QF  0.79
 30 GLU  H      32 GLN  QG      5.05            #peak   721 #SUP  0.83  #QF  0.78
 30 GLU  H     100 LEU  QQD     4.18            #peak   724 #SUP  0.75  #QF  0.75
 25 ALA  HA     29 GLY  H       5.17            #peak   727 #SUP  1.00  #QF  0.88
 27 GLU  QB     29 GLY  H       4.79            #peak   730 #SUP  0.74  #QF  0.74
 28 LYS  QB     29 GLY  H       4.11            #peak   731 #SUP  1.00
 29 GLY  H     100 LEU  QQD     4.52            #peak   732 #SUP  0.79  #QF  0.79
 32 GLN  QG     33 LEU  H       3.85            #peak   736 #SUP  0.80  #QF  0.80
 32 GLN  HB2    33 LEU  H       4.54            #peak   737 #SUP  0.50  #QF  0.50
 33 LEU  H      33 LEU  QB      3.70            #peak   738 #SUP  0.93  #QF  0.83
 94 GLN  H      94 GLN  QB      3.98            #peak   738 #SUP  0.93  #QF  0.83
 93 ALA  QB     94 GLN  H       3.43            #peak   739 #SUP  0.69  #QF  0.69
 33 LEU  H      33 LEU  QD1     4.40            #peak   740 #SUP  0.82  #QF  0.61
 33 LEU  H      33 LEU  QD2     4.74            #peak   740 #SUP  0.82  #QF  0.61
 36 LEU  H      37 GLN  H       4.47            #peak   742 #SUP  0.68  #QF  0.68
 35 TYR  QB     36 LEU  H       4.11            #peak   745 #SUP  0.75  #QF  0.75
 36 LEU  H      36 LEU  QB      3.53            #peak   746 #SUP  0.78  #QF  0.78
 33 LEU  QD2    36 LEU  H       4.97            #peak   748 #SUP  0.75  #QF  0.37
 70 GLN  H      71 GLY  H       4.17            #peak   750 #SUP  0.80  #QF  0.80
 69 ALA  H      70 GLN  H       4.00            #peak   751 #SUP  0.80  #QF  0.80
 70 GLN  H      70 GLN  QB      3.50            #peak   755 #SUP  0.82  #QF  0.82
 69 ALA  QB     70 GLN  H       3.63            #peak   756 #SUP  0.94  #QF  0.94
 90 TYR  H      91 GLU  H       4.12            #peak   758 #SUP  0.76  #QF  0.39
 90 TYR  QB     91 GLU  H       4.53            #peak   760 #SUP  0.88  #QF  0.88
 62 VAL  HB     63 CYS  H       4.19            #peak   771 #SUP  0.79  #QF  0.79
 62 VAL  QG1    63 CYS  H       4.31            #peak   772 #SUP  0.96  #QF  0.72
 55 ILE  HA     59 LEU  H       4.45            #peak   777 #SUP  0.61  #QF  0.61
 58 GLU  QB     59 LEU  H       4.42            #peak   778 #SUP  0.67  #QF  0.67
 59 LEU  H      59 LEU  QB      3.72            #peak   779 #SUP  0.75  #QF  0.75
 59 LEU  H      59 LEU  HG      4.80            #peak   780 #SUP  0.73  #QF  0.73
 59 LEU  H      59 LEU  QD2     4.68            #peak   782 #SUP  0.51  #QF  0.51
 47 LYS  H      47 LYS  QB      4.16            #peak   792 #SUP  0.56  #QF  0.56
 47 LYS  H     114 ILE  QG1     4.70            #peak   793 #SUP  0.48  #QF  0.48
104 LEU  H     105 LYS  H       4.23            #peak   796 #SUP  0.64  #QF  0.64
101 LEU  HA    104 LEU  H       4.42            #peak   798 #SUP  0.44  #QF  0.44
103 ASP  HB2   104 LEU  H       4.49            #peak   800 #SUP  0.72  #QF  0.72
104 LEU  H     104 LEU  QB      3.84            #peak   801 #SUP  0.56  #QF  0.56
 33 LEU  HG    104 LEU  H       4.07            #peak   803 #SUP  0.28  #QF  0.28
 33 LEU  QD2   104 LEU  H       4.08            #peak   804 #SUP  0.69  #QF  0.26
104 LEU  H     104 LEU  QQD     4.25            #peak   804 #SUP  0.69  #QF  0.26
 66 ILE  H      67 GLU  H       4.00            #peak   806 #SUP  0.74  #QF  0.41
 67 GLU  H      67 GLU  HB2     3.55            #peak   809 #SUP  0.73  #QF  0.73
 67 GLU  H      67 GLU  HB3     3.90            #peak   810 #SUP  0.81  #QF  0.81
 66 ILE  QG2    67 GLU  H       4.11            #peak   811 #SUP  0.83  #QF  0.83
 83 ASN  H      86 GLU  QB      4.42            #peak   815 #SUP  0.32  #QF  0.32
 82 LEU  QQD    83 ASN  H       4.37            #peak   816 #SUP  0.60  #QF  0.60
  1 GLN  QB      1 GLN  HE22    4.20            #peak   826 #SUP  0.89  #QF  0.89
 19 ILE  HA     19 ILE  QD1     3.79            #peak     2 #SUP  0.89  #QF  0.89
 19 ILE  HB     19 ILE  QD1     3.99            #peak     5 #SUP  0.92  #QF  0.92
 19 ILE  QG2    19 ILE  QD1     3.49            #peak    10 #SUP  0.57  #QF  0.57
 19 ILE  QD1    77 LEU  QQD     3.56            #peak    11 #SUP  0.63  #QF  0.63
 29 GLY  H      66 ILE  QD1     4.91            #peak    13 #SUP  0.68  #QF  0.68
 66 ILE  H      66 ILE  QD1     4.09            #peak    14 #SUP  0.96  #QF  0.96
 65 MET  H      66 ILE  QD1     4.71            #peak    15 #SUP  0.90  #QF  0.90
 25 ALA  HA     66 ILE  QD1     5.11            #peak    16 #SUP  0.99  #QF  0.61
 65 MET  HA     66 ILE  QD1     5.50            #peak    16 #SUP  0.99  #QF  0.61
 63 CYS  HA     66 ILE  QD1     4.20            #peak    17 #SUP  0.81  #QF  0.81
 66 ILE  HA     66 ILE  QD1     3.38            #peak    18 #SUP  0.80  #QF  0.80
 65 MET  HB2    66 ILE  QD1     4.80            #peak    20 #SUP  0.91  #QF  0.91
 66 ILE  HB     66 ILE  QD1     3.50            #peak    23 #SUP  0.87  #QF  0.50
 28 LYS  QB     66 ILE  QD1     4.45            #peak    24 #SUP  0.92  #QF  0.92
 28 LYS  QD     66 ILE  QD1     3.78            #peak    25 #SUP  0.42  #QF  0.42
 66 ILE  QG2    66 ILE  QD1     3.27            #peak    28 #SUP  0.85  #QF  0.85
114 ILE  QG2   116 THR  H       4.44            #peak    31 #SUP  0.38  #QF  0.38
114 ILE  H     114 ILE  QG2     4.05            #peak    32 #SUP  1.00
 44 ASN  HA    114 ILE  QG2     4.28            #peak    36 #SUP  0.90  #QF  0.90
114 ILE  HA    114 ILE  QG2     3.50            #peak    37 #SUP  0.94  #QF  0.94
111 VAL  HA    114 ILE  QG2     4.68            #peak    38 #SUP  0.70  #QF  0.70
 47 LYS  HD2   114 ILE  QG2     3.39            #peak    40 #SUP  1.00  #QF  0.83
 47 LYS  HD3   114 ILE  QG2     3.39            #peak    41 #SUP  0.76  #QF  0.23
114 ILE  QG2   114 ILE  QG1     3.40            #peak    42 #SUP  0.96  #QF  0.96
 75 ARG  H      77 LEU  QQD     4.49            #peak    48 #SUP  0.89  #QF  0.89
 19 ILE  HA     77 LEU  QQD     3.95            #peak    51 #SUP  0.71  #QF  0.71
 77 LEU  QQD    90 TYR  QB      4.75            #peak    53 #SUP  0.63  #QF  0.63
 77 LEU  QQD    78 LYS  QE      4.64            #peak    54 #SUP  0.94  #QF  0.94
 74 GLU  QB     77 LEU  QQD     3.68            #peak    57 #SUP  0.91  #QF  0.91
 77 LEU  QQD    78 LYS  QG      3.19            #peak    60 #SUP  0.60  #QF  0.60
 19 ILE  HG12   77 LEU  QQD     4.44            #peak    61 #SUP  0.64  #QF  0.64
114 ILE  HA    114 ILE  QD1     3.50            #peak    70 #SUP  0.38  #QF  0.38
111 VAL  HA    114 ILE  QD1     3.52            #peak    72 #SUP  0.88  #QF  0.88
 47 LYS  QE    114 ILE  QD1     4.64            #peak    73 #SUP  0.39  #QF  0.39
 44 ASN  HB2   114 ILE  QD1     4.47            #peak    74 #SUP  0.97  #QF  0.97
114 ILE  HB    114 ILE  QD1     2.85            #peak    75 #SUP  0.83  #QF  0.83
 49 LYS  H     116 THR  QG2     4.49            #peak    85 #SUP  0.71  #QF  0.71
116 THR  QG2   117 GLN  H       3.86            #peak    86 #SUP  0.91  #QF  0.91
116 THR  H     116 THR  QG2     3.62            #peak    87 #SUP  0.79  #QF  0.79
116 THR  HA    116 THR  QG2     3.28            #peak    90 #SUP  0.98  #QF  0.98
 47 LYS  QB    116 THR  QG2     3.49            #peak    93 #SUP  0.48  #QF  0.48
 84 ILE  QD1    85 LEU  H       4.95            #peak    96 #SUP  0.88  #QF  0.26
 99 ILE  QD1   100 LEU  H       5.26            #peak    96 #SUP  0.88  #QF  0.26
 99 ILE  H      99 ILE  QD1     4.03            #peak    97 #SUP  0.95  #QF  0.95
 96 LEU  HA     99 ILE  QD1     3.67            #peak    98 #SUP  0.59  #QF  0.59
 99 ILE  HA     99 ILE  QD1     4.00            #peak    99 #SUP  0.94  #QF  0.94
 26 ILE  HB     26 ILE  QD1     3.63            #peak   100 #SUP  1.00  #QF  0.89
 99 ILE  HB     99 ILE  QD1     3.84            #peak   100 #SUP  1.00  #QF  0.89
 40 LEU  QD2    41 ASP  H       4.57            #peak   107 #SUP  0.75  #QF  0.75
101 LEU  HA    104 LEU  QQD     3.44            #peak   110 #SUP  0.22  #QF  0.22
 22 ALA  HA     73 LEU  QQD     2.87            #peak   111 #SUP  0.22  #QF  0.22
 33 LEU  QD2    37 GLN  HA      4.08            #peak   113 #SUP  0.35  #QF  0.35
 33 LEU  QD2   103 ASP  HB2     4.81            #peak   115 #SUP  0.45  #QF  0.30
 33 LEU  QD2   103 ASP  HB3     4.26            #peak   116 #SUP  0.91  #QF  0.32
 73 LEU  QB     73 LEU  QQD     3.13            #peak   117 #SUP  0.94  #QF  0.84
 26 ILE  H      26 ILE  QG2     3.92            #peak   125 #SUP  0.88  #QF  0.88
 26 ILE  QG2    97 SER  HA      4.19            #peak   128 #SUP  0.35  #QF  0.35
 26 ILE  QD1    97 SER  H       4.83            #peak   138 #SUP  0.21  #QF  0.21
 82 LEU  QQD    83 ASN  HA      3.85            #peak   147 #SUP  0.75  #QF  0.75
 33 LEU  QD2    37 GLN  HE21    4.30            #peak   150 #SUP  0.76  #QF  0.76
 18 LEU  H      18 LEU  QQD     4.48            #peak   157 #SUP  0.73  #QF  0.44
 34 LEU  H      34 LEU  QQD     4.12            #peak   160 #SUP  0.59  #QF  0.59
 31 HIS  HA     34 LEU  QQD     3.74            #peak   162 #SUP  0.88  #QF  0.88
 31 HIS  QB     34 LEU  QQD     4.48            #peak   164 #SUP  0.51  #QF  0.51
101 LEU  QB    101 LEU  QQD     2.67            #peak   165 #SUP  0.69  #QF  0.69
 55 ILE  H      55 ILE  QG2     4.53            #peak   169 #SUP  0.74  #QF  0.74
 55 ILE  HA     55 ILE  QG2     3.52            #peak   171 #SUP  0.90  #QF  0.90
 56 ILE  QG2    57 ARG  H       3.58            #peak   176 #SUP  0.97  #QF  0.74
 56 ILE  QG2    57 ARG  HA      3.71            #peak   178 #SUP  0.76  #QF  0.41
 84 ILE  QG2    85 LEU  HA      4.11            #peak   178 #SUP  0.76  #QF  0.41
 56 ILE  HA     56 ILE  QG2     3.68            #peak   179 #SUP  0.99  #QF  0.71
 84 ILE  HA     84 ILE  QG2     3.83            #peak   179 #SUP  0.99  #QF  0.71
 56 ILE  QG2    57 ARG  QD      4.38            #peak   181 #SUP  0.91  #QF  0.76
 99 ILE  QG2   103 ASP  HB2     3.93            #peak   182 #SUP  0.66  #QF  0.66
 18 LEU  QQD    19 ILE  H       4.81            #peak   191 #SUP  0.98  #QF  0.43
 17 LEU  HA     17 LEU  QQD     3.71            #peak   193 #SUP  0.78  #QF  0.22
 30 GLU  HA    100 LEU  QQD     3.19            #peak   194 #SUP  0.61  #QF  0.61
 30 GLU  QG    100 LEU  QQD     3.86            #peak   196 #SUP  0.85  #QF  0.78
 70 GLN  QG    101 LEU  QQD     4.24            #peak   196 #SUP  0.85  #QF  0.78
101 LEU  QQD   104 LEU  QB      3.65            #peak   197 #SUP  0.33  #QF  0.33
 70 GLN  HE22  101 LEU  QQD     4.54            #peak   198 #SUP  0.92  #QF  0.92
 63 CYS  HA     66 ILE  QG2     3.41            #peak   204 #SUP  0.69  #QF  0.69
 66 ILE  HA     66 ILE  QG2     3.74            #peak   205 #SUP  0.94  #QF  0.94
 66 ILE  QG2    70 GLN  QG      4.56            #peak   206 #SUP  0.48  #QF  0.48
 66 ILE  QG2    70 GLN  QB      4.53            #peak   207 #SUP  0.78  #QF  0.78
 66 ILE  QG2    66 ILE  QG1     3.62            #peak   210 #SUP  0.94  #QF  0.94
 61 VAL  QG2    62 VAL  H       4.14            #peak   215 #SUP  0.99  #QF  0.99
 61 VAL  H      61 VAL  QG2     3.94            #peak   217 #SUP  1.00
 58 GLU  HA     61 VAL  QG2     4.71            #peak   219 #SUP  0.97  #QF  0.97
 61 VAL  HA     61 VAL  QG2     3.37            #peak   220 #SUP  0.98  #QF  0.98
 51 LEU  HA     51 LEU  QD2     4.67            #peak   230 #SUP  0.93  #QF  0.93
111 VAL  H     111 VAL  QG1     3.89            #peak   236 #SUP  0.81  #QF  0.81
111 VAL  HA    111 VAL  QG1     3.77            #peak   238 #SUP  0.90  #QF  0.90
107 THR  QG2   108 GLU  H       4.33            #peak   247 #SUP  0.85  #QF  0.85
107 THR  H     107 THR  QG2     4.16            #peak   248 #SUP  0.89  #QF  0.89
107 THR  HA    107 THR  QG2     3.26            #peak   252 #SUP  0.95  #QF  0.95
 19 ILE  QG2    19 ILE  HG13    4.24            #peak   262 #SUP  0.89  #QF  0.80
 62 VAL  H      62 VAL  QG2     3.20            #peak   266 #SUP  0.77  #QF  0.77
 32 GLN  QG     62 VAL  QG1     3.54            #peak   267 #SUP  0.85  #QF  0.79
 61 VAL  H      61 VAL  QG1     3.94            #peak   273 #SUP  0.98  #QF  0.98
 58 GLU  HA     61 VAL  QG1     4.71            #peak   275 #SUP  0.93  #QF  0.93
 61 VAL  HA     61 VAL  QG1     3.37            #peak   276 #SUP  0.97  #QF  0.97
 84 ILE  HA     84 ILE  HG13    4.17            #peak   285 #SUP  0.93  #QF  0.93
 80 THR  H      80 THR  QG2     3.90            #peak   293 #SUP  0.93  #QF  0.56
 95 THR  QG2    96 LEU  H       3.93            #peak   294 #SUP  0.92  #QF  0.92
 95 THR  QG2    99 ILE  H       4.46            #peak   295 #SUP  0.43  #QF  0.43
 80 THR  HA     80 THR  QG2     2.86            #peak   298 #SUP  0.64  #QF  0.64
 92 GLU  HA     95 THR  QG2     4.03            #peak   301 #SUP  0.83  #QF  0.83
 95 THR  QG2    99 ILE  HA      5.50            #peak   303 #SUP  0.82  #QF  0.82
 92 GLU  QG     95 THR  QG2     4.37            #peak   304 #SUP  0.39  #QF  0.39
 95 THR  QG2    96 LEU  HG      3.98            #peak   307 #SUP  0.80  #QF  0.80
 95 THR  QG2    99 ILE  QD1     2.95            #peak   311 #SUP  0.61  #QF  0.61
 47 LYS  H      47 LYS  QG      4.68            #peak   313 #SUP  0.70  #QF  0.70
 28 LYS  H      28 LYS  QG      4.76            #peak   330 #SUP  0.69  #QF  0.69
 28 LYS  HA     28 LYS  QG      3.81            #peak   333 #SUP  0.86  #QF  0.86
 28 LYS  QG     28 LYS  QE      4.01            #peak   335 #SUP  0.87  #QF  0.87
 28 LYS  QG     28 LYS  QD      2.83            #peak   338 #SUP  0.67  #QF  0.67
109 GLN  HA    112 LYS  QG      4.75            #peak   342 #SUP  0.95  #QF  0.77
 49 LYS  HA     49 LYS  QG      3.39            #peak   347 #SUP  0.70  #QF  0.70
  7 LYS  QG      8 ASP  QB      3.81            #peak   350 #SUP  0.30  #QF  0.30
 49 LYS  QG     50 GLU  QG      4.00            #peak   351 #SUP  0.80  #QF  0.80
 49 LYS  QG     49 LYS  QD      2.83            #peak   354 #SUP  0.99  #QF  0.68
102 LYS  QG    102 LYS  QD      2.78            #peak   354 #SUP  0.99  #QF  0.68
 49 LYS  H      49 LYS  QG      4.73            #peak   357 #SUP  0.98  #QF  0.98
102 LYS  H     102 LYS  QG      4.73            #peak   360 #SUP  0.72  #QF  0.72
 66 ILE  QG1    70 GLN  QB      5.50            #peak   368 #SUP  0.70  #QF  0.58
 22 ALA  QB     23 ASN  H       3.94            #peak   376 #SUP  0.94  #QF  0.94
 22 ALA  H      22 ALA  QB      3.50            #peak   377 #SUP  0.85  #QF  0.85
 22 ALA  QB     24 HIS  H       5.13            #peak   378 #SUP  0.86  #QF  0.70
 66 ILE  H      69 ALA  QB      5.50            #peak   378 #SUP  0.86  #QF  0.70
 69 ALA  H      69 ALA  QB      3.42            #peak   379 #SUP  0.91  #QF  0.91
 19 ILE  HA     22 ALA  QB      3.16            #peak   383 #SUP  0.44  #QF  0.44
 66 ILE  HA     69 ALA  QB      3.50            #peak   384 #SUP  0.55  #QF  0.55
 25 ALA  QB     26 ILE  QG1     3.97            #peak   385 #SUP  0.67  #QF  0.67
 19 ILE  HG12   22 ALA  QB      5.04            #peak   387 #SUP  0.66  #QF  0.66
 19 ILE  HG13   22 ALA  QB      5.50            #peak   388 #SUP  0.95  #QF  0.95
 22 ALA  QB     73 LEU  QQD     3.16            #peak   390 #SUP  0.75  #QF  0.59
 19 ILE  QD1    22 ALA  QB      3.86            #peak   392 #SUP  0.77  #QF  0.77
 25 ALA  H      25 ALA  QB      3.21            #peak   393 #SUP  0.97  #QF  0.97
 64 ALA  QB     65 MET  HB3     3.83            #peak   396 #SUP  0.30  #QF  0.30
 64 ALA  QB     65 MET  QE      4.90            #peak   397 #SUP  0.52  #QF  0.24
 92 GLU  QB     93 ALA  QB      4.08            #peak   400 #SUP  0.75  #QF  0.75
 25 ALA  QB     26 ILE  QG2     3.16            #peak   401 #SUP  0.47  #QF  0.47
 78 LYS  QG     78 LYS  QD      2.86            #peak   408 #SUP  0.68  #QF  0.68
 71 GLY  H      72 ALA  QB      4.98            #peak   410 #SUP  0.80  #QF  0.26
 92 GLU  H      93 ALA  QB      5.30            #peak   410 #SUP  0.80  #QF  0.26
 62 VAL  H      64 ALA  QB      4.68            #peak   411 #SUP  0.77  #QF  0.77
 64 ALA  QB     65 MET  H       3.30            #peak   412 #SUP  0.89  #QF  0.80
 90 TYR  HA     93 ALA  QB      3.71            #peak   413 #SUP  0.33  #QF  0.33
 60 ASP  HA     64 ALA  QB      4.64            #peak   414 #SUP  0.54  #QF  0.24
 89 ASN  HA     93 ALA  QB      5.03            #peak   414 #SUP  0.54  #QF  0.24
 61 VAL  HA     64 ALA  QB      3.40            #peak   416 #SUP  0.86  #QF  0.86
 64 ALA  QB     65 MET  QG      4.18            #peak   418 #SUP  0.64  #QF  0.64
 19 ILE  HG12   93 ALA  QB      5.28            #peak   421 #SUP  0.27  #QF  0.27
 19 ILE  QD1    93 ALA  QB      3.98            #peak   424 #SUP  0.52  #QF  0.52
 11 ARG  HA     11 ARG  QG      3.81            #peak   425 #SUP  0.21  #QF  0.21
 43 LEU  HG     52 GLN  H       5.09            #peak   435 #SUP  0.46  #QF  0.46
 42 GLU  QG     51 LEU  HG      5.42            #peak   436 #SUP  0.66  #QF  0.66
 51 LEU  HG     54 LYS  QB      5.20            #peak   437 #SUP  0.93  #QF  0.93
 47 LYS  HD3   114 ILE  HA      4.47            #peak   446 #SUP  0.90  #QF  0.90
 47 LYS  HA     47 LYS  HD3     4.31            #peak   447 #SUP  0.74  #QF  0.74
 47 LYS  HD3   115 GLN  QG      4.91            #peak   450 #SUP  0.67  #QF  0.67
 49 LYS  QD     50 GLU  QG      4.94            #peak   451 #SUP  0.54  #QF  0.54
 85 LEU  QB     88 PHE  H       5.30            #peak   467 #SUP  0.98  #QF  0.98
 83 ASN  HB3    85 LEU  QB      4.26            #peak   474 #SUP  0.26  #QF  0.26
 85 LEU  QB     86 GLU  QB      4.53            #peak   475 #SUP  0.65  #QF  0.65
 18 LEU  QB     18 LEU  QQD     3.21            #peak   482 #SUP  0.94  #QF  0.70
 85 LEU  QB     85 LEU  QQD     3.50            #peak   482 #SUP  0.94  #QF  0.70
110 LYS  H     112 LYS  QD      5.44            #peak   483 #SUP  0.75  #QF  0.29
112 LYS  QD    113 ASP  H       5.50            #peak   483 #SUP  0.75  #QF  0.29
 49 LYS  QD    117 GLN  HA      4.23            #peak   486 #SUP  0.56  #QF  0.56
 49 LYS  HA     49 LYS  QD      4.07            #peak   487 #SUP  0.42  #QF  0.42
 99 ILE  HA    102 LYS  QD      4.53            #peak   488 #SUP  0.53  #QF  0.53
 78 LYS  QB     78 LYS  QD      3.00            #peak   494 #SUP  0.66  #QF  0.42
112 LYS  QB    112 LYS  QD      3.17            #peak   494 #SUP  0.66  #QF  0.42
  4 LYS  QG      4 LYS  QD      2.69            #peak   496 #SUP  0.98  #QF  0.56
109 GLN  H     112 LYS  QD      4.33            #peak   498 #SUP  0.77  #QF  0.77
 57 ARG  H      57 ARG  HG3     4.47            #peak   516 #SUP  0.77  #QF  0.77
 18 LEU  QB     19 ILE  H       4.15            #peak   526 #SUP  0.96  #QF  0.96
 18 LEU  QB     19 ILE  HA      4.20            #peak   529 #SUP  0.23  #QF  0.23
 82 LEU  QB     83 ASN  HA      4.81            #peak   531 #SUP  0.99  #QF  0.99
 78 LYS  H      78 LYS  QD      4.53            #peak   540 #SUP  0.86  #QF  0.86
 47 LYS  HD2   115 GLN  QG      4.91            #peak   542 #SUP  0.46  #QF  0.46
 47 LYS  HD2   114 ILE  HA      4.47            #peak   553 #SUP  0.79  #QF  0.79
 47 LYS  HA     47 LYS  HD2     4.31            #peak   554 #SUP  0.88  #QF  0.70
 49 LYS  H      49 LYS  QB      4.20            #peak   556 #SUP  0.91  #QF  0.91
 49 LYS  QB    116 THR  HB      3.90            #peak   560 #SUP  0.98  #QF  0.98
100 LEU  QB    101 LEU  H       4.74            #peak   576 #SUP  0.96  #QF  0.43
101 LEU  QB    102 LYS  H       4.46            #peak   577 #SUP  0.96  #QF  0.96
 31 HIS  HA     34 LEU  QB      4.41            #peak   581 #SUP  0.64  #QF  0.64
100 LEU  HA    101 LEU  QB      5.50            #peak   582 #SUP  0.80  #QF  0.80
 97 SER  HA    100 LEU  QB      4.84            #peak   586 #SUP  0.68  #QF  0.56
101 LEU  QB    105 LYS  QB      5.50            #peak   587 #SUP  0.96  #QF  0.70
 17 LEU  QB     17 LEU  QQD     3.73            #peak   593 #SUP  1.00  #QF  0.77
 34 LEU  QB     34 LEU  QQD     4.10            #peak   593 #SUP  1.00  #QF  0.77
 26 ILE  QG2    26 ILE  QG1     3.39            #peak   598 #SUP  0.67  #QF  0.67
101 LEU  QB    104 LEU  QB      5.50            #peak   603 #SUP  0.72  #QF  0.43
 99 ILE  H      99 ILE  HG12    4.50            #peak   605 #SUP  0.70  #QF  0.70
 84 ILE  H      84 ILE  HB      3.72            #peak   613 #SUP  0.97  #QF  0.97
 83 ASN  HA     84 ILE  HB      5.11            #peak   615 #SUP  0.92  #QF  0.92
 84 ILE  HB     85 LEU  HA      4.74            #peak   616 #SUP  0.85  #QF  0.85
 54 LYS  QB     55 ILE  HB      4.66            #peak   618 #SUP  0.59  #QF  0.59
 52 GLN  HA     55 ILE  HB      4.68            #peak   625 #SUP  0.96  #QF  0.69
105 LYS  QB    105 LYS  QD      3.39            #peak   636 #SUP  0.91  #QF  0.60
 76 GLU  H      78 LYS  QB      4.48            #peak   639 #SUP  0.33  #QF  0.33
 91 GLU  QB     92 GLU  H       4.24            #peak   647 #SUP  0.77  #QF  0.64
110 LYS  H     110 LYS  QD      4.15            #peak   653 #SUP  0.48  #QF  0.48
110 LYS  HA    110 LYS  QD      4.43            #peak   655 #SUP  0.88  #QF  0.50
 93 ALA  HA     96 LEU  QB      4.79            #peak   657 #SUP  0.38  #QF  0.38
 96 LEU  QB     96 LEU  QQD     3.80            #peak   664 #SUP  0.88  #QF  0.88
 96 LEU  HA     99 ILE  HB      4.22            #peak   670 #SUP  0.60  #QF  0.60
 39 GLN  H      39 GLN  QG      3.81            #peak   681 #SUP  0.90  #QF  0.90
 39 GLN  HA     39 GLN  QG      3.67            #peak   684 #SUP  0.94  #QF  0.94
 92 GLU  QB     93 ALA  H       3.75            #peak   695 #SUP  0.57  #QF  0.57
 47 LYS  QB     48 SER  HA      5.38            #peak   704 #SUP  0.82  #QF  0.49
 47 LYS  QB    116 THR  HA      5.50            #peak   704 #SUP  0.82  #QF  0.49
 13 GLU  HA     13 GLU  QG      4.25            #peak   722 #SUP  0.87  #QF  0.87
 42 GLU  QG     51 LEU  QB      5.25            #peak   739 #SUP  0.72  #QF  0.72
 30 GLU  H      30 GLU  QB      4.06            #peak   742 #SUP  0.97  #QF  0.97
 30 GLU  QB    100 LEU  QQD     4.17            #peak   748 #SUP  0.89  #QF  0.35
 43 LEU  QB     51 LEU  HG      4.70            #peak   759 #SUP  0.93  #QF  0.84
 73 LEU  QB     77 LEU  QQD     4.66            #peak   763 #SUP  0.32  #QF  0.32
 64 ALA  HA     66 ILE  HB      5.50            #peak   765 #SUP  0.33  #QF  0.33
108 GLU  QG    112 LYS  QD      4.09            #peak   773 #SUP  0.34  #QF  0.34
 52 GLN  QG    116 THR  QG2     4.64            #peak   787 #SUP  0.51  #QF  0.51
 40 LEU  HA     43 LEU  QB      4.70            #peak   789 #SUP  0.42  #QF  0.42
 65 MET  QE     66 ILE  H       4.39            #peak   800 #SUP  0.74  #QF  0.74
 62 VAL  H      65 MET  QE      4.30            #peak   801 #SUP  0.86  #QF  0.86
 65 MET  H      65 MET  QE      4.02            #peak   802 #SUP  0.98  #QF  0.98
 65 MET  HB2    65 MET  QE      3.75            #peak   809 #SUP  0.91  #QF  0.91
 62 VAL  QG2    65 MET  QE      2.85            #peak   816 #SUP  0.61  #QF  0.61
 65 MET  QE     66 ILE  QD1     3.76            #peak   818 #SUP  0.94  #QF  0.94
 32 GLN  HB3    33 LEU  H       4.54            #peak   820 #SUP  0.95  #QF  0.95
 42 GLU  QB     43 LEU  H       4.31            #peak   822 #SUP  0.73  #QF  0.57
 27 GLU  H      27 GLU  QB      3.62            #peak   845 #SUP  0.79  #QF  0.79
 55 ILE  HA     59 LEU  QB      4.79            #peak   848 #SUP  0.55  #QF  0.55
 65 MET  QG     66 ILE  QG1     4.21            #peak   856 #SUP  0.32  #QF  0.32
 54 LYS  QB     55 ILE  QG1     4.57            #peak   858 #SUP  0.56  #QF  0.56
104 LEU  QB    105 LYS  QD      4.94            #peak   859 #SUP  0.68  #QF  0.68
 74 GLU  QB     75 ARG  H       3.99            #peak   861 #SUP  0.98  #QF  0.98
  2 GLU  H       2 GLU  QG      4.24            #peak   865 #SUP  0.58  #QF  0.45
  2 GLU  QG      3 HIS  H       4.66            #peak   865 #SUP  0.58  #QF  0.45
109 GLN  QB    109 GLN  QG      2.86            #peak   895 #SUP  0.96  #QF  0.96
109 GLN  QB    112 LYS  QB      5.50            #peak   896 #SUP  0.61  #QF  0.61
103 ASP  HA    106 GLU  QB      3.74            #peak   901 #SUP  0.90  #QF  0.90
 21 GLN  QB     22 ALA  QB      4.83            #peak   906 #SUP  0.71  #QF  0.37
 69 ALA  QB     70 GLN  QB      5.12            #peak   906 #SUP  0.71  #QF  0.37
 61 VAL  H      62 VAL  HB      5.00            #peak   908 #SUP  0.73  #QF  0.73
108 GLU  HA    111 VAL  HB      4.66            #peak   909 #SUP  0.99  #QF  0.74
 42 GLU  QG     43 LEU  H       4.78            #peak   914 #SUP  0.94  #QF  0.94
 50 GLU  H      50 GLU  QG      3.70            #peak   916 #SUP  0.68  #QF  0.68
 20 GLU  H      20 GLU  QG      4.38            #peak   917 #SUP  0.72  #QF  0.63
 42 GLU  H      42 GLU  QG      3.93            #peak   918 #SUP  0.92  #QF  0.92
 42 GLU  HA     42 GLU  QG      3.42            #peak   922 #SUP  0.93  #QF  0.93
 17 LEU  HG     20 GLU  QG      4.34            #peak   927 #SUP  0.83  #QF  0.83
 17 LEU  QQD    20 GLU  QG      3.83            #peak   930 #SUP  0.81  #QF  0.81
 17 LEU  H      20 GLU  QG      4.84            #peak   933 #SUP  0.33  #QF  0.33
 17 LEU  QB     20 GLU  QG      4.07            #peak   935 #SUP  0.68  #QF  0.60
 45 GLU  QB     45 GLU  QG      2.53            #peak   947 #SUP  0.85  #QF  0.85
 61 VAL  HB     62 VAL  H       4.33            #peak   949 #SUP  0.93  #QF  0.93
 61 VAL  HB     64 ALA  QB      5.08            #peak   958 #SUP  0.92  #QF  0.92
 50 GLU  QG     51 LEU  H       4.79            #peak   962 #SUP  0.56  #QF  0.56
 49 LYS  QE     50 GLU  QG      4.43            #peak   963 #SUP  0.41  #QF  0.41
 49 LYS  QB     50 GLU  QG      4.87            #peak   968 #SUP  0.71  #QF  0.71
 92 GLU  QG     96 LEU  HG      4.53            #peak   970 #SUP  0.47  #QF  0.25
 85 LEU  QQD    86 GLU  QG      4.25            #peak   971 #SUP  0.25  #QF  0.25
 49 LYS  QD    117 GLN  QG      4.28            #peak  1000 #SUP  0.88  #QF  0.88
 74 GLU  H      74 GLU  QG      3.95            #peak  1004 #SUP  0.83  #QF  0.83
 74 GLU  QG     75 ARG  H       4.54            #peak  1006 #SUP  0.97  #QF  0.97
 74 GLU  HA     74 GLU  QG      3.59            #peak  1009 #SUP  0.89  #QF  0.89
 74 GLU  QB     74 GLU  QG      2.40            #peak  1011 #SUP  0.92  #QF  0.92
 73 LEU  QQD    74 GLU  QG      4.63            #peak  1012 #SUP  0.57  #QF  0.57
108 GLU  QB    112 LYS  QD      4.26            #peak  1015 #SUP  0.79  #QF  0.79
 21 GLN  H      21 GLN  QG      4.18            #peak  1017 #SUP  0.72  #QF  0.72
115 GLN  QB    115 GLN  QG      2.85            #peak  1022 #SUP  0.70  #QF  0.70
109 GLN  QG    112 LYS  QD      4.42            #peak  1024 #SUP  0.65  #QF  0.65
115 GLN  QG    116 THR  QG2     4.39            #peak  1026 #SUP  0.53  #QF  0.53
115 GLN  H     115 GLN  QG      3.97            #peak  1027 #SUP  0.75  #QF  0.75
115 GLN  HA    115 GLN  QG      3.65            #peak  1033 #SUP  0.93  #QF  0.93
 21 GLN  QB     21 GLN  QG      2.94            #peak  1039 #SUP  0.96  #QF  0.80
 94 GLN  QG     98 LYS  QG      4.86            #peak  1041 #SUP  0.27  #QF  0.27
 70 GLN  H      70 GLN  QG      4.07            #peak  1043 #SUP  0.72  #QF  0.72
 32 GLN  H      32 GLN  QG      3.53            #peak  1044 #SUP  0.92  #QF  0.92
 32 GLN  HA     32 GLN  QG      3.61            #peak  1048 #SUP  0.96  #QF  0.96
 70 GLN  HA     70 GLN  QG      3.58            #peak  1050 #SUP  0.90  #QF  0.90
 66 ILE  QG1    70 GLN  QG      5.35            #peak  1059 #SUP  0.72  #QF  0.40
 69 ALA  QB     70 GLN  QG      5.50            #peak  1059 #SUP  0.72  #QF  0.40
 30 GLU  H      30 GLU  QG      4.24            #peak  1062 #SUP  0.93  #QF  0.93
 53 GLU  H      53 GLU  QG      3.61            #peak  1063 #SUP  0.35  #QF  0.35
106 GLU  QG    107 THR  H       4.72            #peak  1064 #SUP  0.89  #QF  0.89
 24 HIS  HA     27 GLU  QG      4.46            #peak  1065 #SUP  0.72  #QF  0.61
103 ASP  HA    106 GLU  QG      4.93            #peak  1065 #SUP  0.72  #QF  0.61
106 GLU  HA    106 GLU  QG      3.53            #peak  1066 #SUP  0.95  #QF  0.95
 53 GLU  HA     53 GLU  QG      4.25            #peak  1067 #SUP  0.99  #QF  0.96
106 GLU  QG    110 LYS  QE      4.01            #peak  1068 #SUP  0.25  #QF  0.25
106 GLU  QB    106 GLU  QG      2.40            #peak  1071 #SUP  0.98  #QF  0.98
 30 GLU  QG     34 LEU  QQD     3.90            #peak  1074 #SUP  0.92  #QF  0.25
  7 LYS  QD      8 ASP  QB      4.67            #peak  1084 #SUP  0.93  #QF  0.93
 67 GLU  H      67 GLU  QG      3.84            #peak  1090 #SUP  0.98  #QF  0.98
 67 GLU  HA     67 GLU  QG      3.59            #peak  1091 #SUP  0.62  #QF  0.62
 66 ILE  QG2    67 GLU  QG      3.64            #peak  1093 #SUP  0.39  #QF  0.39
 58 GLU  HA     58 GLU  QG      3.89            #peak  1095 #SUP  0.99  #QF  0.99
 58 GLU  QG     61 VAL  QG1     4.94            #peak  1100 #SUP  0.95  #QF  0.95
 58 GLU  QG     61 VAL  QG2     4.94            #peak  1101 #SUP  0.82  #QF  0.82
100 LEU  HA    103 ASP  HB3     4.48            #peak  1105 #SUP  0.62  #QF  0.62
 33 LEU  QD1   103 ASP  HB3     3.96            #peak  1108 #SUP  0.95  #QF  0.83
113 ASP  QB    114 ILE  HA      4.72            #peak  1126 #SUP  0.74  #QF  0.74
113 ASP  QB    114 ILE  HB      4.79            #peak  1130 #SUP  0.68  #QF  0.68
 60 ASP  H      60 ASP  HB3     3.41            #peak  1131 #SUP  0.92  #QF  0.92
 60 ASP  HB3    61 VAL  H       3.98            #peak  1132 #SUP  0.94  #QF  0.94
 57 ARG  HA     60 ASP  HB3     3.79            #peak  1134 #SUP  0.96  #QF  0.96
 44 ASN  H      44 ASN  HB3     3.83            #peak  1138 #SUP  0.64  #QF  0.39
 44 ASN  HB3    45 GLU  H       3.87            #peak  1140 #SUP  0.75  #QF  0.75
 44 ASN  HB3   114 ILE  QD1     4.47            #peak  1150 #SUP  0.96  #QF  0.96
 83 ASN  HB2    86 GLU  QB      4.42            #peak  1153 #SUP  0.72  #QF  0.24
 82 LEU  HA     83 ASN  HB2     4.53            #peak  1167 #SUP  0.44  #QF  0.44
109 GLN  H     112 LYS  QE      5.50            #peak  1171 #SUP  0.98  #QF  0.98
109 GLN  QG    112 LYS  QE      4.59            #peak  1181 #SUP  0.60  #QF  0.60
109 GLN  QB    112 LYS  QE      5.24            #peak  1185 #SUP  0.75  #QF  0.75
112 LYS  QB    112 LYS  QE      4.08            #peak  1187 #SUP  0.88  #QF  0.88
112 LYS  QD    112 LYS  QE      2.68            #peak  1188 #SUP  0.93  #QF  0.93
112 LYS  QG    112 LYS  QE      3.52            #peak  1189 #SUP  0.98  #QF  0.98
 60 ASP  HB2    61 VAL  H       3.98            #peak  1196 #SUP  0.96  #QF  0.96
 78 LYS  HA     78 LYS  QE      4.33            #peak  1202 #SUP  0.65  #QF  0.48
 79 ARG  HA     79 ARG  QD      4.68            #peak  1202 #SUP  0.65  #QF  0.48
 99 ILE  QG2   102 LYS  QE      3.61            #peak  1215 #SUP  0.28  #QF  0.28
 48 SER  HA     49 LYS  QE      4.45            #peak  1229 #SUP  0.46  #QF  0.46
 54 LYS  QB     54 LYS  QE      3.79            #peak  1230 #SUP  0.88  #QF  0.53
 49 LYS  QE     50 GLU  H       4.67            #peak  1244 #SUP  0.31  #QF  0.31
102 LYS  H     102 LYS  QE      4.68            #peak  1246 #SUP  0.90  #QF  0.90
  6 LYS  HA      6 LYS  QE      3.95            #peak  1252 #SUP  0.29  #QF  0.29
 48 SER  QB     49 LYS  QE      5.19            #peak  1253 #SUP  0.26  #QF  0.26
 49 LYS  QG     49 LYS  QE      3.07            #peak  1261 #SUP  1.00  #QF  0.76
 99 ILE  HA    102 LYS  QE      4.57            #peak  1265 #SUP  0.31  #QF  0.31
 47 LYS  H      47 LYS  QE      5.46            #peak  1279 #SUP  0.96  #QF  0.96
 44 ASN  HA     47 LYS  QE      4.47            #peak  1281 #SUP  0.94  #QF  0.94
 47 LYS  HA     47 LYS  QE      4.67            #peak  1282 #SUP  0.94  #QF  0.94
 47 LYS  QE    114 ILE  QG1     3.49            #peak  1289 #SUP  0.58  #QF  0.58
 47 LYS  QG     47 LYS  QE      3.44            #peak  1290 #SUP  0.92  #QF  0.92
 47 LYS  QE    114 ILE  QG2     3.62            #peak  1292 #SUP  0.91  #QF  0.91
 11 ARG  HA     11 ARG  QD      4.53            #peak  1308 #SUP  0.98  #QF  0.98
 11 ARG  QB     11 ARG  QD      3.47            #peak  1311 #SUP  0.85  #QF  0.85
 24 HIS  QB     25 ALA  HA      4.49            #peak  1330 #SUP  0.31  #QF  0.31
 31 HIS  QB     32 GLN  QG      4.84            #peak  1334 #SUP  0.25  #QF  0.25
 24 HIS  QB     27 GLU  QB      4.68            #peak  1336 #SUP  0.62  #QF  0.62
 57 ARG  H      57 ARG  QD      4.66            #peak  1337 #SUP  0.53  #QF  0.53
 57 ARG  HA     57 ARG  QD      4.34            #peak  1339 #SUP  0.95  #QF  0.95
 54 LYS  HA     57 ARG  QD      4.49            #peak  1340 #SUP  0.39  #QF  0.39
 75 ARG  QB     75 ARG  QD      3.46            #peak  1344 #SUP  0.88  #QF  0.82
 87 ARG  H      88 PHE  QB      4.62            #peak  1350 #SUP  0.56  #QF  0.56
 85 LEU  QB     88 PHE  QB      4.78            #peak  1356 #SUP  0.90  #QF  0.90
 84 ILE  QG2    88 PHE  QB      5.00            #peak  1357 #SUP  0.97  #QF  0.64
 85 LEU  QQD    88 PHE  QB      5.29            #peak  1357 #SUP  0.97  #QF  0.64
 25 ALA  QB     26 ILE  HA      4.83            #peak  1373 #SUP  0.98  #QF  0.98
 26 ILE  HA     26 ILE  QG2     3.39            #peak  1374 #SUP  0.92  #QF  0.92
111 VAL  HA    114 ILE  HB      4.13            #peak  1380 #SUP  0.86  #QF  0.86
111 VAL  HA    111 VAL  QG2     3.77            #peak  1383 #SUP  1.00  #QF  0.24
108 GLU  HA    111 VAL  H       4.68            #peak  1386 #SUP  0.80  #QF  0.80
107 THR  HB    108 GLU  HA      4.64            #peak  1389 #SUP  0.55  #QF  0.55
108 GLU  HA    112 LYS  QB      5.50            #peak  1394 #SUP  0.82  #QF  0.48
 59 LEU  HG    108 GLU  HA      4.93            #peak  1395 #SUP  0.83  #QF  0.83
108 GLU  HA    112 LYS  QD      4.95            #peak  1396 #SUP  0.85  #QF  0.85
  4 LYS  HA      5 PRO  HD3     3.05            #peak  1406 #SUP  0.91  #QF  0.91
 55 ILE  HA     58 GLU  QB      4.17            #peak  1423 #SUP  0.48  #QF  0.48
 99 ILE  HA     99 ILE  HG12    3.66            #peak  1426 #SUP  0.74  #QF  0.74
 99 ILE  HA     99 ILE  HG13    3.66            #peak  1429 #SUP  0.90  #QF  0.90
 99 ILE  HA     99 ILE  QG2     3.11            #peak  1430 #SUP  0.95  #QF  0.95
 52 GLN  HA     52 GLN  QG      4.08            #peak  1438 #SUP  0.61  #QF  0.61
 43 LEU  QD1    52 GLN  HA      4.22            #peak  1442 #SUP  0.80  #QF  0.72
 43 LEU  QD2    52 GLN  HA      4.22            #peak  1442 #SUP  0.80  #QF  0.72
 47 LYS  HA    114 ILE  QG1     4.41            #peak  1450 #SUP  0.47  #QF  0.47
  4 LYS  HA      5 PRO  HD2     3.05            #peak  1453 #SUP  0.86  #QF  0.86
 86 GLU  HA     89 ASN  H       5.12            #peak  1466 #SUP  0.88  #QF  0.78
 86 GLU  HA     88 PHE  H       4.65            #peak  1467 #SUP  0.61  #QF  0.61
 86 GLU  HA     86 GLU  QG      4.04            #peak  1470 #SUP  0.58  #QF  0.58
 73 LEU  QQD    74 GLU  HA      4.44            #peak  1473 #SUP  0.24  #QF  0.24
 85 LEU  QQD    86 GLU  HA      4.46            #peak  1474 #SUP  0.43  #QF  0.43
 61 VAL  HA     65 MET  H       5.01            #peak  1476 #SUP  0.95  #QF  0.81
 66 ILE  HA     69 ALA  H       4.83            #peak  1485 #SUP  0.63  #QF  0.63
 66 ILE  HA     67 GLU  HA      5.00            #peak  1486 #SUP  0.45  #QF  0.45
 65 MET  QG     66 ILE  HA      4.48            #peak  1488 #SUP  0.40  #QF  0.40
 66 ILE  HA     66 ILE  QG1     3.77            #peak  1490 #SUP  0.97  #QF  0.71
 74 GLU  HA     77 LEU  H       4.50            #peak  1494 #SUP  0.56  #QF  0.56
 74 GLU  HA     77 LEU  QB      4.19            #peak  1503 #SUP  0.83  #QF  0.83
 74 GLU  HA     77 LEU  HG      4.35            #peak  1504 #SUP  0.85  #QF  0.85
 74 GLU  HA     77 LEU  QQD     3.73            #peak  1505 #SUP  0.96  #QF  0.96
 92 GLU  QB     95 THR  HB      4.94            #peak  1509 #SUP  0.83  #QF  0.63
 95 THR  HB     96 LEU  QB      5.29            #peak  1509 #SUP  0.83  #QF  0.63
 59 LEU  HG    107 THR  HB      4.88            #peak  1510 #SUP  0.48  #QF  0.48
 95 THR  HB     96 LEU  HG      4.13            #peak  1512 #SUP  0.65  #QF  0.65
 59 LEU  QD2   107 THR  HB      4.96            #peak  1514 #SUP  0.76  #QF  0.25
 33 LEU  QD2   107 THR  HB      4.71            #peak  1515 #SUP  0.87  #QF  0.38
 92 GLU  HA     95 THR  HB      4.50            #peak  1518 #SUP  0.65  #QF  0.65
 97 SER  H      97 SER  QB      3.95            #peak  1520 #SUP  0.99  #QF  0.74
114 ILE  HA    114 ILE  QG1     4.22            #peak  1524 #SUP  0.74  #QF  0.74
 56 ILE  HA     57 ARG  QD      5.45            #peak  1529 #SUP  0.70  #QF  0.62
 84 ILE  HA     88 PHE  QB      5.50            #peak  1529 #SUP  0.70  #QF  0.62
 84 ILE  HA     84 ILE  HG12    4.17            #peak  1531 #SUP  0.60  #QF  0.60
 62 VAL  HA     65 MET  QG      3.81            #peak  1539 #SUP  0.82  #QF  0.74
 62 VAL  HA     62 VAL  QG1     3.78            #peak  1540 #SUP  0.96  #QF  0.73
 62 VAL  HA     62 VAL  QG2     4.04            #peak  1540 #SUP  0.96  #QF  0.73
104 LEU  HA    108 GLU  H       5.50            #peak  1542 #SUP  0.87  #QF  0.72
 37 GLN  HA     37 GLN  HG2     4.09            #peak  1551 #SUP  1.00  #QF  0.99
109 GLN  HA    109 GLN  QG      3.49            #peak  1552 #SUP  0.97  #QF  0.97
 37 GLN  HA     37 GLN  HG3     4.09            #peak  1553 #SUP  0.96  #QF  0.91
109 GLN  HA    109 GLN  QB      2.99            #peak  1554 #SUP  0.94  #QF  0.94
109 GLN  HA    112 LYS  QB      3.90            #peak  1556 #SUP  0.72  #QF  0.72
109 GLN  HA    112 LYS  QD      3.30            #peak  1557 #SUP  0.52  #QF  0.52
104 LEU  HA    104 LEU  HG      3.81            #peak  1558 #SUP  0.87  #QF  0.47
112 LYS  HA    112 LYS  QG      4.06            #peak  1558 #SUP  0.87  #QF  0.47
 33 LEU  QD2   104 LEU  HA      3.46            #peak  1561 #SUP  0.64  #QF  0.35
104 LEU  HA    104 LEU  QQD     3.60            #peak  1561 #SUP  0.64  #QF  0.35
 43 LEU  HA     48 SER  QB      4.30            #peak  1572 #SUP  0.21  #QF  0.21
 48 SER  QB     51 LEU  HA      4.59            #peak  1573 #SUP  0.90  #QF  0.90
 48 SER  QB     51 LEU  QB      4.62            #peak  1580 #SUP  0.64  #QF  0.64
 19 ILE  HA     19 ILE  QG2     3.82            #peak  1598 #SUP  0.64  #QF  0.64
 63 CYS  HA     66 ILE  HB      4.24            #peak  1603 #SUP  0.63  #QF  0.63
 52 GLN  HA     53 GLU  HA      5.03            #peak  1611 #SUP  0.34  #QF  0.34
 94 GLN  HA     98 LYS  QE      5.36            #peak  1613 #SUP  0.48  #QF  0.48
 30 GLU  HA     30 GLU  QG      3.87            #peak  1619 #SUP  0.75  #QF  0.43
 75 ARG  HA     75 ARG  QG      3.40            #peak  1620 #SUP  0.46  #QF  0.46
 75 ARG  HA     75 ARG  QD      4.53            #peak  1625 #SUP  0.47  #QF  0.47
 98 LYS  HA     98 LYS  QG      3.12            #peak  1642 #SUP  0.44  #QF  0.44
 67 GLU  HB2    68 GLY  QA      4.75            #peak  1644 #SUP  0.45  #QF  0.45
 97 SER  HA    100 LEU  HG      4.89            #peak  1655 #SUP  0.22  #QF  0.22
 98 LYS  HA     98 LYS  QB      2.81            #peak  1657 #SUP  0.93  #QF  0.93
 49 LYS  HA    116 THR  QG2     3.69            #peak  1658 #SUP  0.34  #QF  0.34
 54 LYS  HA     55 ILE  HA      4.87            #peak  1664 #SUP  0.75  #QF  0.75
 54 LYS  HA     54 LYS  QE      4.37            #peak  1665 #SUP  0.52  #QF  0.52
110 LYS  HA    113 ASP  QB      3.53            #peak  1666 #SUP  0.67  #QF  0.67
 50 GLU  HA     50 GLU  QB      2.81            #peak  1667 #SUP  0.98  #QF  0.95
110 LYS  HA    110 LYS  QG      3.20            #peak  1676 #SUP  0.82  #QF  0.82
 27 GLU  HA     27 GLU  QB      2.83            #peak  1682 #SUP  1.00  #QF  0.65
 42 GLU  HA     42 GLU  QB      2.97            #peak  1682 #SUP  1.00  #QF  0.65
 33 LEU  HA     33 LEU  QD2     3.09            #peak  1687 #SUP  0.55  #QF  0.55
 25 ALA  HA     28 LYS  QG      5.31            #peak  1692 #SUP  0.65  #QF  0.65
 28 LYS  HA     31 HIS  QB      3.85            #peak  1699 #SUP  0.54  #QF  0.54
 95 THR  QG2    96 LEU  HA      4.65            #peak  1701 #SUP  0.76  #QF  0.76
 22 ALA  HA     24 HIS  H       4.99            #peak  1706 #SUP  0.78  #QF  0.34
 25 ALA  HA     28 LYS  H       5.16            #peak  1706 #SUP  0.78  #QF  0.34
 25 ALA  HA     28 LYS  QB      3.50            #peak  1709 #SUP  0.60  #QF  0.60
 77 LEU  HA     77 LEU  HG      4.14            #peak  1714 #SUP  0.58  #QF  0.58
 34 LEU  HA     37 GLN  H       4.63            #peak  1721 #SUP  0.74  #QF  0.48
 96 LEU  HA     96 LEU  QQD     3.15            #peak  1724 #SUP  0.88  #QF  0.35
101 LEU  HA    101 LEU  QQD     3.02            #peak  1724 #SUP  0.88  #QF  0.35
 72 ALA  HA     75 ARG  QB      3.73            #peak  1728 #SUP  0.34  #QF  0.34
 34 LEU  HA     34 LEU  HG      4.13            #peak  1732 #SUP  0.98  #QF  0.94
 49 LYS  H     116 THR  HB      4.70            #peak  1733 #SUP  0.98  #QF  0.98
 48 SER  HA    116 THR  HB      5.14            #peak  1737 #SUP  0.51  #QF  0.51
 52 GLN  QB    116 THR  HB      4.75            #peak  1741 #SUP  0.69  #QF  0.69
106 GLU  HA    106 GLU  QB      3.00            #peak  1757 #SUP  0.98  #QF  0.97
106 GLU  HA    109 GLN  QB      3.35            #peak  1757 #SUP  0.98  #QF  0.97
 21 GLN  HA     21 GLN  QG      3.62            #peak  1769 #SUP  0.98  #QF  0.98
 57 ARG  HA     60 ASP  H       4.55            #peak  1771 #SUP  0.80  #QF  0.46
 57 ARG  HA     60 ASP  HB2     3.79            #peak  1773 #SUP  0.96  #QF  0.96
 85 LEU  HA     87 ARG  H       4.87            #peak  1776 #SUP  0.76  #QF  0.33
 85 LEU  HA     89 ASN  H       5.09            #peak  1776 #SUP  0.76  #QF  0.33
 78 LYS  HA     78 LYS  QD      3.27            #peak  1786 #SUP  0.83  #QF  0.58
 85 LEU  HA     86 GLU  HA      5.03            #peak  1788 #SUP  0.56  #QF  0.56
 85 LEU  HA     88 PHE  QB      3.34            #peak  1789 #SUP  0.59  #QF  0.59
 85 LEU  HA     85 LEU  QQD     3.43            #peak  1791 #SUP  0.91  #QF  0.37
 64 ALA  HA     67 GLU  H       4.37            #peak  1792 #SUP  0.85  #QF  0.85
 63 CYS  HA     64 ALA  HA      5.45            #peak  1797 #SUP  0.96  #QF  0.69
 92 GLU  HA     93 ALA  HA      5.50            #peak  1797 #SUP  0.96  #QF  0.69
 93 ALA  HA     94 GLN  HA      5.50            #peak  1797 #SUP  0.96  #QF  0.69
 64 ALA  HA     67 GLU  QG      4.44            #peak  1798 #SUP  0.84  #QF  0.84
 64 ALA  HA     67 GLU  HB2     3.44            #peak  1799 #SUP  0.53  #QF  0.53
 93 ALA  HA     96 LEU  QQD     3.45            #peak  1801 #SUP  0.61  #QF  0.61
 51 LEU  HA     53 GLU  H       4.97            #peak  1802 #SUP  0.25  #QF  0.25
 51 LEU  HA     54 LYS  QG      3.68            #peak  1809 #SUP  0.53  #QF  0.53
 51 LEU  HA     55 ILE  QD1     4.78            #peak  1811 #SUP  0.71  #QF  0.71
100 LEU  HA    104 LEU  H       4.84            #peak  1812 #SUP  0.40  #QF  0.40
 45 GLU  HA     45 GLU  QG      3.41            #peak  1819 #SUP  1.00
100 LEU  HA    100 LEU  QQD     3.36            #peak  1821 #SUP  0.70  #QF  0.70
 32 GLN  HA     35 TYR  H       4.45            #peak  1822 #SUP  0.67  #QF  0.67
  6 LYS  HA      6 LYS  QG      3.53            #peak  1836 #SUP  0.96  #QF  0.96
 44 ASN  HA    114 ILE  QD1     3.45            #peak  1837 #SUP  0.90  #QF  0.90
 32 GLN  HA     35 TYR  QB      3.60            #peak  1840 #SUP  0.37  #QF  0.37
116 THR  HB    117 GLN  HA      4.96            #peak  1855 #SUP  0.90  #QF  0.90
117 GLN  HA    117 GLN  QG      3.38            #peak  1858 #SUP  0.97  #QF  0.97
 49 LYS  QB    117 GLN  HA      4.28            #peak  1861 #SUP  0.72  #QF  0.72
 30 GLU  HA     31 HIS  HA      5.11            #peak  1878 #SUP  0.82  #QF  0.82
 31 HIS  HA     34 LEU  HG      4.44            #peak  1881 #SUP  0.75  #QF  0.75
 92 GLU  HA     95 THR  HA      5.04            #peak  1889 #SUP  0.77  #QF  0.77
 95 THR  HA     98 LYS  QD      4.92            #peak  1891 #SUP  0.42  #QF  0.42
 95 THR  HA     95 THR  QG2     3.69            #peak  1892 #SUP  0.88  #QF  0.88
 95 THR  HA     99 ILE  QD1     4.57            #peak  1893 #SUP  0.78  #QF  0.78
 88 PHE  QB     89 ASN  HA      4.70            #peak  1896 #SUP  0.97  #QF  0.97
 89 ASN  HA     92 GLU  QB      3.59            #peak  1899 #SUP  0.76  #QF  0.76
 60 ASP  HA     63 CYS  H       4.30            #peak  1905 #SUP  0.65  #QF  0.65
 42 GLU  HA     43 LEU  HA      5.03            #peak  1931 #SUP  0.83  #QF  0.83
 43 LEU  HA     51 LEU  HG      4.32            #peak  1933 #SUP  0.91  #QF  0.91
 43 LEU  HA     43 LEU  QD1     4.26            #peak  1936 #SUP  0.75  #QF  0.64
 43 LEU  HA     43 LEU  QD2     4.26            #peak  1936 #SUP  0.75  #QF  0.64
 43 LEU  HA     55 ILE  QD1     4.79            #peak  1937 #SUP  0.25  #QF  0.25
  8 ASP  HA      8 ASP  QB      2.94            #peak  1943 #SUP  0.75  #QF  0.75
 82 LEU  HA     82 LEU  HG      4.20            #peak  1945 #SUP  0.84  #QF  0.84
 82 LEU  HA     82 LEU  QQD     3.48            #peak  1946 #SUP  0.71  #QF  0.71
 24 HIS  HA     28 LYS  H       4.12            #peak  1952 #SUP  0.46  #QF  0.46
 24 HIS  HA     27 GLU  QB      3.59            #peak  1958 #SUP  0.65  #QF  0.65
 33 LEU  QD1   103 ASP  HA      5.09            #peak  1975 #SUP  0.87  #QF  0.68
 33 LEU  QD2   103 ASP  HA      5.44            #peak  1975 #SUP  0.87  #QF  0.68
112 LYS  QB    113 ASP  HA      4.81            #peak  1989 #SUP  0.88  #QF  0.88
113 ASP  HA    114 ILE  QD1     5.50            #peak  1991 #SUP  0.72  #QF  0.72
 38 HIS  HA     38 HIS  HE1     4.80            #peak  2013 #SUP  0.57  #QF  0.57
  4 LYS  HA      4 LYS  QD      4.38            #peak  2029 #SUP  0.97  #QF  0.92
 52 GLN  H      55 ILE  QD1     4.95            #peak  2127 #SUP  0.76  #QF  0.59
 55 ILE  QD1    56 ILE  H       5.39            #peak  2127 #SUP  0.76  #QF  0.59
 39 GLN  HA     55 ILE  QD1     4.40            #peak  2128 #SUP  0.60  #QF  0.60
 52 GLN  HA     55 ILE  QD1     3.91            #peak  2130 #SUP  0.97  #QF  0.83
 39 GLN  QB     55 ILE  QD1     3.19            #peak  2131 #SUP  0.71  #QF  0.71
 51 LEU  QD1    55 ILE  QD1     3.80            #peak  2132 #SUP  0.76  #QF  0.44
 51 LEU  QD2    55 ILE  QD1     3.80            #peak  2132 #SUP  0.76  #QF  0.44
 40 LEU  H      40 LEU  QD1     5.05            #peak  2135 #SUP  0.73  #QF  0.73
 33 LEU  QD1   103 ASP  HB2     3.97            #peak  2139 #SUP  0.81  #QF  0.81
 33 LEU  QB     33 LEU  QD1     3.25            #peak  2141 #SUP  0.88  #QF  0.88
 59 LEU  H      59 LEU  QD1     4.68            #peak  2153 #SUP  0.92  #QF  0.92
 59 LEU  QD1   108 GLU  H       4.61            #peak  2154 #SUP  0.90  #QF  0.90
 59 LEU  QD1    60 ASP  H       5.10            #peak  2155 #SUP  0.78  #QF  0.78
 59 LEU  QD1   107 THR  HB      4.96            #peak  2157 #SUP  0.55  #QF  0.55
 59 LEU  QB     59 LEU  QD1     3.43            #peak  2160 #SUP  0.92  #QF  0.92
 36 LEU  H      36 LEU  HG      4.51            #peak  2165 #SUP  0.54  #QF  0.54
 59 LEU  QD2   108 GLU  H       4.61            #peak  2166 #SUP  0.74  #QF  0.74
 59 LEU  QD2    60 ASP  H       5.10            #peak  2167 #SUP  0.70  #QF  0.70
 59 LEU  QB     59 LEU  QD2     3.43            #peak  2172 #SUP  0.39  #QF  0.39
 62 VAL  QG2    63 CYS  H       4.26            #peak  2233 #SUP  0.61  #QF  0.61
 51 LEU  H      51 LEU  QD1     5.02            #peak  2248 #SUP  0.99  #QF  0.95
 51 LEU  HA     51 LEU  QD1     4.67            #peak  2251 #SUP  0.99  #QF  0.99
 59 LEU  HG     63 CYS  H       5.50            #peak  2271 #SUP  0.94  #QF  0.93
 57 ARG  H      57 ARG  HG2     4.47            #peak  2273 #SUP  0.94  #QF  0.94
 39 GLN  QG     40 LEU  H       4.83            #peak  2288 #SUP  1.00
 36 LEU  HA     39 GLN  QG      3.96            #peak  2290 #SUP  0.63  #QF  0.63
 39 GLN  QG     55 ILE  QG1     4.37            #peak  2292 #SUP  0.76  #QF  0.76
 36 LEU  QQD    39 GLN  QG      4.48            #peak  2294 #SUP  0.98  #QF  0.42
 39 GLN  QG     55 ILE  QD1     5.08            #peak  2294 #SUP  0.98  #QF  0.42
 91 GLU  HA     91 GLU  QG      3.34            #peak  2325 #SUP  0.52  #QF  0.52
 20 GLU  QG     21 GLN  H       4.44            #peak  2328 #SUP  0.50  #QF  0.50
 96 LEU  H      96 LEU  HG      4.53            #peak  2378 #SUP  0.63  #QF  0.35
 93 ALA  HA     96 LEU  HG      4.41            #peak  2380 #SUP  0.70  #QF  0.70
 49 LYS  HA    116 THR  HA      4.62            #peak  2492 #SUP  0.61  #QF  0.61
115 GLN  QB    116 THR  HA      4.43            #peak  2495 #SUP  0.69  #QF  0.69
 10 PHE  HA     10 PHE  HD1     3.48            #peak     5 #SUP  0.51  #QF  0.51
 10 PHE  HA     10 PHE  QE      5.33            #peak     6 #SUP  0.98  #QF  0.61
 10 PHE  HA     10 PHE  HD2     5.50            #peak     6 #SUP  0.98  #QF  0.61
 14 PHE  HA     14 PHE  QD      4.23            #peak     7 #SUP  0.55  #QF  0.55
 24 HIS  HA     24 HIS  HD2     4.24            #peak    11 #SUP  0.61  #QF  0.47
 31 HIS  HA     31 HIS  HD2     3.56            #peak    13 #SUP  0.42  #QF  0.42
 35 TYR  HA     35 TYR  QD      3.26            #peak    18 #SUP  0.78  #QF  0.78
 38 HIS  HA     38 HIS  HD2     4.08            #peak    20 #SUP  0.77  #QF  0.77
 88 PHE  HA     88 PHE  QB      2.93            #peak    23 #SUP  0.95  #QF  0.95
 88 PHE  HA     88 PHE  QD      3.40            #peak    24 #SUP  0.78  #QF  0.78
 90 TYR  HA     90 TYR  QD      3.19            #peak    25 #SUP  0.77  #QF  0.77
 90 TYR  HA     90 TYR  QE      4.38            #peak    26 #SUP  0.94  #QF  0.94
 10 PHE  QB     10 PHE  HD1     3.52            #peak    27 #SUP  0.56  #QF  0.56
 24 HIS  QB     24 HIS  HD2     3.69            #peak    31 #SUP  1.00  #QF  0.99
 31 HIS  QB     31 HIS  HD2     3.82            #peak    33 #SUP  0.98  #QF  0.98
 38 HIS  QB     38 HIS  HD2     3.63            #peak    43 #SUP  0.98  #QF  0.98
 19 ILE  HA     90 TYR  QD      5.26            #peak    56 #SUP  0.74  #QF  0.74
 19 ILE  HA     90 TYR  QE      4.88            #peak    57 #SUP  0.90  #QF  0.90
 35 TYR  QE     36 LEU  HA      5.50            #peak    58 #SUP  0.58  #QF  0.23
 86 GLU  HA     90 TYR  QE      4.58            #peak    60 #SUP  0.90  #QF  0.90
 86 GLU  HA     90 TYR  QD      4.07            #peak    61 #SUP  0.96  #QF  0.96
 78 LYS  QE     90 TYR  QD      4.00            #peak    65 #SUP  0.46  #QF  0.46
 78 LYS  QE     90 TYR  QE      4.82            #peak    66 #SUP  0.48  #QF  0.48
 78 LYS  QG     90 TYR  QD      4.60            #peak    71 #SUP  0.92  #QF  0.35
 90 TYR  QD     93 ALA  QB      4.85            #peak    71 #SUP  0.92  #QF  0.35
 19 ILE  HB     90 TYR  QE      4.73            #peak    73 #SUP  1.00
 19 ILE  HG12   90 TYR  QE      4.82            #peak    76 #SUP  0.97  #QF  0.97
 19 ILE  HG13   90 TYR  QE      4.22            #peak    78 #SUP  0.88  #QF  0.88
 33 LEU  QD1    37 GLN  HE22    4.28            #peak    79 #SUP  0.33  #QF  0.33
 40 LEU  QD2    44 ASN  HD22    5.46            #peak    80 #SUP  0.22  #QF  0.22
 33 LEU  QD2    37 GLN  HE22    4.30            #peak    81 #SUP  0.64  #QF  0.64
 77 LEU  QQD    90 TYR  QD      3.53            #peak    83 #SUP  0.62  #QF  0.45
 77 LEU  QQD    90 TYR  QE      3.50            #peak    85 #SUP  0.42  #QF  0.42
 19 ILE  QD1    90 TYR  QD      4.06            #peak    86 #SUP  0.65  #QF  0.65
 19 ILE  QD1    90 TYR  QE      4.09            #peak    87 #SUP  0.61  #QF  0.61
 18 LEU  QQD    90 TYR  QE      3.77            #peak    97 #SUP  0.49  #QF  0.49
 78 LYS  QG     90 TYR  QE      4.74            #peak   101 #SUP  0.97  #QF  0.97
 18 LEU  QB     90 TYR  QE      4.09            #peak   102 #SUP  0.82  #QF  0.82
 86 GLU  QB     90 TYR  QE      4.13            #peak   103 #SUP  0.91  #QF  0.91
 78 LYS  QD     90 TYR  QE      4.60            #peak   106 #SUP  0.55  #QF  0.44
 78 LYS  QD     90 TYR  QD      4.55            #peak   109 #SUP  0.78  #QF  0.78
 19 ILE  QG2    90 TYR  QD      4.40            #peak   111 #SUP  0.54  #QF  0.54
 35 TYR  QE     36 LEU  QB      5.50            #peak   117 #SUP  0.66  #QF  0.66
 35 TYR  QE     39 GLN  QG      3.76            #peak   119 #SUP  0.46  #QF  0.46
 85 LEU  HA     88 PHE  QD      3.91            #peak   139 #SUP  0.96  #QF  0.96
 88 PHE  QE     89 ASN  HA      5.50            #peak   140 #SUP  0.95  #QF  0.90
 88 PHE  QD     89 ASN  HA      4.22            #peak   142 #SUP  0.88  #QF  0.88
 85 LEU  QQD    88 PHE  QD      3.77            #peak   160 #SUP  0.75  #QF  0.75
  1 GLN  HA      1 GLN  QE2     5.27            #peak    58
  1 GLN  QB      1 GLN  QE2     3.62            #peak   826
  4 LYS  QB      5 PRO  HA      4.64            #peak  1873
  4 LYS  QB      5 PRO  QG      3.78            #peak   514
  4 LYS  QB      5 PRO  QD      3.72            #peak  1414
  4 LYS  QG      5 PRO  QD      4.62            #peak  1415
 12 ASN  HA     12 ASN  QD2     4.18            #peak  2082
 19 ILE  HG13   89 ASN  QB      4.16            #peak  1114
 19 ILE  QD1    89 ASN  QB      4.56            #peak     4
 29 GLY  QA     32 GLN  QG      4.44            #peak  1051
 29 GLY  QA    100 LEU  QQD     4.51            #peak  1405
 31 HIS  QB     32 GLN  QB      5.23            #peak  1335
 32 GLN  H      32 GLN  QB      3.62            #peak   717
 32 GLN  QB     32 GLN  QE2     3.59            #peak   251
 32 GLN  QB     33 LEU  H       3.85            #peak   737
 32 GLN  QB     62 VAL  QG1     4.94            #peak   944
 32 GLN  QB     62 VAL  QG2     5.28            #peak   944
 32 GLN  QE2    36 LEU  HG      5.07            #peak    90
 32 GLN  QE2    36 LEU  QQD     3.70            #peak    44
 32 GLN  QE2    62 VAL  HB      4.03            #peak   252
 32 GLN  QE2    62 VAL  QG1     4.07            #peak    77
 32 GLN  QE2    62 VAL  QG2     4.05            #peak    77
 33 LEU  QD1    37 GLN  QB      4.22            #peak   702
 33 LEU  QD1    37 GLN  QE2     3.48            #peak    79
 33 LEU  QD2    37 GLN  QB      5.34            #peak   979
 33 LEU  QD2    37 GLN  QG      4.03            #peak   116
 33 LEU  QD2    37 GLN  QE2     3.71            #peak    81
 34 LEU  HA     37 GLN  QB      3.13            #peak  1749
 34 LEU  HA     37 GLN  QG      4.72            #peak  1731
 34 LEU  QQD    37 GLN  QB      5.34            #peak   979
 37 GLN  H      37 GLN  QG      4.65            #peak   644
 37 GLN  HA     37 GLN  QG      3.50            #peak  1553
 37 GLN  QB     37 GLN  QE2     4.03            #peak    69
 37 GLN  QB     38 HIS  H       3.69            #peak   315
 37 GLN  QE2   103 ASP  HB3     4.88            #peak    19
 39 GLN  HA     51 LEU  QQD     4.55            #peak   231
 39 GLN  QB     51 LEU  QQD     3.57            #peak   232
 39 GLN  QE2    51 LEU  QQD     4.61            #peak   229
 40 LEU  H      40 LEU  QQD     4.11            #peak  2135
 40 LEU  HA     40 LEU  QQD     3.57            #peak   112
 40 LEU  HA     43 LEU  QQD     4.09            #peak   112
 40 LEU  HA     44 ASN  QD2     5.34            #peak    64
 40 LEU  HG     44 ASN  QD2     4.61            #peak    70
 40 LEU  QQD    41 ASP  H       3.95            #peak   107
 40 LEU  QQD    41 ASP  HA      4.34            #peak  1914
 40 LEU  QQD    44 ASN  H       4.60            #peak   632
 40 LEU  QQD    44 ASN  QB      4.87            #peak  1161
 40 LEU  QQD    44 ASN  QD2     3.35            #peak    80
 40 LEU  QQD   107 THR  HB      4.61            #peak  1514
 41 ASP  H      41 ASP  QB      3.16            #peak   200
 41 ASP  QB     42 GLU  H       3.42            #peak   131
 42 GLU  H      51 LEU  QQD     4.95            #peak   134
 42 GLU  QB     51 LEU  QQD     4.11            #peak   830
 42 GLU  QG     46 ASN  QD2     4.53            #peak   919
 42 GLU  QG     51 LEU  QQD     3.72            #peak   929
 43 LEU  H      51 LEU  QQD     4.08            #peak   691
 43 LEU  HA     43 LEU  QQD     3.52            #peak  1936
 43 LEU  HA     46 ASN  QB      3.54            #peak  1932
 43 LEU  HA     51 LEU  QQD     3.72            #peak  1935
 43 LEU  QB     46 ASN  QB      4.83            #peak  1148
 43 LEU  HG     51 LEU  QQD     3.96            #peak  2381
 43 LEU  QQD    44 ASN  H       5.28            #peak   632
 43 LEU  QQD    44 ASN  QB      5.28            #peak  1149
 43 LEU  QQD    51 LEU  HG      3.08            #peak  2147
 43 LEU  QQD    52 GLN  H       4.31            #peak   471
 43 LEU  QQD    52 GLN  HA      3.47            #peak  1442
 43 LEU  QQD    52 GLN  QG      4.75            #peak   786
 43 LEU  QQD   111 VAL  HA      3.40            #peak  1383
 43 LEU  QQD   114 ILE  HB      4.20            #peak   551
 43 LEU  QQD   114 ILE  QG2     3.29            #peak   123
 44 ASN  H      44 ASN  QB      3.30            #peak   627
 44 ASN  HA     47 LYS  QD      3.95            #peak  1805
 44 ASN  QB     44 ASN  QD2     3.13            #peak   159
 44 ASN  QB     45 GLU  QB      5.11            #peak  1148
 44 ASN  QB    114 ILE  QD1     3.85            #peak    74
 44 ASN  QD2   114 ILE  QD1     3.78            #peak    83
 45 GLU  H      46 ASN  QB      4.59            #peak  1164
 46 ASN  H      46 ASN  QB      3.54            #peak   627
 46 ASN  QB     46 ASN  QD2     3.22            #peak   165
 46 ASN  QD2    51 LEU  QQD     3.48            #peak   820
 47 LYS  QB     47 LYS  QD      3.34            #peak   452
 47 LYS  QD    114 ILE  HA      3.91            #peak   553
 47 LYS  QD    114 ILE  QG2     2.87            #peak    40
 47 LYS  QD    114 ILE  QD1     4.06            #peak    76
 47 LYS  QD    115 GLN  H       4.44            #peak   669
 47 LYS  QD    116 THR  QG2     3.70            #peak   599
 48 SER  H      51 LEU  QQD     3.92            #peak   411
 48 SER  QB     51 LEU  QQD     3.77            #peak  1582
 49 LYS  QB    117 GLN  QB      3.74            #peak   565
 49 LYS  QD    117 GLN  QB      3.37            #peak   493
 51 LEU  H      51 LEU  QQD     3.91            #peak   175
 51 LEU  HA     51 LEU  QQD     3.30            #peak   230
 51 LEU  QQD    52 GLN  H       4.68            #peak   490
 51 LEU  QQD    54 LYS  H       5.02            #peak   274
 51 LEU  QQD    54 LYS  QB      4.28            #peak   857
 51 LEU  QQD    54 LYS  QG      4.14            #peak   443
 51 LEU  QQD    55 ILE  H       4.50            #peak   649
 51 LEU  QQD    55 ILE  HB      5.06            #peak  2242
 51 LEU  QQD    55 ILE  QD1     3.33            #peak  2132
 52 GLN  HA    111 VAL  QQG     4.90            #peak   152
 52 GLN  QB     52 GLN  QE2     4.07            #peak   153
 52 GLN  QE2   116 THR  QG2     4.28            #peak    88
 53 GLU  QB     54 LYS  H       3.23            #peak   273
 53 GLU  QB     54 LYS  QG      4.24            #peak   747
 56 ILE  QG2    60 ASP  QB      4.64            #peak  1137
 57 ARG  HA     57 ARG  QG      3.31            #peak   535
 57 ARG  QB     58 GLU  H       3.41            #peak   470
 57 ARG  QG     58 GLU  H       4.86            #peak  2272
 58 GLU  H      61 VAL  QQG     4.93            #peak   271
 58 GLU  HA     61 VAL  QQG     3.58            #peak   275
 58 GLU  QG     61 VAL  QQG     4.26            #peak  1100
 59 LEU  H      59 LEU  QQD     4.06            #peak   782
 59 LEU  HA     59 LEU  QQD     3.02            #peak  1636
 59 LEU  QB     59 LEU  QQD     2.77            #peak  2172
 59 LEU  QQD    60 ASP  H       4.46            #peak  2167
 59 LEU  QQD    60 ASP  HA      4.87            #peak  1914
 59 LEU  QQD    62 VAL  H       5.13            #peak   158
 59 LEU  QQD    63 CYS  H       4.39            #peak   773
 59 LEU  QQD   107 THR  H       5.44            #peak  2168
 59 LEU  QQD   107 THR  HB      4.27            #peak  2157
 59 LEU  QQD   107 THR  QG2     3.50            #peak  2163
 59 LEU  QQD   108 GLU  HA      3.53            #peak  1399
 59 LEU  QQD   108 GLU  QB      4.19            #peak  2159
 59 LEU  QQD   108 GLU  QG      4.34            #peak   726
 60 ASP  H      61 VAL  QQG     5.14            #peak   271
 60 ASP  HA     63 CYS  QB      4.04            #peak  1909
 60 ASP  QB     61 VAL  H       3.49            #peak  1196
 60 ASP  QB     61 VAL  QQG     4.09            #peak   277
 61 VAL  H      61 VAL  QQG     2.96            #peak   273
 61 VAL  HA     61 VAL  QQG     2.93            #peak   276
 61 VAL  QQG    62 VAL  H       3.47            #peak   374
 61 VAL  QQG    64 ALA  QB      4.70            #peak   223
 61 VAL  QQG    65 MET  H       5.44            #peak   216
 61 VAL  QQG    65 MET  QE      4.10            #peak   222
 63 CYS  H      63 CYS  QB      3.68            #peak   769
 63 CYS  QB     64 ALA  H       3.67            #peak   304
 63 CYS  QB     64 ALA  QB      5.03            #peak   417
 66 ILE  QG2    70 GLN  QE2     5.03            #peak     6
 70 GLN  HA     70 GLN  QE2     4.38            #peak  1624
 70 GLN  QE2    74 GLU  QB      5.16            #peak   103
 70 GLN  QE2    74 GLU  QG      3.89            #peak   102
 70 GLN  QE2    98 LYS  HA      4.58            #peak     3
 70 GLN  QE2    98 LYS  QG      5.34            #peak   104
 70 GLN  QE2   101 LEU  HG      4.25            #peak     5
 70 GLN  QE2   101 LEU  QQD     3.94            #peak   105
 83 ASN  QD2    85 LEU  QB      4.67            #peak   469
 84 ILE  H      84 ILE  QG1     4.39            #peak   284
 84 ILE  HA     84 ILE  QG1     3.64            #peak  1531
 84 ILE  QG2    84 ILE  QG1     3.18            #peak   187
 85 LEU  QQD    89 ASN  QB      4.22            #peak   115
 85 LEU  QQD    89 ASN  QD2     4.01            #peak   159
 86 GLU  HA     89 ASN  QB      4.40            #peak  1468
 89 ASN  HA     89 ASN  QD2     4.87            #peak  1895
 89 ASN  QB     90 TYR  H       4.41            #peak   600
 95 THR  QG2    99 ILE  QG1     3.56            #peak   306
 99 ILE  H      99 ILE  QG1     3.89            #peak   265
 99 ILE  HA    102 LYS  QB      3.53            #peak  1424
 99 ILE  QG2    99 ILE  QG1     2.77            #peak   188
 99 ILE  QG2   102 LYS  QB      3.86            #peak   183
101 LEU  QB    102 LYS  QB      5.15            #peak   603
101 LEU  QQD   102 LYS  QB      5.34            #peak   646
102 LYS  H     102 LYS  QB      3.19            #peak   241
102 LYS  QB    102 LYS  QD      3.30            #peak   543
102 LYS  QB    102 LYS  QE      3.87            #peak  1230
102 LYS  QB    103 ASP  H       3.42            #peak   481
108 GLU  HA    111 VAL  QQG     4.58            #peak  1398
110 LYS  H     111 VAL  QQG     4.41            #peak   189
110 LYS  QB    111 VAL  QQG     4.73            #peak   749
111 VAL  HA    111 VAL  QQG     3.13            #peak   238
111 VAL  QQG   112 LYS  H       3.42            #peak   435
111 VAL  QQG   112 LYS  HA      3.87            #peak  1559
111 VAL  QQG   113 ASP  H       5.03            #peak   189
115 GLN  QG    115 GLN  QE2     3.17            #peak   298
117 GLN  H     117 GLN  QB      3.37            #peak   611
117 GLN  HA    117 GLN  QE2     5.01            #peak    19
Constrains/Cyana2.1 format/hbonds.lol0000600000373300001320000001345010525505364016610 0ustar  mandarnmr1 17 LEU  O      21 GLN  H       1.80 
 17 LEU  O      21 GLN  N       2.70 
 18 LEU  O      22 ALA  H       1.80 
 18 LEU  O      22 ALA  N       2.70 
 19 ILE  O      23 ASN  H       1.80 
 19 ILE  O      23 ASN  N       2.70 
 20 GLU  O      24 HIS  H       1.80 
 20 GLU  O      24 HIS  N       2.70 
 21 GLN  O      25 ALA  H       1.80 
 21 GLN  O      25 ALA  N       2.70 
 22 ALA  O      26 ILE  H       1.80 
 22 ALA  O      26 ILE  N       2.70 
 23 ASN  O      27 GLU  H       1.80 
 23 ASN  O      27 GLU  N       2.70 
 24 HIS  O      28 LYS  H       1.80 
 24 HIS  O      28 LYS  N       2.70 
 25 ALA  O      29 GLY  H       1.80 
 25 ALA  O      29 GLY  N       2.70 
 26 ILE  O      30 GLU  H       1.80 
 26 ILE  O      30 GLU  N       2.70 
 27 GLU  O      31 HIS  H       1.80 
 27 GLU  O      31 HIS  N       2.70 
 28 LYS  O      32 GLN  H       1.80 
 28 LYS  O      32 GLN  N       2.70 
 29 GLY  O      33 LEU  H       1.80 
 29 GLY  O      33 LEU  N       2.70 
 30 GLU  O      34 LEU  H       1.80 
 30 GLU  O      34 LEU  N       2.70 
 31 HIS  O      35 TYR  H       1.80 
 31 HIS  O      35 TYR  N       2.70 
 32 GLN  O      36 LEU  H       1.80 
 32 GLN  O      36 LEU  N       2.70 
 33 LEU  O      37 GLN  H       1.80 
 33 LEU  O      37 GLN  N       2.70 
 36 LEU  O      40 LEU  H       1.80 
 36 LEU  O      40 LEU  N       2.70 
 37 GLN  O      41 ASP  H       1.80 
 37 GLN  O      41 ASP  N       2.70 
 38 HIS  O      42 GLU  H       1.80 
 38 HIS  O      42 GLU  N       2.70 
 39 GLN  O      43 LEU  H       1.80 
 39 GLN  O      43 LEU  N       2.70 
 40 LEU  O      44 ASN  H       1.80 
 40 LEU  O      44 ASN  N       2.70 
 42 GLU  O      46 ASN  H       1.80 
 42 GLU  O      46 ASN  N       2.70 
 43 LEU  O      47 LYS  H       1.80 
 43 LEU  O      47 LYS  N       2.70 
 48 SER  O      52 GLN  H       1.80 
 48 SER  O      52 GLN  N       2.70 
 49 LYS  O      53 GLU  H       1.80 
 49 LYS  O      53 GLU  N       2.70 
 50 GLU  O      54 LYS  H       1.80 
 50 GLU  O      54 LYS  N       2.70 
 51 LEU  O      55 ILE  H       1.80 
 51 LEU  O      55 ILE  N       2.70 
 52 GLN  O      56 ILE  H       1.80 
 52 GLN  O      56 ILE  N       2.70 
 54 LYS  O      58 GLU  H       1.80 
 54 LYS  O      58 GLU  N       2.70 
 55 ILE  O      59 LEU  H       1.80 
 55 ILE  O      59 LEU  N       2.70 
 56 ILE  O      60 ASP  H       1.80 
 56 ILE  O      60 ASP  N       2.70 
 57 ARG  O      61 VAL  H       1.80 
 57 ARG  O      61 VAL  N       2.70 
 58 GLU  O      62 VAL  H       1.80 
 58 GLU  O      62 VAL  N       2.70 
 59 LEU  O      63 CYS  H       1.80 
 59 LEU  O      63 CYS  N       2.70 
 60 ASP  O      64 ALA  H       1.80 
 60 ASP  O      64 ALA  N       2.70 
 61 VAL  O      65 MET  H       1.80 
 61 VAL  O      65 MET  N       2.70 
 62 VAL  O      66 ILE  H       1.80 
 62 VAL  O      66 ILE  N       2.70 
 63 CYS  O      67 GLU  H       1.80 
 63 CYS  O      67 GLU  N       2.70 
 64 ALA  O      68 GLY  H       1.80 
 64 ALA  O      68 GLY  N       2.70 
 65 MET  O      69 ALA  H       1.80 
 65 MET  O      69 ALA  N       2.70 
 66 ILE  O      70 GLN  H       1.80 
 66 ILE  O      70 GLN  N       2.70 
 67 GLU  O      71 GLY  H       1.80 
 67 GLU  O      71 GLY  N       2.70 
 68 GLY  O      72 ALA  H       1.80 
 68 GLY  O      72 ALA  N       2.70 
 69 ALA  O      73 LEU  H       1.80 
 69 ALA  O      73 LEU  N       2.70 
 70 GLN  O      74 GLU  H       1.80 
 70 GLN  O      74 GLU  N       2.70 
 71 GLY  O      75 ARG  H       1.80 
 71 GLY  O      75 ARG  N       2.70 
 72 ALA  O      76 GLU  H       1.80 
 72 ALA  O      76 GLU  N       2.70 
 73 LEU  O      77 LEU  H       1.80 
 73 LEU  O      77 LEU  N       2.70 
 74 GLU  O      78 LYS  H       1.80 
 74 GLU  O      78 LYS  N       2.70 
 83 ASN  O      87 ARG  H       1.80 
 83 ASN  O      87 ARG  N       2.70 
 84 ILE  O      88 PHE  H       1.80 
 84 ILE  O      88 PHE  N       2.70 
 85 LEU  O      89 ASN  H       1.80 
 85 LEU  O      89 ASN  N       2.70 
 86 GLU  O      90 TYR  H       1.80 
 86 GLU  O      90 TYR  N       2.70 
 87 ARG  O      91 GLU  H       1.80 
 87 ARG  O      91 GLU  N       2.70 
 88 PHE  O      92 GLU  H       1.80 
 88 PHE  O      92 GLU  N       2.70 
