NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
526564 2lmd 18112 cing 4-filtered-FRED STAR entry full 1717


data_FRED_restraints_with_modified_coordinates_PDB_code_2lmd

# This FRED archive file contains, for PDB entry <2lmd>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, WF Vranken, C Schulte, J Lin, JR Wedell, CJ Penkett, GW Vuister, 
# G Vriend, JL Markley, and EL Ulrich (2009). The NMR Restraints Grid at BMRB for 
# 5,266 Protein and Nucleic Acid PDB Entries. J Biomol. NMR 45, 389?396.




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.PDB_coordinate_file_version  .
    _Entry.Sf_category                  entry_information
    _Entry.ID                           1
    _Entry.Title                        "Data for entry 1"
    _Entry.NMR_STAR_version             3.1.0.8
    _Entry.Experimental_method          NMR
    _Entry.Details                      .

save_


save_assembly_2lmd
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2lmd
    _Assembly.Number_of_components  1
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "all free"
    _Assembly.Molecular_mass        20702.60

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $Prospero_homeobox_protein_1 A . 1 1 
    stop_

save_


save_Prospero_homeobox_protein_1
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "Prospero homeobox protein 1"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  MGHHHHHHSHMAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE
    _Entity.Number_of_monomers           174

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

         1 MET . 1 1 
         2 GLY . 1 1 
         3 HIS . 1 1 
         4 HIS . 1 1 
         5 HIS . 1 1 
         6 HIS . 1 1 
         7 HIS . 1 1 
         8 HIS . 1 1 
         9 SER . 1 1 
        10 HIS . 1 1 
        11 MET . 1 1 
        12 ALA . 1 1 
        13 MET . 1 1 
        14 GLN . 1 1 
        15 GLU . 1 1 
        16 GLY . 1 1 
        17 LEU . 1 1 
        18 SER . 1 1 
        19 PRO . 1 1 
        20 ASN . 1 1 
        21 HIS . 1 1 
        22 LEU . 1 1 
        23 LYS . 1 1 
        24 LYS . 1 1 
        25 ALA . 1 1 
        26 LYS . 1 1 
        27 LEU . 1 1 
        28 MET . 1 1 
        29 PHE . 1 1 
        30 PHE . 1 1 
        31 TYR . 1 1 
        32 THR . 1 1 
        33 ARG . 1 1 
        34 TYR . 1 1 
        35 PRO . 1 1 
        36 SER . 1 1 
        37 SER . 1 1 
        38 ASN . 1 1 
        39 MET . 1 1 
        40 LEU . 1 1 
        41 LYS . 1 1 
        42 THR . 1 1 
        43 TYR . 1 1 
        44 PHE . 1 1 
        45 SER . 1 1 
        46 ASP . 1 1 
        47 VAL . 1 1 
        48 LYS . 1 1 
        49 PHE . 1 1 
        50 ASN . 1 1 
        51 ARG . 1 1 
        52 CYS . 1 1 
        53 ILE . 1 1 
        54 THR . 1 1 
        55 SER . 1 1 
        56 GLN . 1 1 
        57 LEU . 1 1 
        58 ILE . 1 1 
        59 LYS . 1 1 
        60 TRP . 1 1 
        61 PHE . 1 1 
        62 SER . 1 1 
        63 ASN . 1 1 
        64 PHE . 1 1 
        65 ARG . 1 1 
        66 GLU . 1 1 
        67 PHE . 1 1 
        68 TYR . 1 1 
        69 TYR . 1 1 
        70 ILE . 1 1 
        71 GLN . 1 1 
        72 MET . 1 1 
        73 GLU . 1 1 
        74 LYS . 1 1 
        75 TYR . 1 1 
        76 ALA . 1 1 
        77 ARG . 1 1 
        78 GLN . 1 1 
        79 ALA . 1 1 
        80 ILE . 1 1 
        81 ASN . 1 1 
        82 ASP . 1 1 
        83 GLY . 1 1 
        84 VAL . 1 1 
        85 THR . 1 1 
        86 SER . 1 1 
        87 THR . 1 1 
        88 GLU . 1 1 
        89 GLU . 1 1 
        90 LEU . 1 1 
        91 SER . 1 1 
        92 ILE . 1 1 
        93 THR . 1 1 
        94 ARG . 1 1 
        95 ASP . 1 1 
        96 CYS . 1 1 
        97 GLU . 1 1 
        98 LEU . 1 1 
        99 TYR . 1 1 
       100 ARG . 1 1 
       101 ALA . 1 1 
       102 LEU . 1 1 
       103 ASN . 1 1 
       104 MET . 1 1 
       105 HIS . 1 1 
       106 TYR . 1 1 
       107 ASN . 1 1 
       108 LYS . 1 1 
       109 ALA . 1 1 
       110 ASN . 1 1 
       111 ASP . 1 1 
       112 PHE . 1 1 
       113 GLU . 1 1 
       114 VAL . 1 1 
       115 PRO . 1 1 
       116 GLU . 1 1 
       117 ARG . 1 1 
       118 PHE . 1 1 
       119 LEU . 1 1 
       120 GLU . 1 1 
       121 VAL . 1 1 
       122 ALA . 1 1 
       123 GLN . 1 1 
       124 ILE . 1 1 
       125 THR . 1 1 
       126 LEU . 1 1 
       127 ARG . 1 1 
       128 GLU . 1 1 
       129 PHE . 1 1 
       130 PHE . 1 1 
       131 ASN . 1 1 
       132 ALA . 1 1 
       133 ILE . 1 1 
       134 ILE . 1 1 
       135 ALA . 1 1 
       136 GLY . 1 1 
       137 LYS . 1 1 
       138 ASP . 1 1 
       139 VAL . 1 1 
       140 ASP . 1 1 
       141 PRO . 1 1 
       142 SER . 1 1 
       143 TRP . 1 1 
       144 LYS . 1 1 
       145 LYS . 1 1 
       146 ALA . 1 1 
       147 ILE . 1 1 
       148 TYR . 1 1 
       149 LYS . 1 1 
       150 VAL . 1 1 
       151 ILE . 1 1 
       152 CYS . 1 1 
       153 LYS . 1 1 
       154 LEU . 1 1 
       155 ASP . 1 1 
       156 SER . 1 1 
       157 GLU . 1 1 
       158 VAL . 1 1 
       159 PRO . 1 1 
       160 GLU . 1 1 
       161 ILE . 1 1 
       162 PHE . 1 1 
       163 LYS . 1 1 
       164 SER . 1 1 
       165 PRO . 1 1 
       166 ASN . 1 1 
       167 CYS . 1 1 
       168 LEU . 1 1 
       169 GLN . 1 1 
       170 GLU . 1 1 
       171 LEU . 1 1 
       172 LEU . 1 1 
       173 HIS . 1 1 
       174 GLU . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       MET   1   1 1 1 
       GLY   2   2 1 1 
       HIS   3   3 1 1 
       HIS   4   4 1 1 
       HIS   5   5 1 1 
       HIS   6   6 1 1 
       HIS   7   7 1 1 
       HIS   8   8 1 1 
       SER   9   9 1 1 
       HIS  10  10 1 1 
       MET  11  11 1 1 
       ALA  12  12 1 1 
       MET  13  13 1 1 
       GLN  14  14 1 1 
       GLU  15  15 1 1 
       GLY  16  16 1 1 
       LEU  17  17 1 1 
       SER  18  18 1 1 
       PRO  19  19 1 1 
       ASN  20  20 1 1 
       HIS  21  21 1 1 
       LEU  22  22 1 1 
       LYS  23  23 1 1 
       LYS  24  24 1 1 
       ALA  25  25 1 1 
       LYS  26  26 1 1 
       LEU  27  27 1 1 
       MET  28  28 1 1 
       PHE  29  29 1 1 
       PHE  30  30 1 1 
       TYR  31  31 1 1 
       THR  32  32 1 1 
       ARG  33  33 1 1 
       TYR  34  34 1 1 
       PRO  35  35 1 1 
       SER  36  36 1 1 
       SER  37  37 1 1 
       ASN  38  38 1 1 
       MET  39  39 1 1 
       LEU  40  40 1 1 
       LYS  41  41 1 1 
       THR  42  42 1 1 
       TYR  43  43 1 1 
       PHE  44  44 1 1 
       SER  45  45 1 1 
       ASP  46  46 1 1 
       VAL  47  47 1 1 
       LYS  48  48 1 1 
       PHE  49  49 1 1 
       ASN  50  50 1 1 
       ARG  51  51 1 1 
       CYS  52  52 1 1 
       ILE  53  53 1 1 
       THR  54  54 1 1 
       SER  55  55 1 1 
       GLN  56  56 1 1 
       LEU  57  57 1 1 
       ILE  58  58 1 1 
       LYS  59  59 1 1 
       TRP  60  60 1 1 
       PHE  61  61 1 1 
       SER  62  62 1 1 
       ASN  63  63 1 1 
       PHE  64  64 1 1 
       ARG  65  65 1 1 
       GLU  66  66 1 1 
       PHE  67  67 1 1 
       TYR  68  68 1 1 
       TYR  69  69 1 1 
       ILE  70  70 1 1 
       GLN  71  71 1 1 
       MET  72  72 1 1 
       GLU  73  73 1 1 
       LYS  74  74 1 1 
       TYR  75  75 1 1 
       ALA  76  76 1 1 
       ARG  77  77 1 1 
       GLN  78  78 1 1 
       ALA  79  79 1 1 
       ILE  80  80 1 1 
       ASN  81  81 1 1 
       ASP  82  82 1 1 
       GLY  83  83 1 1 
       VAL  84  84 1 1 
       THR  85  85 1 1 
       SER  86  86 1 1 
       THR  87  87 1 1 
       GLU  88  88 1 1 
       GLU  89  89 1 1 
       LEU  90  90 1 1 
       SER  91  91 1 1 
       ILE  92  92 1 1 
       THR  93  93 1 1 
       ARG  94  94 1 1 
       ASP  95  95 1 1 
       CYS  96  96 1 1 
       GLU  97  97 1 1 
       LEU  98  98 1 1 
       TYR  99  99 1 1 
       ARG 100 100 1 1 
       ALA 101 101 1 1 
       LEU 102 102 1 1 
       ASN 103 103 1 1 
       MET 104 104 1 1 
       HIS 105 105 1 1 
       TYR 106 106 1 1 
       ASN 107 107 1 1 
       LYS 108 108 1 1 
       ALA 109 109 1 1 
       ASN 110 110 1 1 
       ASP 111 111 1 1 
       PHE 112 112 1 1 
       GLU 113 113 1 1 
       VAL 114 114 1 1 
       PRO 115 115 1 1 
       GLU 116 116 1 1 
       ARG 117 117 1 1 
       PHE 118 118 1 1 
       LEU 119 119 1 1 
       GLU 120 120 1 1 
       VAL 121 121 1 1 
       ALA 122 122 1 1 
       GLN 123 123 1 1 
       ILE 124 124 1 1 
       THR 125 125 1 1 
       LEU 126 126 1 1 
       ARG 127 127 1 1 
       GLU 128 128 1 1 
       PHE 129 129 1 1 
       PHE 130 130 1 1 
       ASN 131 131 1 1 
       ALA 132 132 1 1 
       ILE 133 133 1 1 
       ILE 134 134 1 1 
       ALA 135 135 1 1 
       GLY 136 136 1 1 
       LYS 137 137 1 1 
       ASP 138 138 1 1 
       VAL 139 139 1 1 
       ASP 140 140 1 1 
       PRO 141 141 1 1 
       SER 142 142 1 1 
       TRP 143 143 1 1 
       LYS 144 144 1 1 
       LYS 145 145 1 1 
       ALA 146 146 1 1 
       ILE 147 147 1 1 
       TYR 148 148 1 1 
       LYS 149 149 1 1 
       VAL 150 150 1 1 
       ILE 151 151 1 1 
       CYS 152 152 1 1 
       LYS 153 153 1 1 
       LEU 154 154 1 1 
       ASP 155 155 1 1 
       SER 156 156 1 1 
       GLU 157 157 1 1 
       VAL 158 158 1 1 
       PRO 159 159 1 1 
       GLU 160 160 1 1 
       ILE 161 161 1 1 
       PHE 162 162 1 1 
       LYS 163 163 1 1 
       SER 164 164 1 1 
       PRO 165 165 1 1 
       ASN 166 166 1 1 
       CYS 167 167 1 1 
       LEU 168 168 1 1 
       GLN 169 169 1 1 
       GLU 170 170 1 1 
       LEU 171 171 1 1 
       LEU 172 172 1 1 
       HIS 173 173 1 1 
       GLU 174 174 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_2_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

          1 1 . . . 1 1 
          2 1 . . . 1 1 
          3 1 . . . 1 1 
          4 1 . . . 1 1 
          5 1 . . . 1 1 
          6 1 . . . 1 1 
          7 1 . . . 1 1 
          8 1 . . . 1 1 
          9 1 . . . 1 1 
         10 1 . . . 1 1 
         11 1 . . . 1 1 
         12 1 . . . 1 1 
         13 1 . . . 1 1 
         14 1 . . . 1 1 
         15 1 . . . 1 1 
         16 1 . . . 1 1 
         17 1 . . . 1 1 
         18 1 . . . 1 1 
         19 1 . . . 1 1 
         20 1 . . . 1 1 
         21 1 . . . 1 1 
         22 1 . . . 1 1 
         23 1 . . . 1 1 
         24 1 . . . 1 1 
         25 1 . . . 1 1 
         26 1 . . . 1 1 
         27 1 . . . 1 1 
         28 1 . . . 1 1 
         29 1 . . . 1 1 
         30 1 . . . 1 1 
         31 1 . . . 1 1 
         32 1 . . . 1 1 
         33 1 . . . 1 1 
         34 1 . . . 1 1 
         35 1 . . . 1 1 
         36 1 . . . 1 1 
         37 1 . . . 1 1 
         38 1 . . . 1 1 
         39 1 . . . 1 1 
         40 1 . . . 1 1 
         41 1 . . . 1 1 
         42 1 . . . 1 1 
         43 1 . . . 1 1 
         44 1 . . . 1 1 
         45 1 . . . 1 1 
         46 1 . . . 1 1 
         47 1 . . . 1 1 
         48 1 . . . 1 1 
         49 1 . . . 1 1 
         50 1 . . . 1 1 
         51 1 . . . 1 1 
         52 1 . . . 1 1 
         53 1 . . . 1 1 
         54 1 . . . 1 1 
         55 1 . . . 1 1 
         56 1 . . . 1 1 
         57 1 . . . 1 1 
         58 1 . . . 1 1 
         59 1 . . . 1 1 
         60 1 . . . 1 1 
         61 1 . . . 1 1 
         62 1 . . . 1 1 
         63 1 . . . 1 1 
         64 1 . . . 1 1 
         65 1 . . . 1 1 
         66 1 . . . 1 1 
         67 1 . . . 1 1 
         68 1 . . . 1 1 
         69 1 . . . 1 1 
         70 1 . . . 1 1 
         71 1 . . . 1 1 
         72 1 . . . 1 1 
         73 1 . . . 1 1 
         74 1 . . . 1 1 
         75 1 . . . 1 1 
         76 1 . . . 1 1 
         77 1 . . . 1 1 
         78 1 . . . 1 1 
         79 1 . . . 1 1 
         80 1 . . . 1 1 
         81 1 . . . 1 1 
         82 1 . . . 1 1 
         83 1 . . . 1 1 
         84 1 . . . 1 1 
         85 1 . . . 1 1 
         86 1 . . . 1 1 
         87 1 . . . 1 1 
         88 1 . . . 1 1 
         89 1 . . . 1 1 
         90 1 . . . 1 1 
         91 1 . . . 1 1 
         92 1 . . . 1 1 
         93 1 . . . 1 1 
         94 1 . . . 1 1 
         95 1 . . . 1 1 
         96 1 . . . 1 1 
         97 1 . . . 1 1 
         98 1 . . . 1 1 
         99 1 . . . 1 1 
        100 1 . . . 1 1 
        101 1 . . . 1 1 
        102 1 . . . 1 1 
        103 1 . . . 1 1 
        104 1 . . . 1 1 
        105 1 . . . 1 1 
        106 1 . . . 1 1 
        107 1 . . . 1 1 
        108 1 . . . 1 1 
        109 1 . . . 1 1 
        110 1 . . . 1 1 
        111 1 . . . 1 1 
        112 1 . . . 1 1 
        113 1 . . . 1 1 
        114 1 . . . 1 1 
        115 1 . . . 1 1 
        116 1 . . . 1 1 
        117 1 . . . 1 1 
        118 1 . . . 1 1 
        119 1 . . . 1 1 
        120 1 . . . 1 1 
        121 1 . . . 1 1 
        122 1 . . . 1 1 
        123 1 . . . 1 1 
        124 1 . . . 1 1 
        125 1 . . . 1 1 
        126 1 . . . 1 1 
        127 1 . . . 1 1 
        128 1 . . . 1 1 
        129 1 . . . 1 1 
        130 1 . . . 1 1 
        131 1 . . . 1 1 
        132 1 . . . 1 1 
        133 1 . . . 1 1 
        134 1 . . . 1 1 
        135 1 . . . 1 1 
        136 1 . . . 1 1 
        137 1 . . . 1 1 
        138 1 . . . 1 1 
        139 1 . . . 1 1 
        140 1 . . . 1 1 
        141 1 . . . 1 1 
        142 1 . . . 1 1 
        143 1 . . . 1 1 
        144 1 . . . 1 1 
        145 1 . . . 1 1 
        146 1 . . . 1 1 
        147 1 . . . 1 1 
        148 1 . . . 1 1 
        149 1 . . . 1 1 
        150 1 . . . 1 1 
        151 1 . . . 1 1 
        152 1 . . . 1 1 
        153 1 . . . 1 1 
        154 1 . . . 1 1 
        155 1 . . . 1 1 
        156 1 . . . 1 1 
        157 1 . . . 1 1 
        158 1 . . . 1 1 
        159 1 . . . 1 1 
        160 1 . . . 1 1 
        161 1 . . . 1 1 
        162 1 . . . 1 1 
        163 1 . . . 1 1 
        164 1 . . . 1 1 
        165 1 . . . 1 1 
        166 1 . . . 1 1 
        167 1 . . . 1 1 
        168 1 . . . 1 1 
        169 1 . . . 1 1 
        170 1 . . . 1 1 
        171 1 . . . 1 1 
        172 1 . . . 1 1 
        173 1 . . . 1 1 
        174 1 . . . 1 1 
        175 1 . . . 1 1 
        176 1 . . . 1 1 
        177 1 . . . 1 1 
        178 1 . . . 1 1 
        179 1 . . . 1 1 
        180 1 . . . 1 1 
        181 1 . . . 1 1 
        182 1 . . . 1 1 
        183 1 . . . 1 1 
        184 1 . . . 1 1 
        185 1 . . . 1 1 
        186 1 . . . 1 1 
        187 1 . . . 1 1 
        188 1 . . . 1 1 
        189 1 . . . 1 1 
        190 1 . . . 1 1 
        191 1 . . . 1 1 
        192 1 . . . 1 1 
        193 1 . . . 1 1 
        194 1 . . . 1 1 
        195 1 . . . 1 1 
        196 1 . . . 1 1 
        197 1 . . . 1 1 
        198 1 . . . 1 1 
        199 1 . . . 1 1 
        200 1 . . . 1 1 
        201 1 . . . 1 1 
        202 1 . . . 1 1 
        203 1 . . . 1 1 
        204 1 . . . 1 1 
        205 1 . . . 1 1 
        206 1 . . . 1 1 
        207 1 . . . 1 1 
        208 1 . . . 1 1 
        209 1 . . . 1 1 
        210 1 . . . 1 1 
        211 1 . . . 1 1 
        212 1 . . . 1 1 
        213 1 . . . 1 1 
        214 1 . . . 1 1 
        215 1 . . . 1 1 
        216 1 . . . 1 1 
        217 1 . . . 1 1 
        218 1 . . . 1 1 
        219 1 . . . 1 1 
        220 1 . . . 1 1 
        221 1 . . . 1 1 
        222 1 . . . 1 1 
        223 1 . . . 1 1 
        224 1 . . . 1 1 
        225 1 . . . 1 1 
        226 1 . . . 1 1 
        227 1 . . . 1 1 
        228 1 . . . 1 1 
        229 1 . . . 1 1 
        230 1 . . . 1 1 
        231 1 . . . 1 1 
        232 1 . . . 1 1 
        233 1 . . . 1 1 
        234 1 . . . 1 1 
        235 1 . . . 1 1 
        236 1 . . . 1 1 
        237 1 . . . 1 1 
        238 1 . . . 1 1 
        239 1 . . . 1 1 
        240 1 . . . 1 1 
        241 1 . . . 1 1 
        242 1 . . . 1 1 
        243 1 . . . 1 1 
        244 1 . . . 1 1 
        245 1 . . . 1 1 
        246 1 . . . 1 1 
        247 1 . . . 1 1 
        248 1 . . . 1 1 
        249 1 . . . 1 1 
        250 1 . . . 1 1 
        251 1 . . . 1 1 
        252 1 . . . 1 1 
        253 1 . . . 1 1 
        254 1 . . . 1 1 
        255 1 . . . 1 1 
        256 1 . . . 1 1 
        257 1 . . . 1 1 
        258 1 . . . 1 1 
        259 1 . . . 1 1 
        260 1 . . . 1 1 
        261 1 . . . 1 1 
        262 1 . . . 1 1 
        263 1 . . . 1 1 
        264 1 . . . 1 1 
        265 1 . . . 1 1 
        266 1 . . . 1 1 
        267 1 . . . 1 1 
        268 1 . . . 1 1 
        269 1 . . . 1 1 
        270 1 . . . 1 1 
        271 1 . . . 1 1 
        272 1 . . . 1 1 
        273 1 . . . 1 1 
        274 1 . . . 1 1 
        275 1 . . . 1 1 
        276 1 . . . 1 1 
        277 1 . . . 1 1 
        278 1 . . . 1 1 
        279 1 . . . 1 1 
        280 1 . . . 1 1 
        281 1 . . . 1 1 
        282 1 . . . 1 1 
        283 1 . . . 1 1 
        284 1 . . . 1 1 
        285 1 . . . 1 1 
        286 1 . . . 1 1 
        287 1 . . . 1 1 
        288 1 . . . 1 1 
        289 1 . . . 1 1 
        290 1 . . . 1 1 
        291 1 . . . 1 1 
        292 1 . . . 1 1 
        293 1 . . . 1 1 
        294 1 . . . 1 1 
        295 1 . . . 1 1 
        296 1 . . . 1 1 
        297 1 . . . 1 1 
        298 1 . . . 1 1 
        299 1 . . . 1 1 
        300 1 . . . 1 1 
        301 1 . . . 1 1 
        302 1 . . . 1 1 
        303 1 . . . 1 1 
        304 1 . . . 1 1 
        305 1 . . . 1 1 
        306 1 . . . 1 1 
        307 1 . . . 1 1 
        308 1 . . . 1 1 
        309 1 . . . 1 1 
        310 1 . . . 1 1 
        311 1 . . . 1 1 
        312 1 . . . 1 1 
        313 1 . . . 1 1 
        314 1 . . . 1 1 
        315 1 . . . 1 1 
        316 1 . . . 1 1 
        317 1 . . . 1 1 
        318 1 . . . 1 1 
        319 1 . . . 1 1 
        320 1 . . . 1 1 
        321 1 . . . 1 1 
        322 1 . . . 1 1 
        323 1 . . . 1 1 
        324 1 . . . 1 1 
        325 1 . . . 1 1 
        326 1 . . . 1 1 
        327 1 . . . 1 1 
        328 1 . . . 1 1 
        329 1 . . . 1 1 
        330 1 . . . 1 1 
        331 1 . . . 1 1 
        332 1 . . . 1 1 
        333 1 . . . 1 1 
        334 1 . . . 1 1 
        335 1 . . . 1 1 
        336 1 . . . 1 1 
        337 1 . . . 1 1 
        338 1 . . . 1 1 
        339 1 . . . 1 1 
        340 1 . . . 1 1 
        341 1 . . . 1 1 
        342 1 . . . 1 1 
        343 1 . . . 1 1 
        344 1 . . . 1 1 
        345 1 . . . 1 1 
        346 1 . . . 1 1 
        347 1 . . . 1 1 
        348 1 . . . 1 1 
        349 1 . . . 1 1 
        350 1 . . . 1 1 
        351 1 . . . 1 1 
        352 1 . . . 1 1 
        353 1 . . . 1 1 
        354 1 . . . 1 1 
        355 1 . . . 1 1 
        356 1 . . . 1 1 
        357 1 . . . 1 1 
        358 1 . . . 1 1 
        359 1 . . . 1 1 
        360 1 . . . 1 1 
        361 1 . . . 1 1 
        362 1 . . . 1 1 
        363 1 . . . 1 1 
        364 1 . . . 1 1 
        365 1 . . . 1 1 
        366 1 . . . 1 1 
        367 1 . . . 1 1 
        368 1 . . . 1 1 
        369 1 . . . 1 1 
        370 1 . . . 1 1 
        371 1 . . . 1 1 
        372 1 . . . 1 1 
        373 1 . . . 1 1 
        374 1 . . . 1 1 
        375 1 . . . 1 1 
        376 1 . . . 1 1 
        377 1 . . . 1 1 
        378 1 . . . 1 1 
        379 1 . . . 1 1 
        380 1 . . . 1 1 
        381 1 . . . 1 1 
        382 1 . . . 1 1 
        383 1 . . . 1 1 
        384 1 . . . 1 1 
        385 1 . . . 1 1 
        386 1 . . . 1 1 
        387 1 . . . 1 1 
        388 1 . . . 1 1 
        389 1 . . . 1 1 
        390 1 . . . 1 1 
        391 1 . . . 1 1 
        392 1 . . . 1 1 
        393 1 . . . 1 1 
        394 1 . . . 1 1 
        395 1 . . . 1 1 
        396 1 . . . 1 1 
        397 1 . . . 1 1 
        398 1 . . . 1 1 
        399 1 . . . 1 1 
        400 1 . . . 1 1 
        401 1 . . . 1 1 
        402 1 . . . 1 1 
        403 1 . . . 1 1 
        404 1 . . . 1 1 
        405 1 . . . 1 1 
        406 1 . . . 1 1 
        407 1 . . . 1 1 
        408 1 . . . 1 1 
        409 1 . . . 1 1 
        410 1 . . . 1 1 
        411 1 . . . 1 1 
        412 1 . . . 1 1 
        413 1 . . . 1 1 
        414 1 . . . 1 1 
        415 1 . . . 1 1 
        416 1 . . . 1 1 
        417 1 . . . 1 1 
        418 1 . . . 1 1 
        419 1 . . . 1 1 
        420 1 . . . 1 1 
        421 1 . . . 1 1 
        422 1 . . . 1 1 
        423 1 . . . 1 1 
        424 1 . . . 1 1 
        425 1 . . . 1 1 
        426 1 . . . 1 1 
        427 1 . . . 1 1 
        428 1 . . . 1 1 
        429 1 . . . 1 1 
        430 1 . . . 1 1 
        431 1 . . . 1 1 
        432 1 . . . 1 1 
        433 1 . . . 1 1 
        434 1 . . . 1 1 
        435 1 . . . 1 1 
        436 1 . . . 1 1 
        437 1 . . . 1 1 
        438 1 . . . 1 1 
        439 1 . . . 1 1 
        440 1 . . . 1 1 
        441 1 . . . 1 1 
        442 1 . . . 1 1 
        443 1 . . . 1 1 
        444 1 . . . 1 1 
        445 1 . . . 1 1 
        446 1 . . . 1 1 
        447 1 . . . 1 1 
        448 1 . . . 1 1 
        449 1 . . . 1 1 
        450 1 . . . 1 1 
        451 1 . . . 1 1 
        452 1 . . . 1 1 
        453 1 . . . 1 1 
        454 1 . . . 1 1 
        455 1 . . . 1 1 
        456 1 . . . 1 1 
        457 1 . . . 1 1 
        458 1 . . . 1 1 
        459 1 . . . 1 1 
        460 1 . . . 1 1 
        461 1 . . . 1 1 
        462 1 . . . 1 1 
        463 1 . . . 1 1 
        464 1 . . . 1 1 
        465 1 . . . 1 1 
        466 1 . . . 1 1 
        467 1 . . . 1 1 
        468 1 . . . 1 1 
        469 1 . . . 1 1 
        470 1 . . . 1 1 
        471 1 . . . 1 1 
        472 1 . . . 1 1 
        473 1 . . . 1 1 
        474 1 . . . 1 1 
        475 1 . . . 1 1 
        476 1 . . . 1 1 
        477 1 . . . 1 1 
        478 1 . . . 1 1 
        479 1 . . . 1 1 
        480 1 . . . 1 1 
        481 1 . . . 1 1 
        482 1 . . . 1 1 
        483 1 . . . 1 1 
        484 1 . . . 1 1 
        485 1 . . . 1 1 
        486 1 . . . 1 1 
        487 1 . . . 1 1 
        488 1 . . . 1 1 
        489 1 . . . 1 1 
        490 1 . . . 1 1 
        491 1 . . . 1 1 
        492 1 . . . 1 1 
        493 1 . . . 1 1 
        494 1 . . . 1 1 
        495 1 . . . 1 1 
        496 1 . . . 1 1 
        497 1 . . . 1 1 
        498 1 . . . 1 1 
        499 1 . . . 1 1 
        500 1 . . . 1 1 
        501 1 . . . 1 1 
        502 1 . . . 1 1 
        503 1 . . . 1 1 
        504 1 . . . 1 1 
        505 1 . . . 1 1 
        506 1 . . . 1 1 
        507 1 . . . 1 1 
        508 1 . . . 1 1 
        509 1 . . . 1 1 
        510 1 . . . 1 1 
        511 1 . . . 1 1 
        512 1 . . . 1 1 
        513 1 . . . 1 1 
        514 1 . . . 1 1 
        515 1 . . . 1 1 
        516 1 . . . 1 1 
        517 1 . . . 1 1 
        518 1 . . . 1 1 
        519 1 . . . 1 1 
        520 1 . . . 1 1 
        521 1 . . . 1 1 
        522 1 . . . 1 1 
        523 1 . . . 1 1 
        524 1 . . . 1 1 
        525 1 . . . 1 1 
        526 1 . . . 1 1 
        527 1 . . . 1 1 
        528 1 . . . 1 1 
        529 1 . . . 1 1 
        530 1 . . . 1 1 
        531 1 . . . 1 1 
        532 1 . . . 1 1 
        533 1 . . . 1 1 
        534 1 . . . 1 1 
        535 1 . . . 1 1 
        536 1 . . . 1 1 
        537 1 . . . 1 1 
        538 1 . . . 1 1 
        539 1 . . . 1 1 
        540 1 . . . 1 1 
        541 1 . . . 1 1 
        542 1 . . . 1 1 
        543 1 . . . 1 1 
        544 1 . . . 1 1 
        545 1 . . . 1 1 
        546 1 . . . 1 1 
        547 1 . . . 1 1 
        548 1 . . . 1 1 
        549 1 . . . 1 1 
        550 1 . . . 1 1 
        551 1 . . . 1 1 
        552 1 . . . 1 1 
        553 1 . . . 1 1 
        554 1 . . . 1 1 
        555 1 . . . 1 1 
        556 1 . . . 1 1 
        557 1 . . . 1 1 
        558 1 . . . 1 1 
        559 1 . . . 1 1 
        560 1 . . . 1 1 
        561 1 . . . 1 1 
        562 1 . . . 1 1 
        563 1 . . . 1 1 
        564 1 . . . 1 1 
        565 1 . . . 1 1 
        566 1 . . . 1 1 
        567 1 . . . 1 1 
        568 1 . . . 1 1 
        569 1 . . . 1 1 
        570 1 . . . 1 1 
        571 1 . . . 1 1 
        572 1 . . . 1 1 
        573 1 . . . 1 1 
        574 1 . . . 1 1 
        575 1 . . . 1 1 
        576 1 . . . 1 1 
        577 1 . . . 1 1 
        578 1 . . . 1 1 
        579 1 . . . 1 1 
        580 1 . . . 1 1 
        581 1 . . . 1 1 
        582 1 . . . 1 1 
        583 1 . . . 1 1 
        584 1 . . . 1 1 
        585 1 . . . 1 1 
        586 1 . . . 1 1 
        587 1 . . . 1 1 
        588 1 . . . 1 1 
        589 1 . . . 1 1 
        590 1 . . . 1 1 
        591 1 . . . 1 1 
        592 1 . . . 1 1 
        593 1 . . . 1 1 
        594 1 . . . 1 1 
        595 1 . . . 1 1 
        596 1 . . . 1 1 
        597 1 . . . 1 1 
        598 1 . . . 1 1 
        599 1 . . . 1 1 
        600 1 . . . 1 1 
        601 1 . . . 1 1 
        602 1 . . . 1 1 
        603 1 . . . 1 1 
        604 1 . . . 1 1 
        605 1 . . . 1 1 
        606 1 . . . 1 1 
        607 1 . . . 1 1 
        608 1 . . . 1 1 
        609 1 . . . 1 1 
        610 1 . . . 1 1 
        611 1 . . . 1 1 
        612 1 . . . 1 1 
        613 1 . . . 1 1 
        614 1 . . . 1 1 
        615 1 . . . 1 1 
        616 1 . . . 1 1 
        617 1 . . . 1 1 
        618 1 . . . 1 1 
        619 1 . . . 1 1 
        620 1 . . . 1 1 
        621 1 . . . 1 1 
        622 1 . . . 1 1 
        623 1 . . . 1 1 
        624 1 . . . 1 1 
        625 1 . . . 1 1 
        626 1 . . . 1 1 
        627 1 . . . 1 1 
        628 1 . . . 1 1 
        629 1 . . . 1 1 
        630 1 . . . 1 1 
        631 1 . . . 1 1 
        632 1 . . . 1 1 
        633 1 . . . 1 1 
        634 1 . . . 1 1 
        635 1 . . . 1 1 
        636 1 . . . 1 1 
        637 1 . . . 1 1 
        638 1 . . . 1 1 
        639 1 . . . 1 1 
        640 1 . . . 1 1 
        641 1 . . . 1 1 
        642 1 . . . 1 1 
        643 1 . . . 1 1 
        644 1 . . . 1 1 
        645 1 . . . 1 1 
        646 1 . . . 1 1 
        647 1 . . . 1 1 
        648 1 . . . 1 1 
        649 1 . . . 1 1 
        650 1 . . . 1 1 
        651 1 . . . 1 1 
        652 1 . . . 1 1 
        653 1 . . . 1 1 
        654 1 . . . 1 1 
        655 1 . . . 1 1 
        656 1 . . . 1 1 
        657 1 . . . 1 1 
        658 1 . . . 1 1 
        659 1 . . . 1 1 
        660 1 . . . 1 1 
        661 1 . . . 1 1 
        662 1 . . . 1 1 
        663 1 . . . 1 1 
        664 1 . . . 1 1 
        665 1 . . . 1 1 
        666 1 . . . 1 1 
        667 1 . . . 1 1 
        668 1 . . . 1 1 
        669 1 . . . 1 1 
        670 1 . . . 1 1 
        671 1 . . . 1 1 
        672 1 . . . 1 1 
        673 1 . . . 1 1 
        674 1 . . . 1 1 
        675 1 . . . 1 1 
        676 1 . . . 1 1 
        677 1 . . . 1 1 
        678 1 . . . 1 1 
        679 1 . . . 1 1 
        680 1 . . . 1 1 
        681 1 . . . 1 1 
        682 1 . . . 1 1 
        683 1 . . . 1 1 
        684 1 . . . 1 1 
        685 1 . . . 1 1 
        686 1 . . . 1 1 
        687 1 . . . 1 1 
        688 1 . . . 1 1 
        689 1 . . . 1 1 
        690 1 . . . 1 1 
        691 1 . . . 1 1 
        692 1 . . . 1 1 
        693 1 . . . 1 1 
        694 1 . . . 1 1 
        695 1 . . . 1 1 
        696 1 . . . 1 1 
        697 1 . . . 1 1 
        698 1 . . . 1 1 
        699 1 . . . 1 1 
        700 1 . . . 1 1 
        701 1 . . . 1 1 
        702 1 . . . 1 1 
        703 1 . . . 1 1 
        704 1 . . . 1 1 
        705 1 . . . 1 1 
        706 1 . . . 1 1 
        707 1 . . . 1 1 
        708 1 . . . 1 1 
        709 1 . . . 1 1 
        710 1 . . . 1 1 
        711 1 . . . 1 1 
        712 1 . . . 1 1 
        713 1 . . . 1 1 
        714 1 . . . 1 1 
        715 1 . . . 1 1 
        716 1 . . . 1 1 
        717 1 . . . 1 1 
        718 1 . . . 1 1 
        719 1 . . . 1 1 
        720 1 . . . 1 1 
        721 1 . . . 1 1 
        722 1 . . . 1 1 
        723 1 . . . 1 1 
        724 1 . . . 1 1 
        725 1 . . . 1 1 
        726 1 . . . 1 1 
        727 1 . . . 1 1 
        728 1 . . . 1 1 
        729 1 . . . 1 1 
        730 1 . . . 1 1 
        731 1 . . . 1 1 
        732 1 . . . 1 1 
        733 1 . . . 1 1 
        734 1 . . . 1 1 
        735 1 . . . 1 1 
        736 1 . . . 1 1 
        737 1 . . . 1 1 
        738 1 . . . 1 1 
        739 1 . . . 1 1 
        740 1 . . . 1 1 
        741 1 . . . 1 1 
        742 1 . . . 1 1 
        743 1 . . . 1 1 
        744 1 . . . 1 1 
        745 1 . . . 1 1 
        746 1 . . . 1 1 
        747 1 . . . 1 1 
        748 1 . . . 1 1 
        749 1 . . . 1 1 
        750 1 . . . 1 1 
        751 1 . . . 1 1 
        752 1 . . . 1 1 
        753 1 . . . 1 1 
        754 1 . . . 1 1 
        755 1 . . . 1 1 
        756 1 . . . 1 1 
        757 1 . . . 1 1 
        758 1 . . . 1 1 
        759 1 . . . 1 1 
        760 1 . . . 1 1 
        761 1 . . . 1 1 
        762 1 . . . 1 1 
        763 1 . . . 1 1 
        764 1 . . . 1 1 
        765 1 . . . 1 1 
        766 1 . . . 1 1 
        767 1 . . . 1 1 
        768 1 . . . 1 1 
        769 1 . . . 1 1 
        770 1 . . . 1 1 
        771 1 . . . 1 1 
        772 1 . . . 1 1 
        773 1 . . . 1 1 
        774 1 . . . 1 1 
        775 1 . . . 1 1 
        776 1 . . . 1 1 
        777 1 . . . 1 1 
        778 1 . . . 1 1 
        779 1 . . . 1 1 
        780 1 . . . 1 1 
        781 1 . . . 1 1 
        782 1 . . . 1 1 
        783 1 . . . 1 1 
        784 1 . . . 1 1 
        785 1 . . . 1 1 
        786 1 . . . 1 1 
        787 1 . . . 1 1 
        788 1 . . . 1 1 
        789 1 . . . 1 1 
        790 1 . . . 1 1 
        791 1 . . . 1 1 
        792 1 . . . 1 1 
        793 1 . . . 1 1 
        794 1 . . . 1 1 
        795 1 . . . 1 1 
        796 1 . . . 1 1 
        797 1 . . . 1 1 
        798 1 . . . 1 1 
        799 1 . . . 1 1 
        800 1 . . . 1 1 
        801 1 . . . 1 1 
        802 1 . . . 1 1 
        803 1 . . . 1 1 
        804 1 . . . 1 1 
        805 1 . . . 1 1 
        806 1 . . . 1 1 
        807 1 . . . 1 1 
        808 1 . . . 1 1 
        809 1 . . . 1 1 
        810 1 . . . 1 1 
        811 1 . . . 1 1 
        812 1 . . . 1 1 
        813 1 . . . 1 1 
        814 1 . . . 1 1 
        815 1 . . . 1 1 
        816 1 . . . 1 1 
        817 1 . . . 1 1 
        818 1 . . . 1 1 
        819 1 . . . 1 1 
        820 1 . . . 1 1 
        821 1 . . . 1 1 
        822 1 . . . 1 1 
        823 1 . . . 1 1 
        824 1 . . . 1 1 
        825 1 . . . 1 1 
        826 1 . . . 1 1 
        827 1 . . . 1 1 
        828 1 . . . 1 1 
        829 1 . . . 1 1 
        830 1 . . . 1 1 
        831 1 . . . 1 1 
        832 1 . . . 1 1 
        833 1 . . . 1 1 
        834 1 . . . 1 1 
        835 1 . . . 1 1 
        836 1 . . . 1 1 
        837 1 . . . 1 1 
        838 1 . . . 1 1 
        839 1 . . . 1 1 
        840 1 . . . 1 1 
        841 1 . . . 1 1 
        842 1 . . . 1 1 
        843 1 . . . 1 1 
        844 1 . . . 1 1 
        845 1 . . . 1 1 
        846 1 . . . 1 1 
        847 1 . . . 1 1 
        848 1 . . . 1 1 
        849 1 . . . 1 1 
        850 1 . . . 1 1 
        851 1 . . . 1 1 
        852 1 . . . 1 1 
        853 1 . . . 1 1 
        854 1 . . . 1 1 
        855 1 . . . 1 1 
        856 1 . . . 1 1 
        857 1 . . . 1 1 
        858 1 . . . 1 1 
        859 1 . . . 1 1 
        860 1 . . . 1 1 
        861 1 . . . 1 1 
        862 1 . . . 1 1 
        863 1 . . . 1 1 
        864 1 . . . 1 1 
        865 1 . . . 1 1 
        866 1 . . . 1 1 
        867 1 . . . 1 1 
        868 1 . . . 1 1 
        869 1 . . . 1 1 
        870 1 . . . 1 1 
        871 1 . . . 1 1 
        872 1 . . . 1 1 
        873 1 . . . 1 1 
        874 1 . . . 1 1 
        875 1 . . . 1 1 
        876 1 . . . 1 1 
        877 1 . . . 1 1 
        878 1 . . . 1 1 
        879 1 . . . 1 1 
        880 1 . . . 1 1 
        881 1 . . . 1 1 
        882 1 . . . 1 1 
        883 1 . . . 1 1 
        884 1 . . . 1 1 
        885 1 . . . 1 1 
        886 1 . . . 1 1 
        887 1 . . . 1 1 
        888 1 . . . 1 1 
        889 1 . . . 1 1 
        890 1 . . . 1 1 
        891 1 . . . 1 1 
        892 1 . . . 1 1 
        893 1 . . . 1 1 
        894 1 . . . 1 1 
        895 1 . . . 1 1 
        896 1 . . . 1 1 
        897 1 . . . 1 1 
        898 1 . . . 1 1 
        899 1 . . . 1 1 
        900 1 . . . 1 1 
        901 1 . . . 1 1 
        902 1 . . . 1 1 
        903 1 . . . 1 1 
        904 1 . . . 1 1 
        905 1 . . . 1 1 
        906 1 . . . 1 1 
        907 1 . . . 1 1 
        908 1 . . . 1 1 
        909 1 . . . 1 1 
        910 1 . . . 1 1 
        911 1 . . . 1 1 
        912 1 . . . 1 1 
        913 1 . . . 1 1 
        914 1 . . . 1 1 
        915 1 . . . 1 1 
        916 1 . . . 1 1 
        917 1 . . . 1 1 
        918 1 . . . 1 1 
        919 1 . . . 1 1 
        920 1 . . . 1 1 
        921 1 . . . 1 1 
        922 1 . . . 1 1 
        923 1 . . . 1 1 
        924 1 . . . 1 1 
        925 1 . . . 1 1 
        926 1 . . . 1 1 
        927 1 . . . 1 1 
        928 1 . . . 1 1 
        929 1 . . . 1 1 
        930 1 . . . 1 1 
        931 1 . . . 1 1 
        932 1 . . . 1 1 
        933 1 . . . 1 1 
        934 1 . . . 1 1 
        935 1 . . . 1 1 
        936 1 . . . 1 1 
        937 1 . . . 1 1 
        938 1 . . . 1 1 
        939 1 . . . 1 1 
        940 1 . . . 1 1 
        941 1 . . . 1 1 
        942 1 . . . 1 1 
        943 1 . . . 1 1 
        944 1 . . . 1 1 
        945 1 . . . 1 1 
        946 1 . . . 1 1 
        947 1 . . . 1 1 
        948 1 . . . 1 1 
        949 1 . . . 1 1 
        950 1 . . . 1 1 
        951 1 . . . 1 1 
        952 1 . . . 1 1 
        953 1 . . . 1 1 
        954 1 . . . 1 1 
        955 1 . . . 1 1 
        956 1 . . . 1 1 
        957 1 . . . 1 1 
        958 1 . . . 1 1 
        959 1 . . . 1 1 
        960 1 . . . 1 1 
        961 1 . . . 1 1 
        962 1 . . . 1 1 
        963 1 . . . 1 1 
        964 1 . . . 1 1 
        965 1 . . . 1 1 
        966 1 . . . 1 1 
        967 1 . . . 1 1 
        968 1 . . . 1 1 
        969 1 . . . 1 1 
        970 1 . . . 1 1 
        971 1 . . . 1 1 
        972 1 . . . 1 1 
        973 1 . . . 1 1 
        974 1 . . . 1 1 
        975 1 . . . 1 1 
        976 1 . . . 1 1 
        977 1 . . . 1 1 
        978 1 . . . 1 1 
        979 1 . . . 1 1 
        980 1 . . . 1 1 
        981 1 . . . 1 1 
        982 1 . . . 1 1 
        983 1 . . . 1 1 
        984 1 . . . 1 1 
        985 1 . . . 1 1 
        986 1 . . . 1 1 
        987 1 . . . 1 1 
        988 1 . . . 1 1 
        989 1 . . . 1 1 
        990 1 . . . 1 1 
        991 1 . . . 1 1 
        992 1 . . . 1 1 
        993 1 . . . 1 1 
        994 1 . . . 1 1 
        995 1 . . . 1 1 
        996 1 . . . 1 1 
        997 1 . . . 1 1 
        998 1 . . . 1 1 
        999 1 . . . 1 1 
       1000 1 . . . 1 1 
       1001 1 . . . 1 1 
       1002 1 . . . 1 1 
       1003 1 . . . 1 1 
       1004 1 . . . 1 1 
       1005 1 . . . 1 1 
       1006 1 . . . 1 1 
       1007 1 . . . 1 1 
       1008 1 . . . 1 1 
       1009 1 . . . 1 1 
       1010 1 . . . 1 1 
       1011 1 . . . 1 1 
       1012 1 . . . 1 1 
       1013 1 . . . 1 1 
       1014 1 . . . 1 1 
       1015 1 . . . 1 1 
       1016 1 . . . 1 1 
       1017 1 . . . 1 1 
       1018 1 . . . 1 1 
       1019 1 . . . 1 1 
       1020 1 . . . 1 1 
       1021 1 . . . 1 1 
       1022 1 . . . 1 1 
       1023 1 . . . 1 1 
       1024 1 . . . 1 1 
       1025 1 . . . 1 1 
       1026 1 . . . 1 1 
       1027 1 . . . 1 1 
       1028 1 . . . 1 1 
       1029 1 . . . 1 1 
       1030 1 . . . 1 1 
       1031 1 . . . 1 1 
       1032 1 . . . 1 1 
       1033 1 . . . 1 1 
       1034 1 . . . 1 1 
       1035 1 . . . 1 1 
       1036 1 . . . 1 1 
       1037 1 . . . 1 1 
       1038 1 . . . 1 1 
       1039 1 . . . 1 1 
       1040 1 . . . 1 1 
       1041 1 . . . 1 1 
       1042 1 . . . 1 1 
       1043 1 . . . 1 1 
       1044 1 . . . 1 1 
       1045 1 . . . 1 1 
       1046 1 . . . 1 1 
       1047 1 . . . 1 1 
       1048 1 . . . 1 1 
       1049 1 . . . 1 1 
       1050 1 . . . 1 1 
       1051 1 . . . 1 1 
       1052 1 . . . 1 1 
       1053 1 . . . 1 1 
       1054 1 . . . 1 1 
       1055 1 . . . 1 1 
       1056 1 . . . 1 1 
       1057 1 . . . 1 1 
       1058 1 . . . 1 1 
       1059 1 . . . 1 1 
       1060 1 . . . 1 1 
       1061 1 . . . 1 1 
       1062 1 . . . 1 1 
       1063 1 . . . 1 1 
       1064 1 . . . 1 1 
       1065 1 . . . 1 1 
       1066 1 . . . 1 1 
       1067 1 . . . 1 1 
       1068 1 . . . 1 1 
       1069 1 . . . 1 1 
       1070 1 . . . 1 1 
       1071 1 . . . 1 1 
       1072 1 . . . 1 1 
       1073 1 . . . 1 1 
       1074 1 . . . 1 1 
       1075 1 . . . 1 1 
       1076 1 . . . 1 1 
       1077 1 . . . 1 1 
       1078 1 . . . 1 1 
       1079 1 . . . 1 1 
       1080 1 . . . 1 1 
       1081 1 . . . 1 1 
       1082 1 . . . 1 1 
       1083 1 . . . 1 1 
       1084 1 . . . 1 1 
       1085 1 . . . 1 1 
       1086 1 . . . 1 1 
       1087 1 . . . 1 1 
       1088 1 . . . 1 1 
       1089 1 . . . 1 1 
       1090 1 . . . 1 1 
       1091 1 . . . 1 1 
       1092 1 . . . 1 1 
       1093 1 . . . 1 1 
       1094 1 . . . 1 1 
       1095 1 . . . 1 1 
       1096 1 . . . 1 1 
       1097 1 . . . 1 1 
       1098 1 . . . 1 1 
       1099 1 . . . 1 1 
       1100 1 . . . 1 1 
       1101 1 . . . 1 1 
       1102 1 . . . 1 1 
       1103 1 . . . 1 1 
       1104 1 . . . 1 1 
       1105 1 . . . 1 1 
       1106 1 . . . 1 1 
       1107 1 . . . 1 1 
       1108 1 . . . 1 1 
       1109 1 . . . 1 1 
       1110 1 . . . 1 1 
       1111 1 . . . 1 1 
       1112 1 . . . 1 1 
       1113 1 . . . 1 1 
       1114 1 . . . 1 1 
       1115 1 . . . 1 1 
       1116 1 . . . 1 1 
       1117 1 . . . 1 1 
       1118 1 . . . 1 1 
       1119 1 . . . 1 1 
       1120 1 . . . 1 1 
       1121 1 . . . 1 1 
       1122 1 . . . 1 1 
       1123 1 . . . 1 1 
       1124 1 . . . 1 1 
       1125 1 . . . 1 1 
       1126 1 . . . 1 1 
       1127 1 . . . 1 1 
       1128 1 . . . 1 1 
       1129 1 . . . 1 1 
       1130 1 . . . 1 1 
       1131 1 . . . 1 1 
       1132 1 . . . 1 1 
       1133 1 . . . 1 1 
       1134 1 . . . 1 1 
       1135 1 . . . 1 1 
       1136 1 . . . 1 1 
       1137 1 . . . 1 1 
       1138 1 . . . 1 1 
       1139 1 . . . 1 1 
       1140 1 . . . 1 1 
       1141 1 . . . 1 1 
       1142 1 . . . 1 1 
       1143 1 . . . 1 1 
       1144 1 . . . 1 1 
       1145 1 . . . 1 1 
       1146 1 . . . 1 1 
       1147 1 . . . 1 1 
       1148 1 . . . 1 1 
       1149 1 . . . 1 1 
       1150 1 . . . 1 1 
       1151 1 . . . 1 1 
       1152 1 . . . 1 1 
       1153 1 . . . 1 1 
       1154 1 . . . 1 1 
       1155 1 . . . 1 1 
       1156 1 . . . 1 1 
       1157 1 . . . 1 1 
       1158 1 . . . 1 1 
       1159 1 . . . 1 1 
       1160 1 . . . 1 1 
       1161 1 . . . 1 1 
       1162 1 . . . 1 1 
       1163 1 . . . 1 1 
       1164 1 . . . 1 1 
       1165 1 . . . 1 1 
       1166 1 . . . 1 1 
       1167 1 . . . 1 1 
       1168 1 . . . 1 1 
       1169 1 . . . 1 1 
       1170 1 . . . 1 1 
       1171 1 . . . 1 1 
       1172 1 . . . 1 1 
       1173 1 . . . 1 1 
       1174 1 . . . 1 1 
       1175 1 . . . 1 1 
       1176 1 . . . 1 1 
       1177 1 . . . 1 1 
       1178 1 . . . 1 1 
       1179 1 . . . 1 1 
       1180 1 . . . 1 1 
       1181 1 . . . 1 1 
       1182 1 . . . 1 1 
       1183 1 . . . 1 1 
       1184 1 . . . 1 1 
       1185 1 . . . 1 1 
       1186 1 . . . 1 1 
       1187 1 . . . 1 1 
       1188 1 . . . 1 1 
       1189 1 . . . 1 1 
       1190 1 . . . 1 1 
       1191 1 . . . 1 1 
       1192 1 . . . 1 1 
       1193 1 . . . 1 1 
       1194 1 . . . 1 1 
       1195 1 . . . 1 1 
       1196 1 . . . 1 1 
       1197 1 . . . 1 1 
       1198 1 . . . 1 1 
       1199 1 . . . 1 1 
       1200 1 . . . 1 1 
       1201 1 . . . 1 1 
       1202 1 . . . 1 1 
       1203 1 . . . 1 1 
       1204 1 . . . 1 1 
       1205 1 . . . 1 1 
       1206 1 . . . 1 1 
       1207 1 . . . 1 1 
       1208 1 . . . 1 1 
       1209 1 . . . 1 1 
       1210 1 . . . 1 1 
       1211 1 . . . 1 1 
       1212 1 . . . 1 1 
       1213 1 . . . 1 1 
       1214 1 . . . 1 1 
       1215 1 . . . 1 1 
       1216 1 . . . 1 1 
       1217 1 . . . 1 1 
       1218 1 . . . 1 1 
       1219 1 . . . 1 1 
       1220 1 . . . 1 1 
       1221 1 . . . 1 1 
       1222 1 . . . 1 1 
       1223 1 . . . 1 1 
       1224 1 . . . 1 1 
       1225 1 . . . 1 1 
       1226 1 . . . 1 1 
       1227 1 . . . 1 1 
       1228 1 . . . 1 1 
       1229 1 . . . 1 1 
       1230 1 . . . 1 1 
       1231 1 . . . 1 1 
       1232 1 . . . 1 1 
       1233 1 . . . 1 1 
       1234 1 . . . 1 1 
       1235 1 . . . 1 1 
       1236 1 . . . 1 1 
       1237 1 . . . 1 1 
       1238 1 . . . 1 1 
       1239 1 . . . 1 1 
       1240 1 . . . 1 1 
       1241 1 . . . 1 1 
       1242 1 . . . 1 1 
       1243 1 . . . 1 1 
       1244 1 . . . 1 1 
       1245 1 . . . 1 1 
       1246 1 . . . 1 1 
       1247 1 . . . 1 1 
       1248 1 . . . 1 1 
       1249 1 . . . 1 1 
       1250 1 . . . 1 1 
       1251 1 . . . 1 1 
       1252 1 . . . 1 1 
       1253 1 . . . 1 1 
       1254 1 . . . 1 1 
       1255 1 . . . 1 1 
       1256 1 . . . 1 1 
       1257 1 . . . 1 1 
       1258 1 . . . 1 1 
       1259 1 . . . 1 1 
       1260 1 . . . 1 1 
       1261 1 . . . 1 1 
       1262 1 . . . 1 1 
       1263 1 . . . 1 1 
       1264 1 . . . 1 1 
       1265 1 . . . 1 1 
       1266 1 . . . 1 1 
       1267 1 . . . 1 1 
       1268 1 . . . 1 1 
       1269 1 . . . 1 1 
       1270 1 . . . 1 1 
       1271 1 . . . 1 1 
       1272 1 . . . 1 1 
       1273 1 . . . 1 1 
       1274 1 . . . 1 1 
       1275 1 . . . 1 1 
       1276 1 . . . 1 1 
       1277 1 . . . 1 1 
       1278 1 . . . 1 1 
       1279 1 . . . 1 1 
       1280 1 . . . 1 1 
       1281 1 . . . 1 1 
       1282 1 . . . 1 1 
       1283 1 . . . 1 1 
       1284 1 . . . 1 1 
       1285 1 . . . 1 1 
       1286 1 . . . 1 1 
       1287 1 . . . 1 1 
       1288 1 . . . 1 1 
       1289 1 . . . 1 1 
       1290 1 . . . 1 1 
       1291 1 . . . 1 1 
       1292 1 . . . 1 1 
       1293 1 . . . 1 1 
       1294 1 . . . 1 1 
       1295 1 . . . 1 1 
       1296 1 . . . 1 1 
       1297 1 . . . 1 1 
       1298 1 . . . 1 1 
       1299 1 . . . 1 1 
       1300 1 . . . 1 1 
       1301 1 . . . 1 1 
       1302 1 . . . 1 1 
       1303 1 . . . 1 1 
       1304 1 . . . 1 1 
       1305 1 . . . 1 1 
       1306 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