 89 ASN  O      93 ALA  H       1.80 
 89 ASN  O      93 ALA  N       2.70 
 90 TYR  O      94 GLN  H       1.80 
 90 TYR  O      94 GLN  N       2.70 
 91 GLU  O      95 THR  H       1.80 
 91 GLU  O      95 THR  N       2.70 
 92 GLU  O      96 LEU  H       1.80 
 92 GLU  O      96 LEU  N       2.70 
 93 ALA  O      97 SER  H       1.80 
 93 ALA  O      97 SER  N       2.70 
 94 GLN  O      98 LYS  H       1.80 
 94 GLN  O      98 LYS  N       2.70 
 95 THR  O      99 ILE  H       1.80 
 95 THR  O      99 ILE  N       2.70 
 96 LEU  O     100 LEU  H       1.80 
 96 LEU  O     100 LEU  N       2.70 
 97 SER  O     101 LEU  H       1.80 
 97 SER  O     101 LEU  N       2.70 
 98 LYS  O     102 LYS  H       1.80 
 98 LYS  O     102 LYS  N       2.70 
 99 ILE  O     103 ASP  H       1.80 
 99 ILE  O     103 ASP  N       2.70 
100 LEU  O     104 LEU  H       1.80 
100 LEU  O     104 LEU  N       2.70 
101 LEU  O     105 LYS  H       1.80 
101 LEU  O     105 LYS  N       2.70 
102 LYS  O     106 GLU  H       1.80 
102 LYS  O     106 GLU  N       2.70 
103 ASP  O     107 THR  H       1.80 
103 ASP  O     107 THR  N       2.70 
104 LEU  O     108 GLU  H       1.80 
104 LEU  O     108 GLU  N       2.70 
105 LYS  O     109 GLN  H       1.80 
105 LYS  O     109 GLN  N       2.70 
106 GLU  O     110 LYS  H       1.80 
106 GLU  O     110 LYS  N       2.70 
107 THR  O     111 VAL  H       1.80 
107 THR  O     111 VAL  N       2.70 
108 GLU  O     112 LYS  H       1.80 
108 GLU  O     112 LYS  N       2.70 
109 GLN  O     113 ASP  H       1.80 
109 GLN  O     113 ASP  N       2.70 
110 LYS  O     114 ILE  H       1.80 
110 LYS  O     114 ILE  N       2.70 
Constrains/Cyana2.1 format/hbonds.upl0000600000373300001320000001345010525505364016622 0ustar  mandarnmr1 17 LEU  O      21 GLN  H       2.00 
 17 LEU  O      21 GLN  N       3.00 
 18 LEU  O      22 ALA  H       2.00 
 18 LEU  O      22 ALA  N       3.00 
 19 ILE  O      23 ASN  H       2.00 
 19 ILE  O      23 ASN  N       3.00 
 20 GLU  O      24 HIS  H       2.00 
 20 GLU  O      24 HIS  N       3.00 
 21 GLN  O      25 ALA  H       2.00 
 21 GLN  O      25 ALA  N       3.00 
 22 ALA  O      26 ILE  H       2.00 
 22 ALA  O      26 ILE  N       3.00 
 23 ASN  O      27 GLU  H       2.00 
 23 ASN  O      27 GLU  N       3.00 
 24 HIS  O      28 LYS  H       2.00 
 24 HIS  O      28 LYS  N       3.00 
 25 ALA  O      29 GLY  H       2.00 
 25 ALA  O      29 GLY  N       3.00 
 26 ILE  O      30 GLU  H       2.00 
 26 ILE  O      30 GLU  N       3.00 
 27 GLU  O      31 HIS  H       2.00 
 27 GLU  O      31 HIS  N       3.00 
 28 LYS  O      32 GLN  H       2.00 
 28 LYS  O      32 GLN  N       3.00 
 29 GLY  O      33 LEU  H       2.00 
 29 GLY  O      33 LEU  N       3.00 
 30 GLU  O      34 LEU  H       2.00 
 30 GLU  O      34 LEU  N       3.00 
 31 HIS  O      35 TYR  H       2.00 
 31 HIS  O      35 TYR  N       3.00 
 32 GLN  O      36 LEU  H       2.00 
 32 GLN  O      36 LEU  N       3.00 
 33 LEU  O      37 GLN  H       2.00 
 33 LEU  O      37 GLN  N       3.00 
 36 LEU  O      40 LEU  H       2.00 
 36 LEU  O      40 LEU  N       3.00 
 37 GLN  O      41 ASP  H       2.00 
 37 GLN  O      41 ASP  N       3.00 
 38 HIS  O      42 GLU  H       2.00 
 38 HIS  O      42 GLU  N       3.00 
 39 GLN  O      43 LEU  H       2.00 
 39 GLN  O      43 LEU  N       3.00 
 40 LEU  O      44 ASN  H       2.00 
 40 LEU  O      44 ASN  N       3.00 
 42 GLU  O      46 ASN  H       2.00 
 42 GLU  O      46 ASN  N       3.00 
 43 LEU  O      47 LYS  H       2.00 
 43 LEU  O      47 LYS  N       3.00 
 48 SER  O      52 GLN  H       2.00 
 48 SER  O      52 GLN  N       3.00 
 49 LYS  O      53 GLU  H       2.00 
 49 LYS  O      53 GLU  N       3.00 
 50 GLU  O      54 LYS  H       2.00 
 50 GLU  O      54 LYS  N       3.00 
 51 LEU  O      55 ILE  H       2.00 
 51 LEU  O      55 ILE  N       3.00 
 52 GLN  O      56 ILE  H       2.00 
 52 GLN  O      56 ILE  N       3.00 
 54 LYS  O      58 GLU  H       2.00 
 54 LYS  O      58 GLU  N       3.00 
 55 ILE  O      59 LEU  H       2.00 
 55 ILE  O      59 LEU  N       3.00 
 56 ILE  O      60 ASP  H       2.00 
 56 ILE  O      60 ASP  N       3.00 
 57 ARG  O      61 VAL  H       2.00 
 57 ARG  O      61 VAL  N       3.00 
 58 GLU  O      62 VAL  H       2.00 
 58 GLU  O      62 VAL  N       3.00 
 59 LEU  O      63 CYS  H       2.00 
 59 LEU  O      63 CYS  N       3.00 
 60 ASP  O      64 ALA  H       2.00 
 60 ASP  O      64 ALA  N       3.00 
 61 VAL  O      65 MET  H       2.00 
 61 VAL  O      65 MET  N       3.00 
 62 VAL  O      66 ILE  H       2.00 
 62 VAL  O      66 ILE  N       3.00 
 63 CYS  O      67 GLU  H       2.00 
 63 CYS  O      67 GLU  N       3.00 
 64 ALA  O      68 GLY  H       2.00 
 64 ALA  O      68 GLY  N       3.00 
 65 MET  O      69 ALA  H       2.00 
 65 MET  O      69 ALA  N       3.00 
 66 ILE  O      70 GLN  H       2.00 
 66 ILE  O      70 GLN  N       3.00 
 67 GLU  O      71 GLY  H       2.00 
 67 GLU  O      71 GLY  N       3.00 
 68 GLY  O      72 ALA  H       2.00 
 68 GLY  O      72 ALA  N       3.00 
 69 ALA  O      73 LEU  H       2.00 
 69 ALA  O      73 LEU  N       3.00 
 70 GLN  O      74 GLU  H       2.00 
 70 GLN  O      74 GLU  N       3.00 
 71 GLY  O      75 ARG  H       2.00 
 71 GLY  O      75 ARG  N       3.00 
 72 ALA  O      76 GLU  H       2.00 
 72 ALA  O      76 GLU  N       3.00 
 73 LEU  O      77 LEU  H       2.00 
 73 LEU  O      77 LEU  N       3.00 
 74 GLU  O      78 LYS  H       2.00 
 74 GLU  O      78 LYS  N       3.00 
 83 ASN  O      87 ARG  H       2.00 
 83 ASN  O      87 ARG  N       3.00 
 84 ILE  O      88 PHE  H       2.00 
 84 ILE  O      88 PHE  N       3.00 
 85 LEU  O      89 ASN  H       2.00 
 85 LEU  O      89 ASN  N       3.00 
 86 GLU  O      90 TYR  H       2.00 
 86 GLU  O      90 TYR  N       3.00 
 87 ARG  O      91 GLU  H       2.00 
 87 ARG  O      91 GLU  N       3.00 
 88 PHE  O      92 GLU  H       2.00 
 88 PHE  O      92 GLU  N       3.00 
 89 ASN  O      93 ALA  H       2.00 
 89 ASN  O      93 ALA  N       3.00 
 90 TYR  O      94 GLN  H       2.00 
 90 TYR  O      94 GLN  N       3.00 
 91 GLU  O      95 THR  H       2.00 
 91 GLU  O      95 THR  N       3.00 
 92 GLU  O      96 LEU  H       2.00 
 92 GLU  O      96 LEU  N       3.00 
 93 ALA  O      97 SER  H       2.00 
 93 ALA  O      97 SER  N       3.00 
 94 GLN  O      98 LYS  H       2.00 
 94 GLN  O      98 LYS  N       3.00 
 95 THR  O      99 ILE  H       2.00 
 95 THR  O      99 ILE  N       3.00 
 96 LEU  O     100 LEU  H       2.00 
 96 LEU  O     100 LEU  N       3.00 
 97 SER  O     101 LEU  H       2.00 
 97 SER  O     101 LEU  N       3.00 
 98 LYS  O     102 LYS  H       2.00 
 98 LYS  O     102 LYS  N       3.00 
 99 ILE  O     103 ASP  H       2.00 
 99 ILE  O     103 ASP  N       3.00 
100 LEU  O     104 LEU  H       2.00 
100 LEU  O     104 LEU  N       3.00 
101 LEU  O     105 LYS  H       2.00 
101 LEU  O     105 LYS  N       3.00 
102 LYS  O     106 GLU  H       2.00 
102 LYS  O     106 GLU  N       3.00 
103 ASP  O     107 THR  H       2.00 
103 ASP  O     107 THR  N       3.00 
104 LEU  O     108 GLU  H       2.00 
104 LEU  O     108 GLU  N       3.00 
105 LYS  O     109 GLN  H       2.00 
105 LYS  O     109 GLN  N       3.00 
106 GLU  O     110 LYS  H       2.00 
106 GLU  O     110 LYS  N       3.00 
107 THR  O     111 VAL  H       2.00 
107 THR  O     111 VAL  N       3.00 
108 GLU  O     112 LYS  H       2.00 
108 GLU  O     112 LYS  N       3.00 
109 GLN  O     113 ASP  H       2.00 
109 GLN  O     113 ASP  N       3.00 
110 LYS  O     114 ILE  H       2.00 
110 LYS  O     114 ILE  N       3.00 

  Entry H atom name         Submitted Coord H atom name
  Start of MODEL    1
    1    H    GLN   1           H        GLN   1   6.891   3.396 -22.943
    2    HA   GLN   1           HA       GLN   1   4.209   3.611 -21.777
    3    HB2  GLN   1           1HB      GLN   1   6.406   1.774 -20.936
    4    HB3  GLN   1           2HB      GLN   1   5.382   2.481 -19.694
    5    HG2  GLN   1           1HG      GLN   1   4.070   1.200 -22.028
    6    HG3  GLN   1           2HG      GLN   1   4.819   0.164 -20.815
    7   HE21  GLN   1          1HE2      GLN   1   2.332   2.525 -21.429
    8   HE22  GLN   1          2HE2      GLN   1   1.402   2.207 -20.008
    9    H    GLU   2           H        GLU   2   3.999   5.113 -20.153
   10    HA   GLU   2           HA       GLU   2   6.364   6.801 -19.683
   11    HB2  GLU   2           1HB      GLU   2   3.429   7.428 -19.837
   12    HB3  GLU   2           2HB      GLU   2   4.541   8.512 -19.013
   13    HG2  GLU   2           1HG      GLU   2   5.893   8.439 -21.201
   14    HG3  GLU   2           2HG      GLU   2   4.414   7.797 -21.913
   15    H    HIS   3           H        HIS   3   7.261   6.123 -17.824
   16    HA   HIS   3           HA       HIS   3   5.509   5.615 -15.521
   17    HD1  HIS   3           1HD      HIS   3   7.158   1.992 -14.767
   18    HD2  HIS   3           2HD      HIS   3   7.066   5.640 -12.782
   19    HE1  HIS   3           1HE      HIS   3   6.770   1.430 -12.347
   20    HB2  HIS   3           1HB      HIS   3   7.269   3.908 -16.336
   21    HB3  HIS   3           2HB      HIS   3   8.452   4.997 -15.618
   22    H    LYS   4           H        LYS   4   5.148   7.482 -14.479
   23    HA   LYS   4           HA       LYS   4   7.474   9.185 -13.862
   24    HB2  LYS   4           1HB      LYS   4   5.639  10.956 -13.457
   25    HB3  LYS   4           2HB      LYS   4   6.051  10.544 -15.117
   26    HG2  LYS   4           1HG      LYS   4   4.061   9.480 -15.495
   27    HG3  LYS   4           2HG      LYS   4   3.831   9.070 -13.793
   28    HD2  LYS   4           1HD      LYS   4   2.274  10.731 -14.004
   29    HD3  LYS   4           2HD      LYS   4   3.679  11.699 -13.548
   30    HE2  LYS   4           1HE      LYS   4   4.102  11.895 -16.075
   31    HE3  LYS   4           2HE      LYS   4   2.443  11.329 -16.259
   32    HZ1  LYS   4           3HZ      LYS   4   1.823  13.209 -14.720
   33    HZ2  LYS   4           1HZ      LYS   4   2.338  13.659 -16.268
   34    HZ3  LYS   4           2HZ      LYS   4   3.387  13.810 -14.949
   35    HA   PRO   5           HA       PRO   5   6.917   8.499  -9.563
   36    HB2  PRO   5           1HB      PRO   5   7.529  10.932  -8.527
   37    HB3  PRO   5           2HB      PRO   5   8.743   9.850  -9.220
   38    HG2  PRO   5           1HG      PRO   5   7.390  12.218 -10.455
   39    HG3  PRO   5           2HG      PRO   5   9.097  11.744 -10.522
   40    HD2  PRO   5           1HD      PRO   5   7.372  11.266 -12.554
   41    HD3  PRO   5           2HD      PRO   5   8.730  10.185 -12.179
   42    H    LYS   6           H        LYS   6   5.231   8.419  -8.207
   43    HA   LYS   6           HA       LYS   6   3.256  10.599  -8.273
   44    HB2  LYS   6           1HB      LYS   6   2.457   8.640  -9.584
   45    HB3  LYS   6           2HB      LYS   6   2.595   7.651  -8.136
   46    HG2  LYS   6           1HG      LYS   6   0.389   8.155  -8.017
   47    HG3  LYS   6           2HG      LYS   6   1.032   9.547  -7.143
   48    HD2  LYS   6           1HD      LYS   6   0.880   9.869 -10.062
   49    HD3  LYS   6           2HD      LYS   6  -0.677   9.705  -9.246
   50    HE2  LYS   6           1HE      LYS   6   1.376  11.579  -8.153
   51    HE3  LYS   6           2HE      LYS   6   0.419  12.060  -9.554
   52    HZ1  LYS   6           3HZ      LYS   6  -1.377  11.027  -7.740
   53    HZ2  LYS   6           1HZ      LYS   6  -1.154  12.657  -8.132
   54    HZ3  LYS   6           2HZ      LYS   6  -0.329  11.984  -6.818
   55    H    LYS   7           H        LYS   7   3.686  11.522  -6.341
   56    HA   LYS   7           HA       LYS   7   3.418   9.806  -3.963
   57    HB2  LYS   7           1HB      LYS   7   5.784  10.612  -4.421
   58    HB3  LYS   7           2HB      LYS   7   5.199  12.238  -4.094
   59    HG2  LYS   7           1HG      LYS   7   6.120  11.559  -2.074
   60    HG3  LYS   7           2HG      LYS   7   4.389  11.290  -1.856
   61    HD2  LYS   7           1HD      LYS   7   5.226   9.305  -1.065
   62    HD3  LYS   7           2HD      LYS   7   4.975   8.893  -2.763
   63    HE2  LYS   7           1HE      LYS   7   7.597  10.038  -1.929
   64    HE3  LYS   7           2HE      LYS   7   7.246   8.352  -1.547
   65    HZ1  LYS   7           3HZ      LYS   7   6.528   8.812  -4.211
   66    HZ2  LYS   7           1HZ      LYS   7   7.763   7.819  -3.616
   67    HZ3  LYS   7           2HZ      LYS   7   8.084   9.437  -3.987
   68    H    ASP   8           H        ASP   8   2.069  10.519  -2.399
   69    HA   ASP   8           HA       ASP   8   0.087  12.366  -2.924
   70    HB2  ASP   8           1HB      ASP   8   0.192  10.578  -1.084
   71    HB3  ASP   8           2HB      ASP   8   1.039  11.789  -0.124
   72    H    ASP   9           H        ASP   9   0.213  14.479  -3.235
   73    HA   ASP   9           HA       ASP   9   2.448  16.009  -2.236
   74    HB2  ASP   9           1HB      ASP   9   1.284  16.282  -4.519
   75    HB3  ASP   9           2HB      ASP   9   0.037  17.153  -3.630
   76    H    PHE  10           H        PHE  10  -1.043  15.855  -1.680
   77    HA   PHE  10           HA       PHE  10  -0.824  17.837   0.453
   78    HD1  PHE  10           1HD      PHE  10  -1.766  19.744   0.388
   79    HD2  PHE  10           2HD      PHE  10  -5.158  17.223   0.892
   80    HE1  PHE  10           1HE      PHE  10  -2.815  21.447   1.822
   81    HE2  PHE  10           2HE      PHE  10  -6.212  18.921   2.326
   82    HZ   PHE  10           HZ       PHE  10  -5.041  21.037   2.792
   83    HB2  PHE  10           1HB      PHE  10  -2.713  17.722  -1.338
   84    HB3  PHE  10           2HB      PHE  10  -3.372  16.449  -0.315
   85    H    ARG  11           H        ARG  11   0.438  16.461   1.849
   86    HA   ARG  11           HA       ARG  11  -0.726  14.029   2.862
   87    HE   ARG  11           HE       ARG  11   3.243  11.056   5.192
   88    HB2  ARG  11           1HB      ARG  11   1.779  14.583   2.631
   89    HB3  ARG  11           2HB      ARG  11   1.574  15.513   4.109
   90    HG2  ARG  11           1HG      ARG  11   1.196  13.639   5.397
   91    HG3  ARG  11           2HG      ARG  11   0.687  12.666   4.016
   92    HD2  ARG  11           1HD      ARG  11   2.864  12.290   3.316
   93    HD3  ARG  11           2HD      ARG  11   3.488  13.699   4.172
   94   HH11  ARG  11          1HH1      ARG  11   3.058  14.413   6.094
   95   HH12  ARG  11          2HH1      ARG  11   3.483  14.125   7.749
   96   HH21  ARG  11          1HH2      ARG  11   3.804  10.665   7.367
   97   HH22  ARG  11          2HH2      ARG  11   3.908  11.994   8.472
   98    H    ASN  12           H        ASN  12  -0.001  17.237   4.232
   99    HA   ASN  12           HA       ASN  12  -1.075  16.841   6.761
  100    HB2  ASN  12           1HB      ASN  12  -0.841  19.322   5.061
  101    HB3  ASN  12           2HB      ASN  12  -1.453  19.368   6.713
  102   HD21  ASN  12          1HD2      ASN  12   1.118  20.154   5.105
  103   HD22  ASN  12          2HD2      ASN  12   2.380  19.716   6.202
  104    H    GLU  13           H        GLU  13  -3.022  15.912   7.028
  105    HA   GLU  13           HA       GLU  13  -5.297  16.931   5.480
  106    HB2  GLU  13           1HB      GLU  13  -4.676  14.408   5.711
  107    HB3  GLU  13           2HB      GLU  13  -5.429  14.546   7.293
  108    HG2  GLU  13           1HG      GLU  13  -7.513  15.234   6.282
  109    HG3  GLU  13           2HG      GLU  13  -6.770  15.218   4.684
  110    H    PHE  14           H        PHE  14  -4.627  18.785   7.209
  111    HA   PHE  14           HA       PHE  14  -5.537  18.579   9.844
  112    HD1  PHE  14           1HD      PHE  14  -4.353  20.292  11.534
  113    HD2  PHE  14           2HD      PHE  14  -2.925  20.803   7.558
  114    HE1  PHE  14           1HE      PHE  14  -2.042  20.351  12.376
  115    HE2  PHE  14           2HE      PHE  14  -0.611  20.862   8.393
  116    HZ   PHE  14           HZ       PHE  14  -0.167  20.636  10.805
  117    HB2  PHE  14           1HB      PHE  14  -5.207  20.918   7.980
  118    HB3  PHE  14           2HB      PHE  14  -5.810  21.131   9.620
  119    H    ASP  15           H        ASP  15  -7.212  19.872   6.981
  120    HA   ASP  15           HA       ASP  15  -9.631  20.515   8.169
  121    HB2  ASP  15           1HB      ASP  15 -10.619  20.154   5.884
  122    HB3  ASP  15           2HB      ASP  15  -9.201  21.198   5.913
  123    H    HIS  16           H        HIS  16  -8.371  17.402   7.221
  124    HA   HIS  16           HA       HIS  16  -9.142  15.275   7.476
  125    HD1  HIS  16           1HD      HIS  16  -8.176  13.765   9.342
  126    HD2  HIS  16           2HD      HIS  16 -12.190  13.977  10.394
  127    HE1  HIS  16           1HE      HIS  16  -8.784  11.459  10.140
  128    HB2  HIS  16           1HB      HIS  16  -9.296  16.281   9.867
  129    HB3  HIS  16           2HB      HIS  16 -11.034  16.275   9.583
  130    H    LEU  17           H        LEU  17 -10.335  16.610   5.402
  131    HA   LEU  17           HA       LEU  17 -13.159  16.588   5.447
  132    HG   LEU  17           HG       LEU  17 -12.229  18.823   4.302
  133    HB2  LEU  17           1HB      LEU  17 -11.041  16.827   3.415
  134    HB3  LEU  17           2HB      LEU  17 -12.587  16.216   2.829
  135   HD11  LEU  17          1HD1      LEU  17 -12.144  18.124   1.406
  136   HD12  LEU  17          2HD1      LEU  17 -11.187  19.294   2.313
  137   HD13  LEU  17          3HD1      LEU  17 -12.863  19.656   1.903
  138   HD21  LEU  17          3HD2      LEU  17 -14.549  17.341   3.187
  139   HD22  LEU  17          1HD2      LEU  17 -14.533  19.097   3.028
  140   HD23  LEU  17          2HD2      LEU  17 -14.436  18.356   4.626
  141    H    LEU  18           H        LEU  18 -14.631  15.108   4.540
  142    HA   LEU  18           HA       LEU  18 -14.228  12.429   5.163
  143    HG   LEU  18           HG       LEU  18 -16.510  14.826   5.060
  144    HB2  LEU  18           1HB      LEU  18 -16.160  13.439   3.088
  145    HB3  LEU  18           2HB      LEU  18 -16.301  11.983   4.072
  146   HD11  LEU  18          1HD1      LEU  18 -18.396  13.583   3.675
  147   HD12  LEU  18          2HD1      LEU  18 -18.773  14.610   5.058
  148   HD13  LEU  18          3HD1      LEU  18 -18.720  12.858   5.249
  149   HD21  LEU  18          3HD2      LEU  18 -15.727  13.799   6.934
  150   HD22  LEU  18          1HD2      LEU  18 -16.297  12.206   6.437
  151   HD23  LEU  18          2HD2      LEU  18 -17.435  13.386   7.088
  152    H    ILE  19           H        ILE  19 -14.471  13.819   1.883
  153    HA   ILE  19           HA       ILE  19 -13.688  11.534   0.495
  154    HB   ILE  19           HB       ILE  19 -13.387  14.445  -0.230
  155   HG12  ILE  19          1HG1      ILE  19 -15.691  13.581   0.010
  156   HG13  ILE  19          2HG1      ILE  19 -15.323  14.031  -1.651
  157   HG21  ILE  19          1HG2      ILE  19 -13.333  13.160  -2.606
  158   HG22  ILE  19          2HG2      ILE  19 -11.895  13.702  -1.741
  159   HG23  ILE  19          3HG2      ILE  19 -12.430  12.028  -1.601
  160   HD11  ILE  19          3HD1      ILE  19 -15.974  12.027  -2.303
  161   HD12  ILE  19          1HD1      ILE  19 -14.659  11.309  -1.373
  162   HD13  ILE  19          2HD1      ILE  19 -16.241  11.542  -0.629
  163    H    GLU  20           H        GLU  20 -11.765  14.043   2.025
  164    HA   GLU  20           HA       GLU  20  -9.280  13.461   0.880
  165    HB2  GLU  20           1HB      GLU  20 -10.172  14.752   3.421
  166    HB3  GLU  20           2HB      GLU  20  -8.474  14.332   3.245
  167    HG2  GLU  20           1HG      GLU  20  -9.949  15.964   1.204
  168    HG3  GLU  20           2HG      GLU  20  -9.147  16.682   2.599
  169    H    GLN  21           H        GLN  21 -10.648  12.315   3.966
  170    HA   GLN  21           HA       GLN  21  -8.531  10.558   4.572
  171    HB2  GLN  21           1HB      GLN  21 -10.323  11.431   6.149
  172    HB3  GLN  21           2HB      GLN  21 -11.392  10.216   5.463
  173    HG2  GLN  21           1HG      GLN  21 -10.309   9.564   7.605
  174    HG3  GLN  21           2HG      GLN  21 -10.033   8.445   6.270
  175   HE21  GLN  21          1HE2      GLN  21  -8.155   7.584   7.035
  176   HE22  GLN  21          2HE2      GLN  21  -6.683   8.477   7.178
  177    H    ALA  22           H        ALA  22 -11.561  10.109   2.822
  178    HA   ALA  22           HA       ALA  22 -11.432   7.307   2.574
  179    HB1  ALA  22           3HB      ALA  22 -12.931   7.744   0.543
  180    HB2  ALA  22           1HB      ALA  22 -13.514   8.265   2.124
  181    HB3  ALA  22           2HB      ALA  22 -12.832   9.444   1.002
  182    H    ASN  23           H        ASN  23 -10.397   9.896   0.360
  183    HA   ASN  23           HA       ASN  23  -9.425   8.233  -1.676
  184    HB2  ASN  23           1HB      ASN  23  -9.207  11.070  -0.946
  185    HB3  ASN  23           2HB      ASN  23  -7.824  10.455  -1.845
  186   HD21  ASN  23          1HD2      ASN  23 -11.361  10.133  -1.920
  187   HD22  ASN  23          2HD2      ASN  23 -11.513  10.358  -3.627
  188    H    HIS  24           H        HIS  24  -7.828   9.603   1.170
  189    HA   HIS  24           HA       HIS  24  -5.228   8.683   0.559
  190    HD1  HIS  24           1HD      HIS  24  -4.277  10.298   4.779
  191    HD2  HIS  24           2HD      HIS  24  -3.143   8.760   1.089
  192    HE1  HIS  24           1HE      HIS  24  -1.763  10.239   4.819
  193    HB2  HIS  24           1HB      HIS  24  -6.041  10.421   2.332
  194    HB3  HIS  24           2HB      HIS  24  -6.187   9.014   3.383
  195    H    ALA  25           H        ALA  25  -7.922   7.251   2.324
  196    HA   ALA  25           HA       ALA  25  -6.517   5.015   3.338
  197    HB1  ALA  25           3HB      ALA  25  -9.375   5.753   3.010
  198    HB2  ALA  25           1HB      ALA  25  -8.983   4.058   3.301
  199    HB3  ALA  25           2HB      ALA  25  -8.483   5.292   4.459
  200    H    ILE  26           H        ILE  26  -8.639   5.370   0.497
  201    HA   ILE  26           HA       ILE  26  -8.310   2.733  -0.440
  202    HB   ILE  26           HB       ILE  26  -9.204   3.536  -2.567
  203   HG12  ILE  26          1HG1      ILE  26  -8.895   6.286  -1.342
  204   HG13  ILE  26          2HG1      ILE  26  -7.995   5.655  -2.718
  205   HG21  ILE  26          1HG2      ILE  26 -11.343   4.301  -1.773
  206   HG22  ILE  26          2HG2      ILE  26 -10.701   3.113  -0.638
  207   HG23  ILE  26          3HG2      ILE  26 -10.630   4.833  -0.250
  208   HD11  ILE  26          3HD1      ILE  26 -10.654   5.349  -3.434
  209   HD12  ILE  26          1HD1      ILE  26 -10.586   6.916  -2.626
  210   HD13  ILE  26          2HD1      ILE  26  -9.536   6.588  -4.004
  211    H    GLU  27           H        GLU  27  -6.463   5.672  -0.926
  212    HA   GLU  27           HA       GLU  27  -4.901   4.771  -3.104
  213    HB2  GLU  27           1HB      GLU  27  -4.728   6.985  -1.126
  214    HB3  GLU  27           2HB      GLU  27  -3.259   6.561  -1.993
  215    HG2  GLU  27           1HG      GLU  27  -5.820   7.074  -3.453
  216    HG3  GLU  27           2HG      GLU  27  -4.769   8.398  -2.951
  217    H    LYS  28           H        LYS  28  -4.147   4.971   0.373
  218    HA   LYS  28           HA       LYS  28  -1.640   3.742   0.247
  219    HB2  LYS  28           1HB      LYS  28  -2.985   4.942   2.211
  220    HB3  LYS  28           2HB      LYS  28  -3.349   3.275   2.641
  221    HG2  LYS  28           1HG      LYS  28  -0.721   3.035   2.321
  222    HG3  LYS  28           2HG      LYS  28  -0.785   4.749   2.738
  223    HD2  LYS  28           1HD      LYS  28  -0.600   3.819   4.826
  224    HD3  LYS  28           2HD      LYS  28  -2.356   3.889   4.663
  225    HE2  LYS  28           1HE      LYS  28  -2.139   1.724   5.341
  226    HE3  LYS  28           2HE      LYS  28  -1.978   1.490   3.601
  227    HZ1  LYS  28           3HZ      LYS  28   0.419   1.499   3.849
  228    HZ2  LYS  28           1HZ      LYS  28  -0.265   0.306   4.835
  229    HZ3  LYS  28           2HZ      LYS  28   0.278   1.756   5.516
  230    H    GLY  29           H        GLY  29  -4.822   2.316   0.986
  231    HA2  GLY  29           1HA      GLY  29  -3.988  -0.316   1.358
  232    HA3  GLY  29           2HA      GLY  29  -5.586   0.160   0.802
  233    H    GLU  30           H        GLU  30  -5.168   1.205  -1.641
  234    HA   GLU  30           HA       GLU  30  -4.963  -1.010  -3.300
  235    HB2  GLU  30           1HB      GLU  30  -5.950   1.315  -3.786
  236    HB3  GLU  30           2HB      GLU  30  -4.314   1.778  -4.232
  237    HG2  GLU  30           1HG      GLU  30  -4.651  -0.521  -5.655
  238    HG3  GLU  30           2HG      GLU  30  -6.275   0.163  -5.676
  239    H    HIS  31           H        HIS  31  -2.530   1.509  -2.667
  240    HA   HIS  31           HA       HIS  31  -0.518   0.565  -4.330
  241    HD1  HIS  31           1HD      HIS  31   1.989   1.017  -0.943
  242    HD2  HIS  31           2HD      HIS  31   1.997   2.622  -4.775
  243    HE1  HIS  31           1HE      HIS  31   4.411   1.163  -1.606
  244    HB2  HIS  31           1HB      HIS  31  -0.372   2.735  -3.245
  245    HB3  HIS  31           2HB      HIS  31  -0.275   1.970  -1.661
  246    H    GLN  32           H        GLN  32  -1.078  -0.187  -0.895
  247    HA   GLN  32           HA       GLN  32   1.067  -1.927  -0.534
  248    HB2  GLN  32           1HB      GLN  32  -1.643  -2.151   0.782
  249    HB3  GLN  32           2HB      GLN  32  -0.116  -2.765   1.401
  250    HG2  GLN  32           1HG      GLN  32   0.057   0.058   0.872
  251    HG3  GLN  32           2HG      GLN  32  -1.298  -0.304   1.941
  252   HE21  GLN  32          1HE2      GLN  32  -0.436  -2.346   3.433
  253   HE22  GLN  32          2HE2      GLN  32   0.952  -1.897   4.357
  254    H    LEU  33           H        LEU  33  -2.204  -2.557  -1.717
  255    HA   LEU  33           HA       LEU  33  -2.002  -5.363  -1.835
  256    HG   LEU  33           HG       LEU  33  -5.310  -5.476  -3.441
  257    HB2  LEU  33           1HB      LEU  33  -4.128  -4.174  -1.946
  258    HB3  LEU  33           2HB      LEU  33  -3.669  -3.482  -3.501
  259   HD11  LEU  33          1HD1      LEU  33  -4.879  -5.312  -5.608
  260   HD12  LEU  33          2HD1      LEU  33  -3.511  -6.402  -5.391
  261   HD13  LEU  33          3HD1      LEU  33  -3.275  -4.658  -5.278
  262   HD21  LEU  33          3HD2      LEU  33  -3.506  -6.708  -1.951
  263   HD22  LEU  33          1HD2      LEU  33  -2.877  -7.178  -3.531
  264   HD23  LEU  33          2HD2      LEU  33  -4.532  -7.591  -3.083
  265    H    LEU  34           H        LEU  34  -1.425  -2.863  -4.292
  266    HA   LEU  34           HA       LEU  34  -0.823  -4.541  -6.434
  267    HG   LEU  34           HG       LEU  34  -2.287  -2.277  -6.841
  268    HB2  LEU  34           1HB      LEU  34  -0.094  -1.744  -5.704
  269    HB3  LEU  34           2HB      LEU  34   0.706  -2.504  -7.078
  270   HD11  LEU  34          1HD1      LEU  34  -1.356  -0.037  -6.818
  271   HD12  LEU  34          2HD1      LEU  34  -2.115  -0.371  -8.374
  272   HD13  LEU  34          3HD1      LEU  34  -0.358  -0.416  -8.223
  273   HD21  LEU  34          3HD2      LEU  34  -2.322  -3.462  -8.717
  274   HD22  LEU  34          1HD2      LEU  34  -0.576  -3.680  -8.586
  275   HD23  LEU  34          2HD2      LEU  34  -1.228  -2.317  -9.496
  276    H    TYR  35           H        TYR  35   1.307  -3.186  -3.943
  277    HA   TYR  35           HA       TYR  35   3.675  -4.378  -4.999
  278    HD1  TYR  35           2HD      TYR  35   3.727  -4.660  -0.759
  279    HD2  TYR  35           1HD      TYR  35   6.344  -3.281  -3.816
  280    HE1  TYR  35           2HE      TYR  35   5.644  -5.581   0.475
  281    HE2  TYR  35           1HE      TYR  35   8.269  -4.198  -2.590
  282    HH   TYR  35           HH       TYR  35   7.875  -6.251   0.177
  283    HB2  TYR  35           1HB      TYR  35   4.061  -2.478  -3.683
  284    HB3  TYR  35           2HB      TYR  35   2.979  -3.027  -2.406
  285    H    LEU  36           H        LEU  36   1.259  -5.324  -2.645
  286    HA   LEU  36           HA       LEU  36   2.698  -7.501  -1.530
  287    HG   LEU  36           HG       LEU  36   1.627  -5.825   0.129
  288    HB2  LEU  36           1HB      LEU  36  -0.180  -6.688  -1.584
  289    HB3  LEU  36           2HB      LEU  36   0.286  -8.262  -0.943
  290   HD11  LEU  36          1HD1      LEU  36  -1.228  -6.316   0.241
  291   HD12  LEU  36          2HD1      LEU  36  -0.301  -4.903   0.746
  292   HD13  LEU  36          3HD1      LEU  36  -0.493  -6.269   1.845
  293   HD21  LEU  36          3HD2      LEU  36   2.232  -8.204   0.730
  294   HD22  LEU  36          1HD2      LEU  36   0.662  -8.307   1.528
  295   HD23  LEU  36          2HD2      LEU  36   1.857  -7.135   2.084
  296    H    GLN  37           H        GLN  37   0.702  -7.118  -4.362
  297    HA   GLN  37           HA       GLN  37  -0.019  -9.717  -4.933
  298    HB2  GLN  37           1HB      GLN  37   0.645  -7.352  -6.641
  299    HB3  GLN  37           2HB      GLN  37   0.365  -8.911  -7.406
  300    HG2  GLN  37           1HG      GLN  37  -1.605  -7.749  -5.474
  301    HG3  GLN  37           2HG      GLN  37  -1.604  -7.297  -7.178
  302   HE21  GLN  37          1HE2      GLN  37  -3.360  -8.971  -5.263
  303   HE22  GLN  37          2HE2      GLN  37  -3.713 -10.381  -6.197
  304    H    HIS  38           H        HIS  38   3.046  -8.084  -5.641
  305    HA   HIS  38           HA       HIS  38   4.265 -10.120  -7.106
  306    HD1  HIS  38           1HD      HIS  38   5.618  -8.202  -8.979
  307    HD2  HIS  38           2HD      HIS  38   8.194  -9.802  -6.139
  308    HE1  HIS  38           1HE      HIS  38   7.675  -8.893 -10.251
  309    HB2  HIS  38           1HB      HIS  38   5.017  -7.647  -6.469
  310    HB3  HIS  38           2HB      HIS  38   5.934  -8.508  -5.236
  311    H    GLN  39           H        GLN  39   4.548  -9.434  -3.618
  312    HA   GLN  39           HA       GLN  39   6.143 -11.611  -2.945
  313    HB2  GLN  39           1HB      GLN  39   4.003 -10.339  -1.231
  314    HB3  GLN  39           2HB      GLN  39   5.369 -11.287  -0.659
  315    HG2  GLN  39           1HG      GLN  39   5.462  -8.593  -1.993
  316    HG3  GLN  39           2HG      GLN  39   5.825  -8.965  -0.309
  317   HE21  GLN  39          1HE2      GLN  39   7.522  -7.660  -2.214
  318   HE22  GLN  39          2HE2      GLN  39   8.936  -8.638  -2.386
  319    H    LEU  40           H        LEU  40   2.658 -11.384  -3.345
  320    HA   LEU  40           HA       LEU  40   1.997 -13.899  -2.251
  321    HG   LEU  40           HG       LEU  40  -0.133 -14.655  -4.283
  322    HB2  LEU  40           1HB      LEU  40   0.295 -12.250  -2.554
  323    HB3  LEU  40           2HB      LEU  40   0.612 -12.166  -4.285
  324   HD11  LEU  40          1HD1      LEU  40  -1.641 -15.304  -2.565
  325   HD12  LEU  40          2HD1      LEU  40  -1.571 -13.711  -1.814
  326   HD13  LEU  40          3HD1      LEU  40  -0.158 -14.764  -1.779
  327   HD21  LEU  40          3HD2      LEU  40  -2.588 -13.288  -3.834
  328   HD22  LEU  40          1HD2      LEU  40  -1.840 -13.744  -5.365
  329   HD23  LEU  40          2HD2      LEU  40  -1.469 -12.183  -4.632
  330    H    ASP  41           H        ASP  41   2.677 -12.864  -5.574
  331    HA   ASP  41           HA       ASP  41   2.205 -15.337  -6.817
  332    HB2  ASP  41           1HB      ASP  41   2.417 -13.188  -8.032
  333    HB3  ASP  41           2HB      ASP  41   4.140 -13.171  -7.665
  334    H    GLU  42           H        GLU  42   5.177 -13.922  -5.493
  335    HA   GLU  42           HA       GLU  42   6.844 -16.106  -6.225
  336    HB2  GLU  42           1HB      GLU  42   7.870 -13.982  -5.836
  337    HB3  GLU  42           2HB      GLU  42   7.177 -13.873  -4.226
  338    HG2  GLU  42           1HG      GLU  42   8.742 -15.220  -3.305
  339    HG3  GLU  42           2HG      GLU  42   8.927 -16.190  -4.765
  340    H    LEU  43           H        LEU  43   5.058 -15.256  -3.303
  341    HA   LEU  43           HA       LEU  43   6.100 -17.358  -1.701
  342    HG   LEU  43           HG       LEU  43   4.015 -16.148   1.083
  343    HB2  LEU  43           1HB      LEU  43   5.028 -15.288  -0.832
  344    HB3  LEU  43           2HB      LEU  43   3.478 -15.904  -1.398
  345   HD11  LEU  43          1HD1      LEU  43   3.424 -18.861   0.376
  346   HD12  LEU  43          2HD1      LEU  43   2.591 -17.757  -0.718
  347   HD13  LEU  43          3HD1      LEU  43   2.356 -17.615   1.023
  348   HD21  LEU  43          3HD2      LEU  43   6.370 -17.107   0.341
  349   HD22  LEU  43          1HD2      LEU  43   5.480 -18.630   0.368
  350   HD23  LEU  43          2HD2      LEU  43   5.574 -17.638   1.823
  351    H    ASN  44           H        ASN  44   3.459 -17.104  -3.966
  352    HA   ASN  44           HA       ASN  44   1.887 -19.263  -3.252
  353    HB2  ASN  44           1HB      ASN  44   2.254 -17.614  -5.586
  354    HB3  ASN  44           2HB      ASN  44   2.012 -19.291  -6.068
  355   HD21  ASN  44          1HD2      ASN  44   0.677 -16.766  -3.988
  356   HD22  ASN  44          2HD2      ASN  44  -0.971 -17.257  -4.154
  357    H    GLU  45           H        GLU  45   4.773 -19.234  -5.324
  358    HA   GLU  45           HA       GLU  45   4.742 -22.139  -5.484
  359    HB2  GLU  45           1HB      GLU  45   6.401 -19.992  -6.778
  360    HB3  GLU  45           2HB      GLU  45   6.879 -21.682  -6.858
  361    HG2  GLU  45           1HG      GLU  45   4.906 -22.270  -8.043
  362    HG3  GLU  45           2HG      GLU  45   4.193 -20.683  -7.763
  363    H    ASN  46           H        ASN  46   6.880 -19.565  -4.290
  364    HA   ASN  46           HA       ASN  46   8.955 -21.103  -3.313
  365    HB2  ASN  46           1HB      ASN  46   8.822 -18.578  -3.393
  366    HB3  ASN  46           2HB      ASN  46   7.863 -18.655  -1.917
  367   HD21  ASN  46          1HD2      ASN  46   9.830 -17.232  -1.403
  368   HD22  ASN  46          2HD2      ASN  46  11.164 -18.046  -0.665
  369    H    LYS  47           H        LYS  47   5.816 -20.438  -1.875
  370    HA   LYS  47           HA       LYS  47   4.780 -21.220   0.002
  371    HB2  LYS  47           1HB      LYS  47   6.462 -23.664  -0.585
  372    HB3  LYS  47           2HB      LYS  47   5.004 -23.624   0.396
  373    HG2  LYS  47           1HG      LYS  47   4.867 -22.680  -2.423
  374    HG3  LYS  47           2HG      LYS  47   4.927 -24.414  -2.095
  375    HD2  LYS  47           1HD      LYS  47   3.034 -23.796  -0.361
  376    HD3  LYS  47           2HD      LYS  47   2.810 -22.423  -1.447
  377    HE2  LYS  47           1HE      LYS  47   1.342 -24.227  -2.102
  378    HE3  LYS  47           2HE      LYS  47   2.581 -23.995  -3.335
  379    HZ1  LYS  47           3HZ      LYS  47   1.956 -26.334  -1.963
  380    HZ2  LYS  47           1HZ      LYS  47   3.498 -25.865  -1.447
  381    HZ3  LYS  47           2HZ      LYS  47   3.191 -26.094  -3.094
  382    H    SER  48           H        SER  48   7.125 -19.688   0.495
  383    HA   SER  48           HA       SER  48   8.746 -20.938   2.479
  384    HG   SER  48           HG       SER  48  10.782 -19.492   2.387
  385    HB2  SER  48           1HB      SER  48   8.498 -18.260   1.279
  386    HB3  SER  48           2HB      SER  48   9.044 -18.263   2.955
  387    H    LYS  49           H        LYS  49   8.347 -21.248   4.565
  388    HA   LYS  49           HA       LYS  49   5.849 -20.665   5.726
  389    HB2  LYS  49           1HB      LYS  49   6.929 -21.401   7.856
  390    HB3  LYS  49           2HB      LYS  49   7.117 -22.538   6.528
  391    HG2  LYS  49           1HG      LYS  49   9.362 -21.011   6.275
  392    HG3  LYS  49           2HG      LYS  49   9.132 -21.043   8.025
  393    HD2  LYS  49           1HD      LYS  49   9.494 -23.291   8.169
  394    HD3  LYS  49           2HD      LYS  49   8.851 -23.607   6.556
  395    HE2  LYS  49           1HE      LYS  49  10.982 -22.266   5.802
  396    HE3  LYS  49           2HE      LYS  49  11.585 -22.754   7.385
  397    HZ1  LYS  49           3HZ      LYS  49  11.842 -24.855   6.717
  398    HZ2  LYS  49           1HZ      LYS  49  11.741 -24.242   5.143
  399    HZ3  LYS  49           2HZ      LYS  49  10.367 -24.892   5.888
  400    H    GLU  50           H        GLU  50   9.018 -19.115   6.036
  401    HA   GLU  50           HA       GLU  50   8.218 -17.233   8.004
  402    HB2  GLU  50           1HB      GLU  50  10.504 -17.132   6.027
  403    HB3  GLU  50           2HB      GLU  50  10.308 -16.050   7.399
  404    HG2  GLU  50           1HG      GLU  50  10.351 -18.099   8.866
  405    HG3  GLU  50           2HG      GLU  50  10.854 -19.002   7.437
  406    H    LEU  51           H        LEU  51   8.753 -16.904   4.496
  407    HA   LEU  51           HA       LEU  51   7.976 -14.248   4.240
  408    HG   LEU  51           HG       LEU  51   6.326 -14.777   1.400
  409    HB2  LEU  51           1HB      LEU  51   9.072 -15.434   2.450
  410    HB3  LEU  51           2HB      LEU  51   7.702 -16.532   2.293
  411   HD11  LEU  51          1HD1      LEU  51   8.664 -12.987   2.021
  412   HD12  LEU  51          2HD1      LEU  51   7.025 -12.887   2.662
  413   HD13  LEU  51          3HD1      LEU  51   7.330 -12.524   0.962
  414   HD21  LEU  51          3HD2      LEU  51   8.994 -14.556   0.028
  415   HD22  LEU  51          1HD2      LEU  51   7.385 -14.453  -0.688
  416   HD23  LEU  51          2HD2      LEU  51   7.980 -15.996  -0.072
  417    H    GLN  52           H        GLN  52   6.033 -17.182   4.319
  418    HA   GLN  52           HA       GLN  52   3.583 -15.961   3.573
  419    HB2  GLN  52           1HB      GLN  52   3.782 -18.329   3.340
  420    HB3  GLN  52           2HB      GLN  52   4.218 -18.523   5.032
  421    HG2  GLN  52           1HG      GLN  52   2.078 -18.426   5.740
  422    HG3  GLN  52           2HG      GLN  52   1.601 -17.278   4.490
  423   HE21  GLN  52          1HE2      GLN  52   1.594 -20.507   5.485
  424   HE22  GLN  52          2HE2      GLN  52   0.930 -21.205   4.051
  425    H    GLU  53           H        GLU  53   4.762 -17.059   6.759
  426    HA   GLU  53           HA       GLU  53   2.687 -16.090   8.306
  427    HB2  GLU  53           1HB      GLU  53   5.518 -16.787   8.780
  428    HB3  GLU  53           2HB      GLU  53   4.790 -15.729   9.980
  429    HG2  GLU  53           1HG      GLU  53   3.247 -17.318  10.640
  430    HG3  GLU  53           2HG      GLU  53   3.392 -18.230   9.139
  431    H    LYS  54           H        LYS  54   5.445 -14.389   6.966
  432    HA   LYS  54           HA       LYS  54   5.095 -11.989   8.453
  433    HB2  LYS  54           1HB      LYS  54   6.570 -12.645   5.909
  434    HB3  LYS  54           2HB      LYS  54   6.523 -11.014   6.565
  435    HG2  LYS  54           1HG      LYS  54   7.394 -13.279   8.300
  436    HG3  LYS  54           2HG      LYS  54   8.512 -12.587   7.122
  437    HD2  LYS  54           1HD      LYS  54   7.009 -10.880   9.087
  438    HD3  LYS  54           2HD      LYS  54   8.556 -11.629   9.491
  439    HE2  LYS  54           1HE      LYS  54   9.423 -10.538   7.339
  440    HE3  LYS  54           2HE      LYS  54   7.956  -9.561   7.397
  441    HZ1  LYS  54           3HZ      LYS  54   9.147  -8.211   8.687
  442    HZ2  LYS  54           1HZ      LYS  54  10.346  -9.368   8.978
  443    HZ3  LYS  54           2HZ      LYS  54   8.936  -9.357   9.913
  444    H    ILE  55           H        ILE  55   4.333 -12.818   5.069
  445    HA   ILE  55           HA       ILE  55   3.060 -10.450   4.373
  446    HB   ILE  55           HB       ILE  55   2.464 -13.243   3.394
  447   HG12  ILE  55          1HG1      ILE  55   4.028 -11.177   1.892
  448   HG13  ILE  55          2HG1      ILE  55   4.821 -12.103   3.162
  449   HG21  ILE  55          1HG2      ILE  55   1.626 -11.986   1.356
  450   HG22  ILE  55          2HG2      ILE  55   0.600 -11.938   2.789
  451   HG23  ILE  55          3HG2      ILE  55   1.606 -10.549   2.379
  452   HD11  ILE  55          3HD1      ILE  55   4.296 -14.168   2.016
  453   HD12  ILE  55          1HD1      ILE  55   3.422 -13.276   0.771
  454   HD13  ILE  55          2HD1      ILE  55   5.166 -13.070   0.943
  455    H    ILE  56           H        ILE  56   1.781 -13.309   5.992
  456    HA   ILE  56           HA       ILE  56  -0.942 -12.626   5.904
  457    HB   ILE  56           HB       ILE  56   0.544 -14.239   7.981
  458   HG12  ILE  56          1HG1      ILE  56  -1.203 -15.389   5.840
  459   HG13  ILE  56          2HG1      ILE  56   0.437 -14.897   5.431
  460   HG21  ILE  56          1HG2      ILE  56  -2.404 -13.934   7.447
  461   HG22  ILE  56          2HG2      ILE  56  -1.711 -15.222   8.432
  462   HG23  ILE  56          3HG2      ILE  56  -1.532 -13.539   8.928
  463   HD11  ILE  56          3HD1      ILE  56  -0.066 -16.697   7.761
  464   HD12  ILE  56          1HD1      ILE  56  -0.018 -17.337   6.119
  465   HD13  ILE  56          2HD1      ILE  56   1.390 -16.510   6.784
  466    H    ARG  57           H        ARG  57   1.564 -11.929   8.316
  467    HA   ARG  57           HA       ARG  57  -0.115 -10.642  10.176
  468    HE   ARG  57           HE       ARG  57   1.236 -12.676  13.621
  469    HB2  ARG  57           1HB      ARG  57   2.754 -11.000   9.767
  470    HB3  ARG  57           2HB      ARG  57   2.359  -9.441  10.479
  471    HG2  ARG  57           1HG      ARG  57   2.758 -10.936  12.266
  472    HG3  ARG  57           2HG      ARG  57   1.014 -10.679  12.198
  473    HD2  ARG  57           1HD      ARG  57   0.935 -12.795  10.772
  474    HD3  ARG  57           2HD      ARG  57   2.591 -13.075  11.308
  475   HH11  ARG  57          1HH1      ARG  57   0.778 -14.789  10.892
  476   HH12  ARG  57          2HH1      ARG  57   0.031 -16.044  11.823
  477   HH21  ARG  57          1HH2      ARG  57   0.252 -14.321  14.858
  478   HH22  ARG  57          2HH2      ARG  57  -0.269 -15.776  14.079
  479    H    GLU  58           H        GLU  58   2.039  -9.281   7.682
  480    HA   GLU  58           HA       GLU  58   1.350  -6.595   8.104
  481    HB2  GLU  58           1HB      GLU  58   3.226  -7.773   6.629
  482    HB3  GLU  58           2HB      GLU  58   2.043  -7.510   5.355
  483    HG2  GLU  58           1HG      GLU  58   2.027  -5.072   6.390
  484    HG3  GLU  58           2HG      GLU  58   3.646  -5.552   6.893
  485    H    LEU  59           H        LEU  59   0.086  -8.959   5.768
  486    HA   LEU  59           HA       LEU  59  -1.771  -7.228   4.550
  487    HG   LEU  59           HG       LEU  59  -3.884  -9.074   3.501
  488    HB2  LEU  59           1HB      LEU  59  -0.914  -9.521   3.779
  489    HB3  LEU  59           2HB      LEU  59  -2.167 -10.189   4.823
  490   HD11  LEU  59          1HD1      LEU  59  -1.522  -7.974   2.011
  491   HD12  LEU  59          2HD1      LEU  59  -2.871  -7.101   2.739
  492   HD13  LEU  59          3HD1      LEU  59  -3.129  -8.070   1.288
  493   HD21  LEU  59          3HD2      LEU  59  -3.775 -10.466   1.587
  494   HD22  LEU  59          1HD2      LEU  59  -2.971 -11.342   2.888
  495   HD23  LEU  59          2HD2      LEU  59  -2.014 -10.532   1.647
  496    H    ASP  60           H        ASP  60  -1.891  -9.143   7.461
  497    HA   ASP  60           HA       ASP  60  -4.706  -9.072   7.827
  498    HB2  ASP  60           1HB      ASP  60  -3.346 -10.721   8.986
  499    HB3  ASP  60           2HB      ASP  60  -2.466  -9.447   9.826
  500    H    VAL  61           H        VAL  61  -2.081  -7.193   9.341
  501    HA   VAL  61           HA       VAL  61  -3.739  -5.456  10.792
  502    HB   VAL  61           HB       VAL  61  -1.390  -5.639  11.332
  503   HG11  VAL  61          1HG1      VAL  61  -0.546  -6.030   9.065
  504   HG12  VAL  61          2HG1      VAL  61  -0.851  -4.340   8.662
  505   HG13  VAL  61          3HG1      VAL  61   0.354  -4.753   9.883
  506   HG21  VAL  61          3HG2      VAL  61  -1.197  -2.877  10.512
  507   HG22  VAL  61          1HG2      VAL  61  -2.806  -3.249  11.130
  508   HG23  VAL  61          2HG2      VAL  61  -1.385  -3.558  12.126
  509    H    VAL  62           H        VAL  62  -2.476  -5.288   7.509
  510    HA   VAL  62           HA       VAL  62  -3.278  -2.618   6.985
  511    HB   VAL  62           HB       VAL  62  -2.721  -4.913   5.103
  512   HG11  VAL  62          1HG1      VAL  62  -2.431  -2.985   3.434
  513   HG12  VAL  62          2HG1      VAL  62  -4.074  -3.493   3.833
  514   HG13  VAL  62          3HG1      VAL  62  -3.397  -2.039   4.567
  515   HG21  VAL  62          3HG2      VAL  62  -0.998  -2.499   5.510
  516   HG22  VAL  62          1HG2      VAL  62  -0.903  -3.864   6.625
  517   HG23  VAL  62          2HG2      VAL  62  -0.558  -4.098   4.911
  518    H    CYS  63           H        CYS  63  -4.712  -5.730   5.988
  519    HA   CYS  63           HA       CYS  63  -7.016  -4.631   4.821
  520    HG   CYS  63           HG       CYS  63  -7.175  -9.098   6.142
  521    HB2  CYS  63           1HB      CYS  63  -7.852  -6.837   4.707
  522    HB3  CYS  63           2HB      CYS  63  -6.105  -7.006   4.589
  523    H    ALA  64           H        ALA  64  -6.185  -5.289   8.122
  524    HA   ALA  64           HA       ALA  64  -8.839  -5.278   9.166
  525    HB1  ALA  64           3HB      ALA  64  -6.259  -4.705  10.618
  526    HB2  ALA  64           1HB      ALA  64  -7.800  -5.169  11.340
  527    HB3  ALA  64           2HB      ALA  64  -6.919  -6.315  10.329
  528    H    MET  65           H        MET  65  -6.215  -2.862   9.367
  529    HA   MET  65           HA       MET  65  -7.784  -0.818  10.470
  530    HB2  MET  65           1HB      MET  65  -5.974   0.644  10.006
  531    HB3  MET  65           2HB      MET  65  -5.257  -0.924  10.353
  532    HG2  MET  65           1HG      MET  65  -5.013  -1.331   7.950
  533    HG3  MET  65           2HG      MET  65  -5.702   0.257   7.621
  534    HE1  MET  65           3HE      MET  65  -2.212  -1.597   8.372
  535    HE2  MET  65           1HE      MET  65  -1.705  -0.565   9.710
  536    HE3  MET  65           2HE      MET  65  -3.191  -1.507   9.838
  537    H    ILE  66           H        ILE  66  -7.238  -1.801   7.149
  538    HA   ILE  66           HA       ILE  66  -8.399   0.503   5.944
  539    HB   ILE  66           HB       ILE  66  -7.426  -2.117   5.020
  540   HG12  ILE  66          1HG1      ILE  66  -6.438  -0.749   3.264
  541   HG13  ILE  66          2HG1      ILE  66  -7.418   0.629   3.751
  542   HG21  ILE  66          1HG2      ILE  66  -8.586  -1.816   2.798
  543   HG22  ILE  66          2HG2      ILE  66  -9.599  -2.382   4.124
  544   HG23  ILE  66          3HG2      ILE  66  -9.674  -0.695   3.616
  545   HD11  ILE  66          3HD1      ILE  66  -5.391  -0.682   5.538
  546   HD12  ILE  66          1HD1      ILE  66  -5.040   0.698   4.497
  547   HD13  ILE  66          2HD1      ILE  66  -6.228   0.850   5.793
  548    H    GLU  67           H        GLU  67  -9.621  -2.757   6.653
  549    HA   GLU  67           HA       GLU  67 -12.178  -2.434   5.563
  550    HB2  GLU  67           1HB      GLU  67 -11.001  -4.235   7.639
  551    HB3  GLU  67           2HB      GLU  67 -12.746  -4.205   7.429
  552    HG2  GLU  67           1HG      GLU  67 -12.580  -4.936   5.183
  553    HG3  GLU  67           2HG      GLU  67 -10.835  -4.686   5.162
  554    H    GLY  68           H        GLY  68 -11.030  -1.921   8.892
  555    HA2  GLY  68           1HA      GLY  68 -13.530  -1.118   9.939
  556    HA3  GLY  68           2HA      GLY  68 -11.961  -0.787  10.657
  557    H    ALA  69           H        ALA  69 -10.737   0.820   8.875
  558    HA   ALA  69           HA       ALA  69 -11.878   3.330   9.366
  559    HB1  ALA  69           3HB      ALA  69  -9.461   2.854   8.903
  560    HB2  ALA  69           1HB      ALA  69  -9.882   2.713   7.196
  561    HB3  ALA  69           2HB      ALA  69 -10.123   4.243   8.040
  562    H    GLN  70           H        GLN  70 -11.657   1.522   6.299
  563    HA   GLN  70           HA       GLN  70 -13.059   3.309   4.701
  564    HB2  GLN  70           1HB      GLN  70 -11.779   1.163   4.056
  565    HB3  GLN  70           2HB      GLN  70 -13.298   0.331   4.362
  566    HG2  GLN  70           1HG      GLN  70 -14.209   2.231   2.744
  567    HG3  GLN  70           2HG      GLN  70 -12.543   2.169   2.171
  568   HE21  GLN  70          1HE2      GLN  70 -15.198  -0.021   3.036
  569   HE22  GLN  70          2HE2      GLN  70 -14.939  -1.125   1.733
  570    H    GLY  71           H        GLY  71 -14.308   0.515   6.524
  571    HA2  GLY  71           1HA      GLY  71 -16.986   0.724   5.796
  572    HA3  GLY  71           2HA      GLY  71 -16.411   0.054   7.316
  573    H    ALA  72           H        ALA  72 -15.392   2.141   8.653
  574    HA   ALA  72           HA       ALA  72 -17.663   3.463   9.640
  575    HB1  ALA  72           3HB      ALA  72 -16.210   4.598  11.110
  576    HB2  ALA  72           1HB      ALA  72 -15.483   3.013  10.847
  577    HB3  ALA  72           2HB      ALA  72 -14.840   4.428  10.012
  578    H    LEU  73           H        LEU  73 -14.904   4.833   7.833
  579    HA   LEU  73           HA       LEU  73 -15.859   7.399   7.508
  580    HG   LEU  73           HG       LEU  73 -14.608   8.785   6.095
  581    HB2  LEU  73           1HB      LEU  73 -13.661   6.045   6.679
  582    HB3  LEU  73           2HB      LEU  73 -14.509   6.270   5.149
  583   HD11  LEU  73          1HD1      LEU  73 -13.389   8.309   8.124
  584   HD12  LEU  73          2HD1      LEU  73 -12.409   9.325   7.068
  585   HD13  LEU  73          3HD1      LEU  73 -12.065   7.599   7.199
  586   HD21  LEU  73          3HD2      LEU  73 -13.259   9.256   4.346
  587   HD22  LEU  73          1HD2      LEU  73 -13.490   7.545   3.989
  588   HD23  LEU  73          2HD2      LEU  73 -12.036   8.080   4.830
  589    H    GLU  74           H        GLU  74 -16.269   4.669   5.251
  590    HA   GLU  74           HA       GLU  74 -17.822   5.952   3.348
  591    HB2  GLU  74           1HB      GLU  74 -17.645   3.096   4.252
  592    HB3  GLU  74           2HB      GLU  74 -18.822   3.567   3.033
  593    HG2  GLU  74           1HG      GLU  74 -15.850   3.988   2.834
  594    HG3  GLU  74           2HG      GLU  74 -16.756   2.693   2.055
  595    H    ARG  75           H        ARG  75 -18.864   4.237   6.277
  596    HA   ARG  75           HA       ARG  75 -21.635   4.602   5.865
  597    HE   ARG  75           HE       ARG  75 -23.500   0.917   7.970
  598    HB2  ARG  75           1HB      ARG  75 -19.892   3.645   8.019
  599    HB3  ARG  75           2HB      ARG  75 -21.361   4.422   8.593
  600    HG2  ARG  75           1HG      ARG  75 -21.347   2.219   6.548
  601    HG3  ARG  75           2HG      ARG  75 -21.501   1.941   8.284
  602    HD2  ARG  75           1HD      ARG  75 -23.414   3.763   8.012
  603    HD3  ARG  75           2HD      ARG  75 -23.427   3.134   6.365
  604   HH11  ARG  75          1HH1      ARG  75 -25.448   3.776   7.585
  605   HH12  ARG  75          2HH1      ARG  75 -26.920   2.996   8.061
  606   HH21  ARG  75          1HH2      ARG  75 -25.431  -0.122   8.598
  607   HH22  ARG  75          2HH2      ARG  75 -26.910   0.779   8.638
  608    H    GLU  76           H        GLU  76 -19.145   6.649   7.147
  609    HA   GLU  76           HA       GLU  76 -20.883   8.456   8.521
  610    HB2  GLU  76           1HB      GLU  76 -18.342   8.078   8.852
  611    HB3  GLU  76           2HB      GLU  76 -18.153   9.181   7.496
  612    HG2  GLU  76           1HG      GLU  76 -19.834   9.971   9.829
  613    HG3  GLU  76           2HG      GLU  76 -18.077  10.081   9.927
  614    H    LEU  77           H        LEU  77 -19.063   8.694   5.464
  615    HA   LEU  77           HA       LEU  77 -20.198  11.155   4.675
  616    HG   LEU  77           HG       LEU  77 -18.873   7.906   3.680
  617    HB2  LEU  77           1HB      LEU  77 -19.346  10.548   2.415
  618    HB3  LEU  77           2HB      LEU  77 -18.143  10.470   3.700
  619   HD11  LEU  77          1HD1      LEU  77 -19.671   7.090   1.714
  620   HD12  LEU  77          2HD1      LEU  77 -18.994   8.408   0.758
  621   HD13  LEU  77          3HD1      LEU  77 -20.461   8.667   1.703
  622   HD21  LEU  77          3HD2      LEU  77 -16.936   7.471   2.285
  623   HD22  LEU  77          1HD2      LEU  77 -16.606   8.806   3.390
  624   HD23  LEU  77          2HD2      LEU  77 -16.962   9.133   1.693
  625    H    LYS  78           H        LYS  78 -21.196   7.830   4.264
  626    HA   LYS  78           HA       LYS  78 -23.137   8.264   2.249
  627    HB2  LYS  78           1HB      LYS  78 -22.560   6.089   4.211
  628    HB3  LYS  78           2HB      LYS  78 -24.112   6.082   3.386
  629    HG2  LYS  78           1HG      LYS  78 -21.432   6.130   2.014
  630    HG3  LYS  78           2HG      LYS  78 -22.420   4.690   2.269
  631    HD2  LYS  78           1HD      LYS  78 -23.699   5.162   0.504
  632    HD3  LYS  78           2HD      LYS  78 -23.951   6.821   1.052
  633    HE2  LYS  78           1HE      LYS  78 -22.860   7.168  -0.944
  634    HE3  LYS  78           2HE      LYS  78 -21.509   7.166   0.189
  635    HZ1  LYS  78           3HZ      LYS  78 -20.698   5.705  -1.308
  636    HZ2  LYS  78           1HZ      LYS  78 -22.223   5.216  -1.853
  637    HZ3  LYS  78           2HZ      LYS  78 -21.603   4.596  -0.406
  638    H    ARG  79           H        ARG  79 -23.048   9.166   5.498
  639    HA   ARG  79           HA       ARG  79 -25.625   8.874   6.425
  640    HE   ARG  79           HE       ARG  79 -26.294  11.121  10.636
  641    HB2  ARG  79           1HB      ARG  79 -23.660   9.847   7.668
  642    HB3  ARG  79           2HB      ARG  79 -23.951  11.357   6.815
  643    HG2  ARG  79           1HG      ARG  79 -25.010  11.667   8.852
  644    HG3  ARG  79           2HG      ARG  79 -26.328  11.205   7.773
  645    HD2  ARG  79           1HD      ARG  79 -26.522   9.097   8.704
  646    HD3  ARG  79           2HD      ARG  79 -24.876   9.111   9.332
  647   HH11  ARG  79          1HH1      ARG  79 -26.313   7.649  10.374
  648   HH12  ARG  79          2HH1      ARG  79 -26.953   7.403  11.965
  649   HH21  ARG  79          1HH2      ARG  79 -27.137  10.808  12.732
  650   HH22  ARG  79          2HH2      ARG  79 -27.422   9.200  13.305
  651    H    THR  80           H        THR  80 -24.362  11.741   4.714
  652    HA   THR  80           HA       THR  80 -26.804  12.027   3.221
  653    HB   THR  80           HB       THR  80 -26.931  14.520   4.122
  654    HG1  THR  80           1HG      THR  80 -25.859  13.020   6.293
  655   HG21  THR  80          3HG2      THR  80 -28.937  13.874   4.884
  656   HG22  THR  80          1HG2      THR  80 -28.229  12.774   6.066
  657   HG23  THR  80          2HG2      THR  80 -28.462  12.247   4.399
  658    H    ASP  81           H        ASP  81 -26.397  12.977   1.317
  659    HA   ASP  81           HA       ASP  81 -24.634  15.113   0.886
  660    HB2  ASP  81           1HB      ASP  81 -22.837  13.572   1.350
  661    HB3  ASP  81           2HB      ASP  81 -23.512  12.382   0.241
  662    H    LEU  82           H        LEU  82 -25.003  16.003  -1.078
  663    HA   LEU  82           HA       LEU  82 -25.937  14.438  -3.308
  664    HG   LEU  82           HG       LEU  82 -27.178  17.130  -1.206
  665    HB2  LEU  82           1HB      LEU  82 -28.051  15.673  -3.563
  666    HB3  LEU  82           2HB      LEU  82 -28.015  14.656  -2.125
  667   HD11  LEU  82          1HD1      LEU  82 -29.609  17.621  -2.891
  668   HD12  LEU  82          2HD1      LEU  82 -27.985  17.955  -3.491
  669   HD13  LEU  82          3HD1      LEU  82 -28.582  18.788  -2.057
  670   HD21  LEU  82          3HD2      LEU  82 -29.883  15.803  -1.181
  671   HD22  LEU  82          1HD2      LEU  82 -29.452  17.193  -0.185
  672   HD23  LEU  82          2HD2      LEU  82 -28.606  15.662   0.028
  673    H    ASN  83           H        ASN  83 -24.676  15.251  -4.846
  674    HA   ASN  83           HA       ASN  83 -24.974  17.829  -5.868
  675    HB2  ASN  83           1HB      ASN  83 -23.064  17.618  -3.679
  676    HB3  ASN  83           2HB      ASN  83 -22.316  18.219  -5.155
  677   HD21  ASN  83          1HD2      ASN  83 -23.820  19.880  -6.311
  678   HD22  ASN  83          2HD2      ASN  83 -24.425  21.132  -5.285
  679    H    ILE  84           H        ILE  84 -23.523  18.273  -7.665
  680    HA   ILE  84           HA       ILE  84 -22.993  16.007  -9.222
  681    HB   ILE  84           HB       ILE  84 -21.742  18.728  -9.596
  682   HG12  ILE  84          1HG1      ILE  84 -23.930  18.543 -11.290
  683   HG13  ILE  84          2HG1      ILE  84 -24.520  17.854  -9.781
  684   HG21  ILE  84          1HG2      ILE  84 -20.711  17.246 -11.078
  685   HG22  ILE  84          2HG2      ILE  84 -22.209  16.371 -11.389
  686   HG23  ILE  84          3HG2      ILE  84 -21.986  17.995 -12.039
  687   HD11  ILE  84          3HD1      ILE  84 -24.618  20.457 -10.341
  688   HD12  ILE  84          1HD1      ILE  84 -24.458  19.830  -8.701
  689   HD13  ILE  84          2HD1      ILE  84 -23.031  20.391  -9.575
  690    H    LEU  85           H        LEU  85 -20.659  18.257  -7.725
  691    HA   LEU  85           HA       LEU  85 -18.376  16.738  -8.337
  692    HG   LEU  85           HG       LEU  85 -16.425  19.470  -6.872
  693    HB2  LEU  85           1HB      LEU  85 -18.794  19.200  -7.334
  694    HB3  LEU  85           2HB      LEU  85 -18.337  18.347  -5.861
  695   HD11  LEU  85          1HD1      LEU  85 -16.279  17.206  -5.695
  696   HD12  LEU  85          2HD1      LEU  85 -14.904  17.709  -6.678
  697   HD13  LEU  85          3HD1      LEU  85 -16.050  16.525  -7.306
  698   HD21  LEU  85          3HD2      LEU  85 -16.059  19.503  -9.062
  699   HD22  LEU  85          1HD2      LEU  85 -17.561  18.604  -9.281
  700   HD23  LEU  85          2HD2      LEU  85 -16.030  17.740  -9.132
  701    H    GLU  86           H        GLU  86 -20.342  16.900  -5.382
  702    HA   GLU  86           HA       GLU  86 -18.845  15.140  -3.821
  703    HB2  GLU  86           1HB      GLU  86 -21.846  15.497  -3.776
  704    HB3  GLU  86           2HB      GLU  86 -20.852  14.862  -2.472
  705    HG2  GLU  86           1HG      GLU  86 -20.458  17.625  -3.566
  706    HG3  GLU  86           2HG      GLU  86 -21.626  17.275  -2.293
  707    H    ARG  87           H        ARG  87 -21.478  14.498  -6.099
  708    HA   ARG  87           HA       ARG  87 -21.704  11.738  -5.601
  709    HE   ARG  87           HE       ARG  87 -26.899  13.047  -7.336
  710    HB2  ARG  87           1HB      ARG  87 -22.509  13.568  -7.814
  711    HB3  ARG  87           2HB      ARG  87 -22.538  11.836  -8.120
  712    HG2  ARG  87           1HG      ARG  87 -23.897  11.737  -5.906
  713    HG3  ARG  87           2HG      ARG  87 -24.180  13.450  -6.227
  714    HD2  ARG  87           1HD      ARG  87 -24.962  12.779  -8.522
  715    HD3  ARG  87           2HD      ARG  87 -24.892  11.104  -7.975
  716   HH11  ARG  87          1HH1      ARG  87 -25.282  10.165  -6.238
  717   HH12  ARG  87          2HH1      ARG  87 -26.599   9.652  -5.235
  718   HH21  ARG  87          1HH2      ARG  87 -28.638  12.382  -6.019
  719   HH22  ARG  87          2HH2      ARG  87 -28.507  10.914  -5.112
  720    H    PHE  88           H        PHE  88 -19.832  13.534  -8.028
  721    HA   PHE  88           HA       PHE  88 -18.746  11.340  -9.372
  722    HD1  PHE  88           1HD      PHE  88 -17.245  11.054 -11.005
  723    HD2  PHE  88           2HD      PHE  88 -15.553  14.712  -9.635
  724    HE1  PHE  88           1HE      PHE  88 -15.123  10.483 -12.113
  725    HE2  PHE  88           2HE      PHE  88 -13.429  14.147 -10.741
  726    HZ   PHE  88           HZ       PHE  88 -13.212  12.030 -11.983
  727    HB2  PHE  88           1HB      PHE  88 -18.553  13.526 -10.337
  728    HB3  PHE  88           2HB      PHE  88 -17.666  14.127  -8.940
  729    H    ASN  89           H        ASN  89 -17.263  13.298  -6.786
  730    HA   ASN  89           HA       ASN  89 -14.958  11.757  -6.475
  731    HB2  ASN  89           1HB      ASN  89 -16.448  13.443  -4.453
  732    HB3  ASN  89           2HB      ASN  89 -14.835  12.784  -4.194
  733   HD21  ASN  89          1HD2      ASN  89 -14.262  15.039  -3.903
  734   HD22  ASN  89          2HD2      ASN  89 -13.904  16.002  -5.292
  735    H    TYR  90           H        TYR  90 -18.098  11.522  -4.849
  736    HA   TYR  90           HA       TYR  90 -17.419   9.472  -3.054
  737    HD1  TYR  90           1HD      TYR  90 -17.929  12.015  -2.620
  738    HD2  TYR  90           2HD      TYR  90 -21.110   9.513  -1.307
  739    HE1  TYR  90           1HE      TYR  90 -17.992  13.228  -0.481
  740    HE2  TYR  90           2HE      TYR  90 -21.184  10.720   0.835
  741    HH   TYR  90           HH       TYR  90 -19.301  13.616   1.378
  742    HB2  TYR  90           1HB      TYR  90 -19.973  10.541  -4.169
  743    HB3  TYR  90           2HB      TYR  90 -20.015   9.008  -3.305
  744    H    GLU  91           H        GLU  91 -18.821   9.348  -6.312
  745    HA   GLU  91           HA       GLU  91 -19.239   6.599  -6.473
  746    HB2  GLU  91           1HB      GLU  91 -20.011   8.354  -8.112
  747    HB3  GLU  91           2HB      GLU  91 -18.379   8.367  -8.763
  748    HG2  GLU  91           1HG      GLU  91 -18.576   6.260  -9.673
  749    HG3  GLU  91           2HG      GLU  91 -19.872   5.793  -8.572
  750    H    GLU  92           H        GLU  92 -16.423   8.468  -7.612
  751    HA   GLU  92           HA       GLU  92 -14.887   6.246  -8.383
  752    HB2  GLU  92           1HB      GLU  92 -14.524   8.718  -8.948
  753    HB3  GLU  92           2HB      GLU  92 -13.726   8.840  -7.386
  754    HG2  GLU  92           1HG      GLU  92 -12.108   7.152  -8.072
  755    HG3  GLU  92           2HG      GLU  92 -12.913   7.011  -9.634
  756    H    ALA  93           H        ALA  93 -15.169   7.958  -5.317
  757    HA   ALA  93           HA       ALA  93 -13.019   6.834  -3.951
  758    HB1  ALA  93           3HB      ALA  93 -14.351   8.708  -3.097
  759    HB2  ALA  93           1HB      ALA  93 -15.703   7.611  -2.814
  760    HB3  ALA  93           2HB      ALA  93 -14.201   7.414  -1.909
  761    H    GLN  94           H        GLN  94 -16.415   5.738  -3.968
  762    HA   GLN  94           HA       GLN  94 -15.928   3.387  -2.481
  763    HB2  GLN  94           1HB      GLN  94 -18.164   2.693  -3.205
  764    HB3  GLN  94           2HB      GLN  94 -18.158   4.368  -2.668
  765    HG2  GLN  94           1HG      GLN  94 -18.202   5.154  -4.935
  766    HG3  GLN  94           2HG      GLN  94 -18.023   3.510  -5.548
  767   HE21  GLN  94          1HE2      GLN  94 -20.112   5.157  -3.191
  768   HE22  GLN  94          2HE2      GLN  94 -21.595   4.530  -3.815
  769    H    THR  95           H        THR  95 -15.821   4.114  -5.905
  770    HA   THR  95           HA       THR  95 -15.801   1.482  -6.895
  771    HB   THR  95           HB       THR  95 -14.503   3.947  -8.073
  772    HG1  THR  95           1HG      THR  95 -16.925   2.846  -8.978
  773   HG21  THR  95          3HG2      THR  95 -14.675   1.164  -8.971
  774   HG22  THR  95          1HG2      THR  95 -13.605   2.460  -9.502
  775   HG23  THR  95          2HG2      THR  95 -15.237   2.340 -10.160
  776    H    LEU  96           H        LEU  96 -13.090   3.692  -6.201
  777    HA   LEU  96           HA       LEU  96 -11.056   1.832  -6.785
  778    HG   LEU  96           HG       LEU  96 -11.320   4.790  -7.456
  779    HB2  LEU  96           1HB      LEU  96 -11.082   4.300  -5.063
  780    HB3  LEU  96           2HB      LEU  96  -9.623   3.371  -5.402
  781   HD11  LEU  96          1HD1      LEU  96 -10.133   6.364  -6.048
  782   HD12  LEU  96          2HD1      LEU  96  -9.391   6.300  -7.646
  783   HD13  LEU  96          3HD1      LEU  96  -8.626   5.478  -6.287
  784   HD21  LEU  96          3HD2      LEU  96  -8.767   4.187  -8.446
  785   HD22  LEU  96          1HD2      LEU  96 -10.308   3.487  -8.941
  786   HD23  LEU  96          2HD2      LEU  96  -9.352   2.710  -7.679
  787    H    SER  97           H        SER  97 -12.586   2.770  -3.724
  788    HA   SER  97           HA       SER  97 -11.020   1.185  -2.028
  789    HG   SER  97           HG       SER  97 -13.967   0.480  -0.626
  790    HB2  SER  97           1HB      SER  97 -12.360   2.005  -0.408
  791    HB3  SER  97           2HB      SER  97 -13.105   2.957  -1.692
  792    H    LYS  98           H        LYS  98 -14.105   0.478  -3.639
  793    HA   LYS  98           HA       LYS  98 -14.518  -2.074  -2.585
  794    HB2  LYS  98           1HB      LYS  98 -15.393  -0.695  -5.096
  795    HB3  LYS  98           2HB      LYS  98 -15.741  -2.406  -4.880
  796    HG2  LYS  98           1HG      LYS  98 -17.106  -2.005  -3.015
  797    HG3  LYS  98           2HG      LYS  98 -16.499  -0.359  -2.821
  798    HD2  LYS  98           1HD      LYS  98 -17.527   0.191  -5.035
  799    HD3  LYS  98           2HD      LYS  98 -18.265  -1.413  -5.028
  800    HE2  LYS  98           1HE      LYS  98 -18.662   0.662  -2.876
  801    HE3  LYS  98           2HE      LYS  98 -19.769   0.401  -4.223
  802    HZ1  LYS  98           3HZ      LYS  98 -20.278  -0.744  -2.019
  803    HZ2  LYS  98           1HZ      LYS  98 -19.023  -1.809  -2.412
  804    HZ3  LYS  98           2HZ      LYS  98 -20.372  -1.681  -3.424
  805    H    ILE  99           H        ILE  99 -12.868  -1.100  -5.581
  806    HA   ILE  99           HA       ILE  99 -12.224  -3.639  -6.524
  807    HB   ILE  99           HB       ILE  99 -10.647  -1.080  -6.821
  808   HG12  ILE  99          1HG1      ILE  99 -12.361  -2.272  -8.959
  809   HG13  ILE  99          2HG1      ILE  99 -13.140  -1.388  -7.651
  810   HG21  ILE  99          1HG2      ILE  99 -10.197  -2.643  -9.052
  811   HG22  ILE  99          2HG2      ILE  99  -9.073  -2.377  -7.721
  812   HG23  ILE  99          3HG2      ILE  99 -10.124  -3.792  -7.716
  813   HD11  ILE  99          3HD1      ILE  99 -11.678   0.548  -8.180
  814   HD12  ILE  99          1HD1      ILE  99 -11.088  -0.344  -9.581
  815   HD13  ILE  99          2HD1      ILE  99 -12.791   0.103  -9.475
  816    H    LEU 100           H        LEU 100 -10.170  -1.441  -4.606
  817    HA   LEU 100           HA       LEU 100  -8.033  -3.196  -4.245
  818    HG   LEU 100           HG       LEU 100  -9.771  -1.500  -1.491
  819    HB2  LEU 100           1HB      LEU 100  -7.158  -1.598  -2.921
  820    HB3  LEU 100           2HB      LEU 100  -8.466  -0.638  -3.611
  821   HD11  LEU 100          1HD1      LEU 100  -7.784  -1.297   0.335
  822   HD12  LEU 100          2HD1      LEU 100  -6.969  -2.191  -0.947
  823   HD13  LEU 100          3HD1      LEU 100  -8.457  -2.822  -0.240
  824   HD21  LEU 100          3HD2      LEU 100  -9.584   0.617  -0.756
  825   HD22  LEU 100          1HD2      LEU 100  -8.670   0.856  -2.245
  826   HD23  LEU 100          2HD2      LEU 100  -7.821   0.562  -0.727
  827    H    LEU 101           H        LEU 101 -11.095  -2.956  -2.590
  828    HA   LEU 101           HA       LEU 101 -10.428  -4.496  -0.312
  829    HG   LEU 101           HG       LEU 101 -13.925  -4.069   0.806
  830    HB2  LEU 101           1HB      LEU 101 -12.505  -2.990  -0.865
  831    HB3  LEU 101           2HB      LEU 101 -13.181  -4.505  -1.460
  832   HD11  LEU 101          1HD1      LEU 101 -13.705  -6.208   1.526
  833   HD12  LEU 101          2HD1      LEU 101 -11.964  -6.244   1.247
  834   HD13  LEU 101          3HD1      LEU 101 -13.078  -6.417  -0.109
  835   HD21  LEU 101          3HD2      LEU 101 -11.007  -4.131   1.570
  836   HD22  LEU 101          1HD2      LEU 101 -12.378  -3.966   2.668
  837   HD23  LEU 101          2HD2      LEU 101 -12.015  -2.685   1.511
  838    H    LYS 102           H        LYS 102 -12.046  -5.361  -3.363
  839    HA   LYS 102           HA       LYS 102 -12.380  -8.088  -2.812
  840    HB2  LYS 102           1HB      LYS 102 -13.530  -6.933  -4.649
  841    HB3  LYS 102           2HB      LYS 102 -11.997  -6.729  -5.487
  842    HG2  LYS 102           1HG      LYS 102 -11.890  -9.335  -5.307
  843    HG3  LYS 102           2HG      LYS 102 -13.636  -9.185  -5.103
  844    HD2  LYS 102           1HD      LYS 102 -13.307  -9.475  -7.414
  845    HD3  LYS 102           2HD      LYS 102 -13.598  -7.747  -7.204
  846    HE2  LYS 102           1HE      LYS 102 -11.385  -7.195  -7.597
  847    HE3  LYS 102           2HE      LYS 102 -10.803  -8.805  -7.174
  848    HZ1  LYS 102           3HZ      LYS 102 -11.601  -9.670  -9.215
  849    HZ2  LYS 102           1HZ      LYS 102 -10.740  -8.262  -9.592
  850    HZ3  LYS 102           2HZ      LYS 102 -12.432  -8.244  -9.588
  851    H    ASP 103           H        ASP 103  -9.784  -6.415  -4.578
  852    HA   ASP 103           HA       ASP 103  -8.253  -8.656  -5.215
  853    HB2  ASP 103           1HB      ASP 103  -8.019  -6.095  -5.850
  854    HB3  ASP 103           2HB      ASP 103  -6.879  -6.100  -4.506
  855    H    LEU 104           H        LEU 104  -8.068  -6.529  -2.373
  856    HA   LEU 104           HA       LEU 104  -5.902  -7.734  -1.108
  857    HG   LEU 104           HG       LEU 104  -6.368  -7.366   1.783
  858    HB2  LEU 104           1HB      LEU 104  -7.182  -5.590  -0.515
  859    HB3  LEU 104           2HB      LEU 104  -8.264  -6.647   0.389
  860   HD11  LEU 104          1HD1      LEU 104  -4.834  -5.348   0.155
  861   HD12  LEU 104          2HD1      LEU 104  -4.545  -7.084   0.246
  862   HD13  LEU 104          3HD1      LEU 104  -4.260  -6.068   1.659
  863   HD21  LEU 104          3HD2      LEU 104  -5.908  -4.899   2.666
  864   HD22  LEU 104          1HD2      LEU 104  -7.452  -5.716   2.907
  865   HD23  LEU 104          2HD2      LEU 104  -7.268  -4.547   1.599
  866    H    LYS 105           H        LYS 105  -9.373  -8.424  -0.740
  867    HA   LYS 105           HA       LYS 105  -9.191 -10.431   1.172
  868    HB2  LYS 105           1HB      LYS 105 -11.163  -9.771  -0.973
  869    HB3  LYS 105           2HB      LYS 105 -11.327 -11.299  -0.118
  870    HG2  LYS 105           1HG      LYS 105 -11.558 -10.169   1.982
  871    HG3  LYS 105           2HG      LYS 105 -11.192  -8.613   1.234
  872    HD2  LYS 105           1HD      LYS 105 -13.255  -8.455   0.238
  873    HD3  LYS 105           2HD      LYS 105 -13.476 -10.205   0.172
  874    HE2  LYS 105           1HE      LYS 105 -13.441  -8.707   2.775
  875    HE3  LYS 105           2HE      LYS 105 -14.915  -8.880   1.824
  876    HZ1  LYS 105           3HZ      LYS 105 -13.369 -11.294   2.413
  877    HZ2  LYS 105           1HZ      LYS 105 -15.041 -11.097   2.247
  878    HZ3  LYS 105           2HZ      LYS 105 -14.269 -10.608   3.669
  879    H    GLU 106           H        GLU 106  -9.137 -10.717  -2.373
  880    HA   GLU 106           HA       GLU 106  -8.958 -13.489  -2.544
  881    HB2  GLU 106           1HB      GLU 106  -9.382 -12.209  -4.521
  882    HB3  GLU 106           2HB      GLU 106  -7.872 -11.326  -4.345
  883    HG2  GLU 106           1HG      GLU 106  -7.695 -14.268  -4.608
  884    HG3  GLU 106           2HG      GLU 106  -8.166 -13.350  -6.037
  885    H    THR 107           H        THR 107  -6.354 -11.077  -2.369
  886    HA   THR 107           HA       THR 107  -4.179 -12.797  -2.565
  887    HB   THR 107           HB       THR 107  -3.367 -10.842  -0.744
  888    HG1  THR 107           1HG      THR 107  -5.091  -9.546  -0.849
  889   HG21  THR 107          3HG2      THR 107  -2.656  -9.683  -2.977
  890   HG22  THR 107          1HG2      THR 107  -3.273 -11.160  -3.717
  891   HG23  THR 107          2HG2      THR 107  -1.964 -11.245  -2.538
  892    H    GLU 108           H        GLU 108  -5.783 -11.606   0.388
  893    HA   GLU 108           HA       GLU 108  -4.245 -12.956   2.257
  894    HB2  GLU 108           1HB      GLU 108  -6.621 -11.438   2.266
  895    HB3  GLU 108           2HB      GLU 108  -7.000 -12.947   3.087
  896    HG2  GLU 108           1HG      GLU 108  -4.936 -10.899   3.810
  897    HG3  GLU 108           2HG      GLU 108  -6.300 -11.474   4.766
  898    H    GLN 109           H        GLN 109  -7.227 -14.044   0.655
  899    HA   GLN 109           HA       GLN 109  -7.511 -16.500   1.910
  900    HB2  GLN 109           1HB      GLN 109  -8.939 -15.216   0.059
  901    HB3  GLN 109           2HB      GLN 109  -8.109 -16.348  -1.002
  902    HG2  GLN 109           1HG      GLN 109  -9.916 -17.611  -0.535
  903    HG3  GLN 109           2HG      GLN 109  -8.927 -18.068   0.853
  904   HE21  GLN 109          1HE2      GLN 109  -9.924 -18.006   2.724
  905   HE22  GLN 109          2HE2      GLN 109 -11.271 -17.005   3.135
  906    H    LYS 110           H        LYS 110  -5.822 -15.802  -1.149
  907    HA   LYS 110           HA       LYS 110  -4.905 -18.353  -1.707
  908    HB2  LYS 110           1HB      LYS 110  -4.039 -15.606  -2.410
  909    HB3  LYS 110           2HB      LYS 110  -2.855 -16.883  -2.655
  910    HG2  LYS 110           1HG      LYS 110  -4.078 -16.508  -4.691
  911    HG3  LYS 110           2HG      LYS 110  -4.488 -18.097  -4.042
  912    HD2  LYS 110           1HD      LYS 110  -6.504 -17.001  -2.980
  913    HD3  LYS 110           2HD      LYS 110  -6.132 -15.576  -3.951
  914    HE2  LYS 110           1HE      LYS 110  -6.386 -18.260  -5.246
  915    HE3  LYS 110           2HE      LYS 110  -7.830 -17.335  -4.837
  916    HZ1  LYS 110           3HZ      LYS 110  -7.381 -15.766  -6.395
  917    HZ2  LYS 110           1HZ      LYS 110  -6.632 -17.081  -7.151
  918    HZ3  LYS 110           2HZ      LYS 110  -5.703 -15.957  -6.293
  919    H    VAL 111           H        VAL 111  -3.297 -15.808   0.187
  920    HA   VAL 111           HA       VAL 111  -0.949 -17.166   0.796
  921    HB   VAL 111           HB       VAL 111  -2.445 -15.196   2.532
  922   HG11  VAL 111          1HG1      VAL 111  -0.833 -16.380   3.864
  923   HG12  VAL 111          2HG1      VAL 111   0.412 -16.155   2.634
  924   HG13  VAL 111          3HG1      VAL 111  -0.210 -14.766   3.526
  925   HG21  VAL 111          3HG2      VAL 111  -0.084 -14.567   0.800
  926   HG22  VAL 111          1HG2      VAL 111  -1.716 -14.568   0.132
  927   HG23  VAL 111          2HG2      VAL 111  -1.306 -13.479   1.458
  928    H    LYS 112           H        LYS 112  -4.057 -17.167   2.503
  929    HA   LYS 112           HA       LYS 112  -3.204 -18.841   4.629
  930    HB2  LYS 112           1HB      LYS 112  -5.970 -18.261   3.558
  931    HB3  LYS 112           2HB      LYS 112  -5.646 -19.134   5.049
  932    HG2  LYS 112           1HG      LYS 112  -4.963 -17.256   6.167
  933    HG3  LYS 112           2HG      LYS 112  -4.470 -16.424   4.690
  934    HD2  LYS 112           1HD      LYS 112  -6.471 -15.401   5.634
  935    HD3  LYS 112           2HD      LYS 112  -6.824 -16.138   4.070
  936    HE2  LYS 112           1HE      LYS 112  -8.600 -16.646   5.626
  937    HE3  LYS 112           2HE      LYS 112  -7.713 -18.119   5.237
  938    HZ1  LYS 112           3HZ      LYS 112  -6.644 -18.090   7.314
  939    HZ2  LYS 112           1HZ      LYS 112  -8.269 -17.759   7.650
  940    HZ3  LYS 112           2HZ      LYS 112  -7.133 -16.506   7.651
  941    H    ASP 113           H        ASP 113  -4.384 -19.441   1.414
  942    HA   ASP 113           HA       ASP 113  -5.119 -22.158   1.782
  943    HB2  ASP 113           1HB      ASP 113  -4.309 -20.658  -0.716
  944    HB3  ASP 113           2HB      ASP 113  -4.997 -22.280  -0.701
  945    H    ILE 114           H        ILE 114  -2.159 -20.589   0.614
  946    HA   ILE 114           HA       ILE 114  -0.714 -22.868  -0.061
  947    HB   ILE 114           HB       ILE 114   0.119 -20.140   0.862
  948   HG12  ILE 114          1HG1      ILE 114   1.292 -20.725  -1.569
  949   HG13  ILE 114          2HG1      ILE 114  -0.249 -21.569  -1.664
  950   HG21  ILE 114          1HG2      ILE 114   1.938 -21.194   1.749
  951   HG22  ILE 114          2HG2      ILE 114   1.807 -22.575   0.661
  952   HG23  ILE 114          3HG2      ILE 114   2.472 -21.051   0.075
  953   HD11  ILE 114          3HD1      ILE 114  -1.402 -19.673  -1.876
  954   HD12  ILE 114          1HD1      ILE 114  -0.452 -18.841  -0.645
  955   HD13  ILE 114          2HD1      ILE 114   0.154 -18.958  -2.297
  956    H    GLN 115           H        GLN 115   0.111 -24.484   1.088
  957    HA   GLN 115           HA       GLN 115  -0.015 -24.383   3.985
  958    HB2  GLN 115           1HB      GLN 115   0.500 -26.769   3.892
  959    HB3  GLN 115           2HB      GLN 115  -0.833 -26.376   2.815
  960    HG2  GLN 115           1HG      GLN 115   1.021 -26.210   1.006
  961    HG3  GLN 115           2HG      GLN 115   1.966 -27.161   2.151
  962   HE21  GLN 115          1HE2      GLN 115   1.810 -28.555   0.119
  963   HE22  GLN 115          2HE2      GLN 115   0.521 -29.704   0.090
  964    H    THR 116           H        THR 116   1.677 -24.224   5.335
  965    HA   THR 116           HA       THR 116   4.386 -24.637   4.344
  966    HB   THR 116           HB       THR 116   5.192 -22.485   5.210
  967    HG1  THR 116           1HG      THR 116   3.914 -21.263   6.368
  968   HG21  THR 116          3HG2      THR 116   2.934 -22.083   3.248
  969   HG22  THR 116          1HG2      THR 116   4.522 -22.721   2.826
  970   HG23  THR 116          2HG2      THR 116   4.366 -21.073   3.436
  971    H    GLN 117           H        GLN 117   5.987 -24.209   6.239
  972    HA   GLN 117           HA       GLN 117   5.433 -26.022   8.277
  973    HB2  GLN 117           1HB      GLN 117   7.700 -25.140   7.499
  974    HB3  GLN 117           2HB      GLN 117   7.402 -23.757   8.545
  975    HG2  GLN 117           1HG      GLN 117   7.055 -25.474  10.406
  976    HG3  GLN 117           2HG      GLN 117   7.807 -26.626   9.303
  977   HE21  GLN 117          1HE2      GLN 117   9.975 -26.304   8.686
  978   HE22  GLN 117          2HE2      GLN 117  11.045 -25.343   9.642
  Start of MODEL    2
    1    H    GLN   1           H        GLN   1  27.250   9.057  -3.900
    2    HA   GLN   1           HA       GLN   1  26.360   6.256  -4.110
    3    HB2  GLN   1           1HB      GLN   1  25.712   8.341  -2.074
    4    HB3  GLN   1           2HB      GLN   1  24.466   7.180  -2.512
    5    HG2  GLN   1           1HG      GLN   1  25.700   5.372  -1.710
    6    HG3  GLN   1           2HG      GLN   1  27.205   6.288  -1.700
    7   HE21  GLN   1          1HE2      GLN   1  26.966   5.108   0.515
    8   HE22  GLN   1          2HE2      GLN   1  26.325   6.087   1.785
    9    H    GLU   2           H        GLU   2  23.806   6.291  -4.318
   10    HA   GLU   2           HA       GLU   2  23.127   8.286  -6.378
   11    HB2  GLU   2           1HB      GLU   2  21.854   6.572  -7.553
   12    HB3  GLU   2           2HB      GLU   2  23.530   6.073  -7.371
   13    HG2  GLU   2           1HG      GLU   2  22.784   4.757  -5.350
   14    HG3  GLU   2           2HG      GLU   2  21.130   5.082  -5.865
   15    H    HIS   3           H        HIS   3  21.323   9.417  -6.049
   16    HA   HIS   3           HA       HIS   3  19.577   8.608  -3.831
   17    HD1  HIS   3           1HD      HIS   3  17.882  12.179  -5.764
   18    HD2  HIS   3           2HD      HIS   3  22.011  11.744  -5.946
   19    HE1  HIS   3           1HE      HIS   3  18.632  13.654  -7.659
   20    HB2  HIS   3           1HB      HIS   3  18.848  10.945  -3.768
   21    HB3  HIS   3           2HB      HIS   3  20.602  10.836  -3.644
   22    H    LYS   4           H        LYS   4  17.238   9.198  -4.089
   23    HA   LYS   4           HA       LYS   4  16.339   8.357  -6.754
   24    HB2  LYS   4           1HB      LYS   4  15.262   8.047  -3.995
   25    HB3  LYS   4           2HB      LYS   4  14.104   8.150  -5.315
   26    HG2  LYS   4           1HG      LYS   4  15.066   6.232  -6.386
   27    HG3  LYS   4           2HG      LYS   4  16.377   6.179  -5.205
   28    HD2  LYS   4           1HD      LYS   4  14.596   5.870  -3.435
   29    HD3  LYS   4           2HD      LYS   4  13.452   5.623  -4.756
   30    HE2  LYS   4           1HE      LYS   4  15.968   4.014  -4.340
   31    HE3  LYS   4           2HE      LYS   4  14.364   3.514  -3.808
   32    HZ1  LYS   4           3HZ      LYS   4  15.432   3.721  -6.537
   33    HZ2  LYS   4           1HZ      LYS   4  13.770   3.913  -6.287
   34    HZ3  LYS   4           2HZ      LYS   4  14.533   2.475  -5.828
   35    HA   PRO   5           HA       PRO   5  14.410  12.180  -7.705
   36    HB2  PRO   5           1HB      PRO   5  12.087  11.395  -8.871
   37    HB3  PRO   5           2HB      PRO   5  13.664  11.215  -9.651
   38    HG2  PRO   5           1HG      PRO   5  12.039   9.181  -8.174
   39    HG3  PRO   5           2HG      PRO   5  12.937   9.006  -9.692
   40    HD2  PRO   5           1HD      PRO   5  13.904   8.131  -7.320
   41    HD3  PRO   5           2HD      PRO   5  14.956   8.739  -8.614
   42    H    LYS   6           H        LYS   6  12.476  13.533  -7.355
   43    HA   LYS   6           HA       LYS   6  11.301  12.957  -4.742
   44    HB2  LYS   6           1HB      LYS   6  12.454  15.200  -5.536
   45    HB3  LYS   6           2HB      LYS   6  10.856  15.534  -6.189
   46    HG2  LYS   6           1HG      LYS   6  10.652  16.488  -4.135
   47    HG3  LYS   6           2HG      LYS   6  10.091  14.856  -3.764
   48    HD2  LYS   6           1HD      LYS   6  12.539  14.361  -3.174
   49    HD3  LYS   6           2HD      LYS   6  12.752  16.113  -3.163
   50    HE2  LYS   6           1HE      LYS   6  10.772  16.174  -1.558
   51    HE3  LYS   6           2HE      LYS   6  10.987  14.431  -1.404
   52    HZ1  LYS   6           3HZ      LYS   6  12.718  16.604  -0.475
   53    HZ2  LYS   6           1HZ      LYS   6  13.443  15.144  -0.926
   54    HZ3  LYS   6           2HZ      LYS   6  12.281  15.167   0.303
   55    H    LYS   7           H        LYS   7   9.390  11.994  -4.694
   56    HA   LYS   7           HA       LYS   7   7.393  12.731  -6.730
   57    HB2  LYS   7           1HB      LYS   7   6.541  10.434  -6.667
   58    HB3  LYS   7           2HB      LYS   7   8.223  10.475  -7.178
   59    HG2  LYS   7           1HG      LYS   7   7.615  10.045  -4.297
   60    HG3  LYS   7           2HG      LYS   7   7.375   8.714  -5.432
   61    HD2  LYS   7           1HD      LYS   7   9.782   9.380  -6.238
   62    HD3  LYS   7           2HD      LYS   7   9.893  10.101  -4.630
   63    HE2  LYS   7           1HE      LYS   7   8.965   7.275  -5.013
   64    HE3  LYS   7           2HE      LYS   7  10.681   7.672  -4.941
   65    HZ1  LYS   7           3HZ      LYS   7   9.001   7.231  -2.810
   66    HZ2  LYS   7           1HZ      LYS   7   9.254   8.904  -2.815
   67    HZ3  LYS   7           2HZ      LYS   7  10.574   7.850  -2.746
   68    H    ASP   8           H        ASP   8   7.768  13.915  -4.144
   69    HA   ASP   8           HA       ASP   8   5.152  13.271  -2.984
   70    HB2  ASP   8           1HB      ASP   8   5.961  13.232  -0.760
   71    HB3  ASP   8           2HB      ASP   8   7.069  12.213  -1.676
   72    H    ASP   9           H        ASP   9   4.029  15.003  -2.151
   73    HA   ASP   9           HA       ASP   9   4.994  17.617  -2.983
   74    HB2  ASP   9           1HB      ASP   9   2.326  16.632  -1.972
   75    HB3  ASP   9           2HB      ASP   9   2.661  18.335  -2.273
   76    H    PHE  10           H        PHE  10   4.272  15.843  -0.051
   77    HA   PHE  10           HA       PHE  10   4.654  16.282   2.147
   78    HD1  PHE  10           1HD      PHE  10   7.001  15.151   2.894
   79    HD2  PHE  10           2HD      PHE  10   6.888  19.356   3.543
   80    HE1  PHE  10           1HE      PHE  10   7.855  14.818   5.177
   81    HE2  PHE  10           2HE      PHE  10   7.743  19.030   5.826
   82    HZ   PHE  10           HZ       PHE  10   8.229  16.759   6.646
   83    HB2  PHE  10           1HB      PHE  10   6.944  16.852   1.007
   84    HB3  PHE  10           2HB      PHE  10   6.512  18.511   1.405
   85    H    ARG  11           H        ARG  11   2.362  17.342   1.407
   86    HA   ARG  11           HA       ARG  11   2.357  20.066   2.533
   87    HE   ARG  11           HE       ARG  11   0.253  22.623   0.341
   88    HB2  ARG  11           1HB      ARG  11   0.658  18.816   0.388
   89    HB3  ARG  11           2HB      ARG  11   0.106  20.227   1.281
   90    HG2  ARG  11           1HG      ARG  11   2.205  21.389   0.569
   91    HG3  ARG  11           2HG      ARG  11   2.534  20.007  -0.479
   92    HD2  ARG  11           1HD      ARG  11   1.479  21.579  -1.865
   93    HD3  ARG  11           2HD      ARG  11   0.220  20.412  -1.462
   94   HH11  ARG  11          1HH1      ARG  11  -0.797  21.590  -2.813
   95   HH12  ARG  11          2HH1      ARG  11  -2.106  22.722  -2.893
   96   HH21  ARG  11          1HH2      ARG  11  -1.467  24.118   0.249
   97   HH22  ARG  11          2HH2      ARG  11  -2.486  24.160  -1.150
   98    H    ASN  12           H        ASN  12   0.329  20.649   3.679
   99    HA   ASN  12           HA       ASN  12  -0.845  18.318   5.046
  100    HB2  ASN  12           1HB      ASN  12   0.807  19.611   6.444
  101    HB3  ASN  12           2HB      ASN  12  -0.282  20.991   6.340
  102   HD21  ASN  12          1HD2      ASN  12  -1.216  21.219   8.238
  103   HD22  ASN  12          2HD2      ASN  12  -1.942  19.958   9.170
  104    H    GLU  13           H        GLU  13  -3.013  18.261   5.197
  105    HA   GLU  13           HA       GLU  13  -4.554  20.705   4.759
  106    HB2  GLU  13           1HB      GLU  13  -5.206  18.192   3.229
  107    HB3  GLU  13           2HB      GLU  13  -5.887  19.798   3.014
  108    HG2  GLU  13           1HG      GLU  13  -4.457  19.682   1.236
  109    HG3  GLU  13           2HG      GLU  13  -3.432  20.457   2.443
  110    H    PHE  14           H        PHE  14  -6.954  20.249   5.089
  111    HA   PHE  14           HA       PHE  14  -7.335  19.171   7.651
  112    HD1  PHE  14           2HD      PHE  14  -8.901  20.049   9.215
  113    HD2  PHE  14           1HD      PHE  14  -9.153  22.440   5.703
  114    HE1  PHE  14           2HE      PHE  14  -8.922  22.080  10.603
  115    HE2  PHE  14           1HE      PHE  14  -9.174  24.475   7.085
  116    HZ   PHE  14           HZ       PHE  14  -9.059  24.297   9.539
  117    HB2  PHE  14           1HB      PHE  14  -9.135  20.166   5.490
  118    HB3  PHE  14           2HB      PHE  14  -9.852  19.254   6.814
  119    H    ASP  15           H        ASP  15  -6.964  17.071   8.038
  120    HA   ASP  15           HA       ASP  15  -7.507  14.996   6.164
  121    HB2  ASP  15           1HB      ASP  15  -7.050  13.498   8.169
  122    HB3  ASP  15           2HB      ASP  15  -5.750  14.592   7.704
  123    H    HIS  16           H        HIS  16  -9.340  16.557   8.644
  124    HA   HIS  16           HA       HIS  16 -11.204  14.637   9.335
  125    HD1  HIS  16           1HD      HIS  16 -11.067  18.835  11.230
  126    HD2  HIS  16           2HD      HIS  16 -10.988  14.698  11.605
  127    HE1  HIS  16           1HE      HIS  16 -10.230  18.387  13.558
  128    HB2  HIS  16           1HB      HIS  16 -11.425  17.624   9.029
  129    HB3  HIS  16           2HB      HIS  16 -12.795  16.651   9.557
  130    H    LEU  17           H        LEU  17 -10.874  16.424   6.368
  131    HA   LEU  17           HA       LEU  17 -13.393  16.218   5.262
  132    HG   LEU  17           HG       LEU  17 -13.137  17.952   3.730
  133    HB2  LEU  17           1HB      LEU  17 -10.639  16.350   4.194
  134    HB3  LEU  17           2HB      LEU  17 -11.891  15.807   3.078
  135   HD11  LEU  17          1HD1      LEU  17 -11.864  19.755   4.607
  136   HD12  LEU  17          2HD1      LEU  17 -10.374  18.814   4.558
  137   HD13  LEU  17          3HD1      LEU  17 -11.648  18.389   5.702
  138   HD21  LEU  17          3HD2      LEU  17 -10.547  18.112   2.189
  139   HD22  LEU  17          1HD2      LEU  17 -11.882  19.260   2.086
  140   HD23  LEU  17          2HD2      LEU  17 -12.109  17.596   1.551
  141    H    LEU  18           H        LEU  18 -14.668  14.551   4.845
  142    HA   LEU  18           HA       LEU  18 -14.044  11.893   5.259
  143    HG   LEU  18           HG       LEU  18 -16.237  13.821   5.777
  144    HB2  LEU  18           1HB      LEU  18 -16.108  12.936   3.325
  145    HB3  LEU  18           2HB      LEU  18 -16.093  11.351   4.096
  146   HD11  LEU  18          1HD1      LEU  18 -18.829  12.670   5.213
  147   HD12  LEU  18          2HD1      LEU  18 -18.079  13.334   3.763
  148   HD13  LEU  18          3HD1      LEU  18 -18.310  14.355   5.181
  149   HD21  LEU  18          3HD2      LEU  18 -17.582  11.171   6.186
  150   HD22  LEU  18          1HD2      LEU  18 -17.167  12.400   7.380
  151   HD23  LEU  18          2HD2      LEU  18 -15.896  11.431   6.635
  152    H    ILE  19           H        ILE  19 -14.499  13.407   2.057
  153    HA   ILE  19           HA       ILE  19 -13.633  11.307   0.495
  154    HB   ILE  19           HB       ILE  19 -13.325  14.270   0.012
  155   HG12  ILE  19          1HG1      ILE  19 -15.639  13.416   0.231
  156   HG13  ILE  19          2HG1      ILE  19 -15.296  14.004  -1.392
  157   HG21  ILE  19          1HG2      ILE  19 -12.381  11.972  -1.533
  158   HG22  ILE  19          2HG2      ILE  19 -13.358  13.113  -2.458
  159   HG23  ILE  19          3HG2      ILE  19 -11.910  13.669  -1.618
  160   HD11  ILE  19          3HD1      ILE  19 -15.984  12.072  -2.205
  161   HD12  ILE  19          1HD1      ILE  19 -14.669  11.257  -1.358
  162   HD13  ILE  19          2HD1      ILE  19 -16.237  11.451  -0.574
  163    H    GLU  20           H        GLU  20 -11.687  13.907   1.929
  164    HA   GLU  20           HA       GLU  20  -9.225  13.325   0.828
  165    HB2  GLU  20           1HB      GLU  20 -10.032  14.445   3.495
  166    HB3  GLU  20           2HB      GLU  20  -8.337  14.177   3.116
  167    HG2  GLU  20           1HG      GLU  20 -10.255  15.957   1.634
  168    HG3  GLU  20           2HG      GLU  20  -8.912  16.461   2.657
  169    H    GLN  21           H        GLN  21 -10.541  12.061   3.891
  170    HA   GLN  21           HA       GLN  21  -8.409  10.332   4.457
  171    HB2  GLN  21           1HB      GLN  21 -11.277  10.452   5.316
  172    HB3  GLN  21           2HB      GLN  21 -10.283   9.078   5.779
  173    HG2  GLN  21           1HG      GLN  21  -9.008  10.297   7.206
  174    HG3  GLN  21           2HG      GLN  21  -9.191  11.783   6.278
  175   HE21  GLN  21          1HE2      GLN  21  -9.794  10.593   9.157
  176   HE22  GLN  21          2HE2      GLN  21 -11.283  11.377   9.548
  177    H    ALA  22           H        ALA  22 -11.344   9.878   2.565
  178    HA   ALA  22           HA       ALA  22 -11.153   7.095   2.208
  179    HB1  ALA  22           3HB      ALA  22 -12.590   9.309   0.859
  180    HB2  ALA  22           1HB      ALA  22 -12.438   7.783  -0.013
  181    HB3  ALA  22           2HB      ALA  22 -13.212   7.820   1.572
  182    H    ASN  23           H        ASN  23  -9.997   9.786   0.190
  183    HA   ASN  23           HA       ASN  23  -8.888   8.213  -1.855
  184    HB2  ASN  23           1HB      ASN  23  -8.748  11.025  -1.001
  185    HB3  ASN  23           2HB      ASN  23  -7.317  10.455  -1.857
  186   HD21  ASN  23          1HD2      ASN  23 -10.704  11.142  -2.069
  187   HD22  ASN  23          2HD2      ASN  23 -10.829  11.033  -3.790
  188    H    HIS  24           H        HIS  24  -7.502   9.478   1.143
  189    HA   HIS  24           HA       HIS  24  -4.849   8.645   0.666
  190    HD1  HIS  24           1HD      HIS  24  -4.241  11.164   4.285
  191    HD2  HIS  24           2HD      HIS  24  -5.400  11.121   0.295
  192    HE1  HIS  24           1HE      HIS  24  -3.625  13.428   3.381
  193    HB2  HIS  24           1HB      HIS  24  -6.388   9.307   3.166
  194    HB3  HIS  24           2HB      HIS  24  -4.717   8.757   3.240
  195    H    ALA  25           H        ALA  25  -7.606   7.061   2.199
  196    HA   ALA  25           HA       ALA  25  -6.225   4.802   3.171
  197    HB1  ALA  25           3HB      ALA  25  -8.513   5.531   3.866
  198    HB2  ALA  25           1HB      ALA  25  -9.118   4.901   2.333
  199    HB3  ALA  25           2HB      ALA  25  -8.370   3.811   3.503
  200    H    ILE  26           H        ILE  26  -8.140   5.260   0.200
  201    HA   ILE  26           HA       ILE  26  -7.664   2.690  -0.851
  202    HB   ILE  26           HB       ILE  26  -8.398   3.605  -3.005
  203   HG12  ILE  26          1HG1      ILE  26  -8.336   6.271  -1.573
  204   HG13  ILE  26          2HG1      ILE  26  -7.265   5.778  -2.880
  205   HG21  ILE  26          1HG2      ILE  26 -10.550   3.646  -2.358
  206   HG22  ILE  26          2HG2      ILE  26  -9.886   3.293  -0.764
  207   HG23  ILE  26          3HG2      ILE  26 -10.286   4.953  -1.204
  208   HD11  ILE  26          3HD1      ILE  26  -9.795   5.406  -3.920
  209   HD12  ILE  26          1HD1      ILE  26  -9.928   6.894  -2.985
  210   HD13  ILE  26          2HD1      ILE  26  -8.707   6.753  -4.250
  211    H    GLU  27           H        GLU  27  -5.855   5.684  -1.009
  212    HA   GLU  27           HA       GLU  27  -4.115   4.972  -3.118
  213    HB2  GLU  27           1HB      GLU  27  -4.083   7.008  -0.935
  214    HB3  GLU  27           2HB      GLU  27  -2.588   6.693  -1.806
  215    HG2  GLU  27           1HG      GLU  27  -3.555   7.341  -3.874
  216    HG3  GLU  27           2HG      GLU  27  -5.171   7.391  -3.172
  217    H    LYS  28           H        LYS  28  -3.527   5.007   0.402
  218    HA   LYS  28           HA       LYS  28  -1.035   3.757   0.337
  219    HB2  LYS  28           1HB      LYS  28  -1.872   4.892   2.325
  220    HB3  LYS  28           2HB      LYS  28  -3.148   3.695   2.499
  221    HG2  LYS  28           1HG      LYS  28  -1.601   1.997   3.076
  222    HG3  LYS  28           2HG      LYS  28  -0.227   2.998   2.604
  223    HD2  LYS  28           1HD      LYS  28  -2.087   3.952   4.739
  224    HD3  LYS  28           2HD      LYS  28  -0.861   2.742   5.126
  225    HE2  LYS  28           1HE      LYS  28   0.899   4.206   4.451
  226    HE3  LYS  28           2HE      LYS  28  -0.246   5.365   3.778
  227    HZ1  LYS  28           3HZ      LYS  28  -1.080   5.782   6.007
  228    HZ2  LYS  28           1HZ      LYS  28   0.581   6.088   5.927
  229    HZ3  LYS  28           2HZ      LYS  28   0.017   4.669   6.654
  230    H    GLY  29           H        GLY  29  -4.281   2.355   0.650
  231    HA2  GLY  29           1HA      GLY  29  -3.434  -0.322   0.982
  232    HA3  GLY  29           2HA      GLY  29  -5.026   0.193   0.447
  233    H    GLU  30           H        GLU  30  -4.092   1.613  -1.884
  234    HA   GLU  30           HA       GLU  30  -4.051  -0.555  -3.720
  235    HB2  GLU  30           1HB      GLU  30  -5.080   1.650  -4.206
  236    HB3  GLU  30           2HB      GLU  30  -3.476   2.368  -4.235
  237    HG2  GLU  30           1HG      GLU  30  -3.689   0.075  -5.998
  238    HG3  GLU  30           2HG      GLU  30  -4.854   1.340  -6.387
  239    H    HIS  31           H        HIS  31  -1.594   1.614  -2.443
  240    HA   HIS  31           HA       HIS  31   0.474   0.805  -4.224
  241    HD1  HIS  31           1HD      HIS  31  -0.065   4.591  -1.863
  242    HD2  HIS  31           2HD      HIS  31   1.426   2.906  -5.356
  243    HE1  HIS  31           1HE      HIS  31  -0.158   6.421  -3.586
  244    HB2  HIS  31           1HB      HIS  31   0.499   2.214  -1.557
  245    HB3  HIS  31           2HB      HIS  31   1.973   1.856  -2.451
  246    H    GLN  32           H        GLN  32  -0.187   0.018  -0.811
  247    HA   GLN  32           HA       GLN  32   1.882  -1.859  -0.526
  248    HB2  GLN  32           1HB      GLN  32   0.776  -2.553   1.496
  249    HB3  GLN  32           2HB      GLN  32   0.634  -0.806   1.354
  250    HG2  GLN  32           1HG      GLN  32  -1.486  -1.359   1.990
  251    HG3  GLN  32           2HG      GLN  32  -1.655  -1.377   0.235
  252   HE21  GLN  32          1HE2      GLN  32  -0.357  -3.697   2.584
  253   HE22  GLN  32          2HE2      GLN  32  -1.354  -5.018   2.089
  254    H    LEU  33           H        LEU  33  -1.429  -2.172  -1.663
  255    HA   LEU  33           HA       LEU  33  -1.478  -5.012  -1.706
  256    HG   LEU  33           HG       LEU  33  -4.888  -4.884  -3.062
  257    HB2  LEU  33           1HB      LEU  33  -3.510  -3.656  -1.682
  258    HB3  LEU  33           2HB      LEU  33  -3.107  -3.018  -3.274
  259   HD11  LEU  33          1HD1      LEU  33  -4.602  -5.239  -5.266
  260   HD12  LEU  33          2HD1      LEU  33  -2.910  -5.698  -5.084
  261   HD13  LEU  33          3HD1      LEU  33  -3.364  -3.994  -5.100
  262   HD21  LEU  33          3HD2      LEU  33  -3.062  -6.235  -1.704
  263   HD22  LEU  33          1HD2      LEU  33  -2.601  -6.760  -3.324
  264   HD23  LEU  33          2HD2      LEU  33  -4.240  -7.045  -2.739
  265    H    LEU  34           H        LEU  34  -0.868  -2.559  -4.199
  266    HA   LEU  34           HA       LEU  34  -0.533  -4.290  -6.365
  267    HG   LEU  34           HG       LEU  34  -1.869  -1.808  -6.516
  268    HB2  LEU  34           1HB      LEU  34   0.499  -1.552  -5.732
  269    HB3  LEU  34           2HB      LEU  34   1.010  -2.383  -7.200
  270   HD11  LEU  34          1HD1      LEU  34  -0.458   0.249  -6.800
  271   HD12  LEU  34          2HD1      LEU  34  -1.779   0.077  -7.955
  272   HD13  LEU  34          3HD1      LEU  34  -0.127  -0.292  -8.445
  273   HD21  LEU  34          3HD2      LEU  34  -0.634  -3.462  -8.448
  274   HD22  LEU  34          1HD2      LEU  34  -1.303  -2.067  -9.295
  275   HD23  LEU  34          2HD2      LEU  34  -2.345  -3.064  -8.279
  276    H    TYR  35           H        TYR  35   1.840  -3.045  -4.041
  277    HA   TYR  35           HA       TYR  35   4.052  -4.391  -5.240
  278    HD1  TYR  35           1HD      TYR  35   6.684  -3.179  -4.663
  279    HD2  TYR  35           2HD      TYR  35   4.883  -4.676  -1.112
  280    HE1  TYR  35           1HE      TYR  35   8.867  -4.041  -3.927
  281    HE2  TYR  35           2HE      TYR  35   7.061  -5.540  -0.365
  282    HH   TYR  35           HH       TYR  35   9.742  -4.677  -1.123
  283    HB2  TYR  35           1HB      TYR  35   4.462  -2.412  -3.927
  284    HB3  TYR  35           2HB      TYR  35   3.695  -3.132  -2.516
  285    H    LEU  36           H        LEU  36   1.751  -5.161  -2.714
  286    HA   LEU  36           HA       LEU  36   3.132  -7.408  -1.665
  287    HG   LEU  36           HG       LEU  36   0.365  -9.025  -0.956
  288    HB2  LEU  36           1HB      LEU  36   1.396  -6.247  -0.414
  289    HB3  LEU  36           2HB      LEU  36   0.196  -6.718  -1.615
  290   HD11  LEU  36          1HD1      LEU  36   1.892  -9.105   1.339
  291   HD12  LEU  36          2HD1      LEU  36   2.856  -8.126   0.234
  292   HD13  LEU  36          3HD1      LEU  36   2.346  -9.746  -0.240
  293   HD21  LEU  36          3HD2      LEU  36   0.262  -7.995   1.755
  294   HD22  LEU  36          1HD2      LEU  36  -1.009  -8.720   0.771
  295   HD23  LEU  36          2HD2      LEU  36  -0.654  -6.998   0.622
  296    H    GLN  37           H        GLN  37   0.957  -6.936  -4.351
  297    HA   GLN  37           HA       GLN  37   0.047  -9.494  -4.829
  298    HB2  GLN  37           1HB      GLN  37  -0.091  -7.114  -6.161
  299    HB3  GLN  37           2HB      GLN  37   0.920  -8.059  -7.245
  300    HG2  GLN  37           1HG      GLN  37  -0.745  -9.611  -7.658
  301    HG3  GLN  37           2HG      GLN  37  -1.637  -9.192  -6.197
  302   HE21  GLN  37          1HE2      GLN  37  -2.941  -7.356  -6.186
  303   HE22  GLN  37          2HE2      GLN  37  -3.446  -6.583  -7.646
  304    H    HIS  38           H        HIS  38   3.162  -8.065  -5.698
  305    HA   HIS  38           HA       HIS  38   4.137 -10.202  -7.238
  306    HD1  HIS  38           1HD      HIS  38   6.996 -11.038  -6.909
  307    HD2  HIS  38           2HD      HIS  38   6.585  -7.452  -8.965
  308    HE1  HIS  38           1HE      HIS  38   8.518 -11.228  -8.903
  309    HB2  HIS  38           1HB      HIS  38   5.063  -7.755  -6.765
  310    HB3  HIS  38           2HB      HIS  38   6.028  -8.612  -5.567
  311    H    GLN  39           H        GLN  39   4.662  -9.433  -3.799
  312    HA   GLN  39           HA       GLN  39   6.255 -11.597  -3.130
  313    HB2  GLN  39           1HB      GLN  39   4.201 -10.122  -1.484
  314    HB3  GLN  39           2HB      GLN  39   5.311 -11.307  -0.810
  315    HG2  GLN  39           1HG      GLN  39   5.966  -8.653  -2.049
  316    HG3  GLN  39           2HG      GLN  39   6.236  -9.179  -0.388
  317   HE21  GLN  39          1HE2      GLN  39   7.855  -8.389  -2.989
  318   HE22  GLN  39          2HE2      GLN  39   9.190  -9.484  -2.915
  319    H    LEU  40           H        LEU  40   2.727 -11.380  -3.253
  320    HA   LEU  40           HA       LEU  40   2.195 -13.944  -2.209
  321    HG   LEU  40           HG       LEU  40  -0.081 -14.837  -3.415
  322    HB2  LEU  40           1HB      LEU  40   0.400 -12.448  -2.223
  323    HB3  LEU  40           2HB      LEU  40   0.646 -12.030  -3.917
  324   HD11  LEU  40          1HD1      LEU  40  -1.425 -13.582  -1.719
  325   HD12  LEU  40          2HD1      LEU  40  -2.377 -14.435  -2.934
  326   HD13  LEU  40          3HD1      LEU  40  -2.158 -12.689  -3.052
  327   HD21  LEU  40          3HD2      LEU  40  -1.791 -13.440  -5.208
  328   HD22  LEU  40          1HD2      LEU  40  -0.562 -14.652  -5.572
  329   HD23  LEU  40          2HD2      LEU  40  -0.127 -12.944  -5.521
  330    H    ASP  41           H        ASP  41   2.452 -12.775  -5.555
  331    HA   ASP  41           HA       ASP  41   1.868 -15.133  -6.888
  332    HB2  ASP  41           1HB      ASP  41   3.504 -12.724  -7.545
  333    HB3  ASP  41           2HB      ASP  41   3.621 -14.126  -8.603
  334    H    GLU  42           H        GLU  42   5.018 -13.975  -5.720
  335    HA   GLU  42           HA       GLU  42   6.430 -16.291  -6.608
  336    HB2  GLU  42           1HB      GLU  42   8.327 -15.376  -5.438
  337    HB3  GLU  42           2HB      GLU  42   7.494 -14.069  -6.268
  338    HG2  GLU  42           1HG      GLU  42   6.534 -13.284  -4.241
  339    HG3  GLU  42           2HG      GLU  42   7.085 -14.708  -3.361
  340    H    LEU  43           H        LEU  43   4.726 -15.402  -3.709
  341    HA   LEU  43           HA       LEU  43   5.861 -17.363  -1.996
  342    HG   LEU  43           HG       LEU  43   3.802 -18.028  -0.225
  343    HB2  LEU  43           1HB      LEU  43   4.830 -15.652  -0.848
  344    HB3  LEU  43           2HB      LEU  43   3.439 -15.625  -1.930
  345   HD11  LEU  43          1HD1      LEU  43   2.783 -15.400   0.844
  346   HD12  LEU  43          2HD1      LEU  43   4.283 -16.194   1.320
  347   HD13  LEU  43          3HD1      LEU  43   2.732 -16.954   1.676
  348   HD21  LEU  43          3HD2      LEU  43   1.776 -18.386  -1.056
  349   HD22  LEU  43          1HD2      LEU  43   1.772 -16.799  -1.826
  350   HD23  LEU  43          2HD2      LEU  43   1.193 -16.977  -0.169
  351    H    ASN  44           H        ASN  44   3.245 -17.370  -4.307
  352    HA   ASN  44           HA       ASN  44   1.833 -19.623  -3.507
  353    HB2  ASN  44           1HB      ASN  44   2.390 -18.586  -6.293
  354    HB3  ASN  44           2HB      ASN  44   1.216 -19.846  -5.929
  355   HD21  ASN  44          1HD2      ASN  44   0.173 -17.836  -7.173
  356   HD22  ASN  44          2HD2      ASN  44  -0.706 -16.777  -6.128
  357    H    GLU  45           H        GLU  45   4.733 -19.384  -5.526
  358    HA   GLU  45           HA       GLU  45   4.897 -22.281  -5.741
  359    HB2  GLU  45           1HB      GLU  45   5.438 -20.605  -7.622
  360    HB3  GLU  45           2HB      GLU  45   6.945 -20.328  -6.760
  361    HG2  GLU  45           1HG      GLU  45   7.692 -22.511  -7.122
  362    HG3  GLU  45           2HG      GLU  45   6.080 -23.084  -7.549
  363    H    ASN  46           H        ASN  46   6.822 -19.599  -4.428
  364    HA   ASN  46           HA       ASN  46   8.948 -21.051  -3.400
  365    HB2  ASN  46           1HB      ASN  46   8.668 -18.520  -3.498
  366    HB3  ASN  46           2HB      ASN  46   7.736 -18.661  -2.011
  367   HD21  ASN  46          1HD2      ASN  46  10.302 -17.340  -2.579
  368   HD22  ASN  46          2HD2      ASN  46  11.428 -18.011  -1.453
  369    H    LYS  47           H        LYS  47   5.741 -20.509  -2.064
  370    HA   LYS  47           HA       LYS  47   4.679 -21.326  -0.218
  371    HB2  LYS  47           1HB      LYS  47   6.484 -23.703  -0.702
  372    HB3  LYS  47           2HB      LYS  47   4.968 -23.711   0.189
  373    HG2  LYS  47           1HG      LYS  47   4.984 -22.810  -2.653
  374    HG3  LYS  47           2HG      LYS  47   5.059 -24.534  -2.283
  375    HD2  LYS  47           1HD      LYS  47   3.042 -23.970  -0.705
  376    HD3  LYS  47           2HD      LYS  47   2.870 -22.569  -1.767
  377    HE2  LYS  47           1HE      LYS  47   2.061 -23.810  -3.446
  378    HE3  LYS  47           2HE      LYS  47   3.269 -25.072  -3.212
  379    HZ1  LYS  47           3HZ      LYS  47   1.654 -25.365  -1.062
  380    HZ2  LYS  47           1HZ      LYS  47   1.565 -26.283  -2.481
  381    HZ3  LYS  47           2HZ      LYS  47   0.556 -24.942  -2.277
  382    H    SER  48           H        SER  48   6.968 -19.703   0.322
  383    HA   SER  48           HA       SER  48   8.511 -20.896   2.418
  384    HG   SER  48           HG       SER  48  10.016 -17.652   2.855
  385    HB2  SER  48           1HB      SER  48   9.490 -19.099   1.129
  386    HB3  SER  48           2HB      SER  48   8.170 -18.013   1.564
  387    H    LYS  49           H        LYS  49   7.814 -21.290   4.400
  388    HA   LYS  49           HA       LYS  49   5.340 -20.513   5.423
  389    HB2  LYS  49           1HB      LYS  49   6.353 -21.181   7.662
  390    HB3  LYS  49           2HB      LYS  49   6.368 -22.403   6.398
  391    HG2  LYS  49           1HG      LYS  49   8.775 -20.801   6.359
  392    HG3  LYS  49           2HG      LYS  49   8.517 -21.569   7.927
  393    HD2  LYS  49           1HD      LYS  49   8.923 -23.625   7.118
  394    HD3  LYS  49           2HD      LYS  49   8.018 -23.322   5.634
  395    HE2  LYS  49           1HE      LYS  49  10.502 -21.802   5.802
  396    HE3  LYS  49           2HE      LYS  49  10.752 -23.546   5.842
  397    HZ1  LYS  49           3HZ      LYS  49   9.008 -23.359   3.853
  398    HZ2  LYS  49           1HZ      LYS  49  10.683 -23.289   3.621
  399    HZ3  LYS  49           2HZ      LYS  49   9.777 -21.862   3.684
  400    H    GLU  50           H        GLU  50   8.506 -19.006   5.695
  401    HA   GLU  50           HA       GLU  50   7.792 -17.111   7.683
  402    HB2  GLU  50           1HB      GLU  50  10.023 -17.251   5.666
  403    HB3  GLU  50           2HB      GLU  50   9.838 -15.873   6.744
  404    HG2  GLU  50           1HG      GLU  50  10.186 -17.213   8.664
  405    HG3  GLU  50           2HG      GLU  50  10.055 -18.702   7.729
  406    H    LEU  51           H        LEU  51   8.159 -16.812   4.150
  407    HA   LEU  51           HA       LEU  51   7.374 -14.155   3.910
  408    HG   LEU  51           HG       LEU  51   5.605 -14.707   1.136
  409    HB2  LEU  51           1HB      LEU  51   8.387 -15.366   2.083
  410    HB3  LEU  51           2HB      LEU  51   7.002 -16.452   1.995
  411   HD11  LEU  51          1HD1      LEU  51   7.840 -12.963   2.017
  412   HD12  LEU  51          2HD1      LEU  51   6.097 -12.722   2.138
  413   HD13  LEU  51          3HD1      LEU  51   6.916 -12.478   0.595
  414   HD21  LEU  51          3HD2      LEU  51   6.639 -14.313  -0.979
  415   HD22  LEU  51          1HD2      LEU  51   7.161 -15.902  -0.416
  416   HD23  LEU  51          2HD2      LEU  51   8.251 -14.520  -0.293
  417    H    GLN  52           H        GLN  52   5.440 -17.084   4.129
  418    HA   GLN  52           HA       GLN  52   2.957 -15.873   3.477
  419    HB2  GLN  52           1HB      GLN  52   3.536 -18.360   3.455
  420    HB3  GLN  52           2HB      GLN  52   3.306 -18.321   5.198
  421    HG2  GLN  52           1HG      GLN  52   1.007 -17.208   4.483
  422    HG3  GLN  52           2HG      GLN  52   1.320 -18.129   3.013
  423   HE21  GLN  52          1HE2      GLN  52   1.695 -20.432   3.253
  424   HE22  GLN  52          2HE2      GLN  52   0.903 -21.287   4.528
  425    H    GLU  53           H        GLU  53   4.269 -16.949   6.617
  426    HA   GLU  53           HA       GLU  53   2.259 -15.911   8.227
  427    HB2  GLU  53           1HB      GLU  53   5.097 -16.681   8.637
  428    HB3  GLU  53           2HB      GLU  53   4.364 -15.675   9.878
  429    HG2  GLU  53           1HG      GLU  53   2.583 -17.318  10.166
  430    HG3  GLU  53           2HG      GLU  53   3.310 -18.326   8.917
  431    H    LYS  54           H        LYS  54   4.954 -14.321   6.695
  432    HA   LYS  54           HA       LYS  54   4.811 -11.915   8.233
  433    HB2  LYS  54           1HB      LYS  54   6.148 -12.653   5.638
  434    HB3  LYS  54           2HB      LYS  54   6.180 -11.006   6.257
  435    HG2  LYS  54           1HG      LYS  54   7.173 -13.401   7.784
  436    HG3  LYS  54           2HG      LYS  54   8.197 -12.348   6.804
  437    HD2  LYS  54           1HD      LYS  54   7.211 -10.440   8.238
  438    HD3  LYS  54           2HD      LYS  54   6.730 -11.727   9.346
  439    HE2  LYS  54           1HE      LYS  54   9.086 -12.479   9.425
  440    HE3  LYS  54           2HE      LYS  54   9.530 -11.112   8.404
  441    HZ1  LYS  54           3HZ      LYS  54   8.014 -10.270  10.658
  442    HZ2  LYS  54           1HZ      LYS  54   9.551  -9.774  10.154
  443    HZ3  LYS  54           2HZ      LYS  54   9.384 -11.135  11.146
  444    H    ILE  55           H        ILE  55   3.875 -12.694   4.879
  445    HA   ILE  55           HA       ILE  55   2.656 -10.268   4.269
  446    HB   ILE  55           HB       ILE  55   1.961 -13.026   3.253
  447   HG12  ILE  55          1HG1      ILE  55   3.529 -10.940   1.772
  448   HG13  ILE  55          2HG1      ILE  55   4.331 -11.967   2.956
  449   HG21  ILE  55          1HG2      ILE  55   1.245 -11.433   1.241
  450   HG22  ILE  55          2HG2      ILE  55   0.129 -11.905   2.520
  451   HG23  ILE  55          3HG2      ILE  55   0.927 -10.334   2.583
  452   HD11  ILE  55          3HD1      ILE  55   3.810 -13.926   1.722
  453   HD12  ILE  55          1HD1      ILE  55   2.739 -13.034   0.642
  454   HD13  ILE  55          2HD1      ILE  55   4.479 -12.749   0.592
  455    H    ILE  56           H        ILE  56   1.339 -13.140   5.843
  456    HA   ILE  56           HA       ILE  56  -1.360 -12.368   5.870
  457    HB   ILE  56           HB       ILE  56   0.145 -14.099   7.834
  458   HG12  ILE  56          1HG1      ILE  56  -1.731 -15.080   5.709
  459   HG13  ILE  56          2HG1      ILE  56  -0.066 -14.686   5.291
  460   HG21  ILE  56          1HG2      ILE  56  -2.775 -13.505   7.512
  461   HG22  ILE  56          2HG2      ILE  56  -2.223 -15.028   8.208
  462   HG23  ILE  56          3HG2      ILE  56  -1.796 -13.499   8.978
  463   HD11  ILE  56          3HD1      ILE  56  -0.436 -16.430   7.635
  464   HD12  ILE  56          1HD1      ILE  56  -0.867 -17.116   6.070
  465   HD13  ILE  56          2HD1      ILE  56   0.761 -16.495   6.341
  466    H    ARG  57           H        ARG  57   1.207 -11.901   8.283
  467    HA   ARG  57           HA       ARG  57  -0.366 -10.594  10.205
  468    HE   ARG  57           HE       ARG  57   0.586 -12.887  13.269
  469    HB2  ARG  57           1HB      ARG  57   2.491 -11.010   9.700
  470    HB3  ARG  57           2HB      ARG  57   2.137  -9.504  10.535
  471    HG2  ARG  57           1HG      ARG  57   2.504 -11.056  12.237
  472    HG3  ARG  57           2HG      ARG  57   0.748 -10.913  12.139
  473    HD2  ARG  57           1HD      ARG  57   0.961 -12.923  10.491
  474    HD3  ARG  57           2HD      ARG  57   2.522 -13.156  11.278
  475   HH11  ARG  57          1HH1      ARG  57   1.450 -15.093  10.719
  476   HH12  ARG  57          2HH1      ARG  57   0.811 -16.485  11.529
  477   HH21  ARG  57          1HH2      ARG  57  -0.260 -14.711  14.345
  478   HH22  ARG  57          2HH2      ARG  57  -0.162 -16.267  13.590
  479    H    GLU  58           H        GLU  58   1.809  -9.217   7.737
  480    HA   GLU  58           HA       GLU  58   1.233  -6.529   8.264
  481    HB2  GLU  58           1HB      GLU  58   3.009  -7.754   6.680
  482    HB3  GLU  58           2HB      GLU  58   1.816  -7.327   5.461
  483    HG2  GLU  58           1HG      GLU  58   2.078  -5.037   5.838
  484    HG3  GLU  58           2HG      GLU  58   2.882  -5.295   7.386
  485    H    LEU  59           H        LEU  59  -0.107  -8.674   5.754
  486    HA   LEU  59           HA       LEU  59  -1.928  -6.856   4.671
  487    HG   LEU  59           HG       LEU  59  -3.337  -9.559   2.610
  488    HB2  LEU  59           1HB      LEU  59  -1.340  -8.948   3.584
  489    HB3  LEU  59           2HB      LEU  59  -2.121  -9.857   4.877
  490   HD11  LEU  59          1HD1      LEU  59  -4.216 -10.422   4.855
  491   HD12  LEU  59          2HD1      LEU  59  -5.392  -9.860   3.669
  492   HD13  LEU  59          3HD1      LEU  59  -4.950  -8.828   5.029
  493   HD21  LEU  59          3HD2      LEU  59  -4.328  -7.580   2.104
  494   HD22  LEU  59          1HD2      LEU  59  -2.923  -6.953   2.965
  495   HD23  LEU  59          2HD2      LEU  59  -4.474  -7.091   3.792
  496    H    ASP  60           H        ASP  60  -2.206  -9.026   7.429
  497    HA   ASP  60           HA       ASP  60  -4.966  -8.763   7.873
  498    HB2  ASP  60           1HB      ASP  60  -3.638 -10.495   8.968
  499    HB3  ASP  60           2HB      ASP  60  -2.738  -9.269   9.858
  500    H    VAL  61           H        VAL  61  -2.238  -7.006   9.348
  501    HA   VAL  61           HA       VAL  61  -3.744  -5.274  10.938
  502    HB   VAL  61           HB       VAL  61  -1.076  -4.717   9.632
  503   HG11  VAL  61          1HG1      VAL  61  -1.347  -2.676  10.490
  504   HG12  VAL  61          2HG1      VAL  61  -2.773  -3.165  11.410
  505   HG13  VAL  61          3HG1      VAL  61  -1.159  -3.431  12.072
  506   HG21  VAL  61          3HG2      VAL  61  -1.746  -6.685  11.490
  507   HG22  VAL  61          1HG2      VAL  61  -0.128  -6.109  11.086
  508   HG23  VAL  61          2HG2      VAL  61  -1.007  -5.393  12.438
  509    H    VAL  62           H        VAL  62  -2.462  -4.785   7.653
  510    HA   VAL  62           HA       VAL  62  -3.501  -2.195   7.293
  511    HB   VAL  62           HB       VAL  62  -2.878  -4.287   5.202
  512   HG11  VAL  62          1HG1      VAL  62  -2.650  -2.338   3.684
  513   HG12  VAL  62          2HG1      VAL  62  -4.299  -2.587   4.262
  514   HG13  VAL  62          3HG1      VAL  62  -3.301  -1.311   4.961
  515   HG21  VAL  62          3HG2      VAL  62  -1.166  -2.984   6.966
  516   HG22  VAL  62          1HG2      VAL  62  -0.717  -3.835   5.487
  517   HG23  VAL  62          2HG2      VAL  62  -1.008  -2.095   5.451
  518    H    CYS  63           H        CYS  63  -4.706  -5.296   5.997
  519    HA   CYS  63           HA       CYS  63  -7.060  -4.341   4.885
  520    HG   CYS  63           HG       CYS  63  -8.556  -8.331   5.136
  521    HB2  CYS  63           1HB      CYS  63  -6.302  -6.574   4.398
  522    HB3  CYS  63           2HB      CYS  63  -6.438  -7.041   6.089
  523    H    ALA  64           H        ALA  64  -6.264  -4.986   8.202
  524    HA   ALA  64           HA       ALA  64  -8.937  -5.086   9.191
  525    HB1  ALA  64           3HB      ALA  64  -7.893  -4.823  11.405
  526    HB2  ALA  64           1HB      ALA  64  -7.127  -6.088  10.444
  527    HB3  ALA  64           2HB      ALA  64  -6.343  -4.518  10.620
  528    H    MET  65           H        MET  65  -6.417  -2.570   9.473
  529    HA   MET  65           HA       MET  65  -8.128  -0.601  10.526
  530    HB2  MET  65           1HB      MET  65  -6.343   0.916  10.238
  531    HB3  MET  65           2HB      MET  65  -5.581  -0.638  10.547
  532    HG2  MET  65           1HG      MET  65  -5.193  -0.923   8.151
  533    HG3  MET  65           2HG      MET  65  -5.948   0.640   7.849
  534    HE1  MET  65           3HE      MET  65  -2.135  -0.048  10.256
  535    HE2  MET  65           1HE      MET  65  -3.498  -1.145  10.030
  536    HE3  MET  65           2HE      MET  65  -2.285  -0.972   8.761
  537    H    ILE  66           H        ILE  66  -7.327  -1.517   7.238
  538    HA   ILE  66           HA       ILE  66  -8.478   0.760   5.980
  539    HB   ILE  66           HB       ILE  66  -7.410  -1.844   5.095
  540   HG12  ILE  66          1HG1      ILE  66  -6.304  -0.433   3.436
  541   HG13  ILE  66          2HG1      ILE  66  -7.309   0.935   3.901
  542   HG21  ILE  66          1HG2      ILE  66  -9.558  -0.397   3.569
  543   HG22  ILE  66          2HG2      ILE  66  -8.399  -1.476   2.794
  544   HG23  ILE  66          3HG2      ILE  66  -9.498  -2.100   4.025
  545   HD11  ILE  66          3HD1      ILE  66  -6.218   1.183   5.947
  546   HD12  ILE  66          1HD1      ILE  66  -5.502  -0.426   5.862
  547   HD13  ILE  66          2HD1      ILE  66  -4.928   0.853   4.790
  548    H    GLU  67           H        GLU  67  -9.653  -2.554   6.531
  549    HA   GLU  67           HA       GLU  67 -12.148  -2.266   5.307
  550    HB2  GLU  67           1HB      GLU  67 -11.060  -4.082   7.423
  551    HB3  GLU  67           2HB      GLU  67 -12.785  -4.099   7.080
  552    HG2  GLU  67           1HG      GLU  67 -12.303  -4.602   4.730
  553    HG3  GLU  67           2HG      GLU  67 -10.579  -4.620   5.099
  554    H    GLY  68           H        GLY  68 -11.253  -1.872   8.735
  555    HA2  GLY  68           1HA      GLY  68 -13.825  -1.126   9.624
  556    HA3  GLY  68           2HA      GLY  68 -12.316  -0.796  10.461
  557    H    ALA  69           H        ALA  69 -11.045   0.832   8.608
  558    HA   ALA  69           HA       ALA  69 -12.175   3.340   9.192
  559    HB1  ALA  69           3HB      ALA  69 -10.052   2.543   7.211
  560    HB2  ALA  69           1HB      ALA  69 -10.480   4.216   7.576
  561    HB3  ALA  69           2HB      ALA  69  -9.822   3.176   8.841
  562    H    GLN  70           H        GLN  70 -11.931   1.629   6.071
  563    HA   GLN  70           HA       GLN  70 -13.346   3.453   4.529
  564    HB2  GLN  70           1HB      GLN  70 -12.090   1.136   3.995
  565    HB3  GLN  70           2HB      GLN  70 -13.757   0.580   3.926
  566    HG2  GLN  70           1HG      GLN  70 -13.082   3.052   2.444
  567    HG3  GLN  70           2HG      GLN  70 -12.475   1.524   1.807
  568   HE21  GLN  70          1HE2      GLN  70 -14.434  -0.223   2.273
  569   HE22  GLN  70          2HE2      GLN  70 -15.887   0.235   1.459
  570    H    GLY  71           H        GLY  71 -14.574   0.576   6.234
  571    HA2  GLY  71           1HA      GLY  71 -17.251   0.792   5.506
  572    HA3  GLY  71           2HA      GLY  71 -16.675   0.061   6.998
  573    H    ALA  72           H        ALA  72 -15.685   2.092   8.433
  574    HA   ALA  72           HA       ALA  72 -17.977   3.357   9.453
  575    HB1  ALA  72           3HB      ALA  72 -16.453   4.585  10.896
  576    HB2  ALA  72           1HB      ALA  72 -15.983   2.888  10.798
  577    HB3  ALA  72           2HB      ALA  72 -15.087   4.105   9.888
  578    H    LEU  73           H        LEU  73 -15.220   4.760   7.673
  579    HA   LEU  73           HA       LEU  73 -16.108   7.363   7.488
  580    HG   LEU  73           HG       LEU  73 -14.579   8.704   6.615
  581    HB2  LEU  73           1HB      LEU  73 -13.949   6.073   6.597
  582    HB3  LEU  73           2HB      LEU  73 -14.832   6.202   5.078
  583   HD11  LEU  73          1HD1      LEU  73 -12.333   7.239   6.640
  584   HD12  LEU  73          2HD1      LEU  73 -12.344   8.998   6.518
  585   HD13  LEU  73          3HD1      LEU  73 -12.166   8.015   5.066
  586   HD21  LEU  73          3HD2      LEU  73 -14.846   7.779   3.861
  587   HD22  LEU  73          1HD2      LEU  73 -13.696   9.101   4.053
  588   HD23  LEU  73          2HD2      LEU  73 -15.360   9.294   4.605
  589    H    GLU  74           H        GLU  74 -16.762   4.683   5.244
  590    HA   GLU  74           HA       GLU  74 -18.297   6.103   3.397
  591    HB2  GLU  74           1HB      GLU  74 -17.947   3.259   4.127
  592    HB3  GLU  74           2HB      GLU  74 -19.435   3.651   3.276
  593    HG2  GLU  74           1HG      GLU  74 -16.684   4.376   2.300
  594    HG3  GLU  74           2HG      GLU  74 -17.574   2.939   1.802
  595    H    ARG  75           H        ARG  75 -19.342   4.247   6.247
  596    HA   ARG  75           HA       ARG  75 -22.091   4.726   5.969
  597    HE   ARG  75           HE       ARG  75 -19.722   2.476   9.287
  598    HB2  ARG  75           1HB      ARG  75 -20.388   4.104   8.379
  599    HB3  ARG  75           2HB      ARG  75 -22.138   4.256   8.471
  600    HG2  ARG  75           1HG      ARG  75 -22.365   2.436   6.837
  601    HG3  ARG  75           2HG      ARG  75 -20.609   2.268   6.804
  602    HD2  ARG  75           1HD      ARG  75 -22.481   1.761   9.104
  603    HD3  ARG  75           2HD      ARG  75 -21.431   0.606   8.284
  604   HH11  ARG  75          1HH1      ARG  75 -22.207   0.450  10.643
  605   HH12  ARG  75          2HH1      ARG  75 -21.444   0.330  12.195
  606   HH21  ARG  75          1HH2      ARG  75 -18.707   2.325  11.325
  607   HH22  ARG  75          2HH2      ARG  75 -19.454   1.397  12.581
  608    H    GLU  76           H        GLU  76 -19.516   6.684   7.251
  609    HA   GLU  76           HA       GLU  76 -21.239   8.534   8.618
  610    HB2  GLU  76           1HB      GLU  76 -18.816   8.070   9.196
  611    HB3  GLU  76           2HB      GLU  76 -18.381   8.996   7.766
  612    HG2  GLU  76           1HG      GLU  76 -18.265  10.295   9.860
  613    HG3  GLU  76           2HG      GLU  76 -19.371  10.978   8.669
  614    H    LEU  77           H        LEU  77 -19.231   8.743   5.677
  615    HA   LEU  77           HA       LEU  77 -20.186  11.272   4.879
  616    HG   LEU  77           HG       LEU  77 -19.075   7.960   3.809
  617    HB2  LEU  77           1HB      LEU  77 -19.232  10.693   2.672
  618    HB3  LEU  77           2HB      LEU  77 -18.116  10.446   4.014
  619   HD11  LEU  77          1HD1      LEU  77 -19.721   7.312   1.705
  620   HD12  LEU  77          2HD1      LEU  77 -18.965   8.701   0.924
  621   HD13  LEU  77          3HD1      LEU  77 -20.474   8.903   1.811
  622   HD21  LEU  77          3HD2      LEU  77 -17.107   8.016   1.841
  623   HD22  LEU  77          1HD2      LEU  77 -16.874   7.771   3.572
  624   HD23  LEU  77          2HD2      LEU  77 -16.746   9.391   2.886
  625    H    LYS  78           H        LYS  78 -21.442   8.063   4.503
  626    HA   LYS  78           HA       LYS  78 -23.147   8.463   2.308
  627    HB2  LYS  78           1HB      LYS  78 -22.989   6.524   4.555
  628    HB3  LYS  78           2HB      LYS  78 -24.519   6.625   3.693
  629    HG2  LYS  78           1HG      LYS  78 -21.908   6.243   2.266
  630    HG3  LYS  78           2HG      LYS  78 -22.848   4.890   2.896
  631    HD2  LYS  78           1HD      LYS  78 -24.674   5.371   1.474
  632    HD3  LYS  78           2HD      LYS  78 -24.028   6.960   1.059
  633    HE2  LYS  78           1HE      LYS  78 -22.424   6.083  -0.357
  634    HE3  LYS  78           2HE      LYS  78 -22.450   4.503   0.425
  635    HZ1  LYS  78           3HZ      LYS  78 -23.646   3.975  -1.392
  636    HZ2  LYS  78           1HZ      LYS  78 -24.160   5.562  -1.673
  637    HZ3  LYS  78           2HZ      LYS  78 -24.932   4.619  -0.500
  638    H    ARG  79           H        ARG  79 -23.284   9.674   5.494
  639    HA   ARG  79           HA       ARG  79 -25.980   9.892   6.036
  640    HE   ARG  79           HE       ARG  79 -26.326   8.702   7.986
  641    HB2  ARG  79           1HB      ARG  79 -23.652  11.693   6.645
  642    HB3  ARG  79           2HB      ARG  79 -25.280  12.122   7.152
  643    HG2  ARG  79           1HG      ARG  79 -24.268   9.415   7.832
  644    HG3  ARG  79           2HG      ARG  79 -23.640  10.798   8.729
  645    HD2  ARG  79           1HD      ARG  79 -25.438  10.396  10.037
  646    HD3  ARG  79           2HD      ARG  79 -26.258  11.365   8.812
  647   HH11  ARG  79          1HH1      ARG  79 -27.592  10.694  10.545
  648   HH12  ARG  79          2HH1      ARG  79 -29.014   9.730  10.769
  649   HH21  ARG  79          1HH2      ARG  79 -28.194   7.424   8.272
  650   HH22  ARG  79          2HH2      ARG  79 -29.356   7.870   9.476
  651    H    THR  80           H        THR  80 -24.032  11.708   3.769
  652    HA   THR  80           HA       THR  80 -26.390  12.684   2.443
  653    HB   THR  80           HB       THR  80 -25.310  15.109   2.556
  654    HG1  THR  80           1HG      THR  80 -23.786  15.133   4.028
  655   HG21  THR  80          3HG2      THR  80 -27.240  15.608   3.570
  656   HG22  THR  80          1HG2      THR  80 -26.801  14.699   5.015
  657   HG23  THR  80          2HG2      THR  80 -27.541  13.873   3.644
  658    H    ASP  81           H        ASP  81 -25.973  13.477   0.356
  659    HA   ASP  81           HA       ASP  81 -23.406  14.013  -0.670
  660    HB2  ASP  81           1HB      ASP  81 -23.123  11.571  -0.276
  661    HB3  ASP  81           2HB      ASP  81 -24.467  11.270  -1.374
  662    H    LEU  82           H        LEU  82 -25.695  15.385  -0.923
  663    HA   LEU  82           HA       LEU  82 -26.860  14.731  -3.524
  664    HG   LEU  82           HG       LEU  82 -29.951  16.495  -2.570
  665    HB2  LEU  82           1HB      LEU  82 -28.098  15.521  -1.328
  666    HB3  LEU  82           2HB      LEU  82 -27.685  17.117  -1.950
  667   HD11  LEU  82          1HD1      LEU  82 -29.845  17.132  -4.813
  668   HD12  LEU  82          2HD1      LEU  82 -28.302  16.319  -5.068
  669   HD13  LEU  82          3HD1      LEU  82 -28.371  17.797  -4.109
  670   HD21  LEU  82          3HD2      LEU  82 -29.158  13.965  -2.684
  671   HD22  LEU  82          1HD2      LEU  82 -29.007  14.357  -4.397
  672   HD23  LEU  82          2HD2      LEU  82 -30.559  14.550  -3.582
  673    H    ASN  83           H        ASN  83 -25.100  15.260  -4.858
  674    HA   ASN  83           HA       ASN  83 -25.068  17.861  -5.872
  675    HB2  ASN  83           1HB      ASN  83 -23.401  17.527  -3.566
  676    HB3  ASN  83           2HB      ASN  83 -22.378  17.799  -4.974
  677   HD21  ASN  83          1HD2      ASN  83 -23.560  19.545  -6.485
  678   HD22  ASN  83          2HD2      ASN  83 -23.921  21.015  -5.651
  679    H    ILE  84           H        ILE  84 -23.697  18.091  -7.699
  680    HA   ILE  84           HA       ILE  84 -23.236  15.708  -9.124
  681    HB   ILE  84           HB       ILE  84 -22.099  18.450  -9.686
  682   HG12  ILE  84          1HG1      ILE  84 -24.589  17.182 -10.836
  683   HG13  ILE  84          2HG1      ILE  84 -24.613  18.296  -9.473
  684   HG21  ILE  84          1HG2      ILE  84 -21.854  15.890 -11.024
  685   HG22  ILE  84          2HG2      ILE  84 -22.538  17.127 -12.077
  686   HG23  ILE  84          3HG2      ILE  84 -20.979  17.396 -11.299
  687   HD11  ILE  84          3HD1      ILE  84 -23.271  19.823 -11.149
  688   HD12  ILE  84          1HD1      ILE  84 -24.088  18.814 -12.344
  689   HD13  ILE  84          2HD1      ILE  84 -25.033  19.740 -11.176
  690    H    LEU  85           H        LEU  85 -20.877  18.063  -7.847
  691    HA   LEU  85           HA       LEU  85 -18.595  16.543  -8.428
  692    HG   LEU  85           HG       LEU  85 -16.602  19.275  -6.961
  693    HB2  LEU  85           1HB      LEU  85 -18.961  19.037  -7.600
  694    HB3  LEU  85           2HB      LEU  85 -18.607  18.305  -6.037
  695   HD11  LEU  85          1HD1      LEU  85 -16.614  17.003  -5.758
  696   HD12  LEU  85          2HD1      LEU  85 -15.158  17.480  -6.634
  697   HD13  LEU  85          3HD1      LEU  85 -16.278  16.322  -7.350
  698   HD21  LEU  85          3HD2      LEU  85 -16.240  19.320  -9.149
  699   HD22  LEU  85          1HD2      LEU  85 -17.637  18.276  -9.413
  700   HD23  LEU  85          2HD2      LEU  85 -16.043  17.567  -9.152
  701    H    GLU  86           H        GLU  86 -20.448  16.845  -5.406
  702    HA   GLU  86           HA       GLU  86 -18.900  15.147  -3.831
  703    HB2  GLU  86           1HB      GLU  86 -21.896  15.519  -3.689
  704    HB3  GLU  86           2HB      GLU  86 -20.858  14.932  -2.398
  705    HG2  GLU  86           1HG      GLU  86 -20.521  17.650  -3.622
  706    HG3  GLU  86           2HG      GLU  86 -21.606  17.345  -2.266
  707    H    ARG  87           H        ARG  87 -21.553  14.418  -6.043
  708    HA   ARG  87           HA       ARG  87 -21.793  11.681  -5.394
  709    HE   ARG  87           HE       ARG  87 -24.789   9.238  -8.347
  710    HB2  ARG  87           1HB      ARG  87 -23.537  12.908  -6.603
  711    HB3  ARG  87           2HB      ARG  87 -22.455  13.113  -7.973
  712    HG2  ARG  87           1HG      ARG  87 -23.813  11.348  -8.613
  713    HG3  ARG  87           2HG      ARG  87 -22.358  10.546  -8.016
  714    HD2  ARG  87           1HD      ARG  87 -23.401   9.952  -5.983
  715    HD3  ARG  87           2HD      ARG  87 -24.751  11.051  -6.269
  716   HH11  ARG  87          1HH1      ARG  87 -25.032   9.133  -4.875
  717   HH12  ARG  87          2HH1      ARG  87 -26.043   7.726  -4.859
  718   HH21  ARG  87          1HH2      ARG  87 -26.119   7.385  -8.338
  719   HH22  ARG  87          2HH2      ARG  87 -26.659   6.732  -6.829
  720    H    PHE  88           H        PHE  88 -19.958  13.376  -7.915
  721    HA   PHE  88           HA       PHE  88 -18.928  11.128  -9.217
  722    HD1  PHE  88           1HD      PHE  88 -17.539  10.894 -11.072
  723    HD2  PHE  88           2HD      PHE  88 -15.630  14.336  -9.450
  724    HE1  PHE  88           1HE      PHE  88 -15.447  10.266 -12.207
  725    HE2  PHE  88           2HE      PHE  88 -13.537  13.714 -10.582
  726    HZ   PHE  88           HZ       PHE  88 -13.444  11.677 -11.964
  727    HB2  PHE  88           1HB      PHE  88 -18.730  13.283 -10.251
  728    HB3  PHE  88           2HB      PHE  88 -17.808  13.915  -8.891
  729    H    ASN  89           H        ASN  89 -17.368  13.147  -6.724
  730    HA   ASN  89           HA       ASN  89 -15.070  11.600  -6.412
  731    HB2  ASN  89           1HB      ASN  89 -16.500  13.283  -4.342
  732    HB3  ASN  89           2HB      ASN  89 -14.844  12.701  -4.211
  733   HD21  ASN  89          1HD2      ASN  89 -14.725  15.157  -3.929
  734   HD22  ASN  89          2HD2      ASN  89 -14.381  16.059  -5.362
  735    H    TYR  90           H        TYR  90 -18.183  11.415  -4.726
  736    HA   TYR  90           HA       TYR  90 -17.477   9.401  -2.900
  737    HD1  TYR  90           2HD      TYR  90 -17.928  11.916  -2.475
  738    HD2  TYR  90           1HD      TYR  90 -21.168   9.526  -1.100
  739    HE1  TYR  90           2HE      TYR  90 -17.938  13.161  -0.355
  740    HE2  TYR  90           1HE      TYR  90 -21.188  10.765   1.025
  741    HH   TYR  90           HH       TYR  90 -20.274  13.388   1.633
  742    HB2  TYR  90           1HB      TYR  90 -20.046  10.469  -3.981
  743    HB3  TYR  90           2HB      TYR  90 -20.083   8.950  -3.093
  744    H    GLU  91           H        GLU  91 -18.997   9.210  -6.106
  745    HA   GLU  91           HA       GLU  91 -19.419   6.464  -6.206
  746    HB2  GLU  91           1HB      GLU  91 -20.110   8.322  -7.870
  747    HB3  GLU  91           2HB      GLU  91 -18.547   8.028  -8.619
  748    HG2  GLU  91           1HG      GLU  91 -19.133   5.927  -9.343