          1 1 1 1 1  28 MET ME   .  28 . HE*  1 1 
          1 1 2 1 1  44 PHE HE1  .  44 . HE2  1 1 
          2 1 1 1 1  86 SER HA   .  86 . HA   1 1 
          2 1 2 1 1  87 THR MG   .  87 . HG2* 1 1 
          3 1 1 1 1  87 THR MG   .  87 . HG2* 1 1 
          3 1 2 1 1 127 ARG HA   . 127 . HA   1 1 
          4 1 1 1 1  72 MET ME   .  72 . HE*  1 1 
          4 1 2 1 1 126 LEU MD2  . 126 . HD2* 1 1 
          5 1 1 1 1  75 TYR HE2  .  75 . HE2  1 1 
          5 1 2 1 1 102 LEU QD   . 102 . HD2* 1 1 
          6 1 1 1 1  85 THR MG   .  85 . HG2* 1 1 
          6 1 2 1 1  86 SER H    .  86 . HN   1 1 
          7 1 1 1 1  79 ALA MB   .  79 . HB*  1 1 
          7 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
          8 1 1 1 1  84 VAL HA   .  84 . HA   1 1 
          8 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
          9 1 1 1 1  84 VAL MG2  .  84 . HG2* 1 1 
          9 1 2 1 1  85 THR H    .  85 . HN   1 1 
         10 1 1 1 1  82 ASP H    .  82 . HN   1 1 
         10 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
         11 1 1 1 1  84 VAL MG2  .  84 . HG2* 1 1 
         11 1 2 1 1  86 SER H    .  86 . HN   1 1 
         12 1 1 1 1 125 THR H    . 125 . HN   1 1 
         12 1 2 1 1 151 ILE MD   . 151 . HD1* 1 1 
         13 1 1 1 1 150 VAL H    . 150 . HN   1 1 
         13 1 2 1 1 151 ILE MD   . 151 . HD1* 1 1 
         14 1 1 1 1  80 ILE MD   .  80 . HD1* 1 1 
         14 1 2 1 1  80 ILE MG   .  80 . HG2* 1 1 
         15 1 1 1 1  80 ILE MD   .  80 . HD1* 1 1 
         15 1 2 1 1 134 ILE H    . 134 . HN   1 1 
         16 1 1 1 1  80 ILE MD   .  80 . HD1* 1 1 
         16 1 2 1 1  81 ASN H    .  81 . HN   1 1 
         17 1 1 1 1  80 ILE MD   .  80 . HD1* 1 1 
         17 1 2 1 1 135 ALA H    . 135 . HN   1 1 
         18 1 1 1 1 168 LEU MD1  . 168 . HD1* 1 1 
         18 1 2 1 1 171 LEU H    . 171 . HN   1 1 
         19 1 1 1 1 168 LEU MD2  . 168 . HD2* 1 1 
         19 1 2 1 1 171 LEU H    . 171 . HN   1 1 
         20 1 1 1 1 160 GLU H    . 160 . HN   1 1 
         20 1 2 1 1 161 ILE MG   . 161 . HG2* 1 1 
         21 1 1 1 1  17 LEU MD1  .  17 . HD1* 1 1 
         21 1 2 1 1  57 LEU H    .  57 . HN   1 1 
         22 1 1 1 1  17 LEU MD1  .  17 . HD1* 1 1 
         22 1 2 1 1  21 HIS HE1  .  21 . HE1  1 1 
         23 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
         23 1 2 1 1  49 PHE HE1  .  49 . HE1  1 1 
         24 1 1 1 1 161 ILE HB   . 161 . HB   1 1 
         24 1 2 1 1 161 ILE MD   . 161 . HD1* 1 1 
         25 1 1 1 1  58 ILE HB   .  58 . HB   1 1 
         25 1 2 1 1  58 ILE MD   .  58 . HD1* 1 1 
         26 1 1 1 1 124 ILE H    . 124 . HN   1 1 
         26 1 2 1 1 124 ILE MG   . 124 . HG2* 1 1 
         27 1 1 1 1 124 ILE HB   . 124 . HB   1 1 
         27 1 2 1 1 154 LEU MD1  . 154 . HD1* 1 1 
         28 1 1 1 1 125 THR H    . 125 . HN   1 1 
         28 1 2 1 1 154 LEU MD1  . 154 . HD1* 1 1 
         29 1 1 1 1 124 ILE H    . 124 . HN   1 1 
         29 1 2 1 1 154 LEU MD1  . 154 . HD1* 1 1 
         30 1 1 1 1 151 ILE H    . 151 . HN   1 1 
         30 1 2 1 1 154 LEU MD1  . 154 . HD1* 1 1 
         31 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
         31 1 2 1 1  92 ILE MG   .  92 . HG2* 1 1 
         32 1 1 1 1 134 ILE H    . 134 . HN   1 1 
         32 1 2 1 1 134 ILE MD   . 134 . HD1* 1 1 
         33 1 1 1 1  92 ILE H    .  92 . HN   1 1 
         33 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
         34 1 1 1 1 131 ASN HA   . 131 . HA   1 1 
         34 1 2 1 1 134 ILE MG   . 134 . HG2* 1 1 
         35 1 1 1 1 133 ILE MD   . 133 . HD1* 1 1 
         35 1 2 1 1 143 TRP HE3  . 143 . HE3  1 1 
         36 1 1 1 1 124 ILE H    . 124 . HN   1 1 
         36 1 2 1 1 124 ILE MD   . 124 . HD1* 1 1 
         37 1 1 1 1 124 ILE MD   . 124 . HD1* 1 1 
         37 1 2 1 1 125 THR H    . 125 . HN   1 1 
         38 1 1 1 1 124 ILE HB   . 124 . HB   1 1 
         38 1 2 1 1 124 ILE MD   . 124 . HD1* 1 1 
         39 1 1 1 1  22 LEU MD2  .  22 . HD2* 1 1 
         39 1 2 1 1  25 ALA MB   .  25 . HB*  1 1 
         40 1 1 1 1  89 GLU H    .  89 . HN   1 1 
         40 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
         41 1 1 1 1  95 ASP H    .  95 . HN   1 1 
         41 1 2 1 1 119 LEU MD1  . 119 . HD1* 1 1 
         42 1 1 1 1  92 ILE H    .  92 . HN   1 1 
         42 1 2 1 1 119 LEU MD1  . 119 . HD1* 1 1 
         43 1 1 1 1 169 GLN H    . 169 . HN   1 1 
         43 1 2 1 1 171 LEU MD2  . 171 . HD2* 1 1 
         44 1 1 1 1  44 PHE HD2  .  44 . HD1  1 1 
         44 1 2 1 1  57 LEU MD1  .  57 . HD1* 1 1 
         45 1 1 1 1  49 PHE HE1  .  49 . HE1  1 1 
         45 1 2 1 1  57 LEU MD1  .  57 . HD1* 1 1 
         46 1 1 1 1  75 TYR HE2  .  75 . HE2  1 1 
         46 1 2 1 1  98 LEU QD   .  98 . HD1* 1 1 
         47 1 1 1 1  98 LEU H    .  98 . HN   1 1 
         47 1 2 1 1  98 LEU QD   .  98 . HD1* 1 1 
         48 1 1 1 1  87 THR H    .  87 . HN   1 1 
         48 1 2 1 1 126 LEU MD2  . 126 . HD2* 1 1 
         49 1 1 1 1  98 LEU QD   .  98 . HD2* 1 1 
         49 1 2 1 1  99 TYR HD1  .  99 . HD1  1 1 
         50 1 1 1 1 143 TRP HZ3  . 143 . HZ3  1 1 
         50 1 2 1 1 147 ILE MD   . 147 . HD1* 1 1 
         51 1 1 1 1 147 ILE MD   . 147 . HD1* 1 1 
         51 1 2 1 1 148 TYR H    . 148 . HN   1 1 
         52 1 1 1 1 133 ILE H    . 133 . HN   1 1 
         52 1 2 1 1 147 ILE MD   . 147 . HD1* 1 1 
         53 1 1 1 1  49 PHE HD1  .  49 . HD1  1 1 
         53 1 2 1 1  57 LEU MD2  .  57 . HD2* 1 1 
         54 1 1 1 1 113 GLU HA   . 113 . HA   1 1 
         54 1 2 1 1 114 VAL MG1  . 114 . HG1* 1 1 
         55 1 1 1 1 139 VAL HA   . 139 . HA   1 1 
         55 1 2 1 1 139 VAL MG1  . 139 . HG1* 1 1 
         56 1 1 1 1 125 THR MG   . 125 . HG2* 1 1 
         56 1 2 1 1 151 ILE MG   . 151 . HG2* 1 1 
         57 1 1 1 1 129 PHE QE   . 129 . HE1  1 1 
         57 1 2 1 1 151 ILE MG   . 151 . HG2* 1 1 
         58 1 1 1 1 126 LEU H    . 126 . HN   1 1 
         58 1 2 1 1 151 ILE MG   . 151 . HG2* 1 1 
         59 1 1 1 1 151 ILE MG   . 151 . HG2* 1 1 
         59 1 2 1 1 154 LEU HG   . 154 . HG   1 1 
         60 1 1 1 1  93 THR H    .  93 . HN   1 1 
         60 1 2 1 1 122 ALA MB   . 122 . HB*  1 1 
         61 1 1 1 1  13 MET H    .  13 . HN   1 1 
         61 1 2 1 1  13 MET ME   .  13 . HE*  1 1 
         62 1 1 1 1 124 ILE H    . 124 . HN   1 1 
         62 1 2 1 1 125 THR MG   . 125 . HG2* 1 1 
         63 1 1 1 1  85 THR HA   .  85 . HA   1 1 
         63 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
         64 1 1 1 1 121 VAL MG2  . 121 . HG2* 1 1 
         64 1 2 1 1 122 ALA H    . 122 . HN   1 1 
         65 1 1 1 1  75 TYR H    .  75 . HN   1 1 
         65 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
         66 1 1 1 1  79 ALA MB   .  79 . HB*  1 1 
         66 1 2 1 1  90 LEU MD1  .  90 . HD1* 1 1 
         67 1 1 1 1  57 LEU MD1  .  57 . HD1* 1 1 
         67 1 2 1 1  60 TRP HH2  .  60 . HH2  1 1 
         68 1 1 1 1  32 THR MG   .  32 . HG2* 1 1 
         68 1 2 1 1  43 TYR HD2  .  43 . HD1  1 1 
         69 1 1 1 1 133 ILE MG   . 133 . HG2* 1 1 
         69 1 2 1 1 135 ALA H    . 135 . HN   1 1 
         70 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
         70 1 2 1 1 122 ALA MB   . 122 . HB*  1 1 
         71 1 1 1 1 124 ILE MD   . 124 . HD1* 1 1 
         71 1 2 1 1 154 LEU MD2  . 154 . HD2* 1 1 
         72 1 1 1 1 149 LYS H    . 149 . HN   1 1 
         72 1 2 1 1 151 ILE MG   . 151 . HG2* 1 1 
         73 1 1 1 1  58 ILE HG12 .  58 . HG12 1 1 
         73 1 2 1 1  58 ILE MG   .  58 . HG2* 1 1 
         74 1 1 1 1  58 ILE HG13 .  58 . HG11 1 1 
         74 1 2 1 1  58 ILE MG   .  58 . HG2* 1 1 
         75 1 1 1 1  25 ALA MB   .  25 . HB*  1 1 
         75 1 2 1 1  44 PHE HE2  .  44 . HE1  1 1 
         76 1 1 1 1  25 ALA MB   .  25 . HB*  1 1 
         76 1 2 1 1  44 PHE HE1  .  44 . HE2  1 1 
         77 1 1 1 1  39 MET ME   .  39 . HE*  1 1 
         77 1 2 1 1  40 LEU HA   .  40 . HA   1 1 
         78 1 1 1 1  45 SER HA   .  45 . HA   1 1 
         78 1 2 1 1  47 VAL MG2  .  47 . HG2* 1 1 
         79 1 1 1 1  47 VAL MG2  .  47 . HG2* 1 1 
         79 1 2 1 1  48 LYS HA   .  48 . HA   1 1 
         80 1 1 1 1  47 VAL MG2  .  47 . HG2* 1 1 
         80 1 2 1 1  49 PHE HA   .  49 . HA   1 1 
         81 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
         81 1 2 1 1  49 PHE HA   .  49 . HA   1 1 
         82 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
         82 1 2 1 1  25 ALA MB   .  25 . HB*  1 1 
         83 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
         83 1 2 1 1  47 VAL HB   .  47 . HB   1 1 
         84 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
         84 1 2 1 1  53 ILE HB   .  53 . HB   1 1 
         85 1 1 1 1  43 TYR HD2  .  43 . HD1  1 1 
         85 1 2 1 1 158 VAL MG1  . 158 . HG1* 1 1 
         86 1 1 1 1  39 MET HA   .  39 . HA   1 1 
         86 1 2 1 1 158 VAL MG1  . 158 . HG1* 1 1 
         87 1 1 1 1 157 GLU HA   . 157 . HA   1 1 
         87 1 2 1 1 158 VAL MG2  . 158 . HG2* 1 1 
         88 1 1 1 1  44 PHE H    .  44 . HN   1 1 
         88 1 2 1 1  57 LEU MD1  .  57 . HD1* 1 1 
         89 1 1 1 1  76 ALA HA   .  76 . HA   1 1 
         89 1 2 1 1  90 LEU MD1  .  90 . HD1* 1 1 
         90 1 1 1 1  87 THR HB   .  87 . HB   1 1 
         90 1 2 1 1  90 LEU MD1  .  90 . HD1* 1 1 
         91 1 1 1 1  39 MET ME   .  39 . HE*  1 1 
         91 1 2 1 1  57 LEU MD1  .  57 . HD1* 1 1 
         92 1 1 1 1  40 LEU HA   .  40 . HA   1 1 
         92 1 2 1 1  57 LEU MD2  .  57 . HD2* 1 1 
         93 1 1 1 1  57 LEU MD2  .  57 . HD2* 1 1 
         93 1 2 1 1  58 ILE HG13 .  58 . HG11 1 1 
         94 1 1 1 1  57 LEU MD2  .  57 . HD2* 1 1 
         94 1 2 1 1  58 ILE HG12 .  58 . HG12 1 1 
         95 1 1 1 1  17 LEU MD1  .  17 . HD1* 1 1 
         95 1 2 1 1  57 LEU HG   .  57 . HG   1 1 
         96 1 1 1 1  87 THR HA   .  87 . HA   1 1 
         96 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
         97 1 1 1 1  44 PHE HE2  .  44 . HE1  1 1 
         97 1 2 1 1  47 VAL MG1  .  47 . HG1* 1 1 
         98 1 1 1 1  47 VAL MG1  .  47 . HG1* 1 1 
         98 1 2 1 1  48 LYS HA   .  48 . HA   1 1 
         99 1 1 1 1 118 PHE H    . 118 . HN   1 1 
         99 1 2 1 1 119 LEU MD2  . 119 . HD2* 1 1 
        100 1 1 1 1  98 LEU QD   .  98 . HD1* 1 1 
        100 1 2 1 1 102 LEU HB2  . 102 . HB2  1 1 
        101 1 1 1 1  98 LEU QD   .  98 . HD1* 1 1 
        101 1 2 1 1 102 LEU HB3  . 102 . HB1  1 1 
        102 1 1 1 1 172 LEU MD1  . 172 . HD1* 1 1 
        102 1 2 1 1 173 HIS H    . 173 . HN   1 1 
        103 1 1 1 1  93 THR HA   .  93 . HA   1 1 
        103 1 2 1 1 119 LEU MD1  . 119 . HD1* 1 1 
        104 1 1 1 1 119 LEU HB3  . 119 . HB1  1 1 
        104 1 2 1 1 119 LEU MD1  . 119 . HD1* 1 1 
        105 1 1 1 1 168 LEU MD2  . 168 . HD2* 1 1 
        105 1 2 1 1 169 GLN H    . 169 . HN   1 1 
        106 1 1 1 1  92 ILE MG   .  92 . HG2* 1 1 
        106 1 2 1 1 119 LEU HB3  . 119 . HB1  1 1 
        107 1 1 1 1 121 VAL MG2  . 121 . HG2* 1 1 
        107 1 2 1 1 152 CYS H    . 152 . HN   1 1 
        108 1 1 1 1 121 VAL MG2  . 121 . HG2* 1 1 
        108 1 2 1 1 154 LEU HA   . 154 . HA   1 1 
        109 1 1 1 1 121 VAL MG2  . 121 . HG2* 1 1 
        109 1 2 1 1 152 CYS HA   . 152 . HA   1 1 
        110 1 1 1 1 101 ALA HA   . 101 . HA   1 1 
        110 1 2 1 1 102 LEU QD   . 102 . HD2* 1 1 
        111 1 1 1 1  76 ALA MB   .  76 . HB*  1 1 
        111 1 2 1 1 129 PHE HA   . 129 . HA   1 1 
        112 1 1 1 1  73 GLU HA   .  73 . HA   1 1 
        112 1 2 1 1  76 ALA MB   .  76 . HB*  1 1 
        113 1 1 1 1  39 MET ME   .  39 . HE*  1 1 
        113 1 2 1 1  44 PHE H    .  44 . HN   1 1 
        114 1 1 1 1  25 ALA MB   .  25 . HB*  1 1 
        114 1 2 1 1  61 PHE H    .  61 . HN   1 1 
        115 1 1 1 1  25 ALA MB   .  25 . HB*  1 1 
        115 1 2 1 1  57 LEU HA   .  57 . HA   1 1 
        116 1 1 1 1 122 ALA MB   . 122 . HB*  1 1 
        116 1 2 1 1 126 LEU H    . 126 . HN   1 1 
        117 1 1 1 1  57 LEU HB3  .  57 . HB1  1 1 
        117 1 2 1 1  58 ILE MG   .  58 . HG2* 1 1 
        118 1 1 1 1 124 ILE MG   . 124 . HG2* 1 1 
        118 1 2 1 1 150 VAL HB   . 150 . HB   1 1 
        119 1 1 1 1 168 LEU HB2  . 168 . HB2  1 1 
        119 1 2 1 1 171 LEU MD1  . 171 . HD1* 1 1 
        120 1 1 1 1  32 THR MG   .  32 . HG2* 1 1 
        120 1 2 1 1 158 VAL HB   . 158 . HB   1 1 
        121 1 1 1 1  80 ILE MD   .  80 . HD1* 1 1 
        121 1 2 1 1 131 ASN HA   . 131 . HA   1 1 
        122 1 1 1 1  80 ILE MD   .  80 . HD1* 1 1 
        122 1 2 1 1 133 ILE HB   . 133 . HB   1 1 
        123 1 1 1 1 121 VAL HA   . 121 . HA   1 1 
        123 1 2 1 1 124 ILE MD   . 124 . HD1* 1 1 
        124 1 1 1 1  80 ILE MG   .  80 . HG2* 1 1 
        124 1 2 1 1  81 ASN HA   .  81 . HA   1 1 
        125 1 1 1 1 132 ALA MB   . 132 . HB*  1 1 
        125 1 2 1 1 147 ILE MD   . 147 . HD1* 1 1 
        126 1 1 1 1 147 ILE MD   . 147 . HD1* 1 1 
        126 1 2 1 1 147 ILE MG   . 147 . HG2* 1 1 
        127 1 1 1 1 121 VAL HA   . 121 . HA   1 1 
        127 1 2 1 1 154 LEU MD1  . 154 . HD1* 1 1 
        128 1 1 1 1 161 ILE MD   . 161 . HD1* 1 1 
        128 1 2 1 1 167 CYS H    . 167 . HN   1 1 
        129 1 1 1 1  22 LEU MD1  .  22 . HD1* 1 1 
        129 1 2 1 1  60 TRP HH2  .  60 . HH2  1 1 
        130 1 1 1 1  22 LEU MD1  .  22 . HD1* 1 1 
        130 1 2 1 1  60 TRP HE3  .  60 . HE3  1 1 
        131 1 1 1 1  22 LEU MD1  .  22 . HD1* 1 1 
        131 1 2 1 1  25 ALA MB   .  25 . HB*  1 1 
        132 1 1 1 1  28 MET ME   .  28 . HE*  1 1 
        132 1 2 1 1  44 PHE HZ   .  44 . HZ   1 1 
        133 1 1 1 1  28 MET ME   .  28 . HE*  1 1 
        133 1 2 1 1  44 PHE H    .  44 . HN   1 1 
        134 1 1 1 1  28 MET ME   .  28 . HE*  1 1 
        134 1 2 1 1  43 TYR HE2  .  43 . HE1  1 1 
        135 1 1 1 1  87 THR MG   .  87 . HG2* 1 1 
        135 1 2 1 1  90 LEU MD1  .  90 . HD1* 1 1 
        136 1 1 1 1  87 THR MG   .  87 . HG2* 1 1 
        136 1 2 1 1 131 ASN H    . 131 . HN   1 1 
        137 1 1 1 1  87 THR MG   .  87 . HG2* 1 1 
        137 1 2 1 1 128 GLU H    . 128 . HN   1 1 
        138 1 1 1 1  87 THR MG   .  87 . HG2* 1 1 
        138 1 2 1 1 127 ARG H    . 127 . HN   1 1 
        139 1 1 1 1  86 SER H    .  86 . HN   1 1 
        139 1 2 1 1  87 THR MG   .  87 . HG2* 1 1 
        140 1 1 1 1  87 THR HA   .  87 . HA   1 1 
        140 1 2 1 1  87 THR MG   .  87 . HG2* 1 1 
        141 1 1 1 1  79 ALA MB   .  79 . HB*  1 1 
        141 1 2 1 1  87 THR MG   .  87 . HG2* 1 1 
        142 1 1 1 1  87 THR MG   .  87 . HG2* 1 1 
        142 1 2 1 1 126 LEU HG   . 126 . HG   1 1 
        143 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
        143 1 2 1 1  87 THR MG   .  87 . HG2* 1 1 
        144 1 1 1 1  72 MET ME   .  72 . HE*  1 1 
        144 1 2 1 1 102 LEU QD   . 102 . HD1* 1 1 
        145 1 1 1 1  72 MET ME   .  72 . HE*  1 1 
        145 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
        146 1 1 1 1  72 MET ME   .  72 . HE*  1 1 
        146 1 2 1 1 106 TYR QE   . 106 . HE2  1 1 
        147 1 1 1 1  72 MET ME   .  72 . HE*  1 1 
        147 1 2 1 1  91 SER H    .  91 . HN   1 1 
        148 1 1 1 1  72 MET ME   .  72 . HE*  1 1 
        148 1 2 1 1 126 LEU HA   . 126 . HA   1 1 
        149 1 1 1 1  72 MET ME   .  72 . HE*  1 1 
        149 1 2 1 1  75 TYR HD2  .  75 . HD2  1 1 
        150 1 1 1 1 102 LEU QD   . 102 . HD2* 1 1 
        150 1 2 1 1 105 HIS H    . 105 . HN   1 1 
        151 1 1 1 1 102 LEU QD   . 102 . HD2* 1 1 
        151 1 2 1 1 106 TYR QD   . 106 . HD2  1 1 
        152 1 1 1 1  54 THR MG   .  54 . HG2* 1 1 
        152 1 2 1 1  58 ILE HG13 .  58 . HG11 1 1 
        153 1 1 1 1  47 VAL MG1  .  47 . HG1* 1 1 
        153 1 2 1 1  54 THR MG   .  54 . HG2* 1 1 
        154 1 1 1 1  54 THR MG   .  54 . HG2* 1 1 
        154 1 2 1 1  57 LEU H    .  57 . HN   1 1 
        155 1 1 1 1  82 ASP HB3  .  82 . HB1  1 1 
        155 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
        156 1 1 1 1 151 ILE H    . 151 . HN   1 1 
        156 1 2 1 1 151 ILE MD   . 151 . HD1* 1 1 
        157 1 1 1 1  80 ILE MD   .  80 . HD1* 1 1 
        157 1 2 1 1 133 ILE MG   . 133 . HG2* 1 1 
        158 1 1 1 1  80 ILE MD   .  80 . HD1* 1 1 
        158 1 2 1 1 133 ILE H    . 133 . HN   1 1 
        159 1 1 1 1  77 ARG H    .  77 . HN   1 1 
        159 1 2 1 1  80 ILE MD   .  80 . HD1* 1 1 
        160 1 1 1 1  78 GLN H    .  78 . HN   1 1 
        160 1 2 1 1  80 ILE MD   .  80 . HD1* 1 1 
        161 1 1 1 1  80 ILE MD   .  80 . HD1* 1 1 
        161 1 2 1 1  84 VAL H    .  84 . HN   1 1 
        162 1 1 1 1 167 CYS H    . 167 . HN   1 1 
        162 1 2 1 1 168 LEU MD1  . 168 . HD1* 1 1 
        163 1 1 1 1 167 CYS HA   . 167 . HA   1 1 
        163 1 2 1 1 168 LEU MD1  . 168 . HD1* 1 1 
        164 1 1 1 1 168 LEU HA   . 168 . HA   1 1 
        164 1 2 1 1 168 LEU MD1  . 168 . HD1* 1 1 
        165 1 1 1 1 168 LEU MD2  . 168 . HD2* 1 1 
        165 1 2 1 1 171 LEU HG   . 171 . HG   1 1 
        166 1 1 1 1 161 ILE MG   . 161 . HG2* 1 1 
        166 1 2 1 1 163 LYS H    . 163 . HN   1 1 
        167 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
        167 1 2 1 1  57 LEU HG   .  57 . HG   1 1 
        168 1 1 1 1  21 HIS HE1  .  21 . HE1  1 1 
        168 1 2 1 1  47 VAL MG2  .  47 . HG2* 1 1 
        169 1 1 1 1  17 LEU MD1  .  17 . HD1* 1 1 
        169 1 2 1 1  22 LEU MD1  .  22 . HD1* 1 1 
        170 1 1 1 1  17 LEU H    .  17 . HN   1 1 
        170 1 2 1 1  17 LEU MD2  .  17 . HD2* 1 1 
        171 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
        171 1 2 1 1  60 TRP HH2  .  60 . HH2  1 1 
        172 1 1 1 1  17 LEU MD1  .  17 . HD1* 1 1 
        172 1 2 1 1  60 TRP HH2  .  60 . HH2  1 1 
        173 1 1 1 1  80 ILE MG   .  80 . HG2* 1 1 
        173 1 2 1 1 133 ILE MG   . 133 . HG2* 1 1 
        174 1 1 1 1  80 ILE H    .  80 . HN   1 1 
        174 1 2 1 1  80 ILE MG   .  80 . HG2* 1 1 
        175 1 1 1 1  54 THR MG   .  54 . HG2* 1 1 
        175 1 2 1 1  58 ILE MD   .  58 . HD1* 1 1 
        176 1 1 1 1 124 ILE HA   . 124 . HA   1 1 
        176 1 2 1 1 124 ILE MG   . 124 . HG2* 1 1 
        177 1 1 1 1  70 ILE MD   .  70 . HD1* 1 1 
        177 1 2 1 1  70 ILE MG   .  70 . HG2* 1 1 
        178 1 1 1 1 147 ILE MG   . 147 . HG2* 1 1 
        178 1 2 1 1 151 ILE MD   . 151 . HD1* 1 1 
        179 1 1 1 1 147 ILE MG   . 147 . HG2* 1 1 
        179 1 2 1 1 151 ILE H    . 151 . HN   1 1 
        180 1 1 1 1 147 ILE H    . 147 . HN   1 1 
        180 1 2 1 1 147 ILE MG   . 147 . HG2* 1 1 
        181 1 1 1 1 121 VAL H    . 121 . HN   1 1 
        181 1 2 1 1 154 LEU MD1  . 154 . HD1* 1 1 
        182 1 1 1 1  92 ILE H    .  92 . HN   1 1 
        182 1 2 1 1  92 ILE MG   .  92 . HG2* 1 1 
        183 1 1 1 1 134 ILE HA   . 134 . HA   1 1 
        183 1 2 1 1 134 ILE MD   . 134 . HD1* 1 1 
        184 1 1 1 1 134 ILE HA   . 134 . HA   1 1 
        184 1 2 1 1 134 ILE MG   . 134 . HG2* 1 1 
        185 1 1 1 1 147 ILE MG   . 147 . HG2* 1 1 
        185 1 2 1 1 148 TYR HD1  . 148 . HD2  1 1 
        186 1 1 1 1 133 ILE MD   . 133 . HD1* 1 1 
        186 1 2 1 1 133 ILE MG   . 133 . HG2* 1 1 
        187 1 1 1 1 133 ILE MD   . 133 . HD1* 1 1 
        187 1 2 1 1 143 TRP HZ3  . 143 . HZ3  1 1 
        188 1 1 1 1 133 ILE H    . 133 . HN   1 1 
        188 1 2 1 1 133 ILE MD   . 133 . HD1* 1 1 
        189 1 1 1 1 133 ILE MG   . 133 . HG2* 1 1 
        189 1 2 1 1 134 ILE H    . 134 . HN   1 1 
        190 1 1 1 1  22 LEU MD2  .  22 . HD2* 1 1 
        190 1 2 1 1  60 TRP HH2  .  60 . HH2  1 1 
        191 1 1 1 1  22 LEU MD2  .  22 . HD2* 1 1 
        191 1 2 1 1  60 TRP HE3  .  60 . HE3  1 1 
        192 1 1 1 1 114 VAL MG1  . 114 . HG1* 1 1 
        192 1 2 1 1 119 LEU H    . 119 . HN   1 1 
        193 1 1 1 1  79 ALA MB   .  79 . HB*  1 1 
        193 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
        194 1 1 1 1  87 THR MG   .  87 . HG2* 1 1 
        194 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
        195 1 1 1 1  84 VAL MG2  .  84 . HG2* 1 1 
        195 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
        196 1 1 1 1  90 LEU MD2  .  90 . HD2* 1 1 
        196 1 2 1 1  91 SER H    .  91 . HN   1 1 
        197 1 1 1 1  87 THR H    .  87 . HN   1 1 
        197 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
        198 1 1 1 1 172 LEU MD2  . 172 . HD2* 1 1 
        198 1 2 1 1 173 HIS H    . 173 . HN   1 1 
        199 1 1 1 1 119 LEU MD1  . 119 . HD1* 1 1 
        199 1 2 1 1 123 GLN H    . 123 . HN   1 1 
        200 1 1 1 1  93 THR H    .  93 . HN   1 1 
        200 1 2 1 1 119 LEU MD1  . 119 . HD1* 1 1 
        201 1 1 1 1 171 LEU H    . 171 . HN   1 1 
        201 1 2 1 1 172 LEU MD2  . 172 . HD2* 1 1 
        202 1 1 1 1  99 TYR HD2  .  99 . HD2  1 1 
        202 1 2 1 1 119 LEU MD2  . 119 . HD2* 1 1 
        203 1 1 1 1 119 LEU H    . 119 . HN   1 1 
        203 1 2 1 1 119 LEU MD2  . 119 . HD2* 1 1 
        204 1 1 1 1 168 LEU H    . 168 . HN   1 1 
        204 1 2 1 1 171 LEU MD2  . 171 . HD2* 1 1 
        205 1 1 1 1 171 LEU H    . 171 . HN   1 1 
        205 1 2 1 1 171 LEU MD2  . 171 . HD2* 1 1 
        206 1 1 1 1 168 LEU H    . 168 . HN   1 1 
        206 1 2 1 1 171 LEU MD1  . 171 . HD1* 1 1 
        207 1 1 1 1  49 PHE HZ   .  49 . HZ   1 1 
        207 1 2 1 1  57 LEU MD1  .  57 . HD1* 1 1 
        208 1 1 1 1  44 PHE HE2  .  44 . HE1  1 1 
        208 1 2 1 1  57 LEU MD1  .  57 . HD1* 1 1 
        209 1 1 1 1  44 PHE HE2  .  44 . HE1  1 1 
        209 1 2 1 1  57 LEU MD2  .  57 . HD2* 1 1 
        210 1 1 1 1  75 TYR HD2  .  75 . HD2  1 1 
        210 1 2 1 1  98 LEU QD   .  98 . HD1* 1 1 
        211 1 1 1 1  93 THR MG   .  93 . HG2* 1 1 
        211 1 2 1 1 119 LEU MD2  . 119 . HD2* 1 1 
        212 1 1 1 1 129 PHE QD   . 129 . HD2  1 1 
        212 1 2 1 1 147 ILE MD   . 147 . HD1* 1 1 
        213 1 1 1 1 143 TRP HE3  . 143 . HE3  1 1 
        213 1 2 1 1 147 ILE MD   . 147 . HD1* 1 1 
        214 1 1 1 1 143 TRP HD1  . 143 . HD1  1 1 
        214 1 2 1 1 147 ILE MD   . 147 . HD1* 1 1 
        215 1 1 1 1 129 PHE QE   . 129 . HE2  1 1 
        215 1 2 1 1 147 ILE MD   . 147 . HD1* 1 1 
        216 1 1 1 1 128 GLU H    . 128 . HN   1 1 
        216 1 2 1 1 147 ILE MD   . 147 . HD1* 1 1 
        217 1 1 1 1  21 HIS HE1  .  21 . HE1  1 1 
        217 1 2 1 1  47 VAL MG1  .  47 . HG1* 1 1 
        218 1 1 1 1  47 VAL MG1  .  47 . HG1* 1 1 
        218 1 2 1 1  49 PHE HD1  .  49 . HD1  1 1 
        219 1 1 1 1  32 THR MG   .  32 . HG2* 1 1 
        219 1 2 1 1 158 VAL MG2  . 158 . HG2* 1 1 
        220 1 1 1 1  80 ILE MD   .  80 . HD1* 1 1 
        220 1 2 1 1 133 ILE MD   . 133 . HD1* 1 1 
        221 1 1 1 1 114 VAL MG2  . 114 . HG2* 1 1 
        221 1 2 1 1 119 LEU MD1  . 119 . HD1* 1 1 
        222 1 1 1 1 114 VAL MG1  . 114 . HG1* 1 1 
        222 1 2 1 1 118 PHE H    . 118 . HN   1 1 
        223 1 1 1 1 139 VAL H    . 139 . HN   1 1 
        223 1 2 1 1 139 VAL MG1  . 139 . HG1* 1 1 
        224 1 1 1 1 151 ILE MD   . 151 . HD1* 1 1 
        224 1 2 1 1 151 ILE MG   . 151 . HG2* 1 1 
        225 1 1 1 1 151 ILE MG   . 151 . HG2* 1 1 
        225 1 2 1 1 154 LEU MD1  . 154 . HD1* 1 1 
        226 1 1 1 1 151 ILE H    . 151 . HN   1 1 
        226 1 2 1 1 151 ILE MG   . 151 . HG2* 1 1 
        227 1 1 1 1 151 ILE MG   . 151 . HG2* 1 1 
        227 1 2 1 1 153 LYS H    . 153 . HN   1 1 
        228 1 1 1 1 151 ILE MG   . 151 . HG2* 1 1 
        228 1 2 1 1 152 CYS HA   . 152 . HA   1 1 
        229 1 1 1 1  25 ALA MB   .  25 . HB*  1 1 
        229 1 2 1 1  44 PHE HZ   .  44 . HZ   1 1 
        230 1 1 1 1  32 THR MG   .  32 . HG2* 1 1 
        230 1 2 1 1  39 MET ME   .  39 . HE*  1 1 
        231 1 1 1 1  39 MET ME   .  39 . HE*  1 1 
        231 1 2 1 1 158 VAL MG1  . 158 . HG1* 1 1 
        232 1 1 1 1  39 MET ME   .  39 . HE*  1 1 
        232 1 2 1 1  44 PHE HE2  .  44 . HE1  1 1 
        233 1 1 1 1  39 MET ME   .  39 . HE*  1 1 
        233 1 2 1 1  43 TYR HD2  .  43 . HD1  1 1 
        234 1 1 1 1  39 MET ME   .  39 . HE*  1 1 
        234 1 2 1 1  43 TYR HE2  .  43 . HE1  1 1 
        235 1 1 1 1 125 THR MG   . 125 . HG2* 1 1 
        235 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
        236 1 1 1 1 125 THR MG   . 125 . HG2* 1 1 
        236 1 2 1 1 151 ILE MD   . 151 . HD1* 1 1 
        237 1 1 1 1 125 THR MG   . 125 . HG2* 1 1 
        237 1 2 1 1 147 ILE MG   . 147 . HG2* 1 1 
        238 1 1 1 1 125 THR MG   . 125 . HG2* 1 1 
        238 1 2 1 1 129 PHE QE   . 129 . HE1  1 1 
        239 1 1 1 1 125 THR MG   . 125 . HG2* 1 1 
        239 1 2 1 1 129 PHE H    . 129 . HN   1 1 
        240 1 1 1 1  72 MET H    .  72 . HN   1 1 
        240 1 2 1 1 125 THR MG   . 125 . HG2* 1 1 
        241 1 1 1 1  72 MET HA   .  72 . HA   1 1 
        241 1 2 1 1 125 THR MG   . 125 . HG2* 1 1 
        242 1 1 1 1  93 THR HA   .  93 . HA   1 1 
        242 1 2 1 1  93 THR MG   .  93 . HG2* 1 1 
        243 1 1 1 1  84 VAL HA   .  84 . HA   1 1 
        243 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
        244 1 1 1 1 121 VAL MG2  . 121 . HG2* 1 1 
        244 1 2 1 1 155 ASP H    . 155 . HN   1 1 
        245 1 1 1 1 126 LEU HA   . 126 . HA   1 1 
        245 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
        246 1 1 1 1  76 ALA HA   .  76 . HA   1 1 
        246 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
        247 1 1 1 1  89 GLU HB2  .  89 . HB2  1 1 
        247 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
        248 1 1 1 1  89 GLU HB3  .  89 . HB1  1 1 
        248 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
        249 1 1 1 1  76 ALA MB   .  76 . HB*  1 1 
        249 1 2 1 1 133 ILE MD   . 133 . HD1* 1 1 
        250 1 1 1 1 122 ALA MB   . 122 . HB*  1 1 
        250 1 2 1 1 125 THR MG   . 125 . HG2* 1 1 
        251 1 1 1 1 119 LEU HA   . 119 . HA   1 1 
        251 1 2 1 1 122 ALA MB   . 122 . HB*  1 1 
        252 1 1 1 1 121 VAL MG1  . 121 . HG1* 1 1 
        252 1 2 1 1 122 ALA MB   . 122 . HB*  1 1 
        253 1 1 1 1 121 VAL MG2  . 121 . HG2* 1 1 
        253 1 2 1 1 124 ILE MD   . 124 . HD1* 1 1 
        254 1 1 1 1  87 THR HA   .  87 . HA   1 1 
        254 1 2 1 1 126 LEU MD2  . 126 . HD2* 1 1 
        255 1 1 1 1  98 LEU QD   .  98 . HD2* 1 1 
        255 1 2 1 1 102 LEU QD   . 102 . HD2* 1 1 
        256 1 1 1 1  72 MET H    .  72 . HN   1 1 
        256 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
        257 1 1 1 1 139 VAL MG2  . 139 . HG2* 1 1 
        257 1 2 1 1 140 ASP H    . 140 . HN   1 1 
        258 1 1 1 1  54 THR MG   .  54 . HG2* 1 1 
        258 1 2 1 1  58 ILE HB   .  58 . HB   1 1 
        259 1 1 1 1  49 PHE HA   .  49 . HA   1 1 
        259 1 2 1 1  54 THR MG   .  54 . HG2* 1 1 
        260 1 1 1 1 124 ILE MG   . 124 . HG2* 1 1 
        260 1 2 1 1 154 LEU MD1  . 154 . HD1* 1 1 
        261 1 1 1 1  28 MET ME   .  28 . HE*  1 1 
        261 1 2 1 1  39 MET ME   .  39 . HE*  1 1 
        262 1 1 1 1  39 MET ME   .  39 . HE*  1 1 
        262 1 2 1 1  40 LEU H    .  40 . HN   1 1 
        263 1 1 1 1  54 THR MG   .  54 . HG2* 1 1 
        263 1 2 1 1  58 ILE MG   .  58 . HG2* 1 1 
        264 1 1 1 1  22 LEU MD1  .  22 . HD1* 1 1 
        264 1 2 1 1  57 LEU HA   .  57 . HA   1 1 
        265 1 1 1 1  22 LEU MD1  .  22 . HD1* 1 1 
        265 1 2 1 1  57 LEU MD2  .  57 . HD2* 1 1 
        266 1 1 1 1  47 VAL MG2  .  47 . HG2* 1 1 
        266 1 2 1 1  49 PHE H    .  49 . HN   1 1 
        267 1 1 1 1  44 PHE HA   .  44 . HA   1 1 
        267 1 2 1 1  47 VAL MG2  .  47 . HG2* 1 1 
        268 1 1 1 1  47 VAL HA   .  47 . HA   1 1 
        268 1 2 1 1  47 VAL MG2  .  47 . HG2* 1 1 
        269 1 1 1 1  44 PHE HB2  .  44 . HB2  1 1 
        269 1 2 1 1  47 VAL MG2  .  47 . HG2* 1 1 
        270 1 1 1 1  44 PHE HB3  .  44 . HB1  1 1 
        270 1 2 1 1  47 VAL MG2  .  47 . HG2* 1 1 
        271 1 1 1 1  47 VAL MG2  .  47 . HG2* 1 1 
        271 1 2 1 1  57 LEU HG   .  57 . HG   1 1 
        272 1 1 1 1 157 GLU HA   . 157 . HA   1 1 
        272 1 2 1 1 158 VAL MG1  . 158 . HG1* 1 1 
        273 1 1 1 1  32 THR MG   .  32 . HG2* 1 1 
        273 1 2 1 1 158 VAL MG1  . 158 . HG1* 1 1 
        274 1 1 1 1 158 VAL MG2  . 158 . HG2* 1 1 
        274 1 2 1 1 159 PRO HA   . 159 . HA   1 1 
        275 1 1 1 1  32 THR HB   .  32 . HB   1 1 
        275 1 2 1 1 158 VAL MG2  . 158 . HG2* 1 1 
        276 1 1 1 1  43 TYR HA   .  43 . HA   1 1 
        276 1 2 1 1 158 VAL MG2  . 158 . HG2* 1 1 
        277 1 1 1 1 158 VAL MG2  . 158 . HG2* 1 1 
        277 1 2 1 1 159 PRO HB2  . 159 . HB2  1 1 
        278 1 1 1 1 158 VAL MG2  . 158 . HG2* 1 1 
        278 1 2 1 1 159 PRO HB3  . 159 . HB1  1 1 
        279 1 1 1 1  39 MET ME   .  39 . HE*  1 1 
        279 1 2 1 1 158 VAL MG2  . 158 . HG2* 1 1 
        280 1 1 1 1 113 GLU H    . 113 . HN   1 1 
        280 1 2 1 1 114 VAL MG2  . 114 . HG2* 1 1 
        281 1 1 1 1 113 GLU HA   . 113 . HA   1 1 
        281 1 2 1 1 114 VAL MG2  . 114 . HG2* 1 1 
        282 1 1 1 1 113 GLU H    . 113 . HN   1 1 
        282 1 2 1 1 114 VAL MG1  . 114 . HG1* 1 1 
        283 1 1 1 1 114 VAL MG1  . 114 . HG1* 1 1 
        283 1 2 1 1 118 PHE HA   . 118 . HA   1 1 
        284 1 1 1 1  90 LEU HA   .  90 . HA   1 1 
        284 1 2 1 1  90 LEU MD1  .  90 . HD1* 1 1 
        285 1 1 1 1  87 THR HA   .  87 . HA   1 1 
        285 1 2 1 1  90 LEU MD1  .  90 . HD1* 1 1 
        286 1 1 1 1  25 ALA MB   .  25 . HB*  1 1 
        286 1 2 1 1  57 LEU MD1  .  57 . HD1* 1 1 
        287 1 1 1 1  47 VAL HB   .  47 . HB   1 1 
        287 1 2 1 1  57 LEU MD1  .  57 . HD1* 1 1 
        288 1 1 1 1  47 VAL MG1  .  47 . HG1* 1 1 
        288 1 2 1 1  57 LEU MD1  .  57 . HD1* 1 1 
        289 1 1 1 1 161 ILE HB   . 161 . HB   1 1 
        289 1 2 1 1 168 LEU MD1  . 168 . HD1* 1 1 
        290 1 1 1 1  57 LEU MD2  .  57 . HD2* 1 1 
        290 1 2 1 1  61 PHE HA   .  61 . HA   1 1 
        291 1 1 1 1  25 ALA MB   .  25 . HB*  1 1 
        291 1 2 1 1  57 LEU MD2  .  57 . HD2* 1 1 
        292 1 1 1 1  39 MET ME   .  39 . HE*  1 1 
        292 1 2 1 1  57 LEU MD2  .  57 . HD2* 1 1 
        293 1 1 1 1  17 LEU MD1  .  17 . HD1* 1 1 
        293 1 2 1 1  25 ALA MB   .  25 . HB*  1 1 
        294 1 1 1 1  85 THR H    .  85 . HN   1 1 
        294 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
        295 1 1 1 1  90 LEU HA   .  90 . HA   1 1 
        295 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
        296 1 1 1 1  79 ALA HA   .  79 . HA   1 1 
        296 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
        297 1 1 1 1  87 THR HB   .  87 . HB   1 1 
        297 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
        298 1 1 1 1  44 PHE HA   .  44 . HA   1 1 
        298 1 2 1 1  47 VAL MG1  .  47 . HG1* 1 1 
        299 1 1 1 1  47 VAL MG1  .  47 . HG1* 1 1 
        299 1 2 1 1  49 PHE HA   .  49 . HA   1 1 
        300 1 1 1 1  41 LYS HA   .  41 . HA   1 1 
        300 1 2 1 1  47 VAL MG1  .  47 . HG1* 1 1 
        301 1 1 1 1  44 PHE HB2  .  44 . HB2  1 1 
        301 1 2 1 1  47 VAL MG1  .  47 . HG1* 1 1 
        302 1 1 1 1  44 PHE HB3  .  44 . HB1  1 1 
        302 1 2 1 1  47 VAL MG1  .  47 . HG1* 1 1 
        303 1 1 1 1  47 VAL MG1  .  47 . HG1* 1 1 
        303 1 2 1 1  53 ILE HB   .  53 . HB   1 1 
        304 1 1 1 1 114 VAL H    . 114 . HN   1 1 
        304 1 2 1 1 119 LEU MD2  . 119 . HD2* 1 1 
        305 1 1 1 1 119 LEU MD2  . 119 . HD2* 1 1 
        305 1 2 1 1 120 GLU H    . 120 . HN   1 1 
        306 1 1 1 1  93 THR HA   .  93 . HA   1 1 
        306 1 2 1 1 119 LEU MD2  . 119 . HD2* 1 1 
        307 1 1 1 1 118 PHE HA   . 118 . HA   1 1 
        307 1 2 1 1 119 LEU MD2  . 119 . HD2* 1 1 
        308 1 1 1 1 119 LEU HA   . 119 . HA   1 1 
        308 1 2 1 1 119 LEU MD2  . 119 . HD2* 1 1 
        309 1 1 1 1 114 VAL HA   . 114 . HA   1 1 
        309 1 2 1 1 119 LEU MD2  . 119 . HD2* 1 1 
        310 1 1 1 1 119 LEU HB2  . 119 . HB2  1 1 
        310 1 2 1 1 119 LEU MD2  . 119 . HD2* 1 1 
        311 1 1 1 1  91 SER HA   .  91 . HA   1 1 
        311 1 2 1 1  98 LEU QD   .  98 . HD1* 1 1 
        312 1 1 1 1 168 LEU HA   . 168 . HA   1 1 
        312 1 2 1 1 171 LEU MD2  . 171 . HD2* 1 1 
        313 1 1 1 1  72 MET ME   .  72 . HE*  1 1 
        313 1 2 1 1  98 LEU QD   .  98 . HD1* 1 1 
        314 1 1 1 1 168 LEU HB2  . 168 . HB2  1 1 
        314 1 2 1 1 171 LEU MD2  . 171 . HD2* 1 1 
        315 1 1 1 1  84 VAL H    .  84 . HN   1 1 
        315 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
        316 1 1 1 1 172 LEU H    . 172 . HN   1 1 
        316 1 2 1 1 172 LEU MD1  . 172 . HD1* 1 1 
        317 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
        317 1 2 1 1  85 THR HA   .  85 . HA   1 1 
        318 1 1 1 1 172 LEU HA   . 172 . HA   1 1 
        318 1 2 1 1 172 LEU MD1  . 172 . HD1* 1 1 
        319 1 1 1 1  84 VAL HA   .  84 . HA   1 1 
        319 1 2 1 1  84 VAL MG1  .  84 . HG1* 1 1 
        320 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
        320 1 2 1 1  89 GLU HB2  .  89 . HB2  1 1 
        321 1 1 1 1 172 LEU HB2  . 172 . HB2  1 1 
        321 1 2 1 1 172 LEU MD1  . 172 . HD1* 1 1 
        322 1 1 1 1 172 LEU HB3  . 172 . HB1  1 1 
        322 1 2 1 1 172 LEU MD1  . 172 . HD1* 1 1 
        323 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
        323 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
        324 1 1 1 1 168 LEU MD1  . 168 . HD1* 1 1 
        324 1 2 1 1 172 LEU MD1  . 172 . HD1* 1 1 
        325 1 1 1 1 119 LEU MD1  . 119 . HD1* 1 1 
        325 1 2 1 1 122 ALA HA   . 122 . HA   1 1 
        326 1 1 1 1 169 GLN HA   . 169 . HA   1 1 
        326 1 2 1 1 172 LEU MD2  . 172 . HD2* 1 1 
        327 1 1 1 1 119 LEU HA   . 119 . HA   1 1 
        327 1 2 1 1 119 LEU MD1  . 119 . HD1* 1 1 
        328 1 1 1 1 172 LEU HB2  . 172 . HB2  1 1 
        328 1 2 1 1 172 LEU MD2  . 172 . HD2* 1 1 
        329 1 1 1 1 172 LEU HB3  . 172 . HB1  1 1 
        329 1 2 1 1 172 LEU MD2  . 172 . HD2* 1 1 
        330 1 1 1 1  75 TYR H    .  75 . HN   1 1 
        330 1 2 1 1 126 LEU MD2  . 126 . HD2* 1 1 
        331 1 1 1 1 168 LEU H    . 168 . HN   1 1 
        331 1 2 1 1 168 LEU MD2  . 168 . HD2* 1 1 
        332 1 1 1 1 161 ILE HB   . 161 . HB   1 1 
        332 1 2 1 1 168 LEU MD2  . 168 . HD2* 1 1 
        333 1 1 1 1 161 ILE HG13 . 161 . HG11 1 1 
        333 1 2 1 1 168 LEU MD2  . 168 . HD2* 1 1 
        334 1 1 1 1 121 VAL MG1  . 121 . HG1* 1 1 
        334 1 2 1 1 125 THR MG   . 125 . HG2* 1 1 
        335 1 1 1 1 161 ILE MG   . 161 . HG2* 1 1 
        335 1 2 1 1 167 CYS HA   . 167 . HA   1 1 
        336 1 1 1 1 161 ILE HG12 . 161 . HG12 1 1 
        336 1 2 1 1 161 ILE MG   . 161 . HG2* 1 1 
        337 1 1 1 1 161 ILE HG13 . 161 . HG11 1 1 
        337 1 2 1 1 161 ILE MG   . 161 . HG2* 1 1 
        338 1 1 1 1 161 ILE MG   . 161 . HG2* 1 1 
        338 1 2 1 1 168 LEU MD1  . 168 . HD1* 1 1 
        339 1 1 1 1 130 PHE HB2  . 130 . HB2  1 1 
        339 1 2 1 1 134 ILE MG   . 134 . HG2* 1 1 
        340 1 1 1 1 130 PHE HB3  . 130 . HB1  1 1 
        340 1 2 1 1 134 ILE MG   . 134 . HG2* 1 1 
        341 1 1 1 1 131 ASN HB2  . 131 . HB2  1 1 
        341 1 2 1 1 134 ILE MG   . 134 . HG2* 1 1 
        342 1 1 1 1 131 ASN HB3  . 131 . HB1  1 1 
        342 1 2 1 1 134 ILE MG   . 134 . HG2* 1 1 
        343 1 1 1 1 134 ILE MG   . 134 . HG2* 1 1 
        343 1 2 1 1 135 ALA MB   . 135 . HB*  1 1 
        344 1 1 1 1 129 PHE HA   . 129 . HA   1 1 
        344 1 2 1 1 147 ILE MG   . 147 . HG2* 1 1 
        345 1 1 1 1  70 ILE HA   .  70 . HA   1 1 
        345 1 2 1 1  70 ILE MG   .  70 . HG2* 1 1 
        346 1 1 1 1 147 ILE MG   . 147 . HG2* 1 1 
        346 1 2 1 1 151 ILE MG   . 151 . HG2* 1 1 
        347 1 1 1 1 147 ILE MG   . 147 . HG2* 1 1 
        347 1 2 1 1 148 TYR HE1  . 148 . HE2  1 1 
        348 1 1 1 1  92 ILE HA   .  92 . HA   1 1 
        348 1 2 1 1  92 ILE MG   .  92 . HG2* 1 1 
        349 1 1 1 1  91 SER HB2  .  91 . HB2  1 1 
        349 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
        350 1 1 1 1  91 SER HB3  .  91 . HB1  1 1 
        350 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
        351 1 1 1 1  54 THR MG   .  54 . HG2* 1 1 
        351 1 2 1 1  57 LEU HB3  .  57 . HB1  1 1 
        352 1 1 1 1  54 THR MG   .  54 . HG2* 1 1 
        352 1 2 1 1  57 LEU MD1  .  57 . HD1* 1 1 
        353 1 1 1 1  82 ASP HA   .  82 . HA   1 1 
        353 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
        354 1 1 1 1  79 ALA HA   .  79 . HA   1 1 
        354 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
        355 1 1 1 1  79 ALA MB   .  79 . HB*  1 1 
        355 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
        356 1 1 1 1  93 THR MG   .  93 . HG2* 1 1 
        356 1 2 1 1 119 LEU MD1  . 119 . HD1* 1 1 
        357 1 1 1 1  91 SER HA   .  91 . HA   1 1 
        357 1 2 1 1 102 LEU QD   . 102 . HD2* 1 1 
        358 1 1 1 1 102 LEU HA   . 102 . HA   1 1 
        358 1 2 1 1 102 LEU QD   . 102 . HD2* 1 1 
        359 1 1 1 1 121 VAL HA   . 121 . HA   1 1 
        359 1 2 1 1 151 ILE MG   . 151 . HG2* 1 1 
        360 1 1 1 1  12 ALA MB   .  12 . HB*  1 1 
        360 1 2 1 1  13 MET ME   .  13 . HE*  1 1 
        361 1 1 1 1  28 MET ME   .  28 . HE*  1 1 
        361 1 2 1 1 158 VAL HB   . 158 . HB   1 1 
        362 1 1 1 1  28 MET ME   .  28 . HE*  1 1 
        362 1 2 1 1 158 VAL MG2  . 158 . HG2* 1 1 
        363 1 1 1 1  28 MET ME   .  28 . HE*  1 1 
        363 1 2 1 1 158 VAL MG1  . 158 . HG1* 1 1 
        364 1 1 1 1  76 ALA MB   .  76 . HB*  1 1 
        364 1 2 1 1  79 ALA H    .  79 . HN   1 1 
        365 1 1 1 1  76 ALA MB   .  76 . HB*  1 1 
        365 1 2 1 1  80 ILE H    .  80 . HN   1 1 
        366 1 1 1 1  73 GLU H    .  73 . HN   1 1 
        366 1 2 1 1  76 ALA MB   .  76 . HB*  1 1 
        367 1 1 1 1  76 ALA MB   .  76 . HB*  1 1 
        367 1 2 1 1 143 TRP HH2  . 143 . HH2  1 1 
        368 1 1 1 1  76 ALA MB   .  76 . HB*  1 1 
        368 1 2 1 1 130 PHE HA   . 130 . HA   1 1 
        369 1 1 1 1  76 ALA MB   .  76 . HB*  1 1 
        369 1 2 1 1  90 LEU MD1  .  90 . HD1* 1 1 
        370 1 1 1 1  76 ALA MB   .  76 . HB*  1 1 
        370 1 2 1 1 147 ILE MD   . 147 . HD1* 1 1 
        371 1 1 1 1  87 THR MG   .  87 . HG2* 1 1 
        371 1 2 1 1 125 THR MG   . 125 . HG2* 1 1 
        372 1 1 1 1  39 MET ME   .  39 . HE*  1 1 
        372 1 2 1 1  42 THR HB   .  42 . HB   1 1 
        373 1 1 1 1 119 LEU HB3  . 119 . HB1  1 1 
        373 1 2 1 1 122 ALA MB   . 122 . HB*  1 1 
        374 1 1 1 1 130 PHE HA   . 130 . HA   1 1 
        374 1 2 1 1 133 ILE MD   . 133 . HD1* 1 1 
        375 1 1 1 1  73 GLU HA   .  73 . HA   1 1 
        375 1 2 1 1 133 ILE MD   . 133 . HD1* 1 1 
        376 1 1 1 1 133 ILE HA   . 133 . HA   1 1 
        376 1 2 1 1 133 ILE MD   . 133 . HD1* 1 1 
        377 1 1 1 1  58 ILE MG   .  58 . HG2* 1 1 
        377 1 2 1 1  60 TRP H    .  60 . HN   1 1 
        378 1 1 1 1 124 ILE MG   . 124 . HG2* 1 1 
        378 1 2 1 1 128 GLU HA   . 128 . HA   1 1 
        379 1 1 1 1 171 LEU H    . 171 . HN   1 1 
        379 1 2 1 1 171 LEU MD1  . 171 . HD1* 1 1 
        380 1 1 1 1 169 GLN H    . 169 . HN   1 1 
        380 1 2 1 1 171 LEU MD1  . 171 . HD1* 1 1 
        381 1 1 1 1 168 LEU HA   . 168 . HA   1 1 
        381 1 2 1 1 171 LEU MD1  . 171 . HD1* 1 1 
        382 1 1 1 1 168 LEU HB3  . 168 . HB1  1 1 
        382 1 2 1 1 171 LEU MD1  . 171 . HD1* 1 1 
        383 1 1 1 1 137 LYS H    . 137 . HN   1 1 
        383 1 2 1 1 139 VAL MG2  . 139 . HG2* 1 1 
        384 1 1 1 1 139 VAL HA   . 139 . HA   1 1 
        384 1 2 1 1 139 VAL MG2  . 139 . HG2* 1 1 
        385 1 1 1 1 133 ILE HA   . 133 . HA   1 1 
        385 1 2 1 1 139 VAL MG2  . 139 . HG2* 1 1 
        386 1 1 1 1 148 TYR HA   . 148 . HA   1 1 
        386 1 2 1 1 151 ILE MD   . 151 . HD1* 1 1 
        387 1 1 1 1 151 ILE MD   . 151 . HD1* 1 1 
        387 1 2 1 1 152 CYS HA   . 152 . HA   1 1 
        388 1 1 1 1 147 ILE HA   . 147 . HA   1 1 
        388 1 2 1 1 151 ILE MD   . 151 . HD1* 1 1 
        389 1 1 1 1  76 ALA HA   .  76 . HA   1 1 
        389 1 2 1 1  80 ILE MD   .  80 . HD1* 1 1 
        390 1 1 1 1  80 ILE HA   .  80 . HA   1 1 
        390 1 2 1 1  80 ILE MD   .  80 . HD1* 1 1 
        391 1 1 1 1  80 ILE MD   .  80 . HD1* 1 1 
        391 1 2 1 1 130 PHE HA   . 130 . HA   1 1 
        392 1 1 1 1  80 ILE MD   .  80 . HD1* 1 1 
        392 1 2 1 1 130 PHE HB2  . 130 . HB2  1 1 
        393 1 1 1 1  80 ILE MD   .  80 . HD1* 1 1 
        393 1 2 1 1 130 PHE HB3  . 130 . HB1  1 1 
        394 1 1 1 1  76 ALA MB   .  76 . HB*  1 1 
        394 1 2 1 1  80 ILE MD   .  80 . HD1* 1 1 
        395 1 1 1 1  80 ILE MD   .  80 . HD1* 1 1 
        395 1 2 1 1 134 ILE HB   . 134 . HB   1 1 
        396 1 1 1 1 134 ILE MD   . 134 . HD1* 1 1 
        396 1 2 1 1 136 GLY H    . 136 . HN   1 1 
        397 1 1 1 1 132 ALA H    . 132 . HN   1 1 
        397 1 2 1 1 134 ILE MD   . 134 . HD1* 1 1 
        398 1 1 1 1  92 ILE HA   .  92 . HA   1 1 
        398 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
        399 1 1 1 1 134 ILE MD   . 134 . HD1* 1 1 
        399 1 2 1 1 135 ALA HA   . 135 . HA   1 1 
        400 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
        400 1 2 1 1 124 ILE H    . 124 . HN   1 1 
        401 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
        401 1 2 1 1 122 ALA HA   . 122 . HA   1 1 
        402 1 1 1 1  87 THR HA   .  87 . HA   1 1 
        402 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
        403 1 1 1 1  92 ILE HB   .  92 . HB   1 1 
        403 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
        404 1 1 1 1 161 ILE MD   . 161 . HD1* 1 1 
        404 1 2 1 1 162 PHE H    . 162 . HN   1 1 
        405 1 1 1 1 161 ILE HA   . 161 . HA   1 1 
        405 1 2 1 1 161 ILE MD   . 161 . HD1* 1 1 
        406 1 1 1 1  70 ILE HA   .  70 . HA   1 1 
        406 1 2 1 1  70 ILE MD   .  70 . HD1* 1 1 
        407 1 1 1 1 161 ILE MD   . 161 . HD1* 1 1 
        407 1 2 1 1 168 LEU HA   . 168 . HA   1 1 
        408 1 1 1 1 161 ILE MD   . 161 . HD1* 1 1 
        408 1 2 1 1 167 CYS HB2  . 167 . HB2  1 1 
        409 1 1 1 1 161 ILE MD   . 161 . HD1* 1 1 
        409 1 2 1 1 167 CYS HB3  . 167 . HB1  1 1 
        410 1 1 1 1 161 ILE MD   . 161 . HD1* 1 1 
        410 1 2 1 1 171 LEU HG   . 171 . HG   1 1 
        411 1 1 1 1  80 ILE MG   .  80 . HG2* 1 1 
        411 1 2 1 1 135 ALA H    . 135 . HN   1 1 
        412 1 1 1 1  80 ILE MG   .  80 . HG2* 1 1 
        412 1 2 1 1  83 GLY HA2  .  83 . HA2  1 1 
        413 1 1 1 1  80 ILE HA   .  80 . HA   1 1 
        413 1 2 1 1  80 ILE MG   .  80 . HG2* 1 1 
        414 1 1 1 1  79 ALA MB   .  79 . HB*  1 1 
        414 1 2 1 1  80 ILE MG   .  80 . HG2* 1 1 
        415 1 1 1 1  80 ILE MG   .  80 . HG2* 1 1 
        415 1 2 1 1 133 ILE HB   . 133 . HB   1 1 
        416 1 1 1 1  80 ILE MG   .  80 . HG2* 1 1 
        416 1 2 1 1 134 ILE HB   . 134 . HB   1 1 
        417 1 1 1 1 132 ALA H    . 132 . HN   1 1 
        417 1 2 1 1 133 ILE MG   . 133 . HG2* 1 1 
        418 1 1 1 1  77 ARG HA   .  77 . HA   1 1 
        418 1 2 1 1 133 ILE MG   . 133 . HG2* 1 1 
        419 1 1 1 1  76 ALA MB   .  76 . HB*  1 1 
        419 1 2 1 1 133 ILE MG   . 133 . HG2* 1 1 
        420 1 1 1 1 147 ILE MD   . 147 . HD1* 1 1 
        420 1 2 1 1 149 LYS H    . 149 . HN   1 1 
        421 1 1 1 1 129 PHE HA   . 129 . HA   1 1 
        421 1 2 1 1 147 ILE MD   . 147 . HD1* 1 1 
        422 1 1 1 1 147 ILE HA   . 147 . HA   1 1 
        422 1 2 1 1 147 ILE MD   . 147 . HD1* 1 1 
        423 1 1 1 1 147 ILE MD   . 147 . HD1* 1 1 
        423 1 2 1 1 151 ILE MD   . 151 . HD1* 1 1 
        424 1 1 1 1 154 LEU HA   . 154 . HA   1 1 
        424 1 2 1 1 154 LEU MD1  . 154 . HD1* 1 1 
        425 1 1 1 1 150 VAL HB   . 150 . HB   1 1 
        425 1 2 1 1 154 LEU MD1  . 154 . HD1* 1 1 
        426 1 1 1 1  13 MET ME   .  13 . HE*  1 1 
        426 1 2 1 1  14 GLN H    .  14 . HN   1 1 
        427 1 1 1 1  72 MET ME   .  72 . HE*  1 1 
        427 1 2 1 1  91 SER HA   .  91 . HA   1 1 
        428 1 1 1 1  71 GLN HA   .  71 . HA   1 1 
        428 1 2 1 1  72 MET ME   .  72 . HE*  1 1 
        429 1 1 1 1  72 MET ME   .  72 . HE*  1 1 
        429 1 2 1 1  91 SER HB2  .  91 . HB2  1 1 
        430 1 1 1 1  72 MET ME   .  72 . HE*  1 1 
        430 1 2 1 1  91 SER HB3  .  91 . HB1  1 1 
        431 1 1 1 1  58 ILE MG   .  58 . HG2* 1 1 
        431 1 2 1 1  59 LYS H    .  59 . HN   1 1 
        432 1 1 1 1 137 LYS HA   . 137 . HA   1 1 
        432 1 2 1 1 139 VAL MG2  . 139 . HG2* 1 1 
        433 1 1 1 1  57 LEU H    .  57 . HN   1 1 
        433 1 2 1 1  57 LEU MD1  .  57 . HD1* 1 1 
        434 1 1 1 1  91 SER H    .  91 . HN   1 1 
        434 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
        435 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
        435 1 2 1 1 127 ARG H    . 127 . HN   1 1 
        436 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
        436 1 2 1 1  93 THR H    .  93 . HN   1 1 
        437 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
        437 1 2 1 1  89 GLU HB3  .  89 . HB1  1 1 
        438 1 1 1 1  28 MET ME   .  28 . HE*  1 1 
        438 1 2 1 1  43 TYR HD2  .  43 . HD1  1 1 
        439 1 1 1 1 132 ALA HA   . 132 . HA   1 1 
        439 1 2 1 1 133 ILE MD   . 133 . HD1* 1 1 
        440 1 1 1 1 134 ILE H    . 134 . HN   1 1 
        440 1 2 1 1 135 ALA H    . 135 . HN   1 1 
        441 1 1 1 1  98 LEU H    .  98 . HN   1 1 
        441 1 2 1 1  99 TYR H    .  99 . HN   1 1 
        442 1 1 1 1 101 ALA H    . 101 . HN   1 1 
        442 1 2 1 1 102 LEU QD   . 102 . HD2* 1 1 
        443 1 1 1 1 130 PHE H    . 130 . HN   1 1 
        443 1 2 1 1 130 PHE HB2  . 130 . HB2  1 1 
        444 1 1 1 1 102 LEU H    . 102 . HN   1 1 
        444 1 2 1 1 103 ASN H    . 103 . HN   1 1 
        445 1 1 1 1  46 ASP H    .  46 . HN   1 1 
        445 1 2 1 1  47 VAL H    .  47 . HN   1 1 
        446 1 1 1 1  70 ILE H    .  70 . HN   1 1 
        446 1 2 1 1  71 GLN H    .  71 . HN   1 1 
        447 1 1 1 1  74 LYS H    .  74 . HN   1 1 
        447 1 2 1 1  75 TYR H    .  75 . HN   1 1 
        448 1 1 1 1  73 GLU H    .  73 . HN   1 1 
        448 1 2 1 1  74 LYS H    .  74 . HN   1 1 
        449 1 1 1 1  77 ARG H    .  77 . HN   1 1 
        449 1 2 1 1  78 GLN H    .  78 . HN   1 1 
        450 1 1 1 1  78 GLN H    .  78 . HN   1 1 
        450 1 2 1 1  79 ALA H    .  79 . HN   1 1 
        451 1 1 1 1  75 TYR HD1  .  75 . HD1  1 1 
        451 1 2 1 1  78 GLN H    .  78 . HN   1 1 
        452 1 1 1 1 126 LEU H    . 126 . HN   1 1 
        452 1 2 1 1 128 GLU H    . 128 . HN   1 1 
        453 1 1 1 1  77 ARG H    .  77 . HN   1 1 
        453 1 2 1 1  79 ALA H    .  79 . HN   1 1 
        454 1 1 1 1 132 ALA H    . 132 . HN   1 1 
        454 1 2 1 1 133 ILE H    . 133 . HN   1 1 
        455 1 1 1 1 132 ALA H    . 132 . HN   1 1 
        455 1 2 1 1 135 ALA H    . 135 . HN   1 1 
        456 1 1 1 1 130 PHE H    . 130 . HN   1 1 
        456 1 2 1 1 132 ALA H    . 132 . HN   1 1 
        457 1 1 1 1 133 ILE H    . 133 . HN   1 1 
        457 1 2 1 1 135 ALA H    . 135 . HN   1 1 
        458 1 1 1 1 133 ILE H    . 133 . HN   1 1 
        458 1 2 1 1 134 ILE H    . 134 . HN   1 1 
        459 1 1 1 1  80 ILE H    .  80 . HN   1 1 
        459 1 2 1 1  81 ASN H    .  81 . HN   1 1 
        460 1 1 1 1  75 TYR H    .  75 . HN   1 1 
        460 1 2 1 1  76 ALA H    .  76 . HN   1 1 
        461 1 1 1 1  73 GLU H    .  73 . HN   1 1 
        461 1 2 1 1  76 ALA H    .  76 . HN   1 1 
        462 1 1 1 1  75 TYR HD1  .  75 . HD1  1 1 
        462 1 2 1 1  76 ALA H    .  76 . HN   1 1 
        463 1 1 1 1  76 ALA H    .  76 . HN   1 1 
        463 1 2 1 1  77 ARG H    .  77 . HN   1 1 
        464 1 1 1 1  72 MET H    .  72 . HN   1 1 
        464 1 2 1 1  73 GLU H    .  73 . HN   1 1 
        465 1 1 1 1  71 GLN H    .  71 . HN   1 1 
        465 1 2 1 1  72 MET H    .  72 . HN   1 1 
        466 1 1 1 1  69 TYR H    .  69 . HN   1 1 
        466 1 2 1 1  70 ILE H    .  70 . HN   1 1 
        467 1 1 1 1  68 TYR H    .  68 . HN   1 1 
        467 1 2 1 1  69 TYR H    .  69 . HN   1 1 
        468 1 1 1 1 160 GLU H    . 160 . HN   1 1 
        468 1 2 1 1 161 ILE H    . 161 . HN   1 1 
        469 1 1 1 1 108 LYS H    . 108 . HN   1 1 
        469 1 2 1 1 109 ALA H    . 109 . HN   1 1 
        470 1 1 1 1 148 TYR H    . 148 . HN   1 1 
        470 1 2 1 1 149 LYS H    . 149 . HN   1 1 
        471 1 1 1 1 149 LYS H    . 149 . HN   1 1 
        471 1 2 1 1 150 VAL H    . 150 . HN   1 1 
        472 1 1 1 1 147 ILE H    . 147 . HN   1 1 
        472 1 2 1 1 149 LYS H    . 149 . HN   1 1 
        473 1 1 1 1 135 ALA H    . 135 . HN   1 1 
        473 1 2 1 1 136 GLY H    . 136 . HN   1 1 
        474 1 1 1 1  63 ASN H    .  63 . HN   1 1 
        474 1 2 1 1  64 PHE H    .  64 . HN   1 1 
        475 1 1 1 1  64 PHE H    .  64 . HN   1 1 
        475 1 2 1 1  66 GLU H    .  66 . HN   1 1 
        476 1 1 1 1  84 VAL H    .  84 . HN   1 1 
        476 1 2 1 1  85 THR H    .  85 . HN   1 1 
        477 1 1 1 1  83 GLY H    .  83 . HN   1 1 
        477 1 2 1 1  84 VAL H    .  84 . HN   1 1 
        478 1 1 1 1  84 VAL H    .  84 . HN   1 1 
        478 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
        479 1 1 1 1  79 ALA MB   .  79 . HB*  1 1 
        479 1 2 1 1  84 VAL H    .  84 . HN   1 1 
        480 1 1 1 1  82 ASP HB3  .  82 . HB1  1 1 
        480 1 2 1 1  84 VAL H    .  84 . HN   1 1 
        481 1 1 1 1  70 ILE H    .  70 . HN   1 1 
        481 1 2 1 1  70 ILE MD   .  70 . HD1* 1 1 
        482 1 1 1 1  70 ILE H    .  70 . HN   1 1 
        482 1 2 1 1  70 ILE MG   .  70 . HG2* 1 1 
        483 1 1 1 1  58 ILE H    .  58 . HN   1 1 
        483 1 2 1 1  60 TRP H    .  60 . HN   1 1 
        484 1 1 1 1  58 ILE H    .  58 . HN   1 1 
        484 1 2 1 1  59 LYS H    .  59 . HN   1 1 
        485 1 1 1 1  66 GLU H    .  66 . HN   1 1 
        485 1 2 1 1  67 PHE H    .  67 . HN   1 1 
        486 1 1 1 1 118 PHE H    . 118 . HN   1 1 
        486 1 2 1 1 119 LEU H    . 119 . HN   1 1 
        487 1 1 1 1 170 GLU H    . 170 . HN   1 1 
        487 1 2 1 1 171 LEU H    . 171 . HN   1 1 
        488 1 1 1 1  60 TRP H    .  60 . HN   1 1 
        488 1 2 1 1  60 TRP HE1  .  60 . HE1  1 1 
        489 1 1 1 1  39 MET H    .  39 . HN   1 1 
        489 1 2 1 1  40 LEU H    .  40 . HN   1 1 
        490 1 1 1 1  38 ASN H    .  38 . HN   1 1 
        490 1 2 1 1  40 LEU H    .  40 . HN   1 1 
        491 1 1 1 1 147 ILE H    . 147 . HN   1 1 
        491 1 2 1 1 147 ILE MD   . 147 . HD1* 1 1 
        492 1 1 1 1 146 ALA H    . 146 . HN   1 1 
        492 1 2 1 1 147 ILE MD   . 147 . HD1* 1 1 
        493 1 1 1 1  22 LEU MD1  .  22 . HD1* 1 1 
        493 1 2 1 1  60 TRP HE1  .  60 . HE1  1 1 
        494 1 1 1 1  22 LEU MD2  .  22 . HD2* 1 1 
        494 1 2 1 1  60 TRP HE1  .  60 . HE1  1 1 
        495 1 1 1 1  17 LEU MD1  .  17 . HD1* 1 1 
        495 1 2 1 1  60 TRP HE1  .  60 . HE1  1 1 
        496 1 1 1 1  59 LYS H    .  59 . HN   1 1 
        496 1 2 1 1  60 TRP H    .  60 . HN   1 1 
        497 1 1 1 1 143 TRP H    . 143 . HN   1 1 
        497 1 2 1 1 143 TRP HE1  . 143 . HE1  1 1 
        498 1 1 1 1  94 ARG H    .  94 . HN   1 1 
        498 1 2 1 1  95 ASP H    .  95 . HN   1 1 
        499 1 1 1 1 167 CYS H    . 167 . HN   1 1 
        499 1 2 1 1 169 GLN H    . 169 . HN   1 1 
        500 1 1 1 1 166 ASN H    . 166 . HN   1 1 
        500 1 2 1 1 167 CYS H    . 167 . HN   1 1 
        501 1 1 1 1 167 CYS H    . 167 . HN   1 1 
        501 1 2 1 1 168 LEU H    . 168 . HN   1 1 
        502 1 1 1 1  93 THR H    .  93 . HN   1 1 
        502 1 2 1 1  94 ARG H    .  94 . HN   1 1 
        503 1 1 1 1  15 GLU H    .  15 . HN   1 1 
        503 1 2 1 1  16 GLY H    .  16 . HN   1 1 
        504 1 1 1 1  92 ILE H    .  92 . HN   1 1 
        504 1 2 1 1  93 THR H    .  93 . HN   1 1 
        505 1 1 1 1  91 SER H    .  91 . HN   1 1 
        505 1 2 1 1  92 ILE H    .  92 . HN   1 1 
        506 1 1 1 1  90 LEU H    .  90 . HN   1 1 
        506 1 2 1 1  91 SER H    .  91 . HN   1 1 
        507 1 1 1 1  88 GLU H    .  88 . HN   1 1 
        507 1 2 1 1  89 GLU H    .  89 . HN   1 1 
        508 1 1 1 1  87 THR H    .  87 . HN   1 1 
        508 1 2 1 1  88 GLU H    .  88 . HN   1 1 
        509 1 1 1 1 151 ILE H    . 151 . HN   1 1 
        509 1 2 1 1 152 CYS H    . 152 . HN   1 1 
        510 1 1 1 1  85 THR H    .  85 . HN   1 1 
        510 1 2 1 1  86 SER H    .  86 . HN   1 1 
        511 1 1 1 1  86 SER H    .  86 . HN   1 1 
        511 1 2 1 1  87 THR H    .  87 . HN   1 1 
        512 1 1 1 1  86 SER H    .  86 . HN   1 1 
        512 1 2 1 1  89 GLU H    .  89 . HN   1 1 
        513 1 1 1 1 169 GLN H    . 169 . HN   1 1 
        513 1 2 1 1 172 LEU H    . 172 . HN   1 1 
        514 1 1 1 1  82 ASP H    .  82 . HN   1 1 
        514 1 2 1 1  83 GLY H    .  83 . HN   1 1 
        515 1 1 1 1  82 ASP H    .  82 . HN   1 1 
        515 1 2 1 1  84 VAL H    .  84 . HN   1 1 
        516 1 1 1 1 101 ALA H    . 101 . HN   1 1 
        516 1 2 1 1 102 LEU H    . 102 . HN   1 1 
        517 1 1 1 1 101 ALA MB   . 101 . HB*  1 1 
        517 1 2 1 1 102 LEU H    . 102 . HN   1 1 
        518 1 1 1 1 102 LEU H    . 102 . HN   1 1 
        518 1 2 1 1 102 LEU QD   . 102 . HD2* 1 1 
        519 1 1 1 1  98 LEU QD   .  98 . HD1* 1 1 
        519 1 2 1 1 102 LEU H    . 102 . HN   1 1 
        520 1 1 1 1 122 ALA MB   . 122 . HB*  1 1 
        520 1 2 1 1 123 GLN H    . 123 . HN   1 1 
        521 1 1 1 1 119 LEU HA   . 119 . HA   1 1 
        521 1 2 1 1 123 GLN H    . 123 . HN   1 1 
        522 1 1 1 1 121 VAL H    . 121 . HN   1 1 
        522 1 2 1 1 122 ALA H    . 122 . HN   1 1 
        523 1 1 1 1 122 ALA H    . 122 . HN   1 1 
        523 1 2 1 1 123 GLN H    . 123 . HN   1 1 
        524 1 1 1 1 121 VAL H    . 121 . HN   1 1 
        524 1 2 1 1 121 VAL MG2  . 121 . HG2* 1 1 
        525 1 1 1 1 121 VAL H    . 121 . HN   1 1 
        525 1 2 1 1 121 VAL MG1  . 121 . HG1* 1 1 
        526 1 1 1 1  79 ALA H    .  79 . HN   1 1 
        526 1 2 1 1  80 ILE MD   .  80 . HD1* 1 1 
        527 1 1 1 1  60 TRP H    .  60 . HN   1 1 
        527 1 2 1 1  62 SER H    .  62 . HN   1 1 
        528 1 1 1 1 130 PHE H    . 130 . HN   1 1 
        528 1 2 1 1 131 ASN H    . 131 . HN   1 1 
        529 1 1 1 1 131 ASN H    . 131 . HN   1 1 
        529 1 2 1 1 132 ALA H    . 132 . HN   1 1 
        530 1 1 1 1  62 SER H    .  62 . HN   1 1 
        530 1 2 1 1  63 ASN H    .  63 . HN   1 1 
        531 1 1 1 1 129 PHE H    . 129 . HN   1 1 
        531 1 2 1 1 130 PHE H    . 130 . HN   1 1 
        532 1 1 1 1 128 GLU H    . 128 . HN   1 1 
        532 1 2 1 1 129 PHE H    . 129 . HN   1 1 
        533 1 1 1 1 126 LEU H    . 126 . HN   1 1 
        533 1 2 1 1 127 ARG H    . 127 . HN   1 1 
        534 1 1 1 1 127 ARG H    . 127 . HN   1 1 
        534 1 2 1 1 128 GLU H    . 128 . HN   1 1 
        535 1 1 1 1 125 THR H    . 125 . HN   1 1 
        535 1 2 1 1 126 LEU H    . 126 . HN   1 1 
        536 1 1 1 1 123 GLN H    . 123 . HN   1 1 
        536 1 2 1 1 124 ILE H    . 124 . HN   1 1 
        537 1 1 1 1 124 ILE H    . 124 . HN   1 1 
        537 1 2 1 1 125 THR H    . 125 . HN   1 1 
        538 1 1 1 1 155 ASP H    . 155 . HN   1 1 
        538 1 2 1 1 156 SER H    . 156 . HN   1 1 
        539 1 1 1 1 153 LYS H    . 153 . HN   1 1 
        539 1 2 1 1 154 LEU H    . 154 . HN   1 1 
        540 1 1 1 1 152 CYS H    . 152 . HN   1 1 
        540 1 2 1 1 153 LYS H    . 153 . HN   1 1 
        541 1 1 1 1 152 CYS H    . 152 . HN   1 1 
        541 1 2 1 1 154 LEU H    . 154 . HN   1 1 
        542 1 1 1 1 150 VAL H    . 150 . HN   1 1 
        542 1 2 1 1 152 CYS H    . 152 . HN   1 1 
        543 1 1 1 1 161 ILE H    . 161 . HN   1 1 
        543 1 2 1 1 162 PHE H    . 162 . HN   1 1 
        544 1 1 1 1 150 VAL H    . 150 . HN   1 1 
        544 1 2 1 1 151 ILE H    . 151 . HN   1 1 
        545 1 1 1 1  61 PHE H    .  61 . HN   1 1 
        545 1 2 1 1  62 SER H    .  62 . HN   1 1 
        546 1 1 1 1  60 TRP H    .  60 . HN   1 1 
        546 1 2 1 1  61 PHE H    .  61 . HN   1 1 
        547 1 1 1 1 172 LEU H    . 172 . HN   1 1 
        547 1 2 1 1 173 HIS H    . 173 . HN   1 1 
        548 1 1 1 1 171 LEU H    . 171 . HN   1 1 
        548 1 2 1 1 172 LEU H    . 172 . HN   1 1 
        549 1 1 1 1 157 GLU H    . 157 . HN   1 1 
        549 1 2 1 1 158 VAL H    . 158 . HN   1 1 
        550 1 1 1 1 163 LYS H    . 163 . HN   1 1 
        550 1 2 1 1 164 SER H    . 164 . HN   1 1 
        551 1 1 1 1 168 LEU H    . 168 . HN   1 1 
        551 1 2 1 1 169 GLN H    . 169 . HN   1 1 
        552 1 1 1 1 169 GLN H    . 169 . HN   1 1 
        552 1 2 1 1 170 GLU H    . 170 . HN   1 1 
        553 1 1 1 1 156 SER H    . 156 . HN   1 1 
        553 1 2 1 1 157 GLU H    . 157 . HN   1 1 
        554 1 1 1 1 117 ARG H    . 117 . HN   1 1 
        554 1 2 1 1 118 PHE H    . 118 . HN   1 1 
        555 1 1 1 1 162 PHE H    . 162 . HN   1 1 
        555 1 2 1 1 163 LYS H    . 163 . HN   1 1 
        556 1 1 1 1 162 PHE H    . 162 . HN   1 1 
        556 1 2 1 1 164 SER H    . 164 . HN   1 1 
        557 1 1 1 1 140 ASP H    . 140 . HN   1 1 
        557 1 2 1 1 143 TRP H    . 143 . HN   1 1 
        558 1 1 1 1 142 SER H    . 142 . HN   1 1 
        558 1 2 1 1 143 TRP H    . 143 . HN   1 1 
        559 1 1 1 1 142 SER H    . 142 . HN   1 1 
        559 1 2 1 1 143 TRP HD1  . 143 . HD1  1 1 
        560 1 1 1 1 136 GLY H    . 136 . HN   1 1 
        560 1 2 1 1 137 LYS H    . 137 . HN   1 1 
        561 1 1 1 1 134 ILE H    . 134 . HN   1 1 
        561 1 2 1 1 136 GLY H    . 136 . HN   1 1 
        562 1 1 1 1 135 ALA H    . 135 . HN   1 1 
        562 1 2 1 1 137 LYS H    . 137 . HN   1 1 
        563 1 1 1 1 108 LYS H    . 108 . HN   1 1 
        563 1 2 1 1 110 ASN H    . 110 . HN   1 1 
        564 1 1 1 1 111 ASP H    . 111 . HN   1 1 
        564 1 2 1 1 112 PHE H    . 112 . HN   1 1 
        565 1 1 1 1 113 GLU H    . 113 . HN   1 1 
        565 1 2 1 1 114 VAL H    . 114 . HN   1 1 
        566 1 1 1 1 104 MET H    . 104 . HN   1 1 
        566 1 2 1 1 107 ASN H    . 107 . HN   1 1 
        567 1 1 1 1 107 ASN H    . 107 . HN   1 1 
        567 1 2 1 1 108 LYS H    . 108 . HN   1 1 
        568 1 1 1 1 106 TYR H    . 106 . HN   1 1 
        568 1 2 1 1 107 ASN H    . 107 . HN   1 1 
        569 1 1 1 1 169 GLN H    . 169 . HN   1 1 
        569 1 2 1 1 171 LEU H    . 171 . HN   1 1 
        570 1 1 1 1 104 MET H    . 104 . HN   1 1 
        570 1 2 1 1 106 TYR H    . 106 . HN   1 1 
        571 1 1 1 1 103 ASN H    . 103 . HN   1 1 
        571 1 2 1 1 104 MET H    . 104 . HN   1 1 
        572 1 1 1 1 105 HIS H    . 105 . HN   1 1 
        572 1 2 1 1 107 ASN H    . 107 . HN   1 1 
        573 1 1 1 1 104 MET H    . 104 . HN   1 1 
        573 1 2 1 1 105 HIS H    . 105 . HN   1 1 
        574 1 1 1 1  97 GLU H    .  97 . HN   1 1 
        574 1 2 1 1  98 LEU H    .  98 . HN   1 1 
        575 1 1 1 1  98 LEU H    .  98 . HN   1 1 
        575 1 2 1 1  99 TYR HD1  .  99 . HD1  1 1 
        576 1 1 1 1  65 ARG H    .  65 . HN   1 1 
        576 1 2 1 1  66 GLU H    .  66 . HN   1 1 
        577 1 1 1 1  64 PHE H    .  64 . HN   1 1 
        577 1 2 1 1  65 ARG H    .  65 . HN   1 1 
        578 1 1 1 1  49 PHE H    .  49 . HN   1 1 
        578 1 2 1 1  50 ASN H    .  50 . HN   1 1 
        579 1 1 1 1  47 VAL H    .  47 . HN   1 1 
        579 1 2 1 1  48 LYS H    .  48 . HN   1 1 
        580 1 1 1 1  45 SER H    .  45 . HN   1 1 
        580 1 2 1 1  47 VAL H    .  47 . HN   1 1 
        581 1 1 1 1  47 VAL H    .  47 . HN   1 1 
        581 1 2 1 1  49 PHE HE2  .  49 . HE2  1 1 
        582 1 1 1 1  48 LYS H    .  48 . HN   1 1 
        582 1 2 1 1  49 PHE H    .  49 . HN   1 1 
        583 1 1 1 1  49 PHE H    .  49 . HN   1 1 
        583 1 2 1 1  49 PHE HD1  .  49 . HD1  1 1 
        584 1 1 1 1  49 PHE H    .  49 . HN   1 1 
        584 1 2 1 1  49 PHE HD2  .  49 . HD2  1 1 
        585 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
        585 1 2 1 1  18 SER H    .  18 . HN   1 1 
        586 1 1 1 1  45 SER H    .  45 . HN   1 1 
        586 1 2 1 1  46 ASP H    .  46 . HN   1 1 
        587 1 1 1 1  44 PHE HD1  .  44 . HD2  1 1 
        587 1 2 1 1  45 SER H    .  45 . HN   1 1 
        588 1 1 1 1  44 PHE H    .  44 . HN   1 1 
        588 1 2 1 1  44 PHE HD1  .  44 . HD2  1 1 
        589 1 1 1 1  42 THR H    .  42 . HN   1 1 
        589 1 2 1 1  44 PHE H    .  44 . HN   1 1 
        590 1 1 1 1  44 PHE H    .  44 . HN   1 1 
        590 1 2 1 1  49 PHE HZ   .  49 . HZ   1 1 
        591 1 1 1 1  41 LYS H    .  41 . HN   1 1 
        591 1 2 1 1  42 THR H    .  42 . HN   1 1 
        592 1 1 1 1  40 LEU H    .  40 . HN   1 1 
        592 1 2 1 1  41 LYS H    .  41 . HN   1 1 
        593 1 1 1 1  41 LYS H    .  41 . HN   1 1 
        593 1 2 1 1  44 PHE H    .  44 . HN   1 1 
        594 1 1 1 1  33 ARG H    .  33 . HN   1 1 
        594 1 2 1 1  34 TYR H    .  34 . HN   1 1 
        595 1 1 1 1  32 THR HB   .  32 . HB   1 1 
        595 1 2 1 1  33 ARG H    .  33 . HN   1 1 
        596 1 1 1 1  55 SER H    .  55 . HN   1 1 
        596 1 2 1 1  57 LEU H    .  57 . HN   1 1 
        597 1 1 1 1  57 LEU MD2  .  57 . HD2* 1 1 
        597 1 2 1 1  58 ILE H    .  58 . HN   1 1 
        598 1 1 1 1  22 LEU MD1  .  22 . HD1* 1 1 
        598 1 2 1 1  60 TRP H    .  60 . HN   1 1 
        599 1 1 1 1  22 LEU MD2  .  22 . HD2* 1 1 
        599 1 2 1 1  60 TRP H    .  60 . HN   1 1 
        600 1 1 1 1 150 VAL H    . 150 . HN   1 1 
        600 1 2 1 1 150 VAL MG1  . 150 . HG1* 1 1 
        601 1 1 1 1 125 THR MG   . 125 . HG2* 1 1 
        601 1 2 1 1 126 LEU H    . 126 . HN   1 1 
        602 1 1 1 1 126 LEU H    . 126 . HN   1 1 
        602 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
        603 1 1 1 1 126 LEU H    . 126 . HN   1 1 
        603 1 2 1 1 126 LEU MD2  . 126 . HD2* 1 1 
        604 1 1 1 1 124 ILE MG   . 124 . HG2* 1 1 
        604 1 2 1 1 125 THR H    . 125 . HN   1 1 
        605 1 1 1 1 122 ALA MB   . 122 . HB*  1 1 
        605 1 2 1 1 125 THR H    . 125 . HN   1 1 
        606 1 1 1 1 125 THR H    . 125 . HN   1 1 
        606 1 2 1 1 125 THR MG   . 125 . HG2* 1 1 
        607 1 1 1 1 124 ILE HB   . 124 . HB   1 1 
        607 1 2 1 1 125 THR H    . 125 . HN   1 1 
        608 1 1 1 1 114 VAL H    . 114 . HN   1 1 
        608 1 2 1 1 114 VAL MG2  . 114 . HG2* 1 1 
        609 1 1 1 1 114 VAL H    . 114 . HN   1 1 
        609 1 2 1 1 114 VAL MG1  . 114 . HG1* 1 1 
        610 1 1 1 1  60 TRP HA   .  60 . HA   1 1 
        610 1 2 1 1  60 TRP HE1  .  60 . HE1  1 1 
        611 1 1 1 1  44 PHE HA   .  44 . HA   1 1 
        611 1 2 1 1  46 ASP H    .  46 . HN   1 1 
        612 1 1 1 1  45 SER HB2  .  45 . HB2  1 1 
        612 1 2 1 1  46 ASP H    .  46 . HN   1 1 
        613 1 1 1 1  45 SER HB3  .  45 . HB1  1 1 
        613 1 2 1 1  46 ASP H    .  46 . HN   1 1 
        614 1 1 1 1  46 ASP H    .  46 . HN   1 1 
        614 1 2 1 1  47 VAL HB   .  47 . HB   1 1 
        615 1 1 1 1  46 ASP H    .  46 . HN   1 1 
        615 1 2 1 1  47 VAL MG2  .  47 . HG2* 1 1 
        616 1 1 1 1  46 ASP H    .  46 . HN   1 1 
        616 1 2 1 1  47 VAL MG1  .  47 . HG1* 1 1 
        617 1 1 1 1 156 SER H    . 156 . HN   1 1 
        617 1 2 1 1 156 SER HB2  . 156 . HB2  1 1 
        618 1 1 1 1 156 SER H    . 156 . HN   1 1 
        618 1 2 1 1 156 SER HB3  . 156 . HB1  1 1 
        619 1 1 1 1 101 ALA MB   . 101 . HB*  1 1 
        619 1 2 1 1 103 ASN H    . 103 . HN   1 1 
        620 1 1 1 1 102 LEU QD   . 102 . HD2* 1 1 
        620 1 2 1 1 103 ASN H    . 103 . HN   1 1 
        621 1 1 1 1  84 VAL HA   .  84 . HA   1 1 
        621 1 2 1 1  85 THR H    .  85 . HN   1 1 
        622 1 1 1 1  85 THR H    .  85 . HN   1 1 
        622 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
        623 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
        623 1 2 1 1  85 THR H    .  85 . HN   1 1 
        624 1 1 1 1 142 SER H    . 142 . HN   1 1 
        624 1 2 1 1 142 SER HB2  . 142 . HB2  1 1 
        625 1 1 1 1 142 SER H    . 142 . HN   1 1 
        625 1 2 1 1 142 SER HB3  . 142 . HB1  1 1 
        626 1 1 1 1 141 PRO HB3  . 141 . HB1  1 1 
        626 1 2 1 1 142 SER H    . 142 . HN   1 1 
        627 1 1 1 1 141 PRO HB2  . 141 . HB2  1 1 
        627 1 2 1 1 142 SER H    . 142 . HN   1 1 
        628 1 1 1 1 115 PRO HA   . 115 . HA   1 1 
        628 1 2 1 1 117 ARG H    . 117 . HN   1 1 
        629 1 1 1 1 115 PRO HB2  . 115 . HB2  1 1 
        629 1 2 1 1 117 ARG H    . 117 . HN   1 1 
        630 1 1 1 1  93 THR HB   .  93 . HB   1 1 
        630 1 2 1 1  94 ARG H    .  94 . HN   1 1 
        631 1 1 1 1  93 THR MG   .  93 . HG2* 1 1 
        631 1 2 1 1  94 ARG H    .  94 . HN   1 1 
        632 1 1 1 1  94 ARG H    .  94 . HN   1 1 
        632 1 2 1 1 119 LEU MD1  . 119 . HD1* 1 1 
        633 1 1 1 1  94 ARG H    .  94 . HN   1 1 
        633 1 2 1 1 119 LEU MD2  . 119 . HD2* 1 1 
        634 1 1 1 1  91 SER HA   .  91 . HA   1 1 
        634 1 2 1 1  98 LEU H    .  98 . HN   1 1 
        635 1 1 1 1  98 LEU H    .  98 . HN   1 1 
        635 1 2 1 1 101 ALA MB   . 101 . HB*  1 1 
        636 1 1 1 1  98 LEU H    .  98 . HN   1 1 
        636 1 2 1 1  98 LEU HG   .  98 . HG   1 1 
        637 1 1 1 1  38 ASN H    .  38 . HN   1 1 
        637 1 2 1 1  39 MET H    .  39 . HN   1 1 
        638 1 1 1 1 108 LYS HA   . 108 . HA   1 1 
        638 1 2 1 1 110 ASN H    . 110 . HN   1 1 
        639 1 1 1 1 110 ASN H    . 110 . HN   1 1 
        639 1 2 1 1 110 ASN HB2  . 110 . HB2  1 1 
        640 1 1 1 1 110 ASN H    . 110 . HN   1 1 
        640 1 2 1 1 110 ASN HB3  . 110 . HB1  1 1 
        641 1 1 1 1 109 ALA MB   . 109 . HB*  1 1 
        641 1 2 1 1 110 ASN H    . 110 . HN   1 1 
        642 1 1 1 1 110 ASN HA   . 110 . HA   1 1 
        642 1 2 1 1 111 ASP H    . 111 . HN   1 1 
        643 1 1 1 1 109 ALA HA   . 109 . HA   1 1 
        643 1 2 1 1 111 ASP H    . 111 . HN   1 1 
        644 1 1 1 1 111 ASP H    . 111 . HN   1 1 
        644 1 2 1 1 111 ASP HB2  . 111 . HB2  1 1 
        645 1 1 1 1 111 ASP H    . 111 . HN   1 1 
        645 1 2 1 1 111 ASP HB3  . 111 . HB1  1 1 
        646 1 1 1 1 109 ALA MB   . 109 . HB*  1 1 
        646 1 2 1 1 111 ASP H    . 111 . HN   1 1 
        647 1 1 1 1 101 ALA HA   . 101 . HA   1 1 
        647 1 2 1 1 104 MET H    . 104 . HN   1 1 
        648 1 1 1 1 101 ALA MB   . 101 . HB*  1 1 
        648 1 2 1 1 104 MET H    . 104 . HN   1 1 
        649 1 1 1 1 137 LYS H    . 137 . HN   1 1 
        649 1 2 1 1 138 ASP H    . 138 . HN   1 1 
        650 1 1 1 1 136 GLY H    . 136 . HN   1 1 
        650 1 2 1 1 138 ASP H    . 138 . HN   1 1 
        651 1 1 1 1 138 ASP H    . 138 . HN   1 1 
        651 1 2 1 1 139 VAL H    . 139 . HN   1 1 
        652 1 1 1 1 133 ILE HA   . 133 . HA   1 1 