  749    HG3  GLU  91           2HG      GLU  91 -20.379   5.734  -8.111
  750    H    GLU  92           H        GLU  92 -16.617   8.283  -7.455
  751    HA   GLU  92           HA       GLU  92 -15.114   6.051  -8.233
  752    HB2  GLU  92           1HB      GLU  92 -14.778   8.627  -8.655
  753    HB3  GLU  92           2HB      GLU  92 -13.763   8.521  -7.223
  754    HG2  GLU  92           1HG      GLU  92 -12.213   8.178  -8.856
  755    HG3  GLU  92           2HG      GLU  92 -12.684   6.514  -8.512
  756    H    ALA  93           H        ALA  93 -15.112   7.892  -5.199
  757    HA   ALA  93           HA       ALA  93 -13.030   6.659  -3.876
  758    HB1  ALA  93           3HB      ALA  93 -14.424   7.141  -1.776
  759    HB2  ALA  93           1HB      ALA  93 -13.977   8.502  -2.805
  760    HB3  ALA  93           2HB      ALA  93 -15.606   7.830  -2.888
  761    H    GLN  94           H        GLN  94 -16.444   5.652  -3.939
  762    HA   GLN  94           HA       GLN  94 -16.068   3.345  -2.345
  763    HB2  GLN  94           1HB      GLN  94 -18.258   4.515  -2.804
  764    HB3  GLN  94           2HB      GLN  94 -18.239   3.772  -4.398
  765    HG2  GLN  94           1HG      GLN  94 -17.992   1.553  -3.095
  766    HG3  GLN  94           2HG      GLN  94 -18.577   2.490  -1.722
  767   HE21  GLN  94          1HE2      GLN  94 -20.624   1.996  -1.408
  768   HE22  GLN  94          2HE2      GLN  94 -21.844   1.896  -2.628
  769    H    THR  95           H        THR  95 -15.952   3.925  -5.814
  770    HA   THR  95           HA       THR  95 -15.922   1.269  -6.697
  771    HB   THR  95           HB       THR  95 -14.561   3.673  -7.929
  772    HG1  THR  95           1HG      THR  95 -16.507   4.179  -8.572
  773   HG21  THR  95          3HG2      THR  95 -14.760   0.857  -8.747
  774   HG22  THR  95          1HG2      THR  95 -13.619   2.104  -9.248
  775   HG23  THR  95          2HG2      THR  95 -15.218   2.022  -9.989
  776    H    LEU  96           H        LEU  96 -13.186   3.447  -6.008
  777    HA   LEU  96           HA       LEU  96 -11.176   1.530  -6.485
  778    HG   LEU  96           HG       LEU  96 -11.315   4.460  -7.282
  779    HB2  LEU  96           1HB      LEU  96 -11.208   4.067  -4.869
  780    HB3  LEU  96           2HB      LEU  96  -9.756   3.091  -5.089
  781   HD11  LEU  96          1HD1      LEU  96  -9.236   5.825  -7.467
  782   HD12  LEU  96          2HD1      LEU  96  -8.690   5.105  -5.953
  783   HD13  LEU  96          3HD1      LEU  96 -10.152   6.091  -5.983
  784   HD21  LEU  96          3HD2      LEU  96  -9.006   3.824  -8.430
  785   HD22  LEU  96          1HD2      LEU  96 -10.393   2.733  -8.439
  786   HD23  LEU  96          2HD2      LEU  96  -9.091   2.496  -7.271
  787    H    SER  97           H        SER  97 -12.710   2.630  -3.476
  788    HA   SER  97           HA       SER  97 -11.240   1.105  -1.678
  789    HG   SER  97           HG       SER  97 -15.077   1.870  -0.698
  790    HB2  SER  97           1HB      SER  97 -13.012   1.469  -0.107
  791    HB3  SER  97           2HB      SER  97 -12.921   2.908  -1.121
  792    H    LYS  98           H        LYS  98 -14.177   0.261  -3.471
  793    HA   LYS  98           HA       LYS  98 -14.572  -2.275  -2.323
  794    HB2  LYS  98           1HB      LYS  98 -15.609  -0.769  -4.602
  795    HB3  LYS  98           2HB      LYS  98 -15.542  -2.501  -4.903
  796    HG2  LYS  98           1HG      LYS  98 -17.705  -1.893  -4.025
  797    HG3  LYS  98           2HG      LYS  98 -16.840  -2.891  -2.854
  798    HD2  LYS  98           1HD      LYS  98 -16.235  -0.130  -2.392
  799    HD3  LYS  98           2HD      LYS  98 -17.986  -0.349  -2.455
  800    HE2  LYS  98           1HE      LYS  98 -16.405  -2.313  -0.890
  801    HE3  LYS  98           2HE      LYS  98 -16.581  -0.691  -0.221
  802    HZ1  LYS  98           3HZ      LYS  98 -18.698  -1.075   0.298
  803    HZ2  LYS  98           1HZ      LYS  98 -18.375  -2.713   0.031
  804    HZ3  LYS  98           2HZ      LYS  98 -19.049  -1.772  -1.203
  805    H    ILE  99           H        ILE  99 -12.942  -1.334  -5.344
  806    HA   ILE  99           HA       ILE  99 -12.184  -3.873  -6.190
  807    HB   ILE  99           HB       ILE  99 -10.691  -1.275  -6.570
  808   HG12  ILE  99          1HG1      ILE  99 -12.418  -2.581  -8.638
  809   HG13  ILE  99          2HG1      ILE  99 -13.175  -1.628  -7.366
  810   HG21  ILE  99          1HG2      ILE  99  -9.243  -3.155  -7.022
  811   HG22  ILE  99          2HG2      ILE  99 -10.475  -3.898  -8.040
  812   HG23  ILE  99          3HG2      ILE  99  -9.709  -2.392  -8.541
  813   HD11  ILE  99          3HD1      ILE  99 -11.128  -0.675  -9.353
  814   HD12  ILE  99          1HD1      ILE  99 -12.842  -0.264  -9.312
  815   HD13  ILE  99          2HD1      ILE  99 -11.771   0.289  -8.025
  816    H    LEU 100           H        LEU 100 -10.375  -1.562  -4.177
  817    HA   LEU 100           HA       LEU 100  -8.076  -3.095  -3.812
  818    HG   LEU 100           HG       LEU 100  -8.647  -0.334  -4.274
  819    HB2  LEU 100           1HB      LEU 100  -9.342  -1.178  -1.860
  820    HB3  LEU 100           2HB      LEU 100  -7.668  -1.729  -1.834
  821   HD11  LEU 100          1HD1      LEU 100  -9.275   1.488  -3.170
  822   HD12  LEU 100          2HD1      LEU 100  -7.597   1.672  -2.661
  823   HD13  LEU 100          3HD1      LEU 100  -8.743   0.818  -1.628
  824   HD21  LEU 100          3HD2      LEU 100  -6.080   0.312  -2.989
  825   HD22  LEU 100          1HD2      LEU 100  -6.454  -0.027  -4.678
  826   HD23  LEU 100          2HD2      LEU 100  -6.256  -1.357  -3.536
  827    H    LEU 101           H        LEU 101 -11.015  -2.925  -1.820
  828    HA   LEU 101           HA       LEU 101 -10.261  -4.668   0.202
  829    HG   LEU 101           HG       LEU 101 -11.980  -2.271   0.409
  830    HB2  LEU 101           1HB      LEU 101 -12.923  -4.026  -1.024
  831    HB3  LEU 101           2HB      LEU 101 -12.777  -5.179   0.301
  832   HD11  LEU 101          1HD1      LEU 101 -13.988  -2.812   2.261
  833   HD12  LEU 101          2HD1      LEU 101 -14.508  -3.608   0.777
  834   HD13  LEU 101          3HD1      LEU 101 -14.137  -1.885   0.768
  835   HD21  LEU 101          3HD2      LEU 101 -11.901  -4.488   2.440
  836   HD22  LEU 101          1HD2      LEU 101 -11.870  -2.781   2.882
  837   HD23  LEU 101          2HD2      LEU 101 -10.577  -3.460   1.893
  838    H    LYS 102           H        LYS 102 -11.834  -5.399  -2.897
  839    HA   LYS 102           HA       LYS 102 -12.145  -8.151  -2.528
  840    HB2  LYS 102           1HB      LYS 102 -11.896  -6.398  -4.948
  841    HB3  LYS 102           2HB      LYS 102 -11.945  -8.145  -5.133
  842    HG2  LYS 102           1HG      LYS 102 -14.095  -8.162  -3.893
  843    HG3  LYS 102           2HG      LYS 102 -14.055  -6.397  -3.889
  844    HD2  LYS 102           1HD      LYS 102 -13.947  -8.065  -6.397
  845    HD3  LYS 102           2HD      LYS 102 -15.444  -7.428  -5.710
  846    HE2  LYS 102           1HE      LYS 102 -14.315  -5.142  -5.817
  847    HE3  LYS 102           2HE      LYS 102 -13.107  -5.913  -6.844
  848    HZ1  LYS 102           3HZ      LYS 102 -14.716  -6.390  -8.471
  849    HZ2  LYS 102           1HZ      LYS 102 -15.007  -4.787  -8.017
  850    HZ3  LYS 102           2HZ      LYS 102 -16.006  -6.023  -7.439
  851    H    ASP 103           H        ASP 103  -9.505  -6.379  -4.132
  852    HA   ASP 103           HA       ASP 103  -7.914  -8.544  -4.818
  853    HB2  ASP 103           1HB      ASP 103  -7.416  -5.659  -4.290
  854    HB3  ASP 103           2HB      ASP 103  -6.013  -6.723  -4.330
  855    H    LEU 104           H        LEU 104  -8.040  -6.735  -1.777
  856    HA   LEU 104           HA       LEU 104  -5.884  -8.003  -0.504
  857    HG   LEU 104           HG       LEU 104  -6.715  -5.276  -0.643
  858    HB2  LEU 104           1HB      LEU 104  -8.379  -6.791   0.675
  859    HB3  LEU 104           2HB      LEU 104  -6.947  -7.244   1.597
  860   HD11  LEU 104          1HD1      LEU 104  -7.757  -3.620   0.423
  861   HD12  LEU 104          2HD1      LEU 104  -7.050  -4.065   1.976
  862   HD13  LEU 104          3HD1      LEU 104  -8.511  -4.874   1.409
  863   HD21  LEU 104          3HD2      LEU 104  -5.278  -5.417   1.996
  864   HD22  LEU 104          1HD2      LEU 104  -4.811  -4.530   0.545
  865   HD23  LEU 104          2HD2      LEU 104  -4.741  -6.293   0.561
  866    H    LYS 105           H        LYS 105  -9.373  -8.698  -0.345
  867    HA   LYS 105           HA       LYS 105  -9.298 -10.854   1.390
  868    HB2  LYS 105           1HB      LYS 105 -11.138 -10.002  -0.798
  869    HB3  LYS 105           2HB      LYS 105 -11.339 -11.617  -0.131
  870    HG2  LYS 105           1HG      LYS 105 -11.942 -10.825   1.955
  871    HG3  LYS 105           2HG      LYS 105 -11.185  -9.254   1.689
  872    HD2  LYS 105           1HD      LYS 105 -13.568  -8.979   1.600
  873    HD3  LYS 105           2HD      LYS 105 -12.920  -8.776  -0.028
  874    HE2  LYS 105           1HE      LYS 105 -14.954 -10.134  -0.034
  875    HE3  LYS 105           2HE      LYS 105 -13.557 -11.061  -0.580
  876    HZ1  LYS 105           3HZ      LYS 105 -15.129 -12.160   1.068
  877    HZ2  LYS 105           1HZ      LYS 105 -14.455 -11.137   2.235
  878    HZ3  LYS 105           2HZ      LYS 105 -13.474 -12.241   1.411
  879    H    GLU 106           H        GLU 106  -8.947 -10.839  -2.144
  880    HA   GLU 106           HA       GLU 106  -8.706 -13.635  -2.440
  881    HB2  GLU 106           1HB      GLU 106  -9.218 -12.069  -4.295
  882    HB3  GLU 106           2HB      GLU 106  -7.570 -11.464  -4.211
  883    HG2  GLU 106           1HG      GLU 106  -6.690 -13.305  -5.201
  884    HG3  GLU 106           2HG      GLU 106  -7.930 -14.381  -4.558
  885    H    THR 107           H        THR 107  -6.338 -11.078  -1.901
  886    HA   THR 107           HA       THR 107  -4.003 -12.557  -2.318
  887    HB   THR 107           HB       THR 107  -4.447 -10.267  -0.393
  888    HG1  THR 107           1HG      THR 107  -4.500  -9.130  -2.167
  889   HG21  THR 107          3HG2      THR 107  -2.323 -10.502   0.234
  890   HG22  THR 107          1HG2      THR 107  -1.806 -10.358  -1.446
  891   HG23  THR 107          2HG2      THR 107  -2.182 -11.944  -0.772
  892    H    GLU 108           H        GLU 108  -5.688 -11.869   0.752
  893    HA   GLU 108           HA       GLU 108  -4.028 -13.468   2.360
  894    HB2  GLU 108           1HB      GLU 108  -5.902 -13.380   4.000
  895    HB3  GLU 108           2HB      GLU 108  -5.439 -11.804   3.372
  896    HG2  GLU 108           1HG      GLU 108  -7.334 -11.891   1.810
  897    HG3  GLU 108           2HG      GLU 108  -7.813 -13.439   2.505
  898    H    GLN 109           H        GLN 109  -7.027 -14.183   0.634
  899    HA   GLN 109           HA       GLN 109  -7.565 -16.707   1.654
  900    HB2  GLN 109           1HB      GLN 109  -8.083 -15.443  -1.021
  901    HB3  GLN 109           2HB      GLN 109  -8.549 -17.110  -0.710
  902    HG2  GLN 109           1HG      GLN 109  -9.399 -15.035   1.233
  903    HG3  GLN 109           2HG      GLN 109 -10.211 -15.101  -0.330
  904   HE21  GLN 109          1HE2      GLN 109  -9.614 -16.749   2.667
  905   HE22  GLN 109          2HE2      GLN 109 -10.847 -17.945   2.492
  906    H    LYS 110           H        LYS 110  -5.663 -15.890  -1.247
  907    HA   LYS 110           HA       LYS 110  -4.871 -18.523  -1.833
  908    HB2  LYS 110           1HB      LYS 110  -3.826 -15.811  -2.573
  909    HB3  LYS 110           2HB      LYS 110  -2.916 -17.250  -3.013
  910    HG2  LYS 110           1HG      LYS 110  -4.715 -18.077  -4.338
  911    HG3  LYS 110           2HG      LYS 110  -5.801 -16.820  -3.744
  912    HD2  LYS 110           1HD      LYS 110  -4.532 -15.115  -4.867
  913    HD3  LYS 110           2HD      LYS 110  -3.290 -16.283  -5.326
  914    HE2  LYS 110           1HE      LYS 110  -4.898 -17.464  -6.722
  915    HE3  LYS 110           2HE      LYS 110  -6.168 -16.341  -6.233
  916    HZ1  LYS 110           3HZ      LYS 110  -4.173 -16.045  -8.249
  917    HZ2  LYS 110           1HZ      LYS 110  -4.151 -14.745  -7.165
  918    HZ3  LYS 110           2HZ      LYS 110  -5.577 -15.138  -7.986
  919    H    VAL 111           H        VAL 111  -3.190 -15.931  -0.072
  920    HA   VAL 111           HA       VAL 111  -0.827 -17.278   0.496
  921    HB   VAL 111           HB       VAL 111  -2.265 -15.247   2.209
  922   HG11  VAL 111          1HG1      VAL 111  -0.660 -16.366   3.575
  923   HG12  VAL 111          2HG1      VAL 111   0.565 -16.278   2.306
  924   HG13  VAL 111          3HG1      VAL 111   0.025 -14.807   3.117
  925   HG21  VAL 111          3HG2      VAL 111  -1.583 -13.689   0.774
  926   HG22  VAL 111          1HG2      VAL 111   0.068 -14.308   0.806
  927   HG23  VAL 111          2HG2      VAL 111  -1.106 -14.986  -0.321
  928    H    LYS 112           H        LYS 112  -3.951 -17.412   2.103
  929    HA   LYS 112           HA       LYS 112  -3.008 -18.975   4.318
  930    HB2  LYS 112           1HB      LYS 112  -5.722 -18.161   3.316
  931    HB3  LYS 112           2HB      LYS 112  -5.559 -19.347   4.605
  932    HG2  LYS 112           1HG      LYS 112  -4.781 -17.811   6.110
  933    HG3  LYS 112           2HG      LYS 112  -4.119 -16.756   4.860
  934    HD2  LYS 112           1HD      LYS 112  -6.068 -15.737   5.909
  935    HD3  LYS 112           2HD      LYS 112  -6.391 -16.105   4.213
  936    HE2  LYS 112           1HE      LYS 112  -8.264 -16.686   5.738
  937    HE3  LYS 112           2HE      LYS 112  -7.648 -18.057   4.816
  938    HZ1  LYS 112           3HZ      LYS 112  -6.628 -18.951   6.683
  939    HZ2  LYS 112           1HZ      LYS 112  -8.094 -18.371   7.297
  940    HZ3  LYS 112           2HZ      LYS 112  -6.668 -17.496   7.544
  941    H    ASP 113           H        ASP 113  -4.457 -19.623   1.193
  942    HA   ASP 113           HA       ASP 113  -5.127 -22.326   1.614
  943    HB2  ASP 113           1HB      ASP 113  -5.730 -20.706  -0.347
  944    HB3  ASP 113           2HB      ASP 113  -4.240 -21.311  -1.066
  945    H    ILE 114           H        ILE 114  -2.191 -20.791   0.355
  946    HA   ILE 114           HA       ILE 114  -0.784 -23.085  -0.358
  947    HB   ILE 114           HB       ILE 114   0.080 -20.355   0.517
  948   HG12  ILE 114          1HG1      ILE 114   1.231 -21.001  -1.915
  949   HG13  ILE 114          2HG1      ILE 114  -0.322 -21.827  -1.977
  950   HG21  ILE 114          1HG2      ILE 114   1.889 -21.432   1.421
  951   HG22  ILE 114          2HG2      ILE 114   1.775 -22.794   0.309
  952   HG23  ILE 114          3HG2      ILE 114   2.428 -21.254  -0.248
  953   HD11  ILE 114          3HD1      ILE 114  -0.341 -19.021  -1.062
  954   HD12  ILE 114          1HD1      ILE 114   0.014 -19.312  -2.764
  955   HD13  ILE 114          2HD1      ILE 114  -1.494 -19.900  -2.064
  956    H    GLN 115           H        GLN 115   0.066 -24.704   0.770
  957    HA   GLN 115           HA       GLN 115  -0.040 -24.653   3.658
  958    HB2  GLN 115           1HB      GLN 115   0.508 -26.994   3.552
  959    HB3  GLN 115           2HB      GLN 115  -0.715 -26.651   2.335
  960    HG2  GLN 115           1HG      GLN 115   0.640 -27.858   1.020
  961    HG3  GLN 115           2HG      GLN 115   1.505 -26.330   0.859
  962   HE21  GLN 115          1HE2      GLN 115   3.007 -28.352   0.317
  963   HE22  GLN 115          2HE2      GLN 115   4.068 -28.781   1.611
  964    H    THR 116           H        THR 116   1.619 -24.385   5.022
  965    HA   THR 116           HA       THR 116   4.361 -24.636   4.051
  966    HB   THR 116           HB       THR 116   5.052 -22.475   4.916
  967    HG1  THR 116           1HG      THR 116   3.675 -21.942   6.515
  968   HG21  THR 116          3HG2      THR 116   4.393 -22.499   2.596
  969   HG22  THR 116          1HG2      THR 116   3.844 -20.991   3.325
  970   HG23  THR 116          2HG2      THR 116   2.697 -22.298   3.034
  971    H    GLN 117           H        GLN 117   5.930 -24.237   5.949
  972    HA   GLN 117           HA       GLN 117   5.064 -25.932   8.116
  973    HB2  GLN 117           1HB      GLN 117   7.458 -25.579   6.865
  974    HB3  GLN 117           2HB      GLN 117   7.697 -24.627   8.325
  975    HG2  GLN 117           1HG      GLN 117   6.745 -27.476   8.353
  976    HG3  GLN 117           2HG      GLN 117   8.444 -27.016   8.445
  977   HE21  GLN 117          1HE2      GLN 117   6.323 -28.240  10.319
  978   HE22  GLN 117          2HE2      GLN 117   6.564 -27.377  11.796
  Start of MODEL    3
    1    H    GLN   1           H        GLN   1  24.051   0.098  -9.322
    2    HA   GLN   1           HA       GLN   1  22.496   0.744  -6.988
    3    HB2  GLN   1           1HB      GLN   1  22.953   2.300  -9.538
    4    HB3  GLN   1           2HB      GLN   1  22.177   2.929  -8.091
    5    HG2  GLN   1           1HG      GLN   1  24.998   1.889  -8.162
    6    HG3  GLN   1           2HG      GLN   1  24.564   3.584  -8.377
    7   HE21  GLN   1          1HE2      GLN   1  24.110   4.809  -6.631
    8   HE22  GLN   1          2HE2      GLN   1  24.160   4.238  -5.002
    9    H    GLU   2           H        GLU   2  20.450   0.166  -6.737
   10    HA   GLU   2           HA       GLU   2  18.741  -0.027  -9.131
   11    HB2  GLU   2           1HB      GLU   2  18.830  -1.733  -6.654
   12    HB3  GLU   2           2HB      GLU   2  17.402  -1.673  -7.678
   13    HG2  GLU   2           1HG      GLU   2  18.768  -2.411  -9.586
   14    HG3  GLU   2           2HG      GLU   2  20.161  -2.536  -8.514
   15    H    HIS   3           H        HIS   3  18.120  -0.021  -5.628
   16    HA   HIS   3           HA       HIS   3  15.907   1.804  -6.005
   17    HD1  HIS   3           1HD      HIS   3  15.796   2.459  -1.878
   18    HD2  HIS   3           2HD      HIS   3  13.288   0.896  -4.799
   19    HE1  HIS   3           1HE      HIS   3  13.493   3.287  -1.300
   20    HB2  HIS   3           1HB      HIS   3  15.947  -0.190  -4.398
   21    HB3  HIS   3           2HB      HIS   3  16.961   0.809  -3.362
   22    H    LYS   4           H        LYS   4  15.695   3.836  -4.986
   23    HA   LYS   4           HA       LYS   4  18.258   5.090  -4.245
   24    HB2  LYS   4           1HB      LYS   4  17.098   7.231  -5.102
   25    HB3  LYS   4           2HB      LYS   4  17.727   6.092  -6.284
   26    HG2  LYS   4           1HG      LYS   4  15.647   5.443  -6.977
   27    HG3  LYS   4           2HG      LYS   4  14.892   5.828  -5.429
   28    HD2  LYS   4           1HD      LYS   4  15.059   8.199  -5.901
   29    HD3  LYS   4           2HD      LYS   4  15.921   7.863  -7.405
   30    HE2  LYS   4           1HE      LYS   4  13.139   6.869  -6.825
   31    HE3  LYS   4           2HE      LYS   4  13.472   8.392  -7.649
   32    HZ1  LYS   4           3HZ      LYS   4  14.208   7.334  -9.509
   33    HZ2  LYS   4           1HZ      LYS   4  13.088   6.182  -8.978
   34    HZ3  LYS   4           2HZ      LYS   4  14.737   5.959  -8.677
   35    HA   PRO   5           HA       PRO   5  16.493   6.382  -0.441
   36    HB2  PRO   5           1HB      PRO   5  17.631   8.822  -0.096
   37    HB3  PRO   5           2HB      PRO   5  18.531   7.309   0.069
   38    HG2  PRO   5           1HG      PRO   5  18.403   9.193  -2.254
   39    HG3  PRO   5           2HG      PRO   5  19.810   8.367  -1.561
   40    HD2  PRO   5           1HD      PRO   5  18.563   7.492  -3.800
   41    HD3  PRO   5           2HD      PRO   5  19.340   6.388  -2.646
   42    H    LYS   6           H        LYS   6  15.033   7.867   0.566
   43    HA   LYS   6           HA       LYS   6  13.886  10.014  -0.985
   44    HB2  LYS   6           1HB      LYS   6  11.544   8.979  -0.691
   45    HB3  LYS   6           2HB      LYS   6  12.557   8.380  -1.998
   46    HG2  LYS   6           1HG      LYS   6  13.219   6.480  -0.560
   47    HG3  LYS   6           2HG      LYS   6  12.090   7.059   0.666
   48    HD2  LYS   6           1HD      LYS   6  11.081   5.286  -0.665
   49    HD3  LYS   6           2HD      LYS   6  10.242   6.817  -0.927
   50    HE2  LYS   6           1HE      LYS   6  11.392   7.141  -3.020
   51    HE3  LYS   6           2HE      LYS   6  12.387   5.713  -2.737
   52    HZ1  LYS   6           3HZ      LYS   6  10.740   4.966  -4.164
   53    HZ2  LYS   6           1HZ      LYS   6   9.517   5.856  -3.406
   54    HZ3  LYS   6           2HZ      LYS   6  10.159   4.485  -2.650
   55    H    LYS   7           H        LYS   7  12.826  11.500   0.271
   56    HA   LYS   7           HA       LYS   7  11.897  10.921   2.910
   57    HB2  LYS   7           1HB      LYS   7  13.470  12.250   4.168
   58    HB3  LYS   7           2HB      LYS   7  14.353  11.014   3.283
   59    HG2  LYS   7           1HG      LYS   7  15.686  12.782   2.824
   60    HG3  LYS   7           2HG      LYS   7  14.536  12.971   1.498
   61    HD2  LYS   7           1HD      LYS   7  13.509  14.784   2.467
   62    HD3  LYS   7           2HD      LYS   7  13.945  14.290   4.105
   63    HE2  LYS   7           1HE      LYS   7  15.366  16.063   3.813
   64    HE3  LYS   7           2HE      LYS   7  16.385  14.741   3.245
   65    HZ1  LYS   7           3HZ      LYS   7  16.459  16.608   1.725
   66    HZ2  LYS   7           1HZ      LYS   7  14.780  16.556   1.528
   67    HZ3  LYS   7           2HZ      LYS   7  15.736  15.276   0.974
   68    H    ASP   8           H        ASP   8  10.894  12.761   3.930
   69    HA   ASP   8           HA       ASP   8   9.530  14.582   3.894
   70    HB2  ASP   8           1HB      ASP   8  11.940  15.558   3.476
   71    HB3  ASP   8           2HB      ASP   8  11.297  15.908   1.874
   72    H    ASP   9           H        ASP   9   9.163  12.449   1.892
   73    HA   ASP   9           HA       ASP   9   8.089  13.874  -0.413
   74    HB2  ASP   9           1HB      ASP   9   7.586  11.541  -1.239
   75    HB3  ASP   9           2HB      ASP   9   9.293  11.891  -0.978
   76    H    PHE  10           H        PHE  10   6.976  11.749   2.200
   77    HA   PHE  10           HA       PHE  10   4.298  11.564   1.527
   78    HD1  PHE  10           1HD      PHE  10   3.679   9.095   2.442
   79    HD2  PHE  10           2HD      PHE  10   7.339  10.307   4.246
   80    HE1  PHE  10           1HE      PHE  10   4.580   6.827   2.129
   81    HE2  PHE  10           2HE      PHE  10   8.246   8.042   3.935
   82    HZ   PHE  10           HZ       PHE  10   6.867   6.298   2.875
   83    HB2  PHE  10           1HB      PHE  10   5.501  11.737   4.298
   84    HB3  PHE  10           2HB      PHE  10   3.886  11.145   3.924
   85    H    ARG  11           H        ARG  11   2.741  13.018   1.316
   86    HA   ARG  11           HA       ARG  11   3.141  15.699   2.411
   87    HE   ARG  11           HE       ARG  11   0.502  16.613  -2.145
   88    HB2  ARG  11           1HB      ARG  11   1.402  14.555   0.253
   89    HB3  ARG  11           2HB      ARG  11   1.008  16.113   0.968
   90    HG2  ARG  11           1HG      ARG  11   2.824  17.152   0.056
   91    HG3  ARG  11           2HG      ARG  11   3.779  15.669  -0.006
   92    HD2  ARG  11           1HD      ARG  11   3.302  16.004  -2.235
   93    HD3  ARG  11           2HD      ARG  11   1.995  14.924  -1.751
   94   HH11  ARG  11          1HH1      ARG  11   3.711  17.948  -1.957
   95   HH12  ARG  11          2HH1      ARG  11   3.225  19.530  -2.469
   96   HH21  ARG  11          1HH2      ARG  11  -0.151  18.692  -2.820
   97   HH22  ARG  11          2HH2      ARG  11   1.026  19.952  -2.959
   98    H    ASN  12           H        ASN  12   2.585  15.507   4.557
   99    HA   ASN  12           HA       ASN  12  -0.006  14.365   5.252
  100    HB2  ASN  12           1HB      ASN  12   2.146  13.941   6.571
  101    HB3  ASN  12           2HB      ASN  12   1.978  15.590   7.164
  102   HD21  ASN  12          1HD2      ASN  12   1.430  15.338   9.225
  103   HD22  ASN  12          2HD2      ASN  12   0.082  14.419   9.793
  104    H    GLU  13           H        GLU  13  -1.644  15.723   4.818
  105    HA   GLU  13           HA       GLU  13  -1.415  18.496   5.790
  106    HB2  GLU  13           1HB      GLU  13  -3.085  19.105   4.088
  107    HB3  GLU  13           2HB      GLU  13  -1.635  18.420   3.369
  108    HG2  GLU  13           1HG      GLU  13  -2.700  16.432   2.806
  109    HG3  GLU  13           2HG      GLU  13  -4.021  16.708   3.942
  110    H    PHE  14           H        PHE  14  -3.300  19.454   6.718
  111    HA   PHE  14           HA       PHE  14  -4.888  17.522   8.204
  112    HD1  PHE  14           2HD      PHE  14  -3.938  17.970  10.913
  113    HD2  PHE  14           1HD      PHE  14  -7.244  20.316   9.615
  114    HE1  PHE  14           2HE      PHE  14  -5.165  17.367  12.958
  115    HE2  PHE  14           1HE      PHE  14  -8.476  19.718  11.659
  116    HZ   PHE  14           HZ       PHE  14  -7.437  18.241  13.333
  117    HB2  PHE  14           1HB      PHE  14  -3.718  19.668   9.139
  118    HB3  PHE  14           2HB      PHE  14  -5.145  20.492   8.521
  119    H    ASP  15           H        ASP  15  -5.730  17.202   5.769
  120    HA   ASP  15           HA       ASP  15  -7.587  18.934   4.652
  121    HB2  ASP  15           1HB      ASP  15  -8.631  16.753   3.741
  122    HB3  ASP  15           2HB      ASP  15  -6.965  17.121   3.307
  123    H    HIS  16           H        HIS  16  -8.247  16.174   6.814
  124    HA   HIS  16           HA       HIS  16  -9.979  15.721   8.219
  125    HD1  HIS  16           1HD      HIS  16  -9.582  16.001  10.816
  126    HD2  HIS  16           2HD      HIS  16 -12.751  18.570  10.026
  127    HE1  HIS  16           1HE      HIS  16 -11.172  15.720  12.743
  128    HB2  HIS  16           1HB      HIS  16  -9.170  18.074   9.012
  129    HB3  HIS  16           2HB      HIS  16 -10.677  18.639   8.297
  130    H    LEU  17           H        LEU  17 -10.524  15.505   5.488
  131    HA   LEU  17           HA       LEU  17 -13.376  16.235   5.425
  132    HG   LEU  17           HG       LEU  17 -14.380  16.431   3.034
  133    HB2  LEU  17           1HB      LEU  17 -11.654  17.403   3.805
  134    HB3  LEU  17           2HB      LEU  17 -11.847  15.909   2.891
  135   HD11  LEU  17          1HD1      LEU  17 -15.076  18.428   3.759
  136   HD12  LEU  17          2HD1      LEU  17 -13.721  19.279   3.017
  137   HD13  LEU  17          3HD1      LEU  17 -13.522  18.504   4.588
  138   HD21  LEU  17          3HD2      LEU  17 -13.645  16.519   0.893
  139   HD22  LEU  17          1HD2      LEU  17 -12.285  17.571   1.284
  140   HD23  LEU  17          2HD2      LEU  17 -13.907  18.247   1.132
  141    H    LEU  18           H        LEU  18 -14.777  14.757   4.375
  142    HA   LEU  18           HA       LEU  18 -14.280  12.061   4.893
  143    HG   LEU  18           HG       LEU  18 -16.430  14.165   5.251
  144    HB2  LEU  18           1HB      LEU  18 -16.241  13.149   2.881
  145    HB3  LEU  18           2HB      LEU  18 -16.319  11.596   3.710
  146   HD11  LEU  18          1HD1      LEU  18 -18.435  14.693   4.475
  147   HD12  LEU  18          2HD1      LEU  18 -19.036  13.081   4.858
  148   HD13  LEU  18          3HD1      LEU  18 -18.305  13.399   3.285
  149   HD21  LEU  18          3HD2      LEU  18 -17.340  11.333   5.715
  150   HD22  LEU  18          1HD2      LEU  18 -17.809  12.684   6.746
  151   HD23  LEU  18          2HD2      LEU  18 -16.110  12.238   6.599
  152    H    ILE  19           H        ILE  19 -14.718  13.474   1.645
  153    HA   ILE  19           HA       ILE  19 -13.782  11.335   0.178
  154    HB   ILE  19           HB       ILE  19 -13.571  14.281  -0.445
  155   HG12  ILE  19          1HG1      ILE  19 -15.858  13.372  -0.163
  156   HG13  ILE  19          2HG1      ILE  19 -15.545  13.894  -1.815
  157   HG21  ILE  19          1HG2      ILE  19 -12.096  13.575  -2.000
  158   HG22  ILE  19          2HG2      ILE  19 -12.661  11.906  -1.937
  159   HG23  ILE  19          3HG2      ILE  19 -13.561  13.107  -2.864
  160   HD11  ILE  19          3HD1      ILE  19 -16.418  11.364  -0.878
  161   HD12  ILE  19          1HD1      ILE  19 -16.171  11.906  -2.537
  162   HD13  ILE  19          2HD1      ILE  19 -14.842  11.165  -1.644
  163    H    GLU  20           H        GLU  20 -11.928  14.065   1.487
  164    HA   GLU  20           HA       GLU  20  -9.449  13.522   0.405
  165    HB2  GLU  20           1HB      GLU  20 -10.258  14.698   3.054
  166    HB3  GLU  20           2HB      GLU  20  -8.566  14.530   2.606
  167    HG2  GLU  20           1HG      GLU  20 -10.424  15.885   0.719
  168    HG3  GLU  20           2HG      GLU  20  -9.870  16.751   2.152
  169    H    GLN  21           H        GLN  21 -10.719  12.344   3.521
  170    HA   GLN  21           HA       GLN  21  -8.520  10.713   4.145
  171    HB2  GLN  21           1HB      GLN  21 -10.561  11.494   5.592
  172    HB3  GLN  21           2HB      GLN  21 -11.292   9.998   5.025
  173    HG2  GLN  21           1HG      GLN  21  -9.491   8.709   5.983
  174    HG3  GLN  21           2HG      GLN  21  -8.657  10.184   6.467
  175   HE21  GLN  21          1HE2      GLN  21  -9.833   7.835   7.951
  176   HE22  GLN  21          2HE2      GLN  21 -10.815   8.557   9.177
  177    H    ALA  22           H        ALA  22 -11.447  10.104   2.292
  178    HA   ALA  22           HA       ALA  22 -11.170   7.304   2.071
  179    HB1  ALA  22           3HB      ALA  22 -13.282   8.035   1.516
  180    HB2  ALA  22           1HB      ALA  22 -12.679   9.387   0.557
  181    HB3  ALA  22           2HB      ALA  22 -12.583   7.744  -0.076
  182    H    ASN  23           H        ASN  23 -10.110   9.965  -0.027
  183    HA   ASN  23           HA       ASN  23  -9.017   8.350  -2.061
  184    HB2  ASN  23           1HB      ASN  23  -8.936  11.198  -1.306
  185    HB3  ASN  23           2HB      ASN  23  -7.530  10.634  -2.205
  186   HD21  ASN  23          1HD2      ASN  23 -10.775  11.589  -2.362
  187   HD22  ASN  23          2HD2      ASN  23 -11.037  11.277  -4.041
  188    H    HIS  24           H        HIS  24  -7.605   9.782   0.849
  189    HA   HIS  24           HA       HIS  24  -4.939   9.003   0.335
  190    HD1  HIS  24           1HD      HIS  24  -3.793  11.889   1.883
  191    HD2  HIS  24           2HD      HIS  24  -3.320   8.110   3.542
  192    HE1  HIS  24           1HE      HIS  24  -1.391  11.772   2.617
  193    HB2  HIS  24           1HB      HIS  24  -5.962  10.665   2.107
  194    HB3  HIS  24           2HB      HIS  24  -5.970   9.234   3.133
  195    H    ALA  25           H        ALA  25  -7.603   7.438   2.044
  196    HA   ALA  25           HA       ALA  25  -6.118   5.264   3.068
  197    HB1  ALA  25           3HB      ALA  25  -8.320   5.903   3.931
  198    HB2  ALA  25           1HB      ALA  25  -9.060   5.390   2.414
  199    HB3  ALA  25           2HB      ALA  25  -8.273   4.204   3.458
  200    H    ILE  26           H        ILE  26  -8.188   5.536   0.181
  201    HA   ILE  26           HA       ILE  26  -7.708   2.919  -0.758
  202    HB   ILE  26           HB       ILE  26  -8.647   3.645  -2.866
  203   HG12  ILE  26          1HG1      ILE  26  -8.398   6.449  -1.756
  204   HG13  ILE  26          2HG1      ILE  26  -7.458   5.777  -3.085
  205   HG21  ILE  26          1HG2      ILE  26 -10.677   3.636  -1.962
  206   HG22  ILE  26          2HG2      ILE  26  -9.908   3.825  -0.386
  207   HG23  ILE  26          3HG2      ILE  26 -10.443   5.247  -1.282
  208   HD11  ILE  26          3HD1      ILE  26  -8.992   6.725  -4.388
  209   HD12  ILE  26          1HD1      ILE  26 -10.019   5.368  -3.930
  210   HD13  ILE  26          2HD1      ILE  26 -10.144   6.901  -3.066
  211    H    GLU  27           H        GLU  27  -5.985   5.937  -1.147
  212    HA   GLU  27           HA       GLU  27  -4.351   5.157  -3.324
  213    HB2  GLU  27           1HB      GLU  27  -4.245   7.313  -1.258
  214    HB3  GLU  27           2HB      GLU  27  -2.810   6.997  -2.223
  215    HG2  GLU  27           1HG      GLU  27  -3.793   7.699  -4.173
  216    HG3  GLU  27           2HG      GLU  27  -5.426   7.368  -3.595
  217    H    LYS  28           H        LYS  28  -3.562   5.426   0.146
  218    HA   LYS  28           HA       LYS  28  -1.047   4.216  -0.009
  219    HB2  LYS  28           1HB      LYS  28  -1.949   5.529   1.929
  220    HB3  LYS  28           2HB      LYS  28  -2.925   4.130   2.356
  221    HG2  LYS  28           1HG      LYS  28   0.020   3.806   2.047
  222    HG3  LYS  28           2HG      LYS  28  -0.624   4.552   3.511
  223    HD2  LYS  28           1HD      LYS  28  -2.217   2.471   3.502
  224    HD3  LYS  28           2HD      LYS  28  -0.954   1.765   2.491
  225    HE2  LYS  28           1HE      LYS  28  -0.270   1.130   4.598
  226    HE3  LYS  28           2HE      LYS  28   0.638   2.624   4.367
  227    HZ1  LYS  28           3HZ      LYS  28  -1.934   3.099   5.510
  228    HZ2  LYS  28           1HZ      LYS  28  -0.407   3.570   6.065
  229    HZ3  LYS  28           2HZ      LYS  28  -1.017   2.043   6.461
  230    H    GLY  29           H        GLY  29  -4.246   2.817   0.591
  231    HA2  GLY  29           1HA      GLY  29  -3.333   0.182   1.097
  232    HA3  GLY  29           2HA      GLY  29  -4.968   0.636   0.638
  233    H    GLU  30           H        GLU  30  -4.220   1.876  -1.859
  234    HA   GLU  30           HA       GLU  30  -4.278  -0.428  -3.518
  235    HB2  GLU  30           1HB      GLU  30  -5.408   1.577  -4.230
  236    HB3  GLU  30           2HB      GLU  30  -3.913   2.500  -4.161
  237    HG2  GLU  30           1HG      GLU  30  -3.006   1.086  -5.977
  238    HG3  GLU  30           2HG      GLU  30  -4.571   0.282  -6.086
  239    H    HIS  31           H        HIS  31  -1.771   1.898  -2.657
  240    HA   HIS  31           HA       HIS  31   0.176   0.920  -4.483
  241    HD1  HIS  31           1HD      HIS  31   0.342   5.022  -2.233
  242    HD2  HIS  31           2HD      HIS  31  -0.070   2.932  -5.800
  243    HE1  HIS  31           1HE      HIS  31  -0.404   6.724  -3.928
  244    HB2  HIS  31           1HB      HIS  31   0.500   2.517  -1.935
  245    HB3  HIS  31           2HB      HIS  31   1.781   2.227  -3.109
  246    H    GLN  32           H        GLN  32  -0.213   0.497  -0.965
  247    HA   GLN  32           HA       GLN  32   1.906  -1.301  -0.623
  248    HB2  GLN  32           1HB      GLN  32   0.923  -1.827   1.517
  249    HB3  GLN  32           2HB      GLN  32   0.748  -0.103   1.218
  250    HG2  GLN  32           1HG      GLN  32  -1.326  -0.610   2.020
  251    HG3  GLN  32           2HG      GLN  32  -1.590  -0.801   0.287
  252   HE21  GLN  32          1HE2      GLN  32  -0.119  -2.873   2.763
  253   HE22  GLN  32          2HE2      GLN  32  -1.127  -4.242   2.460
  254    H    LEU  33           H        LEU  33  -1.459  -1.811  -1.512
  255    HA   LEU  33           HA       LEU  33  -1.434  -4.636  -1.269
  256    HG   LEU  33           HG       LEU  33  -4.894  -4.727  -2.500
  257    HB2  LEU  33           1HB      LEU  33  -3.501  -3.356  -1.287
  258    HB3  LEU  33           2HB      LEU  33  -3.178  -2.830  -2.937
  259   HD11  LEU  33          1HD1      LEU  33  -3.420  -3.953  -4.664
  260   HD12  LEU  33          2HD1      LEU  33  -4.736  -5.126  -4.693
  261   HD13  LEU  33          3HD1      LEU  33  -3.065  -5.678  -4.570
  262   HD21  LEU  33          3HD2      LEU  33  -2.956  -5.928  -1.158
  263   HD22  LEU  33          1HD2      LEU  33  -2.557  -6.542  -2.762
  264   HD23  LEU  33          2HD2      LEU  33  -4.154  -6.841  -2.076
  265    H    LEU  34           H        LEU  34  -1.053  -2.465  -4.059
  266    HA   LEU  34           HA       LEU  34  -0.752  -4.410  -6.031
  267    HG   LEU  34           HG       LEU  34  -2.169  -2.014  -6.349
  268    HB2  LEU  34           1HB      LEU  34   0.253  -1.601  -5.757
  269    HB3  LEU  34           2HB      LEU  34   0.675  -2.581  -7.160
  270   HD11  LEU  34          1HD1      LEU  34  -0.649   0.015  -6.942
  271   HD12  LEU  34          2HD1      LEU  34  -2.240  -0.142  -7.686
  272   HD13  LEU  34          3HD1      LEU  34  -0.796  -0.598  -8.590
  273   HD21  LEU  34          3HD2      LEU  34  -0.812  -3.322  -8.659
  274   HD22  LEU  34          1HD2      LEU  34  -2.327  -2.460  -8.929
  275   HD23  LEU  34          2HD2      LEU  34  -2.268  -3.801  -7.785
  276    H    TYR  35           H        TYR  35   1.663  -2.916  -3.918
  277    HA   TYR  35           HA       TYR  35   3.894  -4.228  -5.092
  278    HD1  TYR  35           1HD      TYR  35   4.526  -4.473  -0.965
  279    HD2  TYR  35           2HD      TYR  35   6.612  -2.911  -4.329
  280    HE1  TYR  35           1HE      TYR  35   6.641  -5.318  -0.038
  281    HE2  TYR  35           2HE      TYR  35   8.733  -3.753  -3.412
  282    HH   TYR  35           HH       TYR  35   8.988  -6.018  -1.151
  283    HB2  TYR  35           1HB      TYR  35   4.339  -2.240  -3.871
  284    HB3  TYR  35           2HB      TYR  35   3.484  -2.831  -2.451
  285    H    LEU  36           H        LEU  36   1.855  -4.910  -2.281
  286    HA   LEU  36           HA       LEU  36   3.301  -7.126  -1.326
  287    HG   LEU  36           HG       LEU  36   2.601  -7.332   0.973
  288    HB2  LEU  36           1HB      LEU  36   0.686  -5.908  -0.866
  289    HB3  LEU  36           2HB      LEU  36   0.702  -7.653  -0.626
  290   HD11  LEU  36          1HD1      LEU  36   1.952  -4.524   1.425
  291   HD12  LEU  36          2HD1      LEU  36   2.761  -4.825  -0.113
  292   HD13  LEU  36          3HD1      LEU  36   3.516  -5.338   1.396
  293   HD21  LEU  36          3HD2      LEU  36   1.039  -6.097   2.687
  294   HD22  LEU  36          1HD2      LEU  36   0.632  -7.705   2.082
  295   HD23  LEU  36          2HD2      LEU  36  -0.154  -6.281   1.399
  296    H    GLN  37           H        GLN  37   0.937  -6.782  -3.865
  297    HA   GLN  37           HA       GLN  37   0.044  -9.369  -4.197
  298    HB2  GLN  37           1HB      GLN  37  -0.374  -7.106  -5.544
  299    HB3  GLN  37           2HB      GLN  37   0.774  -7.849  -6.650
  300    HG2  GLN  37           1HG      GLN  37  -0.663  -9.499  -7.262
  301    HG3  GLN  37           2HG      GLN  37  -1.492  -9.507  -5.707
  302   HE21  GLN  37          1HE2      GLN  37  -3.411  -8.572  -5.600
  303   HE22  GLN  37          2HE2      GLN  37  -4.074  -7.492  -6.773
  304    H    HIS  38           H        HIS  38   3.102  -7.943  -5.211
  305    HA   HIS  38           HA       HIS  38   4.010 -10.085  -6.794
  306    HD1  HIS  38           1HD      HIS  38   6.347  -9.512  -8.594
  307    HD2  HIS  38           2HD      HIS  38   4.334  -6.083  -7.392
  308    HE1  HIS  38           1HE      HIS  38   6.051  -8.141 -10.681
  309    HB2  HIS  38           1HB      HIS  38   5.290  -7.764  -5.429
  310    HB3  HIS  38           2HB      HIS  38   6.332  -9.067  -5.991
  311    H    GLN  39           H        GLN  39   4.779  -9.257  -3.411
  312    HA   GLN  39           HA       GLN  39   6.377 -11.431  -2.810
  313    HB2  GLN  39           1HB      GLN  39   4.419 -10.039  -0.975
  314    HB3  GLN  39           2HB      GLN  39   5.765 -11.048  -0.460
  315    HG2  GLN  39           1HG      GLN  39   6.165  -8.591  -2.130
  316    HG3  GLN  39           2HG      GLN  39   6.083  -8.531  -0.370
  317   HE21  GLN  39          1HE2      GLN  39   8.009  -8.426   0.507
  318   HE22  GLN  39          2HE2      GLN  39   9.434  -9.231  -0.049
  319    H    LEU  40           H        LEU  40   2.847 -11.154  -2.556
  320    HA   LEU  40           HA       LEU  40   2.362 -13.690  -1.469
  321    HG   LEU  40           HG       LEU  40  -0.286 -13.800  -3.788
  322    HB2  LEU  40           1HB      LEU  40   0.572 -12.217  -1.375
  323    HB3  LEU  40           2HB      LEU  40   0.731 -11.762  -3.070
  324   HD11  LEU  40          1HD1      LEU  40  -1.195 -15.188  -1.635
  325   HD12  LEU  40          2HD1      LEU  40   0.400 -14.680  -1.079
  326   HD13  LEU  40          3HD1      LEU  40   0.241 -15.606  -2.572
  327   HD21  LEU  40          3HD2      LEU  40  -2.402 -13.672  -2.123
  328   HD22  LEU  40          1HD2      LEU  40  -2.093 -12.508  -3.411
  329   HD23  LEU  40          2HD2      LEU  40  -1.616 -12.136  -1.753
  330    H    ASP  41           H        ASP  41   2.376 -12.609  -4.856
  331    HA   ASP  41           HA       ASP  41   1.674 -14.996  -6.076
  332    HB2  ASP  41           1HB      ASP  41   2.069 -12.665  -7.113
  333    HB3  ASP  41           2HB      ASP  41   3.752 -13.163  -7.248
  334    H    GLU  42           H        GLU  42   4.890 -13.853  -5.110
  335    HA   GLU  42           HA       GLU  42   6.274 -16.130  -6.102
  336    HB2  GLU  42           1HB      GLU  42   7.527 -14.129  -5.811
  337    HB3  GLU  42           2HB      GLU  42   7.020 -13.973  -4.135
  338    HG2  GLU  42           1HG      GLU  42   8.559 -15.446  -3.382
  339    HG3  GLU  42           2HG      GLU  42   8.498 -16.428  -4.845
  340    H    LEU  43           H        LEU  43   4.750 -15.329  -3.056
  341    HA   LEU  43           HA       LEU  43   5.896 -17.448  -1.546
  342    HG   LEU  43           HG       LEU  43   3.925 -16.355   1.364
  343    HB2  LEU  43           1HB      LEU  43   4.924 -15.451  -0.516
  344    HB3  LEU  43           2HB      LEU  43   3.332 -15.923  -1.106
  345   HD11  LEU  43          1HD1      LEU  43   2.143 -17.685   1.331
  346   HD12  LEU  43          2HD1      LEU  43   2.980 -18.913   0.382
  347   HD13  LEU  43          3HD1      LEU  43   2.195 -17.556  -0.427
  348   HD21  LEU  43          3HD2      LEU  43   5.296 -18.086   1.936
  349   HD22  LEU  43          1HD2      LEU  43   6.115 -17.534   0.475
  350   HD23  LEU  43          2HD2      LEU  43   5.048 -18.936   0.409
  351    H    ASN  44           H        ASN  44   3.132 -17.171  -3.655
  352    HA   ASN  44           HA       ASN  44   1.661 -19.403  -2.860
  353    HB2  ASN  44           1HB      ASN  44   1.968 -17.952  -5.470
  354    HB3  ASN  44           2HB      ASN  44   1.011 -19.428  -5.390
  355   HD21  ASN  44          1HD2      ASN  44  -0.178 -17.120  -6.133
  356   HD22  ASN  44          2HD2      ASN  44  -1.242 -16.564  -4.890
  357    H    GLU  45           H        GLU  45   4.429 -19.141  -5.036
  358    HA   GLU  45           HA       GLU  45   4.383 -22.001  -5.567
  359    HB2  GLU  45           1HB      GLU  45   4.943 -20.218  -7.306
  360    HB3  GLU  45           2HB      GLU  45   6.480 -20.034  -6.473
  361    HG2  GLU  45           1HG      GLU  45   7.013 -21.506  -8.153
  362    HG3  GLU  45           2HG      GLU  45   6.684 -22.593  -6.805
  363    H    ASN  46           H        ASN  46   6.543 -19.612  -4.067
  364    HA   ASN  46           HA       ASN  46   8.589 -21.335  -3.301
  365    HB2  ASN  46           1HB      ASN  46   7.572 -18.734  -2.194
  366    HB3  ASN  46           2HB      ASN  46   8.874 -19.598  -1.382
  367   HD21  ASN  46          1HD2      ASN  46   9.679 -17.300  -2.086
  368   HD22  ASN  46          2HD2      ASN  46  10.588 -17.289  -3.555
  369    H    LYS  47           H        LYS  47   5.501 -20.650  -1.776
  370    HA   LYS  47           HA       LYS  47   4.435 -21.544   0.028
  371    HB2  LYS  47           1HB      LYS  47   5.104 -23.574  -1.617
  372    HB3  LYS  47           2HB      LYS  47   5.944 -24.088  -0.161
  373    HG2  LYS  47           1HG      LYS  47   3.896 -25.117   0.059
  374    HG3  LYS  47           2HG      LYS  47   3.676 -23.647   1.009
  375    HD2  LYS  47           1HD      LYS  47   1.731 -23.910  -0.337
  376    HD3  LYS  47           2HD      LYS  47   2.674 -22.595  -1.042
  377    HE2  LYS  47           1HE      LYS  47   1.781 -24.137  -2.743
  378    HE3  LYS  47           2HE      LYS  47   3.543 -24.080  -2.740
  379    HZ1  LYS  47           3HZ      LYS  47   3.701 -26.183  -1.866
  380    HZ2  LYS  47           1HZ      LYS  47   2.329 -26.347  -2.844
  381    HZ3  LYS  47           2HZ      LYS  47   2.158 -26.147  -1.173
  382    H    SER  48           H        SER  48   6.871 -20.118   0.578
  383    HA   SER  48           HA       SER  48   8.364 -21.541   2.564
  384    HG   SER  48           HG       SER  48  10.218 -20.774   2.499
  385    HB2  SER  48           1HB      SER  48   8.811 -19.267   1.092
  386    HB3  SER  48           2HB      SER  48   8.461 -18.607   2.689
  387    H    LYS  49           H        LYS  49   7.987 -21.731   4.680
  388    HA   LYS  49           HA       LYS  49   5.510 -21.006   5.803
  389    HB2  LYS  49           1HB      LYS  49   6.552 -21.709   7.965
  390    HB3  LYS  49           2HB      LYS  49   6.692 -22.901   6.678
  391    HG2  LYS  49           1HG      LYS  49   8.999 -21.428   6.413
  392    HG3  LYS  49           2HG      LYS  49   8.761 -21.501   8.161
  393    HD2  LYS  49           1HD      LYS  49   9.171 -23.717   8.249
  394    HD3  LYS  49           2HD      LYS  49   8.322 -24.036   6.736
  395    HE2  LYS  49           1HE      LYS  49  10.349 -24.371   5.857
  396    HE3  LYS  49           2HE      LYS  49  10.525 -22.618   5.911
  397    HZ1  LYS  49           3HZ      LYS  49  11.660 -24.655   7.688
  398    HZ2  LYS  49           1HZ      LYS  49  11.309 -23.132   8.335
  399    HZ3  LYS  49           2HZ      LYS  49  12.382 -23.271   7.035
  400    H    GLU  50           H        GLU  50   8.724 -19.552   6.024
  401    HA   GLU  50           HA       GLU  50   8.004 -17.583   7.947
  402    HB2  GLU  50           1HB      GLU  50  10.320 -17.962   6.081
  403    HB3  GLU  50           2HB      GLU  50  10.132 -16.444   6.949
  404    HG2  GLU  50           1HG      GLU  50   9.878 -18.067   9.014
  405    HG3  GLU  50           2HG      GLU  50  10.802 -19.145   7.970
  406    H    LEU  51           H        LEU  51   8.540 -17.392   4.428
  407    HA   LEU  51           HA       LEU  51   7.857 -14.719   4.085
  408    HG   LEU  51           HG       LEU  51   6.608 -14.673   1.302
  409    HB2  LEU  51           1HB      LEU  51   8.870 -16.332   2.409
  410    HB3  LEU  51           2HB      LEU  51   7.226 -16.888   2.100
  411   HD11  LEU  51          1HD1      LEU  51   7.935 -13.214   2.593
  412   HD12  LEU  51          2HD1      LEU  51   8.481 -13.016   0.928
  413   HD13  LEU  51          3HD1      LEU  51   9.432 -13.978   2.059
  414   HD21  LEU  51          3HD2      LEU  51   7.526 -14.917  -0.773
  415   HD22  LEU  51          1HD2      LEU  51   7.927 -16.490  -0.086
  416   HD23  LEU  51          2HD2      LEU  51   9.147 -15.218  -0.145
  417    H    GLN  52           H        GLN  52   5.812 -17.579   4.264
  418    HA   GLN  52           HA       GLN  52   3.405 -16.284   3.489
  419    HB2  GLN  52           1HB      GLN  52   3.880 -18.784   3.495
  420    HB3  GLN  52           2HB      GLN  52   3.606 -18.735   5.231
  421    HG2  GLN  52           1HG      GLN  52   1.390 -17.466   4.265
  422    HG3  GLN  52           2HG      GLN  52   1.701 -18.677   3.024
  423   HE21  GLN  52          1HE2      GLN  52   0.402 -18.073   6.073
  424   HE22  GLN  52          2HE2      GLN  52   0.083 -19.706   6.538
  425    H    GLU  53           H        GLU  53   4.567 -17.355   6.689
  426    HA   GLU  53           HA       GLU  53   2.525 -16.273   8.218
  427    HB2  GLU  53           1HB      GLU  53   5.376 -16.972   8.750
  428    HB3  GLU  53           2HB      GLU  53   4.504 -16.049   9.966
  429    HG2  GLU  53           1HG      GLU  53   2.821 -17.789  10.115
  430    HG3  GLU  53           2HG      GLU  53   3.637 -18.706   8.850
  431    H    LYS  54           H        LYS  54   5.286 -14.723   6.758
  432    HA   LYS  54           HA       LYS  54   5.072 -12.285   8.245
  433    HB2  LYS  54           1HB      LYS  54   6.513 -12.971   5.680
  434    HB3  LYS  54           2HB      LYS  54   6.621 -11.404   6.471
  435    HG2  LYS  54           1HG      LYS  54   7.255 -13.853   8.039
  436    HG3  LYS  54           2HG      LYS  54   8.434 -13.245   6.875
  437    HD2  LYS  54           1HD      LYS  54   9.098 -12.076   8.718
  438    HD3  LYS  54           2HD      LYS  54   7.892 -10.951   8.091
  439    HE2  LYS  54           1HE      LYS  54   6.356 -11.482   9.720
  440    HE3  LYS  54           2HE      LYS  54   7.040 -13.083   9.994
  441    HZ1  LYS  54           3HZ      LYS  54   9.068 -11.557  10.764
  442    HZ2  LYS  54           1HZ      LYS  54   7.853 -12.078  11.820
  443    HZ3  LYS  54           2HZ      LYS  54   7.785 -10.525  11.154
  444    H    ILE  55           H        ILE  55   4.315 -13.158   4.871
  445    HA   ILE  55           HA       ILE  55   3.163 -10.738   4.117
  446    HB   ILE  55           HB       ILE  55   2.509 -13.523   3.151
  447   HG12  ILE  55          1HG1      ILE  55   4.146 -11.475   1.690
  448   HG13  ILE  55          2HG1      ILE  55   4.888 -12.473   2.936
  449   HG21  ILE  55          1HG2      ILE  55   0.682 -12.297   2.429
  450   HG22  ILE  55          2HG2      ILE  55   1.627 -10.824   2.213
  451   HG23  ILE  55          3HG2      ILE  55   1.794 -12.155   1.069
  452   HD11  ILE  55          3HD1      ILE  55   4.449 -14.457   1.728
  453   HD12  ILE  55          1HD1      ILE  55   3.397 -13.613   0.592
  454   HD13  ILE  55          2HD1      ILE  55   5.133 -13.300   0.585
  455    H    ILE  56           H        ILE  56   1.536 -13.682   5.299
  456    HA   ILE  56           HA       ILE  56  -1.069 -12.730   5.297
  457    HB   ILE  56           HB       ILE  56  -0.534 -15.078   5.704
  458   HG12  ILE  56          1HG1      ILE  56  -2.032 -13.832   8.020
  459   HG13  ILE  56          2HG1      ILE  56  -2.715 -14.180   6.436
  460   HG21  ILE  56          1HG2      ILE  56   1.397 -14.296   7.336
  461   HG22  ILE  56          2HG2      ILE  56   0.144 -14.561   8.547
  462   HG23  ILE  56          3HG2      ILE  56   0.638 -15.881   7.487
  463   HD11  ILE  56          3HD1      ILE  56  -2.262 -16.573   6.806
  464   HD12  ILE  56          1HD1      ILE  56  -1.683 -16.185   8.426
  465   HD13  ILE  56          2HD1      ILE  56  -3.367 -15.885   7.995
  466    H    ARG  57           H        ARG  57   1.477 -12.308   7.692
  467    HA   ARG  57           HA       ARG  57  -0.127 -11.195   9.732
  468    HE   ARG  57           HE       ARG  57   3.068 -13.848  11.934
  469    HB2  ARG  57           1HB      ARG  57   2.698 -11.606   9.221
  470    HB3  ARG  57           2HB      ARG  57   2.408 -10.050   9.985
  471    HG2  ARG  57           1HG      ARG  57   2.855 -11.788  11.630
  472    HG3  ARG  57           2HG      ARG  57   1.221 -11.143  11.803
  473    HD2  ARG  57           1HD      ARG  57   0.344 -13.163  11.513
  474    HD3  ARG  57           2HD      ARG  57   1.198 -13.353   9.983
  475   HH11  ARG  57          1HH1      ARG  57  -0.015 -15.176  11.010
  476   HH12  ARG  57          2HH1      ARG  57   0.359 -16.773  11.569
  477   HH21  ARG  57          1HH2      ARG  57   3.572 -15.946  12.672
  478   HH22  ARG  57          2HH2      ARG  57   2.400 -17.210  12.514
  479    H    GLU  58           H        GLU  58   1.968  -9.628   7.308
  480    HA   GLU  58           HA       GLU  58   1.285  -6.988   7.994
  481    HB2  GLU  58           1HB      GLU  58   2.554  -8.308   5.644
  482    HB3  GLU  58           2HB      GLU  58   1.978  -6.659   5.446
  483    HG2  GLU  58           1HG      GLU  58   3.321  -6.124   7.549
  484    HG3  GLU  58           2HG      GLU  58   4.093  -7.689   7.300
  485    H    LEU  59           H        LEU  59  -0.016  -9.172   5.519
  486    HA   LEU  59           HA       LEU  59  -1.862  -7.341   4.424
  487    HG   LEU  59           HG       LEU  59  -3.962  -9.025   3.205
  488    HB2  LEU  59           1HB      LEU  59  -1.022  -9.613   3.527
  489    HB3  LEU  59           2HB      LEU  59  -2.324 -10.301   4.494
  490   HD11  LEU  59          1HD1      LEU  59  -2.875  -7.068   2.553
  491   HD12  LEU  59          2HD1      LEU  59  -3.071  -7.968   1.049
  492   HD13  LEU  59          3HD1      LEU  59  -1.508  -7.944   1.865
  493   HD21  LEU  59          3HD2      LEU  59  -3.960 -10.404   1.342
  494   HD22  LEU  59          1HD2      LEU  59  -2.973 -11.307   2.492
  495   HD23  LEU  59          2HD2      LEU  59  -2.202 -10.384   1.202
  496    H    ASP  60           H        ASP  60  -1.987  -9.471   7.188
  497    HA   ASP  60           HA       ASP  60  -4.798  -9.379   7.581
  498    HB2  ASP  60           1HB      ASP  60  -3.476 -11.140   8.597
  499    HB3  ASP  60           2HB      ASP  60  -2.546  -9.959   9.515
  500    H    VAL  61           H        VAL  61  -2.128  -7.678   9.223
  501    HA   VAL  61           HA       VAL  61  -3.736  -6.034  10.826
  502    HB   VAL  61           HB       VAL  61  -1.733  -4.551  10.981
  503   HG11  VAL  61          1HG1      VAL  61  -1.992  -6.422  12.501
  504   HG12  VAL  61          2HG1      VAL  61  -1.246  -7.508  11.328
  505   HG13  VAL  61          3HG1      VAL  61  -0.293  -6.224  12.072
  506   HG21  VAL  61          3HG2      VAL  61  -0.839  -4.770   8.763
  507   HG22  VAL  61          1HG2      VAL  61   0.360  -5.367   9.910
  508   HG23  VAL  61          2HG2      VAL  61  -0.611  -6.505   8.977
  509    H    VAL  62           H        VAL  62  -2.465  -5.582   7.563
  510    HA   VAL  62           HA       VAL  62  -3.277  -2.883   7.272
  511    HB   VAL  62           HB       VAL  62  -2.709  -4.999   5.195
  512   HG11  VAL  62          1HG1      VAL  62  -2.340  -2.488   4.055
  513   HG12  VAL  62          2HG1      VAL  62  -3.639  -3.632   3.706
  514   HG13  VAL  62          3HG1      VAL  62  -3.874  -2.371   4.917
  515   HG21  VAL  62          3HG2      VAL  62  -0.919  -4.010   6.848
  516   HG22  VAL  62          1HG2      VAL  62  -0.543  -4.243   5.141
  517   HG23  VAL  62          2HG2      VAL  62  -0.970  -2.640   5.739
  518    H    CYS  63           H        CYS  63  -4.688  -5.884   5.950
  519    HA   CYS  63           HA       CYS  63  -6.982  -4.719   4.868
  520    HG   CYS  63           HG       CYS  63  -8.046  -8.850   6.232
  521    HB2  CYS  63           1HB      CYS  63  -7.808  -6.901   4.584
  522    HB3  CYS  63           2HB      CYS  63  -6.060  -7.095   4.542
  523    H    ALA  64           H        ALA  64  -6.196  -5.573   8.136
  524    HA   ALA  64           HA       ALA  64  -8.867  -5.597   9.142
  525    HB1  ALA  64           3HB      ALA  64  -6.312  -5.135  10.673
  526    HB2  ALA  64           1HB      ALA  64  -7.866  -5.654  11.327
  527    HB3  ALA  64           2HB      ALA  64  -6.957  -6.723  10.256
  528    H    MET  65           H        MET  65  -6.216  -3.234   9.534
  529    HA   MET  65           HA       MET  65  -7.796  -1.240  10.724
  530    HB2  MET  65           1HB      MET  65  -5.945   0.193  10.479
  531    HB3  MET  65           2HB      MET  65  -5.247  -1.413  10.645
  532    HG2  MET  65           1HG      MET  65  -4.989  -1.536   8.207
  533    HG3  MET  65           2HG      MET  65  -5.639   0.097   8.073
  534    HE1  MET  65           3HE      MET  65  -1.749  -0.962  10.264
  535    HE2  MET  65           1HE      MET  65  -3.276  -1.842  10.321
  536    HE3  MET  65           2HE      MET  65  -2.241  -1.964   8.898
  537    H    ILE  66           H        ILE  66  -7.150  -2.028   7.371
  538    HA   ILE  66           HA       ILE  66  -8.238   0.372   6.281
  539    HB   ILE  66           HB       ILE  66  -7.263  -2.199   5.212
  540   HG12  ILE  66          1HG1      ILE  66  -6.155  -0.725   3.619
  541   HG13  ILE  66          2HG1      ILE  66  -7.123   0.639   4.169
  542   HG21  ILE  66          1HG2      ILE  66  -9.388  -2.337   4.189
  543   HG22  ILE  66          2HG2      ILE  66  -9.407  -0.612   3.826
  544   HG23  ILE  66          3HG2      ILE  66  -8.301  -1.681   2.965
  545   HD11  ILE  66          3HD1      ILE  66  -6.001   0.744   6.219
  546   HD12  ILE  66          1HD1      ILE  66  -5.295  -0.859   6.012
  547   HD13  ILE  66          2HD1      ILE  66  -4.739   0.486   5.014
  548    H    GLU  67           H        GLU  67  -9.504  -2.921   6.713
  549    HA   GLU  67           HA       GLU  67 -12.007  -2.519   5.541
  550    HB2  GLU  67           1HB      GLU  67 -10.918  -4.440   7.551
  551    HB3  GLU  67           2HB      GLU  67 -12.659  -4.378   7.307
  552    HG2  GLU  67           1HG      GLU  67 -12.400  -4.908   4.975
  553    HG3  GLU  67           2HG      GLU  67 -10.645  -4.831   5.118
  554    H    GLY  68           H        GLY  68 -10.986  -2.146   8.925
  555    HA2  GLY  68           1HA      GLY  68 -13.544  -1.382   9.892
  556    HA3  GLY  68           2HA      GLY  68 -12.011  -1.129  10.714
  557    H    ALA  69           H        ALA  69 -10.646   0.565   9.166
  558    HA   ALA  69           HA       ALA  69 -11.781   3.059   9.720
  559    HB1  ALA  69           3HB      ALA  69  -9.962   3.972   8.291
  560    HB2  ALA  69           1HB      ALA  69  -9.405   2.828   9.511
  561    HB3  ALA  69           2HB      ALA  69  -9.555   2.320   7.828
  562    H    GLN  70           H        GLN  70 -11.320   1.502   6.540
  563    HA   GLN  70           HA       GLN  70 -12.664   3.421   5.028
  564    HB2  GLN  70           1HB      GLN  70 -11.235   1.338   4.324
  565    HB3  GLN  70           2HB      GLN  70 -12.793   0.523   4.283
  566    HG2  GLN  70           1HG      GLN  70 -13.496   2.552   2.806
  567    HG3  GLN  70           2HG      GLN  70 -11.759   2.724   2.562
  568   HE21  GLN  70          1HE2      GLN  70 -13.985  -0.033   2.777
  569   HE22  GLN  70          2HE2      GLN  70 -13.490  -0.767   1.293
  570    H    GLY  71           H        GLY  71 -13.890   0.444   6.532
  571    HA2  GLY  71           1HA      GLY  71 -16.495   0.500   5.576
  572    HA3  GLY  71           2HA      GLY  71 -16.020  -0.171   7.129
  573    H    ALA  72           H        ALA  72 -15.284   1.944   8.602
  574    HA   ALA  72           HA       ALA  72 -17.763   3.123   9.301
  575    HB1  ALA  72           3HB      ALA  72 -15.056   4.067  10.213
  576    HB2  ALA  72           1HB      ALA  72 -16.599   4.199  11.058
  577    HB3  ALA  72           2HB      ALA  72 -15.837   2.621  10.852
  578    H    LEU  73           H        LEU  73 -14.878   4.366   7.660
  579    HA   LEU  73           HA       LEU  73 -15.602   7.048   7.489
  580    HG   LEU  73           HG       LEU  73 -13.715   8.284   6.684
  581    HB2  LEU  73           1HB      LEU  73 -13.428   5.772   6.797
  582    HB3  LEU  73           2HB      LEU  73 -14.208   5.700   5.219
  583   HD11  LEU  73          1HD1      LEU  73 -11.544   7.977   6.293
  584   HD12  LEU  73          2HD1      LEU  73 -11.935   8.172   4.585
  585   HD13  LEU  73          3HD1      LEU  73 -11.841   6.557   5.288
  586   HD21  LEU  73          3HD2      LEU  73 -15.301   8.707   5.058
  587   HD22  LEU  73          1HD2      LEU  73 -14.641   7.504   3.951
  588   HD23  LEU  73          2HD2      LEU  73 -13.797   9.034   4.196
  589    H    GLU  74           H        GLU  74 -16.224   4.414   5.179
  590    HA   GLU  74           HA       GLU  74 -17.665   5.987   3.332
  591    HB2  GLU  74           1HB      GLU  74 -17.600   3.021   3.862
  592    HB3  GLU  74           2HB      GLU  74 -18.578   3.725   2.584
  593    HG2  GLU  74           1HG      GLU  74 -15.608   4.124   2.811
  594    HG3  GLU  74           2HG      GLU  74 -16.353   2.832   1.871
  595    H    ARG  75           H        ARG  75 -18.752   3.835   5.945
  596    HA   ARG  75           HA       ARG  75 -21.505   4.179   5.563
  597    HE   ARG  75           HE       ARG  75 -24.160   1.463   8.238
  598    HB2  ARG  75           1HB      ARG  75 -20.293   2.475   7.039
  599    HB3  ARG  75           2HB      ARG  75 -20.218   3.746   8.252
  600    HG2  ARG  75           1HG      ARG  75 -22.094   2.297   8.686
  601    HG3  ARG  75           2HG      ARG  75 -22.669   3.899   8.219
  602    HD2  ARG  75           1HD      ARG  75 -23.406   3.173   6.148
  603    HD3  ARG  75           2HD      ARG  75 -22.337   1.771   6.148
  604   HH11  ARG  75          1HH1      ARG  75 -24.137   1.578   4.759
  605   HH12  ARG  75          2HH1      ARG  75 -25.520   0.548   4.586
  606   HH21  ARG  75          1HH2      ARG  75 -25.981   0.108   8.024
  607   HH22  ARG  75          2HH2      ARG  75 -26.568  -0.287   6.444
  608    H    GLU  76           H        GLU  76 -19.123   6.213   7.053
  609    HA   GLU  76           HA       GLU  76 -21.000   7.842   8.494
  610    HB2  GLU  76           1HB      GLU  76 -18.657   7.595   9.226
  611    HB3  GLU  76           2HB      GLU  76 -18.120   8.391   7.754
  612    HG2  GLU  76           1HG      GLU  76 -19.025  10.457   8.415
  613    HG3  GLU  76           2HG      GLU  76 -19.973   9.717   9.704
  614    H    LEU  77           H        LEU  77 -18.966   8.383   5.615
  615    HA   LEU  77           HA       LEU  77 -20.095  10.884   4.961
  616    HG   LEU  77           HG       LEU  77 -18.580   7.762   3.798
  617    HB2  LEU  77           1HB      LEU  77 -19.068  10.500   2.730
  618    HB3  LEU  77           2HB      LEU  77 -17.959  10.308   4.086
  619   HD11  LEU  77          1HD1      LEU  77 -19.560   7.124   1.899
  620   HD12  LEU  77          2HD1      LEU  77 -18.610   8.247   0.927
  621   HD13  LEU  77          3HD1      LEU  77 -20.070   8.805   1.742
  622   HD21  LEU  77          3HD2      LEU  77 -16.425   9.329   3.190
  623   HD22  LEU  77          1HD2      LEU  77 -16.777   8.562   1.642
  624   HD23  LEU  77          2HD2      LEU  77 -16.474   7.569   3.067
  625    H    LYS  78           H        LYS  78 -21.165   7.650   4.464
  626    HA   LYS  78           HA       LYS  78 -22.816   8.016   2.212
  627    HB2  LYS  78           1HB      LYS  78 -22.555   6.009   4.372
  628    HB3  LYS  78           2HB      LYS  78 -24.114   6.066   3.559
  629    HG2  LYS  78           1HG      LYS  78 -21.551   5.898   2.015
  630    HG3  LYS  78           2HG      LYS  78 -22.342   4.459   2.662
  631    HD2  LYS  78           1HD      LYS  78 -24.266   4.799   1.343
  632    HD3  LYS  78           2HD      LYS  78 -23.801   6.456   0.952
  633    HE2  LYS  78           1HE      LYS  78 -23.466   4.837  -0.911
  634    HE3  LYS  78           2HE      LYS  78 -22.002   5.694  -0.430
  635    HZ1  LYS  78           3HZ      LYS  78 -22.584   3.082   0.777
  636    HZ2  LYS  78           1HZ      LYS  78 -21.091   3.818   0.477
  637    HZ3  LYS  78           2HZ      LYS  78 -21.967   3.134  -0.797
  638    H    ARG  79           H        ARG  79 -23.092   9.171   5.394
  639    HA   ARG  79           HA       ARG  79 -25.797   9.197   5.914
  640    HE   ARG  79           HE       ARG  79 -26.140  11.559   8.805
  641    HB2  ARG  79           1HB      ARG  79 -23.589  11.124   6.552
  642    HB3  ARG  79           2HB      ARG  79 -25.247  11.504   7.001
  643    HG2  ARG  79           1HG      ARG  79 -23.879   8.950   7.800
  644    HG3  ARG  79           2HG      ARG  79 -23.841  10.418   8.779
  645    HD2  ARG  79           1HD      ARG  79 -26.307   8.909   7.918
  646    HD3  ARG  79           2HD      ARG  79 -25.603   8.915   9.533
  647   HH11  ARG  79          1HH1      ARG  79 -27.852   8.614   9.526
  648   HH12  ARG  79          2HH1      ARG  79 -29.260   9.426  10.127
  649   HH21  ARG  79          1HH2      ARG  79 -27.988  12.639   9.594
  650   HH22  ARG  79          2HH2      ARG  79 -29.336  11.715  10.164
  651    H    THR  80           H        THR  80 -23.933  11.533   3.994
  652    HA   THR  80           HA       THR  80 -26.385  12.241   2.568
  653    HB   THR  80           HB       THR  80 -25.749  14.673   2.666
  654    HG1  THR  80           1HG      THR  80 -23.778  14.905   3.462
  655   HG21  THR  80          3HG2      THR  80 -27.443  13.390   4.193
  656   HG22  THR  80          1HG2      THR  80 -27.008  15.057   4.566
  657   HG23  THR  80          2HG2      THR  80 -26.261  13.731   5.458
  658    H    ASP  81           H        ASP  81 -26.051  13.061   0.477
  659    HA   ASP  81           HA       ASP  81 -23.534  13.696  -0.612
  660    HB2  ASP  81           1HB      ASP  81 -23.057  11.730  -1.937
  661    HB3  ASP  81           2HB      ASP  81 -23.156  11.262  -0.241
  662    H    LEU  82           H        LEU  82 -25.952  14.926  -0.762
  663    HA   LEU  82           HA       LEU  82 -27.093  14.277  -3.375
  664    HG   LEU  82           HG       LEU  82 -29.355  14.546  -3.541
  665    HB2  LEU  82           1HB      LEU  82 -28.362  14.892  -1.138
  666    HB3  LEU  82           2HB      LEU  82 -28.083  16.536  -1.712
  667   HD11  LEU  82          1HD1      LEU  82 -30.595  14.316  -1.457
  668   HD12  LEU  82          2HD1      LEU  82 -31.557  15.152  -2.674
  669   HD13  LEU  82          3HD1      LEU  82 -30.798  16.066  -1.373
  670   HD21  LEU  82          3HD2      LEU  82 -29.148  17.494  -3.258
  671   HD22  LEU  82          1HD2      LEU  82 -30.622  16.834  -3.967
  672   HD23  LEU  82          2HD2      LEU  82 -29.056  16.483  -4.701
  673    H    ASN  83           H        ASN  83 -25.400  14.990  -4.709
  674    HA   ASN  83           HA       ASN  83 -25.577  17.624  -5.618
  675    HB2  ASN  83           1HB      ASN  83 -23.994  17.447  -3.309
  676    HB3  ASN  83           2HB      ASN  83 -22.853  17.575  -4.644
  677   HD21  ASN  83          1HD2      ASN  83 -23.371  19.318  -6.247
  678   HD22  ASN  83          2HD2      ASN  83 -23.928  20.825  -5.613
  679    H    ILE  84           H        ILE  84 -24.270  18.019  -7.458
  680    HA   ILE  84           HA       ILE  84 -23.670  15.755  -8.998
  681    HB   ILE  84           HB       ILE  84 -22.682  18.580  -9.406
  682   HG12  ILE  84          1HG1      ILE  84 -25.080  17.239 -10.661
  683   HG13  ILE  84          2HG1      ILE  84 -25.188  18.249  -9.223
  684   HG21  ILE  84          1HG2      ILE  84 -22.767  17.720 -11.859
  685   HG22  ILE  84          2HG2      ILE  84 -21.382  17.327 -10.842
  686   HG23  ILE  84          3HG2      ILE  84 -22.647  16.128 -11.111