        652 1 2 1 1 138 ASP H    . 138 . HN   1 1 
        653 1 1 1 1 138 ASP H    . 138 . HN   1 1 
        653 1 2 1 1 138 ASP HB2  . 138 . HB2  1 1 
        654 1 1 1 1 138 ASP H    . 138 . HN   1 1 
        654 1 2 1 1 139 VAL MG2  . 139 . HG2* 1 1 
        655 1 1 1 1 138 ASP H    . 138 . HN   1 1 
        655 1 2 1 1 138 ASP HB3  . 138 . HB1  1 1 
        656 1 1 1 1 109 ALA H    . 109 . HN   1 1 
        656 1 2 1 1 109 ALA MB   . 109 . HB*  1 1 
        657 1 1 1 1  90 LEU HB2  .  90 . HB2  1 1 
        657 1 2 1 1  91 SER H    .  91 . HN   1 1 
        658 1 1 1 1  90 LEU HB3  .  90 . HB1  1 1 
        658 1 2 1 1  91 SER H    .  91 . HN   1 1 
        659 1 1 1 1  91 SER H    .  91 . HN   1 1 
        659 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
        660 1 1 1 1  91 SER H    .  91 . HN   1 1 
        660 1 2 1 1 126 LEU MD2  . 126 . HD2* 1 1 
        661 1 1 1 1  90 LEU MD1  .  90 . HD1* 1 1 
        661 1 2 1 1  91 SER H    .  91 . HN   1 1 
        662 1 1 1 1  99 TYR H    .  99 . HN   1 1 
        662 1 2 1 1 100 ARG H    . 100 . HN   1 1 
        663 1 1 1 1  86 SER HA   .  86 . HA   1 1 
        663 1 2 1 1  88 GLU H    .  88 . HN   1 1 
        664 1 1 1 1  87 THR HB   .  87 . HB   1 1 
        664 1 2 1 1  88 GLU H    .  88 . HN   1 1 
        665 1 1 1 1  88 GLU H    .  88 . HN   1 1 
        665 1 2 1 1  88 GLU HB2  .  88 . HB2  1 1 
        666 1 1 1 1  88 GLU H    .  88 . HN   1 1 
        666 1 2 1 1  88 GLU HB3  .  88 . HB1  1 1 
        667 1 1 1 1  87 THR MG   .  87 . HG2* 1 1 
        667 1 2 1 1  88 GLU H    .  88 . HN   1 1 
        668 1 1 1 1 161 ILE HG12 . 161 . HG12 1 1 
        668 1 2 1 1 162 PHE H    . 162 . HN   1 1 
        669 1 1 1 1 161 ILE MG   . 161 . HG2* 1 1 
        669 1 2 1 1 162 PHE H    . 162 . HN   1 1 
        670 1 1 1 1  88 GLU H    .  88 . HN   1 1 
        670 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
        671 1 1 1 1 166 ASN HA   . 166 . HA   1 1 
        671 1 2 1 1 168 LEU H    . 168 . HN   1 1 
        672 1 1 1 1 167 CYS HB2  . 167 . HB2  1 1 
        672 1 2 1 1 168 LEU H    . 168 . HN   1 1 
        673 1 1 1 1 167 CYS HB3  . 167 . HB1  1 1 
        673 1 2 1 1 168 LEU H    . 168 . HN   1 1 
        674 1 1 1 1 160 GLU HB2  . 160 . HB2  1 1 
        674 1 2 1 1 161 ILE H    . 161 . HN   1 1 
        675 1 1 1 1 160 GLU HB3  . 160 . HB1  1 1 
        675 1 2 1 1 161 ILE H    . 161 . HN   1 1 
        676 1 1 1 1 168 LEU H    . 168 . HN   1 1 
        676 1 2 1 1 168 LEU HB3  . 168 . HB1  1 1 
        677 1 1 1 1 168 LEU H    . 168 . HN   1 1 
        677 1 2 1 1 168 LEU HB2  . 168 . HB2  1 1 
        678 1 1 1 1 161 ILE MD   . 161 . HD1* 1 1 
        678 1 2 1 1 168 LEU H    . 168 . HN   1 1 
        679 1 1 1 1 168 LEU H    . 168 . HN   1 1 
        679 1 2 1 1 168 LEU MD1  . 168 . HD1* 1 1 
        680 1 1 1 1 161 ILE H    . 161 . HN   1 1 
        680 1 2 1 1 161 ILE HB   . 161 . HB   1 1 
        681 1 1 1 1 161 ILE H    . 161 . HN   1 1 
        681 1 2 1 1 161 ILE HG12 . 161 . HG12 1 1 
        682 1 1 1 1 161 ILE H    . 161 . HN   1 1 
        682 1 2 1 1 161 ILE HG13 . 161 . HG11 1 1 
        683 1 1 1 1 161 ILE HG13 . 161 . HG11 1 1 
        683 1 2 1 1 168 LEU H    . 168 . HN   1 1 
        684 1 1 1 1 161 ILE MG   . 161 . HG2* 1 1 
        684 1 2 1 1 168 LEU H    . 168 . HN   1 1 
        685 1 1 1 1  13 MET H    .  13 . HN   1 1 
        685 1 2 1 1  14 GLN H    .  14 . HN   1 1 
        686 1 1 1 1  12 ALA MB   .  12 . HB*  1 1 
        686 1 2 1 1  14 GLN H    .  14 . HN   1 1 
        687 1 1 1 1  91 SER HA   .  91 . HA   1 1 
        687 1 2 1 1  92 ILE H    .  92 . HN   1 1 
        688 1 1 1 1  14 GLN HA   .  14 . HA   1 1 
        688 1 2 1 1  15 GLU H    .  15 . HN   1 1 
        689 1 1 1 1  92 ILE H    .  92 . HN   1 1 
        689 1 2 1 1  98 LEU QD   .  98 . HD2* 1 1 
        690 1 1 1 1 115 PRO HA   . 115 . HA   1 1 
        690 1 2 1 1 116 GLU H    . 116 . HN   1 1 
        691 1 1 1 1 115 PRO HB2  . 115 . HB2  1 1 
        691 1 2 1 1 116 GLU H    . 116 . HN   1 1 
        692 1 1 1 1 115 PRO HB3  . 115 . HB1  1 1 
        692 1 2 1 1 116 GLU H    . 116 . HN   1 1 
        693 1 1 1 1  48 LYS HA   .  48 . HA   1 1 
        693 1 2 1 1  49 PHE H    .  49 . HN   1 1 
        694 1 1 1 1  47 VAL HB   .  47 . HB   1 1 
        694 1 2 1 1  49 PHE H    .  49 . HN   1 1 
        695 1 1 1 1  47 VAL MG1  .  47 . HG1* 1 1 
        695 1 2 1 1  49 PHE H    .  49 . HN   1 1 
        696 1 1 1 1 157 GLU HA   . 157 . HA   1 1 
        696 1 2 1 1 158 VAL H    . 158 . HN   1 1 
        697 1 1 1 1 157 GLU HB2  . 157 . HB2  1 1 
        697 1 2 1 1 158 VAL H    . 158 . HN   1 1 
        698 1 1 1 1 157 GLU HB3  . 157 . HB1  1 1 
        698 1 2 1 1 158 VAL H    . 158 . HN   1 1 
        699 1 1 1 1 158 VAL H    . 158 . HN   1 1 
        699 1 2 1 1 158 VAL HB   . 158 . HB   1 1 
        700 1 1 1 1 158 VAL H    . 158 . HN   1 1 
        700 1 2 1 1 158 VAL MG2  . 158 . HG2* 1 1 
        701 1 1 1 1 158 VAL H    . 158 . HN   1 1 
        701 1 2 1 1 158 VAL MG1  . 158 . HG1* 1 1 
        702 1 1 1 1  47 VAL HA   .  47 . HA   1 1 
        702 1 2 1 1  48 LYS H    .  48 . HN   1 1 
        703 1 1 1 1  47 VAL HB   .  47 . HB   1 1 
        703 1 2 1 1  48 LYS H    .  48 . HN   1 1 
        704 1 1 1 1  48 LYS H    .  48 . HN   1 1 
        704 1 2 1 1  48 LYS HB2  .  48 . HB2  1 1 
        705 1 1 1 1  48 LYS H    .  48 . HN   1 1 
        705 1 2 1 1  48 LYS HB3  .  48 . HB1  1 1 
        706 1 1 1 1  47 VAL MG2  .  47 . HG2* 1 1 
        706 1 2 1 1  48 LYS H    .  48 . HN   1 1 
        707 1 1 1 1  47 VAL MG1  .  47 . HG1* 1 1 
        707 1 2 1 1  48 LYS H    .  48 . HN   1 1 
        708 1 1 1 1  12 ALA H    .  12 . HN   1 1 
        708 1 2 1 1  12 ALA MB   .  12 . HB*  1 1 
        709 1 1 1 1 141 PRO HA   . 141 . HA   1 1 
        709 1 2 1 1 143 TRP H    . 143 . HN   1 1 
        710 1 1 1 1 142 SER HB2  . 142 . HB2  1 1 
        710 1 2 1 1 143 TRP H    . 143 . HN   1 1 
        711 1 1 1 1 142 SER HB3  . 142 . HB1  1 1 
        711 1 2 1 1 143 TRP H    . 143 . HN   1 1 
        712 1 1 1 1 141 PRO HB2  . 141 . HB2  1 1 
        712 1 2 1 1 143 TRP H    . 143 . HN   1 1 
        713 1 1 1 1  57 LEU HB3  .  57 . HB1  1 1 
        713 1 2 1 1  58 ILE H    .  58 . HN   1 1 
        714 1 1 1 1  79 ALA HA   .  79 . HA   1 1 
        714 1 2 1 1  84 VAL H    .  84 . HN   1 1 
        715 1 1 1 1  84 VAL H    .  84 . HN   1 1 
        715 1 2 1 1  85 THR MG   .  85 . HG2* 1 1 
        716 1 1 1 1 172 LEU HA   . 172 . HA   1 1 
        716 1 2 1 1 173 HIS H    . 173 . HN   1 1 
        717 1 1 1 1  41 LYS HA   .  41 . HA   1 1 
        717 1 2 1 1  44 PHE H    .  44 . HN   1 1 
        718 1 1 1 1  44 PHE H    .  44 . HN   1 1 
        718 1 2 1 1  47 VAL MG2  .  47 . HG2* 1 1 
        719 1 1 1 1 147 ILE H    . 147 . HN   1 1 
        719 1 2 1 1 148 TYR H    . 148 . HN   1 1 
        720 1 1 1 1 148 TYR H    . 148 . HN   1 1 
        720 1 2 1 1 148 TYR HD1  . 148 . HD2  1 1 
        721 1 1 1 1 148 TYR H    . 148 . HN   1 1 
        721 1 2 1 1 148 TYR HE1  . 148 . HE2  1 1 
        722 1 1 1 1 145 LYS HA   . 145 . HA   1 1 
        722 1 2 1 1 148 TYR H    . 148 . HN   1 1 
        723 1 1 1 1 147 ILE HB   . 147 . HB   1 1 
        723 1 2 1 1 148 TYR H    . 148 . HN   1 1 
        724 1 1 1 1 147 ILE MG   . 147 . HG2* 1 1 
        724 1 2 1 1 148 TYR H    . 148 . HN   1 1 
        725 1 1 1 1 146 ALA HA   . 146 . HA   1 1 
        725 1 2 1 1 148 TYR H    . 148 . HN   1 1 
        726 1 1 1 1  81 ASN H    .  81 . HN   1 1 
        726 1 2 1 1  81 ASN HB2  .  81 . HB2  1 1 
        727 1 1 1 1  81 ASN H    .  81 . HN   1 1 
        727 1 2 1 1  81 ASN HB3  .  81 . HB1  1 1 
        728 1 1 1 1  79 ALA MB   .  79 . HB*  1 1 
        728 1 2 1 1  81 ASN H    .  81 . HN   1 1 
        729 1 1 1 1  80 ILE MG   .  80 . HG2* 1 1 
        729 1 2 1 1  81 ASN H    .  81 . HN   1 1 
        730 1 1 1 1  81 ASN H    .  81 . HN   1 1 
        730 1 2 1 1 133 ILE MG   . 133 . HG2* 1 1 
        731 1 1 1 1  17 LEU H    .  17 . HN   1 1 
        731 1 2 1 1  60 TRP HH2  .  60 . HH2  1 1 
        732 1 1 1 1  17 LEU H    .  17 . HN   1 1 
        732 1 2 1 1  17 LEU MD1  .  17 . HD1* 1 1 
        733 1 1 1 1  76 ALA HA   .  76 . HA   1 1 
        733 1 2 1 1  78 GLN H    .  78 . HN   1 1 
        734 1 1 1 1  98 LEU HA   .  98 . HA   1 1 
        734 1 2 1 1 101 ALA H    . 101 . HN   1 1 
        735 1 1 1 1 101 ALA H    . 101 . HN   1 1 
        735 1 2 1 1 101 ALA MB   . 101 . HB*  1 1 
        736 1 1 1 1 156 SER HA   . 156 . HA   1 1 
        736 1 2 1 1 157 GLU H    . 157 . HN   1 1 
        737 1 1 1 1  12 ALA MB   .  12 . HB*  1 1 
        737 1 2 1 1  13 MET H    .  13 . HN   1 1 
        738 1 1 1 1  80 ILE HA   .  80 . HA   1 1 
        738 1 2 1 1  82 ASP H    .  82 . HN   1 1 
        739 1 1 1 1  82 ASP H    .  82 . HN   1 1 
        739 1 2 1 1  82 ASP HB2  .  82 . HB2  1 1 
        740 1 1 1 1  82 ASP H    .  82 . HN   1 1 
        740 1 2 1 1  82 ASP HB3  .  82 . HB1  1 1 
        741 1 1 1 1  79 ALA MB   .  79 . HB*  1 1 
        741 1 2 1 1  82 ASP H    .  82 . HN   1 1 
        742 1 1 1 1  80 ILE MG   .  80 . HG2* 1 1 
        742 1 2 1 1  82 ASP H    .  82 . HN   1 1 
        743 1 1 1 1  38 ASN HA   .  38 . HA   1 1 
        743 1 2 1 1  40 LEU H    .  40 . HN   1 1 
        744 1 1 1 1  38 ASN HB2  .  38 . HB2  1 1 
        744 1 2 1 1  40 LEU H    .  40 . HN   1 1 
        745 1 1 1 1  38 ASN HB3  .  38 . HB1  1 1 
        745 1 2 1 1  40 LEU H    .  40 . HN   1 1 
        746 1 1 1 1 138 ASP H    . 138 . HN   1 1 
        746 1 2 1 1 140 ASP H    . 140 . HN   1 1 
        747 1 1 1 1 140 ASP H    . 140 . HN   1 1 
        747 1 2 1 1 143 TRP HD1  . 143 . HD1  1 1 
        748 1 1 1 1 139 VAL HA   . 139 . HA   1 1 
        748 1 2 1 1 140 ASP H    . 140 . HN   1 1 
        749 1 1 1 1 138 ASP HA   . 138 . HA   1 1 
        749 1 2 1 1 140 ASP H    . 140 . HN   1 1 
        750 1 1 1 1 107 ASN HA   . 107 . HA   1 1 
        750 1 2 1 1 108 LYS H    . 108 . HN   1 1 
        751 1 1 1 1  44 PHE HA   .  44 . HA   1 1 
        751 1 2 1 1  47 VAL H    .  47 . HN   1 1 
        752 1 1 1 1  45 SER HA   .  45 . HA   1 1 
        752 1 2 1 1  47 VAL H    .  47 . HN   1 1 
        753 1 1 1 1  47 VAL H    .  47 . HN   1 1 
        753 1 2 1 1  47 VAL HB   .  47 . HB   1 1 
        754 1 1 1 1  47 VAL H    .  47 . HN   1 1 
        754 1 2 1 1  47 VAL MG2  .  47 . HG2* 1 1 
        755 1 1 1 1  47 VAL H    .  47 . HN   1 1 
        755 1 2 1 1  47 VAL MG1  .  47 . HG1* 1 1 
        756 1 1 1 1  39 MET H    .  39 . HN   1 1 
        756 1 2 1 1  41 LYS H    .  41 . HN   1 1 
        757 1 1 1 1  38 ASN HB2  .  38 . HB2  1 1 
        757 1 2 1 1  39 MET H    .  39 . HN   1 1 
        758 1 1 1 1  38 ASN HB3  .  38 . HB1  1 1 
        758 1 2 1 1  39 MET H    .  39 . HN   1 1 
        759 1 1 1 1  39 MET H    .  39 . HN   1 1 
        759 1 2 1 1  39 MET ME   .  39 . HE*  1 1 
        760 1 1 1 1 110 ASN HA   . 110 . HA   1 1 
        760 1 2 1 1 112 PHE H    . 112 . HN   1 1 
        761 1 1 1 1  79 ALA H    .  79 . HN   1 1 
        761 1 2 1 1  79 ALA MB   .  79 . HB*  1 1 
        762 1 1 1 1  79 ALA H    .  79 . HN   1 1 
        762 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
        763 1 1 1 1 153 LYS H    . 153 . HN   1 1 
        763 1 2 1 1 155 ASP H    . 155 . HN   1 1 
        764 1 1 1 1 152 CYS HA   . 152 . HA   1 1 
        764 1 2 1 1 155 ASP H    . 155 . HN   1 1 
        765 1 1 1 1 154 LEU MD1  . 154 . HD1* 1 1 
        765 1 2 1 1 155 ASP H    . 155 . HN   1 1 
        766 1 1 1 1 154 LEU MD2  . 154 . HD2* 1 1 
        766 1 2 1 1 155 ASP H    . 155 . HN   1 1 
        767 1 1 1 1  58 ILE HB   .  58 . HB   1 1 
        767 1 2 1 1  59 LYS H    .  59 . HN   1 1 
        768 1 1 1 1  87 THR HB   .  87 . HB   1 1 
        768 1 2 1 1  90 LEU H    .  90 . HN   1 1 
        769 1 1 1 1  89 GLU HB2  .  89 . HB2  1 1 
        769 1 2 1 1  90 LEU H    .  90 . HN   1 1 
        770 1 1 1 1  89 GLU HB3  .  89 . HB1  1 1 
        770 1 2 1 1  90 LEU H    .  90 . HN   1 1 
        771 1 1 1 1  90 LEU H    .  90 . HN   1 1 
        771 1 2 1 1  90 LEU HB2  .  90 . HB2  1 1 
        772 1 1 1 1  87 THR MG   .  87 . HG2* 1 1 
        772 1 2 1 1  90 LEU H    .  90 . HN   1 1 
        773 1 1 1 1  90 LEU H    .  90 . HN   1 1 
        773 1 2 1 1  90 LEU HB3  .  90 . HB1  1 1 
        774 1 1 1 1  90 LEU H    .  90 . HN   1 1 
        774 1 2 1 1 126 LEU MD2  . 126 . HD2* 1 1 
        775 1 1 1 1  90 LEU H    .  90 . HN   1 1 
        775 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
        776 1 1 1 1  90 LEU H    .  90 . HN   1 1 
        776 1 2 1 1  90 LEU MD1  .  90 . HD1* 1 1 
        777 1 1 1 1  41 LYS H    .  41 . HN   1 1 
        777 1 2 1 1  43 TYR H    .  43 . HN   1 1 
        778 1 1 1 1  43 TYR H    .  43 . HN   1 1 
        778 1 2 1 1  43 TYR HD1  .  43 . HD2  1 1 
        779 1 1 1 1  80 ILE H    .  80 . HN   1 1 
        779 1 2 1 1  81 ASN HB2  .  81 . HB2  1 1 
        780 1 1 1 1  80 ILE H    .  80 . HN   1 1 
        780 1 2 1 1  81 ASN HB3  .  81 . HB1  1 1 
        781 1 1 1 1  80 ILE H    .  80 . HN   1 1 
        781 1 2 1 1  80 ILE MD   .  80 . HD1* 1 1 
        782 1 1 1 1  61 PHE H    .  61 . HN   1 1 
        782 1 2 1 1  63 ASN H    .  63 . HN   1 1 
        783 1 1 1 1 169 GLN HA   . 169 . HA   1 1 
        783 1 2 1 1 171 LEU H    . 171 . HN   1 1 
        784 1 1 1 1 171 LEU H    . 171 . HN   1 1 
        784 1 2 1 1 171 LEU HG   . 171 . HG   1 1 
        785 1 1 1 1  57 LEU MD2  .  57 . HD2* 1 1 
        785 1 2 1 1  61 PHE H    .  61 . HN   1 1 
        786 1 1 1 1  57 LEU HA   .  57 . HA   1 1 
        786 1 2 1 1  60 TRP H    .  60 . HN   1 1 
        787 1 1 1 1  95 ASP HA   .  95 . HA   1 1 
        787 1 2 1 1  99 TYR H    .  99 . HN   1 1 
        788 1 1 1 1  98 LEU HG   .  98 . HG   1 1 
        788 1 2 1 1  99 TYR H    .  99 . HN   1 1 
        789 1 1 1 1  98 LEU QD   .  98 . HD2* 1 1 
        789 1 2 1 1  99 TYR H    .  99 . HN   1 1 
        790 1 1 1 1 120 GLU H    . 120 . HN   1 1 
        790 1 2 1 1 121 VAL H    . 121 . HN   1 1 
        791 1 1 1 1 119 LEU H    . 119 . HN   1 1 
        791 1 2 1 1 120 GLU H    . 120 . HN   1 1 
        792 1 1 1 1 118 PHE HA   . 118 . HA   1 1 
        792 1 2 1 1 120 GLU H    . 120 . HN   1 1 
        793 1 1 1 1 119 LEU HG   . 119 . HG   1 1 
        793 1 2 1 1 120 GLU H    . 120 . HN   1 1 
        794 1 1 1 1  93 THR MG   .  93 . HG2* 1 1 
        794 1 2 1 1 120 GLU H    . 120 . HN   1 1 
        795 1 1 1 1 120 GLU H    . 120 . HN   1 1 
        795 1 2 1 1 121 VAL MG2  . 121 . HG2* 1 1 
        796 1 1 1 1 119 LEU MD1  . 119 . HD1* 1 1 
        796 1 2 1 1 120 GLU H    . 120 . HN   1 1 
        797 1 1 1 1 143 TRP H    . 143 . HN   1 1 
        797 1 2 1 1 144 LYS H    . 144 . HN   1 1 
        798 1 1 1 1 143 TRP HE3  . 143 . HE3  1 1 
        798 1 2 1 1 144 LYS H    . 144 . HN   1 1 
        799 1 1 1 1 142 SER HA   . 142 . HA   1 1 
        799 1 2 1 1 144 LYS H    . 144 . HN   1 1 
        800 1 1 1 1 146 ALA H    . 146 . HN   1 1 
        800 1 2 1 1 148 TYR H    . 148 . HN   1 1 
        801 1 1 1 1 145 LYS H    . 145 . HN   1 1 
        801 1 2 1 1 146 ALA H    . 146 . HN   1 1 
        802 1 1 1 1 146 ALA H    . 146 . HN   1 1 
        802 1 2 1 1 147 ILE H    . 147 . HN   1 1 
        803 1 1 1 1 119 LEU H    . 119 . HN   1 1 
        803 1 2 1 1 119 LEU HB2  . 119 . HB2  1 1 
        804 1 1 1 1 114 VAL HB   . 114 . HB   1 1 
        804 1 2 1 1 119 LEU H    . 119 . HN   1 1 
        805 1 1 1 1 119 LEU H    . 119 . HN   1 1 
        805 1 2 1 1 119 LEU HG   . 119 . HG   1 1 
        806 1 1 1 1 119 LEU H    . 119 . HN   1 1 
        806 1 2 1 1 122 ALA MB   . 122 . HB*  1 1 
        807 1 1 1 1 119 LEU H    . 119 . HN   1 1 
        807 1 2 1 1 119 LEU MD1  . 119 . HD1* 1 1 
        808 1 1 1 1 146 ALA HA   . 146 . HA   1 1 
        808 1 2 1 1 150 VAL H    . 150 . HN   1 1 
        809 1 1 1 1 150 VAL H    . 150 . HN   1 1 
        809 1 2 1 1 150 VAL HB   . 150 . HB   1 1 
        810 1 1 1 1 146 ALA MB   . 146 . HB*  1 1 
        810 1 2 1 1 150 VAL H    . 150 . HN   1 1 
        811 1 1 1 1 150 VAL H    . 150 . HN   1 1 
        811 1 2 1 1 151 ILE MG   . 151 . HG2* 1 1 
        812 1 1 1 1 169 GLN HA   . 169 . HA   1 1 
        812 1 2 1 1 172 LEU H    . 172 . HN   1 1 
        813 1 1 1 1 168 LEU HA   . 168 . HA   1 1 
        813 1 2 1 1 172 LEU H    . 172 . HN   1 1 
        814 1 1 1 1 171 LEU HG   . 171 . HG   1 1 
        814 1 2 1 1 172 LEU H    . 172 . HN   1 1 
        815 1 1 1 1 168 LEU MD2  . 168 . HD2* 1 1 
        815 1 2 1 1 172 LEU H    . 172 . HN   1 1 
        816 1 1 1 1 168 LEU MD1  . 168 . HD1* 1 1 
        816 1 2 1 1 172 LEU H    . 172 . HN   1 1 
        817 1 1 1 1 144 LYS H    . 144 . HN   1 1 
        817 1 2 1 1 145 LYS H    . 145 . HN   1 1 
        818 1 1 1 1 145 LYS H    . 145 . HN   1 1 
        818 1 2 1 1 148 TYR HD2  . 148 . HD1  1 1 
        819 1 1 1 1 142 SER HA   . 142 . HA   1 1 
        819 1 2 1 1 145 LYS H    . 145 . HN   1 1 
        820 1 1 1 1 169 GLN HA   . 169 . HA   1 1 
        820 1 2 1 1 170 GLU H    . 170 . HN   1 1 
        821 1 1 1 1 145 LYS H    . 145 . HN   1 1 
        821 1 2 1 1 145 LYS HB2  . 145 . HB2  1 1 
        822 1 1 1 1 145 LYS H    . 145 . HN   1 1 
        822 1 2 1 1 145 LYS HB3  . 145 . HB1  1 1 
        823 1 1 1 1 170 GLU H    . 170 . HN   1 1 
        823 1 2 1 1 171 LEU HG   . 171 . HG   1 1 
        824 1 1 1 1 168 LEU MD2  . 168 . HD2* 1 1 
        824 1 2 1 1 170 GLU H    . 170 . HN   1 1 
        825 1 1 1 1 118 PHE H    . 118 . HN   1 1 
        825 1 2 1 1 120 GLU H    . 120 . HN   1 1 
        826 1 1 1 1 115 PRO HB2  . 115 . HB2  1 1 
        826 1 2 1 1 118 PHE H    . 118 . HN   1 1 
        827 1 1 1 1 154 LEU H    . 154 . HN   1 1 
        827 1 2 1 1 154 LEU HG   . 154 . HG   1 1 
        828 1 1 1 1 154 LEU H    . 154 . HN   1 1 
        828 1 2 1 1 154 LEU MD1  . 154 . HD1* 1 1 
        829 1 1 1 1 154 LEU H    . 154 . HN   1 1 
        829 1 2 1 1 154 LEU MD2  . 154 . HD2* 1 1 
        830 1 1 1 1  86 SER H    .  86 . HN   1 1 
        830 1 2 1 1  88 GLU H    .  88 . HN   1 1 
        831 1 1 1 1  85 THR HA   .  85 . HA   1 1 
        831 1 2 1 1  86 SER H    .  86 . HN   1 1 
        832 1 1 1 1  85 THR HB   .  85 . HB   1 1 
        832 1 2 1 1  86 SER H    .  86 . HN   1 1 
        833 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
        833 1 2 1 1  86 SER H    .  86 . HN   1 1 
        834 1 1 1 1  86 SER H    .  86 . HN   1 1 
        834 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
        835 1 1 1 1 166 ASN HA   . 166 . HA   1 1 
        835 1 2 1 1 169 GLN H    . 169 . HN   1 1 
        836 1 1 1 1  38 ASN HA   .  38 . HA   1 1 
        836 1 2 1 1  41 LYS H    .  41 . HN   1 1 
        837 1 1 1 1 169 GLN H    . 169 . HN   1 1 
        837 1 2 1 1 169 GLN HB2  . 169 . HB2  1 1 
        838 1 1 1 1 169 GLN H    . 169 . HN   1 1 
        838 1 2 1 1 169 GLN HB3  . 169 . HB1  1 1 
        839 1 1 1 1 168 LEU HB3  . 168 . HB1  1 1 
        839 1 2 1 1 169 GLN H    . 169 . HN   1 1 
        840 1 1 1 1  41 LYS H    .  41 . HN   1 1 
        840 1 2 1 1  41 LYS HB2  .  41 . HB2  1 1 
        841 1 1 1 1  41 LYS H    .  41 . HN   1 1 
        841 1 2 1 1  41 LYS HB3  .  41 . HB1  1 1 
        842 1 1 1 1 168 LEU MD1  . 168 . HD1* 1 1 
        842 1 2 1 1 169 GLN H    . 169 . HN   1 1 
        843 1 1 1 1 166 ASN H    . 166 . HN   1 1 
        843 1 2 1 1 166 ASN HB2  . 166 . HB2  1 1 
        844 1 1 1 1 166 ASN H    . 166 . HN   1 1 
        844 1 2 1 1 166 ASN HB3  . 166 . HB1  1 1 
        845 1 1 1 1 161 ILE HA   . 161 . HA   1 1 
        845 1 2 1 1 163 LYS H    . 163 . HN   1 1 
        846 1 1 1 1 161 ILE HG12 . 161 . HG12 1 1 
        846 1 2 1 1 163 LYS H    . 163 . HN   1 1 
        847 1 1 1 1 161 ILE MD   . 161 . HD1* 1 1 
        847 1 2 1 1 163 LYS H    . 163 . HN   1 1 
        848 1 1 1 1 137 LYS H    . 137 . HN   1 1 
        848 1 2 1 1 139 VAL H    . 139 . HN   1 1 
        849 1 1 1 1 135 ALA HA   . 135 . HA   1 1 
        849 1 2 1 1 137 LYS H    . 137 . HN   1 1 
        850 1 1 1 1 133 ILE HA   . 133 . HA   1 1 
        850 1 2 1 1 137 LYS H    . 137 . HN   1 1 
        851 1 1 1 1 135 ALA MB   . 135 . HB*  1 1 
        851 1 2 1 1 137 LYS H    . 137 . HN   1 1 
        852 1 1 1 1 133 ILE MG   . 133 . HG2* 1 1 
        852 1 2 1 1 137 LYS H    . 137 . HN   1 1 
        853 1 1 1 1  44 PHE HA   .  44 . HA   1 1 
        853 1 2 1 1  45 SER H    .  45 . HN   1 1 
        854 1 1 1 1  45 SER H    .  45 . HN   1 1 
        854 1 2 1 1  45 SER HB2  .  45 . HB2  1 1 
        855 1 1 1 1  45 SER H    .  45 . HN   1 1 
        855 1 2 1 1  45 SER HB3  .  45 . HB1  1 1 
        856 1 1 1 1  45 SER H    .  45 . HN   1 1 
        856 1 2 1 1  47 VAL MG2  .  47 . HG2* 1 1 
        857 1 1 1 1  55 SER H    .  55 . HN   1 1 
        857 1 2 1 1  58 ILE HG13 .  58 . HG11 1 1 
        858 1 1 1 1  54 THR MG   .  54 . HG2* 1 1 
        858 1 2 1 1  55 SER H    .  55 . HN   1 1 
        859 1 1 1 1  95 ASP H    .  95 . HN   1 1 
        859 1 2 1 1  99 TYR HD1  .  99 . HD1  1 1 
        860 1 1 1 1  93 THR HA   .  93 . HA   1 1 
        860 1 2 1 1  95 ASP H    .  95 . HN   1 1 
        861 1 1 1 1  95 ASP H    .  95 . HN   1 1 
        861 1 2 1 1  95 ASP HB2  .  95 . HB2  1 1 
        862 1 1 1 1  95 ASP H    .  95 . HN   1 1 
        862 1 2 1 1  95 ASP HB3  .  95 . HB1  1 1 
        863 1 1 1 1  93 THR MG   .  93 . HG2* 1 1 
        863 1 2 1 1  95 ASP H    .  95 . HN   1 1 
        864 1 1 1 1  95 ASP H    .  95 . HN   1 1 
        864 1 2 1 1 119 LEU MD2  . 119 . HD2* 1 1 
        865 1 1 1 1 161 ILE HG12 . 161 . HG12 1 1 
        865 1 2 1 1 164 SER H    . 164 . HN   1 1 
        866 1 1 1 1 161 ILE MD   . 161 . HD1* 1 1 
        866 1 2 1 1 164 SER H    . 164 . HN   1 1 
        867 1 1 1 1  87 THR HB   .  87 . HB   1 1 
        867 1 2 1 1  89 GLU H    .  89 . HN   1 1 
        868 1 1 1 1  87 THR MG   .  87 . HG2* 1 1 
        868 1 2 1 1  89 GLU H    .  89 . HN   1 1 
        869 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
        869 1 2 1 1  89 GLU H    .  89 . HN   1 1 
        870 1 1 1 1  89 GLU H    .  89 . HN   1 1 
        870 1 2 1 1  90 LEU MD1  .  90 . HD1* 1 1 
        871 1 1 1 1 146 ALA HA   . 146 . HA   1 1 
        871 1 2 1 1 149 LYS H    . 149 . HN   1 1 
        872 1 1 1 1 147 ILE HA   . 147 . HA   1 1 
        872 1 2 1 1 149 LYS H    . 149 . HN   1 1 
        873 1 1 1 1 145 LYS HA   . 145 . HA   1 1 
        873 1 2 1 1 149 LYS H    . 149 . HN   1 1 
        874 1 1 1 1 149 LYS H    . 149 . HN   1 1 
        874 1 2 1 1 150 VAL MG1  . 150 . HG1* 1 1 
        875 1 1 1 1 149 LYS H    . 149 . HN   1 1 
        875 1 2 1 1 151 ILE MD   . 151 . HD1* 1 1 
        876 1 1 1 1 166 ASN HA   . 166 . HA   1 1 
        876 1 2 1 1 167 CYS H    . 167 . HN   1 1 
        877 1 1 1 1  92 ILE HA   .  92 . HA   1 1 
        877 1 2 1 1  93 THR H    .  93 . HN   1 1 
        878 1 1 1 1 167 CYS H    . 167 . HN   1 1 
        878 1 2 1 1 167 CYS HB2  . 167 . HB2  1 1 
        879 1 1 1 1 167 CYS H    . 167 . HN   1 1 
        879 1 2 1 1 167 CYS HB3  . 167 . HB1  1 1 
        880 1 1 1 1  93 THR H    .  93 . HN   1 1 
        880 1 2 1 1 119 LEU HG   . 119 . HG   1 1 
        881 1 1 1 1  93 THR H    .  93 . HN   1 1 
        881 1 2 1 1  93 THR MG   .  93 . HG2* 1 1 
        882 1 1 1 1  92 ILE MG   .  92 . HG2* 1 1 
        882 1 2 1 1  93 THR H    .  93 . HN   1 1 
        883 1 1 1 1  16 GLY H    .  16 . HN   1 1 
        883 1 2 1 1  17 LEU H    .  17 . HN   1 1 
        884 1 1 1 1  16 GLY H    .  16 . HN   1 1 
        884 1 2 1 1  53 ILE HB   .  53 . HB   1 1 
        885 1 1 1 1  16 GLY H    .  16 . HN   1 1 
        885 1 2 1 1  17 LEU MD2  .  17 . HD2* 1 1 
        886 1 1 1 1 133 ILE HA   . 133 . HA   1 1 
        886 1 2 1 1 136 GLY H    . 136 . HN   1 1 
        887 1 1 1 1 135 ALA MB   . 135 . HB*  1 1 
        887 1 2 1 1 136 GLY H    . 136 . HN   1 1 
        888 1 1 1 1 134 ILE MG   . 134 . HG2* 1 1 
        888 1 2 1 1 136 GLY H    . 136 . HN   1 1 
        889 1 1 1 1  82 ASP HB3  .  82 . HB1  1 1 
        889 1 2 1 1  83 GLY H    .  83 . HN   1 1 
        890 1 1 1 1  83 GLY H    .  83 . HN   1 1 
        890 1 2 1 1  84 VAL MG2  .  84 . HG2* 1 1 
        891 1 1 1 1  80 ILE MG   .  80 . HG2* 1 1 
        891 1 2 1 1  83 GLY H    .  83 . HN   1 1 
        892 1 1 1 1  80 ILE MD   .  80 . HD1* 1 1 
        892 1 2 1 1  83 GLY H    .  83 . HN   1 1 
        893 1 1 1 1 106 TYR H    . 106 . HN   1 1 
        893 1 2 1 1 106 TYR QE   . 106 . HE2  1 1 
        894 1 1 1 1 102 LEU QD   . 102 . HD2* 1 1 
        894 1 2 1 1 106 TYR H    . 106 . HN   1 1 
        895 1 1 1 1  49 PHE HB2  .  49 . HB2  1 1 
        895 1 2 1 1  50 ASN H    .  50 . HN   1 1 
        896 1 1 1 1  49 PHE HB3  .  49 . HB1  1 1 
        896 1 2 1 1  50 ASN H    .  50 . HN   1 1 
        897 1 1 1 1  47 VAL MG1  .  47 . HG1* 1 1 
        897 1 2 1 1  50 ASN H    .  50 . HN   1 1 
        898 1 1 1 1 139 VAL H    . 139 . HN   1 1 
        898 1 2 1 1 140 ASP H    . 140 . HN   1 1 
        899 1 1 1 1 138 ASP HA   . 138 . HA   1 1 
        899 1 2 1 1 139 VAL H    . 139 . HN   1 1 
        900 1 1 1 1 139 VAL H    . 139 . HN   1 1 
        900 1 2 1 1 139 VAL HB   . 139 . HB   1 1 
        901 1 1 1 1 138 ASP HB2  . 138 . HB2  1 1 
        901 1 2 1 1 139 VAL H    . 139 . HN   1 1 
        902 1 1 1 1 139 VAL H    . 139 . HN   1 1 
        902 1 2 1 1 139 VAL MG2  . 139 . HG2* 1 1 
        903 1 1 1 1 138 ASP HB3  . 138 . HB1  1 1 
        903 1 2 1 1 139 VAL H    . 139 . HN   1 1 
        904 1 1 1 1  42 THR H    .  42 . HN   1 1 
        904 1 2 1 1  43 TYR H    .  43 . HN   1 1 
        905 1 1 1 1  42 THR H    .  42 . HN   1 1 
        905 1 2 1 1  42 THR HB   .  42 . HB   1 1 
        906 1 1 1 1  39 MET ME   .  39 . HE*  1 1 
        906 1 2 1 1  42 THR H    .  42 . HN   1 1 
        907 1 1 1 1  31 TYR HB2  .  31 . HB2  1 1 
        907 1 2 1 1  32 THR H    .  32 . HN   1 1 
        908 1 1 1 1  31 TYR HB3  .  31 . HB1  1 1 
        908 1 2 1 1  32 THR H    .  32 . HN   1 1 
        909 1 1 1 1  32 THR H    .  32 . HN   1 1 
        909 1 2 1 1  32 THR MG   .  32 . HG2* 1 1 
        910 1 1 1 1 144 LYS HA   . 144 . HA   1 1 
        910 1 2 1 1 147 ILE H    . 147 . HN   1 1 
        911 1 1 1 1 146 ALA MB   . 146 . HB*  1 1 
        911 1 2 1 1 147 ILE H    . 147 . HN   1 1 
        912 1 1 1 1 132 ALA HA   . 132 . HA   1 1 
        912 1 2 1 1 135 ALA H    . 135 . HN   1 1 
        913 1 1 1 1 133 ILE HA   . 133 . HA   1 1 
        913 1 2 1 1 135 ALA H    . 135 . HN   1 1 
        914 1 1 1 1 135 ALA H    . 135 . HN   1 1 
        914 1 2 1 1 135 ALA MB   . 135 . HB*  1 1 
        915 1 1 1 1 134 ILE HB   . 134 . HB   1 1 
        915 1 2 1 1 135 ALA H    . 135 . HN   1 1 
        916 1 1 1 1 134 ILE MG   . 134 . HG2* 1 1 
        916 1 2 1 1 135 ALA H    . 135 . HN   1 1 
        917 1 1 1 1  86 SER HA   .  86 . HA   1 1 
        917 1 2 1 1  87 THR H    .  87 . HN   1 1 
        918 1 1 1 1  87 THR H    .  87 . HN   1 1 
        918 1 2 1 1  87 THR HB   .  87 . HB   1 1 
        919 1 1 1 1 151 ILE HB   . 151 . HB   1 1 
        919 1 2 1 1 152 CYS H    . 152 . HN   1 1 
        920 1 1 1 1  76 ALA MB   .  76 . HB*  1 1 
        920 1 2 1 1 130 PHE H    . 130 . HN   1 1 
        921 1 1 1 1  87 THR H    .  87 . HN   1 1 
        921 1 2 1 1  87 THR MG   .  87 . HG2* 1 1 
        922 1 1 1 1 151 ILE MG   . 151 . HG2* 1 1 
        922 1 2 1 1 152 CYS H    . 152 . HN   1 1 
        923 1 1 1 1 150 VAL MG1  . 150 . HG1* 1 1 
        923 1 2 1 1 152 CYS H    . 152 . HN   1 1 
        924 1 1 1 1 152 CYS H    . 152 . HN   1 1 
        924 1 2 1 1 154 LEU MD1  . 154 . HD1* 1 1 
        925 1 1 1 1 151 ILE MD   . 151 . HD1* 1 1 
        925 1 2 1 1 152 CYS H    . 152 . HN   1 1 
        926 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
        926 1 2 1 1  87 THR H    .  87 . HN   1 1 
        927 1 1 1 1  80 ILE MD   .  80 . HD1* 1 1 
        927 1 2 1 1 130 PHE H    . 130 . HN   1 1 
        928 1 1 1 1  87 THR H    .  87 . HN   1 1 
        928 1 2 1 1  90 LEU MD1  .  90 . HD1* 1 1 
        929 1 1 1 1  90 LEU MD1  .  90 . HD1* 1 1 
        929 1 2 1 1 130 PHE H    . 130 . HN   1 1 
        930 1 1 1 1  74 LYS H    .  74 . HN   1 1 
        930 1 2 1 1  76 ALA H    .  76 . HN   1 1 
        931 1 1 1 1  72 MET HA   .  72 . HA   1 1 
        931 1 2 1 1  74 LYS H    .  74 . HN   1 1 
        932 1 1 1 1  70 ILE MG   .  70 . HG2* 1 1 
        932 1 2 1 1  74 LYS H    .  74 . HN   1 1 
        933 1 1 1 1 129 PHE H    . 129 . HN   1 1 
        933 1 2 1 1 131 ASN H    . 131 . HN   1 1 
        934 1 1 1 1 128 GLU HA   . 128 . HA   1 1 
        934 1 2 1 1 131 ASN H    . 131 . HN   1 1 
        935 1 1 1 1 127 ARG HA   . 127 . HA   1 1 
        935 1 2 1 1 131 ASN H    . 131 . HN   1 1 
        936 1 1 1 1 131 ASN H    . 131 . HN   1 1 
        936 1 2 1 1 131 ASN HB2  . 131 . HB2  1 1 
        937 1 1 1 1 131 ASN H    . 131 . HN   1 1 
        937 1 2 1 1 131 ASN HB3  . 131 . HB1  1 1 
        938 1 1 1 1 131 ASN H    . 131 . HN   1 1 
        938 1 2 1 1 132 ALA MB   . 132 . HB*  1 1 
        939 1 1 1 1 131 ASN H    . 131 . HN   1 1 
        939 1 2 1 1 134 ILE MG   . 134 . HG2* 1 1 
        940 1 1 1 1  69 TYR H    .  69 . HN   1 1 
        940 1 2 1 1  70 ILE MD   .  70 . HD1* 1 1 
        941 1 1 1 1 119 LEU HA   . 119 . HA   1 1 
        941 1 2 1 1 122 ALA H    . 122 . HN   1 1 
        942 1 1 1 1 121 VAL HB   . 121 . HB   1 1 
        942 1 2 1 1 122 ALA H    . 122 . HN   1 1 
        943 1 1 1 1 122 ALA H    . 122 . HN   1 1 
        943 1 2 1 1 125 THR MG   . 125 . HG2* 1 1 
        944 1 1 1 1 122 ALA H    . 122 . HN   1 1 
        944 1 2 1 1 122 ALA MB   . 122 . HB*  1 1 
        945 1 1 1 1 121 VAL MG1  . 121 . HG1* 1 1 
        945 1 2 1 1 122 ALA H    . 122 . HN   1 1 
        946 1 1 1 1 123 GLN H    . 123 . HN   1 1 
        946 1 2 1 1 125 THR MG   . 125 . HG2* 1 1 
        947 1 1 1 1 121 VAL MG1  . 121 . HG1* 1 1 
        947 1 2 1 1 123 GLN H    . 123 . HN   1 1 
        948 1 1 1 1 123 GLN H    . 123 . HN   1 1 
        948 1 2 1 1 124 ILE MD   . 124 . HD1* 1 1 
        949 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
        949 1 2 1 1 123 GLN H    . 123 . HN   1 1 
        950 1 1 1 1  76 ALA H    .  76 . HN   1 1 
        950 1 2 1 1  78 GLN H    .  78 . HN   1 1 
        951 1 1 1 1  74 LYS HA   .  74 . HA   1 1 
        951 1 2 1 1  76 ALA H    .  76 . HN   1 1 
        952 1 1 1 1  76 ALA H    .  76 . HN   1 1 
        952 1 2 1 1  76 ALA MB   .  76 . HB*  1 1 
        953 1 1 1 1  76 ALA H    .  76 . HN   1 1 
        953 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
        954 1 1 1 1 125 THR MG   . 125 . HG2* 1 1 
        954 1 2 1 1 128 GLU H    . 128 . HN   1 1 
        955 1 1 1 1 124 ILE MG   . 124 . HG2* 1 1 
        955 1 2 1 1 128 GLU H    . 128 . HN   1 1 
        956 1 1 1 1 128 GLU H    . 128 . HN   1 1 
        956 1 2 1 1 147 ILE MG   . 147 . HG2* 1 1 
        957 1 1 1 1  75 TYR H    .  75 . HN   1 1 
        957 1 2 1 1  76 ALA MB   .  76 . HB*  1 1 
        958 1 1 1 1 132 ALA MB   . 132 . HB*  1 1 
        958 1 2 1 1 134 ILE H    . 134 . HN   1 1 
        959 1 1 1 1  76 ALA MB   .  76 . HB*  1 1 
        959 1 2 1 1 129 PHE H    . 129 . HN   1 1 
        960 1 1 1 1 126 LEU MD1  . 126 . HD1* 1 1 
        960 1 2 1 1 129 PHE H    . 129 . HN   1 1 
        961 1 1 1 1 129 PHE H    . 129 . HN   1 1 
        961 1 2 1 1 147 ILE MG   . 147 . HG2* 1 1 
        962 1 1 1 1 129 PHE H    . 129 . HN   1 1 
        962 1 2 1 1 147 ILE MD   . 147 . HD1* 1 1 
        963 1 1 1 1 124 ILE H    . 124 . HN   1 1 
        963 1 2 1 1 124 ILE HB   . 124 . HB   1 1 
        964 1 1 1 1  76 ALA MB   .  76 . HB*  1 1 
        964 1 2 1 1  77 ARG H    .  77 . HN   1 1 
        965 1 1 1 1  77 ARG H    .  77 . HN   1 1 
        965 1 2 1 1 133 ILE MD   . 133 . HD1* 1 1 
        966 1 1 1 1  77 ARG H    .  77 . HN   1 1 
        966 1 2 1 1 133 ILE MG   . 133 . HG2* 1 1 
        967 1 1 1 1  72 MET H    .  72 . HN   1 1 
        967 1 2 1 1  72 MET ME   .  72 . HE*  1 1 
        968 1 1 1 1 125 THR MG   . 125 . HG2* 1 1 
        968 1 2 1 1 127 ARG H    . 127 . HN   1 1 
        969 1 1 1 1 126 LEU MD1  . 126 . HD1* 1 1 
        969 1 2 1 1 127 ARG H    . 127 . HN   1 1 
        970 1 1 1 1 126 LEU MD2  . 126 . HD2* 1 1 
        970 1 2 1 1 127 ARG H    . 127 . HN   1 1 
        971 1 1 1 1  70 ILE MG   .  70 . HG2* 1 1 
        971 1 2 1 1  71 GLN H    .  71 . HN   1 1 
        972 1 1 1 1 153 LYS H    . 153 . HN   1 1 
        972 1 2 1 1 154 LEU MD1  . 154 . HD1* 1 1 
        973 1 1 1 1 153 LYS H    . 153 . HN   1 1 
        973 1 2 1 1 154 LEU MD2  . 154 . HD2* 1 1 
        974 1 1 1 1 130 PHE H    . 130 . HN   1 1 
        974 1 2 1 1 130 PHE HB3  . 130 . HB1  1 1 
        975 1 1 1 1 132 ALA H    . 132 . HN   1 1 
        975 1 2 1 1 132 ALA MB   . 132 . HB*  1 1 
        976 1 1 1 1 132 ALA H    . 132 . HN   1 1 
        976 1 2 1 1 133 ILE MD   . 133 . HD1* 1 1 
        977 1 1 1 1 132 ALA H    . 132 . HN   1 1 
        977 1 2 1 1 134 ILE MG   . 134 . HG2* 1 1 
        978 1 1 1 1 132 ALA H    . 132 . HN   1 1 
        978 1 2 1 1 147 ILE MD   . 147 . HD1* 1 1 
        979 1 1 1 1 132 ALA MB   . 132 . HB*  1 1 
        979 1 2 1 1 133 ILE H    . 133 . HN   1 1 
        980 1 1 1 1 133 ILE H    . 133 . HN   1 1 
        980 1 2 1 1 133 ILE HB   . 133 . HB   1 1 
        981 1 1 1 1 133 ILE H    . 133 . HN   1 1 
        981 1 2 1 1 133 ILE MG   . 133 . HG2* 1 1 
        982 1 1 1 1 133 ILE H    . 133 . HN   1 1 
        982 1 2 1 1 134 ILE MG   . 134 . HG2* 1 1 
        983 1 1 1 1 132 ALA H    . 132 . HN   1 1 
        983 1 2 1 1 134 ILE H    . 134 . HN   1 1 
        984 1 1 1 1 134 ILE H    . 134 . HN   1 1 
        984 1 2 1 1 135 ALA MB   . 135 . HB*  1 1 
        985 1 1 1 1 134 ILE H    . 134 . HN   1 1 
        985 1 2 1 1 134 ILE HB   . 134 . HB   1 1 
        986 1 1 1 1 133 ILE MD   . 133 . HD1* 1 1 
        986 1 2 1 1 134 ILE H    . 134 . HN   1 1 
        987 1 1 1 1  80 ILE MG   .  80 . HG2* 1 1 
        987 1 2 1 1 134 ILE H    . 134 . HN   1 1 
        988 1 1 1 1 134 ILE H    . 134 . HN   1 1 
        988 1 2 1 1 134 ILE MG   . 134 . HG2* 1 1 
        989 1 1 1 1  59 LYS H    .  59 . HN   1 1 
        989 1 2 1 1  62 SER H    .  62 . HN   1 1 
        990 1 1 1 1  60 TRP HA   .  60 . HA   1 1 
        990 1 2 1 1  62 SER H    .  62 . HN   1 1 
        991 1 1 1 1  60 TRP H    .  60 . HN   1 1 
        991 1 2 1 1  63 ASN H    .  63 . HN   1 1 
        992 1 1 1 1  63 ASN H    .  63 . HN   1 1 
        992 1 2 1 1  66 GLU H    .  66 . HN   1 1 
        993 1 1 1 1 112 PHE HA   . 112 . HA   1 1 
        993 1 2 1 1 114 VAL H    . 114 . HN   1 1 
        994 1 1 1 1 112 PHE HA   . 112 . HA   1 1 
        994 1 2 1 1 113 GLU H    . 113 . HN   1 1 
        995 1 1 1 1 101 ALA MB   . 101 . HB*  1 1 
        995 1 2 1 1 105 HIS H    . 105 . HN   1 1 
        996 1 1 1 1  75 TYR HA   .  75 . HA   1 1 
        996 1 2 1 1  75 TYR HD1  .  75 . HD1  1 1 
        997 1 1 1 1  99 TYR H    .  99 . HN   1 1 
        997 1 2 1 1  99 TYR HE1  .  99 . HE1  1 1 
        998 1 1 1 1  22 LEU MD1  .  22 . HD1* 1 1 
        998 1 2 1 1  60 TRP HZ2  .  60 . HZ2  1 1 
        999 1 1 1 1 143 TRP H    . 143 . HN   1 1 
        999 1 2 1 1 143 TRP HD1  . 143 . HD1  1 1 
       1000 1 1 1 1  60 TRP H    .  60 . HN   1 1 
       1000 1 2 1 1  60 TRP HD1  .  60 . HD1  1 1 
       1001 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
       1001 1 2 1 1  60 TRP HZ2  .  60 . HZ2  1 1 
       1002 1 1 1 1  22 LEU MD2  .  22 . HD2* 1 1 
       1002 1 2 1 1  60 TRP HZ2  .  60 . HZ2  1 1 
       1003 1 1 1 1  99 TYR H    .  99 . HN   1 1 
       1003 1 2 1 1  99 TYR HD1  .  99 . HD1  1 1 
       1004 1 1 1 1  99 TYR HD1  .  99 . HD1  1 1 
       1004 1 2 1 1 100 ARG H    . 100 . HN   1 1 
       1005 1 1 1 1  99 TYR HD2  .  99 . HD2  1 1 
       1005 1 2 1 1 100 ARG H    . 100 . HN   1 1 
       1006 1 1 1 1  99 TYR HD1  .  99 . HD1  1 1 
       1006 1 2 1 1 119 LEU MD1  . 119 . HD1* 1 1 
       1007 1 1 1 1  99 TYR HD1  .  99 . HD1  1 1 
       1007 1 2 1 1 119 LEU MD2  . 119 . HD2* 1 1 
       1008 1 1 1 1  99 TYR HD1  .  99 . HD1  1 1 
       1008 1 2 1 1 102 LEU QD   . 102 . HD1* 1 1 
       1009 1 1 1 1 129 PHE QD   . 129 . HD2  1 1 
       1009 1 2 1 1 143 TRP HH2  . 143 . HH2  1 1 
       1010 1 1 1 1 148 TYR HA   . 148 . HA   1 1 
       1010 1 2 1 1 148 TYR HD1  . 148 . HD2  1 1 
       1011 1 1 1 1 145 LYS HA   . 145 . HA   1 1 
       1011 1 2 1 1 148 TYR HD2  . 148 . HD1  1 1 
       1012 1 1 1 1 147 ILE HB   . 147 . HB   1 1 
       1012 1 2 1 1 148 TYR HD1  . 148 . HD2  1 1 
       1013 1 1 1 1 148 TYR HA   . 148 . HA   1 1 
       1013 1 2 1 1 148 TYR HE1  . 148 . HE2  1 1 
       1014 1 1 1 1 145 LYS HA   . 145 . HA   1 1 
       1014 1 2 1 1 148 TYR HE2  . 148 . HE1  1 1 
       1015 1 1 1 1 147 ILE HB   . 147 . HB   1 1 
       1015 1 2 1 1 148 TYR HE1  . 148 . HE2  1 1 
       1016 1 1 1 1 102 LEU QD   . 102 . HD2* 1 1 
       1016 1 2 1 1 106 TYR QE   . 106 . HE2  1 1 
       1017 1 1 1 1  98 LEU QD   .  98 . HD1* 1 1 
       1017 1 2 1 1 106 TYR QE   . 106 . HE2  1 1 
       1018 1 1 1 1 106 TYR H    . 106 . HN   1 1 
       1018 1 2 1 1 106 TYR QD   . 106 . HD1  1 1 
       1019 1 1 1 1  68 TYR H    .  68 . HN   1 1 
       1019 1 2 1 1 106 TYR QD   . 106 . HD1  1 1 
       1020 1 1 1 1 132 ALA MB   . 132 . HB*  1 1 
       1020 1 2 1 1 143 TRP HZ3  . 143 . HZ3  1 1 
       1021 1 1 1 1 133 ILE MD   . 133 . HD1* 1 1 
       1021 1 2 1 1 143 TRP HH2  . 143 . HH2  1 1 
       1022 1 1 1 1  44 PHE H    .  44 . HN   1 1 
       1022 1 2 1 1  44 PHE HD2  .  44 . HD1  1 1 
       1023 1 1 1 1  43 TYR HE2  .  43 . HE1  1 1 
       1023 1 2 1 1 158 VAL HB   . 158 . HB   1 1 
       1024 1 1 1 1  32 THR MG   .  32 . HG2* 1 1 
       1024 1 2 1 1  43 TYR HE2  .  43 . HE1  1 1 
       1025 1 1 1 1  43 TYR HE2  .  43 . HE1  1 1 
       1025 1 2 1 1 158 VAL MG2  . 158 . HG2* 1 1 
       1026 1 1 1 1  43 TYR HE2  .  43 . HE1  1 1 
       1026 1 2 1 1 158 VAL MG1  . 158 . HG1* 1 1 
       1027 1 1 1 1  32 THR HB   .  32 . HB   1 1 
       1027 1 2 1 1  43 TYR HE2  .  43 . HE1  1 1 
       1028 1 1 1 1  43 TYR HE2  .  43 . HE1  1 1 
       1028 1 2 1 1 157 GLU HA   . 157 . HA   1 1 
       1029 1 1 1 1  43 TYR HA   .  43 . HA   1 1 
       1029 1 2 1 1  43 TYR HD1  .  43 . HD2  1 1 
       1030 1 1 1 1  47 VAL MG2  .  47 . HG2* 1 1 
       1030 1 2 1 1  49 PHE HZ   .  49 . HZ   1 1 
       1031 1 1 1 1  47 VAL MG1  .  47 . HG1* 1 1 
       1031 1 2 1 1  49 PHE HZ   .  49 . HZ   1 1 
       1032 1 1 1 1  21 HIS HE1  .  21 . HE1  1 1 
       1032 1 2 1 1  44 PHE HE1  .  44 . HE2  1 1 
       1033 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
       1033 1 2 1 1  21 HIS HE1  .  21 . HE1  1 1 
       1034 1 1 1 1  75 TYR H    .  75 . HN   1 1 
       1034 1 2 1 1  75 TYR HD1  .  75 . HD1  1 1 
       1035 1 1 1 1  75 TYR HD2  .  75 . HD2  1 1 
       1035 1 2 1 1 126 LEU MD2  . 126 . HD2* 1 1 
       1036 1 1 1 1 141 PRO HA   . 141 . HA   1 1 
       1036 1 2 1 1 143 TRP HD1  . 143 . HD1  1 1 
       1037 1 1 1 1 143 TRP HA   . 143 . HA   1 1 
       1037 1 2 1 1 143 TRP HD1  . 143 . HD1  1 1 
       1038 1 1 1 1 133 ILE MD   . 133 . HD1* 1 1 
       1038 1 2 1 1 143 TRP HZ2  . 143 . HZ2  1 1 
       1039 1 1 1 1  95 ASP HA   .  95 . HA   1 1 
       1039 1 2 1 1  99 TYR HD1  .  99 . HD1  1 1 
       1040 1 1 1 1  75 TYR HD2  .  75 . HD2  1 1 
       1040 1 2 1 1  91 SER HB2  .  91 . HB2  1 1 
       1041 1 1 1 1  75 TYR HD2  .  75 . HD2  1 1 
       1041 1 2 1 1  91 SER HB3  .  91 . HB1  1 1 
       1042 1 1 1 1  75 TYR HD2  .  75 . HD2  1 1 
       1042 1 2 1 1 102 LEU QD   . 102 . HD2* 1 1 
       1043 1 1 1 1  44 PHE HD2  .  44 . HD1  1 1 
       1043 1 2 1 1  49 PHE HE1  .  49 . HE1  1 1 
       1044 1 1 1 1  44 PHE HD2  .  44 . HD1  1 1 
       1044 1 2 1 1  49 PHE HZ   .  49 . HZ   1 1 
       1045 1 1 1 1  44 PHE HA   .  44 . HA   1 1 
       1045 1 2 1 1  44 PHE HD1  .  44 . HD2  1 1 
       1046 1 1 1 1  40 LEU HA   .  40 . HA   1 1 
       1046 1 2 1 1  44 PHE HD2  .  44 . HD1  1 1 
       1047 1 1 1 1  44 PHE HD2  .  44 . HD1  1 1 
       1047 1 2 1 1  47 VAL HB   .  47 . HB   1 1 
       1048 1 1 1 1  44 PHE HD1  .  44 . HD2  1 1 
       1048 1 2 1 1  47 VAL HB   .  47 . HB   1 1 
       1049 1 1 1 1  39 MET ME   .  39 . HE*  1 1 
       1049 1 2 1 1  44 PHE HD2  .  44 . HD1  1 1 
       1050 1 1 1 1  28 MET ME   .  28 . HE*  1 1 
       1050 1 2 1 1  44 PHE HD1  .  44 . HD2  1 1 
       1051 1 1 1 1  44 PHE HD2  .  44 . HD1  1 1 
       1051 1 2 1 1  47 VAL MG2  .  47 . HG2* 1 1 
       1052 1 1 1 1  44 PHE HD1  .  44 . HD2  1 1 
       1052 1 2 1 1  47 VAL MG2  .  47 . HG2* 1 1 
       1053 1 1 1 1  44 PHE HD2  .  44 . HD1  1 1 
       1053 1 2 1 1  57 LEU MD2  .  57 . HD2* 1 1 
       1054 1 1 1 1  44 PHE HD2  .  44 . HD1  1 1 
       1054 1 2 1 1  47 VAL MG1  .  47 . HG1* 1 1 
       1055 1 1 1 1 129 PHE HA   . 129 . HA   1 1 
       1055 1 2 1 1 129 PHE QE   . 129 . HE2  1 1 
       1056 1 1 1 1 126 LEU MD1  . 126 . HD1* 1 1 
       1056 1 2 1 1 129 PHE QE   . 129 . HE1  1 1 
       1057 1 1 1 1  40 LEU HA   .  40 . HA   1 1 
       1057 1 2 1 1  44 PHE HE2  .  44 . HE1  1 1 
       1058 1 1 1 1  44 PHE HE2  .  44 . HE1  1 1 
       1058 1 2 1 1  47 VAL MG2  .  47 . HG2* 1 1 
       1059 1 1 1 1  44 PHE HE1  .  44 . HE2  1 1 
       1059 1 2 1 1  47 VAL MG2  .  47 . HG2* 1 1 
       1060 1 1 1 1  48 LYS HA   .  48 . HA   1 1 
       1060 1 2 1 1  49 PHE HD2  .  49 . HD2  1 1 
       1061 1 1 1 1  49 PHE HA   .  49 . HA   1 1 
       1061 1 2 1 1  49 PHE HD1  .  49 . HD1  1 1 
       1062 1 1 1 1  47 VAL HB   .  47 . HB   1 1 
       1062 1 2 1 1  49 PHE HD1  .  49 . HD1  1 1 
       1063 1 1 1 1  47 VAL HB   .  47 . HB   1 1 
       1063 1 2 1 1  49 PHE HD2  .  49 . HD2  1 1 
       1064 1 1 1 1  45 SER HA   .  45 . HA   1 1 
       1064 1 2 1 1  49 PHE HE2  .  49 . HE2  1 1 
       1065 1 1 1 1  48 LYS HA   .  48 . HA   1 1 
       1065 1 2 1 1  49 PHE HE2  .  49 . HE2  1 1 
       1066 1 1 1 1  41 LYS HA   .  41 . HA   1 1 
       1066 1 2 1 1  49 PHE HE2  .  49 . HE2  1 1 
       1067 1 1 1 1  47 VAL MG2  .  47 . HG2* 1 1 
       1067 1 2 1 1  49 PHE HE1  .  49 . HE1  1 1 
       1068 1 1 1 1  47 VAL MG1  .  47 . HG1* 1 1 
       1068 1 2 1 1  49 PHE HE1  .  49 . HE1  1 1 
       1069 1 1 1 1 129 PHE HA   . 129 . HA   1 1 
       1069 1 2 1 1 129 PHE QD   . 129 . HD2  1 1 
       1070 1 1 1 1 125 THR MG   . 125 . HG2* 1 1 
       1070 1 2 1 1 129 PHE QD   . 129 . HD1  1 1 
       1071 1 1 1 1 129 PHE QD   . 129 . HD2  1 1 
       1071 1 2 1 1 133 ILE MD   . 133 . HD1* 1 1 
       1072 1 1 1 1 129 PHE QD   . 129 . HD1  1 1 
       1072 1 2 1 1 147 ILE MG   . 147 . HG2* 1 1 
       1073 1 1 1 1  42 THR H    .  42 . HN   1 1 
       1073 1 2 1 1  43 TYR HD1  .  43 . HD2  1 1 
       1074 1 1 1 1  68 TYR H    .  68 . HN   1 1 
       1074 1 2 1 1 106 TYR QE   . 106 . HE1  1 1 
       1075 1 1 1 1  99 TYR HE1  .  99 . HE1  1 1 
       1075 1 2 1 1 119 LEU HG   . 119 . HG   1 1 
       1076 1 1 1 1  99 TYR HE1  .  99 . HE1  1 1 
       1076 1 2 1 1 119 LEU MD1  . 119 . HD1* 1 1 
       1077 1 1 1 1  99 TYR HE1  .  99 . HE1  1 1 
       1077 1 2 1 1 119 LEU MD2  . 119 . HD2* 1 1 
       1078 1 1 1 1 129 PHE QE   . 129 . HE2  1 1 
       1078 1 2 1 1 143 TRP HZ3  . 143 . HZ3  1 1 
       1079 1 1 1 1  75 TYR H    .  75 . HN   1 1 
       1079 1 2 1 1  75 TYR HE1  .  75 . HE1  1 1 
       1080 1 1 1 1  75 TYR HA   .  75 . HA   1 1 
       1080 1 2 1 1  75 TYR HE1  .  75 . HE1  1 1 
       1081 1 1 1 1  72 MET ME   .  72 . HE*  1 1 
       1081 1 2 1 1  75 TYR HE2  .  75 . HE2  1 1 
       1082 1 1 1 1  75 TYR HE2  .  75 . HE2  1 1 
       1082 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
       1083 1 1 1 1  47 VAL H    .  47 . HN   1 1 
       1083 1 2 1 1  49 PHE HZ   .  49 . HZ   1 1 
       1084 1 1 1 1  41 LYS HA   .  41 . HA   1 1 
       1084 1 2 1 1  49 PHE HZ   .  49 . HZ   1 1 
       1085 1 1 1 1  44 PHE HB2  .  44 . HB2  1 1 
       1085 1 2 1 1  49 PHE HZ   .  49 . HZ   1 1 
       1086 1 1 1 1  44 PHE HB3  .  44 . HB1  1 1 
       1086 1 2 1 1  49 PHE HZ   .  49 . HZ   1 1 
       1087 1 1 1 1  47 VAL HB   .  47 . HB   1 1 
       1087 1 2 1 1  49 PHE HZ   .  49 . HZ   1 1 
       1088 1 1 1 1  49 PHE HE1  .  49 . HE1  1 1 
       1088 1 2 1 1  57 LEU MD2  .  57 . HD2* 1 1 
       1089 1 1 1 1  21 HIS HE1  .  21 . HE1  1 1 
       1089 1 2 1 1  44 PHE HA   .  44 . HA   1 1 
       1090 1 1 1 1  21 HIS HE1  .  21 . HE1  1 1 
       1090 1 2 1 1  47 VAL HB   .  47 . HB   1 1 
       1091 1 1 1 1  75 TYR HD2  .  75 . HD2  1 1 
       1091 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
       1092 1 1 1 1 129 PHE QD   . 129 . HD2  1 1 
       1092 1 2 1 1 143 TRP HE3  . 143 . HE3  1 1 
       1093 1 1 1 1  25 ALA MB   .  25 . HB*  1 1 
       1093 1 2 1 1  60 TRP HE3  .  60 . HE3  1 1 
       1094 1 1 1 1  80 ILE MD   .  80 . HD1* 1 1 
       1094 1 2 1 1 134 ILE MD   . 134 . HD1* 1 1 
       1095 1 1 1 1  17 LEU MD1  .  17 . HD1* 1 1 
       1095 1 2 1 1  47 VAL MG2  .  47 . HG2* 1 1 
       1096 1 1 1 1  47 VAL MG2  .  47 . HG2* 1 1 
       1096 1 2 1 1  57 LEU MD2  .  57 . HD2* 1 1 
       1097 1 1 1 1 114 VAL MG1  . 114 . HG1* 1 1 
       1097 1 2 1 1 119 LEU MD1  . 119 . HD1* 1 1 
       1098 1 1 1 1 121 VAL MG1  . 121 . HG1* 1 1 
       1098 1 2 1 1 154 LEU MD2  . 154 . HD2* 1 1 
       1099 1 1 1 1 150 VAL MG1  . 150 . HG1* 1 1 
       1099 1 2 1 1 154 LEU MD2  . 154 . HD2* 1 1 
       1100 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
       1100 1 2 1 1  98 LEU QD   .  98 . HD1* 1 1 
       1101 1 1 1 1 114 VAL MG1  . 114 . HG1* 1 1 
       1101 1 2 1 1 119 LEU MD2  . 119 . HD2* 1 1 
       1102 1 1 1 1 168 LEU MD1  . 168 . HD1* 1 1 
       1102 1 2 1 1 172 LEU MD2  . 172 . HD2* 1 1 
       1103 1 1 1 1  98 LEU QD   .  98 . HD2* 1 1 
       1103 1 2 1 1 126 LEU MD2  . 126 . HD2* 1 1 
       1104 1 1 1 1  17 LEU MD1  .  17 . HD1* 1 1 
       1104 1 2 1 1  47 VAL MG1  .  47 . HG1* 1 1 
       1105 1 1 1 1  40 LEU MD1  .  40 . HD1* 1 1 
       1105 1 2 1 1  58 ILE MD   .  58 . HD1* 1 1 
       1106 1 1 1 1 151 ILE MD   . 151 . HD1* 1 1 
       1106 1 2 1 1 154 LEU MD1  . 154 . HD1* 1 1 
       1107 1 1 1 1  40 LEU MD2  .  40 . HD2* 1 1 
       1107 1 2 1 1  58 ILE MD   .  58 . HD1* 1 1 
       1108 1 1 1 1 168 LEU MD2  . 168 . HD2* 1 1 
       1108 1 2 1 1 172 LEU MD2  . 172 . HD2* 1 1 
       1109 1 1 1 1  90 LEU MD2  .  90 . HD2* 1 1 
       1109 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
       1110 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
       1110 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
       1111 1 1 1 1 150 VAL MG2  . 150 . HG2* 1 1 
       1111 1 2 1 1 154 LEU MD1  . 154 . HD1* 1 1 
       1112 1 1 1 1 147 ILE MD   . 147 . HD1* 1 1 
       1112 1 2 1 1 150 VAL MG1  . 150 . HG1* 1 1 
       1113 1 1 1 1 150 VAL MG1  . 150 . HG1* 1 1 
       1113 1 2 1 1 151 ILE MD   . 151 . HD1* 1 1 
       1114 1 1 1 1 161 ILE MD   . 161 . HD1* 1 1 
       1114 1 2 1 1 168 LEU MD2  . 168 . HD2* 1 1 
       1115 1 1 1 1 150 VAL MG1  . 150 . HG1* 1 1 
       1115 1 2 1 1 154 LEU MD1  . 154 . HD1* 1 1 
       1116 1 1 1 1  98 LEU QD   .  98 . HD2* 1 1 
       1116 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
       1117 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
       1117 1 2 1 1  57 LEU MD2  .  57 . HD2* 1 1 
       1118 1 1 1 1  47 VAL MG2  .  47 . HG2* 1 1 
       1118 1 2 1 1  57 LEU MD1  .  57 . HD1* 1 1 
       1119 1 1 1 1 121 VAL MG1  . 121 . HG1* 1 1 
       1119 1 2 1 1 151 ILE MD   . 151 . HD1* 1 1 
       1120 1 1 1 1  40 LEU MD1  .  40 . HD1* 1 1 
       1120 1 2 1 1  57 LEU MD1  .  57 . HD1* 1 1 
       1121 1 1 1 1 168 LEU MD2  . 168 . HD2* 1 1 
       1121 1 2 1 1 172 LEU MD1  . 172 . HD1* 1 1 
       1122 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
       1122 1 2 1 1 119 LEU MD1  . 119 . HD1* 1 1 
       1123 1 1 1 1  17 LEU MD1  .  17 . HD1* 1 1 
       1123 1 2 1 1  53 ILE MD   .  53 . HD1* 1 1 
       1124 1 1 1 1  40 LEU MD2  .  40 . HD2* 1 1 
       1124 1 2 1 1  57 LEU MD2  .  57 . HD2* 1 1 
       1125 1 1 1 1  40 LEU MD1  .  40 . HD1* 1 1 
       1125 1 2 1 1  57 LEU MD2  .  57 . HD2* 1 1 
       1126 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
       1126 1 2 1 1  57 LEU MD1  .  57 . HD1* 1 1 
       1127 1 1 1 1  17 LEU MD1  .  17 . HD1* 1 1 
       1127 1 2 1 1  57 LEU MD1  .  57 . HD1* 1 1 
       1128 1 1 1 1 121 VAL MG2  . 121 . HG2* 1 1 
       1128 1 2 1 1 154 LEU MD1  . 154 . HD1* 1 1 
       1129 1 1 1 1 124 ILE MD   . 124 . HD1* 1 1 
       1129 1 2 1 1 154 LEU MD1  . 154 . HD1* 1 1 
       1130 1 1 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       1130 1 2 1 1  90 LEU MD1  .  90 . HD1* 1 1 
       1131 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       1131 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
       1132 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
       1132 1 2 1 1  47 VAL MG2  .  47 . HG2* 1 1 
       1133 1 1 1 1 102 LEU QD   . 102 . HD1* 1 1 
       1133 1 2 1 1 114 VAL MG1  . 114 . HG1* 1 1 
       1134 1 1 1 1  90 LEU MD1  .  90 . HD1* 1 1 
       1134 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
       1135 1 1 1 1  90 LEU MD1  .  90 . HD1* 1 1 
       1135 1 2 1 1 126 LEU MD2  . 126 . HD2* 1 1 
       1136 1 1 1 1  90 LEU MD2  .  90 . HD2* 1 1 
       1136 1 2 1 1 126 LEU MD2  . 126 . HD2* 1 1 
       1137 1 1 1 1 168 LEU MD2  . 168 . HD2* 1 1 
       1137 1 2 1 1 171 LEU MD2  . 171 . HD2* 1 1 
       1138 1 1 1 1 168 LEU MD1  . 168 . HD1* 1 1 
       1138 1 2 1 1 171 LEU MD1  . 171 . HD1* 1 1 
       1139 1 1 1 1 150 VAL MG2  . 150 . HG2* 1 1 
       1139 1 2 1 1 151 ILE MD   . 151 . HD1* 1 1 
       1140 1 1 1 1  53 ILE MD   .  53 . HD1* 1 1 
       1140 1 2 1 1  57 LEU MD1  .  57 . HD1* 1 1 
       1141 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
       1141 1 2 1 1  53 ILE MD   .  53 . HD1* 1 1 
       1142 1 1 1 1  47 VAL MG1  .  47 . HG1* 1 1 
       1142 1 2 1 1  53 ILE MD   .  53 . HD1* 1 1 
       1143 1 1 1 1  80 ILE MD   .  80 . HD1* 1 1 
       1143 1 2 1 1  90 LEU MD1  .  90 . HD1* 1 1 
       1144 1 1 1 1  90 LEU MD1  .  90 . HD1* 1 1 
       1144 1 2 1 1  92 ILE MD   .  92 . HD1* 1 1 
       1145 1 1 1 1 161 ILE MD   . 161 . HD1* 1 1 
       1145 1 2 1 1 168 LEU MD1  . 168 . HD1* 1 1 
       1146 1 1 1 1  17 LEU MD2  .  17 . HD2* 1 1 
       1146 1 2 1 1  47 VAL MG1  .  47 . HG1* 1 1 
       1147 1 1 1 1  40 LEU MD2  .  40 . HD2* 1 1 
       1147 1 2 1 1  57 LEU MD1  .  57 . HD1* 1 1 
       1148 1 1 1 1 102 LEU QD   . 102 . HD2* 1 1 
       1148 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
       1149 1 1 1 1  92 ILE MD   .  92 . HD1* 1 1 
       1149 1 2 1 1 126 LEU MD2  . 126 . HD2* 1 1 
       1150 1 1 1 1 121 VAL MG2  . 121 . HG2* 1 1 
       1150 1 2 1 1 154 LEU MD2  . 154 . HD2* 1 1 
       1151 1 1 1 1 121 VAL MG1  . 121 . HG1* 1 1 
       1151 1 2 1 1 154 LEU MD1  . 154 . HD1* 1 1 
       1152 1 1 1 1 114 VAL MG2  . 114 . HG2* 1 1 
       1152 1 2 1 1 119 LEU MD2  . 119 . HD2* 1 1 
       1153 1 1 1 1 168 LEU MD1  . 168 . HD1* 1 1 
       1153 1 2 1 1 171 LEU MD2  . 171 . HD2* 1 1 
       1154 1 1 1 1  14 GLN H    .  14 . HN   1 1 
       1154 1 2 1 1  14 GLN QB   .  14 . HB*  1 1 
       1155 1 1 1 1  14 GLN QB   .  14 . HB*  1 1 
       1155 1 2 1 1  15 GLU H    .  15 . HN   1 1 
       1156 1 1 1 1  17 LEU MD1  .  17 . HD1* 1 1 
       1156 1 2 1 1  53 ILE QG   .  53 . HG1* 1 1 
       1157 1 1 1 1  38 ASN QB   .  38 . HB*  1 1 
       1157 1 2 1 1  39 MET H    .  39 . HN   1 1 
       1158 1 1 1 1  40 LEU QD   .  40 . HD*  1 1 
       1158 1 2 1 1  47 VAL MG1  .  47 . HG1* 1 1 
       1159 1 1 1 1  40 LEU QD   .  40 . HD*  1 1 
       1159 1 2 1 1  57 LEU MD2  .  57 . HD2* 1 1 
       1160 1 1 1 1  40 LEU QD   .  40 . HD*  1 1 
       1160 1 2 1 1  58 ILE MD   .  58 . HD1* 1 1 
       1161 1 1 1 1  41 LYS H    .  41 . HN   1 1 
       1161 1 2 1 1  41 LYS QB   .  41 . HB*  1 1 
       1162 1 1 1 1  41 LYS QB   .  41 . HB*  1 1 
       1162 1 2 1 1  42 THR H    .  42 . HN   1 1 
       1163 1 1 1 1  41 LYS QB   .  41 . HB*  1 1 
       1163 1 2 1 1  49 PHE HZ   .  49 . HZ   1 1 
       1164 1 1 1 1  41 LYS QB   .  41 . HB*  1 1 
       1164 1 2 1 1  49 PHE HE2  .  49 . HE2  1 1 
       1165 1 1 1 1  43 TYR QB   .  43 . HB*  1 1 
       1165 1 2 1 1  43 TYR HE2  .  43 . HE1  1 1 
       1166 1 1 1 1  44 PHE H    .  44 . HN   1 1 
       1166 1 2 1 1  44 PHE QB   .  44 . HB*  1 1 
       1167 1 1 1 1  44 PHE QB   .  44 . HB*  1 1 
       1167 1 2 1 1  45 SER H    .  45 . HN   1 1 
       1168 1 1 1 1  44 PHE QB   .  44 . HB*  1 1 
       1168 1 2 1 1  47 VAL MG1  .  47 . HG1* 1 1 
       1169 1 1 1 1  44 PHE QB   .  44 . HB*  1 1 
       1169 1 2 1 1  47 VAL MG2  .  47 . HG2* 1 1 
       1170 1 1 1 1  44 PHE QB   .  44 . HB*  1 1 
       1170 1 2 1 1  49 PHE HZ   .  49 . HZ   1 1 
       1171 1 1 1 1  45 SER H    .  45 . HN   1 1 
       1171 1 2 1 1  45 SER QB   .  45 . HB*  1 1 
       1172 1 1 1 1  45 SER QB   .  45 . HB*  1 1 
       1172 1 2 1 1  46 ASP H    .  46 . HN   1 1 
       1173 1 1 1 1  46 ASP H    .  46 . HN   1 1 
       1173 1 2 1 1  46 ASP QB   .  46 . HB*  1 1 
       1174 1 1 1 1  46 ASP QB   .  46 . HB*  1 1 
       1174 1 2 1 1  47 VAL H    .  47 . HN   1 1 
       1175 1 1 1 1  46 ASP QB   .  46 . HB*  1 1 
       1175 1 2 1 1  47 VAL MG2  .  47 . HG2* 1 1 
       1176 1 1 1 1  47 VAL MG1  .  47 . HG1* 1 1 
       1176 1 2 1 1  53 ILE QG   .  53 . HG1* 1 1 
       1177 1 1 1 1  48 LYS H    .  48 . HN   1 1 
       1177 1 2 1 1  48 LYS QB   .  48 . HB*  1 1 
       1178 1 1 1 1  48 LYS QB   .  48 . HB*  1 1 
       1178 1 2 1 1  49 PHE H    .  49 . HN   1 1 
       1179 1 1 1 1  49 PHE H    .  49 . HN   1 1 
       1179 1 2 1 1  49 PHE QB   .  49 . HB*  1 1 
       1180 1 1 1 1  50 ASN H    .  50 . HN   1 1 
       1180 1 2 1 1  53 ILE QG   .  53 . HG1* 1 1 
       1181 1 1 1 1  72 MET ME   .  72 . HE*  1 1 
       1181 1 2 1 1  91 SER QB   .  91 . HB*  1 1 
       1182 1 1 1 1  74 LYS H    .  74 . HN   1 1 
       1182 1 2 1 1  74 LYS QB   .  74 . HB*  1 1 
       1183 1 1 1 1  74 LYS QB   .  74 . HB*  1 1 
       1183 1 2 1 1  75 TYR H    .  75 . HN   1 1 
       1184 1 1 1 1  74 LYS QB   .  74 . HB*  1 1 
       1184 1 2 1 1  75 TYR HD1  .  75 . HD1  1 1 
       1185 1 1 1 1  74 LYS QB   .  74 . HB*  1 1 
       1185 1 2 1 1  75 TYR HE1  .  75 . HE1  1 1 
       1186 1 1 1 1  75 TYR H    .  75 . HN   1 1 
       1186 1 2 1 1  75 TYR QB   .  75 . HB*  1 1 
       1187 1 1 1 1  75 TYR H    .  75 . HN   1 1 
       1187 1 2 1 1  78 GLN QB   .  78 . HB*  1 1 
       1188 1 1 1 1  75 TYR QB   .  75 . HB*  1 1 
       1188 1 2 1 1  75 TYR HE2  .  75 . HE2  1 1 
       1189 1 1 1 1  75 TYR QB   .  75 . HB*  1 1 
       1189 1 2 1 1  76 ALA H    .  76 . HN   1 1 
       1190 1 1 1 1  75 TYR QB   .  75 . HB*  1 1 
       1190 1 2 1 1  76 ALA MB   .  76 . HB*  1 1 
       1191 1 1 1 1  75 TYR QB   .  75 . HB*  1 1 
       1191 1 2 1 1  90 LEU MD1  .  90 . HD1* 1 1 
       1192 1 1 1 1  75 TYR QB   .  75 . HB*  1 1 
       1192 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
       1193 1 1 1 1  75 TYR QB   .  75 . HB*  1 1 
       1193 1 2 1 1 126 LEU MD2  . 126 . HD2* 1 1 
       1194 1 1 1 1  75 TYR HD1  .  75 . HD1  1 1 
       1194 1 2 1 1  78 GLN QB   .  78 . HB*  1 1 
       1195 1 1 1 1  75 TYR HE2  .  75 . HE2  1 1 
       1195 1 2 1 1  91 SER QB   .  91 . HB*  1 1 
       1196 1 1 1 1  75 TYR HD2  .  75 . HD2  1 1 
       1196 1 2 1 1  91 SER QB   .  91 . HB*  1 1 
       1197 1 1 1 1  76 ALA H    .  76 . HN   1 1 
       1197 1 2 1 1  78 GLN QB   .  78 . HB*  1 1 
       1198 1 1 1 1  78 GLN H    .  78 . HN   1 1 
       1198 1 2 1 1  78 GLN QB   .  78 . HB*  1 1 
       1199 1 1 1 1  78 GLN QB   .  78 . HB*  1 1 
       1199 1 2 1 1  79 ALA H    .  79 . HN   1 1 
       1200 1 1 1 1  80 ILE MG   .  80 . HG2* 1 1 
       1200 1 2 1 1  81 ASN QB   .  81 . HB*  1 1 
       1201 1 1 1 1  80 ILE MD   .  80 . HD1* 1 1 
       1201 1 2 1 1 130 PHE QB   . 130 . HB*  1 1 
       1202 1 1 1 1  81 ASN H    .  81 . HN   1 1 
       1202 1 2 1 1  81 ASN QB   .  81 . HB*  1 1 
       1203 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       1203 1 2 1 1  89 GLU QB   .  89 . HB*  1 1 
       1204 1 1 1 1  84 VAL MG1  .  84 . HG1* 1 1 
       1204 1 2 1 1  90 LEU QB   .  90 . HB*  1 1 
       1205 1 1 1 1  84 VAL MG2  .  84 . HG2* 1 1 
       1205 1 2 1 1  89 GLU QB   .  89 . HB*  1 1 
       1206 1 1 1 1  86 SER H    .  86 . HN   1 1 
       1206 1 2 1 1  86 SER QB   .  86 . HB*  1 1 
       1207 1 1 1 1  86 SER QB   .  86 . HB*  1 1 
       1207 1 2 1 1  89 GLU H    .  89 . HN   1 1 
       1208 1 1 1 1  86 SER QB   .  86 . HB*  1 1 
       1208 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
       1209 1 1 1 1  87 THR MG   .  87 . HG2* 1 1 
       1209 1 2 1 1 130 PHE QB   . 130 . HB*  1 1 
       1210 1 1 1 1  88 GLU H    .  88 . HN   1 1 
       1210 1 2 1 1  88 GLU QB   .  88 . HB*  1 1 
       1211 1 1 1 1  88 GLU QB   .  88 . HB*  1 1 
       1211 1 2 1 1  89 GLU H    .  89 . HN   1 1 
       1212 1 1 1 1  89 GLU H    .  89 . HN   1 1 
       1212 1 2 1 1  89 GLU QB   .  89 . HB*  1 1 
       1213 1 1 1 1  89 GLU QB   .  89 . HB*  1 1 
       1213 1 2 1 1  90 LEU H    .  90 . HN   1 1 
       1214 1 1 1 1  89 GLU QB   .  89 . HB*  1 1 
       1214 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
       1215 1 1 1 1  90 LEU QB   .  90 . HB*  1 1 
       1215 1 2 1 1  90 LEU MD1  .  90 . HD1* 1 1 
       1216 1 1 1 1  90 LEU QB   .  90 . HB*  1 1 
       1216 1 2 1 1  90 LEU MD2  .  90 . HD2* 1 1 
       1217 1 1 1 1  90 LEU QB   .  90 . HB*  1 1 
       1217 1 2 1 1  91 SER H    .  91 . HN   1 1 
       1218 1 1 1 1  90 LEU QB   .  90 . HB*  1 1 
       1218 1 2 1 1 126 LEU MD2  . 126 . HD2* 1 1 
       1219 1 1 1 1  91 SER QB   .  91 . HB*  1 1 
       1219 1 2 1 1  98 LEU QD   .  98 . HD1* 1 1 
       1220 1 1 1 1  91 SER QB   .  91 . HB*  1 1 
       1220 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
       1221 1 1 1 1  91 SER QB   .  91 . HB*  1 1 
       1221 1 2 1 1 126 LEU MD2  . 126 . HD2* 1 1 
       1222 1 1 1 1  95 ASP H    .  95 . HN   1 1 
       1222 1 2 1 1  95 ASP QB   .  95 . HB*  1 1 
       1223 1 1 1 1  98 LEU QD   .  98 . HD1* 1 1 
       1223 1 2 1 1 102 LEU QB   . 102 . HB*  1 1 
       1224 1 1 1 1 102 LEU H    . 102 . HN   1 1 
       1224 1 2 1 1 102 LEU QB   . 102 . HB*  1 1 
       1225 1 1 1 1 102 LEU QB   . 102 . HB*  1 1 
       1225 1 2 1 1 103 ASN H    . 103 . HN   1 1 
       1226 1 1 1 1 102 LEU QB   . 102 . HB*  1 1 
       1226 1 2 1 1 104 MET H    . 104 . HN   1 1 
       1227 1 1 1 1 102 LEU QB   . 102 . HB*  1 1 
       1227 1 2 1 1 106 TYR QD   . 106 . HD2  1 1 
       1228 1 1 1 1 105 HIS QB   . 105 . HB*  1 1 
       1228 1 2 1 1 106 TYR H    . 106 . HN   1 1 
       1229 1 1 1 1 108 LYS H    . 108 . HN   1 1 
       1229 1 2 1 1 108 LYS QB   . 108 . HB*  1 1 
       1230 1 1 1 1 108 LYS QB   . 108 . HB*  1 1 
       1230 1 2 1 1 109 ALA H    . 109 . HN   1 1 
       1231 1 1 1 1 108 LYS QB   . 108 . HB*  1 1 
       1231 1 2 1 1 110 ASN H    . 110 . HN   1 1 
       1232 1 1 1 1 109 ALA H    . 109 . HN   1 1 
       1232 1 2 1 1 110 ASN QB   . 110 . HB*  1 1 
       1233 1 1 1 1 110 ASN H    . 110 . HN   1 1 
       1233 1 2 1 1 110 ASN QB   . 110 . HB*  1 1 
       1234 1 1 1 1 110 ASN H    . 110 . HN   1 1 
       1234 1 2 1 1 111 ASP QB   . 111 . HB*  1 1 
       1235 1 1 1 1 110 ASN QB   . 110 . HB*  1 1 
       1235 1 2 1 1 111 ASP H    . 111 . HN   1 1 
       1236 1 1 1 1 111 ASP H    . 111 . HN   1 1 
       1236 1 2 1 1 111 ASP QB   . 111 . HB*  1 1 
       1237 1 1 1 1 111 ASP QB   . 111 . HB*  1 1 
       1237 1 2 1 1 112 PHE H    . 112 . HN   1 1 
       1238 1 1 1 1 112 PHE QB   . 112 . HB*  1 1 
       1238 1 2 1 1 113 GLU H    . 113 . HN   1 1 
       1239 1 1 1 1 113 GLU H    . 113 . HN   1 1 
       1239 1 2 1 1 113 GLU QB   . 113 . HB*  1 1 
       1240 1 1 1 1 114 VAL MG1  . 114 . HG1* 1 1 
       1240 1 2 1 1 118 PHE QB   . 118 . HB*  1 1 
       1241 1 1 1 1 118 PHE H    . 118 . HN   1 1 
       1241 1 2 1 1 118 PHE QB   . 118 . HB*  1 1 
       1242 1 1 1 1 118 PHE QB   . 118 . HB*  1 1 
       1242 1 2 1 1 119 LEU H    . 119 . HN   1 1 
       1243 1 1 1 1 118 PHE QB   . 118 . HB*  1 1 
       1243 1 2 1 1 119 LEU MD1  . 119 . HD1* 1 1 
       1244 1 1 1 1 118 PHE QB   . 118 . HB*  1 1 
       1244 1 2 1 1 119 LEU MD2  . 119 . HD2* 1 1 
       1245 1 1 1 1 124 ILE H    . 124 . HN   1 1 
       1245 1 2 1 1 124 ILE QG   . 124 . HG1* 1 1 
       1246 1 1 1 1 130 PHE H    . 130 . HN   1 1 
       1246 1 2 1 1 130 PHE QB   . 130 . HB*  1 1 
       1247 1 1 1 1 130 PHE QB   . 130 . HB*  1 1 
       1247 1 2 1 1 131 ASN H    . 131 . HN   1 1 
       1248 1 1 1 1 130 PHE QB   . 130 . HB*  1 1 
       1248 1 2 1 1 134 ILE MG   . 134 . HG2* 1 1 
       1249 1 1 1 1 131 ASN H    . 131 . HN   1 1 
       1249 1 2 1 1 131 ASN QB   . 131 . HB*  1 1 
       1250 1 1 1 1 131 ASN QB   . 131 . HB*  1 1 
       1250 1 2 1 1 132 ALA H    . 132 . HN   1 1 
       1251 1 1 1 1 131 ASN QB   . 131 . HB*  1 1 
       1251 1 2 1 1 134 ILE MD   . 134 . HD1* 1 1 
       1252 1 1 1 1 138 ASP H    . 138 . HN   1 1 
       1252 1 2 1 1 138 ASP QB   . 138 . HB*  1 1 
       1253 1 1 1 1 138 ASP QB   . 138 . HB*  1 1 
       1253 1 2 1 1 139 VAL H    . 139 . HN   1 1 
       1254 1 1 1 1 138 ASP QB   . 138 . HB*  1 1 
       1254 1 2 1 1 140 ASP H    . 140 . HN   1 1 
       1255 1 1 1 1 142 SER H    . 142 . HN   1 1 
       1255 1 2 1 1 142 SER QB   . 142 . HB*  1 1 
       1256 1 1 1 1 142 SER QB   . 142 . HB*  1 1 
       1256 1 2 1 1 143 TRP H    . 143 . HN   1 1 
       1257 1 1 1 1 145 LYS H    . 145 . HN   1 1 
       1257 1 2 1 1 145 LYS QB   . 145 . HB*  1 1 
       1258 1 1 1 1 145 LYS QB   . 145 . HB*  1 1 
       1258 1 2 1 1 146 ALA H    . 146 . HN   1 1 
       1259 1 1 1 1 145 LYS QB   . 145 . HB*  1 1 
       1259 1 2 1 1 148 TYR HD2  . 148 . HD1  1 1 
       1260 1 1 1 1 147 ILE H    . 147 . HN   1 1 
       1260 1 2 1 1 147 ILE QG   . 147 . HG1* 1 1 
       1261 1 1 1 1 147 ILE QG   . 147 . HG1* 1 1 
       1261 1 2 1 1 148 TYR H    . 148 . HN   1 1 
       1262 1 1 1 1 147 ILE QG   . 147 . HG1* 1 1 
       1262 1 2 1 1 151 ILE MD   . 151 . HD1* 1 1 
       1263 1 1 1 1 150 VAL H    . 150 . HN   1 1 
       1263 1 2 1 1 152 CYS QB   . 152 . HB*  1 1 
       1264 1 1 1 1 151 ILE MD   . 151 . HD1* 1 1 
       1264 1 2 1 1 152 CYS QB   . 152 . HB*  1 1 
       1265 1 1 1 1 152 CYS H    . 152 . HN   1 1 
       1265 1 2 1 1 152 CYS QB   . 152 . HB*  1 1 
       1266 1 1 1 1 152 CYS QB   . 152 . HB*  1 1 
       1266 1 2 1 1 153 LYS H    . 153 . HN   1 1 
       1267 1 1 1 1 156 SER H    . 156 . HN   1 1 
       1267 1 2 1 1 156 SER QB   . 156 . HB*  1 1 
       1268 1 1 1 1 156 SER QB   . 156 . HB*  1 1 
       1268 1 2 1 1 157 GLU H    . 157 . HN   1 1 
       1269 1 1 1 1 157 GLU QB   . 157 . HB*  1 1 
       1269 1 2 1 1 158 VAL H    . 158 . HN   1 1 
       1270 1 1 1 1 157 GLU QB   . 157 . HB*  1 1 
       1270 1 2 1 1 158 VAL MG2  . 158 . HG2* 1 1 
       1271 1 1 1 1 158 VAL MG2  . 158 . HG2* 1 1 
       1271 1 2 1 1 159 PRO QB   . 159 . HB*  1 1 
       1272 1 1 1 1 160 GLU H    . 160 . HN   1 1 
       1272 1 2 1 1 160 GLU QB   . 160 . HB*  1 1 
       1273 1 1 1 1 160 GLU QB   . 160 . HB*  1 1 
       1273 1 2 1 1 161 ILE H    . 161 . HN   1 1 
       1274 1 1 1 1 161 ILE MG   . 161 . HG2* 1 1 
       1274 1 2 1 1 167 CYS QB   . 167 . HB*  1 1 
       1275 1 1 1 1 161 ILE MD   . 161 . HD1* 1 1 
       1275 1 2 1 1 167 CYS QB   . 167 . HB*  1 1 
       1276 1 1 1 1 164 SER H    . 164 . HN   1 1 
       1276 1 2 1 1 167 CYS QB   . 167 . HB*  1 1 
       1277 1 1 1 1 165 PRO QB   . 165 . HB*  1 1 
       1277 1 2 1 1 166 ASN H    . 166 . HN   1 1 
       1278 1 1 1 1 166 ASN H    . 166 . HN   1 1 
       1278 1 2 1 1 166 ASN QB   . 166 . HB*  1 1 
       1279 1 1 1 1 166 ASN QB   . 166 . HB*  1 1 
       1279 1 2 1 1 167 CYS H    . 167 . HN   1 1 
       1280 1 1 1 1 166 ASN QB   . 166 . HB*  1 1 
       1280 1 2 1 1 169 GLN H    . 169 . HN   1 1 
       1281 1 1 1 1 167 CYS QB   . 167 . HB*  1 1 
       1281 1 2 1 1 168 LEU H    . 168 . HN   1 1 
       1282 1 1 1 1 167 CYS QB   . 167 . HB*  1 1 
       1282 1 2 1 1 168 LEU MD1  . 168 . HD1* 1 1 
       1283 1 1 1 1 167 CYS QB   . 167 . HB*  1 1 
       1283 1 2 1 1 169 GLN H    . 169 . HN   1 1 
       1284 1 1 1 1 167 CYS QB   . 167 . HB*  1 1 
       1284 1 2 1 1 171 LEU MD2  . 171 . HD2* 1 1 
       1285 1 1 1 1 169 GLN H    . 169 . HN   1 1 
       1285 1 2 1 1 169 GLN QB   . 169 . HB*  1 1 
       1286 1 1 1 1 170 GLU QB   . 170 . HB*  1 1 
       1286 1 2 1 1 171 LEU H    . 171 . HN   1 1 
       1287 1 1 1 1 172 LEU H    . 172 . HN   1 1 
       1287 1 2 1 1 172 LEU QB   . 172 . HB*  1 1 
       1288 1 1 1 1 172 LEU QB   . 172 . HB*  1 1 
       1288 1 2 1 1 172 LEU MD2  . 172 . HD2* 1 1 
       1289 1 1 1 1  72 MET ME   .  72 . HE*  1 1 
       1289 1 2 1 1 122 ALA MB   . 122 . HB*  1 1 
       1290 1 1 1 1  72 MET ME   .  72 . HE*  1 1 
       1290 1 2 1 1 125 THR MG   . 125 . HG2* 1 1 
       1291 1 1 1 1  75 TYR QD   .  75 . HD*  1 1 
       1291 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
       1292 1 1 1 1  75 TYR QD   .  75 . HD*  1 1 
       1292 1 2 1 1  98 LEU QD   .  98 . HD1* 1 1 
       1293 1 1 1 1  99 TYR QD   .  99 . HD*  1 1 
       1293 1 2 1 1 119 LEU MD2  . 119 . HD2* 1 1 
       1294 1 1 1 1  99 TYR QE   .  99 . HE*  1 1 
       1294 1 2 1 1 119 LEU MD2  . 119 . HD2* 1 1 
       1295 1 1 1 1  76 ALA MB   .  76 . HB*  1 1 
       1295 1 2 1 1 126 LEU MD1  . 126 . HD1* 1 1 
       1296 1 1 1 1  27 LEU MD2  .  27 . HD2* 1 1 
       1296 1 2 1 1 114 VAL MG1  . 114 . HG1* 1 1 
       1297 1 1 1 1  64 PHE QD   .  64 . HD*  1 1 
       1297 1 2 1 1 106 TYR QE   . 106 . HE*  1 1 
       1298 1 1 1 1  67 PHE QD   .  67 . HD*  1 1 
       1298 1 2 1 1 106 TYR QE   . 106 . HE*  1 1 
       1299 1 1 1 1  30 PHE QD   .  30 . HD*  1 1 
       1299 1 2 1 1 118 PHE QD   . 118 . HD*  1 1 
       1300 1 1 1 1 112 PHE QE   . 112 . HE*  1 1 
       1300 1 2 1 1 162 PHE QE   . 162 . HE*  1 1 
       1301 1 1 1 1  29 PHE QD   .  29 . HD*  1 1 
       1301 1 2 1 1  61 PHE QD   .  61 . HD*  1 1 
       1302 1 1 1 1  25 ALA MB   .  25 . HB*  1 1 
       1302 1 2 1 1  61 PHE QE   .  61 . HE*  1 1 
       1303 1 1 1 1  49 PHE QE   .  49 . HE*  1 1 
       1303 1 2 1 1  57 LEU MD1  .  57 . HD1* 1 1 
       1304 1 1 1 1  27 LEU MD1  .  27 . HD1* 1 1 
       1304 1 2 1 1 162 PHE QE   . 162 . HE*  1 1 
       1305 1 1 1 1  28 MET ME   .  28 . HE*  1 1 
       1305 1 2 1 1 162 PHE QE   . 162 . HE*  1 1 
       1306 1 1 1 1  43 TYR QE   .  43 . HE*  1 1 
       1306 1 2 1 1 158 VAL MG2  . 158 . HG2* 1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