  687   HD11  ILE  84          3HD1      ILE  84 -24.364  19.065 -11.992
  688   HD12  ILE  84          1HD1      ILE  84 -25.771  19.597 -11.072
  689   HD13  ILE  84          2HD1      ILE  84 -24.153  20.092 -10.574
  690    H    LEU  85           H        LEU  85 -21.420  18.151  -7.607
  691    HA   LEU  85           HA       LEU  85 -19.068  16.782  -8.272
  692    HG   LEU  85           HG       LEU  85 -17.725  17.482  -5.392
  693    HB2  LEU  85           1HB      LEU  85 -18.890  19.054  -7.682
  694    HB3  LEU  85           2HB      LEU  85 -19.719  18.801  -6.148
  695   HD11  LEU  85          1HD1      LEU  85 -16.417  18.680  -7.827
  696   HD12  LEU  85          2HD1      LEU  85 -16.878  16.986  -7.670
  697   HD13  LEU  85          3HD1      LEU  85 -15.658  17.671  -6.595
  698   HD21  LEU  85          3HD2      LEU  85 -16.487  20.036  -5.953
  699   HD22  LEU  85          1HD2      LEU  85 -17.027  19.356  -4.418
  700   HD23  LEU  85          2HD2      LEU  85 -18.167  20.221  -5.451
  701    H    GLU  86           H        GLU  86 -20.903  16.822  -5.223
  702    HA   GLU  86           HA       GLU  86 -19.265  15.091  -3.776
  703    HB2  GLU  86           1HB      GLU  86 -22.257  15.480  -3.587
  704    HB3  GLU  86           2HB      GLU  86 -21.275  14.656  -2.384
  705    HG2  GLU  86           1HG      GLU  86 -20.074  16.687  -1.906
  706    HG3  GLU  86           2HG      GLU  86 -20.923  17.530  -3.200
  707    H    ARG  87           H        ARG  87 -21.895  14.417  -6.024
  708    HA   ARG  87           HA       ARG  87 -22.086  11.646  -5.525
  709    HE   ARG  87           HE       ARG  87 -24.939   9.225  -8.584
  710    HB2  ARG  87           1HB      ARG  87 -23.833  12.912  -6.697
  711    HB3  ARG  87           2HB      ARG  87 -22.737  13.189  -8.042
  712    HG2  ARG  87           1HG      ARG  87 -22.814  10.964  -8.724
  713    HG3  ARG  87           2HG      ARG  87 -23.435  10.413  -7.167
  714    HD2  ARG  87           1HD      ARG  87 -25.521  11.723  -7.648
  715    HD3  ARG  87           2HD      ARG  87 -24.895  11.994  -9.274
  716   HH11  ARG  87          1HH1      ARG  87 -26.908  11.877  -9.687
  717   HH12  ARG  87          2HH1      ARG  87 -28.060  10.860 -10.485
  718   HH21  ARG  87          1HH2      ARG  87 -26.450   7.876  -9.633
  719   HH22  ARG  87          2HH2      ARG  87 -27.800   8.584 -10.454
  720    H    PHE  88           H        PHE  88 -20.261  13.500  -7.940
  721    HA   PHE  88           HA       PHE  88 -19.157  11.321  -9.311
  722    HD1  PHE  88           2HD      PHE  88 -17.752  11.186 -11.168
  723    HD2  PHE  88           1HD      PHE  88 -15.989  14.661  -9.455
  724    HE1  PHE  88           2HE      PHE  88 -15.634  10.670 -12.308
  725    HE2  PHE  88           1HE      PHE  88 -13.868  14.151 -10.594
  726    HZ   PHE  88           HZ       PHE  88 -13.689  12.152 -12.022
  727    HB2  PHE  88           1HB      PHE  88 -19.041  13.504 -10.295
  728    HB3  PHE  88           2HB      PHE  88 -18.148  14.140  -8.917
  729    H    ASN  89           H        ASN  89 -17.682  13.338  -6.766
  730    HA   ASN  89           HA       ASN  89 -15.321  11.890  -6.485
  731    HB2  ASN  89           1HB      ASN  89 -16.778  13.312  -4.249
  732    HB3  ASN  89           2HB      ASN  89 -15.049  12.998  -4.363
  733   HD21  ASN  89          1HD2      ASN  89 -14.429  13.730  -6.871
  734   HD22  ASN  89          2HD2      ASN  89 -14.740  15.412  -7.110
  735    H    TYR  90           H        TYR  90 -18.445  11.473  -4.873
  736    HA   TYR  90           HA       TYR  90 -17.632   9.422  -3.112
  737    HD1  TYR  90           1HD      TYR  90 -18.178  11.919  -2.591
  738    HD2  TYR  90           2HD      TYR  90 -21.283   9.338  -1.250
  739    HE1  TYR  90           1HE      TYR  90 -18.203  13.084  -0.425
  740    HE2  TYR  90           2HE      TYR  90 -21.318  10.496   0.918
  741    HH   TYR  90           HH       TYR  90 -20.507  13.136   1.609
  742    HB2  TYR  90           1HB      TYR  90 -20.253  10.440  -4.115
  743    HB3  TYR  90           2HB      TYR  90 -20.220   8.888  -3.285
  744    H    GLU  91           H        GLU  91 -19.069   9.353  -6.348
  745    HA   GLU  91           HA       GLU  91 -19.468   6.605  -6.576
  746    HB2  GLU  91           1HB      GLU  91 -20.305   8.311  -8.179
  747    HB3  GLU  91           2HB      GLU  91 -18.664   8.512  -8.780
  748    HG2  GLU  91           1HG      GLU  91 -18.675   6.531  -9.896
  749    HG3  GLU  91           2HG      GLU  91 -19.806   5.776  -8.773
  750    H    GLU  92           H        GLU  92 -16.666   8.518  -7.678
  751    HA   GLU  92           HA       GLU  92 -15.115   6.336  -8.513
  752    HB2  GLU  92           1HB      GLU  92 -14.800   8.898  -8.892
  753    HB3  GLU  92           2HB      GLU  92 -13.872   8.828  -7.400
  754    HG2  GLU  92           1HG      GLU  92 -12.295   8.622  -9.109
  755    HG3  GLU  92           2HG      GLU  92 -12.522   6.984  -8.498
  756    H    ALA  93           H        ALA  93 -15.159   8.095  -5.427
  757    HA   ALA  93           HA       ALA  93 -13.093   6.826  -4.117
  758    HB1  ALA  93           3HB      ALA  93 -14.124   8.683  -3.075
  759    HB2  ALA  93           1HB      ALA  93 -15.701   7.891  -3.060
  760    HB3  ALA  93           2HB      ALA  93 -14.407   7.302  -2.016
  761    H    GLN  94           H        GLN  94 -16.497   5.812  -4.295
  762    HA   GLN  94           HA       GLN  94 -16.168   3.480  -2.727
  763    HB2  GLN  94           1HB      GLN  94 -18.335   4.731  -3.382
  764    HB3  GLN  94           2HB      GLN  94 -18.270   3.773  -4.855
  765    HG2  GLN  94           1HG      GLN  94 -18.086   1.754  -3.264
  766    HG3  GLN  94           2HG      GLN  94 -18.681   2.870  -2.036
  767   HE21  GLN  94          1HE2      GLN  94 -20.165   0.713  -2.553
  768   HE22  GLN  94          2HE2      GLN  94 -21.589   1.133  -3.438
  769    H    THR  95           H        THR  95 -15.962   4.111  -6.187
  770    HA   THR  95           HA       THR  95 -15.899   1.492  -7.134
  771    HB   THR  95           HB       THR  95 -14.410   3.891  -8.222
  772    HG1  THR  95           1HG      THR  95 -16.995   2.820  -8.767
  773   HG21  THR  95          3HG2      THR  95 -14.369   1.150  -9.014
  774   HG22  THR  95          1HG2      THR  95 -13.571   2.528  -9.771
  775   HG23  THR  95          2HG2      THR  95 -15.208   2.083 -10.253
  776    H    LEU  96           H        LEU  96 -13.157   3.590  -6.244
  777    HA   LEU  96           HA       LEU  96 -11.181   1.606  -6.644
  778    HG   LEU  96           HG       LEU  96 -11.297   4.567  -7.420
  779    HB2  LEU  96           1HB      LEU  96 -11.169   4.133  -5.005
  780    HB3  LEU  96           2HB      LEU  96  -9.746   3.127  -5.269
  781   HD11  LEU  96          1HD1      LEU  96  -9.239   5.950  -7.574
  782   HD12  LEU  96          2HD1      LEU  96  -8.663   5.183  -6.094
  783   HD13  LEU  96          3HD1      LEU  96 -10.130   6.161  -6.066
  784   HD21  LEU  96          3HD2      LEU  96 -10.311   2.568  -8.306
  785   HD22  LEU  96          1HD2      LEU  96  -8.778   2.913  -7.506
  786   HD23  LEU  96          2HD2      LEU  96  -9.338   3.945  -8.822
  787    H    SER  97           H        SER  97 -12.934   2.707  -3.772
  788    HA   SER  97           HA       SER  97 -11.557   1.216  -1.855
  789    HG   SER  97           HG       SER  97 -13.468   3.429  -0.097
  790    HB2  SER  97           1HB      SER  97 -14.279   2.430  -2.018
  791    HB3  SER  97           2HB      SER  97 -13.957   1.286  -0.716
  792    H    LYS  98           H        LYS  98 -14.418   0.372  -3.778
  793    HA   LYS  98           HA       LYS  98 -14.841  -2.169  -2.643
  794    HB2  LYS  98           1HB      LYS  98 -16.182  -0.618  -4.434
  795    HB3  LYS  98           2HB      LYS  98 -15.531  -1.862  -5.494
  796    HG2  LYS  98           1HG      LYS  98 -16.509  -3.540  -3.844
  797    HG3  LYS  98           2HG      LYS  98 -17.405  -2.175  -3.174
  798    HD2  LYS  98           1HD      LYS  98 -17.467  -2.909  -6.094
  799    HD3  LYS  98           2HD      LYS  98 -18.618  -3.545  -4.916
  800    HE2  LYS  98           1HE      LYS  98 -19.791  -1.731  -5.648
  801    HE3  LYS  98           2HE      LYS  98 -18.886  -0.979  -4.337
  802    HZ1  LYS  98           3HZ      LYS  98 -18.117   0.444  -5.831
  803    HZ2  LYS  98           1HZ      LYS  98 -18.804  -0.418  -7.115
  804    HZ3  LYS  98           2HZ      LYS  98 -17.261  -0.822  -6.555
  805    H    ILE  99           H        ILE  99 -13.150  -1.215  -5.627
  806    HA   ILE  99           HA       ILE  99 -12.362  -3.753  -6.454
  807    HB   ILE  99           HB       ILE  99 -10.882  -1.146  -6.819
  808   HG12  ILE  99          1HG1      ILE  99 -12.569  -2.470  -8.908
  809   HG13  ILE  99          2HG1      ILE  99 -13.350  -1.515  -7.652
  810   HG21  ILE  99          1HG2      ILE  99  -9.266  -2.575  -7.503
  811   HG22  ILE  99          2HG2      ILE  99 -10.403  -3.888  -7.805
  812   HG23  ILE  99          3HG2      ILE  99 -10.230  -2.585  -8.981
  813   HD11  ILE  99          3HD1      ILE  99 -12.972  -0.191  -9.643
  814   HD12  ILE  99          1HD1      ILE  99 -12.008   0.421  -8.299
  815   HD13  ILE  99          2HD1      ILE  99 -11.244  -0.539  -9.567
  816    H    LEU 100           H        LEU 100 -10.751  -1.480  -4.267
  817    HA   LEU 100           HA       LEU 100  -8.383  -2.945  -3.902
  818    HG   LEU 100           HG       LEU 100  -7.395  -0.471  -3.778
  819    HB2  LEU 100           1HB      LEU 100  -9.600  -0.604  -2.823
  820    HB3  LEU 100           2HB      LEU 100  -9.009  -1.596  -1.493
  821   HD11  LEU 100          1HD1      LEU 100  -8.086   1.031  -1.864
  822   HD12  LEU 100          2HD1      LEU 100  -6.354   0.897  -2.166
  823   HD13  LEU 100          3HD1      LEU 100  -7.086   0.013  -0.828
  824   HD21  LEU 100          3HD2      LEU 100  -6.207  -2.374  -3.472
  825   HD22  LEU 100          1HD2      LEU 100  -6.839  -2.641  -1.846
  826   HD23  LEU 100          2HD2      LEU 100  -5.553  -1.462  -2.110
  827    H    LEU 101           H        LEU 101 -11.343  -2.834  -1.925
  828    HA   LEU 101           HA       LEU 101 -10.599  -4.646   0.035
  829    HG   LEU 101           HG       LEU 101 -12.544  -4.523   1.811
  830    HB2  LEU 101           1HB      LEU 101 -13.073  -3.507  -0.974
  831    HB3  LEU 101           2HB      LEU 101 -13.290  -5.149  -0.370
  832   HD11  LEU 101          1HD1      LEU 101 -10.748  -3.015   1.185
  833   HD12  LEU 101          2HD1      LEU 101 -11.829  -2.240   2.343
  834   HD13  LEU 101          3HD1      LEU 101 -11.920  -1.818   0.633
  835   HD21  LEU 101          3HD2      LEU 101 -14.475  -2.535   0.632
  836   HD22  LEU 101          1HD2      LEU 101 -14.174  -2.704   2.362
  837   HD23  LEU 101          2HD2      LEU 101 -14.852  -4.052   1.448
  838    H    LYS 102           H        LYS 102 -12.064  -5.252  -3.130
  839    HA   LYS 102           HA       LYS 102 -12.432  -8.021  -2.839
  840    HB2  LYS 102           1HB      LYS 102 -13.283  -6.392  -4.677
  841    HB3  LYS 102           2HB      LYS 102 -11.757  -6.750  -5.475
  842    HG2  LYS 102           1HG      LYS 102 -12.305  -9.017  -5.743
  843    HG3  LYS 102           2HG      LYS 102 -13.637  -8.914  -4.590
  844    HD2  LYS 102           1HD      LYS 102 -14.493  -8.999  -6.862
  845    HD3  LYS 102           2HD      LYS 102 -14.838  -7.425  -6.138
  846    HE2  LYS 102           1HE      LYS 102 -13.223  -6.347  -7.424
  847    HE3  LYS 102           2HE      LYS 102 -12.372  -7.847  -7.788
  848    HZ1  LYS 102           3HZ      LYS 102 -15.101  -7.743  -8.735
  849    HZ2  LYS 102           1HZ      LYS 102 -13.701  -8.274  -9.521
  850    HZ3  LYS 102           2HZ      LYS 102 -14.064  -6.624  -9.465
  851    H    ASP 103           H        ASP 103  -9.764  -6.205  -4.343
  852    HA   ASP 103           HA       ASP 103  -8.185  -8.419  -5.014
  853    HB2  ASP 103           1HB      ASP 103  -7.690  -5.505  -4.638
  854    HB3  ASP 103           2HB      ASP 103  -6.291  -6.574  -4.693
  855    H    LEU 104           H        LEU 104  -8.269  -6.438  -2.082
  856    HA   LEU 104           HA       LEU 104  -6.080  -7.631  -0.784
  857    HG   LEU 104           HG       LEU 104  -5.554  -5.470   0.211
  858    HB2  LEU 104           1HB      LEU 104  -8.023  -5.670  -0.204
  859    HB3  LEU 104           2HB      LEU 104  -8.082  -6.847   1.105
  860   HD11  LEU 104          1HD1      LEU 104  -7.125  -4.770   2.666
  861   HD12  LEU 104          2HD1      LEU 104  -7.416  -3.964   1.125
  862   HD13  LEU 104          3HD1      LEU 104  -5.826  -3.868   1.883
  863   HD21  LEU 104          3HD2      LEU 104  -6.295  -7.199   2.559
  864   HD22  LEU 104          1HD2      LEU 104  -4.856  -6.179   2.537
  865   HD23  LEU 104          2HD2      LEU 104  -5.036  -7.473   1.352
  866    H    LYS 105           H        LYS 105  -9.551  -8.358  -0.660
  867    HA   LYS 105           HA       LYS 105  -9.454 -10.385   1.261
  868    HB2  LYS 105           1HB      LYS 105 -11.337  -9.718  -0.970
  869    HB3  LYS 105           2HB      LYS 105 -11.546 -11.222  -0.083
  870    HG2  LYS 105           1HG      LYS 105 -11.348  -8.580   1.320
  871    HG3  LYS 105           2HG      LYS 105 -12.878  -9.192   0.690
  872    HD2  LYS 105           1HD      LYS 105 -11.157 -10.869   2.485
  873    HD3  LYS 105           2HD      LYS 105 -12.281  -9.680   3.148
  874    HE2  LYS 105           1HE      LYS 105 -14.079 -10.795   1.775
  875    HE3  LYS 105           2HE      LYS 105 -12.917 -12.076   1.438
  876    HZ1  LYS 105           3HZ      LYS 105 -14.388 -11.509   3.864
  877    HZ2  LYS 105           1HZ      LYS 105 -12.761 -11.903   4.102
  878    HZ3  LYS 105           2HZ      LYS 105 -13.779 -12.977   3.284
  879    H    GLU 106           H        GLU 106  -9.302 -10.616  -2.288
  880    HA   GLU 106           HA       GLU 106  -9.081 -13.391  -2.472
  881    HB2  GLU 106           1HB      GLU 106  -8.340 -11.101  -4.229
  882    HB3  GLU 106           2HB      GLU 106  -7.691 -12.686  -4.628
  883    HG2  GLU 106           1HG      GLU 106  -9.741 -13.552  -5.149
  884    HG3  GLU 106           2HG      GLU 106 -10.604 -12.437  -4.092
  885    H    THR 107           H        THR 107  -6.482 -10.952  -2.457
  886    HA   THR 107           HA       THR 107  -4.298 -12.628  -2.588
  887    HB   THR 107           HB       THR 107  -3.233 -10.779  -1.013
  888    HG1  THR 107           1HG      THR 107  -4.431  -8.930  -0.924
  889   HG21  THR 107          3HG2      THR 107  -3.888  -9.386  -3.428
  890   HG22  THR 107          1HG2      THR 107  -3.623 -11.090  -3.793
  891   HG23  THR 107          2HG2      THR 107  -2.371 -10.159  -2.971
  892    H    GLU 108           H        GLU 108  -5.893 -11.431   0.367
  893    HA   GLU 108           HA       GLU 108  -4.317 -12.768   2.225
  894    HB2  GLU 108           1HB      GLU 108  -5.876 -11.059   2.917
  895    HB3  GLU 108           2HB      GLU 108  -7.239 -12.017   2.355
  896    HG2  GLU 108           1HG      GLU 108  -7.158 -13.443   4.143
  897    HG3  GLU 108           2HG      GLU 108  -5.440 -13.167   4.425
  898    H    GLN 109           H        GLN 109  -7.285 -13.851   0.608
  899    HA   GLN 109           HA       GLN 109  -7.637 -16.273   1.910
  900    HB2  GLN 109           1HB      GLN 109  -8.273 -15.394  -0.897
  901    HB3  GLN 109           2HB      GLN 109  -8.684 -17.003  -0.319
  902    HG2  GLN 109           1HG      GLN 109  -9.541 -14.643   1.276
  903    HG3  GLN 109           2HG      GLN 109 -10.409 -15.038  -0.207
  904   HE21  GLN 109          1HE2      GLN 109  -9.794 -15.900   3.056
  905   HE22  GLN 109          2HE2      GLN 109 -10.908 -17.216   3.152
  906    H    LYS 110           H        LYS 110  -5.837 -15.656  -1.102
  907    HA   LYS 110           HA       LYS 110  -4.933 -18.253  -1.538
  908    HB2  LYS 110           1HB      LYS 110  -4.016 -15.541  -2.355
  909    HB3  LYS 110           2HB      LYS 110  -2.904 -16.883  -2.593
  910    HG2  LYS 110           1HG      LYS 110  -4.004 -16.800  -4.611
  911    HG3  LYS 110           2HG      LYS 110  -4.929 -18.027  -3.741
  912    HD2  LYS 110           1HD      LYS 110  -6.488 -16.157  -3.038
  913    HD3  LYS 110           2HD      LYS 110  -5.654 -15.143  -4.217
  914    HE2  LYS 110           1HE      LYS 110  -7.378 -15.922  -5.503
  915    HE3  LYS 110           2HE      LYS 110  -6.170 -17.164  -5.822
  916    HZ1  LYS 110           3HZ      LYS 110  -8.627 -17.747  -5.096
  917    HZ2  LYS 110           1HZ      LYS 110  -7.953 -17.590  -3.552
  918    HZ3  LYS 110           2HZ      LYS 110  -7.309 -18.708  -4.646
  919    H    VAL 111           H        VAL 111  -3.357 -15.597   0.227
  920    HA   VAL 111           HA       VAL 111  -1.002 -16.898   0.921
  921    HB   VAL 111           HB       VAL 111  -2.525 -14.860   2.551
  922   HG11  VAL 111          1HG1      VAL 111  -0.309 -14.352   3.533
  923   HG12  VAL 111          2HG1      VAL 111  -0.887 -15.972   3.928
  924   HG13  VAL 111          3HG1      VAL 111   0.352 -15.753   2.691
  925   HG21  VAL 111          3HG2      VAL 111  -1.430 -13.185   1.383
  926   HG22  VAL 111          1HG2      VAL 111  -0.172 -14.275   0.800
  927   HG23  VAL 111          2HG2      VAL 111  -1.794 -14.354   0.114
  928    H    LYS 112           H        LYS 112  -4.155 -16.926   2.517
  929    HA   LYS 112           HA       LYS 112  -3.270 -18.488   4.746
  930    HB2  LYS 112           1HB      LYS 112  -6.026 -17.832   3.698
  931    HB3  LYS 112           2HB      LYS 112  -5.738 -18.746   5.172
  932    HG2  LYS 112           1HG      LYS 112  -5.038 -16.922   6.337
  933    HG3  LYS 112           2HG      LYS 112  -4.414 -16.105   4.902
  934    HD2  LYS 112           1HD      LYS 112  -6.369 -14.939   5.727
  935    HD3  LYS 112           2HD      LYS 112  -6.730 -15.683   4.169
  936    HE2  LYS 112           1HE      LYS 112  -8.542 -15.955   5.841
  937    HE3  LYS 112           2HE      LYS 112  -7.904 -17.485   5.240
  938    HZ1  LYS 112           3HZ      LYS 112  -8.279 -17.177   7.757
  939    HZ2  LYS 112           1HZ      LYS 112  -6.826 -16.310   7.716
  940    HZ3  LYS 112           2HZ      LYS 112  -6.859 -17.929   7.229
  941    H    ASP 113           H        ASP 113  -4.470 -19.171   1.564
  942    HA   ASP 113           HA       ASP 113  -5.280 -21.854   2.026
  943    HB2  ASP 113           1HB      ASP 113  -5.828 -20.297   0.028
  944    HB3  ASP 113           2HB      ASP 113  -4.288 -20.846  -0.628
  945    H    ILE 114           H        ILE 114  -2.262 -20.376   0.918
  946    HA   ILE 114           HA       ILE 114  -0.860 -22.682   0.244
  947    HB   ILE 114           HB       ILE 114  -0.051 -19.958   1.138
  948   HG12  ILE 114          1HG1      ILE 114   1.222 -20.115  -1.036
  949   HG13  ILE 114          2HG1      ILE 114   0.491 -21.699  -1.274
  950   HG21  ILE 114          1HG2      ILE 114   2.374 -20.798   0.787
  951   HG22  ILE 114          2HG2      ILE 114   1.593 -21.051   2.347
  952   HG23  ILE 114          3HG2      ILE 114   1.705 -22.378   1.191
  953   HD11  ILE 114          3HD1      ILE 114  -1.735 -20.635  -1.196
  954   HD12  ILE 114          1HD1      ILE 114  -0.944 -19.063  -1.084
  955   HD13  ILE 114          2HD1      ILE 114  -0.729 -20.059  -2.524
  956    H    GLN 115           H        GLN 115  -0.390 -24.402   1.427
  957    HA   GLN 115           HA       GLN 115  -0.432 -24.262   4.320
  958    HB2  GLN 115           1HB      GLN 115  -0.129 -26.720   4.199
  959    HB3  GLN 115           2HB      GLN 115  -1.516 -26.154   3.277
  960    HG2  GLN 115           1HG      GLN 115   0.517 -26.126   1.425
  961    HG3  GLN 115           2HG      GLN 115   0.870 -27.555   2.394
  962   HE21  GLN 115          1HE2      GLN 115   0.168 -29.258   1.324
  963   HE22  GLN 115          2HE2      GLN 115  -1.379 -29.416   0.571
  964    H    THR 116           H        THR 116   1.291 -24.166   5.612
  965    HA   THR 116           HA       THR 116   3.900 -25.047   4.675
  966    HB   THR 116           HB       THR 116   5.034 -22.966   5.214
  967    HG1  THR 116           1HG      THR 116   3.401 -21.097   5.447
  968   HG21  THR 116          3HG2      THR 116   4.249 -21.584   3.373
  969   HG22  THR 116          1HG2      THR 116   2.714 -22.452   3.350
  970   HG23  THR 116          2HG2      THR 116   4.205 -23.287   2.913
  971    H    GLN 117           H        GLN 117   5.572 -24.583   6.522
  972    HA   GLN 117           HA       GLN 117   4.884 -26.097   8.726
  973    HB2  GLN 117           1HB      GLN 117   7.206 -25.496   7.977
  974    HB3  GLN 117           2HB      GLN 117   6.976 -23.919   8.717
  975    HG2  GLN 117           1HG      GLN 117   6.560 -26.381  10.344
  976    HG3  GLN 117           2HG      GLN 117   8.196 -25.818  10.008
  977   HE21  GLN 117          1HE2      GLN 117   6.455 -25.942  12.475
  978   HE22  GLN 117          2HE2      GLN 117   6.563 -24.354  13.147
  Start of MODEL    4
    1    H    GLN   1           H        GLN   1   3.981  -5.796 -18.472
    2    HA   GLN   1           HA       GLN   1   5.139  -4.663 -16.011
    3    HB2  GLN   1           1HB      GLN   1   6.392  -4.958 -18.740
    4    HB3  GLN   1           2HB      GLN   1   7.046  -3.902 -17.494
    5    HG2  GLN   1           1HG      GLN   1   7.506  -5.737 -16.063
    6    HG3  GLN   1           2HG      GLN   1   6.605  -6.846 -17.094
    7   HE21  GLN   1          1HE2      GLN   1   7.478  -7.362 -19.166
    8   HE22  GLN   1          2HE2      GLN   1   9.181  -7.272 -19.442
    9    H    GLU   2           H        GLU   2   3.685  -3.033 -15.693
   10    HA   GLU   2           HA       GLU   2   3.484  -1.031 -17.846
   11    HB2  GLU   2           1HB      GLU   2   1.412  -2.170 -16.039
   12    HB3  GLU   2           2HB      GLU   2   1.292  -0.461 -16.432
   13    HG2  GLU   2           1HG      GLU   2   1.661  -2.435 -18.629
   14    HG3  GLU   2           2HG      GLU   2   0.074  -2.252 -17.883
   15    H    HIS   3           H        HIS   3   3.120   1.196 -17.079
   16    HA   HIS   3           HA       HIS   3   4.659   1.686 -14.624
   17    HD1  HIS   3           1HD      HIS   3   5.951   3.743 -18.668
   18    HD2  HIS   3           2HD      HIS   3   6.763   0.970 -15.684
   19    HE1  HIS   3           1HE      HIS   3   7.969   2.470 -19.465
   20    HB2  HIS   3           1HB      HIS   3   4.097   3.553 -16.938
   21    HB3  HIS   3           2HB      HIS   3   5.120   3.909 -15.548
   22    H    LYS   4           H        LYS   4   4.012   3.441 -13.231
   23    HA   LYS   4           HA       LYS   4   1.092   3.813 -13.214
   24    HB2  LYS   4           1HB      LYS   4   3.112   3.423 -11.064
   25    HB3  LYS   4           2HB      LYS   4   1.745   4.471 -10.709
   26    HG2  LYS   4           1HG      LYS   4   1.138   2.327  -9.959
   27    HG3  LYS   4           2HG      LYS   4   0.255   2.579 -11.466
   28    HD2  LYS   4           1HD      LYS   4   1.935   1.272 -12.671
   29    HD3  LYS   4           2HD      LYS   4   2.829   1.030 -11.168
   30    HE2  LYS   4           1HE      LYS   4   1.634  -0.919 -11.243
   31    HE3  LYS   4           2HE      LYS   4   0.512   0.093 -10.336
   32    HZ1  LYS   4           3HZ      LYS   4  -0.832   0.394 -12.202
   33    HZ2  LYS   4           1HZ      LYS   4  -0.419  -1.245 -12.261
   34    HZ3  LYS   4           2HZ      LYS   4   0.358  -0.141 -13.279
   35    HA   PRO   5           HA       PRO   5   1.447   8.170 -13.582
   36    HB2  PRO   5           1HB      PRO   5  -0.451   9.064 -11.861
   37    HB3  PRO   5           2HB      PRO   5  -0.840   8.280 -13.396
   38    HG2  PRO   5           1HG      PRO   5  -0.803   7.124 -10.636
   39    HG3  PRO   5           2HG      PRO   5  -1.992   6.892 -11.930
   40    HD2  PRO   5           1HD      PRO   5  -0.070   5.068 -11.376
   41    HD3  PRO   5           2HD      PRO   5  -0.693   5.329 -13.018
   42    H    LYS   6           H        LYS   6   2.774   9.697 -12.810
   43    HA   LYS   6           HA       LYS   6   3.972   9.347 -10.206
   44    HB2  LYS   6           1HB      LYS   6   5.101  10.093 -12.446
   45    HB3  LYS   6           2HB      LYS   6   4.522  11.690 -11.992
   46    HG2  LYS   6           1HG      LYS   6   6.485  11.855 -10.935
   47    HG3  LYS   6           2HG      LYS   6   5.701  10.887  -9.685
   48    HD2  LYS   6           1HD      LYS   6   7.251   9.709 -11.985
   49    HD3  LYS   6           2HD      LYS   6   7.959  10.063 -10.408
   50    HE2  LYS   6           1HE      LYS   6   5.587   8.255 -10.854
   51    HE3  LYS   6           2HE      LYS   6   7.250   7.696 -10.687
   52    HZ1  LYS   6           3HZ      LYS   6   6.232   7.502  -8.578
   53    HZ2  LYS   6           1HZ      LYS   6   5.595   9.067  -8.647
   54    HZ3  LYS   6           2HZ      LYS   6   7.262   8.840  -8.480
   55    H    LYS   7           H        LYS   7   3.192  10.216  -8.413
   56    HA   LYS   7           HA       LYS   7   2.290  12.939  -8.324
   57    HB2  LYS   7           1HB      LYS   7   0.280  11.614  -9.136
   58    HB3  LYS   7           2HB      LYS   7   0.275  10.824  -7.565
   59    HG2  LYS   7           1HG      LYS   7   0.343  13.747  -7.439
   60    HG3  LYS   7           2HG      LYS   7  -1.109  13.078  -8.189
   61    HD2  LYS   7           1HD      LYS   7  -0.854  11.454  -6.035
   62    HD3  LYS   7           2HD      LYS   7  -0.191  12.960  -5.394
   63    HE2  LYS   7           1HE      LYS   7  -2.268  14.096  -6.288
   64    HE3  LYS   7           2HE      LYS   7  -2.921  12.483  -6.566
   65    HZ1  LYS   7           3HZ      LYS   7  -1.932  12.576  -3.955
   66    HZ2  LYS   7           1HZ      LYS   7  -3.540  12.421  -4.458
   67    HZ3  LYS   7           2HZ      LYS   7  -2.884  13.955  -4.183
   68    H    ASP   8           H        ASP   8   1.870  13.670  -6.136
   69    HA   ASP   8           HA       ASP   8   3.703  12.646  -4.272
   70    HB2  ASP   8           1HB      ASP   8   2.510  14.998  -4.478
   71    HB3  ASP   8           2HB      ASP   8   1.373  14.271  -3.345
   72    H    ASP   9           H        ASP   9   3.039  12.053  -1.973
   73    HA   ASP   9           HA       ASP   9   1.104   9.863  -2.152
   74    HB2  ASP   9           1HB      ASP   9   3.211  10.458  -0.062
   75    HB3  ASP   9           2HB      ASP   9   2.158   9.046  -0.070
   76    H    PHE  10           H        PHE  10   1.999  12.499   0.072
   77    HA   PHE  10           HA       PHE  10  -0.712  12.358   1.206
   78    HD1  PHE  10           1HD      PHE  10  -0.607  10.944   3.332
   79    HD2  PHE  10           2HD      PHE  10   3.426  12.198   2.806
   80    HE1  PHE  10           1HE      PHE  10   0.176   8.785   4.212
   81    HE2  PHE  10           2HE      PHE  10   4.215  10.040   3.685
   82    HZ   PHE  10           HZ       PHE  10   2.589   8.329   4.389
   83    HB2  PHE  10           1HB      PHE  10   1.730  13.691   2.393
   84    HB3  PHE  10           2HB      PHE  10   0.175  13.447   3.181
   85    H    ARG  11           H        ARG  11  -1.956  14.217   1.417
   86    HA   ARG  11           HA       ARG  11  -1.021  16.527  -0.155
   87    HE   ARG  11           HE       ARG  11  -5.694  15.517  -2.388
   88    HB2  ARG  11           1HB      ARG  11  -2.993  15.072  -1.010
   89    HB3  ARG  11           2HB      ARG  11  -3.922  15.867   0.253
   90    HG2  ARG  11           1HG      ARG  11  -2.994  18.050  -0.824
   91    HG3  ARG  11           2HG      ARG  11  -2.730  17.010  -2.227
   92    HD2  ARG  11           1HD      ARG  11  -5.373  17.136  -0.805
   93    HD3  ARG  11           2HD      ARG  11  -4.949  18.268  -2.089
   94   HH11  ARG  11          1HH1      ARG  11  -3.886  18.139  -3.794
   95   HH12  ARG  11          2HH1      ARG  11  -3.970  17.506  -5.405
   96   HH21  ARG  11          1HH2      ARG  11  -5.812  14.673  -4.504
   97   HH22  ARG  11          2HH2      ARG  11  -5.066  15.535  -5.807
   98    H    ASN  12           H        ASN  12  -3.351  15.669   2.408
   99    HA   ASN  12           HA       ASN  12  -2.358  17.630   4.202
  100    HB2  ASN  12           1HB      ASN  12  -4.653  18.897   4.196
  101    HB3  ASN  12           2HB      ASN  12  -3.402  19.344   3.039
  102   HD21  ASN  12          1HD2      ASN  12  -6.169  17.156   3.383
  103   HD22  ASN  12          2HD2      ASN  12  -6.720  17.320   1.755
  104    H    GLU  13           H        GLU  13  -3.024  17.218   6.250
  105    HA   GLU  13           HA       GLU  13  -5.119  15.171   6.567
  106    HB2  GLU  13           1HB      GLU  13  -2.789  15.721   8.412
  107    HB3  GLU  13           2HB      GLU  13  -3.963  14.422   8.568
  108    HG2  GLU  13           1HG      GLU  13  -2.246  13.283   7.615
  109    HG3  GLU  13           2HG      GLU  13  -3.101  13.802   6.163
  110    H    PHE  14           H        PHE  14  -3.894  18.250   7.647
  111    HA   PHE  14           HA       PHE  14  -5.310  18.645   9.987
  112    HD1  PHE  14           1HD      PHE  14  -3.722  20.500  11.388
  113    HD2  PHE  14           2HD      PHE  14  -2.428  20.108   7.352
  114    HE1  PHE  14           1HE      PHE  14  -1.382  20.441  12.147
  115    HE2  PHE  14           2HE      PHE  14  -0.086  20.047   8.105
  116    HZ   PHE  14           HZ       PHE  14   0.439  20.213  10.505
  117    HB2  PHE  14           1HB      PHE  14  -4.668  20.663   7.827
  118    HB3  PHE  14           2HB      PHE  14  -5.187  21.069   9.459
  119    H    ASP  15           H        ASP  15  -6.409  18.859   6.661
  120    HA   ASP  15           HA       ASP  15  -8.903  20.088   7.185
  121    HB2  ASP  15           1HB      ASP  15  -7.811  18.471   4.899
  122    HB3  ASP  15           2HB      ASP  15  -9.503  18.962   4.925
  123    H    HIS  16           H        HIS  16  -8.035  16.677   6.626
  124    HA   HIS  16           HA       HIS  16  -9.087  14.730   7.158
  125    HD1  HIS  16           1HD      HIS  16 -10.698  14.477  11.437
  126    HD2  HIS  16           2HD      HIS  16  -8.817  12.848   8.109
  127    HE1  HIS  16           1HE      HIS  16 -10.518  12.012  11.905
  128    HB2  HIS  16           1HB      HIS  16  -8.849  16.042   9.455
  129    HB3  HIS  16           2HB      HIS  16 -10.608  16.051   9.358
  130    H    LEU  17           H        LEU  17 -10.290  15.953   5.091
  131    HA   LEU  17           HA       LEU  17 -13.120  16.261   5.560
  132    HG   LEU  17           HG       LEU  17 -14.388  16.527   3.194
  133    HB2  LEU  17           1HB      LEU  17 -11.584  17.424   3.792
  134    HB3  LEU  17           2HB      LEU  17 -11.917  15.978   2.842
  135   HD11  LEU  17          1HD1      LEU  17 -13.381  19.305   3.697
  136   HD12  LEU  17          2HD1      LEU  17 -13.789  18.217   5.023
  137   HD13  LEU  17          3HD1      LEU  17 -15.021  18.674   3.846
  138   HD21  LEU  17          3HD2      LEU  17 -14.422  17.999   1.296
  139   HD22  LEU  17          1HD2      LEU  17 -13.122  16.825   1.080
  140   HD23  LEU  17          2HD2      LEU  17 -12.746  18.474   1.581
  141    H    LEU  18           H        LEU  18 -14.758  14.969   4.557
  142    HA   LEU  18           HA       LEU  18 -14.577  12.260   4.993
  143    HG   LEU  18           HG       LEU  18 -15.780  14.847   2.814
  144    HB2  LEU  18           1HB      LEU  18 -16.507  12.173   3.241
  145    HB3  LEU  18           2HB      LEU  18 -16.738  12.983   4.789
  146   HD11  LEU  18          1HD1      LEU  18 -17.185  14.630   1.068
  147   HD12  LEU  18          2HD1      LEU  18 -18.496  13.994   2.062
  148   HD13  LEU  18          3HD1      LEU  18 -17.186  12.932   1.545
  149   HD21  LEU  18          3HD2      LEU  18 -17.257  16.208   3.841
  150   HD22  LEU  18          1HD2      LEU  18 -17.264  14.932   5.060
  151   HD23  LEU  18          2HD2      LEU  18 -18.539  14.995   3.843
  152    H    ILE  19           H        ILE  19 -14.594  13.776   1.761
  153    HA   ILE  19           HA       ILE  19 -13.841  11.456   0.371
  154    HB   ILE  19           HB       ILE  19 -13.594  14.372  -0.347
  155   HG12  ILE  19          1HG1      ILE  19 -15.870  13.409  -0.184
  156   HG13  ILE  19          2HG1      ILE  19 -15.468  13.894  -1.828
  157   HG21  ILE  19          1HG2      ILE  19 -12.466  12.016  -1.675
  158   HG22  ILE  19          2HG2      ILE  19 -13.425  13.060  -2.723
  159   HG23  ILE  19          3HG2      ILE  19 -12.050  13.721  -1.840
  160   HD11  ILE  19          3HD1      ILE  19 -14.700  11.201  -1.562
  161   HD12  ILE  19          1HD1      ILE  19 -16.309  11.355  -0.859
  162   HD13  ILE  19          2HD1      ILE  19 -16.019  11.873  -2.519
  163    H    GLU  20           H        GLU  20 -11.941  14.026   1.848
  164    HA   GLU  20           HA       GLU  20  -9.448  13.447   0.745
  165    HB2  GLU  20           1HB      GLU  20 -10.320  14.681   3.336
  166    HB3  GLU  20           2HB      GLU  20  -8.615  14.372   3.038
  167    HG2  GLU  20           1HG      GLU  20 -10.449  16.121   1.420
  168    HG3  GLU  20           2HG      GLU  20  -9.120  16.638   2.456
  169    H    GLN  21           H        GLN  21 -10.825  12.296   3.825
  170    HA   GLN  21           HA       GLN  21  -8.696  10.570   4.463
  171    HB2  GLN  21           1HB      GLN  21 -10.593  11.431   5.970
  172    HB3  GLN  21           2HB      GLN  21 -11.545  10.107   5.313
  173    HG2  GLN  21           1HG      GLN  21 -10.265   8.493   6.340
  174    HG3  GLN  21           2HG      GLN  21  -8.864   9.552   6.490
  175   HE21  GLN  21          1HE2      GLN  21  -8.963   8.612   8.702
  176   HE22  GLN  21          2HE2      GLN  21  -9.922   9.436   9.879
  177    H    ALA  22           H        ALA  22 -11.737  10.030   2.738
  178    HA   ALA  22           HA       ALA  22 -11.539   7.245   2.470
  179    HB1  ALA  22           3HB      ALA  22 -13.009   7.670   0.403
  180    HB2  ALA  22           1HB      ALA  22 -13.632   8.141   1.985
  181    HB3  ALA  22           2HB      ALA  22 -12.965   9.361   0.899
  182    H    ASN  23           H        ASN  23 -10.461   9.858   0.313
  183    HA   ASN  23           HA       ASN  23  -9.461   8.214  -1.732
  184    HB2  ASN  23           1HB      ASN  23  -9.246  11.048  -0.965
  185    HB3  ASN  23           2HB      ASN  23  -7.874  10.435  -1.882
  186   HD21  ASN  23          1HD2      ASN  23 -11.411  10.119  -1.939
  187   HD22  ASN  23          2HD2      ASN  23 -11.573  10.369  -3.642
  188    H    HIS  24           H        HIS  24  -7.923   9.565   1.154
  189    HA   HIS  24           HA       HIS  24  -5.306   8.675   0.582
  190    HD1  HIS  24           1HD      HIS  24  -6.496  12.042   3.058
  191    HD2  HIS  24           2HD      HIS  24  -3.281  10.198   1.178
  192    HE1  HIS  24           1HE      HIS  24  -4.989  13.913   2.313
  193    HB2  HIS  24           1HB      HIS  24  -6.740   9.595   3.038
  194    HB3  HIS  24           2HB      HIS  24  -5.169   8.817   3.216
  195    H    ALA  25           H        ALA  25  -8.029   7.179   2.241
  196    HA   ALA  25           HA       ALA  25  -6.635   4.948   3.272
  197    HB1  ALA  25           3HB      ALA  25  -8.668   4.182   3.982
  198    HB2  ALA  25           1HB      ALA  25  -9.052   5.887   3.745
  199    HB3  ALA  25           2HB      ALA  25  -9.502   4.703   2.517
  200    H    ILE  26           H        ILE  26  -8.639   5.311   0.348
  201    HA   ILE  26           HA       ILE  26  -8.222   2.698  -0.617
  202    HB   ILE  26           HB       ILE  26  -8.996   3.557  -2.792
  203   HG12  ILE  26          1HG1      ILE  26  -8.905   6.246  -1.407
  204   HG13  ILE  26          2HG1      ILE  26  -7.893   5.738  -2.755
  205   HG21  ILE  26          1HG2      ILE  26 -11.121   3.540  -2.083
  206   HG22  ILE  26          2HG2      ILE  26 -10.422   3.309  -0.481
  207   HG23  ILE  26          3HG2      ILE  26 -10.877   4.925  -1.019
  208   HD11  ILE  26          3HD1      ILE  26  -9.396   6.643  -4.098
  209   HD12  ILE  26          1HD1      ILE  26 -10.498   5.346  -3.636
  210   HD13  ILE  26          2HD1      ILE  26 -10.529   6.882  -2.768
  211    H    GLU  27           H        GLU  27  -6.416   5.682  -0.999
  212    HA   GLU  27           HA       GLU  27  -4.743   4.849  -3.112
  213    HB2  GLU  27           1HB      GLU  27  -4.963   7.198  -2.492
  214    HB3  GLU  27           2HB      GLU  27  -4.244   6.873  -0.922
  215    HG2  GLU  27           1HG      GLU  27  -2.125   6.514  -1.835
  216    HG3  GLU  27           2HG      GLU  27  -2.765   6.313  -3.466
  217    H    LYS  28           H        LYS  28  -4.025   5.080   0.376
  218    HA   LYS  28           HA       LYS  28  -1.542   3.825   0.307
  219    HB2  LYS  28           1HB      LYS  28  -2.380   5.051   2.258
  220    HB3  LYS  28           2HB      LYS  28  -3.591   3.806   2.532
  221    HG2  LYS  28           1HG      LYS  28  -1.727   2.174   2.848
  222    HG3  LYS  28           2HG      LYS  28  -0.605   3.535   2.777
  223    HD2  LYS  28           1HD      LYS  28  -2.903   3.428   4.716
  224    HD3  LYS  28           2HD      LYS  28  -1.313   2.759   5.091
  225    HE2  LYS  28           1HE      LYS  28  -0.310   4.826   5.158
  226    HE3  LYS  28           2HE      LYS  28  -1.494   5.553   4.073
  227    HZ1  LYS  28           3HZ      LYS  28  -1.525   5.343   6.941
  228    HZ2  LYS  28           1HZ      LYS  28  -2.984   4.877   6.222
  229    HZ3  LYS  28           2HZ      LYS  28  -2.350   6.417   5.927
  230    H    GLY  29           H        GLY  29  -4.726   2.385   1.032
  231    HA2  GLY  29           1HA      GLY  29  -3.891  -0.245   1.388
  232    HA3  GLY  29           2HA      GLY  29  -5.485   0.230   0.824
  233    H    GLU  30           H        GLU  30  -4.797   1.419  -1.609
  234    HA   GLU  30           HA       GLU  30  -4.693  -0.811  -3.303
  235    HB2  GLU  30           1HB      GLU  30  -5.714   1.218  -4.074
  236    HB3  GLU  30           2HB      GLU  30  -4.222   2.120  -3.847
  237    HG2  GLU  30           1HG      GLU  30  -3.169   0.807  -5.628
  238    HG3  GLU  30           2HG      GLU  30  -4.682  -0.065  -5.866
  239    H    HIS  31           H        HIS  31  -2.185   1.526  -2.395
  240    HA   HIS  31           HA       HIS  31  -0.152   0.550  -4.059
  241    HD1  HIS  31           1HD      HIS  31   2.519   1.725  -0.656
  242    HD2  HIS  31           2HD      HIS  31   2.138   1.926  -4.788
  243    HE1  HIS  31           1HE      HIS  31   4.870   1.750  -1.547
  244    HB2  HIS  31           1HB      HIS  31  -0.071   2.722  -2.857
  245    HB3  HIS  31           2HB      HIS  31   0.159   1.851  -1.346
  246    H    GLN  32           H        GLN  32  -0.902  -0.212  -0.666
  247    HA   GLN  32           HA       GLN  32   1.168  -2.022  -0.214
  248    HB2  GLN  32           1HB      GLN  32  -1.620  -2.079   0.955
  249    HB3  GLN  32           2HB      GLN  32  -0.207  -2.891   1.618
  250    HG2  GLN  32           1HG      GLN  32   0.723  -0.379   1.516
  251    HG3  GLN  32           2HG      GLN  32  -0.996  -0.055   1.730
  252   HE21  GLN  32          1HE2      GLN  32   1.164  -2.573   2.981
  253   HE22  GLN  32          2HE2      GLN  32   0.818  -2.283   4.649
  254    H    LEU  33           H        LEU  33  -2.129  -2.610  -1.399
  255    HA   LEU  33           HA       LEU  33  -1.967  -5.393  -1.592
  256    HG   LEU  33           HG       LEU  33  -5.224  -5.412  -3.306
  257    HB2  LEU  33           1HB      LEU  33  -4.059  -4.150  -1.765
  258    HB3  LEU  33           2HB      LEU  33  -3.531  -3.460  -3.298
  259   HD11  LEU  33          1HD1      LEU  33  -3.407  -4.461  -5.129
  260   HD12  LEU  33          2HD1      LEU  33  -4.713  -5.596  -5.470
  261   HD13  LEU  33          3HD1      LEU  33  -3.090  -6.196  -5.128
  262   HD21  LEU  33          3HD2      LEU  33  -4.359  -7.610  -3.190
  263   HD22  LEU  33          1HD2      LEU  33  -3.792  -6.780  -1.740
  264   HD23  LEU  33          2HD2      LEU  33  -2.695  -7.029  -3.099
  265    H    LEU  34           H        LEU  34  -1.277  -2.897  -4.029
  266    HA   LEU  34           HA       LEU  34  -0.648  -4.557  -6.163
  267    HG   LEU  34           HG       LEU  34  -2.021  -2.067  -6.186
  268    HB2  LEU  34           1HB      LEU  34   0.381  -1.844  -5.381
  269    HB3  LEU  34           2HB      LEU  34   0.850  -2.637  -6.884
  270   HD11  LEU  34          1HD1      LEU  34  -0.857   0.052  -6.165
  271   HD12  LEU  34          2HD1      LEU  34  -1.831  -0.085  -7.628
  272   HD13  LEU  34          3HD1      LEU  34  -0.086  -0.325  -7.706
  273   HD21  LEU  34          3HD2      LEU  34  -2.109  -2.105  -8.749
  274   HD22  LEU  34          1HD2      LEU  34  -1.925  -3.643  -7.906
  275   HD23  LEU  34          2HD2      LEU  34  -0.525  -2.877  -8.657
  276    H    TYR  35           H        TYR  35   1.549  -3.186  -3.718
  277    HA   TYR  35           HA       TYR  35   3.871  -4.468  -4.671
  278    HD1  TYR  35           1HD      TYR  35   3.981  -5.066  -0.525
  279    HD2  TYR  35           2HD      TYR  35   6.478  -3.273  -3.465
  280    HE1  TYR  35           1HE      TYR  35   5.959  -6.017   0.585
  281    HE2  TYR  35           2HE      TYR  35   8.464  -4.219  -2.365
  282    HH   TYR  35           HH       TYR  35   8.495  -5.372   0.694
  283    HB2  TYR  35           1HB      TYR  35   4.168  -2.602  -3.235
  284    HB3  TYR  35           2HB      TYR  35   3.139  -3.299  -1.990
  285    H    LEU  36           H        LEU  36   1.535  -5.361  -2.161
  286    HA   LEU  36           HA       LEU  36   2.844  -7.663  -1.238
  287    HG   LEU  36           HG       LEU  36   2.220  -7.214   0.784
  288    HB2  LEU  36           1HB      LEU  36   0.147  -6.516  -1.064
  289    HB3  LEU  36           2HB      LEU  36   0.213  -8.269  -0.896
  290   HD11  LEU  36          1HD1      LEU  36   1.291  -5.068   0.865
  291   HD12  LEU  36          2HD1      LEU  36   0.662  -5.876   2.300
  292   HD13  LEU  36          3HD1      LEU  36  -0.361  -5.685   0.876
  293   HD21  LEU  36          3HD2      LEU  36  -0.450  -8.122   1.769
  294   HD22  LEU  36          1HD2      LEU  36   1.159  -8.470   2.401
  295   HD23  LEU  36          2HD2      LEU  36   0.607  -9.252   0.920
  296    H    GLN  37           H        GLN  37   0.831  -7.100  -4.029
  297    HA   GLN  37           HA       GLN  37   0.024  -9.655  -4.692
  298    HB2  GLN  37           1HB      GLN  37  -0.332  -7.326  -5.873
  299    HB3  GLN  37           2HB      GLN  37   1.033  -7.850  -6.851
  300    HG2  GLN  37           1HG      GLN  37  -0.142  -9.544  -7.838
  301    HG3  GLN  37           2HG      GLN  37  -1.253  -9.713  -6.479
  302   HE21  GLN  37          1HE2      GLN  37  -2.887  -8.083  -6.206
  303   HE22  GLN  37          2HE2      GLN  37  -3.492  -7.234  -7.584
  304    H    HIS  38           H        HIS  38   3.148  -8.109  -5.243
  305    HA   HIS  38           HA       HIS  38   4.273 -10.138  -6.843
  306    HD1  HIS  38           1HD      HIS  38   7.117 -10.898  -6.455
  307    HD2  HIS  38           2HD      HIS  38   6.692  -7.200  -8.301
  308    HE1  HIS  38           1HE      HIS  38   8.725 -10.922  -8.389
  309    HB2  HIS  38           1HB      HIS  38   5.087  -7.681  -6.194
  310    HB3  HIS  38           2HB      HIS  38   6.028  -8.580  -5.009
  311    H    GLN  39           H        GLN  39   4.642  -9.486  -3.357
  312    HA   GLN  39           HA       GLN  39   6.240 -11.645  -2.701
  313    HB2  GLN  39           1HB      GLN  39   4.039 -10.443  -1.012
  314    HB3  GLN  39           2HB      GLN  39   5.382 -11.411  -0.419
  315    HG2  GLN  39           1HG      GLN  39   5.885  -8.888  -1.941
  316    HG3  GLN  39           2HG      GLN  39   5.487  -8.842  -0.224
  317   HE21  GLN  39          1HE2      GLN  39   7.401  -8.213   0.596
  318   HE22  GLN  39          2HE2      GLN  39   8.869  -9.112   0.454
  319    H    LEU  40           H        LEU  40   2.713 -11.491  -2.949
  320    HA   LEU  40           HA       LEU  40   2.203 -14.110  -2.035
  321    HG   LEU  40           HG       LEU  40   0.015 -14.983  -3.451
  322    HB2  LEU  40           1HB      LEU  40   0.373 -12.668  -2.033
  323    HB3  LEU  40           2HB      LEU  40   0.671 -12.139  -3.687
  324   HD11  LEU  40          1HD1      LEU  40  -1.704 -14.793  -2.055
  325   HD12  LEU  40          2HD1      LEU  40  -2.504 -13.849  -3.310
  326   HD13  LEU  40          3HD1      LEU  40  -1.594 -13.033  -2.040
  327   HD21  LEU  40          3HD2      LEU  40  -0.535 -12.666  -5.206
  328   HD22  LEU  40          1HD2      LEU  40  -1.749 -13.946  -5.169
  329   HD23  LEU  40          2HD2      LEU  40  -0.084 -14.322  -5.616
  330    H    ASP  41           H        ASP  41   2.561 -12.783  -5.311
  331    HA   ASP  41           HA       ASP  41   2.057 -15.081  -6.774
  332    HB2  ASP  41           1HB      ASP  41   2.365 -12.827  -7.755
  333    HB3  ASP  41           2HB      ASP  41   4.092 -12.937  -7.422
  334    H    GLU  42           H        GLU  42   5.139 -13.948  -5.419
  335    HA   GLU  42           HA       GLU  42   6.600 -16.225  -6.356
  336    HB2  GLU  42           1HB      GLU  42   8.462 -15.326  -5.121
  337    HB3  GLU  42           2HB      GLU  42   7.640 -14.005  -5.939
  338    HG2  GLU  42           1HG      GLU  42   6.621 -13.282  -3.913
  339    HG3  GLU  42           2HG      GLU  42   7.178 -14.718  -3.056
  340    H    LEU  43           H        LEU  43   4.827 -15.415  -3.475
  341    HA   LEU  43           HA       LEU  43   5.936 -17.424  -1.796
  342    HG   LEU  43           HG       LEU  43   3.649 -18.143  -0.191
  343    HB2  LEU  43           1HB      LEU  43   4.810 -15.493  -0.868
  344    HB3  LEU  43           2HB      LEU  43   3.306 -15.958  -1.662
  345   HD11  LEU  43          1HD1      LEU  43   4.729 -16.119   1.713
  346   HD12  LEU  43          2HD1      LEU  43   5.835 -16.998   0.660
  347   HD13  LEU  43          3HD1      LEU  43   4.798 -17.881   1.780
  348   HD21  LEU  43          3HD2      LEU  43   2.402 -15.509   0.429
  349   HD22  LEU  43          1HD2      LEU  43   2.399 -16.770   1.663
  350   HD23  LEU  43          2HD2      LEU  43   1.645 -17.067   0.096
  351    H    ASN  44           H        ASN  44   3.362 -17.354  -4.149
  352    HA   ASN  44           HA       ASN  44   1.915 -19.611  -3.428
  353    HB2  ASN  44           1HB      ASN  44   1.713 -17.837  -5.438
  354    HB3  ASN  44           2HB      ASN  44   2.401 -19.192  -6.326
  355   HD21  ASN  44          1HD2      ASN  44  -0.322 -18.048  -4.494
  356   HD22  ASN  44          2HD2      ASN  44  -1.422 -19.292  -4.970
  357    H    GLU  45           H        GLU  45   4.869 -19.347  -5.359
  358    HA   GLU  45           HA       GLU  45   5.005 -22.238  -5.665
  359    HB2  GLU  45           1HB      GLU  45   6.898 -20.082  -6.621
  360    HB3  GLU  45           2HB      GLU  45   6.988 -21.786  -7.042
  361    HG2  GLU  45           1HG      GLU  45   4.869 -21.650  -8.196
  362    HG3  GLU  45           2HG      GLU  45   4.687 -19.965  -7.711
  363    H    ASN  46           H        ASN  46   6.923 -19.625  -4.208
  364    HA   ASN  46           HA       ASN  46   8.996 -21.138  -3.163
  365    HB2  ASN  46           1HB      ASN  46   8.759 -18.603  -3.190
  366    HB3  ASN  46           2HB      ASN  46   7.773 -18.774  -1.741
  367   HD21  ASN  46          1HD2      ASN  46   9.931 -17.266  -1.511
  368   HD22  ASN  46          2HD2      ASN  46  11.178 -18.069  -0.624
  369    H    LYS  47           H        LYS  47   5.760 -20.586  -1.902
  370    HA   LYS  47           HA       LYS  47   4.633 -21.441  -0.113
  371    HB2  LYS  47           1HB      LYS  47   6.393 -23.794  -0.818
  372    HB3  LYS  47           2HB      LYS  47   5.034 -23.880   0.294
  373    HG2  LYS  47           1HG      LYS  47   4.661 -22.879  -2.500
  374    HG3  LYS  47           2HG      LYS  47   4.693 -24.608  -2.149
  375    HD2  LYS  47           1HD      LYS  47   2.955 -23.912  -0.289
  376    HD3  LYS  47           2HD      LYS  47   2.692 -22.543  -1.373
  377    HE2  LYS  47           1HE      LYS  47   1.742 -23.829  -2.982
  378    HE3  LYS  47           2HE      LYS  47   2.760 -25.222  -2.621
  379    HZ1  LYS  47           3HZ      LYS  47   0.217 -24.415  -1.408
  380    HZ2  LYS  47           1HZ      LYS  47   1.336 -25.242  -0.445
  381    HZ3  LYS  47           2HZ      LYS  47   0.753 -25.953  -1.865
  382    H    SER  48           H        SER  48   7.047 -19.939   0.483
  383    HA   SER  48           HA       SER  48   8.463 -21.225   2.599
  384    HG   SER  48           HG       SER  48   9.853 -20.378   1.016
  385    HB2  SER  48           1HB      SER  48   8.329 -18.445   1.504
  386    HB3  SER  48           2HB      SER  48   9.051 -18.694   3.094
  387    H    LYS  49           H        LYS  49   7.884 -21.488   4.648
  388    HA   LYS  49           HA       LYS  49   5.353 -20.737   5.621
  389    HB2  LYS  49           1HB      LYS  49   6.343 -21.425   7.868
  390    HB3  LYS  49           2HB      LYS  49   6.335 -22.644   6.600
  391    HG2  LYS  49           1HG      LYS  49   8.771 -21.036   6.668
  392    HG3  LYS  49           2HG      LYS  49   8.484 -21.969   8.139
  393    HD2  LYS  49           1HD      LYS  49   8.579 -23.997   7.024
  394    HD3  LYS  49           2HD      LYS  49   8.194 -23.271   5.462
  395    HE2  LYS  49           1HE      LYS  49  10.466 -22.050   5.764
  396    HE3  LYS  49           2HE      LYS  49  10.795 -23.319   6.943
  397    HZ1  LYS  49           3HZ      LYS  49  11.375 -23.569   4.385
  398    HZ2  LYS  49           1HZ      LYS  49   9.793 -24.166   4.340
  399    HZ3  LYS  49           2HZ      LYS  49  10.943 -24.892   5.346
  400    H    GLU  50           H        GLU  50   8.544 -19.289   5.966
  401    HA   GLU  50           HA       GLU  50   7.772 -17.367   7.922
  402    HB2  GLU  50           1HB      GLU  50   9.921 -16.261   7.326
  403    HB3  GLU  50           2HB      GLU  50  10.093 -17.966   7.722
  404    HG2  GLU  50           1HG      GLU  50   9.797 -18.163   5.071
  405    HG3  GLU  50           2HG      GLU  50  10.518 -16.557   5.167
  406    H    LEU  51           H        LEU  51   8.236 -17.223   4.402
  407    HA   LEU  51           HA       LEU  51   7.619 -14.501   4.093
  408    HG   LEU  51           HG       LEU  51   6.125 -14.755   1.303
  409    HB2  LEU  51           1HB      LEU  51   8.723 -15.848   2.375
  410    HB3  LEU  51           2HB      LEU  51   7.239 -16.769   2.144
  411   HD11  LEU  51          1HD1      LEU  51   8.826 -13.436   1.515
  412   HD12  LEU  51          2HD1      LEU  51   7.468 -13.127   2.596
  413   HD13  LEU  51          3HD1      LEU  51   7.341 -12.723   0.884
  414   HD21  LEU  51          3HD2      LEU  51   8.470 -15.994   0.050
  415   HD22  LEU  51          1HD2      LEU  51   7.990 -14.447  -0.647
  416   HD23  LEU  51          2HD2      LEU  51   6.832 -15.776  -0.567
  417    H    GLN  52           H        GLN  52   5.593 -17.372   4.208
  418    HA   GLN  52           HA       GLN  52   3.196 -16.085   3.378
  419    HB2  GLN  52           1HB      GLN  52   3.324 -18.458   3.157
  420    HB3  GLN  52           2HB      GLN  52   3.726 -18.660   4.857
  421    HG2  GLN  52           1HG      GLN  52   1.145 -17.359   4.213
  422    HG3  GLN  52           2HG      GLN  52   1.292 -19.088   3.899
  423   HE21  GLN  52          1HE2      GLN  52  -0.525 -18.336   5.695
  424   HE22  GLN  52          2HE2      GLN  52  -0.012 -18.712   7.301
  425    H    GLU  53           H        GLU  53   4.417 -17.064   6.578
  426    HA   GLU  53           HA       GLU  53   2.282 -16.035   8.073
  427    HB2  GLU  53           1HB      GLU  53   5.077 -16.856   8.647
  428    HB3  GLU  53           2HB      GLU  53   4.292 -15.829   9.840
  429    HG2  GLU  53           1HG      GLU  53   2.354 -17.564   9.630
  430    HG3  GLU  53           2HG      GLU  53   3.627 -18.607   8.999
  431    H    LYS  54           H        LYS  54   5.097 -14.506   6.701
  432    HA   LYS  54           HA       LYS  54   4.884 -12.084   8.212
  433    HB2  LYS  54           1HB      LYS  54   6.410 -12.867   5.737
  434    HB3  LYS  54           2HB      LYS  54   6.425 -11.218   6.348
  435    HG2  LYS  54           1HG      LYS  54   7.185 -13.573   8.050
  436    HG3  LYS  54           2HG      LYS  54   8.347 -12.711   7.038
  437    HD2  LYS  54           1HD      LYS  54   6.620 -11.147   8.899
  438    HD3  LYS  54           2HD      LYS  54   7.985 -12.049   9.561
  439    HE2  LYS  54           1HE      LYS  54   8.986 -10.035   9.116
  440    HE3  LYS  54           2HE      LYS  54   9.293 -10.889   7.605
  441    HZ1  LYS  54           3HZ      LYS  54   6.787  -9.550   7.535
  442    HZ2  LYS  54           1HZ      LYS  54   8.111  -9.398   6.493
  443    HZ3  LYS  54           2HZ      LYS  54   8.033  -8.464   7.900
  444    H    ILE  55           H        ILE  55   4.103 -12.963   4.850
  445    HA   ILE  55           HA       ILE  55   3.021 -10.500   4.088
  446    HB   ILE  55           HB       ILE  55   2.376 -13.275   3.093
  447   HG12  ILE  55          1HG1      ILE  55   4.003 -11.155   1.708
  448   HG13  ILE  55          2HG1      ILE  55   4.737 -12.257   2.868
  449   HG21  ILE  55          1HG2      ILE  55   1.789 -11.570   1.041
  450   HG22  ILE  55          2HG2      ILE  55   0.609 -12.310   2.119
  451   HG23  ILE  55          3HG2      ILE  55   1.200 -10.681   2.444
  452   HD11  ILE  55          3HD1      ILE  55   3.390 -12.966   0.277
  453   HD12  ILE  55          1HD1      ILE  55   5.100 -13.116   0.680
  454   HD13  ILE  55          2HD1      ILE  55   3.911 -14.148   1.477
  455    H    ILE  56           H        ILE  56   1.339 -13.430   5.225
  456    HA   ILE  56           HA       ILE  56  -1.252 -12.446   5.198
  457    HB   ILE  56           HB       ILE  56  -0.733 -14.805   5.600
  458   HG12  ILE  56          1HG1      ILE  56  -2.422 -15.228   7.324
  459   HG13  ILE  56          2HG1      ILE  56  -2.286 -13.564   7.884
  460   HG21  ILE  56          1HG2      ILE  56   1.175 -14.105   7.243
  461   HG22  ILE  56          2HG2      ILE  56  -0.098 -14.226   8.456
  462   HG23  ILE  56          3HG2      ILE  56   0.318 -15.629   7.473
  463   HD11  ILE  56          3HD1      ILE  56  -3.352 -12.719   6.003
  464   HD12  ILE  56          1HD1      ILE  56  -3.066 -14.184   5.064
  465   HD13  ILE  56          2HD1      ILE  56  -4.252 -14.191   6.370
  466    H    ARG  57           H        ARG  57   1.279 -12.041   7.605
  467    HA   ARG  57           HA       ARG  57  -0.344 -10.923   9.634
  468    HE   ARG  57           HE       ARG  57  -0.497 -12.465  12.149
  469    HB2  ARG  57           1HB      ARG  57   2.489 -11.365   9.161
  470    HB3  ARG  57           2HB      ARG  57   2.193  -9.827   9.960
  471    HG2  ARG  57           1HG      ARG  57   2.586 -11.567  11.591
  472    HG3  ARG  57           2HG      ARG  57   0.924 -10.985  11.705
  473    HD2  ARG  57           1HD      ARG  57   0.874 -13.090   9.857
  474    HD3  ARG  57           2HD      ARG  57   1.904 -13.639  11.179
  475   HH11  ARG  57          1HH1      ARG  57   0.803 -15.361  10.723
  476   HH12  ARG  57          2HH1      ARG  57  -0.398 -16.398  11.415
  477   HH21  ARG  57          1HH2      ARG  57  -2.086 -13.820  13.068
  478   HH22  ARG  57          2HH2      ARG  57  -2.043 -15.521  12.748
  479    H    GLU  58           H        GLU  58   1.827  -9.385   7.260
  480    HA   GLU  58           HA       GLU  58   1.186  -6.736   7.943
  481    HB2  GLU  58           1HB      GLU  58   3.064  -7.796   6.386
  482    HB3  GLU  58           2HB      GLU  58   1.903  -7.397   5.128
  483    HG2  GLU  58           1HG      GLU  58   1.906  -5.068   6.389
  484    HG3  GLU  58           2HG      GLU  58   3.512  -5.617   6.863
  485    H    LEU  59           H        LEU  59  -0.146  -8.901   5.472
  486    HA   LEU  59           HA       LEU  59  -1.930  -7.023   4.345
  487    HG   LEU  59           HG       LEU  59  -2.434  -7.924   2.114
  488    HB2  LEU  59           1HB      LEU  59  -1.115  -9.421   3.576
  489    HB3  LEU  59           2HB      LEU  59  -2.606  -9.919   4.372
  490   HD11  LEU  59          1HD1      LEU  59  -2.899 -10.873   2.183
  491   HD12  LEU  59          2HD1      LEU  59  -1.930  -9.913   1.065
  492   HD13  LEU  59          3HD1      LEU  59  -3.690  -9.883   0.956
  493   HD21  LEU  59          3HD2      LEU  59  -4.412  -7.341   3.043
  494   HD22  LEU  59          1HD2      LEU  59  -4.606  -8.885   3.872
  495   HD23  LEU  59          2HD2      LEU  59  -4.981  -8.754   2.153
  496    H    ASP  60           H        ASP  60  -2.163  -9.206   7.073
  497    HA   ASP  60           HA       ASP  60  -4.965  -9.038   7.442
  498    HB2  ASP  60           1HB      ASP  60  -3.682 -10.821   8.478
  499    HB3  ASP  60           2HB      ASP  60  -2.753  -9.652   9.412
  500    H    VAL  61           H        VAL  61  -2.289  -7.377   9.114
  501    HA   VAL  61           HA       VAL  61  -3.893  -5.704  10.692
  502    HB   VAL  61           HB       VAL  61  -1.554  -6.001  11.216
  503   HG11  VAL  61          1HG1      VAL  61  -0.932  -4.483   8.685
  504   HG12  VAL  61          2HG1      VAL  61   0.231  -5.126   9.847
  505   HG13  VAL  61          3HG1      VAL  61  -0.758  -6.226   8.885
  506   HG21  VAL  61          3HG2      VAL  61  -1.552  -4.003  12.188
  507   HG22  VAL  61          1HG2      VAL  61  -1.211  -3.212  10.649
  508   HG23  VAL  61          2HG2      VAL  61  -2.879  -3.523  11.131
  509    H    VAL  62           H        VAL  62  -2.542  -5.268   7.457
  510    HA   VAL  62           HA       VAL  62  -3.304  -2.559   7.147
  511    HB   VAL  62           HB       VAL  62  -2.728  -4.697   5.096
  512   HG11  VAL  62          1HG1      VAL  62  -3.908  -3.284   3.759
  513   HG12  VAL  62          2HG1      VAL  62  -3.615  -1.883   4.791
  514   HG13  VAL  62          3HG1      VAL  62  -2.349  -2.463   3.708
  515   HG21  VAL  62          3HG2      VAL  62  -0.941  -3.753   6.729
  516   HG22  VAL  62          1HG2      VAL  62  -0.564  -3.880   5.011
  517   HG23  VAL  62          2HG2      VAL  62  -1.014  -2.321   5.702
  518    H    CYS  63           H        CYS  63  -4.762  -5.539   5.831
  519    HA   CYS  63           HA       CYS  63  -7.019  -4.314   4.718
  520    HG   CYS  63           HG       CYS  63  -6.694  -7.147   7.415
  521    HB2  CYS  63           1HB      CYS  63  -7.878  -6.478   4.391
  522    HB3  CYS  63           2HB      CYS  63  -6.132  -6.697   4.360
  523    H    ALA  64           H        ALA  64  -6.280  -5.220   7.980
  524    HA   ALA  64           HA       ALA  64  -8.955  -5.239   8.964
  525    HB1  ALA  64           3HB      ALA  64  -7.128  -6.394  10.116
  526    HB2  ALA  64           1HB      ALA  64  -6.373  -4.840  10.469
  527    HB3  ALA  64           2HB      ALA  64  -7.939  -5.240  11.174
  528    H    MET  65           H        MET  65  -6.306  -2.880   9.389
  529    HA   MET  65           HA       MET  65  -7.890  -0.893  10.582
  530    HB2  MET  65           1HB      MET  65  -6.041   0.560  10.312
  531    HB3  MET  65           2HB      MET  65  -5.357  -1.043  10.550
  532    HG2  MET  65           1HG      MET  65  -5.029  -1.254   8.133
  533    HG3  MET  65           2HG      MET  65  -5.692   0.364   7.911
  534    HE1  MET  65           3HE      MET  65  -1.801  -0.678  10.085
  535    HE2  MET  65           1HE      MET  65  -3.279  -1.638  10.000
  536    HE3  MET  65           2HE      MET  65  -2.203  -1.552   8.606
  537    H    ILE  66           H        ILE  66  -7.211  -1.645   7.224
  538    HA   ILE  66           HA       ILE  66  -8.292   0.754   6.140
  539    HB   ILE  66           HB       ILE  66  -7.322  -1.813   5.071
  540   HG12  ILE  66          1HG1      ILE  66  -6.237  -0.334   3.459
  541   HG13  ILE  66          2HG1      ILE  66  -7.197   1.026   4.030
  542   HG21  ILE  66          1HG2      ILE  66  -8.370  -1.314   2.826
  543   HG22  ILE  66          2HG2      ILE  66  -9.451  -1.963   4.058
  544   HG23  ILE  66          3HG2      ILE  66  -9.476  -0.240   3.683
  545   HD11  ILE  66          3HD1      ILE  66  -5.317  -0.489   5.810
  546   HD12  ILE  66          1HD1      ILE  66  -4.819   0.902   4.848
  547   HD13  ILE  66          2HD1      ILE  66  -6.059   1.086   6.090
  548    H    GLU  67           H        GLU  67  -9.585  -2.532   6.547
  549    HA   GLU  67           HA       GLU  67 -12.087  -2.090   5.382
  550    HB2  GLU  67           1HB      GLU  67 -11.028  -4.052   7.375
  551    HB3  GLU  67           2HB      GLU  67 -12.760  -3.983   7.083
  552    HG2  GLU  67           1HG      GLU  67 -12.466  -4.511   4.775
  553    HG3  GLU  67           2HG      GLU  67 -10.715  -4.365   4.914
  554    H    GLY  68           H        GLY  68 -11.047  -1.778   8.765
  555    HA2  GLY  68           1HA      GLY  68 -13.585  -1.044   9.784
  556    HA3  GLY  68           2HA      GLY  68 -12.039  -0.759  10.569
  557    H    ALA  69           H        ALA  69 -10.764   0.945   8.909
  558    HA   ALA  69           HA       ALA  69 -11.898   3.426   9.527
  559    HB1  ALA  69           3HB      ALA  69  -9.847   2.853   7.393
  560    HB2  ALA  69           1HB      ALA  69 -10.144   4.401   8.185
  561    HB3  ALA  69           2HB      ALA  69  -9.494   3.047   9.110
  562    H    GLN  70           H        GLN  70 -11.953   1.541   6.535
  563    HA   GLN  70           HA       GLN  70 -13.201   3.495   4.929
  564    HB2  GLN  70           1HB      GLN  70 -12.740   0.565   4.751
  565    HB3  GLN  70           2HB      GLN  70 -13.990   1.244   3.717
  566    HG2  GLN  70           1HG      GLN  70 -12.333   2.840   2.823
  567    HG3  GLN  70           2HG      GLN  70 -11.093   2.055   3.800
  568   HE21  GLN  70          1HE2      GLN  70 -13.756   0.772   1.844
  569   HE22  GLN  70          2HE2      GLN  70 -12.766  -0.222   0.836
  570    H    GLY  71           H        GLY  71 -14.565   0.667   6.623
  571    HA2  GLY  71           1HA      GLY  71 -17.233   1.046   5.959
  572    HA3  GLY  71           2HA      GLY  71 -16.676   0.276   7.436
  573    H    ALA  72           H        ALA  72 -15.543   2.248   8.858
  574    HA   ALA  72           HA       ALA  72 -17.753   3.640   9.908
  575    HB1  ALA  72           3HB      ALA  72 -14.831   4.239  10.349
  576    HB2  ALA  72           1HB      ALA  72 -16.177   4.711  11.388
  577    HB3  ALA  72           2HB      ALA  72 -15.752   3.008  11.213
  578    H    LEU  73           H        LEU  73 -14.905   4.881   8.152
  579    HA   LEU  73           HA       LEU  73 -15.634   7.536   7.989
  580    HG   LEU  73           HG       LEU  73 -14.809   8.444   5.387
  581    HB2  LEU  73           1HB      LEU  73 -13.464   6.545   7.278
  582    HB3  LEU  73           2HB      LEU  73 -14.260   5.963   5.817
  583   HD11  LEU  73          1HD1      LEU  73 -14.178   9.222   7.635
  584   HD12  LEU  73          2HD1      LEU  73 -13.274  10.038   6.360
  585   HD13  LEU  73          3HD1      LEU  73 -12.506   8.764   7.307
  586   HD21  LEU  73          3HD2      LEU  73 -12.852   6.793   4.502
  587   HD22  LEU  73          1HD2      LEU  73 -11.897   8.125   5.152
  588   HD23  LEU  73          2HD2      LEU  73 -13.111   8.435   3.912
  589    H    GLU  74           H        GLU  74 -16.273   5.015   5.546
  590    HA   GLU  74           HA       GLU  74 -17.767   6.545   3.785
  591    HB2  GLU  74           1HB      GLU  74 -17.709   3.626   4.443
  592    HB3  GLU  74           2HB      GLU  74 -18.946   4.236   3.351
  593    HG2  GLU  74           1HG      GLU  74 -16.799   3.325   2.327
  594    HG3  GLU  74           2HG      GLU  74 -17.390   4.882   1.747
  595    H    ARG  75           H        ARG  75 -18.965   4.520   6.462
  596    HA   ARG  75           HA       ARG  75 -21.675   5.133   6.173
  597    HE   ARG  75           HE       ARG  75 -23.775   0.976   7.585
  598    HB2  ARG  75           1HB      ARG  75 -20.002   4.208   8.487
  599    HB3  ARG  75           2HB      ARG  75 -21.703   4.591   8.718
  600    HG2  ARG  75           1HG      ARG  75 -20.762   2.652   6.629
  601    HG3  ARG  75           2HG      ARG  75 -21.124   2.167   8.287
  602    HD2  ARG  75           1HD      ARG  75 -23.394   3.191   7.987
  603    HD3  ARG  75           2HD      ARG  75 -23.003   3.400   6.281
  604   HH11  ARG  75          1HH1      ARG  75 -21.911   2.294   4.957
  605   HH12  ARG  75          2HH1      ARG  75 -22.007   0.855   3.995
  606   HH21  ARG  75          1HH2      ARG  75 -23.910  -0.922   6.329
  607   HH22  ARG  75          2HH2      ARG  75 -23.146  -0.973   4.776
  608    H    GLU  76           H        GLU  76 -19.066   6.934   7.591
  609    HA   GLU  76           HA       GLU  76 -20.743   8.748   9.057
  610    HB2  GLU  76           1HB      GLU  76 -18.283   8.148   9.530
  611    HB3  GLU  76           2HB      GLU  76 -17.896   9.284   8.245
  612    HG2  GLU  76           1HG      GLU  76 -18.684  11.108   9.447
  613    HG3  GLU  76           2HG      GLU  76 -19.632  10.100  10.539
  614    H    LEU  77           H        LEU  77 -18.720   9.070   6.138
  615    HA   LEU  77           HA       LEU  77 -19.619  11.666   5.488
  616    HG   LEU  77           HG       LEU  77 -18.445   8.415   4.318
  617    HB2  LEU  77           1HB      LEU  77 -18.658  11.177   3.245
  618    HB3  LEU  77           2HB      LEU  77 -17.553  10.905   4.592
  619   HD11  LEU  77          1HD1      LEU  77 -18.778   7.850   1.982
  620   HD12  LEU  77          2HD1      LEU  77 -18.663   9.551   1.533
  621   HD13  LEU  77          3HD1      LEU  77 -20.011   8.989   2.521
  622   HD21  LEU  77          3HD2      LEU  77 -16.168   9.920   3.403
  623   HD22  LEU  77          1HD2      LEU  77 -16.522   8.592   2.297
  624   HD23  LEU  77          2HD2      LEU  77 -16.251   8.265   4.009