          1 1 . . . . . 3.46 1.8 3.98 1 1 
          2 1 . . . . . 4.49 1.8 5.16 1 1 
          3 1 . . . . .  3.4 1.8 3.91 1 1 
          4 1 . . . . . 3.55 1.8 4.08 1 1 
          5 1 . . . . . 3.59 1.8 4.13 1 1 
          6 1 . . . . .  4.4 1.8 5.06 1 1 
          7 1 . . . . . 3.18 1.8 3.66 1 1 
          8 1 . . . . . 3.29 1.8 3.78 1 1 
          9 1 . . . . . 4.26 1.8  4.9 1 1 
         10 1 . . . . . 4.29 1.8 4.93 1 1 
         11 1 . . . . . 4.67 1.8 5.37 1 1 
         12 1 . . . . .  5.3 1.8  6.1 1 1 
         13 1 . . . . . 4.29 1.8 4.93 1 1 
         14 1 . . . . . 3.22 1.8  3.7 1 1 
         15 1 . . . . .  3.9 1.8 4.49 1 1 
         16 1 . . . . . 4.34 1.8 4.99 1 1 
         17 1 . . . . . 5.13 1.8  5.9 1 1 
         18 1 . . . . . 4.69 1.8 5.39 1 1 
         19 1 . . . . . 3.67 1.8 4.22 1 1 
         20 1 . . . . . 5.45 1.8 6.27 1 1 
         21 1 . . . . . 4.79 1.8 5.51 1 1 
         22 1 . . . . .  5.5 1.8 6.33 1 1 
         23 1 . . . . . 5.24 1.8 6.03 1 1 
         24 1 . . . . . 2.91 1.8 3.35 1 1 
         25 1 . . . . .  3.5 1.8 4.03 1 1 
         26 1 . . . . . 3.79 1.8 4.36 1 1 
         27 1 . . . . .  3.5 1.8 4.03 1 1 
         28 1 . . . . . 4.99 1.8 5.74 1 1 
         29 1 . . . . . 5.11 1.8 5.88 1 1 
         30 1 . . . . . 5.48 1.8  6.3 1 1 
         31 1 . . . . . 3.14 1.8 3.61 1 1 
         32 1 . . . . . 4.04 1.8 4.65 1 1 
         33 1 . . . . .  4.2 1.8 4.83 1 1 
         34 1 . . . . . 3.19 1.8 3.67 1 1 
         35 1 . . . . . 4.28 1.8 4.92 1 1 
         36 1 . . . . . 3.67 1.8 4.22 1 1 
         37 1 . . . . . 4.49 1.8 5.16 1 1 
         38 1 . . . . . 3.11 1.8 3.58 1 1 
         39 1 . . . . . 4.91 1.8 5.65 1 1 
         40 1 . . . . . 4.01 1.8 4.61 1 1 
         41 1 . . . . . 4.78 1.8  5.5 1 1 
         42 1 . . . . . 5.17 1.8 5.95 1 1 
         43 1 . . . . . 4.66 1.8 5.36 1 1 
         44 1 . . . . . 4.07 1.8 4.68 1 1 
         45 1 . . . . . 3.71 1.8 4.27 1 1 
         46 1 . . . . .  3.8 1.8 4.37 1 1 
         47 1 . . . . . 4.44 1.8 4.99 1 1 
         48 1 . . . . . 5.42 1.8 6.23 1 1 
         49 1 . . . . .  5.5 1.8 6.33 1 1 
         50 1 . . . . .  4.0 1.8  4.6 1 1 
         51 1 . . . . . 4.66 1.8 5.36 1 1 
         52 1 . . . . .  5.5 1.8 6.33 1 1 
         53 1 . . . . .  5.0 1.8 5.75 1 1 
         54 1 . . . . . 4.83 1.8 5.55 1 1 
         55 1 . . . . . 2.93 1.8 3.37 1 1 
         56 1 . . . . . 3.96 1.8 4.55 1 1 
         57 1 . . . . . 5.12 1.8 5.89 1 1 
         58 1 . . . . . 5.41 1.8 6.22 1 1 
         59 1 . . . . . 4.07 1.8 4.68 1 1 
         60 1 . . . . . 4.73 1.8 5.44 1 1 
         61 1 . . . . . 3.77 1.8 4.34 1 1 
         62 1 . . . . .  5.0 1.8 5.75 1 1 
         63 1 . . . . . 2.98 1.8 3.43 1 1 
         64 1 . . . . . 4.48 1.8 5.15 1 1 
         65 1 . . . . . 4.19 1.8 4.82 1 1 
         66 1 . . . . . 3.24 1.8 3.73 1 1 
         67 1 . . . . .  4.8 1.8 5.52 1 1 
         68 1 . . . . . 4.03 1.8 4.63 1 1 
         69 1 . . . . . 4.85 1.8 5.58 1 1 
         70 1 . . . . . 3.38 1.8 3.89 1 1 
         71 1 . . . . . 3.01 1.8 3.46 1 1 
         72 1 . . . . . 5.48 1.8  6.3 1 1 
         73 1 . . . . . 3.26 1.8 3.75 1 1 
         74 1 . . . . .  3.4 1.8 3.91 1 1 
         75 1 . . . . . 3.84 1.8 4.42 1 1 
         76 1 . . . . . 4.29 1.8 4.93 1 1 
         77 1 . . . . . 3.28 1.8 3.77 1 1 
         78 1 . . . . .  5.5 1.8 6.33 1 1 
         79 1 . . . . .  5.5 1.8 6.33 1 1 
         80 1 . . . . . 5.25 1.8 6.04 1 1 
         81 1 . . . . . 4.73 1.8 5.44 1 1 
         82 1 . . . . . 4.82 1.8 5.54 1 1 
         83 1 . . . . .  5.1 1.8 5.87 1 1 
         84 1 . . . . . 4.29 1.8 4.93 1 1 
         85 1 . . . . . 3.95 1.8 4.54 1 1 
         86 1 . . . . .  5.5 1.8 6.33 1 1 
         87 1 . . . . . 4.38 1.8 5.04 1 1 
         88 1 . . . . .  5.5 1.8 6.33 1 1 
         89 1 . . . . . 4.31 1.8 4.96 1 1 
         90 1 . . . . . 3.68 1.8 4.23 1 1 
         91 1 . . . . . 5.14 1.8 5.91 1 1 
         92 1 . . . . . 4.97 1.8 5.72 1 1 
         93 1 . . . . . 4.44 1.8 5.11 1 1 
         94 1 . . . . . 3.84 1.8 4.42 1 1 
         95 1 . . . . . 3.57 1.8 4.11 1 1 
         96 1 . . . . . 4.11 1.8 4.73 1 1 
         97 1 . . . . .  5.5 1.8 6.33 1 1 
         98 1 . . . . . 4.16 1.8 4.78 1 1 
         99 1 . . . . . 4.27 1.8 4.91 1 1 
        100 1 . . . . . 4.88 1.8 5.61 1 1 
        101 1 . . . . . 4.88 1.8 5.61 1 1 
        102 1 . . . . .  4.5 1.8 5.18 1 1 
        103 1 . . . . . 3.57 1.8 4.11 1 1 
        104 1 . . . . . 3.33 1.8 3.83 1 1 
        105 1 . . . . . 4.78 1.8  5.5 1 1 
        106 1 . . . . . 4.81 1.8 5.53 1 1 
        107 1 . . . . . 4.96 1.8  5.7 1 1 
        108 1 . . . . . 5.03 1.8 5.78 1 1 
        109 1 . . . . . 4.68 1.8 5.38 1 1 
        110 1 . . . . . 5.27 1.8 6.06 1 1 
        111 1 . . . . . 4.42 1.8 5.08 1 1 
        112 1 . . . . . 4.12 1.8 4.74 1 1 
        113 1 . . . . . 4.32 1.8 4.97 1 1 
        114 1 . . . . .  5.5 1.8 6.33 1 1 
        115 1 . . . . . 4.78 1.8  5.5 1 1 
        116 1 . . . . . 4.74 1.8 5.45 1 1 
        117 1 . . . . . 5.39 1.8  6.2 1 1 
        118 1 . . . . . 4.22 1.8 4.85 1 1 
        119 1 . . . . . 3.57 1.8 4.11 1 1 
        120 1 . . . . . 4.69 1.8 5.39 1 1 
        121 1 . . . . . 4.54 1.8 5.22 1 1 
        122 1 . . . . . 3.79 1.8 4.36 1 1 
        123 1 . . . . . 3.56 1.8 4.09 1 1 
        124 1 . . . . . 4.14 1.8 4.76 1 1 
        125 1 . . . . . 3.69 1.8 4.24 1 1 
        126 1 . . . . . 3.35 1.8 3.85 1 1 
        127 1 . . . . . 4.53 1.8 5.21 1 1 
        128 1 . . . . . 4.23 1.8 4.86 1 1 
        129 1 . . . . .  4.7 1.8  5.4 1 1 
        130 1 . . . . . 3.94 1.8 4.53 1 1 
        131 1 . . . . . 3.71 1.8 4.27 1 1 
        132 1 . . . . . 3.85 1.8 4.43 1 1 
        133 1 . . . . . 4.85 1.8 5.58 1 1 
        134 1 . . . . . 4.36 1.8 5.01 1 1 
        135 1 . . . . . 3.38 1.8 3.89 1 1 
        136 1 . . . . . 4.45 1.8 5.12 1 1 
        137 1 . . . . .  4.9 1.8 5.64 1 1 
        138 1 . . . . . 3.74 1.8  4.3 1 1 
        139 1 . . . . . 5.14 1.8 5.91 1 1 
        140 1 . . . . . 3.18 1.8 3.66 1 1 
        141 1 . . . . . 4.19 1.8 4.82 1 1 
        142 1 . . . . . 3.48 1.8  4.0 1 1 
        143 1 . . . . .  4.6 1.8 5.29 1 1 
        144 1 . . . . . 3.13 1.8  3.6 1 1 
        145 1 . . . . . 3.22 1.8  3.7 1 1 
        146 1 . . . . . 4.41 1.8 5.07 1 1 
        147 1 . . . . .  5.5 1.8 6.33 1 1 
        148 1 . . . . .  5.5 1.8 6.33 1 1 
        149 1 . . . . . 4.09 1.8  4.7 1 1 
        150 1 . . . . . 5.41 1.8 6.22 1 1 
        151 1 . . . . . 3.93 1.8 4.52 1 1 
        152 1 . . . . . 3.76 1.8 4.32 1 1 
        153 1 . . . . .  5.5 1.8 6.33 1 1 
        154 1 . . . . . 5.09 1.8 5.85 1 1 
        155 1 . . . . . 3.74 1.8  4.3 1 1 
        156 1 . . . . . 4.25 1.8 4.89 1 1 
        157 1 . . . . . 3.31 1.8 3.81 1 1 
        158 1 . . . . . 4.63 1.8 5.32 1 1 
        159 1 . . . . . 5.34 1.8 6.14 1 1 
        160 1 . . . . .  5.5 1.8 6.33 1 1 
        161 1 . . . . .  5.5 1.8 6.33 1 1 
        162 1 . . . . . 3.82 1.8 4.39 1 1 
        163 1 . . . . . 4.83 1.8 5.55 1 1 
        164 1 . . . . . 4.14 1.8 4.76 1 1 
        165 1 . . . . . 2.92 1.8 3.36 1 1 
        166 1 . . . . . 4.11 1.8 4.73 1 1 
        167 1 . . . . . 3.58 1.8 4.12 1 1 
        168 1 . . . . . 3.31 1.8 3.81 1 1 
        169 1 . . . . . 5.17 1.8 5.95 1 1 
        170 1 . . . . . 4.04 1.8 4.65 1 1 
        171 1 . . . . . 4.19 1.8 4.82 1 1 
        172 1 . . . . .  4.3 1.8 4.95 1 1 
        173 1 . . . . . 3.18 1.8 3.66 1 1 
        174 1 . . . . . 3.94 1.8 4.53 1 1 
        175 1 . . . . . 3.11 1.8 3.58 1 1 
        176 1 . . . . .  3.5 1.8 4.03 1 1 
        177 1 . . . . .  3.2 1.8 3.68 1 1 
        178 1 . . . . . 3.34 1.8 3.84 1 1 
        179 1 . . . . . 4.83 1.8 5.55 1 1 
        180 1 . . . . . 4.09 1.8  4.7 1 1 
        181 1 . . . . . 5.04 1.8  5.8 1 1 
        182 1 . . . . . 3.98 1.8 4.58 1 1 
        183 1 . . . . . 3.67 1.8 4.22 1 1 
        184 1 . . . . . 3.38 1.8 3.89 1 1 
        185 1 . . . . . 4.05 1.8 4.66 1 1 
        186 1 . . . . . 3.27 1.8 3.76 1 1 
        187 1 . . . . . 4.49 1.8 5.16 1 1 
        188 1 . . . . . 4.09 1.8  4.7 1 1 
        189 1 . . . . . 4.26 1.8  4.9 1 1 
        190 1 . . . . . 4.89 1.8 5.62 1 1 
        191 1 . . . . . 4.76 1.8 5.47 1 1 
        192 1 . . . . . 4.72 1.8 5.43 1 1 
        193 1 . . . . . 2.92 1.8 3.36 1 1 
        194 1 . . . . .  3.8 1.8 4.37 1 1 
        195 1 . . . . . 3.13 1.8  3.6 1 1 
        196 1 . . . . . 3.79 1.8 4.36 1 1 
        197 1 . . . . . 4.16 1.8 4.78 1 1 
        198 1 . . . . .  5.5 1.8 6.33 1 1 
        199 1 . . . . . 4.87 1.8  5.6 1 1 
        200 1 . . . . . 3.69 1.8 4.24 1 1 
        201 1 . . . . . 5.42 1.8 6.23 1 1 
        202 1 . . . . . 5.36 1.8 6.16 1 1 
        203 1 . . . . . 3.52 1.8 4.05 1 1 
        204 1 . . . . . 4.87 1.8  5.6 1 1 
        205 1 . . . . . 3.99 1.8 4.59 1 1 
        206 1 . . . . . 5.05 1.8 5.81 1 1 
        207 1 . . . . . 4.89 1.8 5.62 1 1 
        208 1 . . . . . 3.64 1.8 4.19 1 1 
        209 1 . . . . . 3.37 1.8 3.88 1 1 
        210 1 . . . . . 4.24 1.8 4.88 1 1 
        211 1 . . . . . 3.79 1.8 4.36 1 1 
        212 1 . . . . . 3.99 1.8 4.59 1 1 
        213 1 . . . . . 3.82 1.8 4.39 1 1 
        214 1 . . . . .  5.5 1.8 6.33 1 1 
        215 1 . . . . . 4.16 1.8  4.6 1 1 
        216 1 . . . . .  5.5 1.8 6.33 1 1 
        217 1 . . . . . 4.28 1.8 4.92 1 1 
        218 1 . . . . . 4.05 1.8 4.66 1 1 
        219 1 . . . . . 3.87 1.8 4.45 1 1 
        220 1 . . . . .  4.0 1.8  4.6 1 1 
        221 1 . . . . . 4.01 1.8 4.61 1 1 
        222 1 . . . . . 5.17 1.8 5.95 1 1 
        223 1 . . . . . 3.45 1.8 3.97 1 1 
        224 1 . . . . . 3.32 1.8 3.82 1 1 
        225 1 . . . . . 3.76 1.8 4.32 1 1 
        226 1 . . . . . 4.31 1.8 4.96 1 1 
        227 1 . . . . . 5.35 1.8 6.15 1 1 
        228 1 . . . . .  5.5 1.8 6.33 1 1 
        229 1 . . . . . 3.95 1.8 4.54 1 1 
        230 1 . . . . . 3.38 1.8 3.89 1 1 
        231 1 . . . . . 3.81 1.8 4.38 1 1 
        232 1 . . . . . 3.83 1.8  4.4 1 1 
        233 1 . . . . .  3.6 1.8 4.14 1 1 
        234 1 . . . . . 3.54 1.8 4.07 1 1 
        235 1 . . . . . 4.51 1.8 5.19 1 1 
        236 1 . . . . . 3.97 1.8 4.57 1 1 
        237 1 . . . . .  4.0 1.8  4.6 1 1 
        238 1 . . . . . 4.03 1.8 4.63 1 1 
        239 1 . . . . . 4.79 1.8 5.51 1 1 
        240 1 . . . . .  5.5 1.8 6.33 1 1 
        241 1 . . . . . 4.96 1.8  5.7 1 1 
        242 1 . . . . . 3.17 1.8 3.65 1 1 
        243 1 . . . . . 3.89 1.8 4.47 1 1 
        244 1 . . . . . 4.26 1.8  4.9 1 1 
        245 1 . . . . . 4.37 1.8 5.03 1 1 
        246 1 . . . . . 4.17 1.8  4.8 1 1 
        247 1 . . . . . 3.92 1.8 4.51 1 1 
        248 1 . . . . . 3.92 1.8 4.51 1 1 
        249 1 . . . . . 3.42 1.8 3.93 1 1 
        250 1 . . . . . 3.55 1.8 4.08 1 1 
        251 1 . . . . . 3.76 1.8 4.32 1 1 
        252 1 . . . . . 3.73 1.8 4.29 1 1 
        253 1 . . . . . 3.77 1.8 4.34 1 1 
        254 1 . . . . . 4.21 1.8 4.84 1 1 
        255 1 . . . . .    . 1.8 3.34 1 1 
        256 1 . . . . . 4.71 1.8 5.42 1 1 
        257 1 . . . . . 3.58 1.8 4.12 1 1 
        258 1 . . . . .  4.1 1.8 4.72 1 1 
        259 1 . . . . .  4.4 1.8 5.06 1 1 
        260 1 . . . . . 3.11 1.8 3.58 1 1 
        261 1 . . . . . 3.33 1.8 3.83 1 1 
        262 1 . . . . . 4.09 1.8  4.7 1 1 
        263 1 . . . . . 4.32 1.8 4.97 1 1 
        264 1 . . . . . 4.83 1.8 5.55 1 1 
        265 1 . . . . .  5.5 1.8 6.33 1 1 
        266 1 . . . . . 4.69 1.8 5.39 1 1 
        267 1 . . . . . 4.08 1.8 4.69 1 1 
        268 1 . . . . . 3.47 1.8 3.99 1 1 
        269 1 . . . . . 4.52 1.8  5.2 1 1 
        270 1 . . . . . 4.52 1.8  5.2 1 1 
        271 1 . . . . . 5.12 1.8 5.89 1 1 
        272 1 . . . . . 4.54 1.8 5.22 1 1 
        273 1 . . . . .  4.3 1.8 4.95 1 1 
        274 1 . . . . . 4.29 1.8 4.93 1 1 
        275 1 . . . . . 5.23 1.8 6.01 1 1 
        276 1 . . . . . 5.45 1.8 6.27 1 1 
        277 1 . . . . .  5.5 1.8 6.33 1 1 
        278 1 . . . . .  5.5 1.8 6.33 1 1 
        279 1 . . . . . 3.95 1.8 4.54 1 1 
        280 1 . . . . . 4.46 1.8 5.13 1 1 
        281 1 . . . . .  3.9 1.8 4.49 1 1 
        282 1 . . . . .  5.5 1.8 6.33 1 1 
        283 1 . . . . .  5.1 1.8 5.87 1 1 
        284 1 . . . . . 4.35 1.8  5.0 1 1 
        285 1 . . . . . 3.98 1.8 4.58 1 1 
        286 1 . . . . . 4.51 1.8 5.19 1 1 
        287 1 . . . . . 4.81 1.8 5.53 1 1 
        288 1 . . . . .  3.3 1.8  3.8 1 1 
        289 1 . . . . . 4.34 1.8 4.99 1 1 
        290 1 . . . . .  5.4 1.8 6.21 1 1 
        291 1 . . . . . 3.63 1.8 4.17 1 1 
        292 1 . . . . . 4.45 1.8 5.12 1 1 
        293 1 . . . . . 5.25 1.8 6.04 1 1 
        294 1 . . . . . 5.42 1.8 6.23 1 1 
        295 1 . . . . .  3.5 1.8 4.03 1 1 
        296 1 . . . . . 4.23 1.8 4.86 1 1 
        297 1 . . . . .  4.4 1.8 5.06 1 1 
        298 1 . . . . .  5.5 1.8 6.33 1 1 
        299 1 . . . . . 4.14 1.8 4.76 1 1 
        300 1 . . . . .  5.5 1.8 6.33 1 1 
        301 1 . . . . . 5.35 1.8 6.15 1 1 
        302 1 . . . . . 5.35 1.8 6.15 1 1 
        303 1 . . . . .  4.7 1.8  5.4 1 1 
        304 1 . . . . .  5.5 1.8 6.33 1 1 
        305 1 . . . . . 4.36 1.8 5.01 1 1 
        306 1 . . . . . 3.95 1.8 4.54 1 1 
        307 1 . . . . . 5.03 1.8 5.78 1 1 
        308 1 . . . . . 3.48 1.8  4.0 1 1 
        309 1 . . . . . 4.54 1.8 5.22 1 1 
        310 1 . . . . . 3.39 1.8  3.9 1 1 
        311 1 . . . . . 4.07 1.8 4.68 1 1 
        312 1 . . . . . 3.31 1.8 3.81 1 1 
        313 1 . . . . . 3.43 1.8 3.94 1 1 
        314 1 . . . . .  3.7 1.8 4.26 1 1 
        315 1 . . . . . 3.84 1.8 4.42 1 1 
        316 1 . . . . .  5.0 1.8 5.75 1 1 
        317 1 . . . . . 4.23 1.8 4.86 1 1 
        318 1 . . . . . 3.25 1.8 3.74 1 1 
        319 1 . . . . . 3.43 1.8 3.94 1 1 
        320 1 . . . . . 3.86 1.8 4.44 1 1 
        321 1 . . . . . 3.22 1.8  3.7 1 1 
        322 1 . . . . . 3.22 1.8  3.7 1 1 
        323 1 . . . . .  4.7 1.8  5.4 1 1 
        324 1 . . . . . 4.29 1.8 4.93 1 1 
        325 1 . . . . .  5.5 1.8 6.33 1 1 
        326 1 . . . . . 4.08 1.8 4.69 1 1 
        327 1 . . . . . 3.51 1.8 4.04 1 1 
        328 1 . . . . . 3.14 1.8 3.61 1 1 
        329 1 . . . . . 3.14 1.8 3.61 1 1 
        330 1 . . . . .  5.5 1.8 6.33 1 1 
        331 1 . . . . . 4.36 1.8 5.01 1 1 
        332 1 . . . . . 4.26 1.8  4.9 1 1 
        333 1 . . . . . 4.58 1.8 5.27 1 1 
        334 1 . . . . . 4.09 1.8  4.7 1 1 
        335 1 . . . . . 4.94 1.8 5.68 1 1 
        336 1 . . . . . 3.48 1.8  4.0 1 1 
        337 1 . . . . . 3.37 1.8 3.88 1 1 
        338 1 . . . . . 4.04 1.8 4.65 1 1 
        339 1 . . . . . 5.09 1.8 5.85 1 1 
        340 1 . . . . . 5.09 1.8 5.85 1 1 
        341 1 . . . . .  4.8 1.8 5.52 1 1 
        342 1 . . . . .  4.8 1.8 5.52 1 1 
        343 1 . . . . . 3.52 1.8 4.05 1 1 
        344 1 . . . . . 4.26 1.8  4.9 1 1 
        345 1 . . . . . 3.45 1.8 3.97 1 1 
        346 1 . . . . .  3.8 1.8 4.37 1 1 
        347 1 . . . . . 4.86 1.8 5.59 1 1 
        348 1 . . . . .  3.5 1.8 4.03 1 1 
        349 1 . . . . . 5.25 1.8 6.04 1 1 
        350 1 . . . . . 5.25 1.8 6.04 1 1 
        351 1 . . . . .  4.3 1.8 4.95 1 1 
        352 1 . . . . .  4.6 1.8 5.29 1 1 
        353 1 . . . . . 4.85 1.8 5.58 1 1 
        354 1 . . . . . 3.68 1.8 4.23 1 1 
        355 1 . . . . .  5.5 1.8 6.33 1 1 
        356 1 . . . . . 4.14 1.8 4.76 1 1 
        357 1 . . . . . 5.03 1.8 5.78 1 1 
        358 1 . . . . . 3.92 1.8 4.51 1 1 
        359 1 . . . . . 4.93 1.8 5.67 1 1 
        360 1 . . . . . 4.18 1.8 4.81 1 1 
        361 1 . . . . .  4.2 1.8 4.83 1 1 
        362 1 . . . . .  3.2 1.8 3.68 1 1 
        363 1 . . . . . 3.77 1.8 4.34 1 1 
        364 1 . . . . . 5.08 1.8 5.84 1 1 
        365 1 . . . . .  5.5 1.8 6.33 1 1 
        366 1 . . . . . 4.89 1.8 5.62 1 1 
        367 1 . . . . . 5.09 1.8 5.85 1 1 
        368 1 . . . . . 3.72 1.8 4.28 1 1 
        369 1 . . . . . 4.25 1.8 4.89 1 1 
        370 1 . . . . .  5.5 1.8 6.33 1 1 
        371 1 . . . . .  5.5 1.8 6.33 1 1 
        372 1 . . . . . 5.37 1.8 6.18 1 1 
        373 1 . . . . . 4.29 1.8 4.93 1 1 
        374 1 . . . . . 4.02 1.8 4.62 1 1 
        375 1 . . . . . 4.77 1.8 5.49 1 1 
        376 1 . . . . . 3.85 1.8 4.43 1 1 
        377 1 . . . . . 5.16 1.8 5.93 1 1 
        378 1 . . . . .  5.5 1.8 6.33 1 1 
        379 1 . . . . . 4.21 1.8 4.84 1 1 
        380 1 . . . . .  5.5 1.8 6.33 1 1 
        381 1 . . . . . 3.82 1.8 4.39 1 1 
        382 1 . . . . .  3.7 1.8 4.26 1 1 
        383 1 . . . . . 4.91 1.8 5.65 1 1 
        384 1 . . . . .  3.3 1.8  3.8 1 1 
        385 1 . . . . . 4.58 1.8 5.27 1 1 
        386 1 . . . . . 4.77 1.8 5.49 1 1 
        387 1 . . . . .  5.3 1.8  6.1 1 1 
        388 1 . . . . . 4.57 1.8 5.26 1 1 
        389 1 . . . . . 4.78 1.8  5.5 1 1 
        390 1 . . . . . 3.63 1.8 4.17 1 1 
        391 1 . . . . . 3.88 1.8 4.46 1 1 
        392 1 . . . . . 4.45 1.8 5.12 1 1 
        393 1 . . . . . 4.45 1.8 5.12 1 1 
        394 1 . . . . . 3.92 1.8 4.51 1 1 
        395 1 . . . . . 3.76 1.8 4.32 1 1 
        396 1 . . . . . 5.03 1.8 5.78 1 1 
        397 1 . . . . .  5.5 1.8 6.33 1 1 
        398 1 . . . . . 4.19 1.8 4.82 1 1 
        399 1 . . . . . 3.69 1.8 4.24 1 1 
        400 1 . . . . . 5.47 1.8 6.29 1 1 
        401 1 . . . . . 5.16 1.8 5.93 1 1 
        402 1 . . . . . 4.74 1.8 5.45 1 1 
        403 1 . . . . . 3.58 1.8 4.12 1 1 
        404 1 . . . . . 4.94 1.8 5.68 1 1 
        405 1 . . . . . 3.73 1.8 4.29 1 1 
        406 1 . . . . . 3.71 1.8 4.27 1 1 
        407 1 . . . . . 3.96 1.8 4.55 1 1 
        408 1 . . . . . 4.42 1.8 5.08 1 1 
        409 1 . . . . . 4.42 1.8 5.08 1 1 
        410 1 . . . . . 4.36 1.8 5.01 1 1 
        411 1 . . . . .  5.5 1.8 6.33 1 1 
        412 1 . . . . . 5.12 1.8 5.89 1 1 
        413 1 . . . . . 3.36 1.8 3.86 1 1 
        414 1 . . . . . 5.03 1.8 5.78 1 1 
        415 1 . . . . . 4.43 1.8 5.09 1 1 
        416 1 . . . . . 4.29 1.8 4.93 1 1 
        417 1 . . . . .  5.5 1.8 6.33 1 1 
        418 1 . . . . . 4.09 1.8  4.7 1 1 
        419 1 . . . . .  4.0 1.8  4.6 1 1 
        420 1 . . . . .  5.5 1.8 6.33 1 1 
        421 1 . . . . . 3.56 1.8 4.09 1 1 
        422 1 . . . . . 3.94 1.8 4.53 1 1 
        423 1 . . . . . 4.97 1.8 5.72 1 1 
        424 1 . . . . . 4.24 1.8 4.88 1 1 
        425 1 . . . . . 4.94 1.8 5.68 1 1 
        426 1 . . . . . 5.41 1.8 6.22 1 1 
        427 1 . . . . . 4.66 1.8 5.36 1 1 
        428 1 . . . . . 4.92 1.8 5.66 1 1 
        429 1 . . . . . 4.84 1.8 5.57 1 1 
        430 1 . . . . . 4.84 1.8 5.57 1 1 
        431 1 . . . . . 4.79 1.8 5.51 1 1 
        432 1 . . . . . 3.53 1.8 4.06 1 1 
        433 1 . . . . . 4.66 1.8 5.36 1 1 
        434 1 . . . . . 4.47 1.8 5.14 1 1 
        435 1 . . . . . 4.88 1.8 5.61 1 1 
        436 1 . . . . . 4.26 1.8  4.9 1 1 
        437 1 . . . . . 3.86 1.8 4.44 1 1 
        438 1 . . . . . 3.48 1.8  4.0 1 1 
        439 1 . . . . .  5.5 1.8 6.33 1 1 
        440 1 . . . . . 3.57 1.8 4.11 1 1 
        441 1 . . . . . 4.03 1.8 4.63 1 1 
        442 1 . . . . . 5.42 1.8 6.23 1 1 
        443 1 . . . . . 4.18 1.8 4.81 1 1 
        444 1 . . . . . 4.18 1.8 4.81 1 1 
        445 1 . . . . . 3.35 1.8 3.85 1 1 
        446 1 . . . . . 3.99 1.8 4.59 1 1 
        447 1 . . . . .  3.9 1.8 4.49 1 1 
        448 1 . . . . . 3.74 1.8  4.3 1 1 
        449 1 . . . . . 3.64 1.8 4.19 1 1 
        450 1 . . . . . 3.41 1.8 3.92 1 1 
        451 1 . . . . . 5.36 1.8 6.16 1 1 
        452 1 . . . . . 4.46 1.8 5.13 1 1 
        453 1 . . . . . 4.28 1.8 4.92 1 1 
        454 1 . . . . . 3.53 1.8 4.06 1 1 
        455 1 . . . . . 4.63 1.8 5.32 1 1 
        456 1 . . . . . 4.59 1.8 5.28 1 1 
        457 1 . . . . . 4.24 1.8 4.88 1 1 
        458 1 . . . . .  3.6 1.8 4.14 1 1 
        459 1 . . . . .  3.5 1.8 4.03 1 1 
        460 1 . . . . . 3.82 1.8 4.39 1 1 
        461 1 . . . . . 5.41 1.8 6.22 1 1 
        462 1 . . . . .  5.5 1.8 6.33 1 1 
        463 1 . . . . . 3.52 1.8 4.05 1 1 
        464 1 . . . . . 3.81 1.8 4.38 1 1 
        465 1 . . . . . 3.93 1.8 4.52 1 1 
        466 1 . . . . . 4.23 1.8 4.86 1 1 
        467 1 . . . . . 4.17 1.8  4.8 1 1 
        468 1 . . . . . 3.84 1.8 4.42 1 1 
        469 1 . . . . . 3.34 1.8 3.84 1 1 
        470 1 . . . . .  3.8 1.8 4.37 1 1 
        471 1 . . . . . 3.74 1.8  4.3 1 1 
        472 1 . . . . . 4.31 1.8 4.96 1 1 
        473 1 . . . . . 3.41 1.8 3.92 1 1 
        474 1 . . . . .  4.1 1.8 4.72 1 1 
        475 1 . . . . . 4.66 1.8 5.36 1 1 
        476 1 . . . . . 4.61 1.8  5.3 1 1 
        477 1 . . . . . 3.24 1.8 3.73 1 1 
        478 1 . . . . . 2.98 1.8 3.43 1 1 
        479 1 . . . . . 3.91 1.8  4.5 1 1 
        480 1 . . . . . 3.88 1.8 4.46 1 1 
        481 1 . . . . . 3.53 1.8 4.06 1 1 
        482 1 . . . . .  3.9 1.8 4.49 1 1 
        483 1 . . . . .  4.8 1.8 5.52 1 1 
        484 1 . . . . . 3.99 1.8 4.59 1 1 
        485 1 . . . . . 3.66 1.8 4.21 1 1 
        486 1 . . . . . 3.57 1.8 4.11 1 1 
        487 1 . . . . .  3.3 1.8  3.8 1 1 
        488 1 . . . . . 4.19 1.8 4.82 1 1 
        489 1 . . . . . 3.93 1.8 4.52 1 1 
        490 1 . . . . . 4.28 1.8 4.92 1 1 
        491 1 . . . . . 3.81 1.8 4.38 1 1 
        492 1 . . . . . 5.29 1.8 6.08 1 1 
        493 1 . . . . .  4.0 1.8  4.6 1 1 
        494 1 . . . . . 4.07 1.8 4.68 1 1 
        495 1 . . . . . 4.49 1.8 5.16 1 1 
        496 1 . . . . . 4.12 1.8 4.74 1 1 
        497 1 . . . . . 5.23 1.8 6.01 1 1 
        498 1 . . . . . 3.73 1.8 4.29 1 1 
        499 1 . . . . . 3.97 1.8 4.57 1 1 
        500 1 . . . . . 3.67 1.8 4.22 1 1 
        501 1 . . . . . 3.96 1.8 4.55 1 1 
        502 1 . . . . . 5.22 1.8  6.0 1 1 
        503 1 . . . . . 4.18 1.8 4.81 1 1 
        504 1 . . . . . 4.47 1.8 5.14 1 1 
        505 1 . . . . . 4.07 1.8 4.68 1 1 
        506 1 . . . . . 3.62 1.8 4.16 1 1 
        507 1 . . . . . 3.53 1.8 4.06 1 1 
        508 1 . . . . .  4.0 1.8  4.6 1 1 
        509 1 . . . . . 4.12 1.8 4.74 1 1 
        510 1 . . . . . 3.15 1.8 3.62 1 1 
        511 1 . . . . . 4.22 1.8 4.85 1 1 
        512 1 . . . . .  5.5 1.8 6.33 1 1 
        513 1 . . . . .  5.5 1.8 6.33 1 1 
        514 1 . . . . .  3.3 1.8  3.8 1 1 
        515 1 . . . . . 3.93 1.8 4.52 1 1 
        516 1 . . . . . 3.86 1.8 4.44 1 1 
        517 1 . . . . . 3.52 1.8 4.05 1 1 
        518 1 . . . . . 3.92 1.8 4.51 1 1 
        519 1 . . . . .  4.2 1.8 4.83 1 1 
        520 1 . . . . .  3.5 1.8 4.03 1 1 
        521 1 . . . . . 4.29 1.8 4.93 1 1 
        522 1 . . . . . 3.67 1.8 4.22 1 1 
        523 1 . . . . . 3.95 1.8 4.54 1 1 
        524 1 . . . . . 3.51 1.8 4.04 1 1 
        525 1 . . . . . 3.59 1.8 4.13 1 1 
        526 1 . . . . . 4.39 1.8 5.05 1 1 
        527 1 . . . . . 4.16 1.8 4.78 1 1 
        528 1 . . . . . 3.73 1.8 4.29 1 1 
        529 1 . . . . . 3.67 1.8 4.22 1 1 
        530 1 . . . . . 4.11 1.8 4.73 1 1 
        531 1 . . . . . 4.01 1.8 4.61 1 1 
        532 1 . . . . . 3.87 1.8 4.45 1 1 
        533 1 . . . . . 4.23 1.8 4.86 1 1 
        534 1 . . . . . 4.02 1.8 4.62 1 1 
        535 1 . . . . . 4.26 1.8  4.9 1 1 
        536 1 . . . . . 3.99 1.8 4.59 1 1 
        537 1 . . . . . 3.95 1.8 4.54 1 1 
        538 1 . . . . . 4.71 1.8 5.42 1 1 
        539 1 . . . . . 3.52 1.8 4.05 1 1 
        540 1 . . . . . 3.71 1.8 4.27 1 1 
        541 1 . . . . . 4.35 1.8  5.0 1 1 
        542 1 . . . . . 4.18 1.8 4.81 1 1 
        543 1 . . . . . 4.48 1.8 5.15 1 1 
        544 1 . . . . . 3.67 1.8 4.22 1 1 
        545 1 . . . . . 3.97 1.8 4.57 1 1 
        546 1 . . . . . 3.73 1.8 4.29 1 1 
        547 1 . . . . . 4.47 1.8 5.14 1 1 
        548 1 . . . . . 3.33 1.8 3.83 1 1 
        549 1 . . . . . 4.58 1.8 5.27 1 1 
        550 1 . . . . . 3.55 1.8 4.08 1 1 
        551 1 . . . . . 3.48 1.8  4.0 1 1 
        552 1 . . . . . 3.18 1.8 3.66 1 1 
        553 1 . . . . . 4.46 1.8 5.13 1 1 
        554 1 . . . . . 4.11 1.8 4.73 1 1 
        555 1 . . . . . 3.33 1.8 3.83 1 1 
        556 1 . . . . . 4.43 1.8 5.09 1 1 
        557 1 . . . . . 5.46 1.8 6.28 1 1 
        558 1 . . . . . 3.53 1.8 4.06 1 1 
        559 1 . . . . . 4.62 1.8 5.31 1 1 
        560 1 . . . . . 3.44 1.8 3.96 1 1 
        561 1 . . . . . 4.92 1.8 5.66 1 1 
        562 1 . . . . .  4.4 1.8 5.06 1 1 
        563 1 . . . . . 3.86 1.8 4.44 1 1 
        564 1 . . . . . 3.15 1.8 3.62 1 1 
        565 1 . . . . . 4.04 1.8 4.65 1 1 
        566 1 . . . . . 5.11 1.8 5.88 1 1 
        567 1 . . . . . 4.49 1.8 5.16 1 1 
        568 1 . . . . . 3.46 1.8 3.98 1 1 
        569 1 . . . . . 4.39 1.8 5.05 1 1 
        570 1 . . . . . 4.63 1.8 5.32 1 1 
        571 1 . . . . .  4.0 1.8  4.6 1 1 
        572 1 . . . . . 4.32 1.8 4.97 1 1 
        573 1 . . . . . 3.77 1.8 4.34 1 1 
        574 1 . . . . . 4.38 1.8 5.04 1 1 
        575 1 . . . . .  5.4 1.8 6.21 1 1 
        576 1 . . . . . 3.87 1.8 4.45 1 1 
        577 1 . . . . . 3.77 1.8 4.34 1 1 
        578 1 . . . . . 4.34 1.8 4.99 1 1 
        579 1 . . . . . 4.58 1.8 5.27 1 1 
        580 1 . . . . . 4.26 1.8  4.9 1 1 
        581 1 . . . . . 4.46 1.8 5.13 1 1 
        582 1 . . . . . 4.23 1.8 4.86 1 1 
        583 1 . . . . . 4.71 1.8 5.42 1 1 
        584 1 . . . . . 5.02 1.8 5.77 1 1 
        585 1 . . . . . 4.59 1.8 5.28 1 1 
        586 1 . . . . . 3.62 1.8 4.16 1 1 
        587 1 . . . . . 4.66 1.8 5.36 1 1 
        588 1 . . . . . 4.85 1.8 5.58 1 1 
        589 1 . . . . .  4.5 1.8 5.18 1 1 
        590 1 . . . . . 4.45 1.8 5.12 1 1 
        591 1 . . . . . 3.38 1.8 3.89 1 1 
        592 1 . . . . . 3.94 1.8 4.53 1 1 
        593 1 . . . . .  5.5 1.8 6.33 1 1 
        594 1 . . . . .  4.6 1.8 5.29 1 1 
        595 1 . . . . . 4.89 1.8 5.62 1 1 
        596 1 . . . . . 4.81 1.8 5.53 1 1 
        597 1 . . . . . 4.23 1.8 4.86 1 1 
        598 1 . . . . . 4.73 1.8 5.44 1 1 
        599 1 . . . . . 5.11 1.8 5.88 1 1 
        600 1 . . . . .  3.0 1.8 3.45 1 1 
        601 1 . . . . . 3.55 1.8 4.08 1 1 
        602 1 . . . . . 3.79 1.8 4.36 1 1 
        603 1 . . . . . 4.39 1.8 5.05 1 1 
        604 1 . . . . . 3.57 1.8 4.11 1 1 
        605 1 . . . . . 5.31 1.8 6.11 1 1 
        606 1 . . . . . 3.79 1.8 4.36 1 1 
        607 1 . . . . . 4.07 1.8 4.68 1 1 
        608 1 . . . . .  3.3 1.8  3.8 1 1 
        609 1 . . . . . 3.82 1.8 4.39 1 1 
        610 1 . . . . .  5.3 1.8  6.1 1 1 
        611 1 . . . . . 4.01 1.8 4.61 1 1 
        612 1 . . . . . 4.82 1.8 5.54 1 1 
        613 1 . . . . . 4.82 1.8 5.54 1 1 
        614 1 . . . . . 4.57 1.8 5.26 1 1 
        615 1 . . . . . 4.15 1.8 4.77 1 1 
        616 1 . . . . .  5.5 1.8 6.33 1 1 
        617 1 . . . . . 3.88 1.8 4.46 1 1 
        618 1 . . . . . 3.88 1.8 4.46 1 1 
        619 1 . . . . . 4.44 1.8 5.11 1 1 
        620 1 . . . . . 4.64 1.8 5.34 1 1 
        621 1 . . . . . 3.23 1.8 3.71 1 1 
        622 1 . . . . . 3.46 1.8 3.98 1 1 
        623 1 . . . . . 3.22 1.8  3.7 1 1 
        624 1 . . . . . 3.52 1.8 4.05 1 1 
        625 1 . . . . . 3.52 1.8 4.05 1 1 
        626 1 . . . . . 4.15 1.8 4.77 1 1 
        627 1 . . . . .  3.3 1.8  3.8 1 1 
        628 1 . . . . . 4.72 1.8 5.43 1 1 
        629 1 . . . . . 3.65 1.8  4.2 1 1 
        630 1 . . . . . 4.44 1.8 5.11 1 1 
        631 1 . . . . . 3.54 1.8 4.07 1 1 
        632 1 . . . . . 4.52 1.8  5.2 1 1 
        633 1 . . . . .  4.8 1.8 5.52 1 1 
        634 1 . . . . .  5.5 1.8 6.33 1 1 
        635 1 . . . . . 4.69 1.8 5.39 1 1 
        636 1 . . . . . 4.52 1.8  5.2 1 1 
        637 1 . . . . . 3.96 1.8 4.55 1 1 
        638 1 . . . . .  4.9 1.8 5.64 1 1 
        639 1 . . . . . 4.15 1.8 4.77 1 1 
        640 1 . . . . . 4.15 1.8 4.77 1 1 
        641 1 . . . . . 3.76 1.8 4.32 1 1 
        642 1 . . . . . 3.32 1.8 3.82 1 1 
        643 1 . . . . . 5.09 1.8 5.85 1 1 
        644 1 . . . . . 3.72 1.8 4.28 1 1 
        645 1 . . . . . 3.72 1.8 4.28 1 1 
        646 1 . . . . . 4.28 1.8 4.92 1 1 
        647 1 . . . . . 4.21 1.8 4.84 1 1 
        648 1 . . . . . 5.13 1.8  5.9 1 1 
        649 1 . . . . . 3.34 1.8 3.84 1 1 
        650 1 . . . . . 3.96 1.8 4.55 1 1 
        651 1 . . . . .  3.3 1.8  3.8 1 1 
        652 1 . . . . . 4.27 1.8 4.91 1 1 
        653 1 . . . . . 3.67 1.8 4.22 1 1 
        654 1 . . . . . 4.07 1.8 4.68 1 1 
        655 1 . . . . . 3.67 1.8 4.22 1 1 
        656 1 . . . . .  2.9 1.8 3.34 1 1 
        657 1 . . . . .  4.2 1.8 4.83 1 1 
        658 1 . . . . .  4.2 1.8 4.83 1 1 
        659 1 . . . . . 4.79 1.8 5.51 1 1 
        660 1 . . . . . 3.54 1.8 4.07 1 1 
        661 1 . . . . . 3.83 1.8  4.4 1 1 
        662 1 . . . . . 3.98 1.8 4.58 1 1 
        663 1 . . . . . 4.04 1.8 4.65 1 1 
        664 1 . . . . . 4.03 1.8 4.63 1 1 
        665 1 . . . . . 3.76 1.8 4.32 1 1 
        666 1 . . . . . 3.76 1.8 4.32 1 1 
        667 1 . . . . . 4.45 1.8 5.12 1 1 
        668 1 . . . . . 3.98 1.8 4.58 1 1 
        669 1 . . . . . 3.65 1.8  4.2 1 1 
        670 1 . . . . . 4.39 1.8 5.05 1 1 
        671 1 . . . . . 4.39 1.8 5.05 1 1 
        672 1 . . . . . 3.93 1.8 4.52 1 1 
        673 1 . . . . . 3.93 1.8 4.52 1 1 
        674 1 . . . . . 4.31 1.8 4.96 1 1 
        675 1 . . . . . 4.31 1.8 4.96 1 1 
        676 1 . . . . . 3.08 1.8 3.54 1 1 
        677 1 . . . . . 3.67 1.8 4.22 1 1 
        678 1 . . . . . 3.22 1.8  3.7 1 1 
        679 1 . . . . . 4.05 1.8 4.66 1 1 
        680 1 . . . . . 3.15 1.8 3.62 1 1 
        681 1 . . . . .  4.7 1.8  5.4 1 1 
        682 1 . . . . . 5.05 1.8 5.81 1 1 
        683 1 . . . . .  5.5 1.8 6.33 1 1 
        684 1 . . . . .  3.1 1.8 3.57 1 1 
        685 1 . . . . . 4.31 1.8 4.96 1 1 
        686 1 . . . . . 4.93 1.8 5.67 1 1 
        687 1 . . . . . 2.79 1.8 3.21 1 1 
        688 1 . . . . .  2.7 1.8 3.11 1 1 
        689 1 . . . . . 3.54 1.8 4.07 1 1 
        690 1 . . . . . 3.34 1.8 3.84 1 1 
        691 1 . . . . . 3.28 1.8 3.77 1 1 
        692 1 . . . . . 3.59 1.8 4.13 1 1 
        693 1 . . . . . 3.54 1.8 4.07 1 1 
        694 1 . . . . . 4.49 1.8 5.16 1 1 
        695 1 . . . . . 3.94 1.8 4.53 1 1 
        696 1 . . . . . 3.12 1.8 3.59 1 1 
        697 1 . . . . . 4.44 1.8 5.11 1 1 
        698 1 . . . . . 4.44 1.8 5.11 1 1 
        699 1 . . . . . 3.98 1.8 4.58 1 1 
        700 1 . . . . . 3.37 1.8 3.88 1 1 
        701 1 . . . . . 3.98 1.8 4.58 1 1 
        702 1 . . . . . 3.22 1.8  3.7 1 1 
        703 1 . . . . . 4.45 1.8 5.12 1 1 
        704 1 . . . . . 3.79 1.8 4.36 1 1 
        705 1 . . . . . 3.79 1.8 4.36 1 1 
        706 1 . . . . . 4.01 1.8 4.61 1 1 
        707 1 . . . . . 3.32 1.8 3.82 1 1 
        708 1 . . . . . 2.82 1.8 3.24 1 1 
        709 1 . . . . . 4.15 1.8 4.77 1 1 
        710 1 . . . . . 5.04 1.8  5.8 1 1 
        711 1 . . . . . 5.04 1.8  5.8 1 1 
        712 1 . . . . . 4.85 1.8 5.58 1 1 
        713 1 . . . . . 4.16 1.8 4.78 1 1 
        714 1 . . . . . 3.73 1.8 4.29 1 1 
        715 1 . . . . . 4.86 1.8 5.59 1 1 
        716 1 . . . . . 2.58 1.8 2.97 1 1 
        717 1 . . . . . 4.54 1.8 5.22 1 1 
        718 1 . . . . . 5.15 1.8 5.92 1 1 
        719 1 . . . . . 3.59 1.8 4.13 1 1 
        720 1 . . . . . 3.93 1.8 4.52 1 1 
        721 1 . . . . . 4.82 1.8 5.54 1 1 
        722 1 . . . . . 4.18 1.8 4.81 1 1 
        723 1 . . . . . 3.44 1.8 3.96 1 1 
        724 1 . . . . . 4.02 1.8 4.62 1 1 
        725 1 . . . . . 4.93 1.8 5.67 1 1 
        726 1 . . . . . 3.57 1.8 4.11 1 1 
        727 1 . . . . . 3.57 1.8 4.11 1 1 
        728 1 . . . . . 4.93 1.8 5.67 1 1 
        729 1 . . . . . 3.61 1.8 4.15 1 1 
        730 1 . . . . . 5.15 1.8 5.92 1 1 
        731 1 . . . . . 5.46 1.8 6.28 1 1 
        732 1 . . . . . 3.69 1.8 4.24 1 1 
        733 1 . . . . .  4.7 1.8  5.4 1 1 
        734 1 . . . . . 4.04 1.8 4.65 1 1 
        735 1 . . . . . 3.01 1.8 3.46 1 1 
        736 1 . . . . .  3.0 1.8 3.45 1 1 
        737 1 . . . . . 3.14 1.8 3.61 1 1 
        738 1 . . . . . 4.12 1.8 4.74 1 1 
        739 1 . . . . .  3.3 1.8  3.8 1 1 
        740 1 . . . . . 3.42 1.8 3.93 1 1 
        741 1 . . . . . 4.69 1.8 5.39 1 1 
        742 1 . . . . . 5.34 1.8 6.14 1 1 
        743 1 . . . . . 4.36 1.8 5.01 1 1 
        744 1 . . . . .  5.5 1.8 6.33 1 1 
        745 1 . . . . .  5.5 1.8 6.33 1 1 
        746 1 . . . . . 5.07 1.8 5.83 1 1 
        747 1 . . . . . 4.97 1.8 5.72 1 1 
        748 1 . . . . . 3.53 1.8 4.06 1 1 
        749 1 . . . . . 3.74 1.8  4.3 1 1 
        750 1 . . . . . 3.26 1.8 3.75 1 1 
        751 1 . . . . . 4.58 1.8 5.27 1 1 
        752 1 . . . . . 4.03 1.8 4.63 1 1 
        753 1 . . . . . 3.28 1.8 3.77 1 1 
        754 1 . . . . . 3.17 1.8 3.65 1 1 
        755 1 . . . . . 3.97 1.8 4.57 1 1 
        756 1 . . . . . 5.29 1.8 6.08 1 1 
        757 1 . . . . . 3.96 1.8 4.55 1 1 
        758 1 . . . . . 3.96 1.8 4.55 1 1 
        759 1 . . . . . 5.44 1.8 6.26 1 1 
        760 1 . . . . . 4.11 1.8 4.73 1 1 
        761 1 . . . . . 2.93 1.8 3.37 1 1 
        762 1 . . . . . 4.81 1.8 5.53 1 1 
        763 1 . . . . . 5.04 1.8  5.8 1 1 
        764 1 . . . . . 4.25 1.8 4.89 1 1 
        765 1 . . . . . 4.47 1.8 5.14 1 1 
        766 1 . . . . . 4.45 1.8 5.12 1 1 
        767 1 . . . . . 4.45 1.8 5.12 1 1 
        768 1 . . . . . 4.97 1.8 5.72 1 1 
        769 1 . . . . . 4.21 1.8 4.84 1 1 
        770 1 . . . . . 4.21 1.8 4.84 1 1 
        771 1 . . . . . 3.63 1.8 4.17 1 1 
        772 1 . . . . .  5.3 1.8  6.1 1 1 
        773 1 . . . . . 3.63 1.8 4.17 1 1 
        774 1 . . . . . 3.98 1.8 4.58 1 1 
        775 1 . . . . . 3.58 1.8 4.12 1 1 
        776 1 . . . . . 3.81 1.8 4.38 1 1 
        777 1 . . . . . 4.63 1.8 5.32 1 1 
        778 1 . . . . . 3.92 1.8 4.51 1 1 
        779 1 . . . . .  5.5 1.8 6.33 1 1 
        780 1 . . . . .  5.5 1.8 6.33 1 1 
        781 1 . . . . . 3.62 1.8 4.16 1 1 
        782 1 . . . . . 4.63 1.8 5.32 1 1 
        783 1 . . . . . 3.99 1.8 4.59 1 1 
        784 1 . . . . . 3.04 1.8  3.5 1 1 
        785 1 . . . . . 4.07 1.8 4.68 1 1 
        786 1 . . . . .  4.2 1.8 4.83 1 1 
        787 1 . . . . . 5.13 1.8  5.9 1 1 
        788 1 . . . . . 4.34 1.8 4.99 1 1 
        789 1 . . . . . 4.31 1.8 4.96 1 1 
        790 1 . . . . . 4.04 1.8 4.65 1 1 
        791 1 . . . . . 3.77 1.8 4.34 1 1 
        792 1 . . . . . 4.59 1.8 5.28 1 1 
        793 1 . . . . . 5.33 1.8 6.13 1 1 
        794 1 . . . . . 5.49 1.8 6.31 1 1 
        795 1 . . . . .  5.5 1.8 6.33 1 1 
        796 1 . . . . . 4.63 1.8 5.32 1 1 
        797 1 . . . . . 4.25 1.8 4.89 1 1 
        798 1 . . . . . 5.35 1.8 6.15 1 1 
        799 1 . . . . . 4.33 1.8 4.98 1 1 
        800 1 . . . . . 4.58 1.8 5.27 1 1 
        801 1 . . . . . 3.34 1.8 3.84 1 1 
        802 1 . . . . .  3.5 1.8 4.03 1 1 
        803 1 . . . . . 3.58 1.8 4.12 1 1 
        804 1 . . . . . 4.07 1.8 4.68 1 1 
        805 1 . . . . .  4.3 1.8 4.95 1 1 
        806 1 . . . . . 4.62 1.8 5.31 1 1 
        807 1 . . . . . 3.47 1.8 3.99 1 1 
        808 1 . . . . . 4.61 1.8  5.3 1 1 
        809 1 . . . . . 3.74 1.8  4.3 1 1 
        810 1 . . . . . 4.89 1.8 5.62 1 1 
        811 1 . . . . . 4.55 1.8 5.23 1 1 
        812 1 . . . . . 3.98 1.8 4.58 1 1 
        813 1 . . . . . 5.22 1.8  6.0 1 1 
        814 1 . . . . . 3.68 1.8 4.23 1 1 
        815 1 . . . . . 3.55 1.8 4.08 1 1 
        816 1 . . . . . 4.72 1.8 5.43 1 1 
        817 1 . . . . . 3.39 1.8  3.9 1 1 
        818 1 . . . . . 4.25 1.8 4.89 1 1 
        819 1 . . . . . 4.53 1.8 5.21 1 1 
        820 1 . . . . . 3.49 1.8 4.01 1 1 
        821 1 . . . . .  3.4 1.8 3.91 1 1 
        822 1 . . . . .  3.4 1.8 3.91 1 1 
        823 1 . . . . . 3.84 1.8 4.42 1 1 
        824 1 . . . . . 4.37 1.8 5.03 1 1 
        825 1 . . . . . 4.35 1.8  5.0 1 1 
        826 1 . . . . . 4.26 1.8  4.9 1 1 
        827 1 . . . . .  3.4 1.8 3.91 1 1 
        828 1 . . . . . 4.01 1.8 4.61 1 1 
        829 1 . . . . . 3.32 1.8 3.82 1 1 
        830 1 . . . . . 5.37 1.8 6.18 1 1 
        831 1 . . . . . 3.52 1.8 4.05 1 1 
        832 1 . . . . . 4.57 1.8 5.26 1 1 
        833 1 . . . . . 2.97 1.8 3.42 1 1 
        834 1 . . . . . 4.28 1.8 4.92 1 1 
        835 1 . . . . . 3.98 1.8 4.58 1 1 
        836 1 . . . . . 4.05 1.8 4.66 1 1 
        837 1 . . . . . 3.15 1.8 3.62 1 1 
        838 1 . . . . . 3.15 1.8 3.62 1 1 
        839 1 . . . . . 4.15 1.8 4.77 1 1 
        840 1 . . . . . 3.56 1.8 4.09 1 1 
        841 1 . . . . . 3.56 1.8 4.09 1 1 
        842 1 . . . . . 4.51 1.8 5.19 1 1 
        843 1 . . . . . 4.14 1.8 4.76 1 1 
        844 1 . . . . . 4.14 1.8 4.76 1 1 
        845 1 . . . . . 3.97 1.8 4.57 1 1 
        846 1 . . . . . 4.02 1.8 4.62 1 1 
        847 1 . . . . . 4.54 1.8 5.22 1 1 
        848 1 . . . . . 4.68 1.8 5.38 1 1 
        849 1 . . . . .  5.5 1.8 6.33 1 1 
        850 1 . . . . . 4.42 1.8 5.08 1 1 
        851 1 . . . . . 3.17 1.8 3.65 1 1 
        852 1 . . . . . 4.42 1.8 5.08 1 1 
        853 1 . . . . . 3.51 1.8 4.04 1 1 
        854 1 . . . . . 4.14 1.8 4.76 1 1 
        855 1 . . . . . 4.14 1.8 4.76 1 1 
        856 1 . . . . . 5.13 1.8  5.9 1 1 
        857 1 . . . . . 5.27 1.8 6.06 1 1 
        858 1 . . . . . 3.72 1.8 4.28 1 1 
        859 1 . . . . . 4.52 1.8  5.2 1 1 
        860 1 . . . . . 3.91 1.8  4.5 1 1 
        861 1 . . . . .  4.1 1.8 4.72 1 1 
        862 1 . . . . .  4.1 1.8 4.72 1 1 
        863 1 . . . . . 4.37 1.8 5.03 1 1 
        864 1 . . . . .  5.5 1.8 6.33 1 1 
        865 1 . . . . . 4.93 1.8 5.67 1 1 
        866 1 . . . . . 4.12 1.8 4.74 1 1 
        867 1 . . . . . 4.96 1.8  5.7 1 1 
        868 1 . . . . . 5.17 1.8 5.95 1 1 
        869 1 . . . . . 4.07 1.8 4.68 1 1 
        870 1 . . . . . 4.79 1.8 5.51 1 1 
        871 1 . . . . .  4.0 1.8  4.6 1 1 
        872 1 . . . . . 4.54 1.8 5.22 1 1 
        873 1 . . . . . 4.47 1.8 5.14 1 1 
        874 1 . . . . . 3.99 1.8 4.59 1 1 
        875 1 . . . . . 4.39 1.8 5.05 1 1 
        876 1 . . . . .  3.5 1.8 4.03 1 1 
        877 1 . . . . . 3.35 1.8 3.85 1 1 
        878 1 . . . . . 3.53 1.8 4.06 1 1 
        879 1 . . . . . 3.53 1.8 4.06 1 1 
        880 1 . . . . . 4.56 1.8 5.24 1 1 
        881 1 . . . . .  3.7 1.8 4.26 1 1 
        882 1 . . . . . 3.37 1.8 3.88 1 1 
        883 1 . . . . . 3.29 1.8 3.78 1 1 
        884 1 . . . . . 4.84 1.8 5.57 1 1 
        885 1 . . . . .  5.5 1.8 6.33 1 1 
        886 1 . . . . . 4.49 1.8 5.16 1 1 
        887 1 . . . . . 3.25 1.8 3.74 1 1 
        888 1 . . . . . 5.25 1.8 6.04 1 1 
        889 1 . . . . .  3.6 1.8 4.14 1 1 
        890 1 . . . . .  3.8 1.8 4.37 1 1 
        891 1 . . . . . 4.77 1.8 5.49 1 1 
        892 1 . . . . .  5.5 1.8 6.33 1 1 
        893 1 . . . . . 5.39 1.8  6.2 1 1 
        894 1 . . . . . 5.02 1.8 5.77 1 1 
        895 1 . . . . . 4.55 1.8 5.23 1 1 
        896 1 . . . . . 4.55 1.8 5.23 1 1 
        897 1 . . . . . 4.13 1.8 4.75 1 1 
        898 1 . . . . . 3.04 1.8  3.5 1 1 
        899 1 . . . . . 3.47 1.8 3.99 1 1 
        900 1 . . . . . 3.64 1.8 4.19 1 1 
        901 1 . . . . . 4.51 1.8 5.19 1 1 
        902 1 . . . . . 2.53 1.8 2.91 1 1 
        903 1 . . . . . 4.51 1.8 5.19 1 1 
        904 1 . . . . . 3.49 1.8 4.01 1 1 
        905 1 . . . . . 3.49 1.8 4.01 1 1 
        906 1 . . . . . 5.34 1.8 6.14 1 1 
        907 1 . . . . . 5.21 1.8 5.99 1 1 
        908 1 . . . . . 5.21 1.8 5.99 1 1 
        909 1 . . . . . 3.61 1.8 4.15 1 1 
        910 1 . . . . . 4.31 1.8 4.96 1 1 
        911 1 . . . . .  3.1 1.8 3.57 1 1 
        912 1 . . . . . 3.82 1.8 4.39 1 1 
        913 1 . . . . . 4.59 1.8 5.28 1 1 
        914 1 . . . . . 2.82 1.8 3.24 1 1 
        915 1 . . . . . 4.32 1.8 4.97 1 1 
        916 1 . . . . . 3.11 1.8 3.58 1 1 
        917 1 . . . . . 3.07 1.8 3.53 1 1 
        918 1 . . . . . 3.82 1.8 4.39 1 1 
        919 1 . . . . . 4.36 1.8 5.01 1 1 
        920 1 . . . . . 3.74 1.8  4.3 1 1 
        921 1 . . . . . 3.29 1.8 3.78 1 1 
        922 1 . . . . . 4.19 1.8 4.82 1 1 
        923 1 . . . . . 5.48 1.8  6.3 1 1 
        924 1 . . . . .  5.5 1.8 6.33 1 1 
        925 1 . . . . . 3.79 1.8 4.36 1 1 
        926 1 . . . . . 4.66 1.8 5.36 1 1 
        927 1 . . . . . 5.08 1.8 5.84 1 1 
        928 1 . . . . . 5.21 1.8 5.99 1 1 
        929 1 . . . . .  5.5 1.8 6.33 1 1 
        930 1 . . . . . 4.45 1.8 5.12 1 1 
        931 1 . . . . . 4.62 1.8 5.31 1 1 
        932 1 . . . . . 4.07 1.8 4.68 1 1 
        933 1 . . . . . 4.54 1.8 5.22 1 1 
        934 1 . . . . . 4.01 1.8 4.61 1 1 
        935 1 . . . . . 4.29 1.8 4.93 1 1 
        936 1 . . . . . 3.51 1.8 4.04 1 1 
        937 1 . . . . . 3.51 1.8 4.04 1 1 
        938 1 . . . . . 4.74 1.8 5.45 1 1 
        939 1 . . . . . 4.03 1.8 4.63 1 1 
        940 1 . . . . .  5.5 1.8 6.33 1 1 
        941 1 . . . . . 3.96 1.8 4.55 1 1 
        942 1 . . . . . 3.62 1.8 4.16 1 1 
        943 1 . . . . . 4.48 1.8 5.15 1 1 
        944 1 . . . . . 3.17 1.8 3.65 1 1 
        945 1 . . . . . 3.58 1.8 4.12 1 1 
        946 1 . . . . . 4.64 1.8 5.34 1 1 
        947 1 . . . . .  5.5 1.8 6.33 1 1 
        948 1 . . . . .  5.5 1.8 6.33 1 1 
        949 1 . . . . . 3.85 1.8 4.43 1 1 
        950 1 . . . . . 4.44 1.8 5.11 1 1 
        951 1 . . . . . 4.57 1.8 5.26 1 1 
        952 1 . . . . . 3.16 1.8 3.63 1 1 
        953 1 . . . . . 3.58 1.8 4.12 1 1 
        954 1 . . . . . 5.17 1.8 5.95 1 1 
        955 1 . . . . . 4.28 1.8 4.92 1 1 
        956 1 . . . . . 4.86 1.8 5.59 1 1 
        957 1 . . . . . 4.51 1.8 5.19 1 1 
        958 1 . . . . . 4.78 1.8  5.5 1 1 
        959 1 . . . . . 5.02 1.8 5.77 1 1 
        960 1 . . . . .  5.2 1.8 5.98 1 1 
        961 1 . . . . . 4.15 1.8 4.77 1 1 
        962 1 . . . . . 4.26 1.8  4.9 1 1 
        963 1 . . . . . 3.48 1.8  4.0 1 1 
        964 1 . . . . . 3.33 1.8 3.83 1 1 
        965 1 . . . . . 4.16 1.8 4.78 1 1 
        966 1 . . . . . 4.99 1.8 5.74 1 1 
        967 1 . . . . .  3.6 1.8 4.14 1 1 
        968 1 . . . . . 4.26 1.8  4.9 1 1 
        969 1 . . . . . 4.92 1.8 5.66 1 1 
        970 1 . . . . . 4.51 1.8 5.19 1 1 
        971 1 . . . . . 3.52 1.8 4.05 1 1 
        972 1 . . . . . 4.86 1.8 5.59 1 1 
        973 1 . . . . . 3.99 1.8 4.59 1 1 
        974 1 . . . . . 4.18 1.8 4.81 1 1 
        975 1 . . . . . 2.94 1.8 3.38 1 1 
        976 1 . . . . . 4.53 1.8 5.21 1 1 
        977 1 . . . . . 4.07 1.8 4.68 1 1 
        978 1 . . . . . 5.17 1.8 5.95 1 1 
        979 1 . . . . . 3.49 1.8 4.01 1 1 
        980 1 . . . . . 3.71 1.8 4.27 1 1 
        981 1 . . . . . 4.09 1.8  4.7 1 1 
        982 1 . . . . . 4.42 1.8 5.08 1 1 
        983 1 . . . . . 4.45 1.8 5.12 1 1 
        984 1 . . . . . 4.57 1.8 5.26 1 1 
        985 1 . . . . . 3.46 1.8 3.98 1 1 
        986 1 . . . . . 4.34 1.8 4.99 1 1 
        987 1 . . . . . 4.18 1.8 4.81 1 1 
        988 1 . . . . . 2.96 1.8  3.4 1 1 
        989 1 . . . . . 4.96 1.8  5.7 1 1 
        990 1 . . . . . 4.52 1.8  5.2 1 1 
        991 1 . . . . . 5.48 1.8  6.3 1 1 
        992 1 . . . . .  5.5 1.8 6.33 1 1 
        993 1 . . . . . 4.28 1.8 4.92 1 1 
        994 1 . . . . . 3.19 1.8 3.67 1 1 
        995 1 . . . . . 4.86 1.8 5.59 1 1 
        996 1 . . . . . 3.71 1.8 4.27 1 1 
        997 1 . . . . .  5.3 1.8  6.1 1 1 
        998 1 . . . . . 4.53 1.8 5.21 1 1 
        999 1 . . . . . 3.44 1.8 3.96 1 1 
       1000 1 . . . . . 4.34 1.8 4.99 1 1 
       1001 1 . . . . . 5.03 1.8 5.78 1 1 
       1002 1 . . . . . 4.17 1.8  4.8 1 1 
       1003 1 . . . . . 4.05 1.8 4.66 1 1 
       1004 1 . . . . . 5.32 1.8 6.12 1 1 
       1005 1 . . . . .  5.5 1.8 6.33 1 1 
       1006 1 . . . . . 3.51 1.8 4.04 1 1 
       1007 1 . . . . . 4.52 1.8  5.2 1 1 
       1008 1 . . . . . 4.66 1.8 5.36 1 1 
       1009 1 . . . . . 4.04 1.8 4.65 1 1 
       1010 1 . . . . . 3.65 1.8  4.2 1 1 
       1011 1 . . . . . 3.74 1.8  4.3 1 1 
       1012 1 . . . . .  4.0 1.8  4.6 1 1 
       1013 1 . . . . . 4.65 1.8 5.35 1 1 
       1014 1 . . . . . 4.32 1.8 4.97 1 1 
       1015 1 . . . . . 4.56 1.8 5.24 1 1 
       1016 1 . . . . . 3.88 1.8 4.01 1 1 
       1017 1 . . . . . 5.26 1.8 6.05 1 1 
       1018 1 . . . . . 4.68 1.8 5.38 1 1 
       1019 1 . . . . . 5.15 1.8 5.92 1 1 
       1020 1 . . . . . 3.86 1.8 4.44 1 1 
       1021 1 . . . . . 3.96 1.8 4.55 1 1 
       1022 1 . . . . . 4.47 1.8 5.14 1 1 
       1023 1 . . . . . 4.72 1.8 5.43 1 1 
       1024 1 . . . . . 3.59 1.8 4.13 1 1 
       1025 1 . . . . . 3.66 1.8 4.21 1 1 
       1026 1 . . . . . 3.46 1.8 3.98 1 1 
       1027 1 . . . . . 3.96 1.8 4.55 1 1 
       1028 1 . . . . . 4.85 1.8 5.58 1 1 
       1029 1 . . . . . 3.73 1.8 4.29 1 1 
       1030 1 . . . . . 4.24 1.8 4.88 1 1 
       1031 1 . . . . . 3.84 1.8 4.42 1 1 
       1032 1 . . . . . 4.14 1.8 4.76 1 1 
       1033 1 . . . . . 3.78 1.8 4.35 1 1 
       1034 1 . . . . . 3.57 1.8 4.11 1 1 
       1035 1 . . . . . 3.25 1.8 3.74 1 1 
       1036 1 . . . . . 3.94 1.8 4.53 1 1 
       1037 1 . . . . . 4.44 1.8 5.11 1 1 
       1038 1 . . . . . 4.66 1.8 5.36 1 1 
       1039 1 . . . . .  3.8 1.8 4.37 1 1 
       1040 1 . . . . . 4.93 1.8 5.67 1 1 
       1041 1 . . . . . 4.93 1.8 5.67 1 1 
       1042 1 . . . . . 4.93 1.8 5.67 1 1 
       1043 1 . . . . . 3.72 1.8 4.28 1 1 
       1044 1 . . . . . 4.04 1.8 4.65 1 1 
       1045 1 . . . . . 3.78 1.8 4.35 1 1 
       1046 1 . . . . . 3.76 1.8 4.32 1 1 
       1047 1 . . . . . 4.87 1.8  5.6 1 1 
       1048 1 . . . . . 5.38 1.8 6.19 1 1 
       1049 1 . . . . . 4.45 1.8 5.12 1 1 
       1050 1 . . . . . 4.33 1.8 4.98 1 1 
       1051 1 . . . . . 4.16 1.8 4.78 1 1 
       1052 1 . . . . . 4.29 1.8 4.93 1 1 
       1053 1 . . . . . 3.58 1.8 4.12 1 1 
       1054 1 . . . . .  4.3 1.8 4.95 1 1 
       1055 1 . . . . . 4.39 1.8 5.05 1 1 
       1056 1 . . . . . 4.83 1.8 5.55 1 1 
       1057 1 . . . . . 4.92 1.8 5.66 1 1 
       1058 1 . . . . . 5.39 1.8  6.2 1 1 
       1059 1 . . . . .  5.5 1.8 6.33 1 1 
       1060 1 . . . . . 3.94 1.8 4.53 1 1 
       1061 1 . . . . . 3.88 1.8 4.46 1 1 
       1062 1 . . . . .  5.0 1.8 5.75 1 1 
       1063 1 . . . . .  5.5 1.8 6.33 1 1 
       1064 1 . . . . . 4.87 1.8  5.6 1 1 
       1065 1 . . . . .  5.5 1.8 6.33 1 1 
       1066 1 . . . . .  4.3 1.8 4.95 1 1 
       1067 1 . . . . .  4.0 1.8  4.6 1 1 
       1068 1 . . . . .  3.7 1.8 4.26 1 1 
       1069 1 . . . . . 4.03 1.8 4.63 1 1 
       1070 1 . . . . . 3.59 1.8 4.13 1 1 
       1071 1 . . . . . 3.98 1.8 4.58 1 1 
       1072 1 . . . . . 4.81 1.8 5.53 1 1 
       1073 1 . . . . .  4.8 1.8 5.52 1 1 
       1074 1 . . . . .  4.2 1.8 4.83 1 1 
       1075 1 . . . . . 3.81 1.8 4.38 1 1 
       1076 1 . . . . . 3.42 1.8 3.93 1 1 
       1077 1 . . . . . 3.39 1.8  3.9 1 1 
       1078 1 . . . . . 4.26 1.8  4.9 1 1 
       1079 1 . . . . . 4.67 1.8 5.37 1 1 
       1080 1 . . . . . 4.61 1.8  5.3 1 1 
       1081 1 . . . . . 3.73 1.8 4.29 1 1 
       1082 1 . . . . . 5.43 1.8 6.24 1 1 
       1083 1 . . . . . 4.51 1.8 5.19 1 1 
       1084 1 . . . . . 4.06 1.8 4.67 1 1 
       1085 1 . . . . . 4.59 1.8 5.28 1 1 
       1086 1 . . . . . 4.59 1.8 5.28 1 1 
       1087 1 . . . . . 4.14 1.8 4.76 1 1 
       1088 1 . . . . . 4.41 1.8 5.07 1 1 
       1089 1 . . . . . 4.89 1.8 5.62 1 1 
       1090 1 . . . . . 4.68 1.8 5.38 1 1 
       1091 1 . . . . . 3.66 1.8 4.21 1 1 
       1092 1 . . . . . 3.92 1.8 4.51 1 1 
       1093 1 . . . . . 4.13 1.8  4.6 1 1 
       1094 1 . . . . .  4.0 1.8  4.6 1 1 
       1095 1 . . . . . 5.16 1.8 5.93 1 1 
       1096 1 . . . . .  5.5 1.8 6.33 1 1 
       1097 1 . . . . . 3.94 1.8 4.53 1 1 
       1098 1 . . . . .  5.5 1.8 6.33 1 1 
       1099 1 . . . . . 5.32 1.8 6.12 1 1 
       1100 1 . . . . . 5.33 1.8 6.13 1 1 
       1101 1 . . . . .  4.7 1.8  5.4 1 1 
       1102 1 . . . . . 3.39 1.8  3.9 1 1 
       1103 1 . . . . . 4.67 1.8 5.37 1 1 
       1104 1 . . . . . 5.15 1.8 5.92 1 1 
       1105 1 . . . . . 5.01 1.8 5.76 1 1 
       1106 1 . . . . . 4.92 1.8 5.66 1 1 
       1107 1 . . . . . 5.01 1.8 5.76 1 1 
       1108 1 . . . . .  3.9 1.8 4.49 1 1 
       1109 1 . . . . . 4.97 1.8 5.72 1 1 
       1110 1 . . . . . 4.78 1.8  5.5 1 1 
       1111 1 . . . . . 5.07 1.8 5.83 1 1 
       1112 1 . . . . . 5.06 1.8 5.82 1 1 
       1113 1 . . . . . 4.36 1.8 5.01 1 1 
       1114 1 . . . . . 4.36 1.8 5.01 1 1 
       1115 1 . . . . .  5.5 1.8 6.33 1 1 
       1116 1 . . . . .  5.5 1.8 6.33 1 1 
       1117 1 . . . . . 4.61 1.8  5.3 1 1 
       1118 1 . . . . . 4.98 1.8 5.73 1 1 
       1119 1 . . . . .  4.0 1.8  4.6 1 1 
       1120 1 . . . . . 3.57 1.8 4.11 1 1 
       1121 1 . . . . . 4.56 1.8 5.24 1 1 
       1122 1 . . . . . 5.18 1.8 5.96 1 1 
       1123 1 . . . . . 4.19 1.8 4.82 1 1 
       1124 1 . . . . . 3.71 1.8 4.27 1 1 
       1125 1 . . . . . 3.71 1.8 4.27 1 1 
       1126 1 . . . . .  3.1 1.8 3.57 1 1 
       1127 1 . . . . . 3.61 1.8 4.15 1 1 
       1128 1 . . . . . 3.19 1.8 3.67 1 1 
       1129 1 . . . . .  2.8 1.8 3.22 1 1 
       1130 1 . . . . . 4.74 1.8 5.45 1 1 
       1131 1 . . . . . 2.76 1.8 3.17 1 1 
       1132 1 . . . . . 3.06 1.8 3.52 1 1 
       1133 1 . . . . .  4.5 1.8 5.18 1 1 
       1134 1 . . . . .  3.5 1.8 4.03 1 1 
       1135 1 . . . . . 3.23 1.8 3.71 1 1 
       1136 1 . . . . . 3.76 1.8 4.32 1 1 
       1137 1 . . . . .  4.1 1.8 4.72 1 1 
       1138 1 . . . . . 4.77 1.8 5.49 1 1 
       1139 1 . . . . . 3.14 1.8 3.61 1 1 
       1140 1 . . . . . 3.77 1.8 4.34 1 1 
       1141 1 . . . . . 3.59 1.8 4.13 1 1 
       1142 1 . . . . . 3.22 1.8  3.7 1 1 
       1143 1 . . . . . 5.26 1.8 6.05 1 1 
       1144 1 . . . . . 4.99 1.8 5.74 1 1 
       1145 1 . . . . . 4.17 1.8  4.8 1 1 
       1146 1 . . . . . 2.91 1.8 3.35 1 1 
       1147 1 . . . . . 3.57 1.8 4.11 1 1 
       1148 1 . . . . .  5.5 1.8 6.33 1 1 
       1149 1 . . . . . 2.93 1.8 3.37 1 1 
       1150 1 . . . . . 4.07 1.8 4.68 1 1 
       1151 1 . . . . . 3.55 1.8 4.08 1 1 
       1152 1 . . . . . 3.77 1.8 4.34 1 1 
       1153 1 . . . . . 4.55 1.8 5.23 1 1 
       1154 1 . . . . . 2.76 1.8 3.17 1 1 
       1155 1 . . . . . 3.41 1.8 3.92 1 1 
       1156 1 . . . . . 3.36 1.8 3.86 1 1 
       1157 1 . . . . . 3.38 1.8 3.89 1 1 
       1158 1 . . . . . 4.69 1.8 5.39 1 1 
       1159 1 . . . . . 3.23 1.8 3.71 1 1 
       1160 1 . . . . . 4.39 1.8 5.05 1 1 
       1161 1 . . . . .  3.1 1.8 3.57 1 1 
       1162 1 . . . . .  3.4 1.8 3.91 1 1 
       1163 1 . . . . . 4.82 1.8 5.54 1 1 
       1164 1 . . . . . 4.47 1.8 5.14 1 1 
       1165 1 . . . . . 4.74 1.8 5.45 1 1 
       1166 1 . . . . . 3.59 1.8 4.13 1 1 
       1167 1 . . . . .  4.2 1.8 4.83 1 1 
       1168 1 . . . . . 4.58 1.8 5.27 1 1 
       1169 1 . . . . . 3.93 1.8 4.52 1 1 
       1170 1 . . . . . 3.82 1.8 4.39 1 1 
       1171 1 . . . . . 3.55 1.8 4.08 1 1 
       1172 1 . . . . . 4.13 1.8 4.75 1 1 
       1173 1 . . . . . 3.58 1.8 4.12 1 1 
       1174 1 . . . . . 4.16 1.8 4.78 1 1 
       1175 1 . . . . . 4.58 1.8 5.27 1 1 
       1176 1 . . . . . 4.21 1.8 4.84 1 1 
       1177 1 . . . . . 3.11 1.8 3.58 1 1 
       1178 1 . . . . . 3.46 1.8 3.98 1 1 
       1179 1 . . . . . 3.61 1.8 4.15 1 1 
       1180 1 . . . . . 4.23 1.8 4.86 1 1 
       1181 1 . . . . .  4.2 1.8 4.83 1 1 
       1182 1 . . . . . 3.29 1.8 3.78 1 1 
       1183 1 . . . . . 3.82 1.8 4.39 1 1 
       1184 1 . . . . .  3.9 1.8 4.49 1 1 
       1185 1 . . . . . 4.16 1.8 4.78 1 1 
       1186 1 . . . . . 3.66 1.8 4.21 1 1 
       1187 1 . . . . . 4.83 1.8 5.55 1 1 
       1188 1 . . . . . 4.57 1.8 5.26 1 1 
       1189 1 . . . . . 4.02 1.8 4.62 1 1 
       1190 1 . . . . . 4.04 1.8 4.65 1 1 
       1191 1 . . . . . 4.11 1.8 4.73 1 1 
       1192 1 . . . . . 4.02 1.8 4.62 1 1 
       1193 1 . . . . . 4.41 1.8 5.07 1 1 
       1194 1 . . . . . 4.24 1.8 4.88 1 1 
       1195 1 . . . . . 3.93 1.8 4.52 1 1 
       1196 1 . . . . . 4.26 1.8  4.9 1 1 
       1197 1 . . . . . 4.99 1.8 5.74 1 1 
       1198 1 . . . . . 2.97 1.8 3.42 1 1 
       1199 1 . . . . . 3.24 1.8 3.73 1 1 
       1200 1 . . . . . 4.79 1.8 5.51 1 1 
       1201 1 . . . . . 3.84 1.8 4.42 1 1 
       1202 1 . . . . . 3.07 1.8 3.53 1 1 
       1203 1 . . . . . 3.23 1.8 3.71 1 1 
       1204 1 . . . . . 4.85 1.8 5.58 1 1 
       1205 1 . . . . . 4.52 1.8  5.2 1 1 
       1206 1 . . . . . 3.08 1.8 3.54 1 1 
       1207 1 . . . . . 4.15 1.8 4.77 1 1 
       1208 1 . . . . . 4.42 1.8 5.08 1 1 
       1209 1 . . . . . 4.18 1.8 4.81 1 1 
       1210 1 . . . . . 2.98 1.8 3.43 1 1 
       1211 1 . . . . . 4.44 1.8 5.11 1 1 
       1212 1 . . . . . 2.77 1.8 3.19 1 1 
       1213 1 . . . . . 3.52 1.8 4.05 1 1 
       1214 1 . . . . . 3.44 1.8 3.96 1 1 
       1215 1 . . . . . 3.08 1.8 3.54 1 1 
       1216 1 . . . . . 2.89 1.8 3.32 1 1 
       1217 1 . . . . . 3.48 1.8  4.0 1 1 
       1218 1 . . . . .  4.1 1.8 4.72 1 1 
       1219 1 . . . . . 3.85 1.8 4.43 1 1 
       1220 1 . . . . . 4.58 1.8 5.27 1 1 
       1221 1 . . . . . 4.41 1.8 5.07 1 1 
       1222 1 . . . . . 3.23 1.8 3.71 1 1 
       1223 1 . . . . . 4.11 1.8 4.73 1 1 
       1224 1 . . . . . 3.56 1.8 4.09 1 1 
       1225 1 . . . . . 4.21 1.8 4.84 1 1 
       1226 1 . . . . . 5.34 1.8 6.14 1 1 
       1227 1 . . . . . 4.21 1.8 4.84 1 1 
       1228 1 . . . . . 4.18 1.8 4.81 1 1 
       1229 1 . . . . . 2.85 1.8 3.28 1 1 
       1230 1 . . . . . 3.43 1.8 3.94 1 1 
       1231 1 . . . . . 5.16 1.8 5.93 1 1 
       1232 1 . . . . . 5.34 1.8 6.14 1 1 
       1233 1 . . . . .  3.3 1.8  3.8 1 1 
       1234 1 . . . . . 5.28 1.8 6.07 1 1 
       1235 1 . . . . . 4.27 1.8 4.91 1 1 
       1236 1 . . . . . 3.22 1.8  3.7 1 1 
       1237 1 . . . . . 3.17 1.8 3.65 1 1 
       1238 1 . . . . . 4.09 1.8  4.7 1 1 
       1239 1 . . . . . 3.02 1.8 3.47 1 1 
       1240 1 . . . . . 4.25 1.8 4.89 1 1 
       1241 1 . . . . . 3.55 1.8 4.08 1 1 
       1242 1 . . . . . 4.39 1.8 5.05 1 1 
       1243 1 . . . . .  4.1 1.8 4.72 1 1 
       1244 1 . . . . . 3.43 1.8 3.94 1 1 
       1245 1 . . . . . 3.22 1.8  3.7 1 1 
       1246 1 . . . . . 3.57 1.8 4.11 1 1 
       1247 1 . . . . . 3.88 1.8 4.46 1 1 
       1248 1 . . . . . 4.24 1.8 4.88 1 1 
       1249 1 . . . . . 3.07 1.8 3.53 1 1 
       1250 1 . . . . . 3.55 1.8 4.08 1 1 
       1251 1 . . . . . 5.22 1.8  6.0 1 1 
       1252 1 . . . . . 3.06 1.8 3.52 1 1 
       1253 1 . . . . . 3.81 1.8 4.38 1 1 
       1254 1 . . . . . 5.16 1.8 5.93 1 1 
       1255 1 . . . . . 2.98 1.8 3.43 1 1 
       1256 1 . . . . . 4.31 1.8 4.96 1 1 
       1257 1 . . . . . 2.93 1.8 3.37 1 1 
       1258 1 . . . . .  3.2 1.8 3.68 1 1 
       1259 1 . . . . . 4.26 1.8  4.9 1 1 
       1260 1 . . . . . 3.35 1.8 3.85 1 1 
       1261 1 . . . . . 4.46 1.8 5.13 1 1 
       1262 1 . . . . .  5.1 1.8 5.87 1 1 
       1263 1 . . . . . 4.88 1.8 5.61 1 1 
       1264 1 . . . . . 4.98 1.8 5.73 1 1 
       1265 1 . . . . . 3.37 1.8 3.88 1 1 
       1266 1 . . . . .  3.4 1.8 3.91 1 1 
       1267 1 . . . . . 3.38 1.8 3.89 1 1 
       1268 1 . . . . . 3.36 1.8 3.86 1 1 
       1269 1 . . . . . 3.72 1.8 4.28 1 1 
       1270 1 . . . . . 4.44 1.8 5.11 1 1 
       1271 1 . . . . . 4.81 1.8 5.53 1 1 
       1272 1 . . . . . 2.94 1.8 3.38 1 1 
       1273 1 . . . . . 3.56 1.8 4.09 1 1 
       1274 1 . . . . . 3.97 1.8 4.57 1 1 
       1275 1 . . . . . 3.84 1.8 4.42 1 1 
       1276 1 . . . . . 4.15 1.8 4.77 1 1 
       1277 1 . . . . . 3.99 1.8 4.59 1 1 
       1278 1 . . . . . 3.49 1.8 4.01 1 1 
       1279 1 . . . . . 4.44 1.8 5.11 1 1 
       1280 1 . . . . . 5.34 1.8 6.14 1 1 
       1281 1 . . . . . 3.36 1.8 3.86 1 1 
       1282 1 . . . . . 4.57 1.8 5.26 1 1 
       1283 1 . . . . . 5.34 1.8 6.14 1 1 
       1284 1 . . . . . 5.24 1.8 6.03 1 1 
       1285 1 . . . . . 2.59 1.8 2.98 1 1 
       1286 1 . . . . . 3.32 1.8 3.82 1 1 
       1287 1 . . . . . 2.79 1.8 3.21 1 1 
       1288 1 . . . . . 2.65 1.8 3.05 1 1 
       1289 1 . . . . .  4.0 1.8  4.6 1 1 
       1290 1 . . . . .  4.0 1.8  4.6 1 1 
       1291 1 . . . . .  4.0 1.8  4.6 1 1 
       1292 1 . . . . .  4.0 1.8  4.6 1 1 
       1293 1 . . . . .  4.0 1.8  4.6 1 1 
       1294 1 . . . . .  4.0 1.8  4.6 1 1 
       1295 1 . . . . .  4.0 1.8  4.6 1 1 
       1296 1 . . . . .  5.0 1.8 5.75 1 1 
       1297 1 . . . . .  4.0 1.8  4.6 1 1 
       1298 1 . . . . .  4.0 1.8  4.6 1 1 
       1299 1 . . . . .  4.0 1.8  4.6 1 1 
       1300 1 . . . . .  4.0 1.8  4.6 1 1 
       1301 1 . . . . .  4.0 1.8  4.6 1 1 
       1302 1 . . . . .  4.0 1.8  4.6 1 1 
       1303 1 . . . . .  4.0 1.8  4.6 1 1 
       1304 1 . . . . .  4.0 1.8  4.6 1 1 
       1305 1 . . . . .  4.0 1.8  4.6 1 1 
       1306 1 . . . . .  4.0 1.8  4.6 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_4_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  2
    _Distance_constraint_list.Constraint_type     "hydrogen bond"
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