  625    H    LYS  78           H        LYS  78 -20.991   8.547   5.032
  626    HA   LYS  78           HA       LYS  78 -22.588   8.949   2.780
  627    HB2  LYS  78           1HB      LYS  78 -22.643   7.141   5.127
  628    HB3  LYS  78           2HB      LYS  78 -24.158   7.324   4.254
  629    HG2  LYS  78           1HG      LYS  78 -21.691   6.769   2.693
  630    HG3  LYS  78           2HG      LYS  78 -22.420   5.456   3.621
  631    HD2  LYS  78           1HD      LYS  78 -24.474   5.651   2.443
  632    HD3  LYS  78           2HD      LYS  78 -23.976   7.170   1.695
  633    HE2  LYS  78           1HE      LYS  78 -23.728   5.531   0.023
  634    HE3  LYS  78           2HE      LYS  78 -22.097   5.854   0.613
  635    HZ1  LYS  78           3HZ      LYS  78 -22.434   3.498   0.382
  636    HZ2  LYS  78           1HZ      LYS  78 -23.813   3.548   1.361
  637    HZ3  LYS  78           2HZ      LYS  78 -22.292   3.874   2.025
  638    H    ARG  79           H        ARG  79 -22.835  10.255   5.954
  639    HA   ARG  79           HA       ARG  79 -25.606  10.817   5.998
  640    HE   ARG  79           HE       ARG  79 -23.409  11.863  10.515
  641    HB2  ARG  79           1HB      ARG  79 -23.791  10.913   7.894
  642    HB3  ARG  79           2HB      ARG  79 -23.617  12.582   7.370
  643    HG2  ARG  79           1HG      ARG  79 -26.090  12.842   7.711
  644    HG3  ARG  79           2HG      ARG  79 -26.075  11.248   8.468
  645    HD2  ARG  79           1HD      ARG  79 -24.386  13.580   9.363
  646    HD3  ARG  79           2HD      ARG  79 -25.936  13.141  10.080
  647   HH11  ARG  79          1HH1      ARG  79 -26.859  11.394  10.489
  648   HH12  ARG  79          2HH1      ARG  79 -26.817  10.062  11.595
  649   HH21  ARG  79          1HH2      ARG  79 -23.342  10.109  11.971
  650   HH22  ARG  79          2HH2      ARG  79 -24.817   9.332  12.438
  651    H    THR  80           H        THR  80 -22.924  12.306   4.416
  652    HA   THR  80           HA       THR  80 -23.744  14.924   4.099
  653    HB   THR  80           HB       THR  80 -22.472  14.952   1.990
  654    HG1  THR  80           1HG      THR  80 -22.196  13.159   0.909
  655   HG21  THR  80          3HG2      THR  80 -21.123  15.212   3.902
  656   HG22  THR  80          1HG2      THR  80 -20.312  13.973   2.945
  657   HG23  THR  80          2HG2      THR  80 -21.278  13.512   4.346
  658    H    ASP  81           H        ASP  81 -24.485  15.881   1.930
  659    HA   ASP  81           HA       ASP  81 -27.014  14.595   1.246
  660    HB2  ASP  81           1HB      ASP  81 -26.044  17.327   0.400
  661    HB3  ASP  81           2HB      ASP  81 -27.696  16.719   0.366
  662    H    LEU  82           H        LEU  82 -27.539  15.534  -1.242
  663    HA   LEU  82           HA       LEU  82 -25.680  13.967  -2.864
  664    HG   LEU  82           HG       LEU  82 -27.227  14.915  -5.529
  665    HB2  LEU  82           1HB      LEU  82 -27.975  13.332  -3.074
  666    HB3  LEU  82           2HB      LEU  82 -28.462  14.999  -3.375
  667   HD11  LEU  82          1HD1      LEU  82 -25.795  13.277  -5.943
  668   HD12  LEU  82          2HD1      LEU  82 -27.113  12.107  -5.883
  669   HD13  LEU  82          3HD1      LEU  82 -26.219  12.503  -4.416
  670   HD21  LEU  82          3HD2      LEU  82 -29.728  14.091  -4.978
  671   HD22  LEU  82          1HD2      LEU  82 -29.074  12.623  -5.706
  672   HD23  LEU  82          2HD2      LEU  82 -29.052  14.140  -6.607
  673    H    ASN  83           H        ASN  83 -24.898  14.746  -4.887
  674    HA   ASN  83           HA       ASN  83 -25.277  17.333  -5.878
  675    HB2  ASN  83           1HB      ASN  83 -23.373  17.124  -3.668
  676    HB3  ASN  83           2HB      ASN  83 -22.666  17.832  -5.118
  677   HD21  ASN  83          1HD2      ASN  83 -24.177  19.496  -6.183
  678   HD22  ASN  83          2HD2      ASN  83 -24.883  20.648  -5.106
  679    H    ILE  84           H        ILE  84 -23.789  17.867  -7.625
  680    HA   ILE  84           HA       ILE  84 -23.146  15.643  -9.210
  681    HB   ILE  84           HB       ILE  84 -22.099  18.462  -9.484
  682   HG12  ILE  84          1HG1      ILE  84 -24.491  17.189 -10.826
  683   HG13  ILE  84          2HG1      ILE  84 -24.600  18.232  -9.412
  684   HG21  ILE  84          1HG2      ILE  84 -22.145  16.108 -11.347
  685   HG22  ILE  84          2HG2      ILE  84 -21.999  17.765 -11.931
  686   HG23  ILE  84          3HG2      ILE  84 -20.770  17.098 -10.857
  687   HD11  ILE  84          3HD1      ILE  84 -23.078  19.645 -11.282
  688   HD12  ILE  84          1HD1      ILE  84 -24.417  18.933 -12.181
  689   HD13  ILE  84          2HD1      ILE  84 -24.739  19.959 -10.782
  690    H    LEU  85           H        LEU  85 -20.944  17.963  -7.628
  691    HA   LEU  85           HA       LEU  85 -18.586  16.547  -8.217
  692    HG   LEU  85           HG       LEU  85 -16.741  19.270  -6.563
  693    HB2  LEU  85           1HB      LEU  85 -19.045  18.984  -7.295
  694    HB3  LEU  85           2HB      LEU  85 -18.761  18.193  -5.747
  695   HD11  LEU  85          1HD1      LEU  85 -16.743  17.030  -5.325
  696   HD12  LEU  85          2HD1      LEU  85 -15.261  17.515  -6.148
  697   HD13  LEU  85          3HD1      LEU  85 -16.326  16.318  -6.885
  698   HD21  LEU  85          3HD2      LEU  85 -17.585  18.173  -9.061
  699   HD22  LEU  85          1HD2      LEU  85 -15.964  17.589  -8.687
  700   HD23  LEU  85          2HD2      LEU  85 -16.287  19.322  -8.733
  701    H    GLU  86           H        GLU  86 -20.616  16.604  -5.301
  702    HA   GLU  86           HA       GLU  86 -19.070  14.886  -3.731
  703    HB2  GLU  86           1HB      GLU  86 -22.045  15.396  -3.759
  704    HB3  GLU  86           2HB      GLU  86 -21.248  14.413  -2.539
  705    HG2  GLU  86           1HG      GLU  86 -19.760  16.497  -2.178
  706    HG3  GLU  86           2HG      GLU  86 -21.053  17.355  -3.015
  707    H    ARG  87           H        ARG  87 -21.603  14.196  -6.094
  708    HA   ARG  87           HA       ARG  87 -21.761  11.416  -5.601
  709    HE   ARG  87           HE       ARG  87 -23.953   9.341  -9.794
  710    HB2  ARG  87           1HB      ARG  87 -23.534  12.587  -6.780
  711    HB3  ARG  87           2HB      ARG  87 -22.428  13.013  -8.079
  712    HG2  ARG  87           1HG      ARG  87 -22.315  10.803  -8.857
  713    HG3  ARG  87           2HG      ARG  87 -23.024  10.160  -7.375
  714    HD2  ARG  87           1HD      ARG  87 -25.160  11.067  -7.913
  715    HD3  ARG  87           2HD      ARG  87 -24.492  11.999  -9.251
  716   HH11  ARG  87          1HH1      ARG  87 -26.758  11.354  -9.344
  717   HH12  ARG  87          2HH1      ARG  87 -27.763  10.412 -10.394
  718   HH21  ARG  87          1HH2      ARG  87 -25.268   8.093 -11.179
  719   HH22  ARG  87          2HH2      ARG  87 -26.915   8.557 -11.436
  720    H    PHE  88           H        PHE  88 -19.923  13.321  -7.963
  721    HA   PHE  88           HA       PHE  88 -18.771  11.199  -9.364
  722    HD1  PHE  88           2HD      PHE  88 -17.246  11.008 -10.997
  723    HD2  PHE  88           1HD      PHE  88 -15.651  14.645  -9.467
  724    HE1  PHE  88           2HE      PHE  88 -15.099  10.524 -12.097
  725    HE2  PHE  88           1HE      PHE  88 -13.501  14.168 -10.565
  726    HZ   PHE  88           HZ       PHE  88 -13.223  12.104 -11.880
  727    HB2  PHE  88           1HB      PHE  88 -18.616  13.419 -10.254
  728    HB3  PHE  88           2HB      PHE  88 -17.760  13.994  -8.827
  729    H    ASN  89           H        ASN  89 -17.365  13.102  -6.695
  730    HA   ASN  89           HA       ASN  89 -15.029  11.596  -6.407
  731    HB2  ASN  89           1HB      ASN  89 -16.558  13.173  -4.326
  732    HB3  ASN  89           2HB      ASN  89 -14.912  12.579  -4.127
  733   HD21  ASN  89          1HD2      ASN  89 -14.614  14.937  -3.745
  734   HD22  ASN  89          2HD2      ASN  89 -14.263  15.927  -5.116
  735    H    TYR  90           H        TYR  90 -18.188  11.258  -4.839
  736    HA   TYR  90           HA       TYR  90 -17.492   9.181  -3.080
  737    HD1  TYR  90           1HD      TYR  90 -18.008  11.636  -2.533
  738    HD2  TYR  90           2HD      TYR  90 -21.263   9.130  -1.426
  739    HE1  TYR  90           1HE      TYR  90 -18.128  12.767  -0.353
  740    HE2  TYR  90           2HE      TYR  90 -21.392  10.255   0.759
  741    HH   TYR  90           HH       TYR  90 -20.686  12.024   1.963
  742    HB2  TYR  90           1HB      TYR  90 -20.048  10.237  -4.201
  743    HB3  TYR  90           2HB      TYR  90 -20.079   8.673  -3.396
  744    H    GLU  91           H        GLU  91 -18.811   9.117  -6.370
  745    HA   GLU  91           HA       GLU  91 -19.169   6.355  -6.595
  746    HB2  GLU  91           1HB      GLU  91 -19.877   8.276  -8.189
  747    HB3  GLU  91           2HB      GLU  91 -18.291   8.048  -8.915
  748    HG2  GLU  91           1HG      GLU  91 -20.031   5.669  -8.539
  749    HG3  GLU  91           2HG      GLU  91 -20.416   6.805  -9.831
  750    H    GLU  92           H        GLU  92 -16.407   8.337  -7.673
  751    HA   GLU  92           HA       GLU  92 -14.798   6.201  -8.511
  752    HB2  GLU  92           1HB      GLU  92 -14.365   8.535  -9.133
  753    HB3  GLU  92           2HB      GLU  92 -13.953   8.908  -7.465
  754    HG2  GLU  92           1HG      GLU  92 -12.064   7.354  -7.593
  755    HG3  GLU  92           2HG      GLU  92 -12.468   7.019  -9.277
  756    H    ALA  93           H        ALA  93 -14.892   7.935  -5.412
  757    HA   ALA  93           HA       ALA  93 -12.814   6.685  -4.100
  758    HB1  ALA  93           3HB      ALA  93 -15.445   7.680  -3.026
  759    HB2  ALA  93           1HB      ALA  93 -14.112   7.145  -2.002
  760    HB3  ALA  93           2HB      ALA  93 -13.902   8.532  -3.071
  761    H    GLN  94           H        GLN  94 -16.226   5.658  -4.174
  762    HA   GLN  94           HA       GLN  94 -15.833   3.300  -2.675
  763    HB2  GLN  94           1HB      GLN  94 -18.022   4.596  -3.354
  764    HB3  GLN  94           2HB      GLN  94 -18.003   3.491  -4.723
  765    HG2  GLN  94           1HG      GLN  94 -19.281   2.292  -3.282
  766    HG3  GLN  94           2HG      GLN  94 -17.687   1.691  -2.828
  767   HE21  GLN  94          1HE2      GLN  94 -20.510   2.637  -1.592
  768   HE22  GLN  94          2HE2      GLN  94 -20.000   3.250  -0.060
  769    H    THR  95           H        THR  95 -15.669   4.001  -6.114
  770    HA   THR  95           HA       THR  95 -15.652   1.402  -7.123
  771    HB   THR  95           HB       THR  95 -14.145   3.801  -8.185
  772    HG1  THR  95           1HG      THR  95 -16.000   4.349  -9.141
  773   HG21  THR  95          3HG2      THR  95 -14.380   1.050  -9.106
  774   HG22  THR  95          1HG2      THR  95 -13.298   2.333  -9.648
  775   HG23  THR  95          2HG2      THR  95 -14.928   2.215 -10.311
  776    H    LEU  96           H        LEU  96 -12.885   3.456  -6.212
  777    HA   LEU  96           HA       LEU  96 -10.930   1.464  -6.690
  778    HG   LEU  96           HG       LEU  96 -11.024   4.422  -7.422
  779    HB2  LEU  96           1HB      LEU  96 -10.873   3.960  -5.005
  780    HB3  LEU  96           2HB      LEU  96  -9.463   2.946  -5.301
  781   HD11  LEU  96          1HD1      LEU  96  -9.055   5.870  -7.551
  782   HD12  LEU  96          2HD1      LEU  96  -8.344   5.024  -6.177
  783   HD13  LEU  96          3HD1      LEU  96  -9.826   5.957  -5.967
  784   HD21  LEU  96          3HD2      LEU  96 -10.093   2.686  -8.591
  785   HD22  LEU  96          1HD2      LEU  96  -8.737   2.517  -7.476
  786   HD23  LEU  96          2HD2      LEU  96  -8.763   3.846  -8.634
  787    H    SER  97           H        SER  97 -12.595   2.546  -3.754
  788    HA   SER  97           HA       SER  97 -11.211   0.977  -1.906
  789    HG   SER  97           HG       SER  97 -14.378   0.617  -0.442
  790    HB2  SER  97           1HB      SER  97 -12.664   1.858  -0.424
  791    HB3  SER  97           2HB      SER  97 -13.302   2.773  -1.791
  792    H    LYS  98           H        LYS  98 -14.071   0.239  -3.854
  793    HA   LYS  98           HA       LYS  98 -14.561  -2.312  -2.734
  794    HB2  LYS  98           1HB      LYS  98 -15.426  -0.870  -5.201
  795    HB3  LYS  98           2HB      LYS  98 -15.697  -2.605  -5.110
  796    HG2  LYS  98           1HG      LYS  98 -16.790  -2.093  -2.833
  797    HG3  LYS  98           2HG      LYS  98 -16.852  -0.428  -3.416
  798    HD2  LYS  98           1HD      LYS  98 -17.832  -2.555  -5.239
  799    HD3  LYS  98           2HD      LYS  98 -18.829  -2.163  -3.835
  800    HE2  LYS  98           1HE      LYS  98 -19.518  -0.838  -5.742
  801    HE3  LYS  98           2HE      LYS  98 -18.810   0.202  -4.507
  802    HZ1  LYS  98           3HZ      LYS  98 -16.927   0.559  -5.764
  803    HZ2  LYS  98           1HZ      LYS  98 -18.127   0.514  -6.956
  804    HZ3  LYS  98           2HZ      LYS  98 -17.139  -0.836  -6.700
  805    H    ILE  99           H        ILE  99 -12.919  -1.327  -5.736
  806    HA   ILE  99           HA       ILE  99 -12.213  -3.866  -6.635
  807    HB   ILE  99           HB       ILE  99 -10.693  -1.280  -6.994
  808   HG12  ILE  99          1HG1      ILE  99 -12.446  -2.536  -9.070
  809   HG13  ILE  99          2HG1      ILE  99 -13.191  -1.609  -7.772
  810   HG21  ILE  99          1HG2      ILE  99 -10.111  -3.985  -7.818
  811   HG22  ILE  99          2HG2      ILE  99 -10.297  -2.917  -9.208
  812   HG23  ILE  99          3HG2      ILE  99  -9.122  -2.530  -7.951
  813   HD11  ILE  99          3HD1      ILE  99 -11.727   0.304  -8.400
  814   HD12  ILE  99          1HD1      ILE  99 -11.193  -0.635  -9.795
  815   HD13  ILE  99          2HD1      ILE  99 -12.888  -0.170  -9.642
  816    H    LEU 100           H        LEU 100 -10.387  -1.622  -4.569
  817    HA   LEU 100           HA       LEU 100  -8.109  -3.238  -4.258
  818    HG   LEU 100           HG       LEU 100  -6.771  -0.796  -1.854
  819    HB2  LEU 100           1HB      LEU 100  -8.133  -0.867  -3.712
  820    HB3  LEU 100           2HB      LEU 100  -9.271  -1.168  -2.400
  821   HD11  LEU 100          1HD1      LEU 100  -8.828  -2.007  -0.544
  822   HD12  LEU 100          2HD1      LEU 100  -7.246  -1.661   0.154
  823   HD13  LEU 100          3HD1      LEU 100  -7.587  -3.260  -0.505
  824   HD21  LEU 100          3HD2      LEU 100  -6.272  -2.702  -3.617
  825   HD22  LEU 100          1HD2      LEU 100  -6.507  -3.734  -2.206
  826   HD23  LEU 100          2HD2      LEU 100  -5.267  -2.479  -2.184
  827    H    LEU 101           H        LEU 101 -11.065  -2.956  -2.323
  828    HA   LEU 101           HA       LEU 101 -10.353  -4.630  -0.216
  829    HG   LEU 101           HG       LEU 101 -11.909  -2.365   0.312
  830    HB2  LEU 101           1HB      LEU 101 -12.916  -3.772  -1.446
  831    HB3  LEU 101           2HB      LEU 101 -12.957  -5.125  -0.318
  832   HD11  LEU 101          1HD1      LEU 101 -14.573  -3.655   0.639
  833   HD12  LEU 101          2HD1      LEU 101 -14.167  -1.995   0.206
  834   HD13  LEU 101          3HD1      LEU 101 -14.006  -2.535   1.877
  835   HD21  LEU 101          3HD2      LEU 101 -12.134  -4.909   1.874
  836   HD22  LEU 101          1HD2      LEU 101 -12.199  -3.344   2.686
  837   HD23  LEU 101          2HD2      LEU 101 -10.774  -3.792   1.747
  838    H    LYS 102           H        LYS 102 -11.897  -5.425  -3.311
  839    HA   LYS 102           HA       LYS 102 -12.223  -8.178  -2.820
  840    HB2  LYS 102           1HB      LYS 102 -13.338  -6.865  -4.642
  841    HB3  LYS 102           2HB      LYS 102 -11.804  -6.851  -5.502
  842    HG2  LYS 102           1HG      LYS 102 -11.967  -9.448  -5.211
  843    HG3  LYS 102           2HG      LYS 102 -13.688  -9.103  -5.016
  844    HD2  LYS 102           1HD      LYS 102 -13.315  -9.558  -7.324
  845    HD3  LYS 102           2HD      LYS 102 -13.575  -7.818  -7.170
  846    HE2  LYS 102           1HE      LYS 102 -11.387  -7.313  -7.639
  847    HE3  LYS 102           2HE      LYS 102 -10.789  -8.858  -7.039
  848    HZ1  LYS 102           3HZ      LYS 102 -10.659  -8.605  -9.483
  849    HZ2  LYS 102           1HZ      LYS 102 -12.348  -8.548  -9.544
  850    HZ3  LYS 102           2HZ      LYS 102 -11.569  -9.945  -8.995
  851    H    ASP 103           H        ASP 103  -9.733  -6.497  -4.745
  852    HA   ASP 103           HA       ASP 103  -8.152  -8.696  -5.336
  853    HB2  ASP 103           1HB      ASP 103  -7.598  -5.767  -5.063
  854    HB3  ASP 103           2HB      ASP 103  -6.251  -6.879  -5.290
  855    H    LEU 104           H        LEU 104  -7.921  -6.492  -2.556
  856    HA   LEU 104           HA       LEU 104  -5.695  -7.631  -1.333
  857    HG   LEU 104           HG       LEU 104  -6.238  -7.270   1.602
  858    HB2  LEU 104           1HB      LEU 104  -6.875  -5.479  -0.739
  859    HB3  LEU 104           2HB      LEU 104  -8.049  -6.463   0.131
  860   HD11  LEU 104          1HD1      LEU 104  -4.105  -5.881   1.535
  861   HD12  LEU 104          2HD1      LEU 104  -4.586  -5.432  -0.101
  862   HD13  LEU 104          3HD1      LEU 104  -4.298  -7.125   0.298
  863   HD21  LEU 104          3HD2      LEU 104  -5.943  -5.183   2.843
  864   HD22  LEU 104          1HD2      LEU 104  -7.601  -5.363   2.270
  865   HD23  LEU 104          2HD2      LEU 104  -6.495  -4.268   1.440
  866    H    LYS 105           H        LYS 105  -9.142  -8.318  -0.772
  867    HA   LYS 105           HA       LYS 105  -8.852 -10.282   1.171
  868    HB2  LYS 105           1HB      LYS 105 -10.943  -9.726  -0.903
  869    HB3  LYS 105           2HB      LYS 105 -11.059 -11.177   0.084
  870    HG2  LYS 105           1HG      LYS 105 -10.712  -8.482   1.341
  871    HG3  LYS 105           2HG      LYS 105 -12.303  -9.065   0.845
  872    HD2  LYS 105           1HD      LYS 105 -10.525 -10.767   2.551
  873    HD3  LYS 105           2HD      LYS 105 -11.498  -9.484   3.275
  874    HE2  LYS 105           1HE      LYS 105 -12.653 -11.612   1.488
  875    HE3  LYS 105           2HE      LYS 105 -12.537 -11.790   3.238
  876    HZ1  LYS 105           3HZ      LYS 105 -13.697  -9.343   2.875
  877    HZ2  LYS 105           1HZ      LYS 105 -14.493 -10.769   3.316
  878    HZ3  LYS 105           2HZ      LYS 105 -14.423 -10.307   1.690
  879    H    GLU 106           H        GLU 106  -8.733 -10.551  -2.349
  880    HA   GLU 106           HA       GLU 106  -8.629 -13.371  -2.463
  881    HB2  GLU 106           1HB      GLU 106  -9.008 -11.556  -4.336
  882    HB3  GLU 106           2HB      GLU 106  -7.264 -11.687  -4.520
  883    HG2  GLU 106           1HG      GLU 106  -8.302 -13.143  -6.094
  884    HG3  GLU 106           2HG      GLU 106  -7.534 -14.128  -4.851
  885    H    THR 107           H        THR 107  -6.122 -10.887  -2.289
  886    HA   THR 107           HA       THR 107  -3.899 -12.564  -2.651
  887    HB   THR 107           HB       THR 107  -3.090 -10.532  -0.886
  888    HG1  THR 107           1HG      THR 107  -4.891  -9.483  -2.824
  889   HG21  THR 107          3HG2      THR 107  -1.707 -10.021  -2.593
  890   HG22  THR 107          1HG2      THR 107  -3.021  -9.918  -3.763
  891   HG23  THR 107          2HG2      THR 107  -2.357 -11.490  -3.317
  892    H    GLU 108           H        GLU 108  -5.334 -11.321   0.369
  893    HA   GLU 108           HA       GLU 108  -3.668 -12.708   2.130
  894    HB2  GLU 108           1HB      GLU 108  -5.491 -12.369   3.797
  895    HB3  GLU 108           2HB      GLU 108  -5.041 -10.906   2.934
  896    HG2  GLU 108           1HG      GLU 108  -6.985 -11.289   1.421
  897    HG3  GLU 108           2HG      GLU 108  -7.471 -12.616   2.477
  898    H    GLN 109           H        GLN 109  -6.809 -13.620   0.757
  899    HA   GLN 109           HA       GLN 109  -7.207 -16.002   2.125
  900    HB2  GLN 109           1HB      GLN 109  -8.718 -14.725   0.420
  901    HB3  GLN 109           2HB      GLN 109  -7.940 -15.759  -0.771
  902    HG2  GLN 109           1HG      GLN 109  -8.814 -17.713   0.198
  903    HG3  GLN 109           2HG      GLN 109  -9.285 -16.865   1.670
  904   HE21  GLN 109          1HE2      GLN 109 -11.175 -15.710   1.718
  905   HE22  GLN 109          2HE2      GLN 109 -12.357 -15.781   0.460
  906    H    LYS 110           H        LYS 110  -5.597 -15.507  -1.011
  907    HA   LYS 110           HA       LYS 110  -4.907 -18.164  -1.498
  908    HB2  LYS 110           1HB      LYS 110  -3.766 -15.533  -2.371
  909    HB3  LYS 110           2HB      LYS 110  -2.937 -17.027  -2.792
  910    HG2  LYS 110           1HG      LYS 110  -4.819 -17.814  -4.021
  911    HG3  LYS 110           2HG      LYS 110  -5.827 -16.489  -3.432
  912    HD2  LYS 110           1HD      LYS 110  -4.740 -14.911  -4.757
  913    HD3  LYS 110           2HD      LYS 110  -3.319 -15.936  -4.978
  914    HE2  LYS 110           1HE      LYS 110  -4.389 -17.286  -6.547
  915    HE3  LYS 110           2HE      LYS 110  -5.996 -16.774  -6.032
  916    HZ1  LYS 110           3HZ      LYS 110  -5.070 -15.850  -8.212
  917    HZ2  LYS 110           1HZ      LYS 110  -4.110 -14.852  -7.239
  918    HZ3  LYS 110           2HZ      LYS 110  -5.795 -14.762  -7.139
  919    H    VAL 111           H        VAL 111  -3.036 -15.606   0.116
  920    HA   VAL 111           HA       VAL 111  -0.717 -17.043   0.634
  921    HB   VAL 111           HB       VAL 111  -1.984 -14.930   2.382
  922   HG11  VAL 111          1HG1      VAL 111   0.606 -16.357   2.474
  923   HG12  VAL 111          2HG1      VAL 111   0.640 -14.619   2.777
  924   HG13  VAL 111          3HG1      VAL 111  -0.359 -15.672   3.780
  925   HG21  VAL 111          3HG2      VAL 111  -1.510 -13.503   0.746
  926   HG22  VAL 111          1HG2      VAL 111   0.197 -13.917   0.917
  927   HG23  VAL 111          2HG2      VAL 111  -0.814 -14.799  -0.228
  928    H    LYS 112           H        LYS 112  -3.730 -16.885   2.476
  929    HA   LYS 112           HA       LYS 112  -2.782 -18.472   4.649
  930    HB2  LYS 112           1HB      LYS 112  -5.596 -17.813   3.760
  931    HB3  LYS 112           2HB      LYS 112  -5.185 -18.607   5.275
  932    HG2  LYS 112           1HG      LYS 112  -4.571 -16.692   6.260
  933    HG3  LYS 112           2HG      LYS 112  -3.781 -16.078   4.806
  934    HD2  LYS 112           1HD      LYS 112  -5.525 -14.621   4.880
  935    HD3  LYS 112           2HD      LYS 112  -6.314 -15.923   3.987
  936    HE2  LYS 112           1HE      LYS 112  -6.511 -15.328   6.933
  937    HE3  LYS 112           2HE      LYS 112  -7.793 -15.220   5.727
  938    HZ1  LYS 112           3HZ      LYS 112  -7.499 -17.666   5.402
  939    HZ2  LYS 112           1HZ      LYS 112  -8.109 -17.224   6.916
  940    HZ3  LYS 112           2HZ      LYS 112  -6.488 -17.675   6.758
  941    H    ASP 113           H        ASP 113  -4.315 -19.143   1.584
  942    HA   ASP 113           HA       ASP 113  -5.128 -21.796   2.125
  943    HB2  ASP 113           1HB      ASP 113  -5.965 -20.460   0.213
  944    HB3  ASP 113           2HB      ASP 113  -4.375 -20.567  -0.535
  945    H    ILE 114           H        ILE 114  -2.154 -20.424   0.790
  946    HA   ILE 114           HA       ILE 114  -0.876 -22.774   0.034
  947    HB   ILE 114           HB       ILE 114   0.135 -20.106   0.934
  948   HG12  ILE 114          1HG1      ILE 114   1.240 -20.793  -1.512
  949   HG13  ILE 114          2HG1      ILE 114  -0.359 -21.526  -1.570
  950   HG21  ILE 114          1HG2      ILE 114   1.895 -21.274   1.818
  951   HG22  ILE 114          2HG2      ILE 114   1.703 -22.624   0.700
  952   HG23  ILE 114          3HG2      ILE 114   2.431 -21.116   0.144
  953   HD11  ILE 114          3HD1      ILE 114   0.188 -18.980  -2.273
  954   HD12  ILE 114          1HD1      ILE 114  -1.392 -19.549  -1.737
  955   HD13  ILE 114          2HD1      ILE 114  -0.304 -18.764  -0.593
  956    H    GLN 115           H        GLN 115  -0.521 -24.520   1.229
  957    HA   GLN 115           HA       GLN 115  -0.442 -24.466   4.079
  958    HB2  GLN 115           1HB      GLN 115   0.131 -26.885   3.853
  959    HB3  GLN 115           2HB      GLN 115  -1.327 -26.414   2.989
  960    HG2  GLN 115           1HG      GLN 115  -0.494 -27.094   1.052
  961    HG3  GLN 115           2HG      GLN 115   0.997 -26.187   1.300
  962   HE21  GLN 115          1HE2      GLN 115   2.100 -27.938   0.297
  963   HE22  GLN 115          2HE2      GLN 115   2.466 -29.372   1.188
  964    H    THR 116           H        THR 116   1.235 -24.205   5.399
  965    HA   THR 116           HA       THR 116   3.946 -24.714   4.409
  966    HB   THR 116           HB       THR 116   4.794 -22.623   5.342
  967    HG1  THR 116           1HG      THR 116   3.554 -21.702   6.785
  968   HG21  THR 116          3HG2      THR 116   2.568 -21.620   3.666
  969   HG22  THR 116          1HG2      THR 116   3.575 -22.886   2.967
  970   HG23  THR 116          2HG2      THR 116   4.307 -21.374   3.505
  971    H    GLN 117           H        GLN 117   5.550 -24.396   6.326
  972    HA   GLN 117           HA       GLN 117   4.981 -26.301   8.268
  973    HB2  GLN 117           1HB      GLN 117   7.253 -25.387   7.552
  974    HB3  GLN 117           2HB      GLN 117   6.952 -24.055   8.660
  975    HG2  GLN 117           1HG      GLN 117   6.604 -25.839  10.444
  976    HG3  GLN 117           2HG      GLN 117   7.322 -26.962   9.291
  977   HE21  GLN 117          1HE2      GLN 117   9.386 -27.298   9.631
  978   HE22  GLN 117          2HE2      GLN 117  10.525 -26.151  10.241
  Start of MODEL    5
    1    H    GLN   1           H        GLN   1   3.172  11.248 -21.709
    2    HA   GLN   1           HA       GLN   1   4.919  12.155 -19.567
    3    HB2  GLN   1           1HB      GLN   1   6.493  12.680 -21.430
    4    HB3  GLN   1           2HB      GLN   1   5.999  10.993 -21.371
    5    HG2  GLN   1           1HG      GLN   1   4.464  11.325 -23.190
    6    HG3  GLN   1           2HG      GLN   1   4.791  13.058 -23.196
    7   HE21  GLN   1          1HE2      GLN   1   6.140   9.890 -23.836
    8   HE22  GLN   1          2HE2      GLN   1   7.392  10.427 -24.898
    9    H    GLU   2           H        GLU   2   2.384  13.504 -19.969
   10    HA   GLU   2           HA       GLU   2   3.293  16.145 -20.893
   11    HB2  GLU   2           1HB      GLU   2   0.582  14.861 -20.766
   12    HB3  GLU   2           2HB      GLU   2   0.738  16.610 -20.818
   13    HG2  GLU   2           1HG      GLU   2   1.714  16.572 -22.948
   14    HG3  GLU   2           2HG      GLU   2   2.046  14.842 -22.855
   15    H    HIS   3           H        HIS   3   1.612  14.461 -18.281
   16    HA   HIS   3           HA       HIS   3   1.896  16.866 -16.607
   17    HD1  HIS   3           1HD      HIS   3  -1.375  14.340 -18.122
   18    HD2  HIS   3           2HD      HIS   3   0.720  12.920 -14.829
   19    HE1  HIS   3           1HE      HIS   3  -1.830  11.869 -18.051
   20    HB2  HIS   3           1HB      HIS   3   0.189  15.755 -15.136
   21    HB3  HIS   3           2HB      HIS   3  -0.400  16.185 -16.739
   22    H    LYS   4           H        LYS   4   2.968  16.780 -14.679
   23    HA   LYS   4           HA       LYS   4   4.676  14.453 -14.274
   24    HB2  LYS   4           1HB      LYS   4   4.733  17.306 -13.415
   25    HB3  LYS   4           2HB      LYS   4   5.548  16.127 -12.397
   26    HG2  LYS   4           1HG      LYS   4   7.228  16.865 -13.805
   27    HG3  LYS   4           2HG      LYS   4   6.699  15.364 -14.569
   28    HD2  LYS   4           1HD      LYS   4   6.723  16.735 -16.396
   29    HD3  LYS   4           2HD      LYS   4   5.069  17.014 -15.845
   30    HE2  LYS   4           1HE      LYS   4   7.233  18.740 -14.755
   31    HE3  LYS   4           2HE      LYS   4   6.706  19.013 -16.415
   32    HZ1  LYS   4           3HZ      LYS   4   5.346  20.391 -15.165
   33    HZ2  LYS   4           1HZ      LYS   4   5.148  19.261 -13.922
   34    HZ3  LYS   4           2HZ      LYS   4   4.371  19.031 -15.406
   35    HA   PRO   5           HA       PRO   5   2.617  12.846 -10.749
   36    HB2  PRO   5           1HB      PRO   5   4.681  12.155  -9.126
   37    HB3  PRO   5           2HB      PRO   5   4.286  11.272 -10.606
   38    HG2  PRO   5           1HG      PRO   5   6.389  13.353 -10.145
   39    HG3  PRO   5           2HG      PRO   5   6.501  11.831 -11.045
   40    HD2  PRO   5           1HD      PRO   5   6.167  14.223 -12.267
   41    HD3  PRO   5           2HD      PRO   5   5.490  12.716 -12.918
   42    H    LYS   6           H        LYS   6   2.855  12.902  -8.179
   43    HA   LYS   6           HA       LYS   6   2.139  15.466  -7.353
   44    HB2  LYS   6           1HB      LYS   6   2.377  14.582  -5.044
   45    HB3  LYS   6           2HB      LYS   6   1.451  13.522  -6.099
   46    HG2  LYS   6           1HG      LYS   6   3.810  12.396  -6.458
   47    HG3  LYS   6           2HG      LYS   6   4.130  13.127  -4.884
   48    HD2  LYS   6           1HD      LYS   6   3.318  10.946  -4.447
   49    HD3  LYS   6           2HD      LYS   6   1.985  12.046  -4.090
   50    HE2  LYS   6           1HE      LYS   6   0.875  10.484  -5.331
   51    HE3  LYS   6           2HE      LYS   6   1.385  11.576  -6.618
   52    HZ1  LYS   6           3HZ      LYS   6   1.853   9.314  -7.233
   53    HZ2  LYS   6           1HZ      LYS   6   2.732   9.055  -5.810
   54    HZ3  LYS   6           2HZ      LYS   6   3.316  10.126  -6.983
   55    H    LYS   7           H        LYS   7   3.278  17.225  -6.893
   56    HA   LYS   7           HA       LYS   7   6.161  17.133  -6.922
   57    HB2  LYS   7           1HB      LYS   7   4.560  18.963  -7.889
   58    HB3  LYS   7           2HB      LYS   7   4.580  19.589  -6.246
   59    HG2  LYS   7           1HG      LYS   7   7.198  19.349  -6.588
   60    HG3  LYS   7           2HG      LYS   7   6.731  19.523  -8.282
   61    HD2  LYS   7           1HD      LYS   7   5.570  21.604  -7.757
   62    HD3  LYS   7           2HD      LYS   7   5.995  21.423  -6.053
   63    HE2  LYS   7           1HE      LYS   7   8.046  21.572  -8.250
   64    HE3  LYS   7           2HE      LYS   7   7.444  22.996  -7.404
   65    HZ1  LYS   7           3HZ      LYS   7   9.540  22.079  -6.489
   66    HZ2  LYS   7           1HZ      LYS   7   8.703  20.676  -6.047
   67    HZ3  LYS   7           2HZ      LYS   7   8.289  22.162  -5.354
   68    H    ASP   8           H        ASP   8   7.527  17.915  -5.250
   69    HA   ASP   8           HA       ASP   8   6.957  16.941  -2.697
   70    HB2  ASP   8           1HB      ASP   8   9.057  18.769  -3.803
   71    HB3  ASP   8           2HB      ASP   8   8.938  18.537  -2.061
   72    H    ASP   9           H        ASP   9   6.676  20.198  -4.025
   73    HA   ASP   9           HA       ASP   9   6.135  21.568  -1.646
   74    HB2  ASP   9           1HB      ASP   9   6.648  22.676  -3.797
   75    HB3  ASP   9           2HB      ASP   9   5.077  22.174  -4.416
   76    H    PHE  10           H        PHE  10   3.970  19.910  -3.903
   77    HA   PHE  10           HA       PHE  10   1.558  20.651  -2.634
   78    HD1  PHE  10           1HD      PHE  10  -0.077  17.638  -2.543
   79    HD2  PHE  10           2HD      PHE  10  -0.111  20.449  -5.739
   80    HE1  PHE  10           1HE      PHE  10  -2.536  17.552  -2.589
   81    HE2  PHE  10           2HE      PHE  10  -2.569  20.369  -5.789
   82    HZ   PHE  10           HZ       PHE  10  -3.785  18.920  -4.211
   83    HB2  PHE  10           1HB      PHE  10   1.903  19.648  -4.978
   84    HB3  PHE  10           2HB      PHE  10   1.941  18.087  -4.166
   85    H    ARG  11           H        ARG  11   1.429  20.296  -0.480
   86    HA   ARG  11           HA       ARG  11   1.461  17.498   0.395
   87    HE   ARG  11           HE       ARG  11   4.140  16.998   5.439
   88    HB2  ARG  11           1HB      ARG  11   3.613  18.460   1.060
   89    HB3  ARG  11           2HB      ARG  11   2.783  19.783   1.869
   90    HG2  ARG  11           1HG      ARG  11   2.064  18.447   3.608
   91    HG3  ARG  11           2HG      ARG  11   2.217  16.963   2.666
   92    HD2  ARG  11           1HD      ARG  11   4.388  16.709   3.189
   93    HD3  ARG  11           2HD      ARG  11   4.726  18.433   3.040
   94   HH11  ARG  11          1HH1      ARG  11   3.868  20.094   3.873
   95   HH12  ARG  11          2HH1      ARG  11   3.820  20.987   5.357
   96   HH21  ARG  11          1HH2      ARG  11   4.077  18.161   7.400
   97   HH22  ARG  11          2HH2      ARG  11   3.940  19.886   7.362
   98    H    ASN  12           H        ASN  12  -0.461  17.027   1.210
   99    HA   ASN  12           HA       ASN  12  -1.934  19.135   2.650
  100    HB2  ASN  12           1HB      ASN  12  -2.878  18.421   0.387
  101    HB3  ASN  12           2HB      ASN  12  -3.239  16.871   1.141
  102   HD21  ASN  12          1HD2      ASN  12  -5.070  18.800   0.024
  103   HD22  ASN  12          2HD2      ASN  12  -6.136  19.266   1.301
  104    H    GLU  13           H        GLU  13  -0.819  18.299   4.555
  105    HA   GLU  13           HA       GLU  13  -1.381  15.623   5.444
  106    HB2  GLU  13           1HB      GLU  13   0.674  17.071   6.011
  107    HB3  GLU  13           2HB      GLU  13  -0.370  17.858   7.187
  108    HG2  GLU  13           1HG      GLU  13  -0.632  15.881   8.433
  109    HG3  GLU  13           2HG      GLU  13   0.031  14.885   7.140
  110    H    PHE  14           H        PHE  14  -2.250  18.841   6.722
  111    HA   PHE  14           HA       PHE  14  -4.307  17.712   8.393
  112    HD1  PHE  14           1HD      PHE  14  -4.255  18.749  10.951
  113    HD2  PHE  14           2HD      PHE  14  -1.232  20.487   8.510
  114    HE1  PHE  14           1HE      PHE  14  -2.628  18.479  12.778
  115    HE2  PHE  14           2HE      PHE  14   0.398  20.219  10.332
  116    HZ   PHE  14           HZ       PHE  14  -0.298  19.213  12.469
  117    HB2  PHE  14           1HB      PHE  14  -3.472  20.558   7.824
  118    HB3  PHE  14           2HB      PHE  14  -4.778  20.134   8.925
  119    H    ASP  15           H        ASP  15  -5.144  16.801   6.160
  120    HA   ASP  15           HA       ASP  15  -6.644  18.515   4.484
  121    HB2  ASP  15           1HB      ASP  15  -7.799  16.331   3.821
  122    HB3  ASP  15           2HB      ASP  15  -6.058  16.418   3.571
  123    H    HIS  16           H        HIS  16  -7.677  16.294   7.073
  124    HA   HIS  16           HA       HIS  16  -9.594  16.180   8.302
  125    HD1  HIS  16           1HD      HIS  16 -11.133  20.181   9.907
  126    HD2  HIS  16           2HD      HIS  16 -10.380  16.132  10.458
  127    HE1  HIS  16           1HE      HIS  16 -12.521  19.503  11.892
  128    HB2  HIS  16           1HB      HIS  16  -8.519  18.442   8.958
  129    HB3  HIS  16           2HB      HIS  16  -9.817  19.164   8.013
  130    H    LEU  17           H        LEU  17 -10.263  15.370   5.942
  131    HA   LEU  17           HA       LEU  17 -12.905  16.512   5.506
  132    HG   LEU  17           HG       LEU  17 -11.730  18.723   4.363
  133    HB2  LEU  17           1HB      LEU  17 -10.673  16.651   3.586
  134    HB3  LEU  17           2HB      LEU  17 -12.218  16.114   2.927
  135   HD11  LEU  17          1HD1      LEU  17 -10.742  19.095   2.332
  136   HD12  LEU  17          2HD1      LEU  17 -12.413  19.507   1.953
  137   HD13  LEU  17          3HD1      LEU  17 -11.768  17.931   1.493
  138   HD21  LEU  17          3HD2      LEU  17 -14.049  19.138   3.230
  139   HD22  LEU  17          1HD2      LEU  17 -13.952  18.306   4.782
  140   HD23  LEU  17          2HD2      LEU  17 -14.172  17.378   3.298
  141    H    LEU  18           H        LEU  18 -14.394  15.062   4.650
  142    HA   LEU  18           HA       LEU  18 -14.061  12.369   5.245
  143    HG   LEU  18           HG       LEU  18 -16.375  12.150   6.020
  144    HB2  LEU  18           1HB      LEU  18 -16.014  13.903   3.593
  145    HB3  LEU  18           2HB      LEU  18 -16.052  12.142   3.554
  146   HD11  LEU  18          1HD1      LEU  18 -15.456  14.208   6.702
  147   HD12  LEU  18          2HD1      LEU  18 -17.192  14.351   6.972
  148   HD13  LEU  18          3HD1      LEU  18 -16.452  15.120   5.568
  149   HD21  LEU  18          3HD2      LEU  18 -18.669  13.707   5.419
  150   HD22  LEU  18          1HD2      LEU  18 -18.515  11.951   5.479
  151   HD23  LEU  18          2HD2      LEU  18 -18.223  12.811   3.968
  152    H    ILE  19           H        ILE  19 -14.486  13.630   1.937
  153    HA   ILE  19           HA       ILE  19 -13.667  11.378   0.574
  154    HB   ILE  19           HB       ILE  19 -13.399  14.282  -0.191
  155   HG12  ILE  19          1HG1      ILE  19 -15.688  13.379   0.087
  156   HG13  ILE  19          2HG1      ILE  19 -15.349  13.832  -1.578
  157   HG21  ILE  19          1HG2      ILE  19 -12.562  11.823  -1.633
  158   HG22  ILE  19          2HG2      ILE  19 -13.300  13.125  -2.563
  159   HG23  ILE  19          3HG2      ILE  19 -11.839  13.431  -1.624
  160   HD11  ILE  19          3HD1      ILE  19 -16.266  11.359  -0.577
  161   HD12  ILE  19          1HD1      ILE  19 -15.916  11.807  -2.246
  162   HD13  ILE  19          2HD1      ILE  19 -14.650  11.104  -1.238
  163    H    GLU  20           H        GLU  20 -11.682  14.057   1.773
  164    HA   GLU  20           HA       GLU  20  -9.243  13.399   0.658
  165    HB2  GLU  20           1HB      GLU  20 -10.054  14.751   3.195
  166    HB3  GLU  20           2HB      GLU  20  -8.360  14.340   2.966
  167    HG2  GLU  20           1HG      GLU  20  -9.925  15.905   0.940
  168    HG3  GLU  20           2HG      GLU  20  -9.079  16.667   2.285
  169    H    GLN  21           H        GLN  21 -10.499  12.330   3.820
  170    HA   GLN  21           HA       GLN  21  -8.362  10.628   4.445
  171    HB2  GLN  21           1HB      GLN  21 -10.460  11.492   5.837
  172    HB3  GLN  21           2HB      GLN  21 -11.104   9.924   5.373
  173    HG2  GLN  21           1HG      GLN  21  -8.725  10.552   7.071
  174    HG3  GLN  21           2HG      GLN  21 -10.124   9.546   7.442
  175   HE21  GLN  21          1HE2      GLN  21 -10.079   7.424   6.958
  176   HE22  GLN  21          2HE2      GLN  21  -8.743   6.621   6.213
  177    H    ALA  22           H        ALA  22 -11.425  10.002   2.783
  178    HA   ALA  22           HA       ALA  22 -11.179   7.222   2.545
  179    HB1  ALA  22           3HB      ALA  22 -13.291   8.094   2.073
  180    HB2  ALA  22           1HB      ALA  22 -12.651   9.288   0.944
  181    HB3  ALA  22           2HB      ALA  22 -12.684   7.581   0.498
  182    H    ASN  23           H        ASN  23 -10.090   9.833   0.406
  183    HA   ASN  23           HA       ASN  23  -9.118   8.182  -1.660
  184    HB2  ASN  23           1HB      ASN  23  -8.867  11.021  -0.887
  185    HB3  ASN  23           2HB      ASN  23  -7.543  10.389  -1.860
  186   HD21  ASN  23          1HD2      ASN  23 -10.294  12.024  -2.084
  187   HD22  ASN  23          2HD2      ASN  23 -10.829  11.546  -3.656
  188    H    HIS  24           H        HIS  24  -7.581   9.521   1.230
  189    HA   HIS  24           HA       HIS  24  -4.958   8.667   0.651
  190    HD1  HIS  24           1HD      HIS  24  -4.206   9.841   5.073
  191    HD2  HIS  24           2HD      HIS  24  -2.848   8.814   1.284
  192    HE1  HIS  24           1HE      HIS  24  -1.702   9.722   5.266
  193    HB2  HIS  24           1HB      HIS  24  -5.765  10.342   2.436
  194    HB3  HIS  24           2HB      HIS  24  -6.051   8.925   3.444
  195    H    ALA  25           H        ALA  25  -7.639   7.129   2.360
  196    HA   ALA  25           HA       ALA  25  -6.207   4.882   3.294
  197    HB1  ALA  25           3HB      ALA  25  -8.624   5.814   3.842
  198    HB2  ALA  25           1HB      ALA  25  -9.090   4.610   2.641
  199    HB3  ALA  25           2HB      ALA  25  -8.203   4.120   4.085
  200    H    ILE  26           H        ILE  26  -8.321   5.287   0.454
  201    HA   ILE  26           HA       ILE  26  -7.933   2.695  -0.573
  202    HB   ILE  26           HB       ILE  26  -8.825   3.549  -2.676
  203   HG12  ILE  26          1HG1      ILE  26  -8.572   6.272  -1.380
  204   HG13  ILE  26          2HG1      ILE  26  -7.622   5.687  -2.741
  205   HG21  ILE  26          1HG2      ILE  26 -10.634   5.051  -1.024
  206   HG22  ILE  26          2HG2      ILE  26 -10.853   3.471  -1.776
  207   HG23  ILE  26          3HG2      ILE  26 -10.099   3.595  -0.186
  208   HD11  ILE  26          3HD1      ILE  26 -10.305   6.817  -2.672
  209   HD12  ILE  26          1HD1      ILE  26  -9.142   6.726  -3.993
  210   HD13  ILE  26          2HD1      ILE  26 -10.178   5.345  -3.634
  211    H    GLU  27           H        GLU  27  -6.108   5.663  -0.903
  212    HA   GLU  27           HA       GLU  27  -4.517   4.878  -3.108
  213    HB2  GLU  27           1HB      GLU  27  -4.801   7.227  -2.262
  214    HB3  GLU  27           2HB      GLU  27  -3.759   6.806  -0.911
  215    HG2  GLU  27           1HG      GLU  27  -2.436   7.932  -2.526
  216    HG3  GLU  27           2HG      GLU  27  -1.978   6.230  -2.551
  217    H    LYS  28           H        LYS  28  -3.833   4.900   0.388
  218    HA   LYS  28           HA       LYS  28  -1.302   3.715   0.239
  219    HB2  LYS  28           1HB      LYS  28  -1.994   4.800   2.265
  220    HB3  LYS  28           2HB      LYS  28  -3.367   3.715   2.443
  221    HG2  LYS  28           1HG      LYS  28  -1.795   1.838   2.769
  222    HG3  LYS  28           2HG      LYS  28  -0.456   2.985   2.692
  223    HD2  LYS  28           1HD      LYS  28  -0.999   2.509   5.003
  224    HD3  LYS  28           2HD      LYS  28  -1.408   4.184   4.627
  225    HE2  LYS  28           1HE      LYS  28  -3.539   2.163   4.255
  226    HE3  LYS  28           2HE      LYS  28  -3.069   2.529   5.915
  227    HZ1  LYS  28           3HZ      LYS  28  -3.965   4.568   5.808
  228    HZ2  LYS  28           1HZ      LYS  28  -4.872   3.927   4.533
  229    HZ3  LYS  28           2HZ      LYS  28  -3.482   4.833   4.209
  230    H    GLY  29           H        GLY  29  -4.511   2.257   0.663
  231    HA2  GLY  29           1HA      GLY  29  -3.592  -0.407   0.938
  232    HA3  GLY  29           2HA      GLY  29  -5.222   0.079   0.497
  233    H    GLU  30           H        GLU  30  -4.460   1.533  -1.871
  234    HA   GLU  30           HA       GLU  30  -4.478  -0.615  -3.726
  235    HB2  GLU  30           1HB      GLU  30  -5.576   1.550  -4.160
  236    HB3  GLU  30           2HB      GLU  30  -4.003   2.332  -4.215
  237    HG2  GLU  30           1HG      GLU  30  -3.469   1.433  -6.253
  238    HG3  GLU  30           2HG      GLU  30  -4.538   0.047  -6.044
  239    H    HIS  31           H        HIS  31  -1.993   1.630  -2.622
  240    HA   HIS  31           HA       HIS  31  -0.017   0.834  -4.503
  241    HD1  HIS  31           1HD      HIS  31   2.457   2.321  -0.866
  242    HD2  HIS  31           2HD      HIS  31   2.568   1.684  -4.970
  243    HE1  HIS  31           1HE      HIS  31   4.896   2.117  -1.450
  244    HB2  HIS  31           1HB      HIS  31   0.193   2.975  -3.426
  245    HB3  HIS  31           2HB      HIS  31   0.196   2.229  -1.830
  246    H    GLN  32           H        GLN  32  -0.442   0.082  -1.043
  247    HA   GLN  32           HA       GLN  32   1.674  -1.738  -0.845
  248    HB2  GLN  32           1HB      GLN  32   0.621  -2.501   1.209
  249    HB3  GLN  32           2HB      GLN  32   0.530  -0.747   1.099
  250    HG2  GLN  32           1HG      GLN  32  -1.582  -1.238   1.803
  251    HG3  GLN  32           2HG      GLN  32  -1.816  -1.234   0.056
  252   HE21  GLN  32          1HE2      GLN  32  -0.494  -3.619   2.324
  253   HE22  GLN  32          2HE2      GLN  32  -1.553  -4.902   1.861
  254    H    LEU  33           H        LEU  33  -1.673  -2.168  -1.835
  255    HA   LEU  33           HA       LEU  33  -1.660  -5.000  -1.853
  256    HG   LEU  33           HG       LEU  33  -5.060  -4.966  -3.263
  257    HB2  LEU  33           1HB      LEU  33  -3.734  -3.780  -1.815
  258    HB3  LEU  33           2HB      LEU  33  -3.349  -3.004  -3.351
  259   HD11  LEU  33          1HD1      LEU  33  -4.830  -5.059  -5.495
  260   HD12  LEU  33          2HD1      LEU  33  -3.121  -5.486  -5.407
  261   HD13  LEU  33          3HD1      LEU  33  -3.618  -3.803  -5.235
  262   HD21  LEU  33          3HD2      LEU  33  -2.693  -6.684  -3.773
  263   HD22  LEU  33          1HD2      LEU  33  -4.294  -7.109  -3.166
  264   HD23  LEU  33          2HD2      LEU  33  -3.119  -6.343  -2.095
  265    H    LEU  34           H        LEU  34  -1.296  -2.622  -4.481
  266    HA   LEU  34           HA       LEU  34  -0.902  -4.388  -6.579
  267    HG   LEU  34           HG       LEU  34  -2.298  -1.867  -6.722
  268    HB2  LEU  34           1HB      LEU  34   0.072  -1.606  -6.050
  269    HB3  LEU  34           2HB      LEU  34   0.553  -2.464  -7.512
  270   HD11  LEU  34          1HD1      LEU  34  -0.449  -0.047  -7.585
  271   HD12  LEU  34          2HD1      LEU  34  -2.193   0.087  -7.799
  272   HD13  LEU  34          3HD1      LEU  34  -1.195  -0.572  -9.094
  273   HD21  LEU  34          3HD2      LEU  34  -1.025  -3.418  -8.885
  274   HD22  LEU  34          1HD2      LEU  34  -2.340  -2.345  -9.366
  275   HD23  LEU  34          2HD2      LEU  34  -2.618  -3.589  -8.147
  276    H    TYR  35           H        TYR  35   1.484  -3.015  -4.343
  277    HA   TYR  35           HA       TYR  35   3.705  -4.335  -5.564
  278    HD1  TYR  35           1HD      TYR  35   6.296  -3.429  -5.134
  279    HD2  TYR  35           2HD      TYR  35   4.606  -4.102  -1.287
  280    HE1  TYR  35           1HE      TYR  35   8.471  -4.248  -4.329
  281    HE2  TYR  35           2HE      TYR  35   6.777  -4.921  -0.471
  282    HH   TYR  35           HH       TYR  35   8.941  -5.187  -0.942
  283    HB2  TYR  35           1HB      TYR  35   4.142  -2.317  -4.356
  284    HB3  TYR  35           2HB      TYR  35   3.364  -2.941  -2.906
  285    H    LEU  36           H        LEU  36   1.461  -5.097  -2.998
  286    HA   LEU  36           HA       LEU  36   2.932  -7.236  -1.854
  287    HG   LEU  36           HG       LEU  36   0.158  -8.935  -1.198
  288    HB2  LEU  36           1HB      LEU  36   1.162  -6.152  -0.626
  289    HB3  LEU  36           2HB      LEU  36  -0.019  -6.624  -1.846
  290   HD11  LEU  36          1HD1      LEU  36   2.485  -7.947   0.381
  291   HD12  LEU  36          2HD1      LEU  36   2.333  -9.387  -0.624
  292   HD13  LEU  36          3HD1      LEU  36   1.572  -9.339   0.966
  293   HD21  LEU  36          3HD2      LEU  36  -1.413  -8.356   0.267
  294   HD22  LEU  36          1HD2      LEU  36  -0.610  -6.829   0.633
  295   HD23  LEU  36          2HD2      LEU  36  -0.140  -8.299   1.488
  296    H    GLN  37           H        GLN  37   0.768  -6.972  -4.576
  297    HA   GLN  37           HA       GLN  37  -0.021  -9.587  -4.959
  298    HB2  GLN  37           1HB      GLN  37  -0.180  -7.245  -6.408
  299    HB3  GLN  37           2HB      GLN  37   0.792  -8.281  -7.445
  300    HG2  GLN  37           1HG      GLN  37  -1.622  -8.394  -7.927
  301    HG3  GLN  37           2HG      GLN  37  -0.922  -9.952  -7.488
  302   HE21  GLN  37          1HE2      GLN  37  -2.830  -7.253  -6.299
  303   HE22  GLN  37          2HE2      GLN  37  -3.660  -8.138  -5.070
  304    H    HIS  38           H        HIS  38   3.041  -8.057  -5.838
  305    HA   HIS  38           HA       HIS  38   4.145 -10.156  -7.315
  306    HD1  HIS  38           1HD      HIS  38   5.409  -8.312  -9.292
  307    HD2  HIS  38           2HD      HIS  38   8.131  -9.880  -6.574
  308    HE1  HIS  38           1HE      HIS  38   7.376  -9.060 -10.668
  309    HB2  HIS  38           1HB      HIS  38   4.980  -7.682  -6.755
  310    HB3  HIS  38           2HB      HIS  38   5.944  -8.552  -5.565
  311    H    GLN  39           H        GLN  39   4.604  -9.386  -3.863
  312    HA   GLN  39           HA       GLN  39   6.179 -11.571  -3.192
  313    HB2  GLN  39           1HB      GLN  39   4.150 -10.083  -1.520
  314    HB3  GLN  39           2HB      GLN  39   5.308 -11.235  -0.870
  315    HG2  GLN  39           1HG      GLN  39   6.264  -8.914  -2.483
  316    HG3  GLN  39           2HG      GLN  39   5.816  -8.694  -0.792
  317   HE21  GLN  39          1HE2      GLN  39   7.200  -9.304   0.762
  318   HE22  GLN  39          2HE2      GLN  39   8.721 -10.071   0.478
  319    H    LEU  40           H        LEU  40   2.660 -11.291  -3.338
  320    HA   LEU  40           HA       LEU  40   2.019 -13.775  -2.214
  321    HG   LEU  40           HG       LEU  40  -1.502 -13.228  -3.141
  322    HB2  LEU  40           1HB      LEU  40   0.375 -12.018  -2.569
  323    HB3  LEU  40           2HB      LEU  40   0.553 -12.185  -4.314
  324   HD11  LEU  40          1HD1      LEU  40   0.005 -13.906  -5.441
  325   HD12  LEU  40          2HD1      LEU  40  -1.722 -14.124  -5.153
  326   HD13  LEU  40          3HD1      LEU  40  -0.587 -15.404  -4.722
  327   HD21  LEU  40          3HD2      LEU  40  -1.280 -15.269  -2.081
  328   HD22  LEU  40          1HD2      LEU  40   0.126 -14.388  -1.480
  329   HD23  LEU  40          2HD2      LEU  40   0.314 -15.575  -2.772
  330    H    ASP  41           H        ASP  41   2.403 -12.855  -5.632
  331    HA   ASP  41           HA       ASP  41   1.925 -15.356  -6.759
  332    HB2  ASP  41           1HB      ASP  41   2.271 -13.038  -7.883
  333    HB3  ASP  41           2HB      ASP  41   3.975 -13.484  -7.905
  334    H    GLU  42           H        GLU  42   4.956 -13.938  -5.594
  335    HA   GLU  42           HA       GLU  42   6.591 -16.128  -6.360
  336    HB2  GLU  42           1HB      GLU  42   7.702 -14.074  -6.021
  337    HB3  GLU  42           2HB      GLU  42   6.959 -13.836  -4.446
  338    HG2  GLU  42           1HG      GLU  42   9.329 -14.427  -4.288
  339    HG3  GLU  42           2HG      GLU  42   8.287 -15.613  -3.502
  340    H    LEU  43           H        LEU  43   4.766 -15.344  -3.468
  341    HA   LEU  43           HA       LEU  43   5.897 -17.370  -1.822
  342    HG   LEU  43           HG       LEU  43   3.859 -18.075  -0.057
  343    HB2  LEU  43           1HB      LEU  43   4.883 -15.680  -0.620
  344    HB3  LEU  43           2HB      LEU  43   3.481 -15.623  -1.687
  345   HD11  LEU  43          1HD1      LEU  43   2.855 -15.481   1.106
  346   HD12  LEU  43          2HD1      LEU  43   4.367 -16.283   1.533
  347   HD13  LEU  43          3HD1      LEU  43   2.824 -17.060   1.892
  348   HD21  LEU  43          3HD2      LEU  43   1.261 -16.855  -0.026
  349   HD22  LEU  43          1HD2      LEU  43   1.760 -18.410  -0.694
  350   HD23  LEU  43          2HD2      LEU  43   1.868 -16.951  -1.680
  351    H    ASN  44           H        ASN  44   3.286 -17.276  -4.134
  352    HA   ASN  44           HA       ASN  44   1.820 -19.511  -3.424
  353    HB2  ASN  44           1HB      ASN  44   2.475 -18.347  -6.129
  354    HB3  ASN  44           2HB      ASN  44   1.383 -19.716  -5.935
  355   HD21  ASN  44          1HD2      ASN  44   0.199 -17.783  -7.097
  356   HD22  ASN  44          2HD2      ASN  44  -0.799 -16.842  -6.047
  357    H    GLU  45           H        GLU  45   4.737 -19.338  -5.444
  358    HA   GLU  45           HA       GLU  45   4.861 -22.243  -5.590
  359    HB2  GLU  45           1HB      GLU  45   6.304 -19.989  -6.923
  360    HB3  GLU  45           2HB      GLU  45   7.067 -21.572  -6.869
  361    HG2  GLU  45           1HG      GLU  45   4.293 -21.130  -7.929
  362    HG3  GLU  45           2HG      GLU  45   5.738 -21.053  -8.937
  363    H    ASN  46           H        ASN  46   6.841 -19.554  -4.372
  364    HA   ASN  46           HA       ASN  46   8.971 -20.982  -3.346
  365    HB2  ASN  46           1HB      ASN  46   8.701 -18.463  -3.454
  366    HB3  ASN  46           2HB      ASN  46   7.745 -18.584  -1.980
  367   HD21  ASN  46          1HD2      ASN  46   9.566 -17.081  -1.363
  368   HD22  ASN  46          2HD2      ASN  46  10.965 -17.811  -0.660
  369    H    LYS  47           H        LYS  47   5.780 -20.451  -1.968
  370    HA   LYS  47           HA       LYS  47   4.753 -21.259  -0.097
  371    HB2  LYS  47           1HB      LYS  47   6.536 -23.634  -0.665
  372    HB3  LYS  47           2HB      LYS  47   5.079 -23.653   0.321
  373    HG2  LYS  47           1HG      LYS  47   4.873 -22.709  -2.490
  374    HG3  LYS  47           2HG      LYS  47   5.052 -24.438  -2.185
  375    HD2  LYS  47           1HD      LYS  47   3.136 -23.962  -0.425
  376    HD3  LYS  47           2HD      LYS  47   2.810 -22.603  -1.505
  377    HE2  LYS  47           1HE      LYS  47   1.459 -24.453  -2.198
  378    HE3  LYS  47           2HE      LYS  47   2.726 -24.218  -3.399
  379    HZ1  LYS  47           3HZ      LYS  47   2.288 -26.577  -2.698
  380    HZ2  LYS  47           1HZ      LYS  47   2.965 -26.184  -1.198
  381    HZ3  LYS  47           2HZ      LYS  47   3.901 -26.076  -2.603
  382    H    SER  48           H        SER  48   6.986 -19.615   0.444
  383    HA   SER  48           HA       SER  48   8.625 -20.807   2.466
  384    HG   SER  48           HG       SER  48  10.080 -17.761   3.136
  385    HB2  SER  48           1HB      SER  48   9.706 -19.015   1.475
  386    HB3  SER  48           2HB      SER  48   8.237 -18.041   1.389
  387    H    LYS  49           H        LYS  49   8.091 -21.189   4.503
  388    HA   LYS  49           HA       LYS  49   5.593 -20.611   5.611
  389    HB2  LYS  49           1HB      LYS  49   6.682 -21.231   7.796
  390    HB3  LYS  49           2HB      LYS  49   6.860 -22.419   6.512
  391    HG2  LYS  49           1HG      LYS  49   9.100 -20.913   6.173
  392    HG3  LYS  49           2HG      LYS  49   8.886 -20.852   7.924
  393    HD2  LYS  49           1HD      LYS  49   9.491 -22.991   8.172
  394    HD3  LYS  49           2HD      LYS  49   8.474 -23.519   6.829
  395    HE2  LYS  49           1HE      LYS  49  10.388 -22.313   5.429
  396    HE3  LYS  49           2HE      LYS  49  11.333 -22.719   6.860
  397    HZ1  LYS  49           3HZ      LYS  49  10.434 -25.047   6.559
  398    HZ2  LYS  49           1HZ      LYS  49  11.566 -24.527   5.414
  399    HZ3  LYS  49           2HZ      LYS  49   9.920 -24.559   5.023
  400    H    GLU  50           H        GLU  50   8.732 -19.024   6.140
  401    HA   GLU  50           HA       GLU  50   7.789 -17.103   7.975
  402    HB2  GLU  50           1HB      GLU  50   9.878 -15.863   7.389
  403    HB3  GLU  50           2HB      GLU  50  10.143 -17.541   7.840
  404    HG2  GLU  50           1HG      GLU  50  10.269 -18.124   5.443
  405    HG3  GLU  50           2HG      GLU  50  10.118 -16.412   5.051
  406    H    LEU  51           H        LEU  51   8.225 -17.005   4.459
  407    HA   LEU  51           HA       LEU  51   7.575 -14.327   4.038
  408    HG   LEU  51           HG       LEU  51   5.983 -14.681   1.266
  409    HB2  LEU  51           1HB      LEU  51   8.529 -15.871   2.349
  410    HB3  LEU  51           2HB      LEU  51   6.955 -16.654   2.224
  411   HD11  LEU  51          1HD1      LEU  51   7.748 -12.800   0.713
  412   HD12  LEU  51          2HD1      LEU  51   8.515 -13.420   2.175
  413   HD13  LEU  51          3HD1      LEU  51   6.860 -12.813   2.237
  414   HD21  LEU  51          3HD2      LEU  51   8.610 -15.499   0.056
  415   HD22  LEU  51          1HD2      LEU  51   7.492 -14.399  -0.751
  416   HD23  LEU  51          2HD2      LEU  51   6.988 -16.047  -0.370
  417    H    GLN  52           H        GLN  52   5.504 -17.164   4.356
  418    HA   GLN  52           HA       GLN  52   3.085 -15.835   3.674
  419    HB2  GLN  52           1HB      GLN  52   3.364 -18.288   3.561
  420    HB3  GLN  52           2HB      GLN  52   3.487 -18.344   5.314
  421    HG2  GLN  52           1HG      GLN  52   1.157 -17.108   5.156
  422    HG3  GLN  52           2HG      GLN  52   1.117 -17.911   3.587
  423   HE21  GLN  52          1HE2      GLN  52   1.504 -18.460   7.043
  424   HE22  GLN  52          2HE2      GLN  52   0.900 -20.078   7.039
  425    H    GLU  53           H        GLU  53   4.370 -16.914   6.824
  426    HA   GLU  53           HA       GLU  53   2.415 -15.828   8.449
  427    HB2  GLU  53           1HB      GLU  53   5.322 -16.422   8.855
  428    HB3  GLU  53           2HB      GLU  53   4.424 -15.592  10.118
  429    HG2  GLU  53           1HG      GLU  53   3.449 -18.167   8.940
  430    HG3  GLU  53           2HG      GLU  53   4.624 -18.132  10.254
  431    H    LYS  54           H        LYS  54   5.122 -14.265   6.881
  432    HA   LYS  54           HA       LYS  54   4.900 -11.809   8.338
  433    HB2  LYS  54           1HB      LYS  54   6.339 -12.569   5.796
  434    HB3  LYS  54           2HB      LYS  54   6.385 -10.944   6.465
  435    HG2  LYS  54           1HG      LYS  54   7.114 -13.223   8.229
  436    HG3  LYS  54           2HG      LYS  54   8.264 -12.699   6.997
  437    HD2  LYS  54           1HD      LYS  54   8.942 -11.212   8.532
  438    HD3  LYS  54           2HD      LYS  54   7.480 -10.322   8.101
  439    HE2  LYS  54           1HE      LYS  54   7.361 -10.462  10.420
  440    HE3  LYS  54           2HE      LYS  54   6.327 -11.783   9.879
  441    HZ1  LYS  54           3HZ      LYS  54   8.119 -12.159  11.718
  442    HZ2  LYS  54           1HZ      LYS  54   9.161 -12.337  10.396
  443    HZ3  LYS  54           2HZ      LYS  54   7.819 -13.354  10.559
  444    H    ILE  55           H        ILE  55   4.051 -12.787   5.019
  445    HA   ILE  55           HA       ILE  55   2.869 -10.375   4.241
  446    HB   ILE  55           HB       ILE  55   2.296 -13.189   3.314
  447   HG12  ILE  55          1HG1      ILE  55   3.796 -11.040   1.834
  448   HG13  ILE  55          2HG1      ILE  55   4.609 -12.072   3.005
  449   HG21  ILE  55          1HG2      ILE  55   1.567 -11.604   1.242
  450   HG22  ILE  55          2HG2      ILE  55   0.446 -12.274   2.426
  451   HG23  ILE  55          3HG2      ILE  55   1.046 -10.627   2.613
  452   HD11  ILE  55          3HD1      ILE  55   4.141 -14.018   1.727
  453   HD12  ILE  55          1HD1      ILE  55   3.069 -13.125   0.651
  454   HD13  ILE  55          2HD1      ILE  55   4.803 -12.805   0.631
  455    H    ILE  56           H        ILE  56   1.318 -13.336   5.479
  456    HA   ILE  56           HA       ILE  56  -1.306 -12.442   5.501
  457    HB   ILE  56           HB       ILE  56  -0.671 -14.775   5.943
  458   HG12  ILE  56          1HG1      ILE  56  -2.312 -15.209   7.742
  459   HG13  ILE  56          2HG1      ILE  56  -2.283 -13.501   8.166
  460   HG21  ILE  56          1HG2      ILE  56   1.194 -13.901   7.594
  461   HG22  ILE  56          2HG2      ILE  56  -0.076 -14.156   8.789
  462   HG23  ILE  56          3HG2      ILE  56   0.472 -15.498   7.784
  463   HD11  ILE  56          3HD1      ILE  56  -3.024 -14.401   5.412
  464   HD12  ILE  56          1HD1      ILE  56  -4.205 -14.364   6.720
  465   HD13  ILE  56          2HD1      ILE  56  -3.394 -12.879   6.221
  466    H    ARG  57           H        ARG  57   1.274 -11.888   7.823
  467    HA   ARG  57           HA       ARG  57  -0.341 -10.780   9.870
  468    HE   ARG  57           HE       ARG  57   2.553 -14.232  11.260
  469    HB2  ARG  57           1HB      ARG  57   2.491 -11.157   9.347
  470    HB3  ARG  57           2HB      ARG  57   2.174  -9.603  10.108
  471    HG2  ARG  57           1HG      ARG  57   2.659 -11.339  11.751
  472    HG3  ARG  57           2HG      ARG  57   1.022 -10.707  11.936
  473    HD2  ARG  57           1HD      ARG  57   0.140 -12.724  11.616
  474    HD3  ARG  57           2HD      ARG  57   1.047 -12.939  10.119
  475   HH11  ARG  57          1HH1      ARG  57   0.616 -12.453  13.541
  476   HH12  ARG  57          2HH1      ARG  57   1.240 -13.291  14.923
  477   HH21  ARG  57          1HH2      ARG  57   3.382 -15.343  13.071
  478   HH22  ARG  57          2HH2      ARG  57   2.814 -14.935  14.654
  479    H    GLU  58           H        GLU  58   1.740  -9.230   7.422
  480    HA   GLU  58           HA       GLU  58   1.034  -6.588   8.058
  481    HB2  GLU  58           1HB      GLU  58   2.888  -7.667   6.451
  482    HB3  GLU  58           2HB      GLU  58   1.691  -7.238   5.237
  483    HG2  GLU  58           1HG      GLU  58   1.751  -4.933   6.548
  484    HG3  GLU  58           2HG      GLU  58   3.372  -5.503   6.945
  485    H    LEU  59           H        LEU  59  -0.309  -8.865   5.702
  486    HA   LEU  59           HA       LEU  59  -2.154  -7.070   4.541
  487    HG   LEU  59           HG       LEU  59  -2.817  -8.073   2.398
  488    HB2  LEU  59           1HB      LEU  59  -1.320  -9.452   3.815
  489    HB3  LEU  59           2HB      LEU  59  -2.729  -9.990   4.728
  490   HD11  LEU  59          1HD1      LEU  59  -3.138 -11.044   2.582
  491   HD12  LEU  59          2HD1      LEU  59  -2.225 -10.089   1.414
  492   HD13  LEU  59          3HD1      LEU  59  -3.987 -10.116   1.344
  493   HD21  LEU  59          3HD2      LEU  59  -4.746  -7.591   3.517
  494   HD22  LEU  59          1HD2      LEU  59  -4.835  -9.180   4.278
  495   HD23  LEU  59          2HD2      LEU  59  -5.295  -8.986   2.586
  496    H    ASP  60           H        ASP  60  -2.320  -9.210   7.324
  497    HA   ASP  60           HA       ASP  60  -5.101  -9.035   7.767
  498    HB2  ASP  60           1HB      ASP  60  -3.775 -10.770   8.828
  499    HB3  ASP  60           2HB      ASP  60  -2.839  -9.562   9.703
  500    H    VAL  61           H        VAL  61  -2.406  -7.296   9.326
  501    HA   VAL  61           HA       VAL  61  -3.996  -5.587  10.881
  502    HB   VAL  61           HB       VAL  61  -1.982  -4.126  11.000
  503   HG11  VAL  61          1HG1      VAL  61  -2.078  -5.785  12.645
  504   HG12  VAL  61          2HG1      VAL  61  -1.755  -7.079  11.489
  505   HG13  VAL  61          3HG1      VAL  61  -0.468  -5.962  11.947
  506   HG21  VAL  61          3HG2      VAL  61  -0.898  -6.118   9.015
  507   HG22  VAL  61          1HG2      VAL  61  -1.084  -4.377   8.797
  508   HG23  VAL  61          2HG2      VAL  61   0.105  -5.002   9.940
  509    H    VAL  62           H        VAL  62  -2.716  -5.253   7.607
  510    HA   VAL  62           HA       VAL  62  -3.505  -2.558   7.227
  511    HB   VAL  62           HB       VAL  62  -2.898  -4.761   5.259
  512   HG11  VAL  62          1HG1      VAL  62  -2.641  -2.473   3.826
  513   HG12  VAL  62          2HG1      VAL  62  -4.061  -3.519   3.789
  514   HG13  VAL  62          3HG1      VAL  62  -4.043  -2.092   4.825
  515   HG21  VAL  62          3HG2      VAL  62  -1.192  -2.400   5.329
  516   HG22  VAL  62          1HG2      VAL  62  -1.240  -3.263   6.866
  517   HG23  VAL  62          2HG2      VAL  62  -0.763  -4.109   5.394
  518    H    CYS  63           H        CYS  63  -4.941  -5.584   5.995
  519    HA   CYS  63           HA       CYS  63  -7.225  -4.432   4.877
  520    HG   CYS  63           HG       CYS  63  -8.071  -8.714   6.217
  521    HB2  CYS  63           1HB      CYS  63  -8.075  -6.617   4.667
  522    HB3  CYS  63           2HB      CYS  63  -6.329  -6.823   4.616
  523    H    ALA  64           H        ALA  64  -6.449  -5.195   8.169
  524    HA   ALA  64           HA       ALA  64  -9.120  -5.164   9.175
  525    HB1  ALA  64           3HB      ALA  64  -6.548  -4.695  10.678
  526    HB2  ALA  64           1HB      ALA  64  -8.110  -5.140  11.365
  527    HB3  ALA  64           2HB      ALA  64  -7.244  -6.278  10.333
  528    H    MET  65           H        MET  65  -6.449  -2.813   9.495
  529    HA   MET  65           HA       MET  65  -8.015  -0.771  10.620
  530    HB2  MET  65           1HB      MET  65  -6.150   0.639  10.337
  531    HB3  MET  65           2HB      MET  65  -5.470  -0.967  10.563
  532    HG2  MET  65           1HG      MET  65  -5.214  -1.171   8.122
  533    HG3  MET  65           2HG      MET  65  -5.820   0.474   7.945
  534    HE1  MET  65           3HE      MET  65  -3.482  -1.533  10.164
  535    HE2  MET  65           1HE      MET  65  -2.475  -1.652   8.721
  536    HE3  MET  65           2HE      MET  65  -1.934  -0.687  10.095
  537    H    ILE  66           H        ILE  66  -7.337  -1.647   7.291
  538    HA   ILE  66           HA       ILE  66  -8.399   0.721   6.122
  539    HB   ILE  66           HB       ILE  66  -7.465  -1.899   5.141
  540   HG12  ILE  66          1HG1      ILE  66  -6.315  -0.498   3.514
  541   HG13  ILE  66          2HG1      ILE  66  -7.264   0.901   4.008
  542   HG21  ILE  66          1HG2      ILE  66  -9.570  -0.312   3.696
  543   HG22  ILE  66          2HG2      ILE  66  -8.478  -1.424   2.872
  544   HG23  ILE  66          3HG2      ILE  66  -9.584  -2.028   4.106
  545   HD11  ILE  66          3HD1      ILE  66  -6.160   1.054   6.067
  546   HD12  ILE  66          1HD1      ILE  66  -5.477  -0.564   5.917
  547   HD13  ILE  66          2HD1      ILE  66  -4.893   0.739   4.882
  548    H    GLU  67           H        GLU  67  -9.713  -2.549   6.610
  549    HA   GLU  67           HA       GLU  67 -12.207  -2.138   5.431
  550    HB2  GLU  67           1HB      GLU  67 -11.169  -4.015   7.514
  551    HB3  GLU  67           2HB      GLU  67 -12.901  -3.945   7.219
  552    HG2  GLU  67           1HG      GLU  67 -11.180  -4.203   4.839
  553    HG3  GLU  67           2HG      GLU  67 -11.241  -5.593   5.922
  554    H    GLY  68           H        GLY  68 -11.297  -1.859   8.869
  555    HA2  GLY  68           1HA      GLY  68 -13.816  -0.970   9.767
  556    HA3  GLY  68           2HA      GLY  68 -12.291  -0.739  10.609
  557    H    ALA  69           H        ALA  69 -10.880   0.890   8.985
  558    HA   ALA  69           HA       ALA  69 -11.808   3.425   9.566
  559    HB1  ALA  69           3HB      ALA  69 -10.182   4.195   7.795
  560    HB2  ALA  69           1HB      ALA  69  -9.516   3.150   9.051
  561    HB3  ALA  69           2HB      ALA  69  -9.878   2.492   7.455
  562    H    GLN  70           H        GLN  70 -11.885   1.833   6.371