         1 1 . . . 1 2 
         2 1 . . . 1 2 
         3 1 . . . 1 2 
         4 1 . . . 1 2 
         5 1 . . . 1 2 
         6 1 . . . 1 2 
         7 1 . . . 1 2 
         8 1 . . . 1 2 
         9 1 . . . 1 2 
        10 1 . . . 1 2 
        11 1 . . . 1 2 
        12 1 . . . 1 2 
        13 1 . . . 1 2 
        14 1 . . . 1 2 
        15 1 . . . 1 2 
        16 1 . . . 1 2 
        17 1 . . . 1 2 
        18 1 . . . 1 2 
        19 1 . . . 1 2 
        20 1 . . . 1 2 
        21 1 . . . 1 2 
        22 1 . . . 1 2 
        23 1 . . . 1 2 
        24 1 . . . 1 2 
        25 1 . . . 1 2 
        26 1 . . . 1 2 
        27 1 . . . 1 2 
        28 1 . . . 1 2 
        29 1 . . . 1 2 
        30 1 . . . 1 2 
        31 1 . . . 1 2 
        32 1 . . . 1 2 
        33 1 . . . 1 2 
        34 1 . . . 1 2 
        35 1 . . . 1 2 
        36 1 . . . 1 2 
        37 1 . . . 1 2 
        38 1 . . . 1 2 
        39 1 . . . 1 2 
        40 1 . . . 1 2 
        41 1 . . . 1 2 
        42 1 . . . 1 2 
        43 1 . . . 1 2 
        44 1 . . . 1 2 
        45 1 . . . 1 2 
        46 1 . . . 1 2 
        47 1 . . . 1 2 
        48 1 . . . 1 2 
        49 1 . . . 1 2 
        50 1 . . . 1 2 
        51 1 . . . 1 2 
        52 1 . . . 1 2 
        53 1 . . . 1 2 
        54 1 . . . 1 2 
        55 1 . . . 1 2 
        56 1 . . . 1 2 
        57 1 . . . 1 2 
        58 1 . . . 1 2 
        59 1 . . . 1 2 
        60 1 . . . 1 2 
        61 1 . . . 1 2 
        62 1 . . . 1 2 
        63 1 . . . 1 2 
        64 1 . . . 1 2 
        65 1 . . . 1 2 
        66 1 . . . 1 2 
        67 1 . . . 1 2 
        68 1 . . . 1 2 
        69 1 . . . 1 2 
        70 1 . . . 1 2 
        71 1 . . . 1 2 
        72 1 . . . 1 2 
        73 1 . . . 1 2 
        74 1 . . . 1 2 
        75 1 . . . 1 2 
        76 1 . . . 1 2 
        77 1 . . . 1 2 
        78 1 . . . 1 2 
        79 1 . . . 1 2 
        80 1 . . . 1 2 
        81 1 . . . 1 2 
        82 1 . . . 1 2 
        83 1 . . . 1 2 
        84 1 . . . 1 2 
        85 1 . . . 1 2 
        86 1 . . . 1 2 
        87 1 . . . 1 2 
        88 1 . . . 1 2 
        89 1 . . . 1 2 
        90 1 . . . 1 2 
        91 1 . . . 1 2 
        92 1 . . . 1 2 
        93 1 . . . 1 2 
        94 1 . . . 1 2 
        95 1 . . . 1 2 
        96 1 . . . 1 2 
        97 1 . . . 1 2 
        98 1 . . . 1 2 
        99 1 . . . 1 2 
       100 1 . . . 1 2 
       101 1 . . . 1 2 
       102 1 . . . 1 2 
       103 1 . . . 1 2 
       104 1 . . . 1 2 
       105 1 . . . 1 2 
       106 1 . . . 1 2 
       107 1 . . . 1 2 
       108 1 . . . 1 2 
       109 1 . . . 1 2 
       110 1 . . . 1 2 
       111 1 . . . 1 2 
       112 1 . . . 1 2 
       113 1 . . . 1 2 
       114 1 . . . 1 2 
       115 1 . . . 1 2 
       116 1 . . . 1 2 
       117 1 . . . 1 2 
       118 1 . . . 1 2 
       119 1 . . . 1 2 
       120 1 . . . 1 2 
       121 1 . . . 1 2 
       122 1 . . . 1 2 
       123 1 . . . 1 2 
       124 1 . . . 1 2 
       125 1 . . . 1 2 
       126 1 . . . 1 2 
       127 1 . . . 1 2 
       128 1 . . . 1 2 
       129 1 . . . 1 2 
       130 1 . . . 1 2 
       131 1 . . . 1 2 
       132 1 . . . 1 2 
       133 1 . . . 1 2 
       134 1 . . . 1 2 
       135 1 . . . 1 2 
       136 1 . . . 1 2 
       137 1 . . . 1 2 
       138 1 . . . 1 2 
       139 1 . . . 1 2 
       140 1 . . . 1 2 
       141 1 . . . 1 2 
       142 1 . . . 1 2 
       143 1 . . . 1 2 
       144 1 . . . 1 2 
       145 1 . . . 1 2 
       146 1 . . . 1 2 
       147 1 . . . 1 2 
       148 1 . . . 1 2 
       149 1 . . . 1 2 
       150 1 . . . 1 2 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