  563    HA   GLN  70           HA       GLN  70 -13.392   3.845   5.105
  564    HB2  GLN  70           1HB      GLN  70 -13.551   2.388   3.266
  565    HB3  GLN  70           2HB      GLN  70 -12.020   1.976   4.029
  566    HG2  GLN  70           1HG      GLN  70 -12.975   0.027   5.037
  567    HG3  GLN  70           2HG      GLN  70 -14.588   0.478   4.487
  568   HE21  GLN  70          1HE2      GLN  70 -14.362   1.080   1.942
  569   HE22  GLN  70          2HE2      GLN  70 -13.725  -0.232   1.017
  570    H    GLY  71           H        GLY  71 -14.309   1.029   6.976
  571    HA2  GLY  71           1HA      GLY  71 -17.001   0.825   6.245
  572    HA3  GLY  71           2HA      GLY  71 -16.337   0.339   7.799
  573    H    ALA  72           H        ALA  72 -15.582   2.623   8.976
  574    HA   ALA  72           HA       ALA  72 -18.065   3.775   9.757
  575    HB1  ALA  72           3HB      ALA  72 -15.558   3.549  10.889
  576    HB2  ALA  72           1HB      ALA  72 -15.724   5.278  10.587
  577    HB3  ALA  72           2HB      ALA  72 -16.929   4.433  11.558
  578    H    LEU  73           H        LEU  73 -15.313   4.928   7.850
  579    HA   LEU  73           HA       LEU  73 -16.161   7.578   7.520
  580    HG   LEU  73           HG       LEU  73 -14.392   8.738   7.000
  581    HB2  LEU  73           1HB      LEU  73 -14.000   6.078   6.732
  582    HB3  LEU  73           2HB      LEU  73 -14.801   6.434   5.203
  583   HD11  LEU  73          1HD1      LEU  73 -12.139   8.832   6.993
  584   HD12  LEU  73          2HD1      LEU  73 -11.998   7.998   5.446
  585   HD13  LEU  73          3HD1      LEU  73 -12.285   7.076   6.921
  586   HD21  LEU  73          3HD2      LEU  73 -15.065   9.581   5.039
  587   HD22  LEU  73          1HD2      LEU  73 -14.625   8.122   4.151
  588   HD23  LEU  73          2HD2      LEU  73 -13.396   9.330   4.526
  589    H    GLU  74           H        GLU  74 -16.511   4.828   5.273
  590    HA   GLU  74           HA       GLU  74 -18.110   6.160   3.399
  591    HB2  GLU  74           1HB      GLU  74 -16.923   3.771   3.415
  592    HB3  GLU  74           2HB      GLU  74 -18.546   3.250   3.848
  593    HG2  GLU  74           1HG      GLU  74 -18.411   5.102   1.579
  594    HG3  GLU  74           2HG      GLU  74 -17.640   3.539   1.315
  595    H    ARG  75           H        ARG  75 -19.036   4.067   6.121
  596    HA   ARG  75           HA       ARG  75 -21.809   4.207   5.728
  597    HE   ARG  75           HE       ARG  75 -22.093   0.320   7.060
  598    HB2  ARG  75           1HB      ARG  75 -20.568   2.603   7.231
  599    HB3  ARG  75           2HB      ARG  75 -20.416   3.916   8.391
  600    HG2  ARG  75           1HG      ARG  75 -22.262   2.758   9.154
  601    HG3  ARG  75           2HG      ARG  75 -22.985   4.066   8.216
  602    HD2  ARG  75           1HD      ARG  75 -24.174   2.261   7.437
  603    HD3  ARG  75           2HD      ARG  75 -22.860   2.327   6.264
  604   HH11  ARG  75          1HH1      ARG  75 -24.384   1.650   9.317
  605   HH12  ARG  75          2HH1      ARG  75 -24.451   0.220  10.294
  606   HH21  ARG  75          1HH2      ARG  75 -22.172  -1.569   8.336
  607   HH22  ARG  75          2HH2      ARG  75 -23.191  -1.610   9.735
  608    H    GLU  76           H        GLU  76 -19.563   6.410   7.223
  609    HA   GLU  76           HA       GLU  76 -21.572   7.976   8.551
  610    HB2  GLU  76           1HB      GLU  76 -18.627   8.210   8.111
  611    HB3  GLU  76           2HB      GLU  76 -19.525   9.646   8.586
  612    HG2  GLU  76           1HG      GLU  76 -19.685   7.070  10.115
  613    HG3  GLU  76           2HG      GLU  76 -18.460   8.295  10.439
  614    H    LEU  77           H        LEU  77 -19.444   8.557   5.749
  615    HA   LEU  77           HA       LEU  77 -20.649  10.986   4.988
  616    HG   LEU  77           HG       LEU  77 -19.127   7.867   3.820
  617    HB2  LEU  77           1HB      LEU  77 -19.511  10.640   2.832
  618    HB3  LEU  77           2HB      LEU  77 -18.448  10.414   4.220
  619   HD11  LEU  77          1HD1      LEU  77 -18.934   8.674   0.980
  620   HD12  LEU  77          2HD1      LEU  77 -20.495   8.885   1.772
  621   HD13  LEU  77          3HD1      LEU  77 -19.742   7.291   1.718
  622   HD21  LEU  77          3HD2      LEU  77 -16.928   9.580   3.088
  623   HD22  LEU  77          1HD2      LEU  77 -17.108   8.257   1.935
  624   HD23  LEU  77          2HD2      LEU  77 -16.912   7.909   3.653
  625    H    LYS  78           H        LYS  78 -21.530   7.683   4.466
  626    HA   LYS  78           HA       LYS  78 -23.176   8.026   2.191
  627    HB2  LYS  78           1HB      LYS  78 -22.779   5.933   4.256
  628    HB3  LYS  78           2HB      LYS  78 -24.309   5.900   3.388
  629    HG2  LYS  78           1HG      LYS  78 -21.665   6.004   1.971
  630    HG3  LYS  78           2HG      LYS  78 -22.426   4.486   2.456
  631    HD2  LYS  78           1HD      LYS  78 -24.308   4.886   1.064
  632    HD3  LYS  78           2HD      LYS  78 -23.826   6.561   0.780
  633    HE2  LYS  78           1HE      LYS  78 -23.041   5.673  -1.151
  634    HE3  LYS  78           2HE      LYS  78 -21.639   5.332  -0.138
  635    HZ1  LYS  78           3HZ      LYS  78 -23.730   3.487  -1.084
  636    HZ2  LYS  78           1HZ      LYS  78 -22.865   3.131   0.326
  637    HZ3  LYS  78           2HZ      LYS  78 -22.048   3.316  -1.143
  638    H    ARG  79           H        ARG  79 -23.539   9.041   5.394
  639    HA   ARG  79           HA       ARG  79 -26.227   8.790   5.946
  640    HE   ARG  79           HE       ARG  79 -25.111   9.894   9.678
  641    HB2  ARG  79           1HB      ARG  79 -24.526   9.755   7.479
  642    HB3  ARG  79           2HB      ARG  79 -24.526  11.223   6.511
  643    HG2  ARG  79           1HG      ARG  79 -25.918  11.736   8.295
  644    HG3  ARG  79           2HG      ARG  79 -27.042  11.310   7.003
  645    HD2  ARG  79           1HD      ARG  79 -27.826  10.220   8.949
  646    HD3  ARG  79           2HD      ARG  79 -27.064   8.975   7.958
  647   HH11  ARG  79          1HH1      ARG  79 -28.226   8.363   9.940
  648   HH12  ARG  79          2HH1      ARG  79 -27.850   7.553  11.425
  649   HH21  ARG  79          1HH2      ARG  79 -24.602   8.832  11.633
  650   HH22  ARG  79          2HH2      ARG  79 -25.787   7.821  12.387
  651    H    THR  80           H        THR  80 -24.625  11.325   4.045
  652    HA   THR  80           HA       THR  80 -27.017  11.722   2.484
  653    HB   THR  80           HB       THR  80 -26.712  14.324   2.988
  654    HG1  THR  80           1HG      THR  80 -25.958  13.005   5.401
  655   HG21  THR  80          3HG2      THR  80 -28.716  12.676   3.296
  656   HG22  THR  80          1HG2      THR  80 -28.727  14.234   4.122
  657   HG23  THR  80          2HG2      THR  80 -28.285  12.771   5.003
  658    H    ASP  81           H        ASP  81 -26.659  12.957   0.587
  659    HA   ASP  81           HA       ASP  81 -24.312  14.336  -0.041
  660    HB2  ASP  81           1HB      ASP  81 -23.050  12.342   0.079
  661    HB3  ASP  81           2HB      ASP  81 -24.298  11.406  -0.739
  662    H    LEU  82           H        LEU  82 -24.820  15.593  -1.708
  663    HA   LEU  82           HA       LEU  82 -26.258  14.591  -3.991
  664    HG   LEU  82           HG       LEU  82 -28.475  14.794  -4.564
  665    HB2  LEU  82           1HB      LEU  82 -27.909  15.302  -2.065
  666    HB3  LEU  82           2HB      LEU  82 -27.563  16.921  -2.671
  667   HD11  LEU  82          1HD1      LEU  82 -30.206  16.364  -2.667
  668   HD12  LEU  82          2HD1      LEU  82 -30.120  14.612  -2.861
  669   HD13  LEU  82          3HD1      LEU  82 -30.809  15.608  -4.142
  670   HD21  LEU  82          3HD2      LEU  82 -27.734  16.841  -5.551
  671   HD22  LEU  82          1HD2      LEU  82 -28.703  17.796  -4.428
  672   HD23  LEU  82          2HD2      LEU  82 -29.495  16.799  -5.649
  673    H    ASN  83           H        ASN  83 -24.562  15.280  -5.245
  674    HA   ASN  83           HA       ASN  83 -24.596  17.900  -6.211
  675    HB2  ASN  83           1HB      ASN  83 -22.968  17.530  -3.843
  676    HB3  ASN  83           2HB      ASN  83 -21.982  18.033  -5.213
  677   HD21  ASN  83          1HD2      ASN  83 -23.188  19.813  -6.555
  678   HD22  ASN  83          2HD2      ASN  83 -23.770  21.138  -5.611
  679    H    ILE  84           H        ILE  84 -23.018  18.271  -7.885
  680    HA   ILE  84           HA       ILE  84 -22.453  15.991  -9.416
  681    HB   ILE  84           HB       ILE  84 -21.193  18.727  -9.646
  682   HG12  ILE  84          1HG1      ILE  84 -23.583  17.597 -11.113
  683   HG13  ILE  84          2HG1      ILE  84 -23.699  18.677  -9.729
  684   HG21  ILE  84          1HG2      ILE  84 -20.845  18.076 -12.012
  685   HG22  ILE  84          2HG2      ILE  84 -19.918  17.100 -10.874
  686   HG23  ILE  84          3HG2      ILE  84 -21.384  16.446 -11.607
  687   HD11  ILE  84          3HD1      ILE  84 -23.986  19.864 -11.835
  688   HD12  ILE  84          1HD1      ILE  84 -22.550  20.417 -10.974
  689   HD13  ILE  84          2HD1      ILE  84 -22.387  19.332 -12.356
  690    H    LEU  85           H        LEU  85 -20.171  18.158  -7.730
  691    HA   LEU  85           HA       LEU  85 -17.898  16.562  -8.181
  692    HG   LEU  85           HG       LEU  85 -15.860  17.564  -7.379
  693    HB2  LEU  85           1HB      LEU  85 -18.003  18.995  -7.464
  694    HB3  LEU  85           2HB      LEU  85 -18.290  18.397  -5.831
  695   HD11  LEU  85          1HD1      LEU  85 -14.623  19.399  -6.516
  696   HD12  LEU  85          2HD1      LEU  85 -15.997  19.961  -5.563
  697   HD13  LEU  85          3HD1      LEU  85 -16.042  20.065  -7.323
  698   HD21  LEU  85          3HD2      LEU  85 -16.804  17.475  -4.560
  699   HD22  LEU  85          1HD2      LEU  85 -15.075  17.647  -4.863
  700   HD23  LEU  85          2HD2      LEU  85 -15.949  16.257  -5.508
  701    H    GLU  86           H        GLU  86 -20.051  16.817  -5.362
  702    HA   GLU  86           HA       GLU  86 -18.733  15.004  -3.703
  703    HB2  GLU  86           1HB      GLU  86 -21.709  15.516  -3.866
  704    HB3  GLU  86           2HB      GLU  86 -20.857  14.795  -2.508
  705    HG2  GLU  86           1HG      GLU  86 -20.377  17.584  -3.527
  706    HG3  GLU  86           2HG      GLU  86 -21.444  17.178  -2.184
  707    H    ARG  87           H        ARG  87 -21.203  14.462  -6.176
  708    HA   ARG  87           HA       ARG  87 -21.572  11.708  -5.678
  709    HE   ARG  87           HE       ARG  87 -24.929  11.399  -6.775
  710    HB2  ARG  87           1HB      ARG  87 -23.175  13.032  -6.969
  711    HB3  ARG  87           2HB      ARG  87 -21.973  13.279  -8.230
  712    HG2  ARG  87           1HG      ARG  87 -22.108  11.090  -8.970
  713    HG3  ARG  87           2HG      ARG  87 -22.795  10.515  -7.449
  714    HD2  ARG  87           1HD      ARG  87 -24.215  12.370  -9.352
  715    HD3  ARG  87           2HD      ARG  87 -24.412  10.618  -9.352
  716   HH11  ARG  87          1HH1      ARG  87 -26.213  12.158  -9.920
  717   HH12  ARG  87          2HH1      ARG  87 -27.810  12.486  -9.334
  718   HH21  ARG  87          1HH2      ARG  87 -27.027  11.827  -5.990
  719   HH22  ARG  87          2HH2      ARG  87 -28.271  12.298  -7.098
  720    H    PHE  88           H        PHE  88 -19.490  13.447  -7.968
  721    HA   PHE  88           HA       PHE  88 -18.409  11.201  -9.249
  722    HD1  PHE  88           1HD      PHE  88 -16.957  11.261 -11.346
  723    HD2  PHE  88           2HD      PHE  88 -15.000  14.095  -8.844
  724    HE1  PHE  88           1HE      PHE  88 -14.791  10.630 -12.329
  725    HE2  PHE  88           2HE      PHE  88 -12.832  13.468  -9.823
  726    HZ   PHE  88           HZ       PHE  88 -12.725  11.734 -11.569
  727    HB2  PHE  88           1HB      PHE  88 -18.114  13.363 -10.238
  728    HB3  PHE  88           2HB      PHE  88 -17.292  13.971  -8.806
  729    H    ASN  89           H        ASN  89 -17.012  13.166  -6.620
  730    HA   ASN  89           HA       ASN  89 -14.752  11.605  -6.168
  731    HB2  ASN  89           1HB      ASN  89 -16.355  13.355  -4.300
  732    HB3  ASN  89           2HB      ASN  89 -14.835  12.600  -3.833
  733   HD21  ASN  89          1HD2      ASN  89 -14.051  14.747  -3.499
  734   HD22  ASN  89          2HD2      ASN  89 -13.500  15.688  -4.838
  735    H    TYR  90           H        TYR  90 -17.994  11.361  -4.768
  736    HA   TYR  90           HA       TYR  90 -17.411   9.292  -2.942
  737    HD1  TYR  90           2HD      TYR  90 -17.885  11.832  -2.495
  738    HD2  TYR  90           1HD      TYR  90 -21.175   9.393  -1.342
  739    HE1  TYR  90           2HE      TYR  90 -18.011  13.027  -0.348
  740    HE2  TYR  90           1HE      TYR  90 -21.311  10.582   0.808
  741    HH   TYR  90           HH       TYR  90 -19.746  13.488   1.401
  742    HB2  TYR  90           1HB      TYR  90 -19.903  10.418  -4.142
  743    HB3  TYR  90           2HB      TYR  90 -20.001   8.878  -3.295
  744    H    GLU  91           H        GLU  91 -18.767   9.223  -6.227
  745    HA   GLU  91           HA       GLU  91 -19.215   6.500  -6.462
  746    HB2  GLU  91           1HB      GLU  91 -18.556   8.658  -8.427
  747    HB3  GLU  91           2HB      GLU  91 -18.598   6.987  -8.973
  748    HG2  GLU  91           1HG      GLU  91 -20.883   8.246  -7.493
  749    HG3  GLU  91           2HG      GLU  91 -20.717   8.351  -9.244
  750    H    GLU  92           H        GLU  92 -16.285   8.291  -7.426
  751    HA   GLU  92           HA       GLU  92 -14.784   6.028  -8.150
  752    HB2  GLU  92           1HB      GLU  92 -14.335   8.527  -8.626
  753    HB3  GLU  92           2HB      GLU  92 -13.550   8.541  -7.052
  754    HG2  GLU  92           1HG      GLU  92 -11.962   6.888  -7.769
  755    HG3  GLU  92           2HG      GLU  92 -12.801   6.695  -9.307
  756    H    ALA  93           H        ALA  93 -15.144   7.731  -5.083
  757    HA   ALA  93           HA       ALA  93 -13.113   6.541  -3.618
  758    HB1  ALA  93           3HB      ALA  93 -14.561   6.988  -1.627
  759    HB2  ALA  93           1HB      ALA  93 -14.324   8.374  -2.691
  760    HB3  ALA  93           2HB      ALA  93 -15.839   7.473  -2.740
  761    H    GLN  94           H        GLN  94 -16.523   5.495  -3.784
  762    HA   GLN  94           HA       GLN  94 -16.130   3.107  -2.341
  763    HB2  GLN  94           1HB      GLN  94 -18.336   2.445  -3.239
  764    HB3  GLN  94           2HB      GLN  94 -18.339   4.075  -2.580
  765    HG2  GLN  94           1HG      GLN  94 -18.190   4.999  -4.823
  766    HG3  GLN  94           2HG      GLN  94 -18.143   3.372  -5.499
  767   HE21  GLN  94          1HE2      GLN  94 -19.995   2.722  -6.296
  768   HE22  GLN  94          2HE2      GLN  94 -21.567   3.177  -5.740
  769    H    THR  95           H        THR  95 -15.978   3.860  -5.775
  770    HA   THR  95           HA       THR  95 -15.909   1.268  -6.806
  771    HB   THR  95           HB       THR  95 -14.502   3.731  -7.855
  772    HG1  THR  95           1HG      THR  95 -16.373   4.132  -8.907
  773   HG21  THR  95          3HG2      THR  95 -14.750   0.970  -8.871
  774   HG22  THR  95          1HG2      THR  95 -13.522   2.192  -9.198
  775   HG23  THR  95          2HG2      THR  95 -15.071   2.252 -10.039
  776    H    LEU  96           H        LEU  96 -13.188   3.389  -5.909
  777    HA   LEU  96           HA       LEU  96 -11.178   1.473  -6.430
  778    HG   LEU  96           HG       LEU  96 -11.360   4.460  -7.070
  779    HB2  LEU  96           1HB      LEU  96 -11.198   3.923  -4.680
  780    HB3  LEU  96           2HB      LEU  96  -9.757   2.962  -4.999
  781   HD11  LEU  96          1HD1      LEU  96 -10.228   6.054  -5.738
  782   HD12  LEU  96          2HD1      LEU  96  -9.253   5.835  -7.190
  783   HD13  LEU  96          3HD1      LEU  96  -8.765   5.071  -5.678
  784   HD21  LEU  96          3HD2      LEU  96  -9.254   2.432  -7.227
  785   HD22  LEU  96          1HD2      LEU  96  -8.925   3.894  -8.157
  786   HD23  LEU  96          2HD2      LEU  96 -10.403   2.977  -8.450
  787    H    SER  97           H        SER  97 -12.950   2.352  -3.502
  788    HA   SER  97           HA       SER  97 -11.482   0.802  -1.682
  789    HG   SER  97           HG       SER  97 -14.801   0.261  -0.549
  790    HB2  SER  97           1HB      SER  97 -13.054   1.427  -0.148
  791    HB3  SER  97           2HB      SER  97 -13.501   2.567  -1.417
  792    H    LYS  98           H        LYS  98 -14.294   0.019  -3.681
  793    HA   LYS  98           HA       LYS  98 -14.715  -2.576  -2.639
  794    HB2  LYS  98           1HB      LYS  98 -15.449  -1.369  -5.311
  795    HB3  LYS  98           2HB      LYS  98 -16.004  -2.943  -4.756
  796    HG2  LYS  98           1HG      LYS  98 -16.565  -1.028  -2.730
  797    HG3  LYS  98           2HG      LYS  98 -17.147  -0.406  -4.276
  798    HD2  LYS  98           1HD      LYS  98 -18.963  -1.658  -3.855
  799    HD3  LYS  98           2HD      LYS  98 -17.955  -3.006  -4.392
  800    HE2  LYS  98           1HE      LYS  98 -17.401  -3.589  -2.159
  801    HE3  LYS  98           2HE      LYS  98 -18.079  -2.090  -1.528
  802    HZ1  LYS  98           3HZ      LYS  98 -20.263  -2.826  -2.037
  803    HZ2  LYS  98           1HZ      LYS  98 -19.499  -4.089  -1.212
  804    HZ3  LYS  98           2HZ      LYS  98 -19.693  -4.172  -2.889
  805    H    ILE  99           H        ILE  99 -13.038  -1.457  -5.573
  806    HA   ILE  99           HA       ILE  99 -12.232  -3.943  -6.531
  807    HB   ILE  99           HB       ILE  99 -10.764  -1.313  -6.760
  808   HG12  ILE  99          1HG1      ILE  99 -12.489  -2.540  -8.886
  809   HG13  ILE  99          2HG1      ILE  99 -13.227  -1.600  -7.593
  810   HG21  ILE  99          1HG2      ILE  99 -10.240  -2.777  -9.026
  811   HG22  ILE  99          2HG2      ILE  99  -9.146  -2.559  -7.661
  812   HG23  ILE  99          3HG2      ILE  99 -10.176  -3.988  -7.746
  813   HD11  ILE  99          3HD1      ILE  99 -12.864  -0.214  -9.526
  814   HD12  ILE  99          1HD1      ILE  99 -11.811   0.310  -8.211
  815   HD13  ILE  99          2HD1      ILE  99 -11.152  -0.637  -9.546
  816    H    LEU 100           H        LEU 100 -10.457  -1.693  -4.417
  817    HA   LEU 100           HA       LEU 100  -8.175  -3.279  -4.072
  818    HG   LEU 100           HG       LEU 100  -6.924  -0.816  -1.637
  819    HB2  LEU 100           1HB      LEU 100  -8.340  -0.893  -3.474
  820    HB3  LEU 100           2HB      LEU 100  -9.389  -1.322  -2.125
  821   HD11  LEU 100          1HD1      LEU 100  -8.752  -2.167  -0.274
  822   HD12  LEU 100          2HD1      LEU 100  -7.082  -2.037   0.276
  823   HD13  LEU 100          3HD1      LEU 100  -7.623  -3.491  -0.562
  824   HD21  LEU 100          3HD2      LEU 100  -6.635  -3.633  -2.678
  825   HD22  LEU 100          1HD2      LEU 100  -5.384  -2.667  -1.897
  826   HD23  LEU 100          2HD2      LEU 100  -6.015  -2.184  -3.471
  827    H    LEU 101           H        LEU 101 -11.169  -3.092  -2.183
  828    HA   LEU 101           HA       LEU 101 -10.476  -4.790  -0.096
  829    HG   LEU 101           HG       LEU 101 -12.121  -2.649   0.552
  830    HB2  LEU 101           1HB      LEU 101 -13.000  -3.913  -1.358
  831    HB3  LEU 101           2HB      LEU 101 -13.084  -5.361  -0.357
  832   HD11  LEU 101          1HD1      LEU 101 -14.168  -2.291   1.525
  833   HD12  LEU 101          2HD1      LEU 101 -14.572  -4.007   1.567
  834   HD13  LEU 101          3HD1      LEU 101 -14.642  -3.122   0.043
  835   HD21  LEU 101          3HD2      LEU 101 -12.197  -5.340   1.822
  836   HD22  LEU 101          1HD2      LEU 101 -12.521  -3.921   2.818
  837   HD23  LEU 101          2HD2      LEU 101 -10.989  -4.062   1.955
  838    H    LYS 102           H        LYS 102 -11.945  -5.581  -3.232
  839    HA   LYS 102           HA       LYS 102 -12.202  -8.344  -2.804
  840    HB2  LYS 102           1HB      LYS 102 -11.914  -6.710  -5.324
  841    HB3  LYS 102           2HB      LYS 102 -12.171  -8.450  -5.348
  842    HG2  LYS 102           1HG      LYS 102 -14.272  -8.124  -4.095
  843    HG3  LYS 102           2HG      LYS 102 -14.022  -6.379  -4.185
  844    HD2  LYS 102           1HD      LYS 102 -14.132  -8.134  -6.627
  845    HD3  LYS 102           2HD      LYS 102 -15.571  -7.392  -5.922
  846    HE2  LYS 102           1HE      LYS 102 -14.517  -5.177  -6.186
  847    HE3  LYS 102           2HE      LYS 102 -13.131  -5.948  -6.955
  848    HZ1  LYS 102           3HZ      LYS 102 -14.796  -6.860  -8.604
  849    HZ2  LYS 102           1HZ      LYS 102 -14.481  -5.199  -8.695
  850    HZ3  LYS 102           2HZ      LYS 102 -15.904  -5.753  -7.965
  851    H    ASP 103           H        ASP 103  -9.672  -6.563  -4.579
  852    HA   ASP 103           HA       ASP 103  -8.022  -8.709  -5.171
  853    HB2  ASP 103           1HB      ASP 103  -7.592  -5.778  -4.830
  854    HB3  ASP 103           2HB      ASP 103  -6.171  -6.816  -4.915
  855    H    LEU 104           H        LEU 104  -8.000  -6.623  -2.296
  856    HA   LEU 104           HA       LEU 104  -5.792  -7.739  -1.013
  857    HG   LEU 104           HG       LEU 104  -6.396  -7.437   1.906
  858    HB2  LEU 104           1HB      LEU 104  -7.152  -5.660  -0.411
  859    HB3  LEU 104           2HB      LEU 104  -8.233  -6.762   0.439
  860   HD11  LEU 104          1HD1      LEU 104  -4.807  -5.464   0.278
  861   HD12  LEU 104          2HD1      LEU 104  -4.501  -7.189   0.484
  862   HD13  LEU 104          3HD1      LEU 104  -4.293  -6.087   1.846
  863   HD21  LEU 104          3HD2      LEU 104  -6.749  -4.445   1.737
  864   HD22  LEU 104          1HD2      LEU 104  -6.182  -5.345   3.144
  865   HD23  LEU 104          2HD2      LEU 104  -7.831  -5.570   2.560
  866    H    LYS 105           H        LYS 105  -9.237  -8.555  -0.633
  867    HA   LYS 105           HA       LYS 105  -8.960 -10.601   1.225
  868    HB2  LYS 105           1HB      LYS 105 -10.989  -9.964  -0.877
  869    HB3  LYS 105           2HB      LYS 105 -11.091 -11.507  -0.040
  870    HG2  LYS 105           1HG      LYS 105 -11.578 -10.530   1.987
  871    HG3  LYS 105           2HG      LYS 105 -10.846  -8.988   1.538
  872    HD2  LYS 105           1HD      LYS 105 -12.686  -8.350   0.256
  873    HD3  LYS 105           2HD      LYS 105 -13.278 -10.007   0.113
  874    HE2  LYS 105           1HE      LYS 105 -13.923 -10.023   2.435
  875    HE3  LYS 105           2HE      LYS 105 -13.200  -8.434   2.685
  876    HZ1  LYS 105           3HZ      LYS 105 -15.288  -8.732   0.644
  877    HZ2  LYS 105           1HZ      LYS 105 -14.897  -7.388   1.596
  878    HZ3  LYS 105           2HZ      LYS 105 -15.747  -8.685   2.272
  879    H    GLU 106           H        GLU 106  -8.666 -10.685  -2.289
  880    HA   GLU 106           HA       GLU 106  -8.496 -13.491  -2.555
  881    HB2  GLU 106           1HB      GLU 106  -7.836 -11.144  -4.260
  882    HB3  GLU 106           2HB      GLU 106  -7.116 -12.687  -4.696
  883    HG2  GLU 106           1HG      GLU 106  -9.315 -12.071  -5.801
  884    HG3  GLU 106           2HG      GLU 106  -9.190 -13.680  -5.092
  885    H    THR 107           H        THR 107  -6.029 -10.981  -2.164
  886    HA   THR 107           HA       THR 107  -3.773 -12.623  -2.450
  887    HB   THR 107           HB       THR 107  -3.146 -10.614  -0.551
  888    HG1  THR 107           1HG      THR 107  -4.619  -9.496  -2.697
  889   HG21  THR 107          3HG2      THR 107  -2.373  -9.572  -2.931
  890   HG22  THR 107          1HG2      THR 107  -2.589 -11.267  -3.367
  891   HG23  THR 107          2HG2      THR 107  -1.484 -10.824  -2.065
  892    H    GLU 108           H        GLU 108  -5.392 -11.503   0.526
  893    HA   GLU 108           HA       GLU 108  -3.803 -12.932   2.328
  894    HB2  GLU 108           1HB      GLU 108  -5.684 -12.647   3.916
  895    HB3  GLU 108           2HB      GLU 108  -5.256 -11.157   3.087
  896    HG2  GLU 108           1HG      GLU 108  -7.137 -11.540   1.525
  897    HG3  GLU 108           2HG      GLU 108  -7.595 -12.948   2.480
  898    H    GLN 109           H        GLN 109  -6.801 -13.839   0.678
  899    HA   GLN 109           HA       GLN 109  -7.270 -16.267   1.967
  900    HB2  GLN 109           1HB      GLN 109  -8.776 -15.024   0.327
  901    HB3  GLN 109           2HB      GLN 109  -7.830 -15.772  -0.953
  902    HG2  GLN 109           1HG      GLN 109  -8.955 -17.547   1.133
  903    HG3  GLN 109           2HG      GLN 109 -10.071 -16.837  -0.032
  904   HE21  GLN 109          1HE2      GLN 109  -7.823 -19.283   0.558
  905   HE22  GLN 109          2HE2      GLN 109  -7.742 -19.936  -1.039
  906    H    LYS 110           H        LYS 110  -5.492 -15.649  -1.055
  907    HA   LYS 110           HA       LYS 110  -4.734 -18.283  -1.578
  908    HB2  LYS 110           1HB      LYS 110  -3.446 -15.648  -2.275
  909    HB3  LYS 110           2HB      LYS 110  -2.802 -17.187  -2.835
  910    HG2  LYS 110           1HG      LYS 110  -5.046 -17.641  -3.859
  911    HG3  LYS 110           2HG      LYS 110  -5.480 -15.975  -3.470
  912    HD2  LYS 110           1HD      LYS 110  -3.194 -15.480  -4.714
  913    HD3  LYS 110           2HD      LYS 110  -3.559 -17.026  -5.483
  914    HE2  LYS 110           1HE      LYS 110  -4.646 -15.637  -6.924
  915    HE3  LYS 110           2HE      LYS 110  -5.942 -15.902  -5.759
  916    HZ1  LYS 110           3HZ      LYS 110  -5.625 -13.547  -6.358
  917    HZ2  LYS 110           1HZ      LYS 110  -4.072 -13.597  -5.686
  918    HZ3  LYS 110           2HZ      LYS 110  -5.427 -13.832  -4.702
  919    H    VAL 111           H        VAL 111  -2.992 -15.737   0.193
  920    HA   VAL 111           HA       VAL 111  -0.678 -17.152   0.793
  921    HB   VAL 111           HB       VAL 111  -2.073 -15.084   2.498
  922   HG11  VAL 111          1HG1      VAL 111   0.187 -14.701   3.446
  923   HG12  VAL 111          2HG1      VAL 111  -0.471 -16.293   3.830
  924   HG13  VAL 111          3HG1      VAL 111   0.757 -16.124   2.574
  925   HG21  VAL 111          3HG2      VAL 111  -1.314 -14.602   0.040
  926   HG22  VAL 111          1HG2      VAL 111  -0.969 -13.440   1.323
  927   HG23  VAL 111          2HG2      VAL 111   0.294 -14.536   0.763
  928    H    LYS 112           H        LYS 112  -3.772 -17.057   2.506
  929    HA   LYS 112           HA       LYS 112  -2.907 -18.697   4.675
  930    HB2  LYS 112           1HB      LYS 112  -5.673 -17.991   3.682
  931    HB3  LYS 112           2HB      LYS 112  -5.353 -18.877   5.168
  932    HG2  LYS 112           1HG      LYS 112  -4.601 -17.035   6.272
  933    HG3  LYS 112           2HG      LYS 112  -4.005 -16.260   4.803
  934    HD2  LYS 112           1HD      LYS 112  -5.934 -15.065   5.688
  935    HD3  LYS 112           2HD      LYS 112  -6.312 -15.787   4.122
  936    HE2  LYS 112           1HE      LYS 112  -7.907 -17.092   4.994
  937    HE3  LYS 112           2HE      LYS 112  -6.896 -17.555   6.362
  938    HZ1  LYS 112           3HZ      LYS 112  -8.658 -15.196   6.102
  939    HZ2  LYS 112           1HZ      LYS 112  -7.430 -15.260   7.264
  940    HZ3  LYS 112           2HZ      LYS 112  -8.679 -16.400   7.290
  941    H    ASP 113           H        ASP 113  -4.254 -19.299   1.520
  942    HA   ASP 113           HA       ASP 113  -5.092 -21.970   1.962
  943    HB2  ASP 113           1HB      ASP 113  -5.920 -20.701   0.060
  944    HB3  ASP 113           2HB      ASP 113  -4.290 -20.558  -0.590
  945    H    ILE 114           H        ILE 114  -2.103 -20.576   0.648
  946    HA   ILE 114           HA       ILE 114  -0.796 -22.945  -0.004
  947    HB   ILE 114           HB       ILE 114   0.194 -20.229   0.781
  948   HG12  ILE 114          1HG1      ILE 114   1.265 -20.954  -1.654
  949   HG13  ILE 114          2HG1      ILE 114  -0.304 -21.751  -1.671
  950   HG21  ILE 114          1HG2      ILE 114   2.485 -21.231  -0.001
  951   HG22  ILE 114          2HG2      ILE 114   1.968 -21.374   1.678
  952   HG23  ILE 114          3HG2      ILE 114   1.783 -22.741   0.580
  953   HD11  ILE 114          3HD1      ILE 114  -1.442 -19.802  -1.773
  954   HD12  ILE 114          1HD1      ILE 114  -0.247 -18.922  -0.821
  955   HD13  ILE 114          2HD1      ILE 114   0.060 -19.264  -2.523
  956    H    GLN 115           H        GLN 115   0.093 -24.533   1.147
  957    HA   GLN 115           HA       GLN 115   0.054 -24.343   4.051
  958    HB2  GLN 115           1HB      GLN 115   0.592 -26.781   3.950
  959    HB3  GLN 115           2HB      GLN 115  -0.904 -26.343   3.135
  960    HG2  GLN 115           1HG      GLN 115   1.129 -26.188   1.203
  961    HG3  GLN 115           2HG      GLN 115   1.397 -27.682   2.101
  962   HE21  GLN 115          1HE2      GLN 115   0.066 -26.606  -0.587
  963   HE22  GLN 115          2HE2      GLN 115  -1.280 -27.677  -0.749
  964    H    THR 116           H        THR 116   1.811 -24.260   5.334
  965    HA   THR 116           HA       THR 116   4.454 -24.797   4.231
  966    HB   THR 116           HB       THR 116   5.361 -22.654   5.117
  967    HG1  THR 116           1HG      THR 116   3.188 -22.402   6.366
  968   HG21  THR 116          3HG2      THR 116   3.219 -22.018   3.116
  969   HG22  THR 116          1HG2      THR 116   4.567 -23.073   2.695
  970   HG23  THR 116          2HG2      THR 116   4.871 -21.411   3.203
  971    H    GLN 117           H        GLN 117   6.155 -24.429   6.042
  972    HA   GLN 117           HA       GLN 117   5.049 -25.583   8.512
  973    HB2  GLN 117           1HB      GLN 117   7.754 -25.857   7.210
  974    HB3  GLN 117           2HB      GLN 117   7.447 -26.361   8.867
  975    HG2  GLN 117           1HG      GLN 117   5.770 -27.382   6.610
  976    HG3  GLN 117           2HG      GLN 117   7.326 -28.114   6.998
  977   HE21  GLN 117          1HE2      GLN 117   6.878 -29.977   7.948
  978   HE22  GLN 117          2HE2      GLN 117   5.797 -30.197   9.277
  Start of MODEL    6
    1    H    GLN   1           H        GLN   1 -18.609  13.233 -17.905
    2    HA   GLN   1           HA       GLN   1 -16.085  12.716 -19.334
    3    HB2  GLN   1           1HB      GLN   1 -16.146  15.050 -20.100
    4    HB3  GLN   1           2HB      GLN   1 -17.545  14.145 -20.661
    5    HG2  GLN   1           1HG      GLN   1 -17.778  15.693 -18.136
    6    HG3  GLN   1           2HG      GLN   1 -17.781  16.564 -19.669
    7   HE21  GLN   1          1HE2      GLN   1 -19.214  15.246 -21.355
    8   HE22  GLN   1          2HE2      GLN   1 -20.810  14.915 -20.781
    9    H    GLU   2           H        GLU   2 -14.224  13.846 -18.613
   10    HA   GLU   2           HA       GLU   2 -14.379  15.348 -16.137
   11    HB2  GLU   2           1HB      GLU   2 -12.659  13.871 -15.047
   12    HB3  GLU   2           2HB      GLU   2 -14.260  13.160 -15.202
   13    HG2  GLU   2           1HG      GLU   2 -13.426  12.028 -17.293
   14    HG3  GLU   2           2HG      GLU   2 -11.810  12.563 -16.832
   15    H    HIS   3           H        HIS   3 -12.918  16.933 -16.139
   16    HA   HIS   3           HA       HIS   3 -11.153  17.286 -18.332
   17    HD1  HIS   3           1HD      HIS   3 -13.371  20.221 -15.663
   18    HD2  HIS   3           2HD      HIS   3 -12.216  19.310 -19.548
   19    HE1  HIS   3           1HE      HIS   3 -15.072  21.328 -17.148
   20    HB2  HIS   3           1HB      HIS   3 -11.390  18.760 -15.704
   21    HB3  HIS   3           2HB      HIS   3 -10.343  19.269 -17.025
   22    H    LYS   4           H        LYS   4  -8.809  17.670 -18.132
   23    HA   LYS   4           HA       LYS   4  -7.480  15.436 -17.084
   24    HB2  LYS   4           1HB      LYS   4  -6.649  18.028 -18.288
   25    HB3  LYS   4           2HB      LYS   4  -5.430  17.120 -17.402
   26    HG2  LYS   4           1HG      LYS   4  -5.586  15.285 -18.864
   27    HG3  LYS   4           2HG      LYS   4  -7.087  15.880 -19.577
   28    HD2  LYS   4           1HD      LYS   4  -6.009  17.478 -20.842
   29    HD3  LYS   4           2HD      LYS   4  -4.620  17.554 -19.754
   30    HE2  LYS   4           1HE      LYS   4  -4.003  16.485 -21.846
   31    HE3  LYS   4           2HE      LYS   4  -3.917  15.331 -20.517
   32    HZ1  LYS   4           3HZ      LYS   4  -5.362  15.105 -22.886
   33    HZ2  LYS   4           1HZ      LYS   4  -6.494  15.253 -21.636
   34    HZ3  LYS   4           2HZ      LYS   4  -5.331  14.026 -21.583
   35    HA   PRO   5           HA       PRO   5  -6.554  16.394 -12.904
   36    HB2  PRO   5           1HB      PRO   5  -4.001  15.507 -12.648
   37    HB3  PRO   5           2HB      PRO   5  -5.384  14.419 -12.807
   38    HG2  PRO   5           1HG      PRO   5  -3.433  15.318 -14.891
   39    HG3  PRO   5           2HG      PRO   5  -4.095  13.699 -14.603
   40    HD2  PRO   5           1HD      PRO   5  -5.028  15.326 -16.555
   41    HD3  PRO   5           2HD      PRO   5  -6.068  14.172 -15.696
   42    H    LYS   6           H        LYS   6  -6.520  18.575 -12.585
   43    HA   LYS   6           HA       LYS   6  -3.987  19.978 -13.135
   44    HB2  LYS   6           1HB      LYS   6  -6.254  20.703 -14.236
   45    HB3  LYS   6           2HB      LYS   6  -6.570  21.421 -12.662
   46    HG2  LYS   6           1HG      LYS   6  -4.865  22.966 -12.877
   47    HG3  LYS   6           2HG      LYS   6  -4.011  22.006 -14.086
   48    HD2  LYS   6           1HD      LYS   6  -6.733  23.023 -14.737
   49    HD3  LYS   6           2HD      LYS   6  -5.382  24.158 -14.758
   50    HE2  LYS   6           1HE      LYS   6  -5.181  21.535 -16.184
   51    HE3  LYS   6           2HE      LYS   6  -6.026  22.890 -16.931
   52    HZ1  LYS   6           3HZ      LYS   6  -3.931  24.201 -16.472
   53    HZ2  LYS   6           1HZ      LYS   6  -3.831  23.026 -17.685
   54    HZ3  LYS   6           2HZ      LYS   6  -3.177  22.721 -16.156
   55    H    LYS   7           H        LYS   7  -4.396  18.391 -10.813
   56    HA   LYS   7           HA       LYS   7  -4.189  20.488  -8.767
   57    HB2  LYS   7           1HB      LYS   7  -6.429  19.339  -8.678
   58    HB3  LYS   7           2HB      LYS   7  -5.578  17.845  -8.305
   59    HG2  LYS   7           1HG      LYS   7  -6.253  18.649  -6.231
   60    HG3  LYS   7           2HG      LYS   7  -4.560  19.134  -6.344
   61    HD2  LYS   7           1HD      LYS   7  -5.573  21.069  -5.579
   62    HD3  LYS   7           2HD      LYS   7  -5.530  21.339  -7.322
   63    HE2  LYS   7           1HE      LYS   7  -7.916  20.002  -6.151
   64    HE3  LYS   7           2HE      LYS   7  -7.728  21.738  -5.912
   65    HZ1  LYS   7           3HZ      LYS   7  -7.226  21.495  -8.531
   66    HZ2  LYS   7           1HZ      LYS   7  -8.749  21.855  -7.886
   67    HZ3  LYS   7           2HZ      LYS   7  -8.367  20.265  -8.316
   68    H    ASP   8           H        ASP   8  -2.644  20.157  -7.210
   69    HA   ASP   8           HA       ASP   8  -0.526  18.371  -7.848
   70    HB2  ASP   8           1HB      ASP   8  -1.044  20.163  -5.474
   71    HB3  ASP   8           2HB      ASP   8   0.410  19.180  -5.627
   72    H    ASP   9           H        ASP   9  -0.061  16.391  -7.101
   73    HA   ASP   9           HA       ASP   9  -2.025  14.866  -5.768
   74    HB2  ASP   9           1HB      ASP   9  -0.254  13.993  -7.347
   75    HB3  ASP   9           2HB      ASP   9   0.899  14.159  -6.027
   76    H    PHE  10           H        PHE  10   1.206  15.898  -4.662
   77    HA   PHE  10           HA       PHE  10   0.860  15.016  -2.007
   78    HD1  PHE  10           2HD      PHE  10   3.049  15.229  -4.972
   79    HD2  PHE  10           1HD      PHE  10   3.945  14.675  -0.848
   80    HE1  PHE  10           2HE      PHE  10   4.478  13.310  -5.543
   81    HE2  PHE  10           1HE      PHE  10   5.376  12.755  -1.413
   82    HZ   PHE  10           HZ       PHE  10   5.642  12.069  -3.763
   83    HB2  PHE  10           1HB      PHE  10   2.732  17.040  -3.235
   84    HB3  PHE  10           2HB      PHE  10   2.797  16.588  -1.535
   85    H    ARG  11           H        ARG  11   0.956  16.534  -0.094
   86    HA   ARG  11           HA       ARG  11  -0.543  19.011  -0.490
   87    HE   ARG  11           HE       ARG  11  -5.584  19.516   1.685
   88    HB2  ARG  11           1HB      ARG  11  -2.084  16.995   0.007
   89    HB3  ARG  11           2HB      ARG  11  -1.425  17.076   1.635
   90    HG2  ARG  11           1HG      ARG  11  -2.398  19.135   2.066
   91    HG3  ARG  11           2HG      ARG  11  -2.603  19.506   0.353
   92    HD2  ARG  11           1HD      ARG  11  -4.163  17.406   0.394
   93    HD3  ARG  11           2HD      ARG  11  -4.228  17.735   2.124
   94   HH11  ARG  11          1HH1      ARG  11  -3.920  18.629  -1.241
   95   HH12  ARG  11          2HH1      ARG  11  -4.805  19.737  -2.236
   96   HH21  ARG  11          1HH2      ARG  11  -6.756  20.981   0.385
   97   HH22  ARG  11          2HH2      ARG  11  -6.417  21.075  -1.310
   98    H    ASN  12           H        ASN  12  -0.671  20.288   1.573
   99    HA   ASN  12           HA       ASN  12   1.663  19.767   3.291
  100    HB2  ASN  12           1HB      ASN  12   1.950  22.273   3.398
  101    HB3  ASN  12           2HB      ASN  12   2.322  21.548   1.837
  102   HD21  ASN  12          1HD2      ASN  12   0.986  21.939   0.090
  103   HD22  ASN  12          2HD2      ASN  12  -0.205  23.190   0.095
  104    H    GLU  13           H        GLU  13  -1.195  19.180   3.669
  105    HA   GLU  13           HA       GLU  13  -1.442  20.113   6.342
  106    HB2  GLU  13           1HB      GLU  13  -3.504  21.407   6.100
  107    HB3  GLU  13           2HB      GLU  13  -2.183  22.156   5.214
  108    HG2  GLU  13           1HG      GLU  13  -3.057  21.077   3.144
  109    HG3  GLU  13           2HG      GLU  13  -4.453  20.543   4.079
  110    H    PHE  14           H        PHE  14  -3.633  19.444   7.277
  111    HA   PHE  14           HA       PHE  14  -4.528  16.967   5.953
  112    HD1  PHE  14           1HD      PHE  14  -3.904  14.699   6.452
  113    HD2  PHE  14           2HD      PHE  14  -1.820  17.084   9.294
  114    HE1  PHE  14           1HE      PHE  14  -1.906  13.293   6.161
  115    HE2  PHE  14           2HE      PHE  14   0.182  15.683   9.008
  116    HZ   PHE  14           HZ       PHE  14   0.141  13.785   7.440
  117    HB2  PHE  14           1HB      PHE  14  -4.020  17.543   8.867
  118    HB3  PHE  14           2HB      PHE  14  -5.037  16.201   8.351
  119    H    ASP  15           H        ASP  15  -6.389  17.638   5.014
  120    HA   ASP  15           HA       ASP  15  -8.214  19.464   6.173
  121    HB2  ASP  15           1HB      ASP  15  -8.566  17.439   3.956
  122    HB3  ASP  15           2HB      ASP  15  -9.777  18.643   4.391
  123    H    HIS  16           H        HIS  16  -8.021  15.944   6.134
  124    HA   HIS  16           HA       HIS  16  -9.101  14.335   7.326
  125    HD1  HIS  16           1HD      HIS  16 -11.249  14.885  10.904
  126    HD2  HIS  16           2HD      HIS  16  -7.728  13.183   9.502
  127    HE1  HIS  16           1HE      HIS  16 -10.990  12.732  12.176
  128    HB2  HIS  16           1HB      HIS  16  -8.362  16.088   9.157
  129    HB3  HIS  16           2HB      HIS  16 -10.098  16.358   9.289
  130    H    LEU  17           H        LEU  17 -10.520  15.540   5.205
  131    HA   LEU  17           HA       LEU  17 -13.263  15.822   6.162
  132    HG   LEU  17           HG       LEU  17 -12.356  18.160   5.409
  133    HB2  LEU  17           1HB      LEU  17 -11.856  16.376   3.591
  134    HB3  LEU  17           2HB      LEU  17 -13.601  16.138   3.584
  135   HD11  LEU  17          1HD1      LEU  17 -11.881  18.257   2.725
  136   HD12  LEU  17          2HD1      LEU  17 -11.946  19.655   3.797
  137   HD13  LEU  17          3HD1      LEU  17 -13.371  19.189   2.869
  138   HD21  LEU  17          3HD2      LEU  17 -14.603  17.885   5.908
  139   HD22  LEU  17          1HD2      LEU  17 -15.053  17.637   4.221
  140   HD23  LEU  17          2HD2      LEU  17 -14.619  19.249   4.789
  141    H    LEU  18           H        LEU  18 -14.916  14.772   4.529
  142    HA   LEU  18           HA       LEU  18 -14.805  12.002   4.918
  143    HG   LEU  18           HG       LEU  18 -17.011  14.101   5.371
  144    HB2  LEU  18           1HB      LEU  18 -16.463  13.659   3.028
  145    HB3  LEU  18           2HB      LEU  18 -16.710  11.935   3.292
  146   HD11  LEU  18          1HD1      LEU  18 -19.426  12.889   5.122
  147   HD12  LEU  18          2HD1      LEU  18 -18.852  12.859   3.456
  148   HD13  LEU  18          3HD1      LEU  18 -18.970  14.392   4.320
  149   HD21  LEU  18          3HD2      LEU  18 -17.546  11.136   5.531
  150   HD22  LEU  18          1HD2      LEU  18 -17.897  12.324   6.788
  151   HD23  LEU  18          2HD2      LEU  18 -16.226  11.995   6.328
  152    H    ILE  19           H        ILE  19 -15.012  13.484   1.694
  153    HA   ILE  19           HA       ILE  19 -14.057  11.328   0.263
  154    HB   ILE  19           HB       ILE  19 -13.809  14.269  -0.361
  155   HG12  ILE  19          1HG1      ILE  19 -16.106  13.355  -0.161
  156   HG13  ILE  19          2HG1      ILE  19 -15.733  13.886  -1.798
  157   HG21  ILE  19          1HG2      ILE  19 -13.697  13.128  -2.777
  158   HG22  ILE  19          2HG2      ILE  19 -12.260  13.534  -1.840
  159   HG23  ILE  19          3HG2      ILE  19 -12.878  11.882  -1.835
  160   HD11  ILE  19          3HD1      ILE  19 -16.317  11.901  -2.559
  161   HD12  ILE  19          1HD1      ILE  19 -15.035  11.155  -1.607
  162   HD13  ILE  19          2HD1      ILE  19 -16.645  11.354  -0.915
  163    H    GLU  20           H        GLU  20 -12.226  13.997   1.700
  164    HA   GLU  20           HA       GLU  20  -9.715  13.468   0.670
  165    HB2  GLU  20           1HB      GLU  20 -10.668  14.663   3.242
  166    HB3  GLU  20           2HB      GLU  20  -8.952  14.358   3.020
  167    HG2  GLU  20           1HG      GLU  20  -9.836  16.674   2.439
  168    HG3  GLU  20           2HG      GLU  20  -8.778  15.881   1.274
  169    H    GLN  21           H        GLN  21 -11.060  12.253   3.742
  170    HA   GLN  21           HA       GLN  21  -8.908  10.584   4.390
  171    HB2  GLN  21           1HB      GLN  21 -11.779  10.720   5.202
  172    HB3  GLN  21           2HB      GLN  21 -10.838   9.307   5.662
  173    HG2  GLN  21           1HG      GLN  21 -10.047  12.142   6.285
  174    HG3  GLN  21           2HG      GLN  21 -10.931  11.089   7.388
  175   HE21  GLN  21          1HE2      GLN  21  -9.874   9.386   8.373
  176   HE22  GLN  21          2HE2      GLN  21  -8.153   9.237   8.378
  177    H    ALA  22           H        ALA  22 -11.809   9.999   2.473
  178    HA   ALA  22           HA       ALA  22 -11.530   7.218   2.182
  179    HB1  ALA  22           3HB      ALA  22 -12.970   9.352   0.681
  180    HB2  ALA  22           1HB      ALA  22 -12.829   7.747  -0.037
  181    HB3  ALA  22           2HB      ALA  22 -13.605   7.945   1.534
  182    H    ASN  23           H        ASN  23 -10.373   9.902   0.162
  183    HA   ASN  23           HA       ASN  23  -9.206   8.316  -1.850
  184    HB2  ASN  23           1HB      ASN  23  -9.134  11.145  -1.038
  185    HB3  ASN  23           2HB      ASN  23  -7.684  10.588  -1.870
  186   HD21  ASN  23          1HD2      ASN  23 -11.117  11.100  -2.119
  187   HD22  ASN  23          2HD2      ASN  23 -11.207  11.004  -3.842
  188    H    HIS  24           H        HIS  24  -7.904   9.661   1.151
  189    HA   HIS  24           HA       HIS  24  -5.225   8.882   0.739
  190    HD1  HIS  24           1HD      HIS  24  -3.614  11.005   1.988
  191    HD2  HIS  24           2HD      HIS  24  -4.371   8.036   4.794
  192    HE1  HIS  24           1HE      HIS  24  -1.438  10.653   3.198
  193    HB2  HIS  24           1HB      HIS  24  -6.171  10.525   2.473
  194    HB3  HIS  24           2HB      HIS  24  -6.524   9.101   3.449
  195    H    ALA  25           H        ALA  25  -7.975   7.256   2.239
  196    HA   ALA  25           HA       ALA  25  -6.550   5.040   3.260
  197    HB1  ALA  25           3HB      ALA  25  -8.644   4.054   3.683
  198    HB2  ALA  25           1HB      ALA  25  -8.900   5.790   3.863
  199    HB3  ALA  25           2HB      ALA  25  -9.427   4.968   2.394
  200    H    ILE  26           H        ILE  26  -8.450   5.428   0.271
  201    HA   ILE  26           HA       ILE  26  -7.927   2.853  -0.745
  202    HB   ILE  26           HB       ILE  26  -8.673   3.715  -2.905
  203   HG12  ILE  26          1HG1      ILE  26  -8.629   6.423  -1.555
  204   HG13  ILE  26          2HG1      ILE  26  -7.530   5.893  -2.824
  205   HG21  ILE  26          1HG2      ILE  26 -10.294   4.743  -0.581
  206   HG22  ILE  26          2HG2      ILE  26 -10.899   4.503  -2.219
  207   HG23  ILE  26          3HG2      ILE  26 -10.357   3.120  -1.269
  208   HD11  ILE  26          3HD1      ILE  26  -9.868   5.479  -4.058
  209   HD12  ILE  26          1HD1      ILE  26 -10.323   6.806  -2.990
  210   HD13  ILE  26          2HD1      ILE  26  -8.988   7.005  -4.125
  211    H    GLU  27           H        GLU  27  -6.150   5.862  -0.899
  212    HA   GLU  27           HA       GLU  27  -4.382   5.141  -2.990
  213    HB2  GLU  27           1HB      GLU  27  -4.771   7.471  -2.169
  214    HB3  GLU  27           2HB      GLU  27  -3.864   7.066  -0.719
  215    HG2  GLU  27           1HG      GLU  27  -1.859   7.046  -1.804
  216    HG3  GLU  27           2HG      GLU  27  -2.575   6.599  -3.352
  217    H    LYS  28           H        LYS  28  -3.825   5.281   0.532
  218    HA   LYS  28           HA       LYS  28  -1.314   4.073   0.525
  219    HB2  LYS  28           1HB      LYS  28  -2.265   5.257   2.464
  220    HB3  LYS  28           2HB      LYS  28  -3.427   3.955   2.684
  221    HG2  LYS  28           1HG      LYS  28  -1.502   2.401   3.024
  222    HG3  LYS  28           2HG      LYS  28  -0.441   3.811   3.009
  223    HD2  LYS  28           1HD      LYS  28  -1.706   4.751   4.905
  224    HD3  LYS  28           2HD      LYS  28  -2.706   3.297   4.937
  225    HE2  LYS  28           1HE      LYS  28   0.289   3.335   5.294
  226    HE3  LYS  28           2HE      LYS  28  -0.877   3.285   6.616
  227    HZ1  LYS  28           3HZ      LYS  28  -1.756   1.209   5.448
  228    HZ2  LYS  28           1HZ      LYS  28  -0.290   1.077   6.285
  229    HZ3  LYS  28           2HZ      LYS  28  -0.292   1.209   4.598
  230    H    GLY  29           H        GLY  29  -4.535   2.617   0.856
  231    HA2  GLY  29           1HA      GLY  29  -3.633  -0.034   1.251
  232    HA3  GLY  29           2HA      GLY  29  -5.237   0.435   0.707
  233    H    GLU  30           H        GLU  30  -4.401   1.798  -1.665
  234    HA   GLU  30           HA       GLU  30  -4.316  -0.390  -3.452
  235    HB2  GLU  30           1HB      GLU  30  -5.367   1.740  -4.044
  236    HB3  GLU  30           2HB      GLU  30  -3.806   2.545  -3.964
  237    HG2  GLU  30           1HG      GLU  30  -3.010   1.151  -5.821
  238    HG3  GLU  30           2HG      GLU  30  -4.599   0.396  -5.916
  239    H    HIS  31           H        HIS  31  -1.861   1.840  -2.263
  240    HA   HIS  31           HA       HIS  31   0.204   0.962  -4.013
  241    HD1  HIS  31           1HD      HIS  31   2.905   1.450  -0.944
  242    HD2  HIS  31           2HD      HIS  31   2.342   3.307  -4.618
  243    HE1  HIS  31           1HE      HIS  31   5.212   1.802  -1.880
  244    HB2  HIS  31           1HB      HIS  31   0.181   3.160  -2.805
  245    HB3  HIS  31           2HB      HIS  31   0.516   2.286  -1.314
  246    H    GLN  32           H        GLN  32  -0.420   0.332  -0.559
  247    HA   GLN  32           HA       GLN  32   1.651  -1.520  -0.198
  248    HB2  GLN  32           1HB      GLN  32   0.726  -1.957   1.891
  249    HB3  GLN  32           2HB      GLN  32   0.151  -0.331   1.547
  250    HG2  GLN  32           1HG      GLN  32  -1.771  -1.296   2.294
  251    HG3  GLN  32           2HG      GLN  32  -1.915  -1.610   0.565
  252   HE21  GLN  32          1HE2      GLN  32  -2.930  -3.491   0.424
  253   HE22  GLN  32          2HE2      GLN  32  -2.456  -4.950   1.219
  254    H    LEU  33           H        LEU  33  -1.592  -1.880  -1.454
  255    HA   LEU  33           HA       LEU  33  -1.662  -4.726  -1.330
  256    HG   LEU  33           HG       LEU  33  -5.009  -4.669  -2.847
  257    HB2  LEU  33           1HB      LEU  33  -3.702  -3.420  -1.429
  258    HB3  LEU  33           2HB      LEU  33  -3.238  -2.775  -3.001
  259   HD11  LEU  33          1HD1      LEU  33  -4.674  -4.958  -5.049
  260   HD12  LEU  33          2HD1      LEU  33  -2.989  -5.434  -4.837
  261   HD13  LEU  33          3HD1      LEU  33  -3.431  -3.726  -4.833
  262   HD21  LEU  33          3HD2      LEU  33  -4.327  -6.823  -2.544
  263   HD22  LEU  33          1HD2      LEU  33  -3.193  -6.008  -1.467
  264   HD23  LEU  33          2HD2      LEU  33  -2.679  -6.496  -3.081
  265    H    LEU  34           H        LEU  34  -1.051  -2.415  -3.964
  266    HA   LEU  34           HA       LEU  34  -0.613  -4.267  -6.001
  267    HG   LEU  34           HG       LEU  34  -1.982  -1.745  -6.299
  268    HB2  LEU  34           1HB      LEU  34   0.354  -1.474  -5.522
  269    HB3  LEU  34           2HB      LEU  34   0.898  -2.385  -6.929
  270   HD11  LEU  34          1HD1      LEU  34  -1.798  -0.166  -8.185
  271   HD12  LEU  34          2HD1      LEU  34  -0.061  -0.461  -8.235
  272   HD13  LEU  34          3HD1      LEU  34  -0.786   0.288  -6.813
  273   HD21  LEU  34          3HD2      LEU  34  -0.619  -3.378  -8.344
  274   HD22  LEU  34          1HD2      LEU  34  -1.903  -2.315  -8.922
  275   HD23  LEU  34          2HD2      LEU  34  -2.246  -3.515  -7.675
  276    H    TYR  35           H        TYR  35   1.597  -2.953  -3.586
  277    HA   TYR  35           HA       TYR  35   3.934  -4.170  -4.673
  278    HD1  TYR  35           1HD      TYR  35   6.480  -3.710  -3.753
  279    HD2  TYR  35           2HD      TYR  35   4.167  -3.991  -0.192
  280    HE1  TYR  35           1HE      TYR  35   8.410  -4.688  -2.583
  281    HE2  TYR  35           2HE      TYR  35   6.091  -4.967   0.987
  282    HH   TYR  35           HH       TYR  35   9.228  -4.907  -0.245
  283    HB2  TYR  35           1HB      TYR  35   4.346  -2.304  -3.307
  284    HB3  TYR  35           2HB      TYR  35   3.276  -2.884  -2.036
  285    H    LEU  36           H        LEU  36   1.710  -5.015  -2.046
  286    HA   LEU  36           HA       LEU  36   3.073  -7.305  -1.153
  287    HG   LEU  36           HG       LEU  36   0.648  -6.868   1.529
  288    HB2  LEU  36           1HB      LEU  36   0.428  -6.107  -0.799
  289    HB3  LEU  36           2HB      LEU  36   0.441  -7.863  -0.655
  290   HD11  LEU  36          1HD1      LEU  36   3.423  -7.656   1.373
  291   HD12  LEU  36          2HD1      LEU  36   2.387  -8.749   0.456
  292   HD13  LEU  36          3HD1      LEU  36   2.065  -8.457   2.165
  293   HD21  LEU  36          3HD2      LEU  36   1.549  -4.809   1.533
  294   HD22  LEU  36          1HD2      LEU  36   2.580  -5.143   0.142
  295   HD23  LEU  36          2HD2      LEU  36   3.071  -5.673   1.752
  296    H    GLN  37           H        GLN  37   0.887  -6.775  -3.817
  297    HA   GLN  37           HA       GLN  37   0.008  -9.326  -4.380
  298    HB2  GLN  37           1HB      GLN  37  -0.366  -7.011  -5.592
  299    HB3  GLN  37           2HB      GLN  37   0.919  -7.595  -6.638
  300    HG2  GLN  37           1HG      GLN  37  -0.351  -9.341  -7.452
  301    HG3  GLN  37           2HG      GLN  37  -1.438  -9.331  -6.064
  302   HE21  GLN  37          1HE2      GLN  37  -2.824  -7.395  -5.847
  303   HE22  GLN  37          2HE2      GLN  37  -3.451  -6.682  -7.290
  304    H    HIS  38           H        HIS  38   3.115  -7.844  -5.173
  305    HA   HIS  38           HA       HIS  38   4.127  -9.882  -6.805
  306    HD1  HIS  38           1HD      HIS  38   5.489  -7.996  -8.701
  307    HD2  HIS  38           2HD      HIS  38   8.119  -9.798  -6.038
  308    HE1  HIS  38           1HE      HIS  38   7.438  -8.760 -10.094
  309    HB2  HIS  38           1HB      HIS  38   5.046  -7.475  -6.151
  310    HB3  HIS  38           2HB      HIS  38   5.980  -8.411  -4.988
  311    H    GLN  39           H        GLN  39   4.651  -9.328  -3.321
  312    HA   GLN  39           HA       GLN  39   6.181 -11.579  -2.794
  313    HB2  GLN  39           1HB      GLN  39   4.147 -10.294  -0.963
  314    HB3  GLN  39           2HB      GLN  39   5.469 -11.341  -0.464
  315    HG2  GLN  39           1HG      GLN  39   6.089  -8.872  -2.004
  316    HG3  GLN  39           2HG      GLN  39   5.667  -8.738  -0.299
  317   HE21  GLN  39          1HE2      GLN  39   7.703  -8.050   0.299
  318   HE22  GLN  39          2HE2      GLN  39   9.075  -9.099   0.311
  319    H    LEU  40           H        LEU  40   2.667 -11.230  -2.895
  320    HA   LEU  40           HA       LEU  40   2.003 -13.783  -1.936
  321    HG   LEU  40           HG       LEU  40  -0.266 -14.064  -4.326
  322    HB2  LEU  40           1HB      LEU  40   0.273 -12.212  -2.011
  323    HB3  LEU  40           2HB      LEU  40   0.595 -11.808  -3.696
  324   HD11  LEU  40          1HD1      LEU  40  -1.673 -14.374  -1.773
  325   HD12  LEU  40          2HD1      LEU  40   0.059 -14.695  -1.708
  326   HD13  LEU  40          3HD1      LEU  40  -0.963 -15.587  -2.836
  327   HD21  LEU  40          3HD2      LEU  40  -1.754 -12.272  -4.634
  328   HD22  LEU  40          1HD2      LEU  40  -2.027 -12.091  -2.901
  329   HD23  LEU  40          2HD2      LEU  40  -2.678 -13.491  -3.755
  330    H    ASP  41           H        ASP  41   2.289 -12.609  -5.288
  331    HA   ASP  41           HA       ASP  41   1.745 -14.985  -6.604
  332    HB2  ASP  41           1HB      ASP  41   2.075 -12.679  -7.619
  333    HB3  ASP  41           2HB      ASP  41   3.808 -12.988  -7.533
  334    H    GLU  42           H        GLU  42   4.850 -13.777  -5.390
  335    HA   GLU  42           HA       GLU  42   6.354 -16.008  -6.325
  336    HB2  GLU  42           1HB      GLU  42   7.535 -13.976  -5.952
  337    HB3  GLU  42           2HB      GLU  42   6.928 -13.844  -4.306
  338    HG2  GLU  42           1HG      GLU  42   9.238 -14.510  -4.275
  339    HG3  GLU  42           2HG      GLU  42   8.230 -15.830  -3.685
  340    H    LEU  43           H        LEU  43   4.556 -15.306  -3.424
  341    HA   LEU  43           HA       LEU  43   5.689 -17.352  -1.805
  342    HG   LEU  43           HG       LEU  43   3.574 -18.131  -0.121
  343    HB2  LEU  43           1HB      LEU  43   4.638 -15.731  -0.559
  344    HB3  LEU  43           2HB      LEU  43   3.275 -15.614  -1.670
  345   HD11  LEU  43          1HD1      LEU  43   4.026 -16.322   1.514
  346   HD12  LEU  43          2HD1      LEU  43   2.541 -17.215   1.840
  347   HD13  LEU  43          3HD1      LEU  43   2.463 -15.613   1.106
  348   HD21  LEU  43          3HD2      LEU  43   1.355 -18.355  -0.526
  349   HD22  LEU  43          1HD2      LEU  43   1.743 -17.279  -1.868
  350   HD23  LEU  43          2HD2      LEU  43   1.039 -16.625  -0.388
  351    H    ASN  44           H        ASN  44   3.073 -17.229  -4.123
  352    HA   ASN  44           HA       ASN  44   1.703 -19.559  -3.463
  353    HB2  ASN  44           1HB      ASN  44   2.173 -18.242  -6.141
  354    HB3  ASN  44           2HB      ASN  44   1.083 -19.607  -5.916
  355   HD21  ASN  44          1HD2      ASN  44  -0.066 -17.508  -6.933
  356   HD22  ASN  44          2HD2      ASN  44  -1.011 -16.641  -5.775
  357    H    GLU  45           H        GLU  45   4.570 -19.105  -5.488
  358    HA   GLU  45           HA       GLU  45   4.770 -21.971  -5.957
  359    HB2  GLU  45           1HB      GLU  45   5.250 -20.209  -7.727
  360    HB3  GLU  45           2HB      GLU  45   6.718 -19.841  -6.832
  361    HG2  GLU  45           1HG      GLU  45   7.202 -22.371  -7.062
  362    HG3  GLU  45           2HG      GLU  45   6.002 -22.310  -8.351
  363    H    ASN  46           H        ASN  46   6.673 -19.383  -4.436
  364    HA   ASN  46           HA       ASN  46   8.823 -20.903  -3.555
  365    HB2  ASN  46           1HB      ASN  46   8.545 -18.374  -3.464
  366    HB3  ASN  46           2HB      ASN  46   7.625 -18.622  -1.983
  367   HD21  ASN  46          1HD2      ASN  46   9.522 -17.143  -1.384
  368   HD22  ASN  46          2HD2      ASN  46  10.912 -17.940  -0.738
  369    H    LYS  47           H        LYS  47   5.640 -20.447  -2.127
  370    HA   LYS  47           HA       LYS  47   4.619 -21.374  -0.306
  371    HB2  LYS  47           1HB      LYS  47   5.283 -23.340  -2.006
  372    HB3  LYS  47           2HB      LYS  47   6.201 -23.870  -0.603
  373    HG2  LYS  47           1HG      LYS  47   4.224 -24.968  -0.272
  374    HG3  LYS  47           2HG      LYS  47   3.938 -23.490   0.651
  375    HD2  LYS  47           1HD      LYS  47   1.987 -23.901  -0.656
  376    HD3  LYS  47           2HD      LYS  47   2.837 -22.541  -1.395
  377    HE2  LYS  47           1HE      LYS  47   2.007 -24.173  -3.053
  378    HE3  LYS  47           2HE      LYS  47   3.760 -23.986  -3.093
  379    HZ1  LYS  47           3HZ      LYS  47   2.955 -26.323  -3.213
  380    HZ2  LYS  47           1HZ      LYS  47   2.381 -26.166  -1.629
  381    HZ3  LYS  47           2HZ      LYS  47   4.036 -26.029  -1.946
  382    H    SER  48           H        SER  48   7.028 -19.908   0.266
  383    HA   SER  48           HA       SER  48   8.562 -21.350   2.206
  384    HG   SER  48           HG       SER  48  10.860 -19.354   1.460
  385    HB2  SER  48           1HB      SER  48   8.901 -18.986   0.801
  386    HB3  SER  48           2HB      SER  48   8.640 -18.440   2.457
  387    H    LYS  49           H        LYS  49   8.070 -21.727   4.258
  388    HA   LYS  49           HA       LYS  49   5.629 -21.027   5.422
  389    HB2  LYS  49           1HB      LYS  49   6.776 -21.728   7.589
  390    HB3  LYS  49           2HB      LYS  49   6.723 -22.922   6.299
  391    HG2  LYS  49           1HG      LYS  49   9.111 -21.371   6.054
  392    HG3  LYS  49           2HG      LYS  49   8.968 -21.985   7.702
  393    HD2  LYS  49           1HD      LYS  49   8.952 -24.209   7.002
  394    HD3  LYS  49           2HD      LYS  49   8.510 -23.782   5.347
  395    HE2  LYS  49           1HE      LYS  49  10.786 -22.594   5.265
  396    HE3  LYS  49           2HE      LYS  49  11.169 -23.522   6.714
  397    HZ1  LYS  49           3HZ      LYS  49  10.420 -25.518   5.309
  398    HZ2  LYS  49           1HZ      LYS  49  11.943 -24.849   5.007
  399    HZ3  LYS  49           2HZ      LYS  49  10.646 -24.495   3.981
  400    H    GLU  50           H        GLU  50   8.820 -19.535   5.688
  401    HA   GLU  50           HA       GLU  50   8.111 -17.666   7.700
  402    HB2  GLU  50           1HB      GLU  50  10.187 -16.482   6.995
  403    HB3  GLU  50           2HB      GLU  50  10.431 -18.189   7.337
  404    HG2  GLU  50           1HG      GLU  50  10.280 -18.625   4.887
  405    HG3  GLU  50           2HG      GLU  50  10.250 -16.880   4.636
  406    H    LEU  51           H        LEU  51   8.307 -17.443   4.162
  407    HA   LEU  51           HA       LEU  51   7.665 -14.736   3.910
  408    HG   LEU  51           HG       LEU  51   6.184 -14.642   1.236
  409    HB2  LEU  51           1HB      LEU  51   8.494 -16.360   2.134
  410    HB3  LEU  51           2HB      LEU  51   6.814 -16.865   1.966
  411   HD11  LEU  51          1HD1      LEU  51   9.085 -13.968   1.694
  412   HD12  LEU  51          2HD1      LEU  51   7.685 -13.284   2.519
  413   HD13  LEU  51          3HD1      LEU  51   7.950 -12.948   0.808
  414   HD21  LEU  51          3HD2      LEU  51   6.924 -16.207  -0.464
  415   HD22  LEU  51          1HD2      LEU  51   8.599 -15.712  -0.222
  416   HD23  LEU  51          2HD2      LEU  51   7.429 -14.570  -0.884
  417    H    GLN  52           H        GLN  52   5.603 -17.578   4.216
  418    HA   GLN  52           HA       GLN  52   3.157 -16.224   3.705
  419    HB2  GLN  52           1HB      GLN  52   3.589 -18.731   3.582
  420    HB3  GLN  52           2HB      GLN  52   3.473 -18.739   5.337
  421    HG2  GLN  52           1HG      GLN  52   1.198 -17.443   4.719
  422    HG3  GLN  52           2HG      GLN  52   1.371 -18.471   3.297
  423   HE21  GLN  52          1HE2      GLN  52  -0.288 -19.845   3.726
  424   HE22  GLN  52          2HE2      GLN  52  -0.316 -20.927   5.072
  425    H    GLU  53           H        GLU  53   4.665 -17.356   6.730
  426    HA   GLU  53           HA       GLU  53   2.794 -16.403   8.522
  427    HB2  GLU  53           1HB      GLU  53   5.794 -16.598   8.815
  428    HB3  GLU  53           2HB      GLU  53   4.701 -16.267  10.152
  429    HG2  GLU  53           1HG      GLU  53   4.215 -18.677   8.483
  430    HG3  GLU  53           2HG      GLU  53   5.545 -18.699   9.639
  431    H    LYS  54           H        LYS  54   5.442 -14.683   6.957
  432    HA   LYS  54           HA       LYS  54   5.132 -12.272   8.441
  433    HB2  LYS  54           1HB      LYS  54   6.410 -12.732   5.739
  434    HB3  LYS  54           2HB      LYS  54   6.582 -11.279   6.715
  435    HG2  LYS  54           1HG      LYS  54   7.327 -13.893   7.919
  436    HG3  LYS  54           2HG      LYS  54   8.409 -13.162   6.731
  437    HD2  LYS  54           1HD      LYS  54   9.260 -12.133   8.555
  438    HD3  LYS  54           2HD      LYS  54   7.913 -11.023   8.289
  439    HE2  LYS  54           1HE      LYS  54   6.625 -12.766   9.787
  440    HE3  LYS  54           2HE      LYS  54   8.253 -13.153  10.345
  441    HZ1  LYS  54           3HZ      LYS  54   6.812 -11.287  11.478
  442    HZ2  LYS  54           1HZ      LYS  54   7.479 -10.335  10.249
  443    HZ3  LYS  54           2HZ      LYS  54   8.491 -11.141  11.338
  444    H    ILE  55           H        ILE  55   4.213 -13.172   5.116
  445    HA   ILE  55           HA       ILE  55   2.901 -10.818   4.434
  446    HB   ILE  55           HB       ILE  55   2.357 -13.644   3.530
  447   HG12  ILE  55          1HG1      ILE  55   3.688 -11.440   1.973
  448   HG13  ILE  55          2HG1      ILE  55   4.605 -12.451   3.083
  449   HG21  ILE  55          1HG2      ILE  55   1.011 -11.102   2.878
  450   HG22  ILE  55          2HG2      ILE  55   1.427 -12.136   1.511
  451   HG23  ILE  55          3HG2      ILE  55   0.409 -12.758   2.809
  452   HD11  ILE  55          3HD1      ILE  55   4.292 -14.356   1.798
  453   HD12  ILE  55          1HD1      ILE  55   2.915 -13.668   0.938
  454   HD13  ILE  55          2HD1      ILE  55   4.546 -13.085   0.602
  455    H    ILE  56           H        ILE  56   1.729 -13.643   6.182
  456    HA   ILE  56           HA       ILE  56  -1.005 -12.988   6.201
  457    HB   ILE  56           HB       ILE  56   0.627 -14.568   8.189
  458   HG12  ILE  56          1HG1      ILE  56  -1.366 -15.718   6.276
  459   HG13  ILE  56          2HG1      ILE  56   0.228 -15.268   5.679
  460   HG21  ILE  56          1HG2      ILE  56  -1.757 -15.516   8.678
  461   HG22  ILE  56          2HG2      ILE  56  -1.211 -14.037   9.466
  462   HG23  ILE  56          3HG2      ILE  56  -2.289 -13.948   8.072
  463   HD11  ILE  56          3HD1      ILE  56  -0.210 -17.110   8.012
  464   HD12  ILE  56          1HD1      ILE  56  -0.031 -17.659   6.345
  465   HD13  ILE  56          2HD1      ILE  56   1.292 -16.805   7.140
  466    H    ARG  57           H        ARG  57   1.627 -12.148   8.412
  467    HA   ARG  57           HA       ARG  57   0.017 -10.849  10.339
  468    HE   ARG  57           HE       ARG  57   1.266 -13.062  13.445
  469    HB2  ARG  57           1HB      ARG  57   2.889 -11.116   9.766
  470    HB3  ARG  57           2HB      ARG  57   2.445  -9.618  10.572
  471    HG2  ARG  57           1HG      ARG  57   2.959 -11.091  12.304
  472    HG3  ARG  57           2HG      ARG  57   1.196 -11.085  12.241
  473    HD2  ARG  57           1HD      ARG  57   1.418 -13.128  10.725
  474    HD3  ARG  57           2HD      ARG  57   3.099 -13.190  11.256
  475   HH11  ARG  57          1HH1      ARG  57   2.735 -15.197  11.121
  476   HH12  ARG  57          2HH1      ARG  57   2.561 -16.607  12.111
  477   HH21  ARG  57          1HH2      ARG  57   1.032 -14.912  14.759
  478   HH22  ARG  57          2HH2      ARG  57   1.592 -16.444  14.181
  479    H    GLU  58           H        GLU  58   2.030  -9.546   7.703
  480    HA   GLU  58           HA       GLU  58   1.320  -6.853   8.088
  481    HB2  GLU  58           1HB      GLU  58   2.728  -8.428   6.061
  482    HB3  GLU  58           2HB      GLU  58   1.876  -7.043   5.394
  483    HG2  GLU  58           1HG      GLU  58   3.024  -5.692   7.243
  484    HG3  GLU  58           2HG      GLU  58   4.082  -7.090   7.415
  485    H    LEU  59           H        LEU  59   0.098  -9.231   5.731
  486    HA   LEU  59           HA       LEU  59  -1.812  -7.628   4.510
  487    HG   LEU  59           HG       LEU  59  -3.235  -8.720   2.985
  488    HB2  LEU  59           1HB      LEU  59  -1.036  -9.963   3.873
  489    HB3  LEU  59           2HB      LEU  59  -2.193 -10.559   5.062
  490   HD11  LEU  59          1HD1      LEU  59  -3.098 -11.538   2.151
  491   HD12  LEU  59          2HD1      LEU  59  -1.580 -10.645   2.072
  492   HD13  LEU  59          3HD1      LEU  59  -2.993 -10.059   1.194
  493   HD21  LEU  59          3HD2      LEU  59  -4.579  -9.778   4.826
  494   HD22  LEU  59          1HD2      LEU  59  -4.299 -11.332   4.039
  495   HD23  LEU  59          2HD2      LEU  59  -5.184 -10.063   3.193
  496    H    ASP  60           H        ASP  60  -2.121  -9.689   7.381
  497    HA   ASP  60           HA       ASP  60  -4.858  -9.295   7.828
  498    HB2  ASP  60           1HB      ASP  60  -3.504 -11.034   8.954
  499    HB3  ASP  60           2HB      ASP  60  -2.694  -9.778   9.887
  500    H    VAL  61           H        VAL  61  -2.070  -7.621   9.288