         1 1 1 1 1  20 ASN O .  20 . O  1 2 
         1 1 2 1 1  24 LYS H .  24 . HN 1 2 
         2 1 1 1 1  20 ASN O .  20 . O  1 2 
         2 1 2 1 1  24 LYS N .  24 . N  1 2 
         3 1 1 1 1  21 HIS O .  21 . O  1 2 
         3 1 2 1 1  25 ALA H .  25 . HN 1 2 
         4 1 1 1 1  21 HIS O .  21 . O  1 2 
         4 1 2 1 1  25 ALA N .  25 . N  1 2 
         5 1 1 1 1  22 LEU O .  22 . O  1 2 
         5 1 2 1 1  26 LYS H .  26 . HN 1 2 
         6 1 1 1 1  22 LEU O .  22 . O  1 2 
         6 1 2 1 1  26 LYS N .  26 . N  1 2 
         7 1 1 1 1  23 LYS O .  23 . O  1 2 
         7 1 2 1 1  27 LEU H .  27 . HN 1 2 
         8 1 1 1 1  23 LYS O .  23 . O  1 2 
         8 1 2 1 1  27 LEU N .  27 . N  1 2 
         9 1 1 1 1  24 LYS O .  24 . O  1 2 
         9 1 2 1 1  28 MET H .  28 . HN 1 2 
        10 1 1 1 1  24 LYS O .  24 . O  1 2 
        10 1 2 1 1  28 MET N .  28 . N  1 2 
        11 1 1 1 1  25 ALA O .  25 . O  1 2 
        11 1 2 1 1  29 PHE H .  29 . HN 1 2 
        12 1 1 1 1  25 ALA O .  25 . O  1 2 
        12 1 2 1 1  29 PHE N .  29 . N  1 2 
        13 1 1 1 1  26 LYS O .  26 . O  1 2 
        13 1 2 1 1  30 PHE H .  30 . HN 1 2 
        14 1 1 1 1  26 LYS O .  26 . O  1 2 
        14 1 2 1 1  30 PHE N .  30 . N  1 2 
        15 1 1 1 1  36 SER O .  36 . O  1 2 
        15 1 2 1 1  40 LEU H .  40 . HN 1 2 
        16 1 1 1 1  36 SER O .  36 . O  1 2 
        16 1 2 1 1  40 LEU N .  40 . N  1 2 
        17 1 1 1 1  37 SER O .  37 . O  1 2 
        17 1 2 1 1  41 LYS H .  41 . HN 1 2 
        18 1 1 1 1  37 SER O .  37 . O  1 2 
        18 1 2 1 1  41 LYS N .  41 . N  1 2 
        19 1 1 1 1  38 ASN O .  38 . O  1 2 
        19 1 2 1 1  42 THR H .  42 . HN 1 2 
        20 1 1 1 1  38 ASN O .  38 . O  1 2 
        20 1 2 1 1  42 THR N .  42 . N  1 2 
        21 1 1 1 1  39 MET O .  39 . O  1 2 
        21 1 2 1 1  43 TYR H .  43 . HN 1 2 
        22 1 1 1 1  39 MET O .  39 . O  1 2 
        22 1 2 1 1  43 TYR N .  43 . N  1 2 
        23 1 1 1 1  40 LEU O .  40 . O  1 2 
        23 1 2 1 1  44 PHE H .  44 . HN 1 2 
        24 1 1 1 1  40 LEU O .  40 . O  1 2 
        24 1 2 1 1  44 PHE N .  44 . N  1 2 
        25 1 1 1 1  50 ASN O .  50 . O  1 2 
        25 1 2 1 1  54 THR H .  54 . HN 1 2 
        26 1 1 1 1  50 ASN O .  50 . O  1 2 
        26 1 2 1 1  54 THR N .  54 . N  1 2 
        27 1 1 1 1  51 ARG O .  51 . O  1 2 
        27 1 2 1 1  55 SER H .  55 . HN 1 2 
        28 1 1 1 1  51 ARG O .  51 . O  1 2 
        28 1 2 1 1  55 SER N .  55 . N  1 2 
        29 1 1 1 1  52 CYS O .  52 . O  1 2 
        29 1 2 1 1  56 GLN H .  56 . HN 1 2 
        30 1 1 1 1  52 CYS O .  52 . O  1 2 
        30 1 2 1 1  56 GLN N .  56 . N  1 2 
        31 1 1 1 1  53 ILE O .  53 . O  1 2 
        31 1 2 1 1  57 LEU H .  57 . HN 1 2 
        32 1 1 1 1  53 ILE O .  53 . O  1 2 
        32 1 2 1 1  57 LEU N .  57 . N  1 2 
        33 1 1 1 1  54 THR O .  54 . O  1 2 
        33 1 2 1 1  58 ILE H .  58 . HN 1 2 
        34 1 1 1 1  54 THR O .  54 . O  1 2 
        34 1 2 1 1  58 ILE N .  58 . N  1 2 
        35 1 1 1 1  55 SER O .  55 . O  1 2 
        35 1 2 1 1  59 LYS H .  59 . HN 1 2 
        36 1 1 1 1  55 SER O .  55 . O  1 2 
        36 1 2 1 1  59 LYS N .  59 . N  1 2 
        37 1 1 1 1  56 GLN O .  56 . O  1 2 
        37 1 2 1 1  60 TRP H .  60 . HN 1 2 
        38 1 1 1 1  56 GLN O .  56 . O  1 2 
        38 1 2 1 1  60 TRP N .  60 . N  1 2 
        39 1 1 1 1  57 LEU O .  57 . O  1 2 
        39 1 2 1 1  61 PHE H .  61 . HN 1 2 
        40 1 1 1 1  57 LEU O .  57 . O  1 2 
        40 1 2 1 1  61 PHE N .  61 . N  1 2 
        41 1 1 1 1  58 ILE O .  58 . O  1 2 
        41 1 2 1 1  62 SER H .  62 . HN 1 2 
        42 1 1 1 1  58 ILE O .  58 . O  1 2 
        42 1 2 1 1  62 SER N .  62 . N  1 2 
        43 1 1 1 1  59 LYS O .  59 . O  1 2 
        43 1 2 1 1  63 ASN H .  63 . HN 1 2 
        44 1 1 1 1  59 LYS O .  59 . O  1 2 
        44 1 2 1 1  63 ASN N .  63 . N  1 2 
        45 1 1 1 1  60 TRP O .  60 . O  1 2 
        45 1 2 1 1  64 PHE H .  64 . HN 1 2 
        46 1 1 1 1  60 TRP O .  60 . O  1 2 
        46 1 2 1 1  64 PHE N .  64 . N  1 2 
        47 1 1 1 1  61 PHE O .  61 . O  1 2 
        47 1 2 1 1  65 ARG H .  65 . HN 1 2 
        48 1 1 1 1  61 PHE O .  61 . O  1 2 
        48 1 2 1 1  65 ARG N .  65 . N  1 2 
        49 1 1 1 1  62 SER O .  62 . O  1 2 
        49 1 2 1 1  66 GLU H .  66 . HN 1 2 
        50 1 1 1 1  62 SER O .  62 . O  1 2 
        50 1 2 1 1  66 GLU N .  66 . N  1 2 
        51 1 1 1 1  63 ASN O .  63 . O  1 2 
        51 1 2 1 1  67 PHE H .  67 . HN 1 2 
        52 1 1 1 1  63 ASN O .  63 . O  1 2 
        52 1 2 1 1  67 PHE N .  67 . N  1 2 
        53 1 1 1 1  64 PHE O .  64 . O  1 2 
        53 1 2 1 1  68 TYR H .  68 . HN 1 2 
        54 1 1 1 1  64 PHE O .  64 . O  1 2 
        54 1 2 1 1  68 TYR N .  68 . N  1 2 
        55 1 1 1 1  65 ARG O .  65 . O  1 2 
        55 1 2 1 1  69 TYR H .  69 . HN 1 2 
        56 1 1 1 1  65 ARG O .  65 . O  1 2 
        56 1 2 1 1  69 TYR N .  69 . N  1 2 
        57 1 1 1 1  66 GLU O .  66 . O  1 2 
        57 1 2 1 1  70 ILE H .  70 . HN 1 2 
        58 1 1 1 1  66 GLU O .  66 . O  1 2 
        58 1 2 1 1  70 ILE N .  70 . N  1 2 
        59 1 1 1 1  67 PHE O .  67 . O  1 2 
        59 1 2 1 1  71 GLN H .  71 . HN 1 2 
        60 1 1 1 1  67 PHE O .  67 . O  1 2 
        60 1 2 1 1  71 GLN N .  71 . N  1 2 
        61 1 1 1 1  68 TYR O .  68 . O  1 2 
        61 1 2 1 1  72 MET H .  72 . HN 1 2 
        62 1 1 1 1  68 TYR O .  68 . O  1 2 
        62 1 2 1 1  72 MET N .  72 . N  1 2 
        63 1 1 1 1  69 TYR O .  69 . O  1 2 
        63 1 2 1 1  73 GLU H .  73 . HN 1 2 
        64 1 1 1 1  69 TYR O .  69 . O  1 2 
        64 1 2 1 1  73 GLU N .  73 . N  1 2 
        65 1 1 1 1  70 ILE O .  70 . O  1 2 
        65 1 2 1 1  74 LYS H .  74 . HN 1 2 
        66 1 1 1 1  70 ILE O .  70 . O  1 2 
        66 1 2 1 1  74 LYS N .  74 . N  1 2 
        67 1 1 1 1  71 GLN O .  71 . O  1 2 
        67 1 2 1 1  75 TYR H .  75 . HN 1 2 
        68 1 1 1 1  71 GLN O .  71 . O  1 2 
        68 1 2 1 1  75 TYR N .  75 . N  1 2 
        69 1 1 1 1  72 MET O .  72 . O  1 2 
        69 1 2 1 1  76 ALA H .  76 . HN 1 2 
        70 1 1 1 1  72 MET O .  72 . O  1 2 
        70 1 2 1 1  76 ALA N .  76 . N  1 2 
        71 1 1 1 1  73 GLU O .  73 . O  1 2 
        71 1 2 1 1  77 ARG H .  77 . HN 1 2 
        72 1 1 1 1  73 GLU O .  73 . O  1 2 
        72 1 2 1 1  77 ARG N .  77 . N  1 2 
        73 1 1 1 1  74 LYS O .  74 . O  1 2 
        73 1 2 1 1  78 GLN H .  78 . HN 1 2 
        74 1 1 1 1  74 LYS O .  74 . O  1 2 
        74 1 2 1 1  78 GLN N .  78 . N  1 2 
        75 1 1 1 1  75 TYR O .  75 . O  1 2 
        75 1 2 1 1  79 ALA H .  79 . HN 1 2 
        76 1 1 1 1  75 TYR O .  75 . O  1 2 
        76 1 2 1 1  79 ALA N .  79 . N  1 2 
        77 1 1 1 1  76 ALA O .  76 . O  1 2 
        77 1 2 1 1  80 ILE H .  80 . HN 1 2 
        78 1 1 1 1  76 ALA O .  76 . O  1 2 
        78 1 2 1 1  80 ILE N .  80 . N  1 2 
        79 1 1 1 1  77 ARG O .  77 . O  1 2 
        79 1 2 1 1  81 ASN H .  81 . HN 1 2 
        80 1 1 1 1  77 ARG O .  77 . O  1 2 
        80 1 2 1 1  81 ASN N .  81 . N  1 2 
        81 1 1 1 1  78 GLN O .  78 . O  1 2 
        81 1 2 1 1  82 ASP H .  82 . HN 1 2 
        82 1 1 1 1  78 GLN O .  78 . O  1 2 
        82 1 2 1 1  82 ASP N .  82 . N  1 2 
        83 1 1 1 1  79 ALA O .  79 . O  1 2 
        83 1 2 1 1  83 GLY H .  83 . HN 1 2 
        84 1 1 1 1  79 ALA O .  79 . O  1 2 
        84 1 2 1 1  83 GLY N .  83 . N  1 2 
        85 1 1 1 1  96 CYS O .  96 . O  1 2 
        85 1 2 1 1 100 ARG H . 100 . HN 1 2 
        86 1 1 1 1  96 CYS O .  96 . O  1 2 
        86 1 2 1 1 100 ARG N . 100 . N  1 2 
        87 1 1 1 1  97 GLU O .  97 . O  1 2 
        87 1 2 1 1 101 ALA H . 101 . HN 1 2 
        88 1 1 1 1  97 GLU O .  97 . O  1 2 
        88 1 2 1 1 101 ALA N . 101 . N  1 2 
        89 1 1 1 1  98 LEU O .  98 . O  1 2 
        89 1 2 1 1 102 LEU H . 102 . HN 1 2 
        90 1 1 1 1  98 LEU O .  98 . O  1 2 
        90 1 2 1 1 102 LEU N . 102 . N  1 2 
        91 1 1 1 1  99 TYR O .  99 . O  1 2 
        91 1 2 1 1 103 ASN H . 103 . HN 1 2 
        92 1 1 1 1  99 TYR O .  99 . O  1 2 
        92 1 2 1 1 103 ASN N . 103 . N  1 2 
        93 1 1 1 1 100 ARG O . 100 . O  1 2 
        93 1 2 1 1 104 MET H . 104 . HN 1 2 
        94 1 1 1 1 100 ARG O . 100 . O  1 2 
        94 1 2 1 1 104 MET N . 104 . N  1 2 
        95 1 1 1 1 101 ALA O . 101 . O  1 2 
        95 1 2 1 1 105 HIS H . 105 . HN 1 2 
        96 1 1 1 1 101 ALA O . 101 . O  1 2 
        96 1 2 1 1 105 HIS N . 105 . N  1 2 
        97 1 1 1 1 102 LEU O . 102 . O  1 2 
        97 1 2 1 1 106 TYR H . 106 . HN 1 2 
        98 1 1 1 1 102 LEU O . 102 . O  1 2 
        98 1 2 1 1 106 TYR N . 106 . N  1 2 
        99 1 1 1 1 103 ASN O . 103 . O  1 2 
        99 1 2 1 1 107 ASN H . 107 . HN 1 2 
       100 1 1 1 1 103 ASN O . 103 . O  1 2 
       100 1 2 1 1 107 ASN N . 107 . N  1 2 
       101 1 1 1 1 116 GLU O . 116 . O  1 2 
       101 1 2 1 1 120 GLU H . 120 . HN 1 2 
       102 1 1 1 1 116 GLU O . 116 . O  1 2 
       102 1 2 1 1 120 GLU N . 120 . N  1 2 
       103 1 1 1 1 117 ARG O . 117 . O  1 2 
       103 1 2 1 1 121 VAL H . 121 . HN 1 2 
       104 1 1 1 1 117 ARG O . 117 . O  1 2 
       104 1 2 1 1 121 VAL N . 121 . N  1 2 
       105 1 1 1 1 118 PHE O . 118 . O  1 2 
       105 1 2 1 1 122 ALA H . 122 . HN 1 2 
       106 1 1 1 1 118 PHE O . 118 . O  1 2 
       106 1 2 1 1 122 ALA N . 122 . N  1 2 
       107 1 1 1 1 119 LEU O . 119 . O  1 2 
       107 1 2 1 1 123 GLN H . 123 . HN 1 2 
       108 1 1 1 1 119 LEU O . 119 . O  1 2 
       108 1 2 1 1 123 GLN N . 123 . N  1 2 
       109 1 1 1 1 120 GLU O . 120 . O  1 2 
       109 1 2 1 1 124 ILE H . 124 . HN 1 2 
       110 1 1 1 1 120 GLU O . 120 . O  1 2 
       110 1 2 1 1 124 ILE N . 124 . N  1 2 
       111 1 1 1 1 121 VAL O . 121 . O  1 2 
       111 1 2 1 1 125 THR H . 125 . HN 1 2 
       112 1 1 1 1 121 VAL O . 121 . O  1 2 
       112 1 2 1 1 125 THR N . 125 . N  1 2 
       113 1 1 1 1 122 ALA O . 122 . O  1 2 
       113 1 2 1 1 126 LEU H . 126 . HN 1 2 
       114 1 1 1 1 122 ALA O . 122 . O  1 2 
       114 1 2 1 1 126 LEU N . 126 . N  1 2 
       115 1 1 1 1 123 GLN O . 123 . O  1 2 
       115 1 2 1 1 127 ARG H . 127 . HN 1 2 
       116 1 1 1 1 123 GLN O . 123 . O  1 2 
       116 1 2 1 1 127 ARG N . 127 . N  1 2 
       117 1 1 1 1 124 ILE O . 124 . O  1 2 
       117 1 2 1 1 128 GLU H . 128 . HN 1 2 
       118 1 1 1 1 124 ILE O . 124 . O  1 2 
       118 1 2 1 1 128 GLU N . 128 . N  1 2 
       119 1 1 1 1 125 THR O . 125 . O  1 2 
       119 1 2 1 1 129 PHE H . 129 . HN 1 2 
       120 1 1 1 1 125 THR O . 125 . O  1 2 
       120 1 2 1 1 129 PHE N . 129 . N  1 2 
       121 1 1 1 1 126 LEU O . 126 . O  1 2 
       121 1 2 1 1 130 PHE H . 130 . HN 1 2 
       122 1 1 1 1 126 LEU O . 126 . O  1 2 
       122 1 2 1 1 130 PHE N . 130 . N  1 2 
       123 1 1 1 1 127 ARG O . 127 . O  1 2 
       123 1 2 1 1 131 ASN H . 131 . HN 1 2 
       124 1 1 1 1 127 ARG O . 127 . O  1 2 
       124 1 2 1 1 131 ASN N . 131 . N  1 2 
       125 1 1 1 1 128 GLU O . 128 . O  1 2 
       125 1 2 1 1 132 ALA H . 132 . HN 1 2 
       126 1 1 1 1 128 GLU O . 128 . O  1 2 
       126 1 2 1 1 132 ALA N . 132 . N  1 2 
       127 1 1 1 1 129 PHE O . 129 . O  1 2 
       127 1 2 1 1 133 ILE H . 133 . HN 1 2 
       128 1 1 1 1 129 PHE O . 129 . O  1 2 
       128 1 2 1 1 133 ILE N . 133 . N  1 2 
       129 1 1 1 1 130 PHE O . 130 . O  1 2 
       129 1 2 1 1 134 ILE H . 134 . HN 1 2 
       130 1 1 1 1 130 PHE O . 130 . O  1 2 
       130 1 2 1 1 134 ILE N . 134 . N  1 2 
       131 1 1 1 1 131 ASN O . 131 . O  1 2 
       131 1 2 1 1 135 ALA H . 135 . HN 1 2 
       132 1 1 1 1 131 ASN O . 131 . O  1 2 
       132 1 2 1 1 135 ALA N . 135 . N  1 2 
       133 1 1 1 1 132 ALA O . 132 . O  1 2 
       133 1 2 1 1 136 GLY H . 136 . HN 1 2 
       134 1 1 1 1 132 ALA O . 132 . O  1 2 
       134 1 2 1 1 136 GLY N . 136 . N  1 2 
       135 1 1 1 1 142 SER O . 142 . O  1 2 
       135 1 2 1 1 146 ALA H . 146 . HN 1 2 
       136 1 1 1 1 142 SER O . 142 . O  1 2 
       136 1 2 1 1 146 ALA N . 146 . N  1 2 
       137 1 1 1 1 143 TRP O . 143 . O  1 2 
       137 1 2 1 1 147 ILE H . 147 . HN 1 2 
       138 1 1 1 1 143 TRP O . 143 . O  1 2 
       138 1 2 1 1 147 ILE N . 147 . N  1 2 
       139 1 1 1 1 144 LYS O . 144 . O  1 2 
       139 1 2 1 1 148 TYR H . 148 . HN 1 2 
       140 1 1 1 1 144 LYS O . 144 . O  1 2 
       140 1 2 1 1 148 TYR N . 148 . N  1 2 
       141 1 1 1 1 145 LYS O . 145 . O  1 2 
       141 1 2 1 1 149 LYS H . 149 . HN 1 2 
       142 1 1 1 1 145 LYS O . 145 . O  1 2 
       142 1 2 1 1 149 LYS N . 149 . N  1 2 
       143 1 1 1 1 146 ALA O . 146 . O  1 2 
       143 1 2 1 1 150 VAL H . 150 . HN 1 2 
       144 1 1 1 1 146 ALA O . 146 . O  1 2 
       144 1 2 1 1 150 VAL N . 150 . N  1 2 
       145 1 1 1 1 147 ILE O . 147 . O  1 2 
       145 1 2 1 1 151 ILE H . 151 . HN 1 2 
       146 1 1 1 1 147 ILE O . 147 . O  1 2 
       146 1 2 1 1 151 ILE N . 151 . N  1 2 
       147 1 1 1 1 148 TYR O . 148 . O  1 2 
       147 1 2 1 1 152 CYS H . 152 . HN 1 2 
       148 1 1 1 1 148 TYR O . 148 . O  1 2 
       148 1 2 1 1 152 CYS N . 152 . N  1 2 
       149 1 1 1 1 149 LYS O . 149 . O  1 2 
       149 1 2 1 1 153 LYS H . 153 . HN 1 2 
       150 1 1 1 1 149 LYS O . 149 . O  1 2 
       150 1 2 1 1 153 LYS N . 153 . N  1 2 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