  501    HA   VAL  61           HA       VAL  61  -3.488  -5.792  10.831
  502    HB   VAL  61           HB       VAL  61  -0.820  -5.384   9.471
  503   HG11  VAL  61          1HG1      VAL  61  -0.840  -3.324  10.297
  504   HG12  VAL  61          2HG1      VAL  61  -2.438  -3.594  10.996
  505   HG13  VAL  61          3HG1      VAL  61  -0.990  -3.993  11.922
  506   HG21  VAL  61          3HG2      VAL  61  -1.473  -7.276  11.336
  507   HG22  VAL  61          1HG2      VAL  61   0.142  -6.619  11.074
  508   HG23  VAL  61          2HG2      VAL  61  -0.886  -5.949  12.339
  509    H    VAL  62           H        VAL  62  -2.202  -5.379   7.533
  510    HA   VAL  62           HA       VAL  62  -3.153  -2.783   7.109
  511    HB   VAL  62           HB       VAL  62  -2.717  -4.975   5.074
  512   HG11  VAL  62          1HG1      VAL  62  -3.511  -3.568   3.552
  513   HG12  VAL  62          2HG1      VAL  62  -3.810  -2.350   4.793
  514   HG13  VAL  62          3HG1      VAL  62  -2.245  -2.418   3.982
  515   HG21  VAL  62          3HG2      VAL  62  -0.842  -2.715   5.686
  516   HG22  VAL  62          1HG2      VAL  62  -0.791  -4.221   6.602
  517   HG23  VAL  62          2HG2      VAL  62  -0.512  -4.238   4.860
  518    H    CYS  63           H        CYS  63  -4.581  -5.865   6.012
  519    HA   CYS  63           HA       CYS  63  -6.912  -4.835   4.919
  520    HG   CYS  63           HG       CYS  63  -6.672  -8.593   3.565
  521    HB2  CYS  63           1HB      CYS  63  -6.329  -7.492   6.221
  522    HB3  CYS  63           2HB      CYS  63  -7.884  -7.132   5.480
  523    H    ALA  64           H        ALA  64  -6.048  -5.354   8.248
  524    HA   ALA  64           HA       ALA  64  -8.682  -5.223   9.323
  525    HB1  ALA  64           3HB      ALA  64  -6.105  -4.574  10.740
  526    HB2  ALA  64           1HB      ALA  64  -7.634  -5.071  11.465
  527    HB3  ALA  64           2HB      ALA  64  -6.708  -6.212  10.488
  528    H    MET  65           H        MET  65  -6.015  -2.846   9.370
  529    HA   MET  65           HA       MET  65  -7.579  -0.720  10.347
  530    HB2  MET  65           1HB      MET  65  -5.719   0.662   9.941
  531    HB3  MET  65           2HB      MET  65  -5.033  -0.919  10.290
  532    HG2  MET  65           1HG      MET  65  -4.754  -1.322   7.895
  533    HG3  MET  65           2HG      MET  65  -5.427   0.271   7.554
  534    HE1  MET  65           3HE      MET  65  -1.717  -1.431   8.322
  535    HE2  MET  65           1HE      MET  65  -1.640  -0.614   9.884
  536    HE3  MET  65           2HE      MET  65  -2.990  -1.688   9.517
  537    H    ILE  66           H        ILE  66  -6.944  -1.891   7.107
  538    HA   ILE  66           HA       ILE  66  -7.997   0.375   5.740
  539    HB   ILE  66           HB       ILE  66  -7.097  -2.333   4.987
  540   HG12  ILE  66          1HG1      ILE  66  -5.950  -1.092   3.231
  541   HG13  ILE  66          2HG1      ILE  66  -6.874   0.355   3.615
  542   HG21  ILE  66          1HG2      ILE  66  -9.203  -0.856   3.431
  543   HG22  ILE  66          2HG2      ILE  66  -8.127  -2.040   2.691
  544   HG23  ILE  66          3HG2      ILE  66  -9.223  -2.532   3.981
  545   HD11  ILE  66          3HD1      ILE  66  -4.488   0.218   4.472
  546   HD12  ILE  66          1HD1      ILE  66  -5.736   0.679   5.629
  547   HD13  ILE  66          2HD1      ILE  66  -5.095  -0.964   5.631
  548    H    GLU  67           H        GLU  67  -9.331  -2.834   6.512
  549    HA   GLU  67           HA       GLU  67 -11.839  -2.483   5.337
  550    HB2  GLU  67           1HB      GLU  67 -10.808  -4.216   7.553
  551    HB3  GLU  67           2HB      GLU  67 -12.533  -4.171   7.216
  552    HG2  GLU  67           1HG      GLU  67 -10.699  -4.617   4.932
  553    HG3  GLU  67           2HG      GLU  67 -10.911  -5.930   6.088
  554    H    GLY  68           H        GLY  68 -10.826  -1.917   8.705
  555    HA2  GLY  68           1HA      GLY  68 -13.332  -0.978   9.606
  556    HA3  GLY  68           2HA      GLY  68 -11.786  -0.684  10.387
  557    H    ALA  69           H        ALA  69 -10.440   0.789   8.526
  558    HA   ALA  69           HA       ALA  69 -11.462   3.370   8.929
  559    HB1  ALA  69           3HB      ALA  69  -9.667   4.141   7.516
  560    HB2  ALA  69           1HB      ALA  69  -9.076   2.845   8.556
  561    HB3  ALA  69           2HB      ALA  69  -9.440   2.520   6.861
  562    H    GLN  70           H        GLN  70 -11.227   1.511   5.891
  563    HA   GLN  70           HA       GLN  70 -12.550   3.296   4.239
  564    HB2  GLN  70           1HB      GLN  70 -11.359   0.994   3.762
  565    HB3  GLN  70           2HB      GLN  70 -12.997   0.363   3.876
  566    HG2  GLN  70           1HG      GLN  70 -12.144   2.574   2.021
  567    HG3  GLN  70           2HG      GLN  70 -12.282   0.875   1.568
  568   HE21  GLN  70          1HE2      GLN  70 -14.392  -0.115   1.737
  569   HE22  GLN  70          2HE2      GLN  70 -15.805   0.851   1.507
  570    H    GLY  71           H        GLY  71 -13.928   0.600   6.113
  571    HA2  GLY  71           1HA      GLY  71 -16.600   0.999   5.319
  572    HA3  GLY  71           2HA      GLY  71 -16.082   0.163   6.774
  573    H    ALA  72           H        ALA  72 -14.684   2.467   7.867
  574    HA   ALA  72           HA       ALA  72 -16.863   3.655   9.253
  575    HB1  ALA  72           3HB      ALA  72 -13.936   4.380   9.217
  576    HB2  ALA  72           1HB      ALA  72 -15.128   5.038  10.337
  577    HB3  ALA  72           2HB      ALA  72 -14.747   3.315  10.365
  578    H    LEU  73           H        LEU  73 -14.359   5.180   7.212
  579    HA   LEU  73           HA       LEU  73 -15.519   7.684   7.016
  580    HG   LEU  73           HG       LEU  73 -13.911   4.974   5.230
  581    HB2  LEU  73           1HB      LEU  73 -14.253   7.872   4.854
  582    HB3  LEU  73           2HB      LEU  73 -13.302   7.409   6.264
  583   HD11  LEU  73          1HD1      LEU  73 -14.487   6.851   3.162
  584   HD12  LEU  73          2HD1      LEU  73 -14.575   5.091   3.121
  585   HD13  LEU  73          3HD1      LEU  73 -13.068   5.907   2.707
  586   HD21  LEU  73          3HD2      LEU  73 -11.581   6.794   4.658
  587   HD22  LEU  73          1HD2      LEU  73 -11.611   5.084   4.224
  588   HD23  LEU  73          2HD2      LEU  73 -11.715   5.566   5.918
  589    H    GLU  74           H        GLU  74 -15.949   4.883   4.872
  590    HA   GLU  74           HA       GLU  74 -17.673   6.106   3.032
  591    HB2  GLU  74           1HB      GLU  74 -16.477   3.772   3.005
  592    HB3  GLU  74           2HB      GLU  74 -17.971   3.212   3.743
  593    HG2  GLU  74           1HG      GLU  74 -18.355   4.884   1.374
  594    HG3  GLU  74           2HG      GLU  74 -17.504   3.371   1.070
  595    H    ARG  75           H        ARG  75 -18.403   4.182   5.933
  596    HA   ARG  75           HA       ARG  75 -21.204   4.334   5.717
  597    HE   ARG  75           HE       ARG  75 -24.504   2.893   8.721
  598    HB2  ARG  75           1HB      ARG  75 -20.089   2.701   7.154
  599    HB3  ARG  75           2HB      ARG  75 -19.479   3.995   8.176
  600    HG2  ARG  75           1HG      ARG  75 -21.372   2.929   9.221
  601    HG3  ARG  75           2HG      ARG  75 -21.784   4.587   8.779
  602    HD2  ARG  75           1HD      ARG  75 -23.225   3.931   7.122
  603    HD3  ARG  75           2HD      ARG  75 -22.378   2.412   6.839
  604   HH11  ARG  75          1HH1      ARG  75 -21.804   0.858   7.886
  605   HH12  ARG  75          2HH1      ARG  75 -22.400  -0.513   8.760
  606   HH21  ARG  75          1HH2      ARG  75 -25.298   1.094   9.875
  607   HH22  ARG  75          2HH2      ARG  75 -24.388  -0.379   9.891
  608    H    GLU  76           H        GLU  76 -18.828   6.556   6.950
  609    HA   GLU  76           HA       GLU  76 -20.706   8.192   8.381
  610    HB2  GLU  76           1HB      GLU  76 -18.042   7.920   8.564
  611    HB3  GLU  76           2HB      GLU  76 -18.105   9.323   7.506
  612    HG2  GLU  76           1HG      GLU  76 -19.114   9.039  10.308
  613    HG3  GLU  76           2HG      GLU  76 -17.975  10.213   9.651
  614    H    LEU  77           H        LEU  77 -18.812   8.647   5.394
  615    HA   LEU  77           HA       LEU  77 -20.047  11.063   4.646
  616    HG   LEU  77           HG       LEU  77 -18.702   7.876   3.452
  617    HB2  LEU  77           1HB      LEU  77 -19.101  10.624   2.419
  618    HB3  LEU  77           2HB      LEU  77 -17.926  10.418   3.716
  619   HD11  LEU  77          1HD1      LEU  77 -18.722   8.673   0.589
  620   HD12  LEU  77          2HD1      LEU  77 -20.217   8.814   1.513
  621   HD13  LEU  77          3HD1      LEU  77 -19.411   7.252   1.374
  622   HD21  LEU  77          3HD2      LEU  77 -16.412   8.657   3.345
  623   HD22  LEU  77          1HD2      LEU  77 -16.681   9.302   1.726
  624   HD23  LEU  77          2HD2      LEU  77 -16.738   7.560   2.002
  625    H    LYS  78           H        LYS  78 -21.008   7.755   4.315
  626    HA   LYS  78           HA       LYS  78 -22.813   7.990   2.172
  627    HB2  LYS  78           1HB      LYS  78 -22.266   6.048   4.313
  628    HB3  LYS  78           2HB      LYS  78 -23.929   6.044   3.738
  629    HG2  LYS  78           1HG      LYS  78 -21.603   5.892   1.850
  630    HG3  LYS  78           2HG      LYS  78 -22.288   4.456   2.615
  631    HD2  LYS  78           1HD      LYS  78 -24.342   4.715   1.531
  632    HD3  LYS  78           2HD      LYS  78 -24.026   6.406   1.139
  633    HE2  LYS  78           1HE      LYS  78 -23.690   5.376  -0.898
  634    HE3  LYS  78           2HE      LYS  78 -22.052   5.434  -0.249
  635    HZ1  LYS  78           3HZ      LYS  78 -23.283   3.067   0.619
  636    HZ2  LYS  78           1HZ      LYS  78 -21.942   3.244  -0.398
  637    HZ3  LYS  78           2HZ      LYS  78 -23.499   3.191  -1.055
  638    H    ARG  79           H        ARG  79 -22.946   9.211   5.343
  639    HA   ARG  79           HA       ARG  79 -25.616   9.148   6.018
  640    HE   ARG  79           HE       ARG  79 -25.505  11.537   9.335
  641    HB2  ARG  79           1HB      ARG  79 -23.480  11.215   6.468
  642    HB3  ARG  79           2HB      ARG  79 -25.117  11.465   7.058
  643    HG2  ARG  79           1HG      ARG  79 -23.549   8.998   7.729
  644    HG3  ARG  79           2HG      ARG  79 -23.426  10.480   8.678
  645    HD2  ARG  79           1HD      ARG  79 -26.034   9.097   8.088
  646    HD3  ARG  79           2HD      ARG  79 -25.071   8.775   9.529
  647   HH11  ARG  79          1HH1      ARG  79 -27.268   8.595   9.937
  648   HH12  ARG  79          2HH1      ARG  79 -28.465   9.362  10.927
  649   HH21  ARG  79          1HH2      ARG  79 -27.076  12.557  10.637
  650   HH22  ARG  79          2HH2      ARG  79 -28.356  11.615  11.323
  651    H    THR  80           H        THR  80 -23.965  11.307   3.768
  652    HA   THR  80           HA       THR  80 -26.516  11.954   2.535
  653    HB   THR  80           HB       THR  80 -25.965  14.412   2.513
  654    HG1  THR  80           1HG      THR  80 -23.724  14.036   3.221
  655   HG21  THR  80          3HG2      THR  80 -26.895  14.843   4.704
  656   HG22  THR  80          1HG2      THR  80 -26.426  13.236   5.256
  657   HG23  THR  80          2HG2      THR  80 -27.668  13.415   4.017
  658    H    ASP  81           H        ASP  81 -26.248  13.100   0.470
  659    HA   ASP  81           HA       ASP  81 -23.738  13.510  -0.735
  660    HB2  ASP  81           1HB      ASP  81 -23.649  11.026  -0.575
  661    HB3  ASP  81           2HB      ASP  81 -25.099  10.942  -1.573
  662    H    LEU  82           H        LEU  82 -25.942  15.060  -0.649
  663    HA   LEU  82           HA       LEU  82 -27.337  14.762  -3.202
  664    HG   LEU  82           HG       LEU  82 -29.678  15.256  -2.988
  665    HB2  LEU  82           1HB      LEU  82 -28.363  15.381  -0.849
  666    HB3  LEU  82           2HB      LEU  82 -27.877  17.007  -1.323
  667   HD11  LEU  82          1HD1      LEU  82 -31.554  16.356  -2.075
  668   HD12  LEU  82          2HD1      LEU  82 -30.548  17.511  -1.202
  669   HD13  LEU  82          3HD1      LEU  82 -30.589  15.821  -0.699
  670   HD21  LEU  82          3HD2      LEU  82 -30.290  17.520  -3.932
  671   HD22  LEU  82          1HD2      LEU  82 -28.677  16.927  -4.327
  672   HD23  LEU  82          2HD2      LEU  82 -28.882  18.155  -3.079
  673    H    ASN  83           H        ASN  83 -25.412  15.269  -4.441
  674    HA   ASN  83           HA       ASN  83 -25.355  17.929  -5.325
  675    HB2  ASN  83           1HB      ASN  83 -24.046  17.898  -3.013
  676    HB3  ASN  83           2HB      ASN  83 -22.732  17.328  -4.037
  677   HD21  ASN  83          1HD2      ASN  83 -25.321  19.702  -4.521
  678   HD22  ASN  83          2HD2      ASN  83 -24.273  21.013  -4.931
  679    H    ILE  84           H        ILE  84 -24.387  18.070  -7.293
  680    HA   ILE  84           HA       ILE  84 -23.825  15.797  -8.759
  681    HB   ILE  84           HB       ILE  84 -22.761  18.579  -9.264
  682   HG12  ILE  84          1HG1      ILE  84 -25.199  17.284 -10.482
  683   HG13  ILE  84          2HG1      ILE  84 -25.285  18.259  -9.019
  684   HG21  ILE  84          1HG2      ILE  84 -22.732  17.801 -11.649
  685   HG22  ILE  84          2HG2      ILE  84 -21.532  17.045 -10.602
  686   HG23  ILE  84          3HG2      ILE  84 -22.994  16.164 -11.046
  687   HD11  ILE  84          3HD1      ILE  84 -25.759  19.857 -10.548
  688   HD12  ILE  84          1HD1      ILE  84 -24.002  19.992 -10.558
  689   HD13  ILE  84          2HD1      ILE  84 -24.823  19.076 -11.822
  690    H    LEU  85           H        LEU  85 -21.455  18.113  -7.439
  691    HA   LEU  85           HA       LEU  85 -19.166  16.680  -8.180
  692    HG   LEU  85           HG       LEU  85 -17.561  18.201  -8.305
  693    HB2  LEU  85           1HB      LEU  85 -19.680  19.084  -6.970
  694    HB3  LEU  85           2HB      LEU  85 -18.934  18.159  -5.669
  695   HD11  LEU  85          1HD1      LEU  85 -18.394  20.592  -7.281
  696   HD12  LEU  85          2HD1      LEU  85 -16.979  20.359  -8.306
  697   HD13  LEU  85          3HD1      LEU  85 -16.798  20.410  -6.553
  698   HD21  LEU  85          3HD2      LEU  85 -15.595  18.372  -6.708
  699   HD22  LEU  85          1HD2      LEU  85 -16.535  16.879  -6.648
  700   HD23  LEU  85          2HD2      LEU  85 -16.761  18.114  -5.409
  701    H    GLU  86           H        GLU  86 -21.031  16.655  -5.162
  702    HA   GLU  86           HA       GLU  86 -19.396  14.929  -3.701
  703    HB2  GLU  86           1HB      GLU  86 -22.369  15.420  -3.600
  704    HB3  GLU  86           2HB      GLU  86 -21.542  14.370  -2.459
  705    HG2  GLU  86           1HG      GLU  86 -20.157  16.238  -1.731
  706    HG3  GLU  86           2HG      GLU  86 -20.971  17.294  -2.885
  707    H    ARG  87           H        ARG  87 -22.068  14.228  -5.915
  708    HA   ARG  87           HA       ARG  87 -22.151  11.448  -5.502
  709    HE   ARG  87           HE       ARG  87 -26.161  12.156  -7.242
  710    HB2  ARG  87           1HB      ARG  87 -23.792  13.035  -6.769
  711    HB3  ARG  87           2HB      ARG  87 -22.781  12.679  -8.162
  712    HG2  ARG  87           1HG      ARG  87 -23.188  10.233  -7.668
  713    HG3  ARG  87           2HG      ARG  87 -24.424  10.769  -6.528
  714    HD2  ARG  87           1HD      ARG  87 -24.433  11.765  -9.350
  715    HD3  ARG  87           2HD      ARG  87 -25.093  10.175  -8.969
  716   HH11  ARG  87          1HH1      ARG  87 -26.369  10.925 -10.492
  717   HH12  ARG  87          2HH1      ARG  87 -28.011  11.427 -10.717
  718   HH21  ARG  87          1HH2      ARG  87 -28.324  12.821  -7.526
  719   HH22  ARG  87          2HH2      ARG  87 -29.123  12.507  -9.028
  720    H    PHE  88           H        PHE  88 -20.435  13.395  -7.928
  721    HA   PHE  88           HA       PHE  88 -19.290  11.309  -9.374
  722    HD1  PHE  88           1HD      PHE  88 -17.877  11.249 -11.199
  723    HD2  PHE  88           2HD      PHE  88 -16.158  14.701  -9.396
  724    HE1  PHE  88           1HE      PHE  88 -15.761  10.804 -12.372
  725    HE2  PHE  88           2HE      PHE  88 -14.040  14.262 -10.568
  726    HZ   PHE  88           HZ       PHE  88 -13.839  12.312 -12.060
  727    HB2  PHE  88           1HB      PHE  88 -19.192  13.541 -10.243
  728    HB3  PHE  88           2HB      PHE  88 -18.297  14.110  -8.837
  729    H    ASN  89           H        ASN  89 -17.815  13.203  -6.736
  730    HA   ASN  89           HA       ASN  89 -15.463  11.699  -6.543
  731    HB2  ASN  89           1HB      ASN  89 -16.889  13.251  -4.369
  732    HB3  ASN  89           2HB      ASN  89 -15.212  12.717  -4.312
  733   HD21  ASN  89          1HD2      ASN  89 -15.224  15.181  -3.913
  734   HD22  ASN  89          2HD2      ASN  89 -14.924  16.150  -5.311
  735    H    TYR  90           H        TYR  90 -18.569  11.363  -4.878
  736    HA   TYR  90           HA       TYR  90 -17.824   9.316  -3.110
  737    HD1  TYR  90           1HD      TYR  90 -18.297  11.716  -2.575
  738    HD2  TYR  90           2HD      TYR  90 -21.632   9.335  -1.431
  739    HE1  TYR  90           1HE      TYR  90 -18.397  12.902  -0.423
  740    HE2  TYR  90           2HE      TYR  90 -21.743  10.515   0.724
  741    HH   TYR  90           HH       TYR  90 -20.720  13.199   1.407
  742    HB2  TYR  90           1HB      TYR  90 -20.412  10.314  -4.212
  743    HB3  TYR  90           2HB      TYR  90 -20.404   8.770  -3.366
  744    H    GLU  91           H        GLU  91 -19.177   9.192  -6.383
  745    HA   GLU  91           HA       GLU  91 -19.499   6.415  -6.556
  746    HB2  GLU  91           1HB      GLU  91 -20.332   8.236  -8.156
  747    HB3  GLU  91           2HB      GLU  91 -18.736   8.163  -8.887
  748    HG2  GLU  91           1HG      GLU  91 -19.049   5.946  -9.601
  749    HG3  GLU  91           2HG      GLU  91 -20.464   5.731  -8.573
  750    H    GLU  92           H        GLU  92 -16.808   8.435  -7.738
  751    HA   GLU  92           HA       GLU  92 -15.177   6.312  -8.572
  752    HB2  GLU  92           1HB      GLU  92 -14.981   8.873  -9.002
  753    HB3  GLU  92           2HB      GLU  92 -14.033   8.878  -7.522
  754    HG2  GLU  92           1HG      GLU  92 -12.385   8.645  -9.079
  755    HG3  GLU  92           2HG      GLU  92 -12.723   6.954  -8.712
  756    H    ALA  93           H        ALA  93 -15.216   8.129  -5.519
  757    HA   ALA  93           HA       ALA  93 -13.077   6.956  -4.235
  758    HB1  ALA  93           3HB      ALA  93 -14.342   7.438  -2.112
  759    HB2  ALA  93           1HB      ALA  93 -14.156   8.803  -3.214
  760    HB3  ALA  93           2HB      ALA  93 -15.694   7.944  -3.126
  761    H    GLN  94           H        GLN  94 -16.468   5.860  -4.184
  762    HA   GLN  94           HA       GLN  94 -16.007   3.563  -2.622
  763    HB2  GLN  94           1HB      GLN  94 -18.230   4.779  -3.347
  764    HB3  GLN  94           2HB      GLN  94 -18.187   3.616  -4.666
  765    HG2  GLN  94           1HG      GLN  94 -17.844   1.889  -2.735
  766    HG3  GLN  94           2HG      GLN  94 -18.562   3.162  -1.749
  767   HE21  GLN  94          1HE2      GLN  94 -20.430   4.235  -3.350
  768   HE22  GLN  94          2HE2      GLN  94 -21.628   3.063  -3.766
  769    H    THR  95           H        THR  95 -15.902   4.130  -6.092
  770    HA   THR  95           HA       THR  95 -15.805   1.496  -6.995
  771    HB   THR  95           HB       THR  95 -14.375   3.886  -8.173
  772    HG1  THR  95           1HG      THR  95 -16.860   2.837  -9.028
  773   HG21  THR  95          3HG2      THR  95 -13.571   2.449  -9.674
  774   HG22  THR  95          1HG2      THR  95 -15.228   2.116 -10.175
  775   HG23  THR  95          2HG2      THR  95 -14.462   1.115  -8.943
  776    H    LEU  96           H        LEU  96 -13.094   3.672  -6.206
  777    HA   LEU  96           HA       LEU  96 -11.071   1.754  -6.638
  778    HG   LEU  96           HG       LEU  96 -11.198   4.688  -7.435
  779    HB2  LEU  96           1HB      LEU  96 -11.139   4.290  -5.022
  780    HB3  LEU  96           2HB      LEU  96  -9.685   3.314  -5.214
  781   HD11  LEU  96          1HD1      LEU  96  -9.197   6.107  -7.575
  782   HD12  LEU  96          2HD1      LEU  96  -8.550   5.317  -6.137
  783   HD13  LEU  96          3HD1      LEU  96 -10.027   6.274  -6.026
  784   HD21  LEU  96          3HD2      LEU  96 -10.232   2.754  -8.367
  785   HD22  LEU  96          1HD2      LEU  96  -8.761   2.928  -7.410
  786   HD23  LEU  96          2HD2      LEU  96  -9.099   4.059  -8.721
  787    H    SER  97           H        SER  97 -12.772   2.797  -3.708
  788    HA   SER  97           HA       SER  97 -11.319   1.292  -1.854
  789    HG   SER  97           HG       SER  97 -13.551   3.871  -0.691
  790    HB2  SER  97           1HB      SER  97 -14.274   1.904  -1.665
  791    HB3  SER  97           2HB      SER  97 -13.142   1.652  -0.336
  792    H    LYS  98           H        LYS  98 -14.268   0.469  -3.656
  793    HA   LYS  98           HA       LYS  98 -14.674  -2.071  -2.548
  794    HB2  LYS  98           1HB      LYS  98 -16.080  -0.554  -4.250
  795    HB3  LYS  98           2HB      LYS  98 -15.349  -1.652  -5.413
  796    HG2  LYS  98           1HG      LYS  98 -16.215  -3.491  -3.766
  797    HG3  LYS  98           2HG      LYS  98 -17.319  -2.212  -3.253
  798    HD2  LYS  98           1HD      LYS  98 -16.964  -2.939  -6.148
  799    HD3  LYS  98           2HD      LYS  98 -18.113  -3.784  -5.108
  800    HE2  LYS  98           1HE      LYS  98 -19.368  -1.821  -4.734
  801    HE3  LYS  98           2HE      LYS  98 -18.096  -0.791  -5.391
  802    HZ1  LYS  98           3HZ      LYS  98 -19.697  -0.924  -7.065
  803    HZ2  LYS  98           1HZ      LYS  98 -19.936  -2.585  -6.852
  804    HZ3  LYS  98           2HZ      LYS  98 -18.507  -2.021  -7.555
  805    H    ILE  99           H        ILE  99 -12.963  -1.127  -5.522
  806    HA   ILE  99           HA       ILE  99 -12.203  -3.666  -6.366
  807    HB   ILE  99           HB       ILE  99 -10.683  -1.076  -6.688
  808   HG12  ILE  99          1HG1      ILE  99 -12.340  -2.348  -8.827
  809   HG13  ILE  99          2HG1      ILE  99 -13.152  -1.436  -7.559
  810   HG21  ILE  99          1HG2      ILE  99  -9.067  -2.417  -7.467
  811   HG22  ILE  99          2HG2      ILE  99 -10.145  -3.808  -7.575
  812   HG23  ILE  99          3HG2      ILE  99 -10.114  -2.615  -8.873
  813   HD11  ILE  99          3HD1      ILE  99 -12.752  -0.042  -9.488
  814   HD12  ILE  99          1HD1      ILE  99 -11.792   0.523  -8.120
  815   HD13  ILE  99          2HD1      ILE  99 -11.026  -0.397  -9.416
  816    H    LEU 100           H        LEU 100 -10.396  -1.373  -4.327
  817    HA   LEU 100           HA       LEU 100  -8.131  -2.928  -3.901
  818    HG   LEU 100           HG       LEU 100  -8.156  -2.130  -0.620
  819    HB2  LEU 100           1HB      LEU 100  -8.094  -0.656  -3.249
  820    HB3  LEU 100           2HB      LEU 100  -9.491  -0.862  -2.195
  821   HD11  LEU 100          1HD1      LEU 100  -5.711  -2.332  -0.956
  822   HD12  LEU 100          2HD1      LEU 100  -5.924  -1.744  -2.606
  823   HD13  LEU 100          3HD1      LEU 100  -6.657  -3.270  -2.112
  824   HD21  LEU 100          3HD2      LEU 100  -6.400   0.197  -1.194
  825   HD22  LEU 100          1HD2      LEU 100  -7.120  -0.332   0.327
  826   HD23  LEU 100          2HD2      LEU 100  -8.108   0.502  -0.872
  827    H    LEU 101           H        LEU 101 -11.153  -2.799  -2.044
  828    HA   LEU 101           HA       LEU 101 -10.451  -4.548   0.006
  829    HG   LEU 101           HG       LEU 101 -13.673  -3.266   1.147
  830    HB2  LEU 101           1HB      LEU 101 -12.940  -3.526  -1.166
  831    HB3  LEU 101           2HB      LEU 101 -13.098  -5.082  -0.354
  832   HD11  LEU 101          1HD1      LEU 101 -12.317  -3.887   3.006
  833   HD12  LEU 101          2HD1      LEU 101 -11.006  -4.407   1.948
  834   HD13  LEU 101          3HD1      LEU 101 -12.517  -5.314   1.989
  835   HD21  LEU 101          3HD2      LEU 101 -12.543  -1.380   0.432
  836   HD22  LEU 101          1HD2      LEU 101 -10.998  -2.223   0.314
  837   HD23  LEU 101          2HD2      LEU 101 -11.659  -1.811   1.897
  838    H    LYS 102           H        LYS 102 -12.010  -5.256  -3.112
  839    HA   LYS 102           HA       LYS 102 -12.324  -8.001  -2.793
  840    HB2  LYS 102           1HB      LYS 102 -11.978  -6.228  -5.185
  841    HB3  LYS 102           2HB      LYS 102 -12.026  -7.974  -5.391
  842    HG2  LYS 102           1HG      LYS 102 -14.219  -8.000  -4.239
  843    HG3  LYS 102           2HG      LYS 102 -14.173  -6.237  -4.196
  844    HD2  LYS 102           1HD      LYS 102 -13.884  -7.758  -6.769
  845    HD3  LYS 102           2HD      LYS 102 -15.470  -7.359  -6.105
  846    HE2  LYS 102           1HE      LYS 102 -14.516  -4.948  -5.963
  847    HE3  LYS 102           2HE      LYS 102 -13.328  -5.535  -7.127
  848    HZ1  LYS 102           3HZ      LYS 102 -14.845  -5.002  -8.649
  849    HZ2  LYS 102           1HZ      LYS 102 -16.094  -4.875  -7.516
  850    HZ3  LYS 102           2HZ      LYS 102 -15.686  -6.386  -8.157
  851    H    ASP 103           H        ASP 103  -9.616  -6.254  -4.313
  852    HA   ASP 103           HA       ASP 103  -8.028  -8.451  -4.925
  853    HB2  ASP 103           1HB      ASP 103  -7.743  -5.888  -5.441
  854    HB3  ASP 103           2HB      ASP 103  -6.758  -5.909  -3.981
  855    H    LEU 104           H        LEU 104  -8.244  -6.587  -1.927
  856    HA   LEU 104           HA       LEU 104  -6.114  -7.808  -0.568
  857    HG   LEU 104           HG       LEU 104  -6.629  -4.981  -0.354
  858    HB2  LEU 104           1HB      LEU 104  -8.571  -6.337   0.266
  859    HB3  LEU 104           2HB      LEU 104  -7.607  -7.163   1.488
  860   HD11  LEU 104          1HD1      LEU 104  -8.255  -4.358   1.495
  861   HD12  LEU 104          2HD1      LEU 104  -6.699  -3.527   1.492
  862   HD13  LEU 104          3HD1      LEU 104  -6.992  -4.846   2.625
  863   HD21  LEU 104          3HD2      LEU 104  -4.954  -5.447   1.898
  864   HD22  LEU 104          1HD2      LEU 104  -4.568  -5.594   0.183
  865   HD23  LEU 104          2HD2      LEU 104  -5.211  -6.980   1.063
  866    H    LYS 105           H        LYS 105  -9.568  -8.612  -0.680
  867    HA   LYS 105           HA       LYS 105  -9.512 -10.739   1.144
  868    HB2  LYS 105           1HB      LYS 105 -11.315 -10.120  -1.191
  869    HB3  LYS 105           2HB      LYS 105 -11.570 -11.521  -0.158
  870    HG2  LYS 105           1HG      LYS 105 -11.406  -8.724   0.923
  871    HG3  LYS 105           2HG      LYS 105 -12.919  -9.458   0.385
  872    HD2  LYS 105           1HD      LYS 105 -12.339 -11.377   1.976
  873    HD3  LYS 105           2HD      LYS 105 -11.139 -10.279   2.663
  874    HE2  LYS 105           1HE      LYS 105 -12.961  -9.887   4.018
  875    HE3  LYS 105           2HE      LYS 105 -13.142  -8.620   2.804
  876    HZ1  LYS 105           3HZ      LYS 105 -14.536 -10.544   1.656
  877    HZ2  LYS 105           1HZ      LYS 105 -15.227  -9.452   2.748
  878    HZ3  LYS 105           2HZ      LYS 105 -14.768 -10.992   3.271
  879    H    GLU 106           H        GLU 106  -9.029 -10.680  -2.365
  880    HA   GLU 106           HA       GLU 106  -8.842 -13.452  -2.757
  881    HB2  GLU 106           1HB      GLU 106  -8.319 -11.044  -4.288
  882    HB3  GLU 106           2HB      GLU 106  -7.123 -12.288  -4.625
  883    HG2  GLU 106           1HG      GLU 106  -8.756 -13.806  -5.368
  884    HG3  GLU 106           2HG      GLU 106 -10.070 -12.841  -4.699
  885    H    THR 107           H        THR 107  -6.272 -11.037  -2.278
  886    HA   THR 107           HA       THR 107  -4.088 -12.751  -2.367
  887    HB   THR 107           HB       THR 107  -2.884 -11.064  -1.013
  888    HG1  THR 107           1HG      THR 107  -4.212  -9.135  -0.499
  889   HG21  THR 107          3HG2      THR 107  -2.664 -10.134  -3.031
  890   HG22  THR 107          1HG2      THR 107  -4.015  -9.082  -2.611
  891   HG23  THR 107          2HG2      THR 107  -4.306 -10.584  -3.489
  892    H    GLU 108           H        GLU 108  -6.045 -11.769   0.432
  893    HA   GLU 108           HA       GLU 108  -4.604 -13.131   2.398
  894    HB2  GLU 108           1HB      GLU 108  -6.532 -11.432   2.642
  895    HB3  GLU 108           2HB      GLU 108  -7.594 -12.825   2.492
  896    HG2  GLU 108           1HG      GLU 108  -7.046 -13.642   4.535
  897    HG3  GLU 108           2HG      GLU 108  -5.407 -12.996   4.478
  898    H    GLN 109           H        GLN 109  -7.416 -14.192   0.501
  899    HA   GLN 109           HA       GLN 109  -7.758 -16.702   1.639
  900    HB2  GLN 109           1HB      GLN 109  -9.024 -15.336  -0.309
  901    HB3  GLN 109           2HB      GLN 109  -8.152 -16.506  -1.290
  902    HG2  GLN 109           1HG      GLN 109 -10.150 -17.576  -0.922
  903    HG3  GLN 109           2HG      GLN 109  -9.133 -18.247   0.350
  904   HE21  GLN 109          1HE2      GLN 109 -10.929 -18.766   1.605
  905   HE22  GLN 109          2HE2      GLN 109 -11.832 -17.561   2.451
  906    H    LYS 110           H        LYS 110  -5.831 -15.826  -1.224
  907    HA   LYS 110           HA       LYS 110  -4.838 -18.352  -1.818
  908    HB2  LYS 110           1HB      LYS 110  -4.468 -15.777  -2.786
  909    HB3  LYS 110           2HB      LYS 110  -2.866 -16.247  -2.233
  910    HG2  LYS 110           1HG      LYS 110  -2.638 -17.211  -4.224
  911    HG3  LYS 110           2HG      LYS 110  -3.706 -18.471  -3.603
  912    HD2  LYS 110           1HD      LYS 110  -4.690 -15.987  -4.999
  913    HD3  LYS 110           2HD      LYS 110  -4.369 -17.512  -5.828
  914    HE2  LYS 110           1HE      LYS 110  -6.324 -17.105  -3.565
  915    HE3  LYS 110           2HE      LYS 110  -6.741 -17.262  -5.271
  916    HZ1  LYS 110           3HZ      LYS 110  -5.185 -19.454  -4.695
  917    HZ2  LYS 110           1HZ      LYS 110  -6.863 -19.433  -4.916
  918    HZ3  LYS 110           2HZ      LYS 110  -6.213 -19.298  -3.361
  919    H    VAL 111           H        VAL 111  -3.429 -15.839   0.268
  920    HA   VAL 111           HA       VAL 111  -1.095 -17.164   0.992
  921    HB   VAL 111           HB       VAL 111  -2.750 -15.297   2.698
  922   HG11  VAL 111          1HG1      VAL 111  -0.536 -14.825   3.783
  923   HG12  VAL 111          2HG1      VAL 111  -1.197 -16.430   4.105
  924   HG13  VAL 111          3HG1      VAL 111   0.105 -16.229   2.931
  925   HG21  VAL 111          3HG2      VAL 111  -1.531 -14.777   0.277
  926   HG22  VAL 111          1HG2      VAL 111  -1.978 -13.582   1.495
  927   HG23  VAL 111          2HG2      VAL 111  -0.340 -14.236   1.462
  928    H    LYS 112           H        LYS 112  -4.318 -17.306   2.459
  929    HA   LYS 112           HA       LYS 112  -3.548 -19.058   4.571
  930    HB2  LYS 112           1HB      LYS 112  -6.288 -18.496   3.423
  931    HB3  LYS 112           2HB      LYS 112  -5.968 -19.320   4.943
  932    HG2  LYS 112           1HG      LYS 112  -5.481 -17.405   6.041
  933    HG3  LYS 112           2HG      LYS 112  -4.772 -16.640   4.617
  934    HD2  LYS 112           1HD      LYS 112  -6.825 -15.505   5.243
  935    HD3  LYS 112           2HD      LYS 112  -7.029 -16.318   3.689
  936    HE2  LYS 112           1HE      LYS 112  -8.544 -17.785   4.508
  937    HE3  LYS 112           2HE      LYS 112  -7.753 -17.889   6.079
  938    HZ1  LYS 112           3HZ      LYS 112  -9.683 -15.875   5.119
  939    HZ2  LYS 112           1HZ      LYS 112  -8.640 -15.527   6.404
  940    HZ3  LYS 112           2HZ      LYS 112  -9.736 -16.809   6.529
  941    H    ASP 113           H        ASP 113  -4.526 -19.497   1.276
  942    HA   ASP 113           HA       ASP 113  -5.321 -22.218   1.472
  943    HB2  ASP 113           1HB      ASP 113  -4.377 -20.573  -0.882
  944    HB3  ASP 113           2HB      ASP 113  -4.997 -22.216  -1.018
  945    H    ILE 114           H        ILE 114  -2.279 -20.632   0.573
  946    HA   ILE 114           HA       ILE 114  -0.817 -22.896  -0.125
  947    HB   ILE 114           HB       ILE 114  -0.067 -20.195   0.898
  948   HG12  ILE 114          1HG1      ILE 114   1.382 -20.571  -1.316
  949   HG13  ILE 114          2HG1      ILE 114   0.127 -21.765  -1.625
  950   HG21  ILE 114          1HG2      ILE 114   1.599 -21.291   2.050
  951   HG22  ILE 114          2HG2      ILE 114   1.689 -22.607   0.880
  952   HG23  ILE 114          3HG2      ILE 114   2.372 -21.030   0.487
  953   HD11  ILE 114          3HD1      ILE 114  -1.551 -20.148  -1.694
  954   HD12  ILE 114          1HD1      ILE 114  -0.539 -18.936  -0.909
  955   HD13  ILE 114          2HD1      ILE 114  -0.201 -19.427  -2.569
  956    H    GLN 115           H        GLN 115   0.150 -24.491   0.980
  957    HA   GLN 115           HA       GLN 115  -0.137 -24.479   3.898
  958    HB2  GLN 115           1HB      GLN 115   0.205 -26.920   3.738
  959    HB3  GLN 115           2HB      GLN 115  -1.167 -26.371   2.785
  960    HG2  GLN 115           1HG      GLN 115   0.920 -26.276   0.995
  961    HG3  GLN 115           2HG      GLN 115   1.268 -27.714   1.953
  962   HE21  GLN 115          1HE2      GLN 115   0.776 -29.239   0.469
  963   HE22  GLN 115          2HE2      GLN 115  -0.803 -29.477  -0.192
  964    H    THR 116           H        THR 116   1.574 -24.433   5.219
  965    HA   THR 116           HA       THR 116   4.212 -25.189   4.255
  966    HB   THR 116           HB       THR 116   5.283 -23.107   4.916
  967    HG1  THR 116           1HG      THR 116   3.610 -21.296   5.223
  968   HG21  THR 116          3HG2      THR 116   4.525 -23.319   2.594
  969   HG22  THR 116          1HG2      THR 116   4.448 -21.645   3.141
  970   HG23  THR 116          2HG2      THR 116   2.973 -22.607   3.033
  971    H    GLN 117           H        GLN 117   5.859 -24.762   6.139
  972    HA   GLN 117           HA       GLN 117   5.161 -26.395   8.273
  973    HB2  GLN 117           1HB      GLN 117   7.489 -25.528   7.421
  974    HB3  GLN 117           2HB      GLN 117   7.243 -24.276   8.630
  975    HG2  GLN 117           1HG      GLN 117   6.861 -27.093   9.466
  976    HG3  GLN 117           2HG      GLN 117   8.506 -26.535   9.167
  977   HE21  GLN 117          1HE2      GLN 117   5.698 -26.248  11.176
  978   HE22  GLN 117          2HE2      GLN 117   6.438 -25.327  12.437
  Start of MODEL    7
    1    H    GLN   1           H        GLN   1   1.878  15.048 -14.774
    2    HA   GLN   1           HA       GLN   1  -0.441  13.807 -13.531
    3    HB2  GLN   1           1HB      GLN   1   0.685  16.446 -12.748
    4    HB3  GLN   1           2HB      GLN   1  -1.064  16.318 -12.872
    5    HG2  GLN   1           1HG      GLN   1  -1.109  14.558 -11.246
    6    HG3  GLN   1           2HG      GLN   1   0.653  14.494 -11.208
    7   HE21  GLN   1          1HE2      GLN   1   1.182  15.136  -9.231
    8   HE22  GLN   1          2HE2      GLN   1   0.663  16.602  -8.480
    9    H    GLU   2           H        GLU   2  -2.280  14.055 -14.697
   10    HA   GLU   2           HA       GLU   2  -2.017  15.364 -17.281
   11    HB2  GLU   2           1HB      GLU   2  -4.255  13.667 -16.160
   12    HB3  GLU   2           2HB      GLU   2  -4.145  14.245 -17.817
   13    HG2  GLU   2           1HG      GLU   2  -2.161  12.406 -16.498
   14    HG3  GLU   2           2HG      GLU   2  -3.468  11.894 -17.564
   15    H    HIS   3           H        HIS   3  -3.851  15.663 -14.303
   16    HA   HIS   3           HA       HIS   3  -5.736  17.558 -15.216
   17    HD1  HIS   3           1HD      HIS   3  -6.039  14.532 -12.451
   18    HD2  HIS   3           2HD      HIS   3  -8.345  17.696 -13.840
   19    HE1  HIS   3           1HE      HIS   3  -8.375  13.623 -12.655
   20    HB2  HIS   3           1HB      HIS   3  -4.756  16.659 -12.542
   21    HB3  HIS   3           2HB      HIS   3  -5.704  18.141 -12.634
   22    H    LYS   4           H        LYS   4  -5.818  19.810 -14.105
   23    HA   LYS   4           HA       LYS   4  -3.236  21.116 -14.632
   24    HB2  LYS   4           1HB      LYS   4  -6.074  21.924 -15.055
   25    HB3  LYS   4           2HB      LYS   4  -4.904  23.187 -14.697
   26    HG2  LYS   4           1HG      LYS   4  -4.840  23.166 -16.982
   27    HG3  LYS   4           2HG      LYS   4  -3.529  22.045 -16.604
   28    HD2  LYS   4           1HD      LYS   4  -4.881  20.159 -17.080
   29    HD3  LYS   4           2HD      LYS   4  -6.351  21.135 -17.120
   30    HE2  LYS   4           1HE      LYS   4  -5.089  22.383 -19.053
   31    HE3  LYS   4           2HE      LYS   4  -4.179  20.876 -19.150
   32    HZ1  LYS   4           3HZ      LYS   4  -6.096  20.901 -20.645
   33    HZ2  LYS   4           1HZ      LYS   4  -7.136  21.095 -19.325
   34    HZ3  LYS   4           2HZ      LYS   4  -6.230  19.676 -19.486
   35    HA   PRO   5           HA       PRO   5  -2.853  22.579 -10.513
   36    HB2  PRO   5           1HB      PRO   5  -1.922  25.103 -10.868
   37    HB3  PRO   5           2HB      PRO   5  -0.940  23.666 -11.174
   38    HG2  PRO   5           1HG      PRO   5  -2.434  25.388 -13.115
   39    HG3  PRO   5           2HG      PRO   5  -0.805  24.698 -13.254
   40    HD2  PRO   5           1HD      PRO   5  -2.959  23.607 -14.479
   41    HD3  PRO   5           2HD      PRO   5  -1.599  22.630 -13.889
   42    H    LYS   6           H        LYS   6  -3.601  24.167  -8.940
   43    HA   LYS   6           HA       LYS   6  -5.254  25.356  -7.926
   44    HB2  LYS   6           1HB      LYS   6  -5.198  26.610 -10.659
   45    HB3  LYS   6           2HB      LYS   6  -6.336  27.155  -9.433
   46    HG2  LYS   6           1HG      LYS   6  -3.366  27.057  -8.990
   47    HG3  LYS   6           2HG      LYS   6  -4.212  28.476  -9.612
   48    HD2  LYS   6           1HD      LYS   6  -5.247  28.903  -7.611
   49    HD3  LYS   6           2HD      LYS   6  -5.218  27.210  -7.111
   50    HE2  LYS   6           1HE      LYS   6  -2.708  28.842  -7.354
   51    HE3  LYS   6           2HE      LYS   6  -3.677  28.838  -5.881
   52    HZ1  LYS   6           3HZ      LYS   6  -1.708  27.093  -6.419
   53    HZ2  LYS   6           1HZ      LYS   6  -3.066  26.213  -6.916
   54    HZ3  LYS   6           2HZ      LYS   6  -2.972  26.802  -5.333
   55    H    LYS   7           H        LYS   7  -5.930  22.810  -9.099
   56    HA   LYS   7           HA       LYS   7  -8.416  22.898 -10.437
   57    HB2  LYS   7           1HB      LYS   7  -8.613  20.508  -9.678
   58    HB3  LYS   7           2HB      LYS   7  -7.134  20.887 -10.550
   59    HG2  LYS   7           1HG      LYS   7  -5.840  20.843  -8.583
   60    HG3  LYS   7           2HG      LYS   7  -7.273  20.867  -7.552
   61    HD2  LYS   7           1HD      LYS   7  -7.895  18.639  -8.485
   62    HD3  LYS   7           2HD      LYS   7  -6.349  18.619  -9.338
   63    HE2  LYS   7           1HE      LYS   7  -6.753  18.752  -6.351
   64    HE3  LYS   7           2HE      LYS   7  -6.191  17.356  -7.271
   65    HZ1  LYS   7           3HZ      LYS   7  -4.778  19.894  -6.738
   66    HZ2  LYS   7           1HZ      LYS   7  -4.319  18.889  -8.019
   67    HZ3  LYS   7           2HZ      LYS   7  -4.263  18.312  -6.431
   68    H    ASP   8           H        ASP   8  -7.522  22.943  -7.051
   69    HA   ASP   8           HA       ASP   8 -10.378  23.154  -6.350
   70    HB2  ASP   8           1HB      ASP   8  -8.079  21.859  -4.924
   71    HB3  ASP   8           2HB      ASP   8  -9.447  22.475  -4.000
   72    H    ASP   9           H        ASP   9 -10.941  25.159  -5.859
   73    HA   ASP   9           HA       ASP   9  -8.941  27.091  -5.027
   74    HB2  ASP   9           1HB      ASP   9 -10.708  27.631  -6.723
   75    HB3  ASP   9           2HB      ASP   9 -11.906  27.513  -5.439
   76    H    PHE  10           H        PHE  10 -11.980  25.750  -3.763
   77    HA   PHE  10           HA       PHE  10 -11.981  27.140  -1.327
   78    HD1  PHE  10           1HD      PHE  10 -13.398  27.438   0.214
   79    HD2  PHE  10           2HD      PHE  10 -14.296  23.307  -0.279
   80    HE1  PHE  10           1HE      PHE  10 -14.300  27.364   2.502
   81    HE2  PHE  10           2HE      PHE  10 -15.201  23.227   2.007
   82    HZ   PHE  10           HZ       PHE  10 -15.204  25.257   3.400
   83    HB2  PHE  10           1HB      PHE  10 -13.948  25.947  -2.204
   84    HB3  PHE  10           2HB      PHE  10 -13.133  24.409  -1.936
   85    H    ARG  11           H        ARG  11 -11.117  26.735   0.656
   86    HA   ARG  11           HA       ARG  11  -9.120  24.577   0.782
   87    HE   ARG  11           HE       ARG  11 -10.061  29.405   4.149
   88    HB2  ARG  11           1HB      ARG  11  -8.030  25.939   2.541
   89    HB3  ARG  11           2HB      ARG  11  -8.128  26.774   0.996
   90    HG2  ARG  11           1HG      ARG  11  -9.789  28.228   1.753
   91    HG3  ARG  11           2HG      ARG  11 -10.186  27.200   3.130
   92    HD2  ARG  11           1HD      ARG  11  -7.822  27.662   3.951
   93    HD3  ARG  11           2HD      ARG  11  -7.762  28.932   2.730
   94   HH11  ARG  11          1HH1      ARG  11  -6.671  29.132   4.895
   95   HH12  ARG  11          2HH1      ARG  11  -6.745  30.227   6.236
   96   HH21  ARG  11          1HH2      ARG  11 -10.171  30.848   5.913
   97   HH22  ARG  11          2HH2      ARG  11  -8.737  31.202   6.814
   98    H    ASN  12           H        ASN  12  -8.651  24.073   3.260
   99    HA   ASN  12           HA       ASN  12 -11.232  23.669   4.616
  100    HB2  ASN  12           1HB      ASN  12 -10.190  21.432   5.385
  101    HB3  ASN  12           2HB      ASN  12 -10.829  21.530   3.747
  102   HD21  ASN  12          1HD2      ASN  12  -7.921  21.532   5.688
  103   HD22  ASN  12          2HD2      ASN  12  -6.842  21.077   4.417
  104    H    GLU  13           H        GLU  13 -11.044  23.259   6.937
  105    HA   GLU  13           HA       GLU  13  -8.674  24.590   8.072
  106    HB2  GLU  13           1HB      GLU  13 -10.688  25.914   8.382
  107    HB3  GLU  13           2HB      GLU  13 -11.520  24.534   9.084
  108    HG2  GLU  13           1HG      GLU  13 -10.657  26.292  10.685
  109    HG3  GLU  13           2HG      GLU  13 -10.249  24.616  11.045
  110    H    PHE  14           H        PHE  14 -10.894  21.897   8.341
  111    HA   PHE  14           HA       PHE  14  -9.953  20.875  10.802
  112    HD1  PHE  14           1HD      PHE  14 -11.540  19.840  12.218
  113    HD2  PHE  14           2HD      PHE  14 -13.591  20.461   8.541
  114    HE1  PHE  14           1HE      PHE  14 -13.549  20.533  13.458
  115    HE2  PHE  14           2HE      PHE  14 -15.602  21.156   9.775
  116    HZ   PHE  14           HZ       PHE  14 -15.583  21.195  12.237
  117    HB2  PHE  14           1HB      PHE  14 -11.450  19.665   8.489
  118    HB3  PHE  14           2HB      PHE  14 -10.944  18.682   9.860
  119    H    ASP  15           H        ASP  15  -8.814  18.770  11.040
  120    HA   ASP  15           HA       ASP  15  -6.294  18.877   9.724
  121    HB2  ASP  15           1HB      ASP  15  -6.671  18.093  12.084
  122    HB3  ASP  15           2HB      ASP  15  -7.377  16.622  11.420
  123    H    HIS  16           H        HIS  16  -9.153  16.855   9.396
  124    HA   HIS  16           HA       HIS  16  -8.192  15.952   6.805
  125    HD1  HIS  16           1HD      HIS  16  -6.549  12.969   9.743
  126    HD2  HIS  16           2HD      HIS  16  -6.389  14.663   5.952
  127    HE1  HIS  16           1HE      HIS  16  -4.183  12.642   8.960
  128    HB2  HIS  16           1HB      HIS  16  -8.658  14.146   9.150
  129    HB3  HIS  16           2HB      HIS  16  -9.003  13.562   7.524
  130    H    LEU  17           H        LEU  17  -9.832  15.337   5.391
  131    HA   LEU  17           HA       LEU  17 -12.554  15.935   6.339
  132    HG   LEU  17           HG       LEU  17 -12.342  18.575   3.777
  133    HB2  LEU  17           1HB      LEU  17 -11.126  16.469   3.783
  134    HB3  LEU  17           2HB      LEU  17 -12.867  16.198   3.733
  135   HD11  LEU  17          1HD1      LEU  17 -14.242  18.837   4.884
  136   HD12  LEU  17          2HD1      LEU  17 -13.405  18.585   6.416
  137   HD13  LEU  17          3HD1      LEU  17 -14.076  17.209   5.542
  138   HD21  LEU  17          3HD2      LEU  17 -10.961  19.588   5.258
  139   HD22  LEU  17          1HD2      LEU  17 -10.233  17.982   5.306
  140   HD23  LEU  17          2HD2      LEU  17 -11.364  18.475   6.567
  141    H    LEU  18           H        LEU  18 -14.248  14.879   4.791
  142    HA   LEU  18           HA       LEU  18 -14.136  12.107   5.177
  143    HG   LEU  18           HG       LEU  18 -16.281  14.112   5.803
  144    HB2  LEU  18           1HB      LEU  18 -15.862  13.799   3.384
  145    HB3  LEU  18           2HB      LEU  18 -16.096  12.064   3.594
  146   HD11  LEU  18          1HD1      LEU  18 -18.209  14.594   4.725
  147   HD12  LEU  18          2HD1      LEU  18 -18.765  13.149   5.569
  148   HD13  LEU  18          3HD1      LEU  18 -18.257  13.045   3.882
  149   HD21  LEU  18          3HD2      LEU  18 -17.577  11.568   6.235
  150   HD22  LEU  18          1HD2      LEU  18 -16.395  12.414   7.234
  151   HD23  LEU  18          2HD2      LEU  18 -15.852  11.364   5.925
  152    H    ILE  19           H        ILE  19 -14.473  13.583   1.962
  153    HA   ILE  19           HA       ILE  19 -13.583  11.426   0.496
  154    HB   ILE  19           HB       ILE  19 -13.362  14.367  -0.134
  155   HG12  ILE  19          1HG1      ILE  19 -15.644  13.423   0.138
  156   HG13  ILE  19          2HG1      ILE  19 -15.330  13.982  -1.500
  157   HG21  ILE  19          1HG2      ILE  19 -13.096  13.613  -2.502
  158   HG22  ILE  19          2HG2      ILE  19 -11.709  13.276  -1.466
  159   HG23  ILE  19          3HG2      ILE  19 -12.827  11.980  -1.892
  160   HD11  ILE  19          3HD1      ILE  19 -16.210  11.441  -0.643
  161   HD12  ILE  19          1HD1      ILE  19 -15.893  12.000  -2.285
  162   HD13  ILE  19          2HD1      ILE  19 -14.605  11.245  -1.346
  163    H    GLU  20           H        GLU  20 -11.682  14.093   1.848
  164    HA   GLU  20           HA       GLU  20  -9.220  13.567   0.721
  165    HB2  GLU  20           1HB      GLU  20 -10.050  14.709   3.365
  166    HB3  GLU  20           2HB      GLU  20  -8.346  14.433   3.031
  167    HG2  GLU  20           1HG      GLU  20  -8.770  15.777   0.880
  168    HG3  GLU  20           2HG      GLU  20 -10.245  16.309   1.686
  169    H    GLN  21           H        GLN  21 -10.464  12.289   3.808
  170    HA   GLN  21           HA       GLN  21  -8.280  10.611   4.347
  171    HB2  GLN  21           1HB      GLN  21 -11.107  10.766   5.290
  172    HB3  GLN  21           2HB      GLN  21 -10.179   9.320   5.668
  173    HG2  GLN  21           1HG      GLN  21  -8.991  11.985   6.247
  174    HG3  GLN  21           2HG      GLN  21 -10.245  11.352   7.312
  175   HE21  GLN  21          1HE2      GLN  21  -8.804  11.177   9.029
  176   HE22  GLN  21          2HE2      GLN  21  -7.600   9.939   9.094
  177    H    ALA  22           H        ALA  22 -11.263  10.068   2.546
  178    HA   ALA  22           HA       ALA  22 -11.008   7.290   2.199
  179    HB1  ALA  22           3HB      ALA  22 -12.821   7.442   0.832
  180    HB2  ALA  22           1HB      ALA  22 -12.952   9.005   1.637
  181    HB3  ALA  22           2HB      ALA  22 -12.235   8.899   0.029
  182    H    ASN  23           H        ASN  23  -9.921  10.004   0.181
  183    HA   ASN  23           HA       ASN  23  -8.854   8.452  -1.910
  184    HB2  ASN  23           1HB      ASN  23  -8.725  11.261  -1.044
  185    HB3  ASN  23           2HB      ASN  23  -7.311  10.712  -1.939
  186   HD21  ASN  23          1HD2      ASN  23 -10.777  11.141  -2.046
  187   HD22  ASN  23          2HD2      ASN  23 -10.920  11.127  -3.768
  188    H    HIS  24           H        HIS  24  -7.406   9.730   1.054
  189    HA   HIS  24           HA       HIS  24  -4.758   8.924   0.510
  190    HD1  HIS  24           1HD      HIS  24  -4.165   9.464   5.043
  191    HD2  HIS  24           2HD      HIS  24  -2.635   9.533   1.181
  192    HE1  HIS  24           1HE      HIS  24  -1.665   9.447   5.310
  193    HB2  HIS  24           1HB      HIS  24  -5.601  10.549   2.311
  194    HB3  HIS  24           2HB      HIS  24  -5.935   9.116   3.278
  195    H    ALA  25           H        ALA  25  -7.459   7.306   2.104
  196    HA   ALA  25           HA       ALA  25  -6.028   5.059   3.034
  197    HB1  ALA  25           3HB      ALA  25  -8.948   5.227   2.299
  198    HB2  ALA  25           1HB      ALA  25  -8.191   4.011   3.328
  199    HB3  ALA  25           2HB      ALA  25  -8.260   5.693   3.855
  200    H    ILE  26           H        ILE  26  -8.007   5.518   0.107
  201    HA   ILE  26           HA       ILE  26  -7.534   2.950  -0.962
  202    HB   ILE  26           HB       ILE  26  -8.341   3.859  -3.088
  203   HG12  ILE  26          1HG1      ILE  26  -8.278   6.530  -1.665
  204   HG13  ILE  26          2HG1      ILE  26  -7.216   6.044  -2.982
  205   HG21  ILE  26          1HG2      ILE  26 -10.308   5.209  -1.518
  206   HG22  ILE  26          2HG2      ILE  26 -10.385   3.613  -2.265
  207   HG23  ILE  26          3HG2      ILE  26  -9.730   3.794  -0.638
  208   HD11  ILE  26          3HD1      ILE  26  -8.680   6.950  -4.368
  209   HD12  ILE  26          1HD1      ILE  26  -9.787   5.641  -3.955
  210   HD13  ILE  26          2HD1      ILE  26  -9.860   7.168  -3.075
  211    H    GLU  27           H        GLU  27  -5.753   5.957  -1.125
  212    HA   GLU  27           HA       GLU  27  -4.065   5.280  -3.292
  213    HB2  GLU  27           1HB      GLU  27  -4.408   7.589  -2.387
  214    HB3  GLU  27           2HB      GLU  27  -3.443   7.135  -0.989
  215    HG2  GLU  27           1HG      GLU  27  -1.485   6.973  -2.239
  216    HG3  GLU  27           2HG      GLU  27  -2.359   6.877  -3.766
  217    H    LYS  28           H        LYS  28  -3.538   5.148   0.229
  218    HA   LYS  28           HA       LYS  28  -0.990   3.912   0.038
  219    HB2  LYS  28           1HB      LYS  28  -1.666   5.170   2.021
  220    HB3  LYS  28           2HB      LYS  28  -2.948   4.009   2.341
  221    HG2  LYS  28           1HG      LYS  28  -1.158   2.257   2.562
  222    HG3  LYS  28           2HG      LYS  28   0.020   3.570   2.511
  223    HD2  LYS  28           1HD      LYS  28  -2.255   3.510   4.479
  224    HD3  LYS  28           2HD      LYS  28  -0.689   2.768   4.814
  225    HE2  LYS  28           1HE      LYS  28  -0.349   4.838   5.721
  226    HE3  LYS  28           2HE      LYS  28   0.208   5.132   4.074
  227    HZ1  LYS  28           3HZ      LYS  28  -2.593   5.568   4.316
  228    HZ2  LYS  28           1HZ      LYS  28  -1.388   6.622   3.769
  229    HZ3  LYS  28           2HZ      LYS  28  -1.738   6.522   5.421
  230    H    GLY  29           H        GLY  29  -4.275   2.692   0.314
  231    HA2  GLY  29           1HA      GLY  29  -3.539  -0.013   0.850
  232    HA3  GLY  29           2HA      GLY  29  -5.117   0.548   0.319
  233    H    GLU  30           H        GLU  30  -4.637   1.637  -2.110
  234    HA   GLU  30           HA       GLU  30  -4.454  -0.623  -3.778
  235    HB2  GLU  30           1HB      GLU  30  -4.803   0.843  -5.586
  236    HB3  GLU  30           2HB      GLU  30  -5.647   1.588  -4.235
  237    HG2  GLU  30           1HG      GLU  30  -4.577   3.397  -5.120
  238    HG3  GLU  30           2HG      GLU  30  -3.395   2.874  -3.921
  239    H    HIS  31           H        HIS  31  -2.118   1.854  -2.885
  240    HA   HIS  31           HA       HIS  31  -0.123   1.104  -4.757
  241    HD1  HIS  31           1HD      HIS  31   2.512   2.583  -1.410
  242    HD2  HIS  31           2HD      HIS  31   2.140   2.600  -5.548
  243    HE1  HIS  31           1HE      HIS  31   4.860   2.734  -2.296
  244    HB2  HIS  31           1HB      HIS  31  -0.131   3.304  -3.677
  245    HB3  HIS  31           2HB      HIS  31   0.150   2.548  -2.111
  246    H    GLN  32           H        GLN  32  -0.441   0.461  -1.264
  247    HA   GLN  32           HA       GLN  32   1.791  -1.237  -1.075
  248    HB2  GLN  32           1HB      GLN  32   1.018  -1.795   1.091
  249    HB3  GLN  32           2HB      GLN  32   0.529  -0.127   0.825
  250    HG2  GLN  32           1HG      GLN  32  -1.730  -0.853   0.303
  251    HG3  GLN  32           2HG      GLN  32  -1.249  -2.536   0.517
  252   HE21  GLN  32          1HE2      GLN  32   0.162  -2.595   2.751
  253   HE22  GLN  32          2HE2      GLN  32  -0.758  -2.039   4.103
  254    H    LEU  33           H        LEU  33  -1.550  -1.835  -1.947
  255    HA   LEU  33           HA       LEU  33  -1.418  -4.672  -1.791
  256    HG   LEU  33           HG       LEU  33  -4.912  -4.848  -2.900
  257    HB2  LEU  33           1HB      LEU  33  -3.528  -3.444  -1.708
  258    HB3  LEU  33           2HB      LEU  33  -3.278  -2.894  -3.364
  259   HD11  LEU  33          1HD1      LEU  33  -3.528  -4.019  -5.095
  260   HD12  LEU  33          2HD1      LEU  33  -4.786  -5.253  -5.096
  261   HD13  LEU  33          3HD1      LEU  33  -3.090  -5.725  -5.013
  262   HD21  LEU  33          3HD2      LEU  33  -4.094  -6.942  -2.505
  263   HD22  LEU  33          1HD2      LEU  33  -2.914  -5.991  -1.602
  264   HD23  LEU  33          2HD2      LEU  33  -2.519  -6.583  -3.216
  265    H    LEU  34           H        LEU  34  -1.165  -2.368  -4.485
  266    HA   LEU  34           HA       LEU  34  -0.849  -4.228  -6.544
  267    HG   LEU  34           HG       LEU  34  -2.377  -1.852  -6.685
  268    HB2  LEU  34           1HB      LEU  34   0.054  -1.390  -6.198
  269    HB3  LEU  34           2HB      LEU  34   0.440  -2.301  -7.655
  270   HD11  LEU  34          1HD1      LEU  34  -1.328   0.305  -7.136
  271   HD12  LEU  34          2HD1      LEU  34  -2.532  -0.089  -8.363
  272   HD13  LEU  34          3HD1      LEU  34  -0.815  -0.270  -8.723
  273   HD21  LEU  34          3HD2      LEU  34  -2.875  -3.301  -8.290
  274   HD22  LEU  34          1HD2      LEU  34  -1.181  -3.424  -8.762
  275   HD23  LEU  34          2HD2      LEU  34  -2.205  -2.175  -9.470
  276    H    TYR  35           H        TYR  35   1.554  -2.687  -4.449
  277    HA   TYR  35           HA       TYR  35   3.790  -3.922  -5.731
  278    HD1  TYR  35           1HD      TYR  35   4.429  -3.886  -1.536
  279    HD2  TYR  35           2HD      TYR  35   6.563  -2.684  -5.015
  280    HE1  TYR  35           1HE      TYR  35   6.522  -4.684  -0.521
  281    HE2  TYR  35           2HE      TYR  35   8.662  -3.480  -4.009
  282    HH   TYR  35           HH       TYR  35   9.622  -4.036  -1.951
  283    HB2  TYR  35           1HB      TYR  35   4.300  -1.916  -4.623
  284    HB3  TYR  35           2HB      TYR  35   3.421  -2.386  -3.173
  285    H    LEU  36           H        LEU  36   1.736  -4.695  -2.997
  286    HA   LEU  36           HA       LEU  36   3.353  -6.773  -1.936
  287    HG   LEU  36           HG       LEU  36   2.453  -5.021  -0.146
  288    HB2  LEU  36           1HB      LEU  36   0.540  -5.870  -1.598
  289    HB3  LEU  36           2HB      LEU  36   0.971  -7.484  -1.033
  290   HD11  LEU  36          1HD1      LEU  36  -0.225  -5.502   0.373
  291   HD12  LEU  36          2HD1      LEU  36   0.854  -4.450   1.288
  292   HD13  LEU  36          3HD1      LEU  36   0.612  -6.121   1.797
  293   HD21  LEU  36          3HD2      LEU  36   3.770  -6.634   0.671
  294   HD22  LEU  36          1HD2      LEU  36   2.556  -7.888   0.414
  295   HD23  LEU  36          2HD2      LEU  36   2.491  -6.880   1.861
  296    H    GLN  37           H        GLN  37   0.994  -6.610  -4.491
  297    HA   GLN  37           HA       GLN  37   0.193  -9.227  -4.759
  298    HB2  GLN  37           1HB      GLN  37   0.682  -7.027  -6.723
  299    HB3  GLN  37           2HB      GLN  37   0.311  -8.638  -7.323
  300    HG2  GLN  37           1HG      GLN  37  -1.422  -7.242  -5.312
  301    HG3  GLN  37           2HG      GLN  37  -1.624  -7.024  -7.049
  302   HE21  GLN  37          1HE2      GLN  37  -2.735  -8.676  -4.473
  303   HE22  GLN  37          2HE2      GLN  37  -3.348 -10.087  -5.258
  304    H    HIS  38           H        HIS  38   3.220  -7.749  -5.808
  305    HA   HIS  38           HA       HIS  38   4.247  -9.864  -7.307
  306    HD1  HIS  38           1HD      HIS  38   3.651  -7.044  -8.094
  307    HD2  HIS  38           2HD      HIS  38   7.638  -8.063  -8.664
  308    HE1  HIS  38           1HE      HIS  38   4.242  -6.189 -10.383
  309    HB2  HIS  38           1HB      HIS  38   5.435  -7.570  -5.820
  310    HB3  HIS  38           2HB      HIS  38   6.516  -8.857  -6.348
  311    H    GLN  39           H        GLN  39   4.827  -9.115  -3.869
  312    HA   GLN  39           HA       GLN  39   6.373 -11.351  -3.270
  313    HB2  GLN  39           1HB      GLN  39   4.434  -9.986  -1.397
  314    HB3  GLN  39           2HB      GLN  39   5.854 -10.921  -0.948
  315    HG2  GLN  39           1HG      GLN  39   5.710  -8.198  -2.179
  316    HG3  GLN  39           2HG      GLN  39   6.513  -8.706  -0.695
  317   HE21  GLN  39          1HE2      GLN  39   8.218 -10.483  -1.133
  318   HE22  GLN  39          2HE2      GLN  39   9.302 -10.153  -2.436
  319    H    LEU  40           H        LEU  40   2.865 -10.943  -3.266
  320    HA   LEU  40           HA       LEU  40   2.155 -13.366  -2.076
  321    HG   LEU  40           HG       LEU  40  -0.089 -13.958  -4.328
  322    HB2  LEU  40           1HB      LEU  40   0.466 -11.759  -2.351
  323    HB3  LEU  40           2HB      LEU  40   0.787 -11.597  -4.076
  324   HD11  LEU  40          1HD1      LEU  40  -0.137 -14.985  -2.298
  325   HD12  LEU  40          2HD1      LEU  40  -1.790 -14.374  -2.345
  326   HD13  LEU  40          3HD1      LEU  40  -0.556 -13.507  -1.432
  327   HD21  LEU  40          3HD2      LEU  40  -1.499 -11.471  -3.920
  328   HD22  LEU  40          1HD2      LEU  40  -2.507 -12.857  -3.500
  329   HD23  LEU  40          2HD2      LEU  40  -1.784 -12.747  -5.105
  330    H    ASP  41           H        ASP  41   2.403 -12.591  -5.549
  331    HA   ASP  41           HA       ASP  41   1.880 -15.141  -6.533
  332    HB2  ASP  41           1HB      ASP  41   2.114 -12.918  -7.807
  333    HB3  ASP  41           2HB      ASP  41   3.841 -13.264  -7.836
  334    H    GLU  42           H        GLU  42   4.937 -13.685  -5.514
  335    HA   GLU  42           HA       GLU  42   6.580 -15.852  -6.310
  336    HB2  GLU  42           1HB      GLU  42   7.645 -13.761  -5.972
  337    HB3  GLU  42           2HB      GLU  42   6.963 -13.588  -4.361
  338    HG2  GLU  42           1HG      GLU  42   8.536 -14.892  -3.400
  339    HG3  GLU  42           2HG      GLU  42   8.695 -15.934  -4.811
  340    H    LEU  43           H        LEU  43   4.855 -15.083  -3.344
  341    HA   LEU  43           HA       LEU  43   6.025 -17.144  -1.772
  342    HG   LEU  43           HG       LEU  43   3.915 -16.099   1.058
  343    HB2  LEU  43           1HB      LEU  43   4.960 -15.179  -0.786
  344    HB3  LEU  43           2HB      LEU  43   3.405 -15.692  -1.437
  345   HD11  LEU  43          1HD1      LEU  43   2.257 -17.313  -0.768
  346   HD12  LEU  43          2HD1      LEU  43   2.179 -17.493   0.984
  347   HD13  LEU  43          3HD1      LEU  43   3.059 -18.675   0.015
  348   HD21  LEU  43          3HD2      LEU  43   6.155 -17.260   0.218
  349   HD22  LEU  43          1HD2      LEU  43   5.102 -18.673   0.192
  350   HD23  LEU  43          2HD2      LEU  43   5.322 -17.767   1.689
  351    H    ASN  44           H        ASN  44   3.314 -16.982  -3.964
  352    HA   ASN  44           HA       ASN  44   1.885 -19.241  -3.199
  353    HB2  ASN  44           1HB      ASN  44   2.225 -17.733  -5.746
  354    HB3  ASN  44           2HB      ASN  44   1.472 -19.323  -5.832
  355   HD21  ASN  44          1HD2      ASN  44   1.289 -16.828  -3.333
  356   HD22  ASN  44          2HD2      ASN  44  -0.423 -16.618  -3.422
  357    H    GLU  45           H        GLU  45   4.666 -18.959  -5.380
  358    HA   GLU  45           HA       GLU  45   4.759 -21.847  -5.728
  359    HB2  GLU  45           1HB      GLU  45   5.233 -20.052  -7.545
  360    HB3  GLU  45           2HB      GLU  45   6.811 -19.925  -6.782
  361    HG2  GLU  45           1HG      GLU  45   7.157 -21.438  -8.499
  362    HG3  GLU  45           2HG      GLU  45   6.944 -22.467  -7.083
  363    H    ASN  46           H        ASN  46   6.750 -19.257  -4.351
  364    HA   ASN  46           HA       ASN  46   8.932 -20.785  -3.544
  365    HB2  ASN  46           1HB      ASN  46   8.797 -18.286  -3.506
  366    HB3  ASN  46           2HB      ASN  46   7.788 -18.405  -2.068
  367   HD21  ASN  46          1HD2      ASN  46   9.520 -17.071  -1.164
  368   HD22  ASN  46          2HD2      ASN  46  10.912 -17.857  -0.508
  369    H    LYS  47           H        LYS  47   5.792 -20.338  -2.054
  370    HA   LYS  47           HA       LYS  47   4.802 -21.259  -0.220
  371    HB2  LYS  47           1HB      LYS  47   6.688 -23.548  -0.811
  372    HB3  LYS  47           2HB      LYS  47   5.199 -23.640   0.120
  373    HG2  LYS  47           1HG      LYS  47   5.113 -22.675  -2.701
  374    HG3  LYS  47           2HG      LYS  47   5.243 -24.404  -2.365
  375    HD2  LYS  47           1HD      LYS  47   3.250 -23.945  -0.740
  376    HD3  LYS  47           2HD      LYS  47   3.019 -22.506  -1.738
  377    HE2  LYS  47           1HE      LYS  47   1.735 -23.922  -2.948
  378    HE3  LYS  47           2HE      LYS  47   3.286 -24.343  -3.669
  379    HZ1  LYS  47           3HZ      LYS  47   2.720 -26.414  -3.097
  380    HZ2  LYS  47           1HZ      LYS  47   1.557 -25.912  -1.976
  381    HZ3  LYS  47           2HZ      LYS  47   3.189 -25.974  -1.533
  382    H    SER  48           H        SER  48   6.983 -19.538   0.345
  383    HA   SER  48           HA       SER  48   8.680 -20.702   2.328
  384    HG   SER  48           HG       SER  48   9.898 -17.487   3.062
  385    HB2  SER  48           1HB      SER  48   9.678 -18.831   1.418
  386    HB3  SER  48           2HB      SER  48   8.159 -17.942   1.309
  387    H    LYS  49           H        LYS  49   8.306 -21.021   4.422
  388    HA   LYS  49           HA       LYS  49   5.750 -20.665   5.551
  389    HB2  LYS  49           1HB      LYS  49   6.885 -21.277   7.702
  390    HB3  LYS  49           2HB      LYS  49   7.154 -22.413   6.387
  391    HG2  LYS  49           1HG      LYS  49   9.279 -20.752   6.089
  392    HG3  LYS  49           2HG      LYS  49   9.053 -20.722   7.839
  393    HD2  LYS  49           1HD      LYS  49   9.642 -22.897   8.085
  394    HD3  LYS  49           2HD      LYS  49   8.917 -23.376   6.548
  395    HE2  LYS  49           1HE      LYS  49  10.872 -22.028   5.502
  396    HE3  LYS  49           2HE      LYS  49  11.620 -22.205   7.088
  397    HZ1  LYS  49           3HZ      LYS  49  11.499 -24.576   6.888
  398    HZ2  LYS  49           1HZ      LYS  49  12.255 -23.962   5.504
  399    HZ3  LYS  49           2HZ      LYS  49  10.644 -24.468   5.433
  400    H    GLU  50           H        GLU  50   8.793 -18.894   6.034
  401    HA   GLU  50           HA       GLU  50   7.732 -17.054   7.911
  402    HB2  GLU  50           1HB      GLU  50   9.780 -15.728   7.412
  403    HB3  GLU  50           2HB      GLU  50  10.108 -17.408   7.815
  404    HG2  GLU  50           1HG      GLU  50  10.289 -17.899   5.391
  405    HG3  GLU  50           2HG      GLU  50  10.110 -16.174   5.072
  406    H    LEU  51           H        LEU  51   8.259 -16.896   4.409
  407    HA   LEU  51           HA       LEU  51   7.467 -14.237   4.029
  408    HG   LEU  51           HG       LEU  51   6.214 -14.364   1.211
  409    HB2  LEU  51           1HB      LEU  51   8.611 -15.770   2.381
  410    HB3  LEU  51           2HB      LEU  51   7.029 -16.481   2.072
  411   HD11  LEU  51          1HD1      LEU  51   8.302 -12.703   0.813
  412   HD12  LEU  51          2HD1      LEU  51   8.721 -13.373   2.389
  413   HD13  LEU  51          3HD1      LEU  51   7.170 -12.564   2.159
  414   HD21  LEU  51          3HD2      LEU  51   8.746 -14.493  -0.262
  415   HD22  LEU  51          1HD2      LEU  51   7.089 -14.715  -0.824
  416   HD23  LEU  51          2HD2      LEU  51   7.941 -16.049  -0.044
  417    H    GLN  52           H        GLN  52   5.600 -17.221   4.181
  418    HA   GLN  52           HA       GLN  52   3.130 -16.063   3.379
  419    HB2  GLN  52           1HB      GLN  52   3.580 -18.481   3.233
  420    HB3  GLN  52           2HB      GLN  52   3.644 -18.571   4.988
  421    HG2  GLN  52           1HG      GLN  52   1.242 -17.542   4.817
  422    HG3  GLN  52           2HG      GLN  52   1.303 -18.217   3.189
  423   HE21  GLN  52          1HE2      GLN  52   0.062 -18.834   6.028
  424   HE22  GLN  52          2HE2      GLN  52   0.188 -20.555   6.100
  425    H    GLU  53           H        GLU  53   4.355 -17.065   6.575
  426    HA   GLU  53           HA       GLU  53   2.205 -16.118   8.080
  427    HB2  GLU  53           1HB      GLU  53   5.057 -16.757   8.662
  428    HB3  GLU  53           2HB      GLU  53   4.149 -15.863   9.874
  429    HG2  GLU  53           1HG      GLU  53   2.524 -17.626  10.032
  430    HG3  GLU  53           2HG      GLU  53   3.287 -18.498   8.704
  431    H    LYS  54           H        LYS  54   4.931 -14.450   6.696
  432    HA   LYS  54           HA       LYS  54   4.633 -12.056   8.238
  433    HB2  LYS  54           1HB      LYS  54   6.166 -12.764   5.747
  434    HB3  LYS  54           2HB      LYS  54   6.100 -11.109   6.340
  435    HG2  LYS  54           1HG      LYS  54   6.888 -13.254   8.238
  436    HG3  LYS  54           2HG      LYS  54   8.050 -12.741   7.012
  437    HD2  LYS  54           1HD      LYS  54   8.601 -11.208   8.578
  438    HD3  LYS  54           2HD      LYS  54   7.220 -10.340   7.