         1 1 . . . . .  1.9 1.81 1.99 1 2 
         2 1 . . . . . 2.85 2.71 2.99 1 2 
         3 1 . . . . .  1.9 1.81 1.99 1 2 
         4 1 . . . . . 2.85 2.71 2.99 1 2 
         5 1 . . . . .  1.9 1.81 1.99 1 2 
         6 1 . . . . . 2.85 2.71 2.99 1 2 
         7 1 . . . . .  1.9 1.81 1.99 1 2 
         8 1 . . . . . 2.85 2.71 2.99 1 2 
         9 1 . . . . .  1.9 1.81 1.99 1 2 
        10 1 . . . . . 2.85 2.71 2.99 1 2 
        11 1 . . . . .  1.9 1.81 1.99 1 2 
        12 1 . . . . . 2.85 2.71 2.99 1 2 
        13 1 . . . . .  1.9 1.81 1.99 1 2 
        14 1 . . . . . 2.85 2.71 2.99 1 2 
        15 1 . . . . .  1.9 1.81 1.99 1 2 
        16 1 . . . . . 2.85 2.71 2.99 1 2 
        17 1 . . . . .  1.9 1.81 1.99 1 2 
        18 1 . . . . . 2.85 2.71 2.99 1 2 
        19 1 . . . . .  1.9 1.81 1.99 1 2 
        20 1 . . . . . 2.85 2.71 2.99 1 2 
        21 1 . . . . .  1.9 1.81 1.99 1 2 
        22 1 . . . . . 2.85 2.71 2.99 1 2 
        23 1 . . . . .  1.9 1.81 1.99 1 2 
        24 1 . . . . . 2.85 2.71 2.99 1 2 
        25 1 . . . . .  1.9 1.81 1.99 1 2 
        26 1 . . . . . 2.85 2.71 2.99 1 2 
        27 1 . . . . .  1.9 1.81 1.99 1 2 
        28 1 . . . . . 2.85 2.71 2.99 1 2 
        29 1 . . . . .  1.9 1.81 1.99 1 2 
        30 1 . . . . . 2.85 2.71 2.99 1 2 
        31 1 . . . . .  1.9 1.81 1.99 1 2 
        32 1 . . . . . 2.85 2.71 2.99 1 2 
        33 1 . . . . .  1.9 1.81 1.99 1 2 
        34 1 . . . . . 2.85 2.71 2.99 1 2 
        35 1 . . . . .  1.9 1.81 1.99 1 2 
        36 1 . . . . . 2.85 2.71 2.99 1 2 
        37 1 . . . . .  1.9 1.81 1.99 1 2 
        38 1 . . . . . 2.85 2.71 2.99 1 2 
        39 1 . . . . .  1.9 1.81 1.99 1 2 
        40 1 . . . . . 2.85 2.71 2.99 1 2 
        41 1 . . . . .  1.9 1.81 1.99 1 2 
        42 1 . . . . . 2.85 2.71 2.99 1 2 
        43 1 . . . . .  1.9 1.81 1.99 1 2 
        44 1 . . . . . 2.85 2.71 2.99 1 2 
        45 1 . . . . .  1.9 1.81 1.99 1 2 
        46 1 . . . . . 2.85 2.71 2.99 1 2 
        47 1 . . . . .  1.9 1.81 1.99 1 2 
        48 1 . . . . . 2.85 2.71 2.99 1 2 
        49 1 . . . . .  1.9 1.81 1.99 1 2 
        50 1 . . . . . 2.85 2.71 2.99 1 2 
        51 1 . . . . .  1.9 1.81 1.99 1 2 
        52 1 . . . . . 2.85 2.71 2.99 1 2 
        53 1 . . . . .  1.9 1.81 1.99 1 2 
        54 1 . . . . . 2.85 2.71 2.99 1 2 
        55 1 . . . . .  1.9 1.81 1.99 1 2 
        56 1 . . . . . 2.85 2.71 2.99 1 2 
        57 1 . . . . .  1.9 1.81 1.99 1 2 
        58 1 . . . . . 2.85 2.71 2.99 1 2 
        59 1 . . . . .  1.9 1.81 1.99 1 2 
        60 1 . . . . . 2.85 2.71 2.99 1 2 
        61 1 . . . . .  1.9 1.81 1.99 1 2 
        62 1 . . . . . 2.85 2.71 2.99 1 2 
        63 1 . . . . .  1.9 1.81 1.99 1 2 
        64 1 . . . . . 2.85 2.71 2.99 1 2 
        65 1 . . . . .  1.9 1.81 1.99 1 2 
        66 1 . . . . . 2.85 2.71 2.99 1 2 
        67 1 . . . . .  1.9 1.81 1.99 1 2 
        68 1 . . . . . 2.85 2.71 2.99 1 2 
        69 1 . . . . .  1.9 1.81 1.99 1 2 
        70 1 . . . . . 2.85 2.71 2.99 1 2 
        71 1 . . . . .  1.9 1.81 1.99 1 2 
        72 1 . . . . . 2.85 2.71 2.99 1 2 
        73 1 . . . . .  1.9 1.81 1.99 1 2 
        74 1 . . . . . 2.85 2.71 2.99 1 2 
        75 1 . . . . .  1.9 1.81 1.99 1 2 
        76 1 . . . . . 2.85 2.71 2.99 1 2 
        77 1 . . . . .  1.9 1.81 1.99 1 2 
        78 1 . . . . . 2.85 2.71 2.99 1 2 
        79 1 . . . . .  1.9 1.81 1.99 1 2 
        80 1 . . . . . 2.85 2.71 2.99 1 2 
        81 1 . . . . .  1.9 1.81 1.99 1 2 
        82 1 . . . . . 2.85 2.71 2.99 1 2 
        83 1 . . . . .  1.9 1.81 1.99 1 2 
        84 1 . . . . . 2.85 2.71 2.99 1 2 
        85 1 . . . . .  1.9 1.81 1.99 1 2 
        86 1 . . . . . 2.85 2.71 2.99 1 2 
        87 1 . . . . .  1.9 1.81 1.99 1 2 
        88 1 . . . . . 2.85 2.71 2.99 1 2 
        89 1 . . . . .  1.9 1.81 1.99 1 2 
        90 1 . . . . . 2.85 2.71 2.99 1 2 
        91 1 . . . . .  1.9 1.81 1.99 1 2 
        92 1 . . . . . 2.85 2.71 2.99 1 2 
        93 1 . . . . .  1.9 1.81 1.99 1 2 
        94 1 . . . . . 2.85 2.71 2.99 1 2 
        95 1 . . . . .  1.9 1.81 1.99 1 2 
        96 1 . . . . . 2.85 2.71 2.99 1 2 
        97 1 . . . . .  1.9 1.81 1.99 1 2 
        98 1 . . . . . 2.85 2.71 2.99 1 2 
        99 1 . . . . .  1.9 1.81 1.99 1 2 
       100 1 . . . . . 2.85 2.71 2.99 1 2 
       101 1 . . . . .  1.9 1.81 1.99 1 2 
       102 1 . . . . . 2.85 2.71 2.99 1 2 
       103 1 . . . . .  1.9 1.81 1.99 1 2 
       104 1 . . . . . 2.85 2.71 2.99 1 2 
       105 1 . . . . .  1.9 1.81 1.99 1 2 
       106 1 . . . . . 2.85 2.71 2.99 1 2 
       107 1 . . . . .  1.9 1.81 1.99 1 2 
       108 1 . . . . . 2.85 2.71 2.99 1 2 
       109 1 . . . . .  1.9 1.81 1.99 1 2 
       110 1 . . . . . 2.85 2.71 2.99 1 2 
       111 1 . . . . .  1.9 1.81 1.99 1 2 
       112 1 . . . . . 2.85 2.71 2.99 1 2 
       113 1 . . . . .  1.9 1.81 1.99 1 2 
       114 1 . . . . . 2.85 2.71 2.99 1 2 
       115 1 . . . . .  1.9 1.81 1.99 1 2 
       116 1 . . . . . 2.85 2.71 2.99 1 2 
       117 1 . . . . .  1.9 1.81 1.99 1 2 
       118 1 . . . . . 2.85 2.71 2.99 1 2 
       119 1 . . . . .  1.9 1.81 1.99 1 2 
       120 1 . . . . . 2.85 2.71 2.99 1 2 
       121 1 . . . . .  1.9 1.81 1.99 1 2 
       122 1 . . . . . 2.85 2.71 2.99 1 2 
       123 1 . . . . .  1.9 1.81 1.99 1 2 
       124 1 . . . . . 2.85 2.71 2.99 1 2 
       125 1 . . . . .  1.9 1.81 1.99 1 2 
       126 1 . . . . . 2.85 2.71 2.99 1 2 
       127 1 . . . . .  1.9 1.81 1.99 1 2 
       128 1 . . . . . 2.85 2.71 2.99 1 2 
       129 1 . . . . .  1.9 1.81 1.99 1 2 
       130 1 . . . . . 2.85 2.71 2.99 1 2 
       131 1 . . . . .  1.9 1.81 1.99 1 2 
       132 1 . . . . . 2.85 2.71 2.99 1 2 
       133 1 . . . . .  1.9 1.81 1.99 1 2 
       134 1 . . . . . 2.85 2.71 2.99 1 2 
       135 1 . . . . .  1.9 1.81 1.99 1 2 
       136 1 . . . . . 2.85 2.71 2.99 1 2 
       137 1 . . . . .  1.9 1.81 1.99 1 2 
       138 1 . . . . . 2.85 2.71 2.99 1 2 
       139 1 . . . . .  1.9 1.81 1.99 1 2 
       140 1 . . . . . 2.85 2.71 2.99 1 2 
       141 1 . . . . .  1.9 1.81 1.99 1 2 
       142 1 . . . . . 2.85 2.71 2.99 1 2 
       143 1 . . . . .  1.9 1.81 1.99 1 2 
       144 1 . . . . . 2.85 2.71 2.99 1 2 
       145 1 . . . . .  1.9 1.81 1.99 1 2 
       146 1 . . . . . 2.85 2.71 2.99 1 2 
       147 1 . . . . .  1.9 1.81 1.99 1 2 
       148 1 . . . . . 2.85 2.71 2.99 1 2 
       149 1 . . . . .  1.9 1.81 1.99 1 2 
       150 1 . . . . . 2.85 2.71 2.99 1 2 
    stop_

save_


save_CNS/XPLOR_dihedral_3
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

         1 . 1 1  35 PRO C 1 1  36 SER N  1 1  36 SER CA 1 1  36 SER C     -83.19     -43.19 .  35 . C .  36 . N  .  36 . CA .  36 . C 1 1 
         2 . 1 1  36 SER N 1 1  36 SER CA 1 1  36 SER C  1 1  37 SER N     -60.22     -20.22 .  36 . N .  36 . CA .  36 . C  .  37 . N 1 1 
         3 . 1 1  36 SER C 1 1  37 SER N  1 1  37 SER CA 1 1  37 SER C     -82.28     -42.28 .  36 . C .  37 . N  .  37 . CA .  37 . C 1 1 
         4 . 1 1  37 SER N 1 1  37 SER CA 1 1  37 SER C  1 1  38 ASN N     -64.61     -24.61 .  37 . N .  37 . CA .  37 . C  .  38 . N 1 1 
         5 . 1 1  37 SER C 1 1  38 ASN N  1 1  38 ASN CA 1 1  38 ASN C     -82.63     -42.63 .  37 . C .  38 . N  .  38 . CA .  38 . C 1 1 
         6 . 1 1  38 ASN N 1 1  38 ASN CA 1 1  38 ASN C  1 1  39 MET N -62.449997     -22.45 .  38 . N .  38 . CA .  38 . C  .  39 . N 1 1 
         7 . 1 1  38 ASN C 1 1  39 MET N  1 1  39 MET CA 1 1  39 MET C     -84.83     -44.83 .  38 . C .  39 . N  .  39 . CA .  39 . C 1 1 
         8 . 1 1  39 MET N 1 1  39 MET CA 1 1  39 MET C  1 1  40 LEU N     -61.49     -21.49 .  39 . N .  39 . CA .  39 . C  .  40 . N 1 1 
         9 . 1 1  39 MET C 1 1  40 LEU N  1 1  40 LEU CA 1 1  40 LEU C     -85.35     -45.35 .  39 . C .  40 . N  .  40 . CA .  40 . C 1 1 
        10 . 1 1  40 LEU N 1 1  40 LEU CA 1 1  40 LEU C  1 1  41 LYS N -63.479996     -23.48 .  40 . N .  40 . CA .  40 . C  .  41 . N 1 1 
        11 . 1 1  40 LEU C 1 1  41 LYS N  1 1  41 LYS CA 1 1  41 LYS C     -80.06     -40.06 .  40 . C .  41 . N  .  41 . CA .  41 . C 1 1 
        12 . 1 1  41 LYS N 1 1  41 LYS CA 1 1  41 LYS C  1 1  42 THR N     -64.88     -24.88 .  41 . N .  41 . CA .  41 . C  .  42 . N 1 1 
        13 . 1 1  41 LYS C 1 1  42 THR N  1 1  42 THR CA 1 1  42 THR C     -84.41     -44.41 .  41 . C .  42 . N  .  42 . CA .  42 . C 1 1 
        14 . 1 1  42 THR N 1 1  42 THR CA 1 1  42 THR C  1 1  43 TYR N     -55.28 -15.279999 .  42 . N .  42 . CA .  42 . C  .  43 . N 1 1 
        15 . 1 1  44 PHE C 1 1  45 SER N  1 1  45 SER CA 1 1  45 SER C     -87.08     -47.08 .  44 . C .  45 . N  .  45 . CA .  45 . C 1 1 
        16 . 1 1  45 SER N 1 1  45 SER CA 1 1  45 SER C  1 1  46 ASP N     -42.88      -2.88 .  45 . N .  45 . CA .  45 . C  .  46 . N 1 1 
        17 . 1 1  50 ASN C 1 1  51 ARG N  1 1  51 ARG CA 1 1  51 ARG C     -89.99     -45.81 .  50 . C .  51 . N  .  51 . CA .  51 . C 1 1 
        18 . 1 1  51 ARG N 1 1  51 ARG CA 1 1  51 ARG C  1 1  52 CYS N     -59.03     -19.03 .  51 . N .  51 . CA .  51 . C  .  52 . N 1 1 
        19 . 1 1  51 ARG C 1 1  52 CYS N  1 1  52 CYS CA 1 1  52 CYS C  -89.99999     -45.54 .  51 . C .  52 . N  .  52 . CA .  52 . C 1 1 
        20 . 1 1  52 CYS N 1 1  52 CYS CA 1 1  52 CYS C  1 1  53 ILE N     -62.53     -22.53 .  52 . N .  52 . CA .  52 . C  .  53 . N 1 1 
        21 . 1 1  52 CYS C 1 1  53 ILE N  1 1  53 ILE CA 1 1  53 ILE C  -89.99999      -48.3 .  52 . C .  53 . N  .  53 . CA .  53 . C 1 1 
        22 . 1 1  53 ILE N 1 1  53 ILE CA 1 1  53 ILE C  1 1  54 THR N     -63.46     -23.46 .  53 . N .  53 . CA .  53 . C  .  54 . N 1 1 
        23 . 1 1  53 ILE C 1 1  54 THR N  1 1  54 THR CA 1 1  54 THR C  -89.99999     -44.32 .  53 . C .  54 . N  .  54 . CA .  54 . C 1 1 
        24 . 1 1  54 THR N 1 1  54 THR CA 1 1  54 THR C  1 1  55 SER N     -62.55     -22.55 .  54 . N .  54 . CA .  54 . C  .  55 . N 1 1 
        25 . 1 1  54 THR C 1 1  55 SER N  1 1  55 SER CA 1 1  55 SER C     -89.99     -45.81 .  54 . C .  55 . N  .  55 . CA .  55 . C 1 1 
        26 . 1 1  55 SER N 1 1  55 SER CA 1 1  55 SER C  1 1  56 GLN N      -60.5      -20.5 .  55 . N .  55 . CA .  55 . C  .  56 . N 1 1 
        27 . 1 1  55 SER C 1 1  56 GLN N  1 1  56 GLN CA 1 1  56 GLN C  -89.99999      -45.4 .  55 . C .  56 . N  .  56 . CA .  56 . C 1 1 
        28 . 1 1  56 GLN N 1 1  56 GLN CA 1 1  56 GLN C  1 1  57 LEU N -58.049995     -18.05 .  56 . N .  56 . CA .  56 . C  .  57 . N 1 1 
        29 . 1 1  56 GLN C 1 1  57 LEU N  1 1  57 LEU CA 1 1  57 LEU C     -93.37     -45.37 .  56 . C .  57 . N  .  57 . CA .  57 . C 1 1 
        30 . 1 1  57 LEU N 1 1  57 LEU CA 1 1  57 LEU C  1 1  58 ILE N     -60.26      -20.0 .  57 . N .  57 . CA .  57 . C  .  58 . N 1 1 
        31 . 1 1  58 ILE C 1 1  59 LYS N  1 1  59 LYS CA 1 1  59 LYS C     -92.34     -45.34 .  58 . C .  59 . N  .  59 . CA .  59 . C 1 1 
        32 . 1 1  59 LYS N 1 1  59 LYS CA 1 1  59 LYS C  1 1  60 TRP N     -57.27     -17.27 .  59 . N .  59 . CA .  59 . C  .  60 . N 1 1 
        33 . 1 1  59 LYS C 1 1  60 TRP N  1 1  60 TRP CA 1 1  60 TRP C  -89.99999     -45.88 .  59 . C .  60 . N  .  60 . CA .  60 . C 1 1 
        34 . 1 1  60 TRP N 1 1  60 TRP CA 1 1  60 TRP C  1 1  61 PHE N     -57.19     -17.19 .  60 . N .  60 . CA .  60 . C  .  61 . N 1 1 
        35 . 1 1  62 SER C 1 1  63 ASN N  1 1  63 ASN CA 1 1  63 ASN C     -89.62     -49.62 .  62 . C .  63 . N  .  63 . CA .  63 . C 1 1 
        36 . 1 1  63 ASN N 1 1  63 ASN CA 1 1  63 ASN C  1 1  64 PHE N     -64.17     -20.17 .  63 . N .  63 . CA .  63 . C  .  64 . N 1 1 
        37 . 1 1  63 ASN C 1 1  64 PHE N  1 1  64 PHE CA 1 1  64 PHE C  -89.99999     -45.16 .  63 . C .  64 . N  .  64 . CA .  64 . C 1 1 
        38 . 1 1  64 PHE N 1 1  64 PHE CA 1 1  64 PHE C  1 1  65 ARG N     -69.67     -20.33 .  64 . N .  64 . CA .  64 . C  .  65 . N 1 1 
        39 . 1 1  65 ARG C 1 1  66 GLU N  1 1  66 GLU CA 1 1  66 GLU C     -90.01     -44.07 .  65 . C .  66 . N  .  66 . CA .  66 . C 1 1 
        40 . 1 1  66 GLU N 1 1  66 GLU CA 1 1  66 GLU C  1 1  67 PHE N -62.130005     -22.13 .  66 . N .  66 . CA .  66 . C  .  67 . N 1 1 
        41 . 1 1  67 PHE C 1 1  68 TYR N  1 1  68 TYR CA 1 1  68 TYR C  -89.99999     -42.72 .  67 . C .  68 . N  .  68 . CA .  68 . C 1 1 
        42 . 1 1  68 TYR N 1 1  68 TYR CA 1 1  68 TYR C  1 1  69 TYR N -60.089996     -26.09 .  68 . N .  68 . CA .  68 . C  .  69 . N 1 1 
        43 . 1 1  68 TYR C 1 1  69 TYR N  1 1  69 TYR CA 1 1  69 TYR C  -89.99999     -42.62 .  68 . C .  69 . N  .  69 . CA .  69 . C 1 1 
        44 . 1 1  69 TYR N 1 1  69 TYR CA 1 1  69 TYR C  1 1  70 ILE N     -58.79     -18.79 .  69 . N .  69 . CA .  69 . C  .  70 . N 1 1 
        45 . 1 1  69 TYR C 1 1  70 ILE N  1 1  70 ILE CA 1 1  70 ILE C  -89.99999     -47.22 .  69 . C .  70 . N  .  70 . CA .  70 . C 1 1 
        46 . 1 1  70 ILE N 1 1  70 ILE CA 1 1  70 ILE C  1 1  71 GLN N -59.869995     -19.87 .  70 . N .  70 . CA .  70 . C  .  71 . N 1 1 
        47 . 1 1  70 ILE C 1 1  71 GLN N  1 1  71 GLN CA 1 1  71 GLN C  -89.99999     -43.98 .  70 . C .  71 . N  .  71 . CA .  71 . C 1 1 
        48 . 1 1  71 GLN N 1 1  71 GLN CA 1 1  71 GLN C  1 1  72 MET N     -54.98     -20.98 .  71 . N .  71 . CA .  71 . C  .  72 . N 1 1 
        49 . 1 1  71 GLN C 1 1  72 MET N  1 1  72 MET CA 1 1  72 MET C      -89.6      -45.6 .  71 . C .  72 . N  .  72 . CA .  72 . C 1 1 
        50 . 1 1  72 MET N 1 1  72 MET CA 1 1  72 MET C  1 1  73 GLU N -60.409996     -20.41 .  72 . N .  72 . CA .  72 . C  .  73 . N 1 1 
        51 . 1 1  72 MET C 1 1  73 GLU N  1 1  73 GLU CA 1 1  73 GLU C  -89.99999      -45.8 .  72 . C .  73 . N  .  73 . CA .  73 . C 1 1 
        52 . 1 1  73 GLU N 1 1  73 GLU CA 1 1  73 GLU C  1 1  74 LYS N -62.700005      -22.7 .  73 . N .  73 . CA .  73 . C  .  74 . N 1 1 
        53 . 1 1  73 GLU C 1 1  74 LYS N  1 1  74 LYS CA 1 1  74 LYS C     -90.01     -42.91 .  73 . C .  74 . N  .  74 . CA .  74 . C 1 1 
        54 . 1 1  74 LYS N 1 1  74 LYS CA 1 1  74 LYS C  1 1  75 TYR N -61.600002      -21.6 .  74 . N .  74 . CA .  74 . C  .  75 . N 1 1 
        55 . 1 1  74 LYS C 1 1  75 TYR N  1 1  75 TYR CA 1 1  75 TYR C     -82.54     -42.54 .  74 . C .  75 . N  .  75 . CA .  75 . C 1 1 
        56 . 1 1  75 TYR N 1 1  75 TYR CA 1 1  75 TYR C  1 1  76 ALA N     -61.14     -21.14 .  75 . N .  75 . CA .  75 . C  .  76 . N 1 1 
        57 . 1 1  75 TYR C 1 1  76 ALA N  1 1  76 ALA CA 1 1  76 ALA C      -80.8      -45.8 .  75 . C .  76 . N  .  76 . CA .  76 . C 1 1 
        58 . 1 1  76 ALA N 1 1  76 ALA CA 1 1  76 ALA C  1 1  77 ARG N     -65.03     -20.03 .  76 . N .  76 . CA .  76 . C  .  77 . N 1 1 
        59 . 1 1  76 ALA C 1 1  77 ARG N  1 1  77 ARG CA 1 1  77 ARG C     -84.17     -44.17 .  76 . C .  77 . N  .  77 . CA .  77 . C 1 1 
        60 . 1 1  77 ARG N 1 1  77 ARG CA 1 1  77 ARG C  1 1  78 GLN N     -60.38     -20.38 .  77 . N .  77 . CA .  77 . C  .  78 . N 1 1 
        61 . 1 1  77 ARG C 1 1  78 GLN N  1 1  78 GLN CA 1 1  78 GLN C     -84.71     -44.71 .  77 . C .  78 . N  .  78 . CA .  78 . C 1 1 
        62 . 1 1  78 GLN N 1 1  78 GLN CA 1 1  78 GLN C  1 1  79 ALA N     -63.92     -23.92 .  78 . N .  78 . CA .  78 . C  .  79 . N 1 1 
        63 . 1 1  78 GLN C 1 1  79 ALA N  1 1  79 ALA CA 1 1  79 ALA C  -89.99999      -40.0 .  78 . C .  79 . N  .  79 . CA .  79 . C 1 1 
        64 . 1 1  79 ALA N 1 1  79 ALA CA 1 1  79 ALA C  1 1  80 ILE N -63.589996     -23.59 .  79 . N .  79 . CA .  79 . C  .  80 . N 1 1 
        65 . 1 1  79 ALA C 1 1  80 ILE N  1 1  80 ILE CA 1 1  80 ILE C     -89.99     -43.09 .  79 . C .  80 . N  .  80 . CA .  80 . C 1 1 
        66 . 1 1  80 ILE N 1 1  80 ILE CA 1 1  80 ILE C  1 1  81 ASN N     -64.58     -24.58 .  80 . N .  80 . CA .  80 . C  .  81 . N 1 1 
        67 . 1 1  80 ILE C 1 1  81 ASN N  1 1  81 ASN CA 1 1  81 ASN C     -85.12     -45.12 .  80 . C .  81 . N  .  81 . CA .  81 . C 1 1 
        68 . 1 1  81 ASN N 1 1  81 ASN CA 1 1  81 ASN C  1 1  82 ASP N     -60.14     -20.14 .  81 . N .  81 . CA .  81 . C  .  82 . N 1 1 
        69 . 1 1  81 ASN C 1 1  82 ASP N  1 1  82 ASP CA 1 1  82 ASP C    -101.36     -61.36 .  81 . C .  82 . N  .  82 . CA .  82 . C 1 1 
        70 . 1 1  82 ASP N 1 1  82 ASP CA 1 1  82 ASP C  1 1  83 GLY N     -26.29      13.71 .  82 . N .  82 . CA .  82 . C  .  83 . N 1 1 
        71 . 1 1  85 THR C 1 1  86 SER N  1 1  86 SER CA 1 1  86 SER C     -141.5     -101.5 .  85 . C .  86 . N  .  86 . CA .  86 . C 1 1 
        72 . 1 1  86 SER N 1 1  86 SER CA 1 1  86 SER C  1 1  87 THR N  107.94999     147.95 .  86 . N .  86 . CA .  86 . C  .  87 . N 1 1 
        73 . 1 1  86 SER C 1 1  87 THR N  1 1  87 THR CA 1 1  87 THR C     -77.67     -37.67 .  86 . C .  87 . N  .  87 . CA .  87 . C 1 1 
        74 . 1 1  87 THR N 1 1  87 THR CA 1 1  87 THR C  1 1  88 GLU N     -48.35      -8.35 .  87 . N .  87 . CA .  87 . C  .  88 . N 1 1 
        75 . 1 1  87 THR C 1 1  88 GLU N  1 1  88 GLU CA 1 1  88 GLU C     -88.48     -48.48 .  87 . C .  88 . N  .  88 . CA .  88 . C 1 1 
        76 . 1 1  88 GLU N 1 1  88 GLU CA 1 1  88 GLU C  1 1  89 GLU N     -39.41       0.57 .  88 . N .  88 . CA .  88 . C  .  89 . N 1 1 
        77 . 1 1  96 CYS C 1 1  97 GLU N  1 1  97 GLU CA 1 1  97 GLU C -91.329994     -41.33 .  96 . C .  97 . N  .  97 . CA .  97 . C 1 1 
        78 . 1 1  97 GLU N 1 1  97 GLU CA 1 1  97 GLU C  1 1  98 LEU N     -56.36     -20.36 .  97 . N .  97 . CA .  97 . C  .  98 . N 1 1 
        79 . 1 1  97 GLU C 1 1  98 LEU N  1 1  98 LEU CA 1 1  98 LEU C  -93.03999     -43.04 .  97 . C .  98 . N  .  98 . CA .  98 . C 1 1 
        80 . 1 1  98 LEU N 1 1  98 LEU CA 1 1  98 LEU C  1 1  99 TYR N     -65.08     -25.08 .  98 . N .  98 . CA .  98 . C  .  99 . N 1 1 
        81 . 1 1  98 LEU C 1 1  99 TYR N  1 1  99 TYR CA 1 1  99 TYR C     -91.35     -41.35 .  98 . C .  99 . N  .  99 . CA .  99 . C 1 1 
        82 . 1 1  99 TYR N 1 1  99 TYR CA 1 1  99 TYR C  1 1 100 ARG N     -64.24     -24.24 .  99 . N .  99 . CA .  99 . C  . 100 . N 1 1 
        83 . 1 1  99 TYR C 1 1 100 ARG N  1 1 100 ARG CA 1 1 100 ARG C      -82.8 -42.799995 .  99 . C . 100 . N  . 100 . CA . 100 . C 1 1 
        84 . 1 1 100 ARG N 1 1 100 ARG CA 1 1 100 ARG C  1 1 101 ALA N -60.999996      -21.0 . 100 . N . 100 . CA . 100 . C  . 101 . N 1 1 
        85 . 1 1 100 ARG C 1 1 101 ALA N  1 1 101 ALA CA 1 1 101 ALA C      -83.0      -43.0 . 100 . C . 101 . N  . 101 . CA . 101 . C 1 1 
        86 . 1 1 101 ALA N 1 1 101 ALA CA 1 1 101 ALA C  1 1 102 LEU N -62.349995 -22.349998 . 101 . N . 101 . CA . 101 . C  . 102 . N 1 1 
        87 . 1 1 101 ALA C 1 1 102 LEU N  1 1 102 LEU CA 1 1 102 LEU C     -86.58     -46.58 . 101 . C . 102 . N  . 102 . CA . 102 . C 1 1 
        88 . 1 1 102 LEU N 1 1 102 LEU CA 1 1 102 LEU C  1 1 103 ASN N -59.729996     -19.73 . 102 . N . 102 . CA . 102 . C  . 103 . N 1 1 
        89 . 1 1 102 LEU C 1 1 103 ASN N  1 1 103 ASN CA 1 1 103 ASN C     -89.49     -40.49 . 102 . C . 103 . N  . 103 . CA . 103 . C 1 1 
        90 . 1 1 103 ASN N 1 1 103 ASN CA 1 1 103 ASN C  1 1 104 MET N -62.879997 -22.879997 . 103 . N . 103 . CA . 103 . C  . 104 . N 1 1 
        91 . 1 1 103 ASN C 1 1 104 MET N  1 1 104 MET CA 1 1 104 MET C     -83.08     -43.08 . 103 . C . 104 . N  . 104 . CA . 104 . C 1 1 
        92 . 1 1 104 MET N 1 1 104 MET CA 1 1 104 MET C  1 1 105 HIS N     -52.68     -22.68 . 104 . N . 104 . CA . 104 . C  . 105 . N 1 1 
        93 . 1 1 104 MET C 1 1 105 HIS N  1 1 105 HIS CA 1 1 105 HIS C     -89.54     -49.54 . 104 . C . 105 . N  . 105 . CA . 105 . C 1 1 
        94 . 1 1 105 HIS N 1 1 105 HIS CA 1 1 105 HIS C  1 1 106 TYR N     -53.79     -13.79 . 105 . N . 105 . CA . 105 . C  . 106 . N 1 1 
        95 . 1 1 105 HIS C 1 1 106 TYR N  1 1 106 TYR CA 1 1 106 TYR C      -90.8      -45.8 . 105 . C . 106 . N  . 106 . CA . 106 . C 1 1 
        96 . 1 1 106 TYR N 1 1 106 TYR CA 1 1 106 TYR C  1 1 107 ASN N     -60.84     -20.16 . 106 . N . 106 . CA . 106 . C  . 107 . N 1 1 
        97 . 1 1 115 PRO C 1 1 116 GLU N  1 1 116 GLU CA 1 1 116 GLU C     -90.41     -40.41 . 115 . C . 116 . N  . 116 . CA . 116 . C 1 1 
        98 . 1 1 116 GLU N 1 1 116 GLU CA 1 1 116 GLU C  1 1 117 ARG N -60.859997     -20.86 . 116 . N . 116 . CA . 116 . C  . 117 . N 1 1 
        99 . 1 1 116 GLU C 1 1 117 ARG N  1 1 117 ARG CA 1 1 117 ARG C     -85.08 -45.079998 . 116 . C . 117 . N  . 117 . CA . 117 . C 1 1 
       100 . 1 1 117 ARG N 1 1 117 ARG CA 1 1 117 ARG C  1 1 118 PHE N     -60.99     -20.99 . 117 . N . 117 . CA . 117 . C  . 118 . N 1 1 
       101 . 1 1 117 ARG C 1 1 118 PHE N  1 1 118 PHE CA 1 1 118 PHE C      -83.9      -43.9 . 117 . C . 118 . N  . 118 . CA . 118 . C 1 1 
       102 . 1 1 118 PHE N 1 1 118 PHE CA 1 1 118 PHE C  1 1 119 LEU N -61.779995 -21.779999 . 118 . N . 118 . CA . 118 . C  . 119 . N 1 1 
       103 . 1 1 118 PHE C 1 1 119 LEU N  1 1 119 LEU CA 1 1 119 LEU C     -83.74     -43.74 . 118 . C . 119 . N  . 119 . CA . 119 . C 1 1 
       104 . 1 1 119 LEU N 1 1 119 LEU CA 1 1 119 LEU C  1 1 120 GLU N     -64.08     -20.08 . 119 . N . 119 . CA . 119 . C  . 120 . N 1 1 
       105 . 1 1 119 LEU C 1 1 120 GLU N  1 1 120 GLU CA 1 1 120 GLU C     -84.67     -44.67 . 119 . C . 120 . N  . 120 . CA . 120 . C 1 1 
       106 . 1 1 120 GLU N 1 1 120 GLU CA 1 1 120 GLU C  1 1 121 VAL N     -60.81 -20.809998 . 120 . N . 120 . CA . 120 . C  . 121 . N 1 1 
       107 . 1 1 120 GLU C 1 1 121 VAL N  1 1 121 VAL CA 1 1 121 VAL C     -85.25     -45.25 . 120 . C . 121 . N  . 121 . CA . 121 . C 1 1 
       108 . 1 1 121 VAL N 1 1 121 VAL CA 1 1 121 VAL C  1 1 122 ALA N     -60.96     -20.96 . 121 . N . 121 . CA . 121 . C  . 122 . N 1 1 
       109 . 1 1 121 VAL C 1 1 122 ALA N  1 1 122 ALA CA 1 1 122 ALA C     -86.51     -46.51 . 121 . C . 122 . N  . 122 . CA . 122 . C 1 1 
       110 . 1 1 122 ALA N 1 1 122 ALA CA 1 1 122 ALA C  1 1 123 GLN N -61.119995     -21.12 . 122 . N . 122 . CA . 122 . C  . 123 . N 1 1 
       111 . 1 1 122 ALA C 1 1 123 GLN N  1 1 123 GLN CA 1 1 123 GLN C     -86.45     -43.45 . 122 . C . 123 . N  . 123 . CA . 123 . C 1 1 
       112 . 1 1 123 GLN N 1 1 123 GLN CA 1 1 123 GLN C  1 1 124 ILE N     -62.39     -22.39 . 123 . N . 123 . CA . 123 . C  . 124 . N 1 1 
       113 . 1 1 123 GLN C 1 1 124 ILE N  1 1 124 ILE CA 1 1 124 ILE C     -87.27     -40.27 . 123 . C . 124 . N  . 124 . CA . 124 . C 1 1 
       114 . 1 1 124 ILE N 1 1 124 ILE CA 1 1 124 ILE C  1 1 125 THR N -60.209995     -20.21 . 124 . N . 124 . CA . 124 . C  . 125 . N 1 1 
       115 . 1 1 124 ILE C 1 1 125 THR N  1 1 125 THR CA 1 1 125 THR C  -87.49999      -43.5 . 124 . C . 125 . N  . 125 . CA . 125 . C 1 1 
       116 . 1 1 125 THR N 1 1 125 THR CA 1 1 125 THR C  1 1 126 LEU N -59.069996     -19.07 . 125 . N . 125 . CA . 125 . C  . 126 . N 1 1 
       117 . 1 1 125 THR C 1 1 126 LEU N  1 1 126 LEU CA 1 1 126 LEU C     -87.44     -42.44 . 125 . C . 126 . N  . 126 . CA . 126 . C 1 1 
       118 . 1 1 126 LEU N 1 1 126 LEU CA 1 1 126 LEU C  1 1 127 ARG N     -65.18     -20.18 . 126 . N . 126 . CA . 126 . C  . 127 . N 1 1 
       119 . 1 1 126 LEU C 1 1 127 ARG N  1 1 127 ARG CA 1 1 127 ARG C     -88.09     -39.09 . 126 . C . 127 . N  . 127 . CA . 127 . C 1 1 
       120 . 1 1 127 ARG N 1 1 127 ARG CA 1 1 127 ARG C  1 1 128 GLU N -62.369995     -22.37 . 127 . N . 127 . CA . 127 . C  . 128 . N 1 1 
       121 . 1 1 127 ARG C 1 1 128 GLU N  1 1 128 GLU CA 1 1 128 GLU C     -88.09 -44.089996 . 127 . C . 128 . N  . 128 . CA . 128 . C 1 1 
       122 . 1 1 128 GLU N 1 1 128 GLU CA 1 1 128 GLU C  1 1 129 PHE N     -62.61     -22.61 . 128 . N . 128 . CA . 128 . C  . 129 . N 1 1 
       123 . 1 1 128 GLU C 1 1 129 PHE N  1 1 129 PHE CA 1 1 129 PHE C     -88.91     -45.91 . 128 . C . 129 . N  . 129 . CA . 129 . C 1 1 
       124 . 1 1 129 PHE N 1 1 129 PHE CA 1 1 129 PHE C  1 1 130 PHE N     -62.15     -22.15 . 129 . N . 129 . CA . 129 . C  . 130 . N 1 1 
       125 . 1 1 129 PHE C 1 1 130 PHE N  1 1 130 PHE CA 1 1 130 PHE C     -88.79     -42.79 . 129 . C . 130 . N  . 130 . CA . 130 . C 1 1 
       126 . 1 1 130 PHE N 1 1 130 PHE CA 1 1 130 PHE C  1 1 131 ASN N -60.869995     -20.87 . 130 . N . 130 . CA . 130 . C  . 131 . N 1 1 
       127 . 1 1 130 PHE C 1 1 131 ASN N  1 1 131 ASN CA 1 1 131 ASN C      -88.7 -41.699997 . 130 . C . 131 . N  . 131 . CA . 131 . C 1 1 
       128 . 1 1 131 ASN N 1 1 131 ASN CA 1 1 131 ASN C  1 1 132 ALA N -60.230003     -20.23 . 131 . N . 131 . CA . 131 . C  . 132 . N 1 1 
       129 . 1 1 131 ASN C 1 1 132 ALA N  1 1 132 ALA CA 1 1 132 ALA C     -88.05     -46.05 . 131 . C . 132 . N  . 132 . CA . 132 . C 1 1 
       130 . 1 1 132 ALA N 1 1 132 ALA CA 1 1 132 ALA C  1 1 133 ILE N     -60.58     -20.58 . 132 . N . 132 . CA . 132 . C  . 133 . N 1 1 
       131 . 1 1 132 ALA C 1 1 133 ILE N  1 1 133 ILE CA 1 1 133 ILE C     -88.77     -44.77 . 132 . C . 133 . N  . 133 . CA . 133 . C 1 1 
       132 . 1 1 133 ILE N 1 1 133 ILE CA 1 1 133 ILE C  1 1 134 ILE N -61.229996     -21.23 . 133 . N . 133 . CA . 133 . C  . 134 . N 1 1 
       133 . 1 1 133 ILE C 1 1 134 ILE N  1 1 134 ILE CA 1 1 134 ILE C     -88.03     -44.03 . 133 . C . 134 . N  . 134 . CA . 134 . C 1 1 
       134 . 1 1 134 ILE N 1 1 134 ILE CA 1 1 134 ILE C  1 1 135 ALA N -60.409996     -20.41 . 134 . N . 134 . CA . 134 . C  . 135 . N 1 1 
       135 . 1 1 141 PRO C 1 1 142 SER N  1 1 142 SER CA 1 1 142 SER C     -92.45     -52.45 . 141 . C . 142 . N  . 142 . CA . 142 . C 1 1 
       136 . 1 1 142 SER N 1 1 142 SER CA 1 1 142 SER C  1 1 143 TRP N     -54.48     -14.48 . 142 . N . 142 . CA . 142 . C  . 143 . N 1 1 
       137 . 1 1 142 SER C 1 1 143 TRP N  1 1 143 TRP CA 1 1 143 TRP C     -85.96     -45.96 . 142 . C . 143 . N  . 143 . CA . 143 . C 1 1 
       138 . 1 1 143 TRP N 1 1 143 TRP CA 1 1 143 TRP C  1 1 144 LYS N     -55.12     -15.12 . 143 . N . 143 . CA . 143 . C  . 144 . N 1 1 
       139 . 1 1 143 TRP C 1 1 144 LYS N  1 1 144 LYS CA 1 1 144 LYS C     -83.31     -43.31 . 143 . C . 144 . N  . 144 . CA . 144 . C 1 1 
       140 . 1 1 144 LYS N 1 1 144 LYS CA 1 1 144 LYS C  1 1 145 LYS N     -62.83     -22.83 . 144 . N . 144 . CA . 144 . C  . 145 . N 1 1 
       141 . 1 1 144 LYS C 1 1 145 LYS N  1 1 145 LYS CA 1 1 145 LYS C     -92.43     -42.43 . 144 . C . 145 . N  . 145 . CA . 145 . C 1 1 
       142 . 1 1 145 LYS N 1 1 145 LYS CA 1 1 145 LYS C  1 1 146 ALA N      -63.0      -23.0 . 145 . N . 145 . CA . 145 . C  . 146 . N 1 1 
       143 . 1 1 145 LYS C 1 1 146 ALA N  1 1 146 ALA CA 1 1 146 ALA C  -92.38999     -42.39 . 145 . C . 146 . N  . 146 . CA . 146 . C 1 1 
       144 . 1 1 146 ALA N 1 1 146 ALA CA 1 1 146 ALA C  1 1 147 ILE N      -61.9      -21.9 . 146 . N . 146 . CA . 146 . C  . 147 . N 1 1 
       145 . 1 1 146 ALA C 1 1 147 ILE N  1 1 147 ILE CA 1 1 147 ILE C     -91.36     -41.36 . 146 . C . 147 . N  . 147 . CA . 147 . C 1 1 
       146 . 1 1 147 ILE N 1 1 147 ILE CA 1 1 147 ILE C  1 1 148 TYR N     -66.54     -26.54 . 147 . N . 147 . CA . 147 . C  . 148 . N 1 1 
       147 . 1 1 147 ILE C 1 1 148 TYR N  1 1 148 TYR CA 1 1 148 TYR C     -90.78     -50.78 . 147 . C . 148 . N  . 148 . CA . 148 . C 1 1 
       148 . 1 1 148 TYR N 1 1 148 TYR CA 1 1 148 TYR C  1 1 149 LYS N     -52.02     -12.02 . 148 . N . 148 . CA . 148 . C  . 149 . N 1 1 
       149 . 1 1 148 TYR C 1 1 149 LYS N  1 1 149 LYS CA 1 1 149 LYS C     -92.08 -42.079998 . 148 . C . 149 . N  . 149 . CA . 149 . C 1 1 
       150 . 1 1 149 LYS N 1 1 149 LYS CA 1 1 149 LYS C  1 1 150 VAL N     -63.01     -23.01 . 149 . N . 149 . CA . 149 . C  . 150 . N 1 1 
       151 . 1 1 149 LYS C 1 1 150 VAL N  1 1 150 VAL CA 1 1 150 VAL C     -94.68     -44.68 . 149 . C . 150 . N  . 150 . CA . 150 . C 1 1 
       152 . 1 1 150 VAL N 1 1 150 VAL CA 1 1 150 VAL C  1 1 151 ILE N -62.339996     -22.34 . 150 . N . 150 . CA . 150 . C  . 151 . N 1 1 
       153 . 1 1 161 ILE C 1 1 162 PHE N  1 1 162 PHE CA 1 1 162 PHE C     -88.71     -48.71 . 161 . C . 162 . N  . 162 . CA . 162 . C 1 1 
       154 . 1 1 162 PHE N 1 1 162 PHE CA 1 1 162 PHE C  1 1 163 LYS N     -58.32     -18.32 . 162 . N . 162 . CA . 162 . C  . 163 . N 1 1 
       155 . 1 1 162 PHE C 1 1 163 LYS N  1 1 163 LYS CA 1 1 163 LYS C -93.799995      -53.8 . 162 . C . 163 . N  . 163 . CA . 163 . C 1 1 
       156 . 1 1 163 LYS N 1 1 163 LYS CA 1 1 163 LYS C  1 1 164 SER N     -44.34     -20.34 . 163 . N . 163 . CA . 163 . C  . 164 . N 1 1 
       157 . 1 1 167 CYS C 1 1 168 LEU N  1 1 168 LEU CA 1 1 168 LEU C     -84.05 -44.049995 . 167 . C . 168 . N  . 168 . CA . 168 . C 1 1 
       158 . 1 1 168 LEU N 1 1 168 LEU CA 1 1 168 LEU C  1 1 169 GLN N     -53.91     -13.91 . 168 . N . 168 . CA . 168 . C  . 169 . N 1 1 
       159 . 1 1 168 LEU C 1 1 169 GLN N  1 1 169 GLN CA 1 1 169 GLN C  -87.03999     -47.04 . 168 . C . 169 . N  . 169 . CA . 169 . C 1 1 
       160 . 1 1 169 GLN N 1 1 169 GLN CA 1 1 169 GLN C  1 1 170 GLU N -57.789997     -17.79 . 169 . N . 169 . CA . 169 . C  . 170 . N 1 1 
       161 . 1 1 169 GLN C 1 1 170 GLU N  1 1 170 GLU CA 1 1 170 GLU C     -96.11     -56.11 . 169 . C . 170 . N  . 170 . CA . 170 . C 1 1 
       162 . 1 1 170 GLU N 1 1 170 GLU CA 1 1 170 GLU C  1 1 171 LEU N     -51.75     -11.75 . 170 . N . 170 . CA . 170 . C  . 171 . N 1 1 
       163 . 1 1 171 LEU C 1 1 172 LEU N  1 1 172 LEU CA 1 1 172 LEU C -114.02999     -74.03 . 171 . C . 172 . N  . 172 . CA . 172 . C 1 1 
       164 . 1 1 172 LEU N 1 1 172 LEU CA 1 1 172 LEU C  1 1 173 HIS N      67.39     107.39 . 172 . N . 172 . CA . 172 . C  . 173 . N 1 1 
    stop_

save_


save_CNS/XPLOR_dipolar_coupling_5
    _RDC_constraint_list.Sf_category         RDC_constraints
    _RDC_constraint_list.Entry_ID            1
    _RDC_constraint_list.ID                  1
    _RDC_constraint_list.Constraint_file_ID  .
    _RDC_constraint_list.Block_ID            .

    loop_
       _RDC_constraint.ID
       _RDC_constraint.Entity_assembly_ID_1
       _RDC_constraint.Entity_ID_1
       _RDC_constraint.Comp_index_ID_1
       _RDC_constraint.Comp_ID_1
       _RDC_constraint.Atom_ID_1
       _RDC_constraint.Entity_assembly_ID_2
       _RDC_constraint.Entity_ID_2
       _RDC_constraint.Comp_index_ID_2
       _RDC_constraint.Comp_ID_2
       _RDC_constraint.Atom_ID_2
       _RDC_constraint.RDC_val
       _RDC_constraint.RDC_lower_bound
       _RDC_constraint.RDC_upper_bound
       _RDC_constraint.RDC_val_err
       _RDC_constraint.Auth_asym_ID_1
       _RDC_constraint.Auth_seq_ID_1
       _RDC_constraint.Auth_comp_ID_1
       _RDC_constraint.Auth_atom_ID_1
       _RDC_constraint.Auth_asym_ID_2
       _RDC_constraint.Auth_seq_ID_2
       _RDC_constraint.Auth_comp_ID_2
       _RDC_constraint.Auth_atom_ID_2
       _RDC_constraint.Entry_ID
       _RDC_constraint.RDC_constraint_list_ID

        1 1 1  12 ALA N 1 1  12 ALA H  0.244 . . . .  12 . HN .  12 . N  1 1 
        2 1 1  13 MET N 1 1  13 MET H -0.072 . . . .  13 . HN .  13 . N  1 1 
        3 1 1  17 LEU N 1 1  17 LEU H -1.544 . . . .  17 . HN .  17 . N  1 1 
        4 1 1  32 THR N 1 1  32 THR H  3.426 . . . .  32 . HN .  32 . N  1 1 
        5 1 1  34 TYR N 1 1  34 TYR H -2.744 . . . .  34 . HN .  34 . N  1 1 
        6 1 1  36 SER N 1 1  36 SER H -6.114 . . . .  36 . N  .  36 . HN 1 1 
        7 1 1  39 MET N 1 1  39 MET H  2.146 . . . .  39 . HN .  39 . N  1 1 
        8 1 1  40 LEU N 1 1  40 LEU H  5.926 . . . .  40 . HN .  40 . N  1 1 
        9 1 1  44 PHE N 1 1  44 PHE H  1.972 . . . .  44 . HN .  44 . N  1 1 
       10 1 1  45 SER N 1 1  45 SER H  0.396 . . . .  45 . HN .  45 . N  1 1 
       11 1 1  46 ASP N 1 1  46 ASP H -4.688 . . . .  46 . HN .  46 . N  1 1 
       12 1 1  48 LYS N 1 1  48 LYS H  4.892 . . . .  48 . HN .  48 . N  1 1 
       13 1 1  49 PHE N 1 1  49 PHE H  5.806 . . . .  49 . HN .  49 . N  1 1 
       14 1 1  58 ILE N 1 1  58 ILE H -4.182 . . . .  58 . HN .  58 . N  1 1 
       15 1 1  61 PHE N 1 1  61 PHE H -3.704 . . . .  61 . HN .  61 . N  1 1 
       16 1 1  62 SER N 1 1  62 SER H  2.432 . . . .  62 . HN .  62 . N  1 1 
       17 1 1  65 ARG N 1 1  65 ARG H   -2.4 . . . .  65 . HN .  65 . N  1 1 
       18 1 1  68 TYR N 1 1  68 TYR H -3.544 . . . .  68 . HN .  68 . N  1 1 
       19 1 1  69 TYR N 1 1  69 TYR H -2.228 . . . .  69 . HN .  69 . N  1 1 
       20 1 1  70 ILE N 1 1  70 ILE H -1.684 . . . .  70 . HN .  70 . N  1 1 
       21 1 1  71 GLN N 1 1  71 GLN H -5.178 . . . .  71 . HN .  71 . N  1 1 
       22 1 1  72 MET N 1 1  72 MET H  -3.99 . . . .  72 . HN .  72 . N  1 1 
       23 1 1  73 GLU N 1 1  73 GLU H -3.212 . . . .  73 . HN .  73 . N  1 1 
       24 1 1  74 LYS N 1 1  74 LYS H  0.598 . . . .  74 . HN .  74 . N  1 1 
       25 1 1  75 TYR N 1 1  75 TYR H -4.314 . . . .  75 . HN .  75 . N  1 1 
       26 1 1  76 ALA N 1 1  76 ALA H -4.988 . . . .  76 . HN .  76 . N  1 1 
       27 1 1  77 ARG N 1 1  77 ARG H -0.198 . . . .  77 . HN .  77 . N  1 1 
       28 1 1  78 GLN N 1 1  78 GLN H -0.948 . . . .  78 . HN .  78 . N  1 1 
       29 1 1  80 ILE N 1 1  80 ILE H -3.222 . . . .  80 . HN .  80 . N  1 1 
       30 1 1  81 ASN N 1 1  81 ASN H -2.146 . . . .  81 . HN .  81 . N  1 1 
       31 1 1  82 ASP N 1 1  82 ASP H -3.878 . . . .  82 . HN .  82 . N  1 1 
       32 1 1  83 GLY N 1 1  83 GLY H -5.828 . . . .  83 . HN .  83 . N  1 1 
       33 1 1  84 VAL N 1 1  84 VAL H  0.506 . . . .  84 . HN .  84 . N  1 1 
       34 1 1  85 THR N 1 1  85 THR H -0.406 . . . .  85 . HN .  85 . N  1 1 
       35 1 1  86 SER N 1 1  86 SER H  3.428 . . . .  86 . HN .  86 . N  1 1 
       36 1 1  89 GLU N 1 1  89 GLU H -0.686 . . . .  89 . HN .  89 . N  1 1 
       37 1 1  90 LEU N 1 1  90 LEU H  5.306 . . . .  90 . HN .  90 . N  1 1 
       38 1 1  91 SER N 1 1  91 SER H  1.014 . . . .  91 . HN .  91 . N  1 1 
       39 1 1  94 ARG N 1 1  94 ARG H -4.266 . . . .  94 . HN .  94 . N  1 1 
       40 1 1  97 GLU N 1 1  97 GLU H  -0.27 . . . .  97 . HN .  97 . N  1 1 
       41 1 1  99 TYR N 1 1  99 TYR H -4.556 . . . .  99 . HN .  99 . N  1 1 
       42 1 1 100 ARG N 1 1 100 ARG H -1.794 . . . . 100 . HN . 100 . N  1 1 
       43 1 1 101 ALA N 1 1 101 ALA H  3.436 . . . . 101 . HN . 101 . N  1 1 
       44 1 1 102 LEU N 1 1 102 LEU H  0.698 . . . . 102 . HN . 102 . N  1 1 
       45 1 1 104 MET N 1 1 104 MET H -2.284 . . . . 104 . HN . 104 . N  1 1 
       46 1 1 105 HIS N 1 1 105 HIS H   0.99 . . . . 105 . HN . 105 . N  1 1 
       47 1 1 107 ASN N 1 1 107 ASN H  -3.37 . . . . 107 . HN . 107 . N  1 1 
       48 1 1 108 LYS N 1 1 108 LYS H -5.414 . . . . 108 . HN . 108 . N  1 1 
       49 1 1 109 ALA N 1 1 109 ALA H -3.628 . . . . 109 . HN . 109 . N  1 1 
       50 1 1 110 ASN N 1 1 110 ASN H  0.794 . . . . 110 . HN . 110 . N  1 1 
       51 1 1 111 ASP N 1 1 111 ASP H -5.578 . . . . 111 . HN . 111 . N  1 1 
       52 1 1 113 GLU N 1 1 113 GLU H -2.974 . . . . 113 . HN . 113 . N  1 1 
       53 1 1 114 VAL N 1 1 114 VAL H  -1.84 . . . . 114 . HN . 114 . N  1 1 
       54 1 1 116 GLU N 1 1 116 GLU H -0.474 . . . . 116 . HN . 116 . N  1 1 
       55 1 1 117 ARG N 1 1 117 ARG H -1.978 . . . . 117 . HN . 117 . N  1 1 
       56 1 1 119 LEU N 1 1 119 LEU H  -0.17 . . . . 119 . HN . 119 . N  1 1 
       57 1 1 120 GLU N 1 1 120 GLU H   -1.2 . . . . 120 . HN . 120 . N  1 1 
       58 1 1 122 ALA N 1 1 122 ALA H   3.03 . . . . 122 . HN . 122 . N  1 1 
       59 1 1 123 GLN N 1 1 123 GLN H  -0.76 . . . . 123 . HN . 123 . N  1 1 
       60 1 1 124 ILE N 1 1 124 ILE H  0.414 . . . . 124 . HN . 124 . N  1 1 
       61 1 1 125 THR N 1 1 125 THR H   2.94 . . . . 125 . HN . 125 . N  1 1 
       62 1 1 126 LEU N 1 1 126 LEU H  2.548 . . . . 126 . HN . 126 . N  1 1 
       63 1 1 127 ARG N 1 1 127 ARG H   1.94 . . . . 127 . HN . 127 . N  1 1 
       64 1 1 128 GLU N 1 1 128 GLU H  2.354 . . . . 128 . HN . 128 . N  1 1 
       65 1 1 129 PHE N 1 1 129 PHE H  1.352 . . . . 129 . HN . 129 . N  1 1 
       66 1 1 131 ASN N 1 1 131 ASN H -0.134 . . . . 131 . HN . 131 . N  1 1 
       67 1 1 132 ALA N 1 1 132 ALA H  3.226 . . . . 132 . HN . 132 . N  1 1 
       68 1 1 133 ILE N 1 1 133 ILE H  0.128 . . . . 133 . HN . 133 . N  1 1 
       69 1 1 134 ILE N 1 1 134 ILE H  1.114 . . . . 134 . HN . 134 . N  1 1 
       70 1 1 135 ALA N 1 1 135 ALA H -0.308 . . . . 135 . HN . 135 . N  1 1 
       71 1 1 136 GLY N 1 1 136 GLY H  4.444 . . . . 136 . HN . 136 . N  1 1 
       72 1 1 137 LYS N 1 1 137 LYS H -4.396 . . . . 137 . HN . 137 . N  1 1 
       73 1 1 138 ASP N 1 1 138 ASP H -7.284 . . . . 138 . HN . 138 . N  1 1 
       74 1 1 139 VAL N 1 1 139 VAL H  0.302 . . . . 139 . HN . 139 . N  1 1 
       75 1 1 140 ASP N 1 1 140 ASP H -3.206 . . . . 140 . HN . 140 . N  1 1 
       76 1 1 142 SER N 1 1 142 SER H  3.896 . . . . 142 . HN . 142 . N  1 1 
       77 1 1 143 TRP N 1 1 143 TRP H -2.358 . . . . 143 . HN . 143 . N  1 1 
       78 1 1 144 LYS N 1 1 144 LYS H -2.758 . . . . 144 . HN . 144 . N  1 1 
       79 1 1 145 LYS N 1 1 145 LYS H -2.838 . . . . 145 . HN . 145 . N  1 1 
       80 1 1 146 ALA N 1 1 146 ALA H -3.052 . . . . 146 . HN . 146 . N  1 1 
       81 1 1 147 ILE N 1 1 147 ILE H -1.386 . . . . 147 . HN . 147 . N  1 1 
       82 1 1 148 TYR N 1 1 148 TYR H   -2.4 . . . . 148 . HN . 148 . N  1 1 
       83 1 1 149 LYS N 1 1 149 LYS H  -0.92 . . . . 149 . HN . 149 . N  1 1 
       84 1 1 150 VAL N 1 1 150 VAL H -0.356 . . . . 150 . HN . 150 . N  1 1 
       85 1 1 153 LYS N 1 1 153 LYS H -4.204 . . . . 153 . HN . 153 . N  1 1 
       86 1 1 155 ASP N 1 1 155 ASP H -2.052 . . . . 155 . HN . 155 . N  1 1 
       87 1 1 156 SER N 1 1 156 SER H  5.038 . . . . 156 . HN . 156 . N  1 1 
       88 1 1 157 GLU N 1 1 157 GLU H  -1.81 . . . . 157 . HN . 157 . N  1 1 
       89 1 1 158 VAL N 1 1 158 VAL H -3.888 . . . . 158 . HN . 158 . N  1 1 
       90 1 1 160 GLU N 1 1 160 GLU H -2.148 . . . . 160 . HN . 160 . N  1 1 
       91 1 1 163 LYS N 1 1 163 LYS H -2.418 . . . . 163 . HN . 163 . N  1 1 
       92 1 1 166 ASN N 1 1 166 ASN H  1.838 . . . . 166 . HN . 166 . N  1 1 
       93 1 1 167 CYS N 1 1 167 CYS H -3.436 . . . . 167 . HN . 167 . N  1 1 
       94 1 1 168 LEU N 1 1 168 LEU H -4.734 . . . . 168 . HN . 168 . N  1 1 
       95 1 1 169 GLN N 1 1 169 GLN H -5.116 . . . . 169 . HN . 169 . N  1 1 
       96 1 1 172 LEU N 1 1 172 LEU H -3.972 . . . . 172 . HN . 172 . N  1 1 
       97 1 1 173 HIS N 1 1 173 HIS H -0.616 . . . . 173 . HN . 173 . N  1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1   1 MET C    C  19.019   4.487  -1.308 1.00 . A A .   1 MET C    1 1 
        1     2 1 1   1 MET CA   C  17.918   5.537  -1.501 1.00 . A A .   1 MET CA   1 1 
        1     3 1 1   1 MET CB   C  17.174   5.294  -2.845 1.00 . A A .   1 MET CB   1 1 
        1     4 1 1   1 MET CE   C  13.800   7.803  -2.542 1.00 . A A .   1 MET CE   1 1 
        1     5 1 1   1 MET CG   C  16.112   6.347  -3.179 1.00 . A A .   1 MET CG   1 1 
        1     6 1 1   1 MET H1   H  19.030   7.037  -0.574 1.00 . A A .   1 MET H1   1 1 
        1     7 1 1   1 MET H2   H  17.765   7.619  -1.527 1.00 . A A .   1 MET H2   1 1 
        1     8 1 1   1 MET H3   H  19.174   7.028  -2.260 1.00 . A A .   1 MET H3   1 1 
        1     9 1 1   1 MET HA   H  17.210   5.466  -0.682 1.00 . A A .   1 MET HA   1 1 
        1    10 1 1   1 MET HB2  H  17.899   5.281  -3.654 1.00 . A A .   1 MET HB2  1 1 
        1    11 1 1   1 MET HB3  H  16.686   4.325  -2.805 1.00 . A A .   1 MET HB3  1 1 
        1    12 1 1   1 MET HE1  H  13.442   7.553  -3.530 1.00 . A A .   1 MET HE1  1 1 
        1    13 1 1   1 MET HE2  H  14.382   8.712  -2.589 1.00 . A A .   1 MET HE2  1 1 
        1    14 1 1   1 MET HE3  H  12.958   7.949  -1.882 1.00 . A A .   1 MET HE3  1 1 
        1    15 1 1   1 MET HG2  H  16.594   7.312  -3.272 1.00 . A A .   1 MET HG2  1 1 
        1    16 1 1   1 MET HG3  H  15.647   6.090  -4.123 1.00 . A A .   1 MET HG3  1 1 
        1    17 1 1   1 MET N    N  18.512   6.899  -1.466 1.00 . A A .   1 MET N    1 1 
        1    18 1 1   1 MET O    O  20.040   4.526  -2.002 1.00 . A A .   1 MET O    1 1 
        1    19 1 1   1 MET SD   S  14.826   6.466  -1.915 1.00 . A A .   1 MET SD   1 1 
        1    20 1 1   2 GLY C    C  18.898   1.137  -0.063 1.00 . A A .   2 GLY C    1 1 
        1    21 1 1   2 GLY CA   C  19.694   2.431  -0.106 1.00 . A A .   2 GLY CA   1 1 
        1    22 1 1   2 GLY H    H  18.014   3.674   0.220 1.00 . A A .   2 GLY H    1 1 
        1    23 1 1   2 GLY HA2  H  20.447   2.370  -0.888 1.00 . A A .   2 GLY HA2  1 1 
        1    24 1 1   2 GLY HA3  H  20.186   2.568   0.846 1.00 . A A .   2 GLY HA3  1 1 
        1    25 1 1   2 GLY N    N  18.805   3.570  -0.349 1.00 . A A .   2 GLY N    1 1 
        1    26 1 1   2 GLY O    O  17.836   1.099   0.566 1.00 . A A .   2 GLY O    1 1 
        1    27 1 1   3 HIS C    C  18.671  -1.980   0.489 1.00 . A A .   3 HIS C    1 1 
        1    28 1 1   3 HIS CA   C  18.695  -1.216  -0.863 1.00 . A A .   3 HIS CA   1 1 
        1    29 1 1   3 HIS CB   C  19.294  -2.080  -2.021 1.00 . A A .   3 HIS CB   1 1 
        1    30 1 1   3 HIS CD2  C  21.864  -1.742  -2.387 1.00 . A A .   3 HIS CD2  1 1 
        1    31 1 1   3 HIS CE1  C  22.580  -3.493  -1.286 1.00 . A A .   3 HIS CE1  1 1 
        1    32 1 1   3 HIS CG   C  20.776  -2.391  -1.910 1.00 . A A .   3 HIS CG   1 1 
        1    33 1 1   3 HIS H    H  20.281   0.175  -1.167 1.00 . A A .   3 HIS H    1 1 
        1    34 1 1   3 HIS HA   H  17.664  -0.985  -1.125 1.00 . A A .   3 HIS HA   1 1 
        1    35 1 1   3 HIS HB2  H  18.759  -3.022  -2.065 1.00 . A A .   3 HIS HB2  1 1 
        1    36 1 1   3 HIS HB3  H  19.137  -1.557  -2.955 1.00 . A A .   3 HIS HB3  1 1 
        1    37 1 1   3 HIS HD1  H  20.726  -4.144  -0.757 1.00 . A A .   3 HIS HD1  1 1 
        1    38 1 1   3 HIS HD2  H  21.860  -0.831  -2.974 1.00 . A A .   3 HIS HD2  1 1 
        1    39 1 1   3 HIS HE1  H  23.227  -4.234  -0.842 1.00 . A A .   3 HIS HE1  1 1 
        1    40 1 1   3 HIS HE2  H  23.899  -2.165  -2.098 1.00 . A A .   3 HIS HE2  1 1 
        1    41 1 1   3 HIS N    N  19.403   0.078  -0.740 1.00 . A A .   3 HIS N    1 1 
        1    42 1 1   3 HIS ND1  N  21.267  -3.483  -1.228 1.00 . A A .   3 HIS ND1  1 1 
        1    43 1 1   3 HIS NE2  N  22.968  -2.449  -1.984 1.00 . A A .   3 HIS NE2  1 1 
        1    44 1 1   3 HIS O    O  19.515  -2.832   0.772 1.00 . A A .   3 HIS O    1 1 
        1    45 1 1   4 HIS C    C  16.443  -3.329   2.532 1.00 . A A .   4 HIS C    1 1 
        1    46 1 1   4 HIS CA   C  17.520  -2.252   2.659 1.00 . A A .   4 HIS CA   1 1 
        1    47 1 1   4 HIS CB   C  17.152  -1.204   3.742 1.00 . A A .   4 HIS CB   1 1 
        1    48 1 1   4 HIS CD2  C  19.380  -0.377   4.818 1.00 . A A .   4 HIS CD2  1 1 
        1    49 1 1   4 HIS CE1  C  19.422   1.641   3.968 1.00 . A A .   4 HIS CE1  1 1 
        1    50 1 1   4 HIS CG   C  18.271  -0.237   4.045 1.00 . A A .   4 HIS CG   1 1 
        1    51 1 1   4 HIS H    H  17.109  -0.887   1.092 1.00 . A A .   4 HIS H    1 1 
        1    52 1 1   4 HIS HA   H  18.457  -2.732   2.947 1.00 . A A .   4 HIS HA   1 1 
        1    53 1 1   4 HIS HB2  H  16.292  -0.632   3.411 1.00 . A A .   4 HIS HB2  1 1 
        1    54 1 1   4 HIS HB3  H  16.896  -1.716   4.665 1.00 . A A .   4 HIS HB3  1 1 
        1    55 1 1   4 HIS HD1  H  17.667   1.449   2.929 1.00 . A A .   4 HIS HD1  1 1 
        1    56 1 1   4 HIS HD2  H  19.662  -1.254   5.385 1.00 . A A .   4 HIS HD2  1 1 
        1    57 1 1   4 HIS HE1  H  19.723   2.653   3.733 1.00 . A A .   4 HIS HE1  1 1 
        1    58 1 1   4 HIS HE2  H  20.862   1.032   5.291 1.00 . A A .   4 HIS HE2  1 1 
        1    59 1 1   4 HIS N    N  17.713  -1.612   1.350 1.00 . A A .   4 HIS N    1 1 
        1    60 1 1   4 HIS ND1  N  18.332   1.040   3.530 1.00 . A A .   4 HIS ND1  1 1 
        1    61 1 1   4 HIS NE2  N  20.074   0.804   4.750 1.00 . A A .   4 HIS NE2  1 1 
        1    62 1 1   4 HIS O    O  15.245  -3.028   2.507 1.00 . A A .   4 HIS O    1 1 
        1    63 1 1   5 HIS C    C  16.289  -6.802   3.285 1.00 . A A .   5 HIS C    1 1 
        1    64 1 1   5 HIS CA   C  16.002  -5.740   2.216 1.00 . A A .   5 HIS CA   1 1 
        1    65 1 1   5 HIS CB   C  16.183  -6.324   0.793 1.00 . A A .   5 HIS CB   1 1 
        1    66 1 1   5 HIS CD2  C  13.992  -7.686   0.376 1.00 . A A .   5 HIS CD2  1 1 
        1    67 1 1   5 HIS CE1  C  14.899  -9.656   0.080 1.00 . A A .   5 HIS CE1  1 1 
        1    68 1 1   5 HIS CG   C  15.336  -7.543   0.507 1.00 . A A .   5 HIS CG   1 1 
        1    69 1 1   5 HIS H    H  17.858  -4.742   2.447 1.00 . A A .   5 HIS H    1 1 
        1    70 1 1   5 HIS HA   H  14.970  -5.405   2.325 1.00 . A A .   5 HIS HA   1 1 
        1    71 1 1   5 HIS HB2  H  15.923  -5.564   0.063 1.00 . A A .   5 HIS HB2  1 1 
        1    72 1 1   5 HIS HB3  H  17.224  -6.596   0.649 1.00 . A A .   5 HIS HB3  1 1 
        1    73 1 1   5 HIS HD1  H  16.823  -9.021   0.342 1.00 . A A .   5 HIS HD1  1 1 
        1    74 1 1   5 HIS HD2  H  13.250  -6.902   0.465 1.00 . A A .   5 HIS HD2  1 1 
        1    75 1 1   5 HIS HE1  H  15.024 -10.715  -0.107 1.00 . A A .   5 HIS HE1  1 1 
        1    76 1 1   5 HIS HE2  H  12.870  -9.439   0.141 1.00 . A A .   5 HIS HE2  1 1 
        1    77 1 1   5 HIS N    N  16.889  -4.586   2.406 1.00 . A A .   5 HIS N    1 1 
        1    78 1 1   5 HIS ND1  N  15.868  -8.798   0.316 1.00 . A A .   5 HIS ND1  1 1 
        1    79 1 1   5 HIS NE2  N  13.751  -9.008   0.107 1.00 . A A .   5 HIS NE2  1 1 
        1    80 1 1   5 HIS O    O  17.365  -7.406   3.297 1.00 . A A .   5 HIS O    1 1 
        1    81 1 1   6 HIS C    C  14.383  -9.151   4.826 1.00 . A A .   6 HIS C    1 1 
        1    82 1 1   6 HIS CA   C  15.378  -8.055   5.211 1.00 . A A .   6 HIS CA   1 1 
        1    83 1 1   6 HIS CB   C  15.031  -7.493   6.612 1.00 . A A .   6 HIS CB   1 1 
        1    84 1 1   6 HIS CD2  C  17.166  -6.245   7.434 1.00 . A A .   6 HIS CD2  1 1 
        1    85 1 1   6 HIS CE1  C  16.359  -4.213   7.450 1.00 . A A .   6 HIS CE1  1 1 
        1    86 1 1   6 HIS CG   C  15.877  -6.317   7.027 1.00 . A A .   6 HIS CG   1 1 
        1    87 1 1   6 HIS H    H  14.534  -6.419   4.168 1.00 . A A .   6 HIS H    1 1 
        1    88 1 1   6 HIS HA   H  16.386  -8.471   5.233 1.00 . A A .   6 HIS HA   1 1 
        1    89 1 1   6 HIS HB2  H  13.995  -7.175   6.624 1.00 . A A .   6 HIS HB2  1 1 
        1    90 1 1   6 HIS HB3  H  15.165  -8.275   7.351 1.00 . A A .   6 HIS HB3  1 1 
        1    91 1 1   6 HIS HD1  H  14.496  -4.740   6.800 1.00 . A A .   6 HIS HD1  1 1 
        1    92 1 1   6 HIS HD2  H  17.853  -7.075   7.539 1.00 . A A .   6 HIS HD2  1 1 
        1    93 1 1   6 HIS HE1  H  16.271  -3.140   7.562 1.00 . A A .   6 HIS HE1  1 1 
        1    94 1 1   6 HIS HE2  H  18.333  -4.556   7.849 1.00 . A A .   6 HIS HE2  1 1 
        1    95 1 1   6 HIS N    N  15.322  -7.000   4.191 1.00 . A A .   6 HIS N    1 1 
        1    96 1 1   6 HIS ND1  N  15.404  -5.023   7.049 1.00 . A A .   6 HIS ND1  1 1 
        1    97 1 1   6 HIS NE2  N  17.437  -4.928   7.691 1.00 . A A .   6 HIS NE2  1 1 
        1    98 1 1   6 HIS O    O  13.179  -8.889   4.721 1.00 . A A .   6 HIS O    1 1 
        1    99 1 1   7 HIS C    C  13.652 -12.181   5.650 1.00 . A A .   7 HIS C    1 1 
        1   100 1 1   7 HIS CA   C  14.046 -11.540   4.311 1.00 . A A .   7 HIS CA   1 1 
        1   101 1 1   7 HIS CB   C  14.773 -12.536   3.360 1.00 . A A .   7 HIS CB   1 1 
        1   102 1 1   7 HIS CD2  C  13.833 -14.979   3.344 1.00 . A A .   7 HIS CD2  1 1 
        1   103 1 1   7 HIS CE1  C  12.400 -14.753   1.706 1.00 . A A .   7 HIS CE1  1 1 
        1   104 1 1   7 HIS CG   C  13.915 -13.696   2.902 1.00 . A A .   7 HIS CG   1 1 
        1   105 1 1   7 HIS H    H  15.859 -10.487   4.625 1.00 . A A .   7 HIS H    1 1 
        1   106 1 1   7 HIS HA   H  13.138 -11.192   3.820 1.00 . A A .   7 HIS HA   1 1 
        1   107 1 1   7 HIS HB2  H  15.103 -12.002   2.478 1.00 . A A .   7 HIS HB2  1 1 
        1   108 1 1   7 HIS HB3  H  15.642 -12.941   3.863 1.00 . A A .   7 HIS HB3  1 1 
        1   109 1 1   7 HIS HD1  H  12.825 -12.784   1.348 1.00 . A A .   7 HIS HD1  1 1 
        1   110 1 1   7 HIS HD2  H  14.411 -15.418   4.150 1.00 . A A .   7 HIS HD2  1 1 
        1   111 1 1   7 HIS HE1  H  11.645 -14.968   0.965 1.00 . A A .   7 HIS HE1  1 1 
        1   112 1 1   7 HIS HE2  H  12.510 -16.493   2.773 1.00 . A A .   7 HIS HE2  1 1 
        1   113 1 1   7 HIS N    N  14.890 -10.369   4.594 1.00 . A A .   7 HIS N    1 1 
        1   114 1 1   7 HIS ND1  N  13.005 -13.594   1.875 1.00 . A A .   7 HIS ND1  1 1 
        1   115 1 1   7 HIS NE2  N  12.886 -15.609   2.585 1.00 . A A .   7 HIS NE2  1 1 
        1   116 1 1   7 HIS O    O  14.131 -13.251   6.010 1.00 . A A .   7 HIS O    1 1 
        1   117 1 1   8 HIS C    C  10.925 -11.320   7.960 1.00 . A A .   8 HIS C    1 1 
        1   118 1 1   8 HIS CA   C  12.367 -11.819   7.755 1.00 . A A .   8 HIS CA   1 1 
        1   119 1 1   8 HIS CB   C  13.320 -11.191   8.826 1.00 . A A .   8 HIS CB   1 1 
        1   120 1 1   8 HIS CD2  C  15.028 -13.158   8.925 1.00 . A A .   8 HIS CD2  1 1 
        1   121 1 1   8 HIS CE1  C  16.830 -12.007   9.376 1.00 . A A .   8 HIS CE1  1 1 
        1   122 1 1   8 HIS CG   C  14.670 -11.853   8.975 1.00 . A A .   8 HIS CG   1 1 
        1   123 1 1   8 HIS H    H  12.449 -10.631   6.003 1.00 . A A .   8 HIS H    1 1 
        1   124 1 1   8 HIS HA   H  12.368 -12.902   7.851 1.00 . A A .   8 HIS HA   1 1 
        1   125 1 1   8 HIS HB2  H  13.498 -10.157   8.570 1.00 . A A .   8 HIS HB2  1 1 
        1   126 1 1   8 HIS HB3  H  12.837 -11.225   9.798 1.00 . A A .   8 HIS HB3  1 1 
        1   127 1 1   8 HIS HD1  H  15.893 -10.185   9.398 1.00 . A A .   8 HIS HD1  1 1 
        1   128 1 1   8 HIS HD2  H  14.369 -13.994   8.718 1.00 . A A .   8 HIS HD2  1 1 
        1   129 1 1   8 HIS HE1  H  17.857 -11.743   9.595 1.00 . A A .   8 HIS HE1  1 1 
        1   130 1 1   8 HIS HE2  H  16.933 -14.027   9.061 1.00 . A A .   8 HIS HE2  1 1 
        1   131 1 1   8 HIS N    N  12.811 -11.458   6.396 1.00 . A A .   8 HIS N    1 1 
        1   132 1 1   8 HIS ND1  N  15.826 -11.158   9.263 1.00 . A A .   8 HIS ND1  1 1 
        1   133 1 1   8 HIS NE2  N  16.374 -13.226   9.176 1.00 . A A .   8 HIS NE2  1 1 
        1   134 1 1   8 HIS O    O  10.237 -11.007   6.982 1.00 . A A .   8 HIS O    1 1 
        1   135 1 1   9 SER C    C   7.956 -11.550   9.372 1.00 . A A .   9 SER C    1 1 
        1   136 1 1   9 SER CA   C   9.205 -10.699   9.684 1.00 . A A .   9 SER CA   1 1 
        1   137 1 1   9 SER CB   C   9.053  -9.244   9.165 1.00 . A A .   9 SER CB   1 1 
        1   138 1 1   9 SER H    H  11.009 -11.782   9.906 1.00 . A A .   9 SER H    1 1 
        1   139 1 1   9 SER HA   H   9.291 -10.649  10.764 1.00 . A A .   9 SER HA   1 1 
        1   140 1 1   9 SER HB2  H   8.997  -9.249   8.088 1.00 . A A .   9 SER HB2  1 1 
        1   141 1 1   9 SER HB3  H   8.156  -8.793   9.571 1.00 . A A .   9 SER HB3  1 1 
        1   142 1 1   9 SER HG   H  10.431  -8.681  10.444 1.00 . A A .   9 SER HG   1 1 
        1   143 1 1   9 SER N    N  10.470 -11.321   9.232 1.00 . A A .   9 SER N    1 1 
        1   144 1 1   9 SER O    O   7.057 -11.604  10.199 1.00 . A A .   9 SER O    1 1 
        1   145 1 1   9 SER OG   O  10.168  -8.450   9.548 1.00 . A A .   9 SER OG   1 1 
        1   146 1 1  10 HIS C    C   6.404 -14.144   8.815 1.00 . A A .  10 HIS C    1 1 
        1   147 1 1  10 HIS CA   C   6.769 -13.057   7.769 1.00 . A A .  10 HIS CA   1 1 
        1   148 1 1  10 HIS CB   C   7.093 -13.694   6.384 1.00 . A A .  10 HIS CB   1 1 
        1   149 1 1  10 HIS CD2  C   5.358 -15.608   5.931 1.00 . A A .  10 HIS CD2  1 1 
        1   150 1 1  10 HIS CE1  C   4.392 -14.740   4.172 1.00 . A A .  10 HIS CE1  1 1 
        1   151 1 1  10 HIS CG   C   5.940 -14.403   5.699 1.00 . A A .  10 HIS CG   1 1 
        1   152 1 1  10 HIS H    H   8.703 -12.205   7.637 1.00 . A A .  10 HIS H    1 1 
        1   153 1 1  10 HIS HA   H   5.927 -12.380   7.657 1.00 . A A .  10 HIS HA   1 1 
        1   154 1 1  10 HIS HB2  H   7.436 -12.913   5.714 1.00 . A A .  10 HIS HB2  1 1 
        1   155 1 1  10 HIS HB3  H   7.897 -14.412   6.505 1.00 . A A .  10 HIS HB3  1 1 
        1   156 1 1  10 HIS HD1  H   5.502 -13.034   4.174 1.00 . A A .  10 HIS HD1  1 1 
        1   157 1 1  10 HIS HD2  H   5.614 -16.302   6.723 1.00 . A A .  10 HIS HD2  1 1 
        1   158 1 1  10 HIS HE1  H   3.746 -14.601   3.315 1.00 . A A .  10 HIS HE1  1 1 
        1   159 1 1  10 HIS HE2  H   3.728 -16.504   4.969 1.00 . A A .  10 HIS HE2  1 1 
        1   160 1 1  10 HIS N    N   7.927 -12.245   8.215 1.00 . A A .  10 HIS N    1 1 
        1   161 1 1  10 HIS ND1  N   5.305 -13.893   4.593 1.00 . A A .  10 HIS ND1  1 1 
        1   162 1 1  10 HIS NE2  N   4.403 -15.790   4.968 1.00 . A A .  10 HIS NE2  1 1 
        1   163 1 1  10 HIS O    O   5.228 -14.462   9.001 1.00 . A A .  10 HIS O    1 1 
        1   164 1 1  11 MET C    C   7.776 -15.200  11.913 1.00 . A A .  11 MET C    1 1 
        1   165 1 1  11 MET CA   C   7.286 -15.728  10.545 1.00 . A A .  11 MET CA   1 1 
        1   166 1 1  11 MET CB   C   8.069 -17.015  10.144 1.00 . A A .  11 MET CB   1 1 
        1   167 1 1  11 MET CE   C   8.385 -20.211   9.966 1.00 . A A .  11 MET CE   1 1 
        1   168 1 1  11 MET CG   C   7.527 -17.751   8.908 1.00 . A A .  11 MET CG   1 1 
        1   169 1 1  11 MET H    H   8.345 -14.383   9.278 1.00 . A A .  11 MET H    1 1 
        1   170 1 1  11 MET HA   H   6.232 -15.972  10.644 1.00 . A A .  11 MET HA   1 1 
        1   171 1 1  11 MET HB2  H   9.100 -16.748   9.945 1.00 . A A .  11 MET HB2  1 1 
        1   172 1 1  11 MET HB3  H   8.053 -17.710  10.979 1.00 . A A .  11 MET HB3  1 1 
        1   173 1 1  11 MET HE1  H   8.929 -21.134   9.830 1.00 . A A .  11 MET HE1  1 1 
        1   174 1 1  11 MET HE2  H   7.346 -20.434  10.162 1.00 . A A .  11 MET HE2  1 1 
        1   175 1 1  11 MET HE3  H   8.801 -19.670  10.804 1.00 . A A .  11 MET HE3  1 1 
        1   176 1 1  11 MET HG2  H   6.508 -18.065   9.098 1.00 . A A .  11 MET HG2  1 1 
        1   177 1 1  11 MET HG3  H   7.536 -17.071   8.064 1.00 . A A .  11 MET HG3  1 1 
        1   178 1 1  11 MET N    N   7.438 -14.691   9.492 1.00 . A A .  11 MET N    1 1 
        1   179 1 1  11 MET O    O   8.067 -15.985  12.817 1.00 . A A .  11 MET O    1 1 
        1   180 1 1  11 MET SD   S   8.514 -19.209   8.481 1.00 . A A .  11 MET SD   1 1 
        1   181 1 1  12 ALA C    C   7.063 -12.886  14.206 1.00 . A A .  12 ALA C    1 1 
        1   182 1 1  12 ALA CA   C   8.273 -13.225  13.331 1.00 . A A .  12 ALA CA   1 1 
        1   183 1 1  12 ALA CB   C   9.114 -11.981  13.034 1.00 . A A .  12 ALA CB   1 1 
        1   184 1 1  12 ALA H    H   7.487 -13.300  11.356 1.00 . A A .  12 ALA H    1 1 
        1   185 1 1  12 ALA HA   H   8.907 -13.934  13.871 1.00 . A A .  12 ALA HA   1 1 
        1   186 1 1  12 ALA HB1  H   8.511 -11.253  12.502 1.00 . A A .  12 ALA HB1  1 1 
        1   187 1 1  12 ALA HB2  H   9.960 -12.255  12.422 1.00 . A A .  12 ALA HB2  1 1 
        1   188 1 1  12 ALA HB3  H   9.468 -11.545  13.959 1.00 . A A .  12 ALA HB3  1 1 
        1   189 1 1  12 ALA N    N   7.817 -13.866  12.079 1.00 . A A .  12 ALA N    1 1 
        1   190 1 1  12 ALA O    O   6.610 -11.728  14.263 1.00 . A A .  12 ALA O    1 1 
        1   191 1 1  13 MET C    C   5.669 -13.301  17.083 1.00 . A A .  13 MET C    1 1 
        1   192 1 1  13 MET CA   C   5.298 -13.818  15.684 1.00 . A A .  13 MET CA   1 1 
        1   193 1 1  13 MET CB   C   4.556 -15.187  15.741 1.00 . A A .  13 MET CB   1 1 
        1   194 1 1  13 MET CE   C   3.600 -15.723  11.686 1.00 . A A .  13 MET CE   1 1 
        1   195 1 1  13 MET CG   C   4.361 -15.842  14.366 1.00 . A A .  13 MET CG   1 1 
        1   196 1 1  13 MET H    H   6.959 -14.797  14.787 1.00 . A A .  13 MET H    1 1 
        1   197 1 1  13 MET HA   H   4.641 -13.087  15.217 1.00 . A A .  13 MET HA   1 1 
        1   198 1 1  13 MET HB2  H   5.120 -15.872  16.366 1.00 . A A .  13 MET HB2  1 1 
        1   199 1 1  13 MET HB3  H   3.578 -15.037  16.185 1.00 . A A .  13 MET HB3  1 1 
        1   200 1 1  13 MET HE1  H   3.178 -16.707  11.827 1.00 . A A .  13 MET HE1  1 1 
        1   201 1 1  13 MET HE2  H   4.641 -15.813  11.409 1.00 . A A .  13 MET HE2  1 1 
        1   202 1 1  13 MET HE3  H   3.064 -15.210  10.900 1.00 . A A .  13 MET HE3  1 1 
        1   203 1 1  13 MET HG2  H   5.336 -16.064  13.945 1.00 . A A .  13 MET HG2  1 1 
        1   204 1 1  13 MET HG3  H   3.809 -16.765  14.489 1.00 . A A .  13 MET HG3  1 1 
        1   205 1 1  13 MET N    N   6.519 -13.923  14.861 1.00 . A A .  13 MET N    1 1 
        1   206 1 1  13 MET O    O   5.692 -14.042  18.067 1.00 . A A .  13 MET O    1 1 
        1   207 1 1  13 MET SD   S   3.467 -14.783  13.208 1.00 . A A .  13 MET SD   1 1 
        1   208 1 1  14 GLN C    C   5.290 -10.390  18.781 1.00 . A A .  14 GLN C    1 1 
        1   209 1 1  14 GLN CA   C   6.438 -11.308  18.339 1.00 . A A .  14 GLN CA   1 1 
        1   210 1 1  14 GLN CB   C   7.721 -10.485  18.041 1.00 . A A .  14 GLN CB   1 1 
        1   211 1 1  14 GLN CD   C   9.549 -12.232  18.599 1.00 . A A .  14 GLN CD   1 1 
        1   212 1 1  14 GLN CG   C   8.928 -11.316  17.538 1.00 . A A .  14 GLN CG   1 1 
        1   213 1 1  14 GLN H    H   6.019 -11.511  16.282 1.00 . A A .  14 GLN H    1 1 
        1   214 1 1  14 GLN HA   H   6.644 -12.032  19.124 1.00 . A A .  14 GLN HA   1 1 
        1   215 1 1  14 GLN HB2  H   7.491  -9.741  17.281 1.00 . A A .  14 GLN HB2  1 1 
        1   216 1 1  14 GLN HB3  H   8.023  -9.965  18.945 1.00 . A A .  14 GLN HB3  1 1 
        1   217 1 1  14 GLN HE21 H  10.071 -13.551  17.212 1.00 . A A .  14 GLN HE21 1 1 
        1   218 1 1  14 GLN HE22 H  10.499 -13.957  18.836 1.00 . A A .  14 GLN HE22 1 1 
        1   219 1 1  14 GLN HG2  H   8.601 -11.927  16.704 1.00 . A A .  14 GLN HG2  1 1 
        1   220 1 1  14 GLN HG3  H   9.696 -10.635  17.188 1.00 . A A .  14 GLN HG3  1 1 
        1   221 1 1  14 GLN N    N   6.036 -12.017  17.122 1.00 . A A .  14 GLN N    1 1 
        1   222 1 1  14 GLN NE2  N  10.093 -13.358  18.175 1.00 . A A .  14 GLN NE2  1 1 
        1   223 1 1  14 GLN O    O   4.479  -9.976  17.953 1.00 . A A .  14 GLN O    1 1 
        1   224 1 1  14 GLN OE1  O   9.552 -11.921  19.787 1.00 . A A .  14 GLN OE1  1 1 
        1   225 1 1  15 GLU C    C   4.737  -8.349  21.786 1.00 . A A .  15 GLU C    1 1 
        1   226 1 1  15 GLU CA   C   4.178  -9.200  20.636 1.00 . A A .  15 GLU CA   1 1 
        1   227 1 1  15 GLU CB   C   2.965 -10.041  21.122 1.00 . A A .  15 GLU CB   1 1 
        1   228 1 1  15 GLU CD   C   0.604 -10.045  22.174 1.00 . A A .  15 GLU CD   1 1 
        1   229 1 1  15 GLU CG   C   1.734  -9.206  21.546 1.00 . A A .  15 GLU CG   1 1 
        1   230 1 1  15 GLU H    H   5.906 -10.417  20.688 1.00 . A A .  15 GLU H    1 1 
        1   231 1 1  15 GLU HA   H   3.844  -8.530  19.846 1.00 . A A .  15 GLU HA   1 1 
        1   232 1 1  15 GLU HB2  H   2.665 -10.705  20.319 1.00 . A A .  15 GLU HB2  1 1 
        1   233 1 1  15 GLU HB3  H   3.277 -10.647  21.968 1.00 . A A .  15 GLU HB3  1 1 
        1   234 1 1  15 GLU HG2  H   2.055  -8.460  22.266 1.00 . A A .  15 GLU HG2  1 1 
        1   235 1 1  15 GLU HG3  H   1.350  -8.696  20.668 1.00 . A A .  15 GLU HG3  1 1 
        1   236 1 1  15 GLU N    N   5.228 -10.064  20.079 1.00 . A A .  15 GLU N    1 1 
        1   237 1 1  15 GLU O    O   5.598  -8.799  22.544 1.00 . A A .  15 GLU O    1 1 
        1   238 1 1  15 GLU OE1  O   0.683 -10.359  23.382 1.00 . A A .  15 GLU OE1  1 1 
        1   239 1 1  15 GLU OE2  O  -0.373 -10.382  21.473 1.00 . A A .  15 GLU OE2  1 1 
        1   240 1 1  16 GLY C    C   3.858  -4.843  22.712 1.00 . A A .  16 GLY C    1 1 
        1   241 1 1  16 GLY CA   C   4.579  -6.167  22.931 1.00 . A A .  16 GLY CA   1 1 
        1   242 1 1  16 GLY H    H   3.562  -6.843  21.212 1.00 . A A .  16 GLY H    1 1 
        1   243 1 1  16 GLY HA2  H   4.295  -6.579  23.895 1.00 . A A .  16 GLY HA2  1 1 
        1   244 1 1  16 GLY HA3  H   5.647  -5.995  22.918 1.00 . A A .  16 GLY HA3  1 1 
        1   245 1 1  16 GLY N    N   4.220  -7.119  21.884 1.00 . A A .  16 GLY N    1 1 
        1   246 1 1  16 GLY O    O   3.540  -4.128  23.662 1.00 . A A .  16 GLY O    1 1 
        1   247 1 1  17 LEU C    C   1.287  -3.880  21.036 1.00 . A A .  17 LEU C    1 1 
        1   248 1 1  17 LEU CA   C   2.754  -3.415  21.003 1.00 . A A .  17 LEU CA   1 1 
        1   249 1 1  17 LEU CB   C   3.138  -2.987  19.562 1.00 . A A .  17 LEU CB   1 1 
        1   250 1 1  17 LEU CD1  C   4.958  -2.535  17.809 1.00 . A A .  17 LEU CD1  1 1 
        1   251 1 1  17 LEU CD2  C   5.006  -1.275  20.015 1.00 . A A .  17 LEU CD2  1 1 
        1   252 1 1  17 LEU CG   C   4.633  -2.601  19.320 1.00 . A A .  17 LEU CG   1 1 
        1   253 1 1  17 LEU H    H   3.970  -5.115  20.743 1.00 . A A .  17 LEU H    1 1 
        1   254 1 1  17 LEU HA   H   2.897  -2.580  21.685 1.00 . A A .  17 LEU HA   1 1 
        1   255 1 1  17 LEU HB2  H   2.895  -3.811  18.893 1.00 . A A .  17 LEU HB2  1 1 
        1   256 1 1  17 LEU HB3  H   2.520  -2.139  19.280 1.00 . A A .  17 LEU HB3  1 1 
        1   257 1 1  17 LEU HD11 H   6.007  -2.300  17.668 1.00 . A A .  17 LEU HD11 1 1 
        1   258 1 1  17 LEU HD12 H   4.354  -1.774  17.331 1.00 . A A .  17 LEU HD12 1 1 
        1   259 1 1  17 LEU HD13 H   4.747  -3.496  17.350 1.00 . A A .  17 LEU HD13 1 1 
        1   260 1 1  17 LEU HD21 H   4.393  -0.470  19.628 1.00 . A A .  17 LEU HD21 1 1 
        1   261 1 1  17 LEU HD22 H   6.050  -1.049  19.830 1.00 . A A .  17 LEU HD22 1 1 
        1   262 1 1  17 LEU HD23 H   4.850  -1.365  21.081 1.00 . A A .  17 LEU HD23 1 1 
        1   263 1 1  17 LEU HG   H   5.259  -3.376  19.743 1.00 . A A .  17 LEU HG   1 1 
        1   264 1 1  17 LEU N    N   3.597  -4.537  21.431 1.00 . A A .  17 LEU N    1 1 
        1   265 1 1  17 LEU O    O   1.000  -5.034  20.680 1.00 . A A .  17 LEU O    1 1 
        1   266 1 1  18 SER C    C  -1.739  -3.321  20.147 1.00 . A A .  18 SER C    1 1 
        1   267 1 1  18 SER CA   C  -1.069  -3.285  21.551 1.00 . A A .  18 SER CA   1 1 
        1   268 1 1  18 SER CB   C  -1.732  -2.229  22.465 1.00 . A A .  18 SER CB   1 1 
        1   269 1 1  18 SER H    H   0.681  -2.087  21.672 1.00 . A A .  18 SER H    1 1 
        1   270 1 1  18 SER HA   H  -1.173  -4.263  22.015 1.00 . A A .  18 SER HA   1 1 
        1   271 1 1  18 SER HB2  H  -1.658  -1.250  22.009 1.00 . A A .  18 SER HB2  1 1 
        1   272 1 1  18 SER HB3  H  -2.776  -2.478  22.611 1.00 . A A .  18 SER HB3  1 1 
        1   273 1 1  18 SER HG   H  -0.967  -3.088  24.057 1.00 . A A .  18 SER HG   1 1 
        1   274 1 1  18 SER N    N   0.375  -2.984  21.440 1.00 . A A .  18 SER N    1 1 
        1   275 1 1  18 SER O    O  -1.170  -2.784  19.198 1.00 . A A .  18 SER O    1 1 
        1   276 1 1  18 SER OG   O  -1.101  -2.187  23.737 1.00 . A A .  18 SER OG   1 1 
        1   277 1 1  19 PRO C    C  -4.049  -2.662  18.103 1.00 . A A .  19 PRO C    1 1 
        1   278 1 1  19 PRO CA   C  -3.677  -4.050  18.682 1.00 . A A .  19 PRO CA   1 1 
        1   279 1 1  19 PRO CB   C  -4.942  -4.892  19.016 1.00 . A A .  19 PRO CB   1 1 
        1   280 1 1  19 PRO CD   C  -3.682  -4.734  21.043 1.00 . A A .  19 PRO CD   1 1 
        1   281 1 1  19 PRO CG   C  -5.091  -4.798  20.503 1.00 . A A .  19 PRO CG   1 1 
        1   282 1 1  19 PRO HA   H  -3.076  -4.578  17.946 1.00 . A A .  19 PRO HA   1 1 
        1   283 1 1  19 PRO HB2  H  -5.818  -4.497  18.506 1.00 . A A .  19 PRO HB2  1 1 
        1   284 1 1  19 PRO HB3  H  -4.788  -5.925  18.725 1.00 . A A .  19 PRO HB3  1 1 
        1   285 1 1  19 PRO HD2  H  -3.663  -4.208  21.990 1.00 . A A .  19 PRO HD2  1 1 
        1   286 1 1  19 PRO HD3  H  -3.268  -5.729  21.160 1.00 . A A .  19 PRO HD3  1 1 
        1   287 1 1  19 PRO HG2  H  -5.647  -3.898  20.769 1.00 . A A .  19 PRO HG2  1 1 
        1   288 1 1  19 PRO HG3  H  -5.598  -5.675  20.889 1.00 . A A .  19 PRO HG3  1 1 
        1   289 1 1  19 PRO N    N  -2.949  -3.975  19.988 1.00 . A A .  19 PRO N    1 1 
        1   290 1 1  19 PRO O    O  -4.269  -2.529  16.891 1.00 . A A .  19 PRO O    1 1 
        1   291 1 1  20 ASN C    C  -3.110   0.219  17.694 1.00 . A A .  20 ASN C    1 1 
        1   292 1 1  20 ASN CA   C  -4.283  -0.227  18.574 1.00 . A A .  20 ASN CA   1 1 
        1   293 1 1  20 ASN CB   C  -4.397   0.725  19.795 1.00 . A A .  20 ASN CB   1 1 
        1   294 1 1  20 ASN CG   C  -5.661   0.533  20.639 1.00 . A A .  20 ASN CG   1 1 
        1   295 1 1  20 ASN H    H  -4.049  -1.845  19.941 1.00 . A A .  20 ASN H    1 1 
        1   296 1 1  20 ASN HA   H  -5.201  -0.164  17.991 1.00 . A A .  20 ASN HA   1 1 
        1   297 1 1  20 ASN HB2  H  -3.545   0.569  20.440 1.00 . A A .  20 ASN HB2  1 1 
        1   298 1 1  20 ASN HB3  H  -4.379   1.754  19.441 1.00 . A A .  20 ASN HB3  1 1 
        1   299 1 1  20 ASN HD21 H  -5.716   2.478  21.060 1.00 . A A .  20 ASN HD21 1 1 
        1   300 1 1  20 ASN HD22 H  -6.969   1.521  21.769 1.00 . A A .  20 ASN HD22 1 1 
        1   301 1 1  20 ASN N    N  -4.110  -1.638  18.986 1.00 . A A .  20 ASN N    1 1 
        1   302 1 1  20 ASN ND2  N  -6.170   1.620  21.211 1.00 . A A .  20 ASN ND2  1 1 
        1   303 1 1  20 ASN O    O  -3.315   0.930  16.715 1.00 . A A .  20 ASN O    1 1 
        1   304 1 1  20 ASN OD1  O  -6.173  -0.576  20.777 1.00 . A A .  20 ASN OD1  1 1 
        1   305 1 1  21 HIS C    C  -0.727  -0.596  15.901 1.00 . A A .  21 HIS C    1 1 
        1   306 1 1  21 HIS CA   C  -0.668   0.060  17.284 1.00 . A A .  21 HIS CA   1 1 
        1   307 1 1  21 HIS CB   C   0.632  -0.385  18.044 1.00 . A A .  21 HIS CB   1 1 
        1   308 1 1  21 HIS CD2  C   1.907   0.873  19.945 1.00 . A A .  21 HIS CD2  1 1 
        1   309 1 1  21 HIS CE1  C   2.465   2.656  18.815 1.00 . A A .  21 HIS CE1  1 1 
        1   310 1 1  21 HIS CG   C   1.408   0.734  18.692 1.00 . A A .  21 HIS CG   1 1 
        1   311 1 1  21 HIS H    H  -1.816  -0.764  18.877 1.00 . A A .  21 HIS H    1 1 
        1   312 1 1  21 HIS HA   H  -0.632   1.138  17.136 1.00 . A A .  21 HIS HA   1 1 
        1   313 1 1  21 HIS HB2  H   0.364  -1.083  18.823 1.00 . A A .  21 HIS HB2  1 1 
        1   314 1 1  21 HIS HB3  H   1.314  -0.885  17.362 1.00 . A A .  21 HIS HB3  1 1 
        1   315 1 1  21 HIS HD1  H   1.564   2.078  17.074 1.00 . A A .  21 HIS HD1  1 1 
        1   316 1 1  21 HIS HD2  H   1.810   0.160  20.753 1.00 . A A .  21 HIS HD2  1 1 
        1   317 1 1  21 HIS HE1  H   2.879   3.619  18.551 1.00 . A A .  21 HIS HE1  1 1 
        1   318 1 1  21 HIS HE2  H   3.149   2.370  20.718 1.00 . A A .  21 HIS HE2  1 1 
        1   319 1 1  21 HIS N    N  -1.889  -0.225  18.059 1.00 . A A .  21 HIS N    1 1 
        1   320 1 1  21 HIS ND1  N   1.776   1.871  18.014 1.00 . A A .  21 HIS ND1  1 1 
        1   321 1 1  21 HIS NE2  N   2.556   2.076  19.992 1.00 . A A .  21 HIS NE2  1 1 
        1   322 1 1  21 HIS O    O  -0.209  -0.028  14.970 1.00 . A A .  21 HIS O    1 1 
        1   323 1 1  22 LEU C    C  -2.315  -1.661  13.513 1.00 . A A .  22 LEU C    1 1 
        1   324 1 1  22 LEU CA   C  -1.453  -2.495  14.474 1.00 . A A .  22 LEU CA   1 1 
        1   325 1 1  22 LEU CB   C  -2.002  -3.945  14.666 1.00 . A A .  22 LEU CB   1 1 
        1   326 1 1  22 LEU CD1  C  -1.535  -4.615  12.171 1.00 . A A .  22 LEU CD1  1 1 
        1   327 1 1  22 LEU CD2  C  -2.682  -6.240  13.733 1.00 . A A .  22 LEU CD2  1 1 
        1   328 1 1  22 LEU CG   C  -2.485  -4.745  13.388 1.00 . A A .  22 LEU CG   1 1 
        1   329 1 1  22 LEU H    H  -1.685  -2.223  16.587 1.00 . A A .  22 LEU H    1 1 
        1   330 1 1  22 LEU HA   H  -0.450  -2.563  14.047 1.00 . A A .  22 LEU HA   1 1 
        1   331 1 1  22 LEU HB2  H  -1.220  -4.524  15.147 1.00 . A A .  22 LEU HB2  1 1 
        1   332 1 1  22 LEU HB3  H  -2.840  -3.889  15.357 1.00 . A A .  22 LEU HB3  1 1 
        1   333 1 1  22 LEU HD11 H  -1.945  -5.158  11.329 1.00 . A A .  22 LEU HD11 1 1 
        1   334 1 1  22 LEU HD12 H  -0.564  -5.018  12.416 1.00 . A A .  22 LEU HD12 1 1 
        1   335 1 1  22 LEU HD13 H  -1.428  -3.573  11.900 1.00 . A A .  22 LEU HD13 1 1 
        1   336 1 1  22 LEU HD21 H  -1.728  -6.680  14.011 1.00 . A A .  22 LEU HD21 1 1 
        1   337 1 1  22 LEU HD22 H  -3.079  -6.764  12.874 1.00 . A A .  22 LEU HD22 1 1 
        1   338 1 1  22 LEU HD23 H  -3.374  -6.338  14.557 1.00 . A A .  22 LEU HD23 1 1 
        1   339 1 1  22 LEU HG   H  -3.445  -4.354  13.081 1.00 . A A .  22 LEU HG   1 1 
        1   340 1 1  22 LEU N    N  -1.320  -1.801  15.785 1.00 . A A .  22 LEU N    1 1 
        1   341 1 1  22 LEU O    O  -1.867  -1.328  12.395 1.00 . A A .  22 LEU O    1 1 
        1   342 1 1  23 LYS C    C  -3.780   0.849  12.814 1.00 . A A .  23 LYS C    1 1 
        1   343 1 1  23 LYS CA   C  -4.462  -0.477  13.217 1.00 . A A .  23 LYS CA   1 1 
        1   344 1 1  23 LYS CB   C  -5.735  -0.200  14.065 1.00 . A A .  23 LYS CB   1 1 
        1   345 1 1  23 LYS CD   C  -7.926   1.116  14.326 1.00 . A A .  23 LYS CD   1 1 
        1   346 1 1  23 LYS CE   C  -8.893   2.128  13.694 1.00 . A A .  23 LYS CE   1 1 
        1   347 1 1  23 LYS CG   C  -6.769   0.729  13.386 1.00 . A A .  23 LYS CG   1 1 
        1   348 1 1  23 LYS H    H  -3.783  -1.621  14.871 1.00 . A A .  23 LYS H    1 1 
        1   349 1 1  23 LYS HA   H  -4.745  -1.020  12.322 1.00 . A A .  23 LYS HA   1 1 
        1   350 1 1  23 LYS HB2  H  -6.220  -1.145  14.284 1.00 . A A .  23 LYS HB2  1 1 
        1   351 1 1  23 LYS HB3  H  -5.433   0.257  15.003 1.00 . A A .  23 LYS HB3  1 1 
        1   352 1 1  23 LYS HD2  H  -8.479   0.221  14.586 1.00 . A A .  23 LYS HD2  1 1 
        1   353 1 1  23 LYS HD3  H  -7.511   1.549  15.233 1.00 . A A .  23 LYS HD3  1 1 
        1   354 1 1  23 LYS HE2  H  -8.343   3.010  13.398 1.00 . A A .  23 LYS HE2  1 1 
        1   355 1 1  23 LYS HE3  H  -9.357   1.683  12.823 1.00 . A A .  23 LYS HE3  1 1 
        1   356 1 1  23 LYS HG2  H  -6.267   1.637  13.064 1.00 . A A .  23 LYS HG2  1 1 
        1   357 1 1  23 LYS HG3  H  -7.177   0.224  12.515 1.00 . A A .  23 LYS HG3  1 1 
        1   358 1 1  23 LYS HZ1  H -10.550   1.718  14.891 1.00 . A A .  23 LYS HZ1  1 1 
        1   359 1 1  23 LYS HZ2  H -10.556   3.270  14.222 1.00 . A A .  23 LYS HZ2  1 1 
        1   360 1 1  23 LYS HZ3  H  -9.532   2.910  15.517 1.00 . A A .  23 LYS HZ3  1 1 
        1   361 1 1  23 LYS N    N  -3.524  -1.316  13.976 1.00 . A A .  23 LYS N    1 1 
        1   362 1 1  23 LYS NZ   N  -9.957   2.535  14.647 1.00 . A A .  23 LYS NZ   1 1 
        1   363 1 1  23 LYS O    O  -3.625   1.133  11.628 1.00 . A A .  23 LYS O    1 1 
        1   364 1 1  24 LYS C    C  -1.500   2.903  12.718 1.00 . A A .  24 LYS C    1 1 
        1   365 1 1  24 LYS CA   C  -2.708   2.925  13.693 1.00 . A A .  24 LYS CA   1 1 
        1   366 1 1  24 LYS CB   C  -2.293   3.449  15.119 1.00 . A A .  24 LYS CB   1 1 
        1   367 1 1  24 LYS CD   C  -1.548   5.879  14.609 1.00 . A A .  24 LYS CD   1 1 
        1   368 1 1  24 LYS CE   C  -1.719   7.358  14.986 1.00 . A A .  24 LYS CE   1 1 
        1   369 1 1  24 LYS CG   C  -2.502   4.961  15.400 1.00 . A A .  24 LYS CG   1 1 
        1   370 1 1  24 LYS H    H  -3.318   1.175  14.729 1.00 . A A .  24 LYS H    1 1 
        1   371 1 1  24 LYS HA   H  -3.479   3.575  13.290 1.00 . A A .  24 LYS HA   1 1 
        1   372 1 1  24 LYS HB2  H  -2.870   2.908  15.864 1.00 . A A .  24 LYS HB2  1 1 
        1   373 1 1  24 LYS HB3  H  -1.247   3.220  15.289 1.00 . A A .  24 LYS HB3  1 1 
        1   374 1 1  24 LYS HD2  H  -0.524   5.584  14.814 1.00 . A A .  24 LYS HD2  1 1 
        1   375 1 1  24 LYS HD3  H  -1.744   5.761  13.548 1.00 . A A .  24 LYS HD3  1 1 
        1   376 1 1  24 LYS HE2  H  -2.733   7.668  14.762 1.00 . A A .  24 LYS HE2  1 1 
        1   377 1 1  24 LYS HE3  H  -1.539   7.476  16.047 1.00 . A A .  24 LYS HE3  1 1 
        1   378 1 1  24 LYS HG2  H  -3.523   5.227  15.152 1.00 . A A .  24 LYS HG2  1 1 
        1   379 1 1  24 LYS HG3  H  -2.346   5.134  16.462 1.00 . A A .  24 LYS HG3  1 1 
        1   380 1 1  24 LYS HZ1  H   0.201   7.965  14.442 1.00 . A A .  24 LYS HZ1  1 1 
        1   381 1 1  24 LYS HZ2  H  -0.912   9.235  14.535 1.00 . A A .  24 LYS HZ2  1 1 
        1   382 1 1  24 LYS HZ3  H  -0.951   8.172  13.223 1.00 . A A .  24 LYS HZ3  1 1 
        1   383 1 1  24 LYS N    N  -3.292   1.575  13.833 1.00 . A A .  24 LYS N    1 1 
        1   384 1 1  24 LYS NZ   N  -0.782   8.243  14.245 1.00 . A A .  24 LYS NZ   1 1 
        1   385 1 1  24 LYS O    O  -1.440   3.706  11.785 1.00 . A A .  24 LYS O    1 1 
        1   386 1 1  25 ALA C    C   0.412   1.500  10.689 1.00 . A A .  25 ALA C    1 1 
        1   387 1 1  25 ALA CA   C   0.676   1.822  12.157 1.00 . A A .  25 ALA CA   1 1 
        1   388 1 1  25 ALA CB   C   1.607   0.754  12.760 1.00 . A A .  25 ALA CB   1 1 
        1   389 1 1  25 ALA H    H  -0.778   1.264  13.608 1.00 . A A .  25 ALA H    1 1 
        1   390 1 1  25 ALA HA   H   1.187   2.781  12.223 1.00 . A A .  25 ALA HA   1 1 
        1   391 1 1  25 ALA HB1  H   1.131  -0.222  12.707 1.00 . A A .  25 ALA HB1  1 1 
        1   392 1 1  25 ALA HB2  H   1.807   0.995  13.796 1.00 . A A .  25 ALA HB2  1 1 
        1   393 1 1  25 ALA HB3  H   2.543   0.727  12.218 1.00 . A A .  25 ALA HB3  1 1 
        1   394 1 1  25 ALA N    N  -0.584   1.935  12.928 1.00 . A A .  25 ALA N    1 1 
        1   395 1 1  25 ALA O    O   1.025   2.106   9.810 1.00 . A A .  25 ALA O    1 1 
        1   396 1 1  26 LYS C    C  -1.521   1.274   8.317 1.00 . A A .  26 LYS C    1 1 
        1   397 1 1  26 LYS CA   C  -0.858   0.106   9.078 1.00 . A A .  26 LYS CA   1 1 
        1   398 1 1  26 LYS CB   C  -1.814  -1.111   9.110 1.00 . A A .  26 LYS CB   1 1 
        1   399 1 1  26 LYS CD   C  -3.327  -2.695   7.749 1.00 . A A .  26 LYS CD   1 1 
        1   400 1 1  26 LYS CE   C  -4.641  -2.061   8.235 1.00 . A A .  26 LYS CE   1 1 
        1   401 1 1  26 LYS CG   C  -2.163  -1.682   7.713 1.00 . A A .  26 LYS CG   1 1 
        1   402 1 1  26 LYS H    H  -0.923   0.078  11.210 1.00 . A A .  26 LYS H    1 1 
        1   403 1 1  26 LYS HA   H   0.054  -0.177   8.560 1.00 . A A .  26 LYS HA   1 1 
        1   404 1 1  26 LYS HB2  H  -1.353  -1.900   9.698 1.00 . A A .  26 LYS HB2  1 1 
        1   405 1 1  26 LYS HB3  H  -2.736  -0.814   9.603 1.00 . A A .  26 LYS HB3  1 1 
        1   406 1 1  26 LYS HD2  H  -3.481  -3.085   6.749 1.00 . A A .  26 LYS HD2  1 1 
        1   407 1 1  26 LYS HD3  H  -3.067  -3.516   8.410 1.00 . A A .  26 LYS HD3  1 1 
        1   408 1 1  26 LYS HE2  H  -4.528  -1.751   9.265 1.00 . A A .  26 LYS HE2  1 1 
        1   409 1 1  26 LYS HE3  H  -4.868  -1.195   7.623 1.00 . A A .  26 LYS HE3  1 1 
        1   410 1 1  26 LYS HG2  H  -2.438  -0.861   7.056 1.00 . A A .  26 LYS HG2  1 1 
        1   411 1 1  26 LYS HG3  H  -1.282  -2.173   7.307 1.00 . A A .  26 LYS HG3  1 1 
        1   412 1 1  26 LYS HZ1  H  -5.542  -3.899   8.636 1.00 . A A .  26 LYS HZ1  1 1 
        1   413 1 1  26 LYS HZ2  H  -6.000  -3.221   7.153 1.00 . A A .  26 LYS HZ2  1 1 
        1   414 1 1  26 LYS HZ3  H  -6.621  -2.597   8.596 1.00 . A A .  26 LYS HZ3  1 1 
        1   415 1 1  26 LYS N    N  -0.491   0.525  10.444 1.00 . A A .  26 LYS N    1 1 
        1   416 1 1  26 LYS NZ   N  -5.780  -3.011   8.152 1.00 . A A .  26 LYS NZ   1 1 
        1   417 1 1  26 LYS O    O  -1.178   1.542   7.154 1.00 . A A .  26 LYS O    1 1 
        1   418 1 1  27 LEU C    C  -2.131   4.258   8.085 1.00 . A A .  27 LEU C    1 1 
        1   419 1 1  27 LEU CA   C  -3.145   3.150   8.444 1.00 . A A .  27 LEU CA   1 1 
        1   420 1 1  27 LEU CB   C  -4.217   3.687   9.428 1.00 . A A .  27 LEU CB   1 1 
        1   421 1 1  27 LEU CD1  C  -6.401   3.421  10.743 1.00 . A A .  27 LEU CD1  1 1 
        1   422 1 1  27 LEU CD2  C  -6.164   2.307   8.449 1.00 . A A .  27 LEU CD2  1 1 
        1   423 1 1  27 LEU CG   C  -5.432   2.751   9.739 1.00 . A A .  27 LEU CG   1 1 
        1   424 1 1  27 LEU H    H  -2.678   1.683   9.915 1.00 . A A .  27 LEU H    1 1 
        1   425 1 1  27 LEU HA   H  -3.643   2.835   7.529 1.00 . A A .  27 LEU HA   1 1 
        1   426 1 1  27 LEU HB2  H  -3.718   3.913  10.367 1.00 . A A .  27 LEU HB2  1 1 
        1   427 1 1  27 LEU HB3  H  -4.606   4.617   9.025 1.00 . A A .  27 LEU HB3  1 1 
        1   428 1 1  27 LEU HD11 H  -6.804   4.334  10.319 1.00 . A A .  27 LEU HD11 1 1 
        1   429 1 1  27 LEU HD12 H  -5.871   3.658  11.656 1.00 . A A .  27 LEU HD12 1 1 
        1   430 1 1  27 LEU HD13 H  -7.213   2.744  10.976 1.00 . A A .  27 LEU HD13 1 1 
        1   431 1 1  27 LEU HD21 H  -5.474   1.777   7.802 1.00 . A A .  27 LEU HD21 1 1 
        1   432 1 1  27 LEU HD22 H  -6.551   3.172   7.926 1.00 . A A .  27 LEU HD22 1 1 
        1   433 1 1  27 LEU HD23 H  -6.982   1.646   8.702 1.00 . A A .  27 LEU HD23 1 1 
        1   434 1 1  27 LEU HG   H  -5.058   1.855  10.217 1.00 . A A .  27 LEU HG   1 1 
        1   435 1 1  27 LEU N    N  -2.454   1.970   9.002 1.00 . A A .  27 LEU N    1 1 
        1   436 1 1  27 LEU O    O  -2.257   4.923   7.052 1.00 . A A .  27 LEU O    1 1 
        1   437 1 1  28 MET C    C   0.961   4.832   7.609 1.00 . A A .  28 MET C    1 1 
        1   438 1 1  28 MET CA   C  -0.001   5.369   8.682 1.00 . A A .  28 MET CA   1 1 
        1   439 1 1  28 MET CB   C   0.774   5.685   9.985 1.00 . A A .  28 MET CB   1 1 
        1   440 1 1  28 MET CE   C   2.034   8.100  11.857 1.00 . A A .  28 MET CE   1 1 
        1   441 1 1  28 MET CG   C  -0.037   6.440  11.034 1.00 . A A .  28 MET CG   1 1 
        1   442 1 1  28 MET H    H  -1.098   3.894   9.770 1.00 . A A .  28 MET H    1 1 
        1   443 1 1  28 MET HA   H  -0.436   6.295   8.307 1.00 . A A .  28 MET HA   1 1 
        1   444 1 1  28 MET HB2  H   1.112   4.755  10.429 1.00 . A A .  28 MET HB2  1 1 
        1   445 1 1  28 MET HB3  H   1.645   6.287   9.743 1.00 . A A .  28 MET HB3  1 1 
        1   446 1 1  28 MET HE1  H   2.636   7.686  11.060 1.00 . A A .  28 MET HE1  1 1 
        1   447 1 1  28 MET HE2  H   2.683   8.450  12.648 1.00 . A A .  28 MET HE2  1 1 
        1   448 1 1  28 MET HE3  H   1.453   8.929  11.476 1.00 . A A .  28 MET HE3  1 1 
        1   449 1 1  28 MET HG2  H  -0.405   7.363  10.598 1.00 . A A .  28 MET HG2  1 1 
        1   450 1 1  28 MET HG3  H  -0.882   5.831  11.336 1.00 . A A .  28 MET HG3  1 1 
        1   451 1 1  28 MET N    N  -1.108   4.425   8.941 1.00 . A A .  28 MET N    1 1 
        1   452 1 1  28 MET O    O   1.656   5.610   6.976 1.00 . A A .  28 MET O    1 1 
        1   453 1 1  28 MET SD   S   0.939   6.839  12.495 1.00 . A A .  28 MET SD   1 1 
        1   454 1 1  29 PHE C    C   1.296   2.999   5.022 1.00 . A A .  29 PHE C    1 1 
        1   455 1 1  29 PHE CA   C   1.884   2.849   6.437 1.00 . A A .  29 PHE CA   1 1 
        1   456 1 1  29 PHE CB   C   2.090   1.352   6.796 1.00 . A A .  29 PHE CB   1 1 
        1   457 1 1  29 PHE CD1  C   4.277   1.040   5.515 1.00 . A A .  29 PHE CD1  1 1 
        1   458 1 1  29 PHE CD2  C   2.592  -0.640   5.278 1.00 . A A .  29 PHE CD2  1 1 
        1   459 1 1  29 PHE CE1  C   5.101   0.336   4.659 1.00 . A A .  29 PHE CE1  1 1 
        1   460 1 1  29 PHE CE2  C   3.417  -1.343   4.420 1.00 . A A .  29 PHE CE2  1 1 
        1   461 1 1  29 PHE CG   C   3.004   0.565   5.840 1.00 . A A .  29 PHE CG   1 1 
        1   462 1 1  29 PHE CZ   C   4.670  -0.857   4.110 1.00 . A A .  29 PHE CZ   1 1 
        1   463 1 1  29 PHE H    H   0.465   2.941   8.024 1.00 . A A .  29 PHE H    1 1 
        1   464 1 1  29 PHE HA   H   2.852   3.347   6.458 1.00 . A A .  29 PHE HA   1 1 
        1   465 1 1  29 PHE HB2  H   2.529   1.291   7.787 1.00 . A A .  29 PHE HB2  1 1 
        1   466 1 1  29 PHE HB3  H   1.119   0.866   6.825 1.00 . A A .  29 PHE HB3  1 1 
        1   467 1 1  29 PHE HD1  H   4.622   1.976   5.943 1.00 . A A .  29 PHE HD1  1 1 
        1   468 1 1  29 PHE HD2  H   1.607  -1.027   5.514 1.00 . A A .  29 PHE HD2  1 1 
        1   469 1 1  29 PHE HE1  H   6.083   0.720   4.419 1.00 . A A .  29 PHE HE1  1 1 
        1   470 1 1  29 PHE HE2  H   3.075  -2.277   3.991 1.00 . A A .  29 PHE HE2  1 1 
        1   471 1 1  29 PHE HZ   H   5.315  -1.410   3.440 1.00 . A A .  29 PHE HZ   1 1 
        1   472 1 1  29 PHE N    N   1.019   3.504   7.445 1.00 . A A .  29 PHE N    1 1 
        1   473 1 1  29 PHE O    O   2.053   2.941   4.041 1.00 . A A .  29 PHE O    1 1 
        1   474 1 1  30 PHE C    C  -0.117   4.570   2.840 1.00 . A A .  30 PHE C    1 1 
        1   475 1 1  30 PHE CA   C  -0.762   3.413   3.666 1.00 . A A .  30 PHE CA   1 1 
        1   476 1 1  30 PHE CB   C  -2.286   3.690   3.908 1.00 . A A .  30 PHE CB   1 1 
        1   477 1 1  30 PHE CD1  C  -3.436   1.760   5.116 1.00 . A A .  30 PHE CD1  1 1 
        1   478 1 1  30 PHE CD2  C  -3.770   1.962   2.769 1.00 . A A .  30 PHE CD2  1 1 
        1   479 1 1  30 PHE CE1  C  -4.250   0.647   5.137 1.00 . A A .  30 PHE CE1  1 1 
        1   480 1 1  30 PHE CE2  C  -4.583   0.849   2.785 1.00 . A A .  30 PHE CE2  1 1 
        1   481 1 1  30 PHE CG   C  -3.180   2.440   3.937 1.00 . A A .  30 PHE CG   1 1 
        1   482 1 1  30 PHE CZ   C  -4.822   0.190   3.970 1.00 . A A .  30 PHE CZ   1 1 
        1   483 1 1  30 PHE H    H  -0.584   3.035   5.764 1.00 . A A .  30 PHE H    1 1 
        1   484 1 1  30 PHE HA   H  -0.679   2.503   3.077 1.00 . A A .  30 PHE HA   1 1 
        1   485 1 1  30 PHE HB2  H  -2.403   4.207   4.853 1.00 . A A .  30 PHE HB2  1 1 
        1   486 1 1  30 PHE HB3  H  -2.664   4.343   3.124 1.00 . A A .  30 PHE HB3  1 1 
        1   487 1 1  30 PHE HD1  H  -2.991   2.113   6.035 1.00 . A A .  30 PHE HD1  1 1 
        1   488 1 1  30 PHE HD2  H  -3.585   2.476   1.833 1.00 . A A .  30 PHE HD2  1 1 
        1   489 1 1  30 PHE HE1  H  -4.437   0.132   6.073 1.00 . A A .  30 PHE HE1  1 1 
        1   490 1 1  30 PHE HE2  H  -5.030   0.494   1.865 1.00 . A A .  30 PHE HE2  1 1 
        1   491 1 1  30 PHE HZ   H  -5.461  -0.684   3.986 1.00 . A A .  30 PHE HZ   1 1 
        1   492 1 1  30 PHE N    N  -0.050   3.146   4.937 1.00 . A A .  30 PHE N    1 1 
        1   493 1 1  30 PHE O    O  -0.420   5.751   3.043 1.00 . A A .  30 PHE O    1 1 
        1   494 1 1  31 TYR C    C   2.087   6.210   1.168 1.00 . A A .  31 TYR C    1 1 
        1   495 1 1  31 TYR CA   C   1.301   4.942   0.782 1.00 . A A .  31 TYR CA   1 1 
        1   496 1 1  31 TYR CB   C   0.115   5.281  -0.176 1.00 . A A .  31 TYR CB   1 1 
        1   497 1 1  31 TYR CD1  C  -0.367   2.831  -0.777 1.00 . A A .  31 TYR CD1  1 1 
        1   498 1 1  31 TYR CD2  C  -2.225   4.261  -0.310 1.00 . A A .  31 TYR CD2  1 1 
        1   499 1 1  31 TYR CE1  C  -1.232   1.778  -0.980 1.00 . A A .  31 TYR CE1  1 1 
        1   500 1 1  31 TYR CE2  C  -3.083   3.208  -0.521 1.00 . A A .  31 TYR CE2  1 1 
        1   501 1 1  31 TYR CG   C  -0.845   4.102  -0.433 1.00 . A A .  31 TYR CG   1 1 
        1   502 1 1  31 TYR CZ   C  -2.589   1.976  -0.852 1.00 . A A .  31 TYR CZ   1 1 
        1   503 1 1  31 TYR H    H   1.220   3.287   2.095 1.00 . A A .  31 TYR H    1 1 
        1   504 1 1  31 TYR HA   H   1.985   4.295   0.256 1.00 . A A .  31 TYR HA   1 1 
        1   505 1 1  31 TYR HB2  H  -0.458   6.098   0.252 1.00 . A A .  31 TYR HB2  1 1 
        1   506 1 1  31 TYR HB3  H   0.515   5.604  -1.132 1.00 . A A .  31 TYR HB3  1 1 
        1   507 1 1  31 TYR HD1  H   0.701   2.678  -0.883 1.00 . A A .  31 TYR HD1  1 1 
        1   508 1 1  31 TYR HD2  H  -2.625   5.235  -0.047 1.00 . A A .  31 TYR HD2  1 1 
        1   509 1 1  31 TYR HE1  H  -0.844   0.806  -1.245 1.00 . A A .  31 TYR HE1  1 1 
        1   510 1 1  31 TYR HE2  H  -4.149   3.357  -0.420 1.00 . A A .  31 TYR HE2  1 1 
        1   511 1 1  31 TYR HH   H  -3.212   0.196  -0.495 1.00 . A A .  31 TYR HH   1 1 
        1   512 1 1  31 TYR N    N   0.819   4.164   1.948 1.00 . A A .  31 TYR N    1 1 
        1   513 1 1  31 TYR O    O   1.980   7.243   0.492 1.00 . A A .  31 TYR O    1 1 
        1   514 1 1  31 TYR OH   O  -3.464   0.938  -1.049 1.00 . A A .  31 TYR OH   1 1 
        1   515 1 1  32 THR C    C   4.962   7.408   1.671 1.00 . A A .  32 THR C    1 1 
        1   516 1 1  32 THR CA   C   3.786   7.222   2.645 1.00 . A A .  32 THR CA   1 1 
        1   517 1 1  32 THR CB   C   4.314   7.043   4.106 1.00 . A A .  32 THR CB   1 1 
        1   518 1 1  32 THR CG2  C   3.250   7.408   5.143 1.00 . A A .  32 THR CG2  1 1 
        1   519 1 1  32 THR H    H   2.956   5.264   2.715 1.00 . A A .  32 THR H    1 1 
        1   520 1 1  32 THR HA   H   3.186   8.134   2.616 1.00 . A A .  32 THR HA   1 1 
        1   521 1 1  32 THR HB   H   5.167   7.702   4.255 1.00 . A A .  32 THR HB   1 1 
        1   522 1 1  32 THR HG1  H   4.168   5.242   4.922 1.00 . A A .  32 THR HG1  1 1 
        1   523 1 1  32 THR HG21 H   2.964   8.446   5.028 1.00 . A A .  32 THR HG21 1 1 
        1   524 1 1  32 THR HG22 H   3.646   7.255   6.138 1.00 . A A .  32 THR HG22 1 1 
        1   525 1 1  32 THR HG23 H   2.379   6.780   5.007 1.00 . A A .  32 THR HG23 1 1 
        1   526 1 1  32 THR N    N   2.917   6.109   2.222 1.00 . A A .  32 THR N    1 1 
        1   527 1 1  32 THR O    O   4.873   8.219   0.752 1.00 . A A .  32 THR O    1 1 
        1   528 1 1  32 THR OG1  O   4.758   5.686   4.306 1.00 . A A .  32 THR OG1  1 1 
        1   529 1 1  33 ARG C    C   8.129   5.587   0.995 1.00 . A A .  33 ARG C    1 1 
        1   530 1 1  33 ARG CA   C   7.291   6.865   1.106 1.00 . A A .  33 ARG CA   1 1 
        1   531 1 1  33 ARG CB   C   8.087   8.029   1.777 1.00 . A A .  33 ARG CB   1 1 
        1   532 1 1  33 ARG CD   C   8.996   9.023   3.977 1.00 . A A .  33 ARG CD   1 1 
        1   533 1 1  33 ARG CG   C   8.613   7.741   3.208 1.00 . A A .  33 ARG CG   1 1 
        1   534 1 1  33 ARG CZ   C   9.958  11.278   3.412 1.00 . A A .  33 ARG CZ   1 1 
        1   535 1 1  33 ARG H    H   6.004   5.882   2.482 1.00 . A A .  33 ARG H    1 1 
        1   536 1 1  33 ARG HA   H   7.011   7.177   0.102 1.00 . A A .  33 ARG HA   1 1 
        1   537 1 1  33 ARG HB2  H   8.934   8.275   1.146 1.00 . A A .  33 ARG HB2  1 1 
        1   538 1 1  33 ARG HB3  H   7.435   8.898   1.821 1.00 . A A .  33 ARG HB3  1 1 
        1   539 1 1  33 ARG HD2  H   8.084   9.543   4.250 1.00 . A A .  33 ARG HD2  1 1 
        1   540 1 1  33 ARG HD3  H   9.522   8.741   4.880 1.00 . A A .  33 ARG HD3  1 1 
        1   541 1 1  33 ARG HE   H  10.376   9.546   2.465 1.00 . A A .  33 ARG HE   1 1 
        1   542 1 1  33 ARG HG2  H   7.840   7.218   3.765 1.00 . A A .  33 ARG HG2  1 1 
        1   543 1 1  33 ARG HG3  H   9.484   7.099   3.132 1.00 . A A .  33 ARG HG3  1 1 
        1   544 1 1  33 ARG HH11 H   8.652  11.348   4.971 1.00 . A A .  33 ARG HH11 1 1 
        1   545 1 1  33 ARG HH12 H   9.353  12.872   4.528 1.00 . A A .  33 ARG HH12 1 1 
        1   546 1 1  33 ARG HH21 H  11.282  11.558   1.906 1.00 . A A .  33 ARG HH21 1 1 
        1   547 1 1  33 ARG HH22 H  10.846  12.988   2.786 1.00 . A A .  33 ARG HH22 1 1 
        1   548 1 1  33 ARG N    N   6.049   6.630   1.847 1.00 . A A .  33 ARG N    1 1 
        1   549 1 1  33 ARG NE   N   9.853   9.944   3.198 1.00 . A A .  33 ARG NE   1 1 
        1   550 1 1  33 ARG NH1  N   9.265  11.880   4.381 1.00 . A A .  33 ARG NH1  1 1 
        1   551 1 1  33 ARG NH2  N  10.759  11.999   2.640 1.00 . A A .  33 ARG NH2  1 1 
        1   552 1 1  33 ARG O    O   8.200   4.804   1.947 1.00 . A A .  33 ARG O    1 1 
        1   553 1 1  34 TYR C    C  10.763   4.153   0.619 1.00 . A A .  34 TYR C    1 1 
        1   554 1 1  34 TYR CA   C   9.698   4.313  -0.518 1.00 . A A .  34 TYR CA   1 1 
        1   555 1 1  34 TYR CB   C  10.387   4.559  -1.905 1.00 . A A .  34 TYR CB   1 1 
        1   556 1 1  34 TYR CD1  C  11.208   2.289  -2.770 1.00 . A A .  34 TYR CD1  1 1 
        1   557 1 1  34 TYR CD2  C  12.855   3.837  -2.010 1.00 . A A .  34 TYR CD2  1 1 
        1   558 1 1  34 TYR CE1  C  12.197   1.369  -3.048 1.00 . A A .  34 TYR CE1  1 1 
        1   559 1 1  34 TYR CE2  C  13.848   2.919  -2.284 1.00 . A A .  34 TYR CE2  1 1 
        1   560 1 1  34 TYR CG   C  11.509   3.546  -2.251 1.00 . A A .  34 TYR CG   1 1 
        1   561 1 1  34 TYR CZ   C  13.512   1.683  -2.798 1.00 . A A .  34 TYR CZ   1 1 
        1   562 1 1  34 TYR H    H   8.273   5.832  -0.989 1.00 . A A .  34 TYR H    1 1 
        1   563 1 1  34 TYR HA   H   9.152   3.381  -0.578 1.00 . A A .  34 TYR HA   1 1 
        1   564 1 1  34 TYR HB2  H   9.636   4.514  -2.682 1.00 . A A .  34 TYR HB2  1 1 
        1   565 1 1  34 TYR HB3  H  10.822   5.554  -1.909 1.00 . A A .  34 TYR HB3  1 1 
        1   566 1 1  34 TYR HD1  H  10.177   2.037  -2.973 1.00 . A A .  34 TYR HD1  1 1 
        1   567 1 1  34 TYR HD2  H  13.119   4.806  -1.609 1.00 . A A .  34 TYR HD2  1 1 
        1   568 1 1  34 TYR HE1  H  11.931   0.402  -3.452 1.00 . A A .  34 TYR HE1  1 1 
        1   569 1 1  34 TYR HE2  H  14.882   3.171  -2.088 1.00 . A A .  34 TYR HE2  1 1 
        1   570 1 1  34 TYR HH   H  15.092   0.687  -2.333 1.00 . A A .  34 TYR HH   1 1 
        1   571 1 1  34 TYR N    N   8.673   5.356  -0.231 1.00 . A A .  34 TYR N    1 1 
        1   572 1 1  34 TYR O    O  11.039   3.015   1.009 1.00 . A A .  34 TYR O    1 1 
        1   573 1 1  34 TYR OH   O  14.495   0.762  -3.086 1.00 . A A .  34 TYR OH   1 1 
        1   574 1 1  35 PRO C    C  11.353   4.967   3.645 1.00 . A A .  35 PRO C    1 1 
        1   575 1 1  35 PRO CA   C  12.232   5.167   2.384 1.00 . A A .  35 PRO CA   1 1 
        1   576 1 1  35 PRO CB   C  13.006   6.524   2.406 1.00 . A A .  35 PRO CB   1 1 
        1   577 1 1  35 PRO CD   C  11.476   6.630   0.579 1.00 . A A .  35 PRO CD   1 1 
        1   578 1 1  35 PRO CG   C  12.821   7.116   1.043 1.00 . A A .  35 PRO CG   1 1 
        1   579 1 1  35 PRO HA   H  12.944   4.345   2.315 1.00 . A A .  35 PRO HA   1 1 
        1   580 1 1  35 PRO HB2  H  12.600   7.181   3.175 1.00 . A A .  35 PRO HB2  1 1 
        1   581 1 1  35 PRO HB3  H  14.061   6.353   2.598 1.00 . A A .  35 PRO HB3  1 1 
        1   582 1 1  35 PRO HD2  H  10.677   7.248   0.972 1.00 . A A .  35 PRO HD2  1 1 
        1   583 1 1  35 PRO HD3  H  11.432   6.603  -0.504 1.00 . A A .  35 PRO HD3  1 1 
        1   584 1 1  35 PRO HG2  H  12.838   8.198   1.096 1.00 . A A .  35 PRO HG2  1 1 
        1   585 1 1  35 PRO HG3  H  13.594   6.764   0.364 1.00 . A A .  35 PRO HG3  1 1 
        1   586 1 1  35 PRO N    N  11.409   5.256   1.152 1.00 . A A .  35 PRO N    1 1 
        1   587 1 1  35 PRO O    O  11.274   5.853   4.508 1.00 . A A .  35 PRO O    1 1 
        1   588 1 1  36 SER C    C  10.461   3.435   6.192 1.00 . A A .  36 SER C    1 1 
        1   589 1 1  36 SER CA   C   9.771   3.437   4.819 1.00 . A A .  36 SER CA   1 1 
        1   590 1 1  36 SER CB   C   9.165   2.047   4.521 1.00 . A A .  36 SER CB   1 1 
        1   591 1 1  36 SER H    H  10.723   3.186   2.974 1.00 . A A .  36 SER H    1 1 
        1   592 1 1  36 SER HA   H   8.969   4.158   4.838 1.00 . A A .  36 SER HA   1 1 
        1   593 1 1  36 SER HB2  H   8.553   1.719   5.353 1.00 . A A .  36 SER HB2  1 1 
        1   594 1 1  36 SER HB3  H   8.550   2.105   3.630 1.00 . A A .  36 SER HB3  1 1 
        1   595 1 1  36 SER HG   H   9.832   0.345   3.803 1.00 . A A .  36 SER HG   1 1 
        1   596 1 1  36 SER N    N  10.672   3.810   3.717 1.00 . A A .  36 SER N    1 1 
        1   597 1 1  36 SER O    O   9.802   3.641   7.198 1.00 . A A .  36 SER O    1 1 
        1   598 1 1  36 SER OG   O  10.191   1.084   4.300 1.00 . A A .  36 SER OG   1 1 
        1   599 1 1  37 SER C    C  12.567   4.598   8.118 1.00 . A A .  37 SER C    1 1 
        1   600 1 1  37 SER CA   C  12.604   3.210   7.439 1.00 . A A .  37 SER CA   1 1 
        1   601 1 1  37 SER CB   C  14.056   2.805   7.110 1.00 . A A .  37 SER CB   1 1 
        1   602 1 1  37 SER H    H  12.234   3.023   5.352 1.00 . A A .  37 SER H    1 1 
        1   603 1 1  37 SER HA   H  12.182   2.475   8.118 1.00 . A A .  37 SER HA   1 1 
        1   604 1 1  37 SER HB2  H  14.519   3.574   6.504 1.00 . A A .  37 SER HB2  1 1 
        1   605 1 1  37 SER HB3  H  14.620   2.690   8.029 1.00 . A A .  37 SER HB3  1 1 
        1   606 1 1  37 SER HG   H  13.317   1.059   6.570 1.00 . A A .  37 SER HG   1 1 
        1   607 1 1  37 SER N    N  11.789   3.203   6.206 1.00 . A A .  37 SER N    1 1 
        1   608 1 1  37 SER O    O  12.500   4.691   9.355 1.00 . A A .  37 SER O    1 1 
        1   609 1 1  37 SER OG   O  14.111   1.576   6.392 1.00 . A A .  37 SER OG   1 1 
        1   610 1 1  38 ASN C    C  11.094   7.260   8.418 1.00 . A A .  38 ASN C    1 1 
        1   611 1 1  38 ASN CA   C  12.468   7.063   7.769 1.00 . A A .  38 ASN CA   1 1 
        1   612 1 1  38 ASN CB   C  12.687   8.082   6.617 1.00 . A A .  38 ASN CB   1 1 
        1   613 1 1  38 ASN CG   C  14.124   8.096   6.092 1.00 . A A .  38 ASN CG   1 1 
        1   614 1 1  38 ASN H    H  12.697   5.515   6.325 1.00 . A A .  38 ASN H    1 1 
        1   615 1 1  38 ASN HA   H  13.233   7.223   8.528 1.00 . A A .  38 ASN HA   1 1 
        1   616 1 1  38 ASN HB2  H  12.026   7.831   5.796 1.00 . A A .  38 ASN HB2  1 1 
        1   617 1 1  38 ASN HB3  H  12.440   9.080   6.971 1.00 . A A .  38 ASN HB3  1 1 
        1   618 1 1  38 ASN HD21 H  14.615   9.580   7.325 1.00 . A A .  38 ASN HD21 1 1 
        1   619 1 1  38 ASN HD22 H  15.877   9.012   6.290 1.00 . A A .  38 ASN HD22 1 1 
        1   620 1 1  38 ASN N    N  12.594   5.669   7.288 1.00 . A A .  38 ASN N    1 1 
        1   621 1 1  38 ASN ND2  N  14.957   8.981   6.624 1.00 . A A .  38 ASN ND2  1 1 
        1   622 1 1  38 ASN O    O  11.019   7.551   9.606 1.00 . A A .  38 ASN O    1 1 
        1   623 1 1  38 ASN OD1  O  14.480   7.316   5.217 1.00 . A A .  38 ASN OD1  1 1 
        1   624 1 1  39 MET C    C   8.398   6.324   9.401 1.00 . A A .  39 MET C    1 1 
        1   625 1 1  39 MET CA   C   8.613   7.106   8.086 1.00 . A A .  39 MET CA   1 1 
        1   626 1 1  39 MET CB   C   7.665   6.573   6.967 1.00 . A A .  39 MET CB   1 1 
        1   627 1 1  39 MET CE   C   4.347   5.119   9.085 1.00 . A A .  39 MET CE   1 1 
        1   628 1 1  39 MET CG   C   6.196   6.372   7.390 1.00 . A A .  39 MET CG   1 1 
        1   629 1 1  39 MET H    H  10.203   6.874   6.670 1.00 . A A .  39 MET H    1 1 
        1   630 1 1  39 MET HA   H   8.370   8.153   8.261 1.00 . A A .  39 MET HA   1 1 
        1   631 1 1  39 MET HB2  H   7.684   7.274   6.138 1.00 . A A .  39 MET HB2  1 1 
        1   632 1 1  39 MET HB3  H   8.048   5.622   6.613 1.00 . A A .  39 MET HB3  1 1 
        1   633 1 1  39 MET HE1  H   4.397   5.985   9.732 1.00 . A A .  39 MET HE1  1 1 
        1   634 1 1  39 MET HE2  H   4.071   4.253   9.670 1.00 . A A .  39 MET HE2  1 1 
        1   635 1 1  39 MET HE3  H   3.601   5.283   8.318 1.00 . A A .  39 MET HE3  1 1 
        1   636 1 1  39 MET HG2  H   5.883   7.211   8.000 1.00 . A A .  39 MET HG2  1 1 
        1   637 1 1  39 MET HG3  H   5.576   6.335   6.502 1.00 . A A .  39 MET HG3  1 1 
        1   638 1 1  39 MET N    N  10.028   7.046   7.622 1.00 . A A .  39 MET N    1 1 
        1   639 1 1  39 MET O    O   7.787   6.833  10.335 1.00 . A A .  39 MET O    1 1 
        1   640 1 1  39 MET SD   S   5.945   4.842   8.327 1.00 . A A .  39 MET SD   1 1 
        1   641 1 1  40 LEU C    C   9.409   4.749  11.843 1.00 . A A .  40 LEU C    1 1 
        1   642 1 1  40 LEU CA   C   8.767   4.170  10.567 1.00 . A A .  40 LEU CA   1 1 
        1   643 1 1  40 LEU CB   C   9.366   2.767  10.171 1.00 . A A .  40 LEU CB   1 1 
        1   644 1 1  40 LEU CD1  C   9.223   0.194  10.224 1.00 . A A .  40 LEU CD1  1 1 
        1   645 1 1  40 LEU CD2  C   9.590   1.452  12.393 1.00 . A A .  40 LEU CD2  1 1 
        1   646 1 1  40 LEU CG   C   8.926   1.502  11.001 1.00 . A A .  40 LEU CG   1 1 
        1   647 1 1  40 LEU H    H   9.603   4.893   8.746 1.00 . A A .  40 LEU H    1 1 
        1   648 1 1  40 LEU HA   H   7.693   4.065  10.723 1.00 . A A .  40 LEU HA   1 1 
        1   649 1 1  40 LEU HB2  H   9.096   2.586   9.135 1.00 . A A .  40 LEU HB2  1 1 
        1   650 1 1  40 LEU HB3  H  10.451   2.838  10.212 1.00 . A A .  40 LEU HB3  1 1 
        1   651 1 1  40 LEU HD11 H  10.286   0.106  10.031 1.00 . A A .  40 LEU HD11 1 1 
        1   652 1 1  40 LEU HD12 H   8.692   0.208   9.281 1.00 . A A .  40 LEU HD12 1 1 
        1   653 1 1  40 LEU HD13 H   8.891  -0.660  10.800 1.00 . A A .  40 LEU HD13 1 1 
        1   654 1 1  40 LEU HD21 H   9.251   0.575  12.927 1.00 . A A .  40 LEU HD21 1 1 
        1   655 1 1  40 LEU HD22 H   9.316   2.335  12.955 1.00 . A A .  40 LEU HD22 1 1 
        1   656 1 1  40 LEU HD23 H  10.668   1.416  12.290 1.00 . A A .  40 LEU HD23 1 1 
        1   657 1 1  40 LEU HG   H   7.853   1.546  11.154 1.00 . A A .  40 LEU HG   1 1 
        1   658 1 1  40 LEU N    N   8.976   5.119   9.460 1.00 . A A .  40 LEU N    1 1 
        1   659 1 1  40 LEU O    O   8.714   5.128  12.800 1.00 . A A .  40 LEU O    1 1 
        1   660 1 1  41 LYS C    C  11.236   6.738  13.438 1.00 . A A .  41 LYS C    1 1 
        1   661 1 1  41 LYS CA   C  11.552   5.291  12.964 1.00 . A A .  41 LYS CA   1 1 
        1   662 1 1  41 LYS CB   C  13.050   5.112  12.602 1.00 . A A .  41 LYS CB   1 1 
        1   663 1 1  41 LYS CD   C  15.513   5.030  13.319 1.00 . A A .  41 LYS CD   1 1 
        1   664 1 1  41 LYS CE   C  16.550   5.408  14.388 1.00 . A A .  41 LYS CE   1 1 
        1   665 1 1  41 LYS CG   C  14.060   5.367  13.741 1.00 . A A .  41 LYS CG   1 1 
        1   666 1 1  41 LYS H    H  11.197   4.743  10.942 1.00 . A A .  41 LYS H    1 1 
        1   667 1 1  41 LYS HA   H  11.312   4.611  13.774 1.00 . A A .  41 LYS HA   1 1 
        1   668 1 1  41 LYS HB2  H  13.193   4.097  12.248 1.00 . A A .  41 LYS HB2  1 1 
        1   669 1 1  41 LYS HB3  H  13.285   5.789  11.784 1.00 . A A .  41 LYS HB3  1 1 
        1   670 1 1  41 LYS HD2  H  15.585   3.964  13.133 1.00 . A A .  41 LYS HD2  1 1 
        1   671 1 1  41 LYS HD3  H  15.748   5.563  12.400 1.00 . A A .  41 LYS HD3  1 1 
        1   672 1 1  41 LYS HE2  H  17.537   5.190  14.011 1.00 . A A .  41 LYS HE2  1 1 
        1   673 1 1  41 LYS HE3  H  16.475   6.469  14.592 1.00 . A A .  41 LYS HE3  1 1 
        1   674 1 1  41 LYS HG2  H  14.007   6.414  14.027 1.00 . A A .  41 LYS HG2  1 1 
        1   675 1 1  41 LYS HG3  H  13.789   4.753  14.595 1.00 . A A .  41 LYS HG3  1 1 
        1   676 1 1  41 LYS HZ1  H  15.396   4.818  16.022 1.00 . A A .  41 LYS HZ1  1 1 
        1   677 1 1  41 LYS HZ2  H  17.041   4.997  16.369 1.00 . A A .  41 LYS HZ2  1 1 
        1   678 1 1  41 LYS HZ3  H  16.501   3.646  15.507 1.00 . A A .  41 LYS HZ3  1 1 
        1   679 1 1  41 LYS N    N  10.740   4.897  11.798 1.00 . A A .  41 LYS N    1 1 
        1   680 1 1  41 LYS NZ   N  16.358   4.666  15.657 1.00 . A A .  41 LYS NZ   1 1 
        1   681 1 1  41 LYS O    O  11.358   7.049  14.634 1.00 . A A .  41 LYS O    1 1 
        1   682 1 1  42 THR C    C   9.067   9.131  13.415 1.00 . A A .  42 THR C    1 1 
        1   683 1 1  42 THR CA   C  10.469   9.017  12.798 1.00 . A A .  42 THR CA   1 1 
        1   684 1 1  42 THR CB   C  10.562   9.925  11.523 1.00 . A A .  42 THR CB   1 1 
        1   685 1 1  42 THR CG2  C  10.244  11.408  11.808 1.00 . A A .  42 THR CG2  1 1 
        1   686 1 1  42 THR H    H  10.701   7.288  11.577 1.00 . A A .  42 THR H    1 1 
        1   687 1 1  42 THR HA   H  11.196   9.383  13.523 1.00 . A A .  42 THR HA   1 1 
        1   688 1 1  42 THR HB   H   9.860   9.556  10.779 1.00 . A A .  42 THR HB   1 1 
        1   689 1 1  42 THR HG1  H  12.150   8.909  10.949 1.00 . A A .  42 THR HG1  1 1 
        1   690 1 1  42 THR HG21 H  10.343  11.984  10.896 1.00 . A A .  42 THR HG21 1 1 
        1   691 1 1  42 THR HG22 H  10.928  11.796  12.553 1.00 . A A .  42 THR HG22 1 1 
        1   692 1 1  42 THR HG23 H   9.230  11.501  12.172 1.00 . A A .  42 THR HG23 1 1 
        1   693 1 1  42 THR N    N  10.809   7.609  12.495 1.00 . A A .  42 THR N    1 1 
        1   694 1 1  42 THR O    O   8.901   9.739  14.471 1.00 . A A .  42 THR O    1 1 
        1   695 1 1  42 THR OG1  O  11.881   9.832  10.976 1.00 . A A .  42 THR OG1  1 1 
        1   696 1 1  43 TYR C    C   6.303   7.868  14.414 1.00 . A A .  43 TYR C    1 1 
        1   697 1 1  43 TYR CA   C   6.643   8.682  13.158 1.00 . A A .  43 TYR CA   1 1 
        1   698 1 1  43 TYR CB   C   5.697   8.320  11.979 1.00 . A A .  43 TYR CB   1 1 
        1   699 1 1  43 TYR CD1  C   6.531  10.446  10.759 1.00 . A A .  43 TYR CD1  1 1 
        1   700 1 1  43 TYR CD2  C   4.724   9.223   9.782 1.00 . A A .  43 TYR CD2  1 1 
        1   701 1 1  43 TYR CE1  C   6.460  11.366   9.735 1.00 . A A .  43 TYR CE1  1 1 
        1   702 1 1  43 TYR CE2  C   4.649  10.151   8.764 1.00 . A A .  43 TYR CE2  1 1 
        1   703 1 1  43 TYR CG   C   5.662   9.345  10.811 1.00 . A A .  43 TYR CG   1 1 
        1   704 1 1  43 TYR CZ   C   5.516  11.216   8.748 1.00 . A A .  43 TYR CZ   1 1 
        1   705 1 1  43 TYR H    H   8.276   7.954  11.984 1.00 . A A .  43 TYR H    1 1 
        1   706 1 1  43 TYR HA   H   6.489   9.732  13.400 1.00 . A A .  43 TYR HA   1 1 
        1   707 1 1  43 TYR HB2  H   6.001   7.364  11.566 1.00 . A A .  43 TYR HB2  1 1 
        1   708 1 1  43 TYR HB3  H   4.684   8.224  12.356 1.00 . A A .  43 TYR HB3  1 1 
        1   709 1 1  43 TYR HD1  H   7.283  10.569  11.535 1.00 . A A .  43 TYR HD1  1 1 
        1   710 1 1  43 TYR HD2  H   4.039   8.386   9.788 1.00 . A A .  43 TYR HD2  1 1 
        1   711 1 1  43 TYR HE1  H   7.142  12.206   9.719 1.00 . A A .  43 TYR HE1  1 1 
        1   712 1 1  43 TYR HE2  H   3.910  10.034   7.983 1.00 . A A .  43 TYR HE2  1 1 
        1   713 1 1  43 TYR HH   H   4.568  12.570   7.780 1.00 . A A .  43 TYR HH   1 1 
        1   714 1 1  43 TYR N    N   8.062   8.526  12.758 1.00 . A A .  43 TYR N    1 1 
        1   715 1 1  43 TYR O    O   5.345   8.203  15.125 1.00 . A A .  43 TYR O    1 1 
        1   716 1 1  43 TYR OH   O   5.430  12.145   7.744 1.00 . A A .  43 TYR OH   1 1 
        1   717 1 1  44 PHE C    C   8.029   6.371  16.941 1.00 . A A .  44 PHE C    1 1 
        1   718 1 1  44 PHE CA   C   6.926   6.006  15.922 1.00 . A A .  44 PHE CA   1 1 
        1   719 1 1  44 PHE CB   C   6.930   4.493  15.572 1.00 . A A .  44 PHE CB   1 1 
        1   720 1 1  44 PHE CD1  C   4.537   4.421  14.709 1.00 . A A .  44 PHE CD1  1 1 
        1   721 1 1  44 PHE CD2  C   6.245   3.444  13.360 1.00 . A A .  44 PHE CD2  1 1 
        1   722 1 1  44 PHE CE1  C   3.598   4.092  13.751 1.00 . A A .  44 PHE CE1  1 1 
        1   723 1 1  44 PHE CE2  C   5.312   3.123  12.406 1.00 . A A .  44 PHE CE2  1 1 
        1   724 1 1  44 PHE CG   C   5.881   4.099  14.529 1.00 . A A .  44 PHE CG   1 1 
        1   725 1 1  44 PHE CZ   C   3.988   3.446  12.597 1.00 . A A .  44 PHE CZ   1 1 
        1   726 1 1  44 PHE H    H   7.757   6.519  14.023 1.00 . A A .  44 PHE H    1 1 
        1   727 1 1  44 PHE HA   H   5.970   6.252  16.379 1.00 . A A .  44 PHE HA   1 1 
        1   728 1 1  44 PHE HB2  H   7.912   4.223  15.197 1.00 . A A .  44 PHE HB2  1 1 
        1   729 1 1  44 PHE HB3  H   6.737   3.921  16.471 1.00 . A A .  44 PHE HB3  1 1 
        1   730 1 1  44 PHE HD1  H   4.224   4.927  15.614 1.00 . A A .  44 PHE HD1  1 1 
        1   731 1 1  44 PHE HD2  H   7.287   3.183  13.200 1.00 . A A .  44 PHE HD2  1 1 
        1   732 1 1  44 PHE HE1  H   2.557   4.346  13.906 1.00 . A A .  44 PHE HE1  1 1 
        1   733 1 1  44 PHE HE2  H   5.623   2.610  11.507 1.00 . A A .  44 PHE HE2  1 1 
        1   734 1 1  44 PHE HZ   H   3.254   3.191  11.844 1.00 . A A .  44 PHE HZ   1 1 
        1   735 1 1  44 PHE N    N   7.080   6.804  14.687 1.00 . A A .  44 PHE N    1 1 
        1   736 1 1  44 PHE O    O   8.678   5.493  17.513 1.00 . A A .  44 PHE O    1 1 
        1   737 1 1  45 SER C    C   8.953   7.640  19.573 1.00 . A A .  45 SER C    1 1 
        1   738 1 1  45 SER CA   C   9.135   8.257  18.171 1.00 . A A .  45 SER CA   1 1 
        1   739 1 1  45 SER CB   C   8.928   9.787  18.274 1.00 . A A .  45 SER CB   1 1 
        1   740 1 1  45 SER H    H   7.714   8.325  16.604 1.00 . A A .  45 SER H    1 1 
        1   741 1 1  45 SER HA   H  10.142   8.063  17.828 1.00 . A A .  45 SER HA   1 1 
        1   742 1 1  45 SER HB2  H   7.926   9.997  18.621 1.00 . A A .  45 SER HB2  1 1 
        1   743 1 1  45 SER HB3  H   9.641  10.206  18.975 1.00 . A A .  45 SER HB3  1 1 
        1   744 1 1  45 SER HG   H   9.658   9.870  16.461 1.00 . A A .  45 SER HG   1 1 
        1   745 1 1  45 SER N    N   8.203   7.693  17.165 1.00 . A A .  45 SER N    1 1 
        1   746 1 1  45 SER O    O   9.926   7.437  20.303 1.00 . A A .  45 SER O    1 1 
        1   747 1 1  45 SER OG   O   9.104  10.424  17.026 1.00 . A A .  45 SER OG   1 1 
        1   748 1 1  46 ASP C    C   7.765   5.339  21.374 1.00 . A A .  46 ASP C    1 1 
        1   749 1 1  46 ASP CA   C   7.331   6.811  21.252 1.00 . A A .  46 ASP CA   1 1 
        1   750 1 1  46 ASP CB   C   5.807   6.956  21.492 1.00 . A A .  46 ASP CB   1 1 
        1   751 1 1  46 ASP CG   C   5.394   6.607  22.934 1.00 . A A .  46 ASP CG   1 1 
        1   752 1 1  46 ASP H    H   6.977   7.530  19.283 1.00 . A A .  46 ASP H    1 1 
        1   753 1 1  46 ASP HA   H   7.857   7.394  22.002 1.00 . A A .  46 ASP HA   1 1 
        1   754 1 1  46 ASP HB2  H   5.516   7.983  21.286 1.00 . A A .  46 ASP HB2  1 1 
        1   755 1 1  46 ASP HB3  H   5.272   6.305  20.805 1.00 . A A .  46 ASP HB3  1 1 
        1   756 1 1  46 ASP N    N   7.692   7.359  19.931 1.00 . A A .  46 ASP N    1 1 
        1   757 1 1  46 ASP O    O   8.197   4.900  22.447 1.00 . A A .  46 ASP O    1 1 
        1   758 1 1  46 ASP OD1  O   5.485   7.485  23.822 1.00 . A A .  46 ASP OD1  1 1 
        1   759 1 1  46 ASP OD2  O   5.009   5.450  23.197 1.00 . A A .  46 ASP OD2  1 1 
        1   760 1 1  47 VAL C    C   9.568   3.074  20.360 1.00 . A A .  47 VAL C    1 1 
        1   761 1 1  47 VAL CA   C   8.038   3.170  20.202 1.00 . A A .  47 VAL CA   1 1 
        1   762 1 1  47 VAL CB   C   7.569   2.488  18.857 1.00 . A A .  47 VAL CB   1 1 
        1   763 1 1  47 VAL CG1  C   7.989   0.998  18.779 1.00 . A A .  47 VAL CG1  1 1 
        1   764 1 1  47 VAL CG2  C   6.041   2.640  18.675 1.00 . A A .  47 VAL CG2  1 1 
        1   765 1 1  47 VAL H    H   7.325   5.016  19.442 1.00 . A A .  47 VAL H    1 1 
        1   766 1 1  47 VAL HA   H   7.553   2.659  21.035 1.00 . A A .  47 VAL HA   1 1 
        1   767 1 1  47 VAL HB   H   8.053   3.010  18.033 1.00 . A A .  47 VAL HB   1 1 
        1   768 1 1  47 VAL HG11 H   9.067   0.920  18.858 1.00 . A A .  47 VAL HG11 1 1 
        1   769 1 1  47 VAL HG12 H   7.675   0.578  17.831 1.00 . A A .  47 VAL HG12 1 1 
        1   770 1 1  47 VAL HG13 H   7.532   0.440  19.588 1.00 . A A .  47 VAL HG13 1 1 
        1   771 1 1  47 VAL HG21 H   5.777   3.689  18.688 1.00 . A A .  47 VAL HG21 1 1 
        1   772 1 1  47 VAL HG22 H   5.520   2.132  19.478 1.00 . A A .  47 VAL HG22 1 1 
        1   773 1 1  47 VAL HG23 H   5.739   2.212  17.726 1.00 . A A .  47 VAL HG23 1 1 
        1   774 1 1  47 VAL N    N   7.646   4.590  20.258 1.00 . A A .  47 VAL N    1 1 
        1   775 1 1  47 VAL O    O  10.302   3.734  19.634 1.00 . A A .  47 VAL O    1 1 
        1   776 1 1  48 LYS C    C  12.279   1.398  20.749 1.00 . A A .  48 LYS C    1 1 
        1   777 1 1  48 LYS CA   C  11.425   2.183  21.759 1.00 . A A .  48 LYS CA   1 1 
        1   778 1 1  48 LYS CB   C  11.482   1.534  23.166 1.00 . A A .  48 LYS CB   1 1 
        1   779 1 1  48 LYS CD   C  10.576   1.570  25.586 1.00 . A A .  48 LYS CD   1 1 
        1   780 1 1  48 LYS CE   C   9.891   2.407  26.682 1.00 . A A .  48 LYS CE   1 1 
        1   781 1 1  48 LYS CG   C  10.713   2.333  24.247 1.00 . A A .  48 LYS CG   1 1 
        1   782 1 1  48 LYS H    H   9.363   1.667  21.758 1.00 . A A .  48 LYS H    1 1 
        1   783 1 1  48 LYS HA   H  11.811   3.199  21.827 1.00 . A A .  48 LYS HA   1 1 
        1   784 1 1  48 LYS HB2  H  11.055   0.535  23.105 1.00 . A A .  48 LYS HB2  1 1 
        1   785 1 1  48 LYS HB3  H  12.519   1.450  23.476 1.00 . A A .  48 LYS HB3  1 1 
        1   786 1 1  48 LYS HD2  H   9.990   0.671  25.418 1.00 . A A .  48 LYS HD2  1 1 
        1   787 1 1  48 LYS HD3  H  11.566   1.283  25.930 1.00 . A A .  48 LYS HD3  1 1 
        1   788 1 1  48 LYS HE2  H   9.793   1.803  27.574 1.00 . A A .  48 LYS HE2  1 1 
        1   789 1 1  48 LYS HE3  H  10.508   3.270  26.906 1.00 . A A .  48 LYS HE3  1 1 
        1   790 1 1  48 LYS HG2  H  11.235   3.268  24.426 1.00 . A A .  48 LYS HG2  1 1 
        1   791 1 1  48 LYS HG3  H   9.718   2.555  23.868 1.00 . A A .  48 LYS HG3  1 1 
        1   792 1 1  48 LYS HZ1  H   7.958   2.073  25.971 1.00 . A A .  48 LYS HZ1  1 1 
        1   793 1 1  48 LYS HZ2  H   8.598   3.571  25.512 1.00 . A A .  48 LYS HZ2  1 1 
        1   794 1 1  48 LYS HZ3  H   8.061   3.328  27.097 1.00 . A A .  48 LYS HZ3  1 1 
        1   795 1 1  48 LYS N    N  10.013   2.260  21.328 1.00 . A A .  48 LYS N    1 1 
        1   796 1 1  48 LYS NZ   N   8.535   2.878  26.286 1.00 . A A .  48 LYS NZ   1 1 
        1   797 1 1  48 LYS O    O  13.465   1.697  20.578 1.00 . A A .  48 LYS O    1 1 
        1   798 1 1  49 PHE C    C  13.126  -1.548  19.562 1.00 . A A .  49 PHE C    1 1 
        1   799 1 1  49 PHE CA   C  12.201  -0.432  19.020 1.00 . A A .  49 PHE CA   1 1 
        1   800 1 1  49 PHE CB   C  12.906   0.412  17.900 1.00 . A A .  49 PHE CB   1 1 
        1   801 1 1  49 PHE CD1  C  10.892   0.977  16.456 1.00 . A A .  49 PHE CD1  1 1 
        1   802 1 1  49 PHE CD2  C  12.246   2.786  17.231 1.00 . A A .  49 PHE CD2  1 1 
        1   803 1 1  49 PHE CE1  C  10.073   1.875  15.803 1.00 . A A .  49 PHE CE1  1 1 
        1   804 1 1  49 PHE CE2  C  11.425   3.681  16.578 1.00 . A A .  49 PHE CE2  1 1 
        1   805 1 1  49 PHE CG   C  11.993   1.415  17.183 1.00 . A A .  49 PHE CG   1 1 
        1   806 1 1  49 PHE CZ   C  10.340   3.225  15.865 1.00 . A A .  49 PHE CZ   1 1 
        1   807 1 1  49 PHE H    H  10.781   0.114  20.503 1.00 . A A .  49 PHE H    1 1 
        1   808 1 1  49 PHE HA   H  11.346  -0.932  18.570 1.00 . A A .  49 PHE HA   1 1 
        1   809 1 1  49 PHE HB2  H  13.731   0.958  18.345 1.00 . A A .  49 PHE HB2  1 1 
        1   810 1 1  49 PHE HB3  H  13.313  -0.262  17.149 1.00 . A A .  49 PHE HB3  1 1 
        1   811 1 1  49 PHE HD1  H  10.675  -0.087  16.403 1.00 . A A .  49 PHE HD1  1 1 
        1   812 1 1  49 PHE HD2  H  13.100   3.150  17.793 1.00 . A A .  49 PHE HD2  1 1 
        1   813 1 1  49 PHE HE1  H   9.224   1.516  15.239 1.00 . A A .  49 PHE HE1  1 1 
        1   814 1 1  49 PHE HE2  H  11.634   4.743  16.629 1.00 . A A .  49 PHE HE2  1 1 
        1   815 1 1  49 PHE HZ   H   9.696   3.928  15.351 1.00 . A A .  49 PHE HZ   1 1 
        1   816 1 1  49 PHE N    N  11.645   0.381  20.130 1.00 . A A .  49 PHE N    1 1 
        1   817 1 1  49 PHE O    O  14.209  -1.806  19.022 1.00 . A A .  49 PHE O    1 1 
        1   818 1 1  50 ASN C    C  12.982  -4.546  19.923 1.00 . A A .  50 ASN C    1 1 
        1   819 1 1  50 ASN CA   C  13.182  -3.533  21.069 1.00 . A A .  50 ASN CA   1 1 
        1   820 1 1  50 ASN CB   C  12.414  -3.978  22.356 1.00 . A A .  50 ASN CB   1 1 
        1   821 1 1  50 ASN CG   C  12.851  -5.320  22.980 1.00 . A A .  50 ASN CG   1 1 
        1   822 1 1  50 ASN H    H  11.929  -1.815  21.144 1.00 . A A .  50 ASN H    1 1 
        1   823 1 1  50 ASN HA   H  14.242  -3.417  21.285 1.00 . A A .  50 ASN HA   1 1 
        1   824 1 1  50 ASN HB2  H  12.540  -3.207  23.107 1.00 . A A .  50 ASN HB2  1 1 
        1   825 1 1  50 ASN HB3  H  11.354  -4.050  22.126 1.00 . A A .  50 ASN HB3  1 1 
        1   826 1 1  50 ASN HD21 H  12.235  -4.711  24.763 1.00 . A A .  50 ASN HD21 1 1 
        1   827 1 1  50 ASN HD22 H  12.906  -6.299  24.702 1.00 . A A .  50 ASN HD22 1 1 
        1   828 1 1  50 ASN N    N  12.655  -2.219  20.628 1.00 . A A .  50 ASN N    1 1 
        1   829 1 1  50 ASN ND2  N  12.643  -5.455  24.278 1.00 . A A .  50 ASN ND2  1 1 
        1   830 1 1  50 ASN O    O  11.945  -4.501  19.272 1.00 . A A .  50 ASN O    1 1 
        1   831 1 1  50 ASN OD1  O  13.334  -6.241  22.317 1.00 . A A .  50 ASN OD1  1 1 
        1   832 1 1  51 ARG C    C  12.611  -7.129  18.390 1.00 . A A .  51 ARG C    1 1 
        1   833 1 1  51 ARG CA   C  13.965  -6.411  18.556 1.00 . A A .  51 ARG CA   1 1 
        1   834 1 1  51 ARG CB   C  15.087  -7.465  18.739 1.00 . A A .  51 ARG CB   1 1 
        1   835 1 1  51 ARG CD   C  16.286  -9.559  17.874 1.00 . A A .  51 ARG CD   1 1 
        1   836 1 1  51 ARG CG   C  15.170  -8.531  17.620 1.00 . A A .  51 ARG CG   1 1 
        1   837 1 1  51 ARG CZ   C  18.695  -9.474  18.567 1.00 . A A .  51 ARG CZ   1 1 
        1   838 1 1  51 ARG H    H  14.717  -5.480  20.322 1.00 . A A .  51 ARG H    1 1 
        1   839 1 1  51 ARG HA   H  14.168  -5.847  17.655 1.00 . A A .  51 ARG HA   1 1 
        1   840 1 1  51 ARG HB2  H  16.044  -6.952  18.783 1.00 . A A .  51 ARG HB2  1 1 
        1   841 1 1  51 ARG HB3  H  14.932  -7.980  19.682 1.00 . A A .  51 ARG HB3  1 1 
        1   842 1 1  51 ARG HD2  H  16.059 -10.108  18.781 1.00 . A A .  51 ARG HD2  1 1 
        1   843 1 1  51 ARG HD3  H  16.322 -10.248  17.040 1.00 . A A .  51 ARG HD3  1 1 
        1   844 1 1  51 ARG HE   H  17.686  -7.998  17.663 1.00 . A A .  51 ARG HE   1 1 
        1   845 1 1  51 ARG HG2  H  14.219  -9.054  17.565 1.00 . A A .  51 ARG HG2  1 1 
        1   846 1 1  51 ARG HG3  H  15.354  -8.033  16.673 1.00 . A A .  51 ARG HG3  1 1 
        1   847 1 1  51 ARG HH11 H  17.801 -11.252  19.002 1.00 . A A .  51 ARG HH11 1 1 
        1   848 1 1  51 ARG HH12 H  19.468 -11.129  19.459 1.00 . A A .  51 ARG HH12 1 1 
        1   849 1 1  51 ARG HH21 H  19.844  -7.823  18.303 1.00 . A A .  51 ARG HH21 1 1 
        1   850 1 1  51 ARG HH22 H  20.636  -9.170  19.060 1.00 . A A .  51 ARG HH22 1 1 
        1   851 1 1  51 ARG N    N  13.965  -5.448  19.694 1.00 . A A .  51 ARG N    1 1 
        1   852 1 1  51 ARG NE   N  17.605  -8.913  18.014 1.00 . A A .  51 ARG NE   1 1 
        1   853 1 1  51 ARG NH1  N  18.653 -10.719  19.048 1.00 . A A .  51 ARG NH1  1 1 
        1   854 1 1  51 ARG NH2  N  19.814  -8.767  18.649 1.00 . A A .  51 ARG NH2  1 1 
        1   855 1 1  51 ARG O    O  12.153  -7.345  17.266 1.00 . A A .  51 ARG O    1 1 
        1   856 1 1  52 CYS C    C   9.587  -7.278  18.903 1.00 . A A .  52 CYS C    1 1 
        1   857 1 1  52 CYS CA   C  10.688  -8.150  19.556 1.00 . A A .  52 CYS CA   1 1 
        1   858 1 1  52 CYS CB   C  10.335  -8.486  21.019 1.00 . A A .  52 CYS CB   1 1 
        1   859 1 1  52 CYS H    H  12.410  -7.232  20.378 1.00 . A A .  52 CYS H    1 1 
        1   860 1 1  52 CYS HA   H  10.785  -9.079  18.995 1.00 . A A .  52 CYS HA   1 1 
        1   861 1 1  52 CYS HB2  H  10.090  -7.576  21.546 1.00 . A A .  52 CYS HB2  1 1 
        1   862 1 1  52 CYS HB3  H   9.480  -9.152  21.039 1.00 . A A .  52 CYS HB3  1 1 
        1   863 1 1  52 CYS HG   H  12.638  -8.397  22.120 1.00 . A A .  52 CYS HG   1 1 
        1   864 1 1  52 CYS N    N  11.982  -7.465  19.525 1.00 . A A .  52 CYS N    1 1 
        1   865 1 1  52 CYS O    O   9.020  -7.643  17.861 1.00 . A A .  52 CYS O    1 1 
        1   866 1 1  52 CYS SG   S  11.676  -9.291  21.933 1.00 . A A .  52 CYS SG   1 1 
        1   867 1 1  53 ILE C    C   8.603  -4.588  17.628 1.00 . A A .  53 ILE C    1 1 
        1   868 1 1  53 ILE CA   C   8.283  -5.170  19.025 1.00 . A A .  53 ILE CA   1 1 
        1   869 1 1  53 ILE CB   C   8.030  -4.005  20.055 1.00 . A A .  53 ILE CB   1 1 
        1   870 1 1  53 ILE CD1  C   9.107  -1.885  21.109 1.00 . A A .  53 ILE CD1  1 1 
        1   871 1 1  53 ILE CG1  C   9.269  -3.061  20.165 1.00 . A A .  53 ILE CG1  1 1 
        1   872 1 1  53 ILE CG2  C   7.635  -4.579  21.440 1.00 . A A .  53 ILE CG2  1 1 
        1   873 1 1  53 ILE H    H   9.908  -5.819  20.242 1.00 . A A .  53 ILE H    1 1 
        1   874 1 1  53 ILE HA   H   7.363  -5.742  18.944 1.00 . A A .  53 ILE HA   1 1 
        1   875 1 1  53 ILE HB   H   7.181  -3.426  19.694 1.00 . A A .  53 ILE HB   1 1 
        1   876 1 1  53 ILE HD11 H   8.273  -1.273  20.794 1.00 . A A .  53 ILE HD11 1 1 
        1   877 1 1  53 ILE HD12 H  10.010  -1.292  21.093 1.00 . A A .  53 ILE HD12 1 1 
        1   878 1 1  53 ILE HD13 H   8.933  -2.246  22.112 1.00 . A A .  53 ILE HD13 1 1 
        1   879 1 1  53 ILE HG12 H  10.120  -3.630  20.511 1.00 . A A .  53 ILE HG12 1 1 
        1   880 1 1  53 ILE HG13 H   9.497  -2.658  19.184 1.00 . A A .  53 ILE HG13 1 1 
        1   881 1 1  53 ILE HG21 H   7.426  -3.768  22.129 1.00 . A A .  53 ILE HG21 1 1 
        1   882 1 1  53 ILE HG22 H   8.445  -5.179  21.837 1.00 . A A .  53 ILE HG22 1 1 
        1   883 1 1  53 ILE HG23 H   6.750  -5.196  21.345 1.00 . A A .  53 ILE HG23 1 1 
        1   884 1 1  53 ILE N    N   9.345  -6.093  19.488 1.00 . A A .  53 ILE N    1 1 
        1   885 1 1  53 ILE O    O   7.700  -4.180  16.907 1.00 . A A .  53 ILE O    1 1 
        1   886 1 1  54 THR C    C  10.013  -5.178  14.883 1.00 . A A .  54 THR C    1 1 
        1   887 1 1  54 THR CA   C  10.367  -4.131  15.945 1.00 . A A .  54 THR CA   1 1 
        1   888 1 1  54 THR CB   C  11.913  -3.869  15.940 1.00 . A A .  54 THR CB   1 1 
        1   889 1 1  54 THR CG2  C  12.422  -3.314  14.596 1.00 . A A .  54 THR CG2  1 1 
        1   890 1 1  54 THR H    H  10.563  -4.886  17.910 1.00 . A A .  54 THR H    1 1 
        1   891 1 1  54 THR HA   H   9.861  -3.196  15.709 1.00 . A A .  54 THR HA   1 1 
        1   892 1 1  54 THR HB   H  12.427  -4.802  16.151 1.00 . A A .  54 THR HB   1 1 
        1   893 1 1  54 THR HG1  H  13.024  -3.230  17.430 1.00 . A A .  54 THR HG1  1 1 
        1   894 1 1  54 THR HG21 H  13.489  -3.142  14.656 1.00 . A A .  54 THR HG21 1 1 
        1   895 1 1  54 THR HG22 H  11.918  -2.380  14.367 1.00 . A A .  54 THR HG22 1 1 
        1   896 1 1  54 THR HG23 H  12.224  -4.025  13.808 1.00 . A A .  54 THR HG23 1 1 
        1   897 1 1  54 THR N    N   9.900  -4.576  17.265 1.00 . A A .  54 THR N    1 1 
        1   898 1 1  54 THR O    O   9.504  -4.835  13.832 1.00 . A A .  54 THR O    1 1 
        1   899 1 1  54 THR OG1  O  12.237  -2.936  16.967 1.00 . A A .  54 THR OG1  1 1 
        1   900 1 1  55 SER C    C   8.418  -7.717  14.127 1.00 . A A .  55 SER C    1 1 
        1   901 1 1  55 SER CA   C   9.943  -7.586  14.284 1.00 . A A .  55 SER CA   1 1 
        1   902 1 1  55 SER CB   C  10.562  -8.907  14.801 1.00 . A A .  55 SER CB   1 1 
        1   903 1 1  55 SER H    H  10.704  -6.659  16.048 1.00 . A A .  55 SER H    1 1 
        1   904 1 1  55 SER HA   H  10.366  -7.362  13.307 1.00 . A A .  55 SER HA   1 1 
        1   905 1 1  55 SER HB2  H  10.231  -9.096  15.815 1.00 . A A .  55 SER HB2  1 1 
        1   906 1 1  55 SER HB3  H  10.254  -9.734  14.167 1.00 . A A .  55 SER HB3  1 1 
        1   907 1 1  55 SER HG   H  12.283  -8.623  15.676 1.00 . A A .  55 SER HG   1 1 
        1   908 1 1  55 SER N    N  10.280  -6.462  15.186 1.00 . A A .  55 SER N    1 1 
        1   909 1 1  55 SER O    O   7.931  -8.089  13.062 1.00 . A A .  55 SER O    1 1 
        1   910 1 1  55 SER OG   O  11.977  -8.837  14.798 1.00 . A A .  55 SER OG   1 1 
        1   911 1 1  56 GLN C    C   5.709  -6.181  14.283 1.00 . A A .  56 GLN C    1 1 
        1   912 1 1  56 GLN CA   C   6.217  -7.315  15.215 1.00 . A A .  56 GLN CA   1 1 
        1   913 1 1  56 GLN CB   C   5.725  -7.089  16.670 1.00 . A A .  56 GLN CB   1 1 
        1   914 1 1  56 GLN CD   C   3.760  -6.563  18.247 1.00 . A A .  56 GLN CD   1 1 
        1   915 1 1  56 GLN CG   C   4.210  -6.855  16.812 1.00 . A A .  56 GLN CG   1 1 
        1   916 1 1  56 GLN H    H   8.170  -7.183  16.046 1.00 . A A .  56 GLN H    1 1 
        1   917 1 1  56 GLN HA   H   5.834  -8.267  14.857 1.00 . A A .  56 GLN HA   1 1 
        1   918 1 1  56 GLN HB2  H   5.992  -7.955  17.270 1.00 . A A .  56 GLN HB2  1 1 
        1   919 1 1  56 GLN HB3  H   6.239  -6.222  17.076 1.00 . A A .  56 GLN HB3  1 1 
        1   920 1 1  56 GLN HE21 H   1.915  -7.186  17.843 1.00 . A A .  56 GLN HE21 1 1 
        1   921 1 1  56 GLN HE22 H   2.178  -6.634  19.457 1.00 . A A .  56 GLN HE22 1 1 
        1   922 1 1  56 GLN HG2  H   3.923  -6.012  16.193 1.00 . A A .  56 GLN HG2  1 1 
        1   923 1 1  56 GLN HG3  H   3.692  -7.742  16.459 1.00 . A A .  56 GLN HG3  1 1 
        1   924 1 1  56 GLN N    N   7.689  -7.389  15.209 1.00 . A A .  56 GLN N    1 1 
        1   925 1 1  56 GLN NE2  N   2.490  -6.824  18.547 1.00 . A A .  56 GLN NE2  1 1 
        1   926 1 1  56 GLN O    O   4.857  -6.418  13.407 1.00 . A A .  56 GLN O    1 1 
        1   927 1 1  56 GLN OE1  O   4.533  -6.073  19.067 1.00 . A A .  56 GLN OE1  1 1 
        1   928 1 1  57 LEU C    C   6.160  -3.935  12.233 1.00 . A A .  57 LEU C    1 1 
        1   929 1 1  57 LEU CA   C   5.876  -3.742  13.742 1.00 . A A .  57 LEU CA   1 1 
        1   930 1 1  57 LEU CB   C   6.647  -2.495  14.321 1.00 . A A .  57 LEU CB   1 1 
        1   931 1 1  57 LEU CD1  C   6.712  -0.036  15.079 1.00 . A A .  57 LEU CD1  1 1 
        1   932 1 1  57 LEU CD2  C   5.434  -0.655  12.958 1.00 . A A .  57 LEU CD2  1 1 
        1   933 1 1  57 LEU CG   C   5.874  -1.125  14.366 1.00 . A A .  57 LEU CG   1 1 
        1   934 1 1  57 LEU H    H   6.962  -4.888  15.165 1.00 . A A .  57 LEU H    1 1 
        1   935 1 1  57 LEU HA   H   4.808  -3.596  13.884 1.00 . A A .  57 LEU HA   1 1 
        1   936 1 1  57 LEU HB2  H   6.945  -2.734  15.339 1.00 . A A .  57 LEU HB2  1 1 
        1   937 1 1  57 LEU HB3  H   7.557  -2.349  13.745 1.00 . A A .  57 LEU HB3  1 1 
        1   938 1 1  57 LEU HD11 H   7.643   0.121  14.550 1.00 . A A .  57 LEU HD11 1 1 
        1   939 1 1  57 LEU HD12 H   6.925  -0.351  16.092 1.00 . A A .  57 LEU HD12 1 1 
        1   940 1 1  57 LEU HD13 H   6.154   0.891  15.110 1.00 . A A .  57 LEU HD13 1 1 
        1   941 1 1  57 LEU HD21 H   4.910   0.288  13.033 1.00 . A A .  57 LEU HD21 1 1 
        1   942 1 1  57 LEU HD22 H   4.771  -1.393  12.521 1.00 . A A .  57 LEU HD22 1 1 
        1   943 1 1  57 LEU HD23 H   6.300  -0.535  12.318 1.00 . A A .  57 LEU HD23 1 1 
        1   944 1 1  57 LEU HG   H   4.974  -1.262  14.960 1.00 . A A .  57 LEU HG   1 1 
        1   945 1 1  57 LEU N    N   6.262  -4.966  14.485 1.00 . A A .  57 LEU N    1 1 
        1   946 1 1  57 LEU O    O   5.304  -3.661  11.372 1.00 . A A .  57 LEU O    1 1 
        1   947 1 1  58 ILE C    C   7.067  -5.948  10.019 1.00 . A A .  58 ILE C    1 1 
        1   948 1 1  58 ILE CA   C   7.812  -4.727  10.575 1.00 . A A .  58 ILE CA   1 1 
        1   949 1 1  58 ILE CB   C   9.382  -4.917  10.484 1.00 . A A .  58 ILE CB   1 1 
        1   950 1 1  58 ILE CD1  C  11.637  -3.733  11.007 1.00 . A A .  58 ILE CD1  1 1 
        1   951 1 1  58 ILE CG1  C  10.118  -3.635  11.004 1.00 . A A .  58 ILE CG1  1 1 
        1   952 1 1  58 ILE CG2  C   9.848  -5.248   9.036 1.00 . A A .  58 ILE CG2  1 1 
        1   953 1 1  58 ILE H    H   7.973  -4.639  12.672 1.00 . A A .  58 ILE H    1 1 
        1   954 1 1  58 ILE HA   H   7.547  -3.866   9.958 1.00 . A A .  58 ILE HA   1 1 
        1   955 1 1  58 ILE HB   H   9.650  -5.756  11.121 1.00 . A A .  58 ILE HB   1 1 
        1   956 1 1  58 ILE HD11 H  12.051  -2.814  11.394 1.00 . A A .  58 ILE HD11 1 1 
        1   957 1 1  58 ILE HD12 H  11.994  -3.890  10.000 1.00 . A A .  58 ILE HD12 1 1 
        1   958 1 1  58 ILE HD13 H  11.948  -4.558  11.635 1.00 . A A .  58 ILE HD13 1 1 
        1   959 1 1  58 ILE HG12 H   9.854  -2.790  10.384 1.00 . A A .  58 ILE HG12 1 1 
        1   960 1 1  58 ILE HG13 H   9.804  -3.431  12.022 1.00 . A A .  58 ILE HG13 1 1 
        1   961 1 1  58 ILE HG21 H  10.918  -5.408   9.019 1.00 . A A .  58 ILE HG21 1 1 
        1   962 1 1  58 ILE HG22 H   9.600  -4.429   8.371 1.00 . A A .  58 ILE HG22 1 1 
        1   963 1 1  58 ILE HG23 H   9.352  -6.147   8.689 1.00 . A A .  58 ILE HG23 1 1 
        1   964 1 1  58 ILE N    N   7.367  -4.442  11.940 1.00 . A A .  58 ILE N    1 1 
        1   965 1 1  58 ILE O    O   6.910  -6.042   8.823 1.00 . A A .  58 ILE O    1 1 
        1   966 1 1  59 LYS C    C   4.386  -7.412   9.880 1.00 . A A .  59 LYS C    1 1 
        1   967 1 1  59 LYS CA   C   5.701  -7.977  10.420 1.00 . A A .  59 LYS CA   1 1 
        1   968 1 1  59 LYS CB   C   5.390  -9.024  11.518 1.00 . A A .  59 LYS CB   1 1 
        1   969 1 1  59 LYS CD   C   4.184 -11.251  12.119 1.00 . A A .  59 LYS CD   1 1 
        1   970 1 1  59 LYS CE   C   3.055 -10.837  13.079 1.00 . A A .  59 LYS CE   1 1 
        1   971 1 1  59 LYS CG   C   4.487 -10.193  11.031 1.00 . A A .  59 LYS CG   1 1 
        1   972 1 1  59 LYS H    H   6.838  -6.829  11.837 1.00 . A A .  59 LYS H    1 1 
        1   973 1 1  59 LYS HA   H   6.219  -8.481   9.600 1.00 . A A .  59 LYS HA   1 1 
        1   974 1 1  59 LYS HB2  H   6.327  -9.441  11.877 1.00 . A A .  59 LYS HB2  1 1 
        1   975 1 1  59 LYS HB3  H   4.892  -8.531  12.349 1.00 . A A .  59 LYS HB3  1 1 
        1   976 1 1  59 LYS HD2  H   3.894 -12.175  11.633 1.00 . A A .  59 LYS HD2  1 1 
        1   977 1 1  59 LYS HD3  H   5.086 -11.432  12.696 1.00 . A A .  59 LYS HD3  1 1 
        1   978 1 1  59 LYS HE2  H   2.140 -10.726  12.515 1.00 . A A .  59 LYS HE2  1 1 
        1   979 1 1  59 LYS HE3  H   2.920 -11.626  13.809 1.00 . A A .  59 LYS HE3  1 1 
        1   980 1 1  59 LYS HG2  H   3.548  -9.785  10.673 1.00 . A A .  59 LYS HG2  1 1 
        1   981 1 1  59 LYS HG3  H   4.987 -10.685  10.199 1.00 . A A .  59 LYS HG3  1 1 
        1   982 1 1  59 LYS HZ1  H   3.429  -8.779  13.136 1.00 . A A .  59 LYS HZ1  1 1 
        1   983 1 1  59 LYS HZ2  H   4.172  -9.647  14.384 1.00 . A A .  59 LYS HZ2  1 1 
        1   984 1 1  59 LYS HZ3  H   2.507  -9.348  14.431 1.00 . A A .  59 LYS HZ3  1 1 
        1   985 1 1  59 LYS N    N   6.587  -6.879  10.885 1.00 . A A .  59 LYS N    1 1 
        1   986 1 1  59 LYS NZ   N   3.314  -9.562  13.807 1.00 . A A .  59 LYS NZ   1 1 
        1   987 1 1  59 LYS O    O   3.895  -7.890   8.865 1.00 . A A .  59 LYS O    1 1 
        1   988 1 1  60 TRP C    C   2.885  -5.026   8.752 1.00 . A A .  60 TRP C    1 1 
        1   989 1 1  60 TRP CA   C   2.615  -5.697  10.104 1.00 . A A .  60 TRP CA   1 1 
        1   990 1 1  60 TRP CB   C   2.185  -4.614  11.109 1.00 . A A .  60 TRP CB   1 1 
        1   991 1 1  60 TRP CD1  C   1.619  -6.365  12.926 1.00 . A A .  60 TRP CD1  1 1 
        1   992 1 1  60 TRP CD2  C   1.969  -4.292  13.688 1.00 . A A .  60 TRP CD2  1 1 
        1   993 1 1  60 TRP CE2  C   1.662  -5.121  14.772 1.00 . A A .  60 TRP CE2  1 1 
        1   994 1 1  60 TRP CE3  C   2.229  -2.942  13.920 1.00 . A A .  60 TRP CE3  1 1 
        1   995 1 1  60 TRP CG   C   1.947  -5.101  12.513 1.00 . A A .  60 TRP CG   1 1 
        1   996 1 1  60 TRP CH2  C   1.858  -3.323  16.272 1.00 . A A .  60 TRP CH2  1 1 
        1   997 1 1  60 TRP CZ2  C   1.600  -4.645  16.073 1.00 . A A .  60 TRP CZ2  1 1 
        1   998 1 1  60 TRP CZ3  C   2.172  -2.471  15.210 1.00 . A A .  60 TRP CZ3  1 1 
        1   999 1 1  60 TRP H    H   4.218  -6.158  11.447 1.00 . A A .  60 TRP H    1 1 
        1  1000 1 1  60 TRP HA   H   1.812  -6.423   9.992 1.00 . A A .  60 TRP HA   1 1 
        1  1001 1 1  60 TRP HB2  H   2.953  -3.852  11.157 1.00 . A A .  60 TRP HB2  1 1 
        1  1002 1 1  60 TRP HB3  H   1.264  -4.155  10.760 1.00 . A A .  60 TRP HB3  1 1 
        1  1003 1 1  60 TRP HD1  H   1.515  -7.220  12.267 1.00 . A A .  60 TRP HD1  1 1 
        1  1004 1 1  60 TRP HE1  H   1.227  -7.168  14.816 1.00 . A A .  60 TRP HE1  1 1 
        1  1005 1 1  60 TRP HE3  H   2.466  -2.273  13.105 1.00 . A A .  60 TRP HE3  1 1 
        1  1006 1 1  60 TRP HH2  H   1.825  -2.909  17.273 1.00 . A A .  60 TRP HH2  1 1 
        1  1007 1 1  60 TRP HZ2  H   1.362  -5.291  16.910 1.00 . A A .  60 TRP HZ2  1 1 
        1  1008 1 1  60 TRP HZ3  H   2.371  -1.425  15.413 1.00 . A A .  60 TRP HZ3  1 1 
        1  1009 1 1  60 TRP N    N   3.822  -6.411  10.579 1.00 . A A .  60 TRP N    1 1 
        1  1010 1 1  60 TRP NE1  N   1.457  -6.381  14.281 1.00 . A A .  60 TRP NE1  1 1 
        1  1011 1 1  60 TRP O    O   2.110  -5.172   7.792 1.00 . A A .  60 TRP O    1 1 
        1  1012 1 1  61 PHE C    C   4.791  -4.555   6.359 1.00 . A A .  61 PHE C    1 1 
        1  1013 1 1  61 PHE CA   C   4.467  -3.580   7.505 1.00 . A A .  61 PHE CA   1 1 
        1  1014 1 1  61 PHE CB   C   5.682  -2.666   7.844 1.00 . A A .  61 PHE CB   1 1 
        1  1015 1 1  61 PHE CD1  C   4.142  -1.174   9.257 1.00 . A A .  61 PHE CD1  1 1 
        1  1016 1 1  61 PHE CD2  C   6.110  -0.194   8.315 1.00 . A A .  61 PHE CD2  1 1 
        1  1017 1 1  61 PHE CE1  C   3.805   0.045   9.811 1.00 . A A .  61 PHE CE1  1 1 
        1  1018 1 1  61 PHE CE2  C   5.768   1.025   8.876 1.00 . A A .  61 PHE CE2  1 1 
        1  1019 1 1  61 PHE CG   C   5.305  -1.320   8.492 1.00 . A A .  61 PHE CG   1 1 
        1  1020 1 1  61 PHE CZ   C   4.618   1.142   9.622 1.00 . A A .  61 PHE CZ   1 1 
        1  1021 1 1  61 PHE H    H   4.528  -4.204   9.539 1.00 . A A .  61 PHE H    1 1 
        1  1022 1 1  61 PHE HA   H   3.648  -2.946   7.177 1.00 . A A .  61 PHE HA   1 1 
        1  1023 1 1  61 PHE HB2  H   6.339  -3.191   8.530 1.00 . A A .  61 PHE HB2  1 1 
        1  1024 1 1  61 PHE HB3  H   6.233  -2.453   6.933 1.00 . A A .  61 PHE HB3  1 1 
        1  1025 1 1  61 PHE HD1  H   3.495  -2.029   9.418 1.00 . A A .  61 PHE HD1  1 1 
        1  1026 1 1  61 PHE HD2  H   7.014  -0.276   7.728 1.00 . A A .  61 PHE HD2  1 1 
        1  1027 1 1  61 PHE HE1  H   2.898   0.137  10.400 1.00 . A A .  61 PHE HE1  1 1 
        1  1028 1 1  61 PHE HE2  H   6.406   1.885   8.724 1.00 . A A .  61 PHE HE2  1 1 
        1  1029 1 1  61 PHE HZ   H   4.348   2.096  10.059 1.00 . A A .  61 PHE HZ   1 1 
        1  1030 1 1  61 PHE N    N   4.004  -4.287   8.711 1.00 . A A .  61 PHE N    1 1 
        1  1031 1 1  61 PHE O    O   4.525  -4.239   5.210 1.00 . A A .  61 PHE O    1 1 
        1  1032 1 1  62 SER C    C   4.426  -7.607   5.323 1.00 . A A .  62 SER C    1 1 
        1  1033 1 1  62 SER CA   C   5.656  -6.780   5.689 1.00 . A A .  62 SER CA   1 1 
        1  1034 1 1  62 SER CB   C   6.798  -7.707   6.185 1.00 . A A .  62 SER CB   1 1 
        1  1035 1 1  62 SER H    H   5.365  -5.981   7.638 1.00 . A A .  62 SER H    1 1 
        1  1036 1 1  62 SER HA   H   6.000  -6.265   4.792 1.00 . A A .  62 SER HA   1 1 
        1  1037 1 1  62 SER HB2  H   6.510  -8.176   7.117 1.00 . A A .  62 SER HB2  1 1 
        1  1038 1 1  62 SER HB3  H   6.998  -8.475   5.444 1.00 . A A .  62 SER HB3  1 1 
        1  1039 1 1  62 SER HG   H   7.808  -6.211   6.956 1.00 . A A .  62 SER HG   1 1 
        1  1040 1 1  62 SER N    N   5.296  -5.753   6.692 1.00 . A A .  62 SER N    1 1 
        1  1041 1 1  62 SER O    O   4.391  -8.196   4.268 1.00 . A A .  62 SER O    1 1 
        1  1042 1 1  62 SER OG   O   7.996  -6.979   6.409 1.00 . A A .  62 SER OG   1 1 
        1  1043 1 1  63 ASN C    C   1.402  -7.526   4.851 1.00 . A A .  63 ASN C    1 1 
        1  1044 1 1  63 ASN CA   C   2.144  -8.331   5.914 1.00 . A A .  63 ASN CA   1 1 
        1  1045 1 1  63 ASN CB   C   1.270  -8.510   7.187 1.00 . A A .  63 ASN CB   1 1 
        1  1046 1 1  63 ASN CG   C  -0.041  -9.258   6.906 1.00 . A A .  63 ASN CG   1 1 
        1  1047 1 1  63 ASN H    H   3.509  -7.171   7.050 1.00 . A A .  63 ASN H    1 1 
        1  1048 1 1  63 ASN HA   H   2.383  -9.316   5.506 1.00 . A A .  63 ASN HA   1 1 
        1  1049 1 1  63 ASN HB2  H   1.833  -9.077   7.921 1.00 . A A .  63 ASN HB2  1 1 
        1  1050 1 1  63 ASN HB3  H   1.035  -7.538   7.609 1.00 . A A .  63 ASN HB3  1 1 
        1  1051 1 1  63 ASN HD21 H  -0.992  -7.551   6.519 1.00 . A A .  63 ASN HD21 1 1 
        1  1052 1 1  63 ASN HD22 H  -1.938  -8.990   6.382 1.00 . A A .  63 ASN HD22 1 1 
        1  1053 1 1  63 ASN N    N   3.413  -7.642   6.204 1.00 . A A .  63 ASN N    1 1 
        1  1054 1 1  63 ASN ND2  N  -1.097  -8.527   6.571 1.00 . A A .  63 ASN ND2  1 1 
        1  1055 1 1  63 ASN O    O   1.040  -8.061   3.806 1.00 . A A .  63 ASN O    1 1 
        1  1056 1 1  63 ASN OD1  O  -0.095 -10.487   6.977 1.00 . A A .  63 ASN OD1  1 1 
        1  1057 1 1  64 PHE C    C   1.448  -5.180   2.876 1.00 . A A .  64 PHE C    1 1 
        1  1058 1 1  64 PHE CA   C   0.589  -5.314   4.146 1.00 . A A .  64 PHE CA   1 1 
        1  1059 1 1  64 PHE CB   C   0.299  -3.914   4.753 1.00 . A A .  64 PHE CB   1 1 
        1  1060 1 1  64 PHE CD1  C  -1.861  -3.205   3.598 1.00 . A A .  64 PHE CD1  1 1 
        1  1061 1 1  64 PHE CD2  C   0.124  -1.984   3.067 1.00 . A A .  64 PHE CD2  1 1 
        1  1062 1 1  64 PHE CE1  C  -2.576  -2.420   2.717 1.00 . A A .  64 PHE CE1  1 1 
        1  1063 1 1  64 PHE CE2  C  -0.593  -1.193   2.190 1.00 . A A .  64 PHE CE2  1 1 
        1  1064 1 1  64 PHE CG   C  -0.498  -3.002   3.796 1.00 . A A .  64 PHE CG   1 1 
        1  1065 1 1  64 PHE CZ   C  -1.942  -1.416   2.009 1.00 . A A .  64 PHE CZ   1 1 
        1  1066 1 1  64 PHE H    H   1.583  -5.850   5.950 1.00 . A A .  64 PHE H    1 1 
        1  1067 1 1  64 PHE HA   H  -0.359  -5.772   3.872 1.00 . A A .  64 PHE HA   1 1 
        1  1068 1 1  64 PHE HB2  H  -0.276  -4.035   5.668 1.00 . A A .  64 PHE HB2  1 1 
        1  1069 1 1  64 PHE HB3  H   1.238  -3.427   4.999 1.00 . A A .  64 PHE HB3  1 1 
        1  1070 1 1  64 PHE HD1  H  -2.368  -3.988   4.153 1.00 . A A .  64 PHE HD1  1 1 
        1  1071 1 1  64 PHE HD2  H   1.186  -1.810   3.202 1.00 . A A .  64 PHE HD2  1 1 
        1  1072 1 1  64 PHE HE1  H  -3.635  -2.594   2.580 1.00 . A A .  64 PHE HE1  1 1 
        1  1073 1 1  64 PHE HE2  H  -0.094  -0.409   1.637 1.00 . A A .  64 PHE HE2  1 1 
        1  1074 1 1  64 PHE HZ   H  -2.507  -0.802   1.320 1.00 . A A .  64 PHE HZ   1 1 
        1  1075 1 1  64 PHE N    N   1.239  -6.215   5.107 1.00 . A A .  64 PHE N    1 1 
        1  1076 1 1  64 PHE O    O   0.902  -5.158   1.777 1.00 . A A .  64 PHE O    1 1 
        1  1077 1 1  65 ARG C    C   3.595  -6.176   0.962 1.00 . A A .  65 ARG C    1 1 
        1  1078 1 1  65 ARG CA   C   3.714  -4.967   1.895 1.00 . A A .  65 ARG CA   1 1 
        1  1079 1 1  65 ARG CB   C   5.189  -4.784   2.342 1.00 . A A .  65 ARG CB   1 1 
        1  1080 1 1  65 ARG CD   C   5.986  -3.350   0.315 1.00 . A A .  65 ARG CD   1 1 
        1  1081 1 1  65 ARG CG   C   6.234  -4.598   1.200 1.00 . A A .  65 ARG CG   1 1 
        1  1082 1 1  65 ARG CZ   C   3.978  -2.583  -0.996 1.00 . A A .  65 ARG CZ   1 1 
        1  1083 1 1  65 ARG H    H   3.155  -5.129   3.952 1.00 . A A .  65 ARG H    1 1 
        1  1084 1 1  65 ARG HA   H   3.411  -4.077   1.348 1.00 . A A .  65 ARG HA   1 1 
        1  1085 1 1  65 ARG HB2  H   5.244  -3.917   2.988 1.00 . A A .  65 ARG HB2  1 1 
        1  1086 1 1  65 ARG HB3  H   5.480  -5.655   2.922 1.00 . A A .  65 ARG HB3  1 1 
        1  1087 1 1  65 ARG HD2  H   5.798  -2.497   0.958 1.00 . A A .  65 ARG HD2  1 1 
        1  1088 1 1  65 ARG HD3  H   6.880  -3.162  -0.269 1.00 . A A .  65 ARG HD3  1 1 
        1  1089 1 1  65 ARG HE   H   4.731  -4.439  -0.981 1.00 . A A .  65 ARG HE   1 1 
        1  1090 1 1  65 ARG HG2  H   7.217  -4.509   1.650 1.00 . A A .  65 ARG HG2  1 1 
        1  1091 1 1  65 ARG HG3  H   6.220  -5.481   0.571 1.00 . A A .  65 ARG HG3  1 1 
        1  1092 1 1  65 ARG HH11 H   4.813  -1.096   0.105 1.00 . A A .  65 ARG HH11 1 1 
        1  1093 1 1  65 ARG HH12 H   3.426  -0.641  -0.822 1.00 . A A .  65 ARG HH12 1 1 
        1  1094 1 1  65 ARG HH21 H   2.934  -3.826  -2.193 1.00 . A A .  65 ARG HH21 1 1 
        1  1095 1 1  65 ARG HH22 H   2.355  -2.196  -2.131 1.00 . A A .  65 ARG HH22 1 1 
        1  1096 1 1  65 ARG N    N   2.791  -5.097   3.042 1.00 . A A .  65 ARG N    1 1 
        1  1097 1 1  65 ARG NE   N   4.851  -3.533  -0.619 1.00 . A A .  65 ARG NE   1 1 
        1  1098 1 1  65 ARG NH1  N   4.080  -1.338  -0.534 1.00 . A A .  65 ARG NH1  1 1 
        1  1099 1 1  65 ARG NH2  N   3.013  -2.893  -1.843 1.00 . A A .  65 ARG NH2  1 1 
        1  1100 1 1  65 ARG O    O   3.310  -5.998  -0.219 1.00 . A A .  65 ARG O    1 1 
        1  1101 1 1  66 GLU C    C   2.398  -8.889   0.121 1.00 . A A .  66 GLU C    1 1 
        1  1102 1 1  66 GLU CA   C   3.779  -8.641   0.738 1.00 . A A .  66 GLU CA   1 1 
        1  1103 1 1  66 GLU CB   C   4.207  -9.853   1.614 1.00 . A A .  66 GLU CB   1 1 
        1  1104 1 1  66 GLU CD   C   6.091 -11.021   2.936 1.00 . A A .  66 GLU CD   1 1 
        1  1105 1 1  66 GLU CG   C   5.685  -9.817   2.064 1.00 . A A .  66 GLU CG   1 1 
        1  1106 1 1  66 GLU H    H   3.950  -7.432   2.478 1.00 . A A .  66 GLU H    1 1 
        1  1107 1 1  66 GLU HA   H   4.499  -8.531  -0.070 1.00 . A A .  66 GLU HA   1 1 
        1  1108 1 1  66 GLU HB2  H   3.579  -9.878   2.502 1.00 . A A .  66 GLU HB2  1 1 
        1  1109 1 1  66 GLU HB3  H   4.047 -10.770   1.054 1.00 . A A .  66 GLU HB3  1 1 
        1  1110 1 1  66 GLU HG2  H   6.318  -9.793   1.182 1.00 . A A .  66 GLU HG2  1 1 
        1  1111 1 1  66 GLU HG3  H   5.851  -8.901   2.629 1.00 . A A .  66 GLU HG3  1 1 
        1  1112 1 1  66 GLU N    N   3.799  -7.384   1.514 1.00 . A A .  66 GLU N    1 1 
        1  1113 1 1  66 GLU O    O   2.310  -9.186  -1.056 1.00 . A A .  66 GLU O    1 1 
        1  1114 1 1  66 GLU OE1  O   6.357 -12.109   2.375 1.00 . A A .  66 GLU OE1  1 1 
        1  1115 1 1  66 GLU OE2  O   6.129 -10.901   4.182 1.00 . A A .  66 GLU OE2  1 1 
        1  1116 1 1  67 PHE C    C  -0.472  -8.022  -0.664 1.00 . A A .  67 PHE C    1 1 
        1  1117 1 1  67 PHE CA   C  -0.059  -9.001   0.453 1.00 . A A .  67 PHE CA   1 1 
        1  1118 1 1  67 PHE CB   C  -1.073  -8.958   1.636 1.00 . A A .  67 PHE CB   1 1 
        1  1119 1 1  67 PHE CD1  C   0.144 -10.840   2.899 1.00 . A A .  67 PHE CD1  1 1 
        1  1120 1 1  67 PHE CD2  C  -2.232 -10.684   3.126 1.00 . A A .  67 PHE CD2  1 1 
        1  1121 1 1  67 PHE CE1  C   0.154 -11.936   3.742 1.00 . A A .  67 PHE CE1  1 1 
        1  1122 1 1  67 PHE CE2  C  -2.219 -11.781   3.970 1.00 . A A .  67 PHE CE2  1 1 
        1  1123 1 1  67 PHE CG   C  -1.050 -10.187   2.573 1.00 . A A .  67 PHE CG   1 1 
        1  1124 1 1  67 PHE CZ   C  -1.028 -12.407   4.275 1.00 . A A .  67 PHE CZ   1 1 
        1  1125 1 1  67 PHE H    H   1.465  -8.432   1.847 1.00 . A A .  67 PHE H    1 1 
        1  1126 1 1  67 PHE HA   H  -0.067 -10.006   0.037 1.00 . A A .  67 PHE HA   1 1 
        1  1127 1 1  67 PHE HB2  H  -0.866  -8.083   2.241 1.00 . A A .  67 PHE HB2  1 1 
        1  1128 1 1  67 PHE HB3  H  -2.080  -8.865   1.234 1.00 . A A .  67 PHE HB3  1 1 
        1  1129 1 1  67 PHE HD1  H   1.081 -10.474   2.486 1.00 . A A .  67 PHE HD1  1 1 
        1  1130 1 1  67 PHE HD2  H  -3.172 -10.204   2.889 1.00 . A A .  67 PHE HD2  1 1 
        1  1131 1 1  67 PHE HE1  H   1.092 -12.423   3.982 1.00 . A A .  67 PHE HE1  1 1 
        1  1132 1 1  67 PHE HE2  H  -3.146 -12.152   4.383 1.00 . A A .  67 PHE HE2  1 1 
        1  1133 1 1  67 PHE HZ   H  -1.020 -13.266   4.936 1.00 . A A .  67 PHE HZ   1 1 
        1  1134 1 1  67 PHE N    N   1.325  -8.737   0.921 1.00 . A A .  67 PHE N    1 1 
        1  1135 1 1  67 PHE O    O  -0.997  -8.457  -1.685 1.00 . A A .  67 PHE O    1 1 
        1  1136 1 1  68 TYR C    C   0.286  -5.777  -2.715 1.00 . A A .  68 TYR C    1 1 
        1  1137 1 1  68 TYR CA   C  -0.565  -5.647  -1.437 1.00 . A A .  68 TYR CA   1 1 
        1  1138 1 1  68 TYR CB   C  -0.395  -4.241  -0.803 1.00 . A A .  68 TYR CB   1 1 
        1  1139 1 1  68 TYR CD1  C  -2.338  -2.823  -1.649 1.00 . A A .  68 TYR CD1  1 1 
        1  1140 1 1  68 TYR CD2  C  -0.144  -2.264  -2.419 1.00 . A A .  68 TYR CD2  1 1 
        1  1141 1 1  68 TYR CE1  C  -2.859  -1.786  -2.390 1.00 . A A .  68 TYR CE1  1 1 
        1  1142 1 1  68 TYR CE2  C  -0.662  -1.229  -3.164 1.00 . A A .  68 TYR CE2  1 1 
        1  1143 1 1  68 TYR CG   C  -0.967  -3.087  -1.643 1.00 . A A .  68 TYR CG   1 1 
        1  1144 1 1  68 TYR CZ   C  -2.018  -0.992  -3.146 1.00 . A A .  68 TYR CZ   1 1 
        1  1145 1 1  68 TYR H    H   0.151  -6.452   0.417 1.00 . A A .  68 TYR H    1 1 
        1  1146 1 1  68 TYR HA   H  -1.610  -5.775  -1.709 1.00 . A A .  68 TYR HA   1 1 
        1  1147 1 1  68 TYR HB2  H  -0.899  -4.230   0.159 1.00 . A A .  68 TYR HB2  1 1 
        1  1148 1 1  68 TYR HB3  H   0.661  -4.051  -0.634 1.00 . A A .  68 TYR HB3  1 1 
        1  1149 1 1  68 TYR HD1  H  -3.000  -3.445  -1.056 1.00 . A A .  68 TYR HD1  1 1 
        1  1150 1 1  68 TYR HD2  H   0.922  -2.452  -2.436 1.00 . A A .  68 TYR HD2  1 1 
        1  1151 1 1  68 TYR HE1  H  -3.924  -1.599  -2.380 1.00 . A A .  68 TYR HE1  1 1 
        1  1152 1 1  68 TYR HE2  H  -0.004  -0.608  -3.757 1.00 . A A .  68 TYR HE2  1 1 
        1  1153 1 1  68 TYR HH   H  -3.146   0.558  -3.333 1.00 . A A .  68 TYR HH   1 1 
        1  1154 1 1  68 TYR N    N  -0.232  -6.711  -0.448 1.00 . A A .  68 TYR N    1 1 
        1  1155 1 1  68 TYR O    O  -0.212  -5.552  -3.833 1.00 . A A .  68 TYR O    1 1 
        1  1156 1 1  68 TYR OH   O  -2.537   0.054  -3.880 1.00 . A A .  68 TYR OH   1 1 
        1  1157 1 1  69 TYR C    C   1.981  -7.535  -4.495 1.00 . A A .  69 TYR C    1 1 
        1  1158 1 1  69 TYR CA   C   2.510  -6.391  -3.626 1.00 . A A .  69 TYR CA   1 1 
        1  1159 1 1  69 TYR CB   C   3.915  -6.736  -3.059 1.00 . A A .  69 TYR CB   1 1 
        1  1160 1 1  69 TYR CD1  C   5.694  -6.114  -4.792 1.00 . A A .  69 TYR CD1  1 1 
        1  1161 1 1  69 TYR CD2  C   5.252  -8.438  -4.432 1.00 . A A .  69 TYR CD2  1 1 
        1  1162 1 1  69 TYR CE1  C   6.640  -6.443  -5.739 1.00 . A A .  69 TYR CE1  1 1 
        1  1163 1 1  69 TYR CE2  C   6.195  -8.767  -5.377 1.00 . A A .  69 TYR CE2  1 1 
        1  1164 1 1  69 TYR CG   C   4.978  -7.103  -4.115 1.00 . A A .  69 TYR CG   1 1 
        1  1165 1 1  69 TYR CZ   C   6.884  -7.769  -6.024 1.00 . A A .  69 TYR CZ   1 1 
        1  1166 1 1  69 TYR H    H   1.883  -6.249  -1.603 1.00 . A A .  69 TYR H    1 1 
        1  1167 1 1  69 TYR HA   H   2.581  -5.487  -4.224 1.00 . A A .  69 TYR HA   1 1 
        1  1168 1 1  69 TYR HB2  H   4.280  -5.881  -2.496 1.00 . A A .  69 TYR HB2  1 1 
        1  1169 1 1  69 TYR HB3  H   3.814  -7.573  -2.374 1.00 . A A .  69 TYR HB3  1 1 
        1  1170 1 1  69 TYR HD1  H   5.499  -5.068  -4.565 1.00 . A A .  69 TYR HD1  1 1 
        1  1171 1 1  69 TYR HD2  H   4.704  -9.223  -3.920 1.00 . A A .  69 TYR HD2  1 1 
        1  1172 1 1  69 TYR HE1  H   7.186  -5.660  -6.247 1.00 . A A .  69 TYR HE1  1 1 
        1  1173 1 1  69 TYR HE2  H   6.389  -9.804  -5.606 1.00 . A A .  69 TYR HE2  1 1 
        1  1174 1 1  69 TYR HH   H   7.463  -8.743  -7.562 1.00 . A A .  69 TYR HH   1 1 
        1  1175 1 1  69 TYR N    N   1.566  -6.137  -2.524 1.00 . A A .  69 TYR N    1 1 
        1  1176 1 1  69 TYR O    O   1.742  -7.342  -5.671 1.00 . A A .  69 TYR O    1 1 
        1  1177 1 1  69 TYR OH   O   7.829  -8.099  -6.953 1.00 . A A .  69 TYR OH   1 1 
        1  1178 1 1  70 ILE C    C  -0.149  -9.677  -5.115 1.00 . A A .  70 ILE C    1 1 
        1  1179 1 1  70 ILE CA   C   1.255  -9.925  -4.522 1.00 . A A .  70 ILE CA   1 1 
        1  1180 1 1  70 ILE CB   C   1.233 -11.150  -3.509 1.00 . A A .  70 ILE CB   1 1 
        1  1181 1 1  70 ILE CD1  C   3.622 -11.971  -4.183 1.00 . A A .  70 ILE CD1  1 1 
        1  1182 1 1  70 ILE CG1  C   2.685 -11.530  -3.062 1.00 . A A .  70 ILE CG1  1 1 
        1  1183 1 1  70 ILE CG2  C   0.490 -12.396  -4.069 1.00 . A A .  70 ILE CG2  1 1 
        1  1184 1 1  70 ILE H    H   2.015  -8.757  -2.922 1.00 . A A .  70 ILE H    1 1 
        1  1185 1 1  70 ILE HA   H   1.930 -10.177  -5.338 1.00 . A A .  70 ILE HA   1 1 
        1  1186 1 1  70 ILE HB   H   0.685 -10.824  -2.626 1.00 . A A .  70 ILE HB   1 1 
        1  1187 1 1  70 ILE HD11 H   4.585 -12.230  -3.764 1.00 . A A .  70 ILE HD11 1 1 
        1  1188 1 1  70 ILE HD12 H   3.747 -11.167  -4.894 1.00 . A A .  70 ILE HD12 1 1 
        1  1189 1 1  70 ILE HD13 H   3.211 -12.836  -4.687 1.00 . A A .  70 ILE HD13 1 1 
        1  1190 1 1  70 ILE HG12 H   3.140 -10.673  -2.585 1.00 . A A .  70 ILE HG12 1 1 
        1  1191 1 1  70 ILE HG13 H   2.632 -12.337  -2.339 1.00 . A A .  70 ILE HG13 1 1 
        1  1192 1 1  70 ILE HG21 H   0.976 -12.737  -4.976 1.00 . A A .  70 ILE HG21 1 1 
        1  1193 1 1  70 ILE HG22 H  -0.537 -12.140  -4.295 1.00 . A A .  70 ILE HG22 1 1 
        1  1194 1 1  70 ILE HG23 H   0.499 -13.192  -3.335 1.00 . A A .  70 ILE HG23 1 1 
        1  1195 1 1  70 ILE N    N   1.783  -8.708  -3.867 1.00 . A A .  70 ILE N    1 1 
        1  1196 1 1  70 ILE O    O  -0.491 -10.270  -6.129 1.00 . A A .  70 ILE O    1 1 
        1  1197 1 1  71 GLN C    C  -2.254  -7.737  -6.303 1.00 . A A .  71 GLN C    1 1 
        1  1198 1 1  71 GLN CA   C  -2.297  -8.433  -4.930 1.00 . A A .  71 GLN CA   1 1 
        1  1199 1 1  71 GLN CB   C  -2.968  -7.486  -3.892 1.00 . A A .  71 GLN CB   1 1 
        1  1200 1 1  71 GLN CD   C  -5.206  -8.628  -3.452 1.00 . A A .  71 GLN CD   1 1 
        1  1201 1 1  71 GLN CG   C  -4.498  -7.384  -3.990 1.00 . A A .  71 GLN CG   1 1 
        1  1202 1 1  71 GLN H    H  -0.575  -8.343  -3.676 1.00 . A A .  71 GLN H    1 1 
        1  1203 1 1  71 GLN HA   H  -2.876  -9.345  -5.007 1.00 . A A .  71 GLN HA   1 1 
        1  1204 1 1  71 GLN HB2  H  -2.716  -7.831  -2.893 1.00 . A A .  71 GLN HB2  1 1 
        1  1205 1 1  71 GLN HB3  H  -2.553  -6.486  -4.010 1.00 . A A .  71 GLN HB3  1 1 
        1  1206 1 1  71 GLN HE21 H  -5.133  -7.872  -1.622 1.00 . A A .  71 GLN HE21 1 1 
        1  1207 1 1  71 GLN HE22 H  -5.842  -9.435  -1.761 1.00 . A A .  71 GLN HE22 1 1 
        1  1208 1 1  71 GLN HG2  H  -4.833  -6.520  -3.428 1.00 . A A .  71 GLN HG2  1 1 
        1  1209 1 1  71 GLN HG3  H  -4.770  -7.251  -5.031 1.00 . A A .  71 GLN HG3  1 1 
        1  1210 1 1  71 GLN N    N  -0.931  -8.783  -4.479 1.00 . A A .  71 GLN N    1 1 
        1  1211 1 1  71 GLN NE2  N  -5.426  -8.648  -2.149 1.00 . A A .  71 GLN NE2  1 1 
        1  1212 1 1  71 GLN O    O  -2.864  -8.197  -7.273 1.00 . A A .  71 GLN O    1 1 
        1  1213 1 1  71 GLN OE1  O  -5.522  -9.567  -4.188 1.00 . A A .  71 GLN OE1  1 1 
        1  1214 1 1  72 MET C    C  -0.562  -6.518  -8.666 1.00 . A A .  72 MET C    1 1 
        1  1215 1 1  72 MET CA   C  -1.356  -5.804  -7.573 1.00 . A A .  72 MET CA   1 1 
        1  1216 1 1  72 MET CB   C  -0.689  -4.464  -7.219 1.00 . A A .  72 MET CB   1 1 
        1  1217 1 1  72 MET CE   C  -3.991  -2.477  -5.754 1.00 . A A .  72 MET CE   1 1 
        1  1218 1 1  72 MET CG   C  -1.542  -3.579  -6.329 1.00 . A A .  72 MET CG   1 1 
        1  1219 1 1  72 MET H    H  -1.001  -6.373  -5.546 1.00 . A A .  72 MET H    1 1 
        1  1220 1 1  72 MET HA   H  -2.358  -5.606  -7.951 1.00 . A A .  72 MET HA   1 1 
        1  1221 1 1  72 MET HB2  H   0.248  -4.660  -6.708 1.00 . A A .  72 MET HB2  1 1 
        1  1222 1 1  72 MET HB3  H  -0.478  -3.916  -8.133 1.00 . A A .  72 MET HB3  1 1 
        1  1223 1 1  72 MET HE1  H  -4.089  -3.219  -4.973 1.00 . A A .  72 MET HE1  1 1 
        1  1224 1 1  72 MET HE2  H  -4.965  -2.173  -6.085 1.00 . A A .  72 MET HE2  1 1 
        1  1225 1 1  72 MET HE3  H  -3.454  -1.619  -5.376 1.00 . A A .  72 MET HE3  1 1 
        1  1226 1 1  72 MET HG2  H  -1.740  -4.095  -5.395 1.00 . A A .  72 MET HG2  1 1 
        1  1227 1 1  72 MET HG3  H  -1.009  -2.658  -6.126 1.00 . A A .  72 MET HG3  1 1 
        1  1228 1 1  72 MET N    N  -1.487  -6.639  -6.361 1.00 . A A .  72 MET N    1 1 
        1  1229 1 1  72 MET O    O  -0.871  -6.377  -9.851 1.00 . A A .  72 MET O    1 1 
        1  1230 1 1  72 MET SD   S  -3.105  -3.178  -7.127 1.00 . A A .  72 MET SD   1 1 
        1  1231 1 1  73 GLU C    C   0.387  -9.163  -9.766 1.00 . A A .  73 GLU C    1 1 
        1  1232 1 1  73 GLU CA   C   1.292  -8.105  -9.109 1.00 . A A .  73 GLU CA   1 1 
        1  1233 1 1  73 GLU CB   C   2.452  -8.740  -8.270 1.00 . A A .  73 GLU CB   1 1 
        1  1234 1 1  73 GLU CD   C   3.113 -10.965  -9.429 1.00 . A A .  73 GLU CD   1 1 
        1  1235 1 1  73 GLU CG   C   3.534  -9.535  -9.042 1.00 . A A .  73 GLU CG   1 1 
        1  1236 1 1  73 GLU H    H   0.732  -7.169  -7.306 1.00 . A A .  73 GLU H    1 1 
        1  1237 1 1  73 GLU HA   H   1.724  -7.476  -9.885 1.00 . A A .  73 GLU HA   1 1 
        1  1238 1 1  73 GLU HB2  H   2.957  -7.939  -7.740 1.00 . A A .  73 GLU HB2  1 1 
        1  1239 1 1  73 GLU HB3  H   2.013  -9.401  -7.527 1.00 . A A .  73 GLU HB3  1 1 
        1  1240 1 1  73 GLU HG2  H   3.788  -8.983  -9.939 1.00 . A A .  73 GLU HG2  1 1 
        1  1241 1 1  73 GLU HG3  H   4.422  -9.600  -8.417 1.00 . A A .  73 GLU HG3  1 1 
        1  1242 1 1  73 GLU N    N   0.480  -7.242  -8.239 1.00 . A A .  73 GLU N    1 1 
        1  1243 1 1  73 GLU O    O   0.482  -9.388 -10.969 1.00 . A A .  73 GLU O    1 1 
        1  1244 1 1  73 GLU OE1  O   2.634 -11.702  -8.547 1.00 . A A .  73 GLU OE1  1 1 
        1  1245 1 1  73 GLU OE2  O   3.291 -11.366 -10.596 1.00 . A A .  73 GLU OE2  1 1 
        1  1246 1 1  74 LYS C    C  -2.433 -10.159 -10.487 1.00 . A A .  74 LYS C    1 1 
        1  1247 1 1  74 LYS CA   C  -1.498 -10.772  -9.445 1.00 . A A .  74 LYS CA   1 1 
        1  1248 1 1  74 LYS CB   C  -2.349 -11.337  -8.265 1.00 . A A .  74 LYS CB   1 1 
        1  1249 1 1  74 LYS CD   C  -4.267 -12.873  -7.462 1.00 . A A .  74 LYS CD   1 1 
        1  1250 1 1  74 LYS CE   C  -3.395 -13.629  -6.443 1.00 . A A .  74 LYS CE   1 1 
        1  1251 1 1  74 LYS CG   C  -3.456 -12.337  -8.669 1.00 . A A .  74 LYS CG   1 1 
        1  1252 1 1  74 LYS H    H  -0.541  -9.534  -8.007 1.00 . A A .  74 LYS H    1 1 
        1  1253 1 1  74 LYS HA   H  -0.942 -11.584  -9.900 1.00 . A A .  74 LYS HA   1 1 
        1  1254 1 1  74 LYS HB2  H  -1.679 -11.835  -7.572 1.00 . A A .  74 LYS HB2  1 1 
        1  1255 1 1  74 LYS HB3  H  -2.816 -10.506  -7.743 1.00 . A A .  74 LYS HB3  1 1 
        1  1256 1 1  74 LYS HD2  H  -4.750 -12.042  -6.959 1.00 . A A .  74 LYS HD2  1 1 
        1  1257 1 1  74 LYS HD3  H  -5.032 -13.548  -7.833 1.00 . A A .  74 LYS HD3  1 1 
        1  1258 1 1  74 LYS HE2  H  -2.818 -14.384  -6.965 1.00 . A A .  74 LYS HE2  1 1 
        1  1259 1 1  74 LYS HE3  H  -2.717 -12.932  -5.964 1.00 . A A .  74 LYS HE3  1 1 
        1  1260 1 1  74 LYS HG2  H  -4.139 -11.839  -9.348 1.00 . A A .  74 LYS HG2  1 1 
        1  1261 1 1  74 LYS HG3  H  -2.999 -13.175  -9.185 1.00 . A A .  74 LYS HG3  1 1 
        1  1262 1 1  74 LYS HZ1  H  -4.814 -15.027  -5.834 1.00 . A A .  74 LYS HZ1  1 1 
        1  1263 1 1  74 LYS HZ2  H  -4.821 -13.614  -4.912 1.00 . A A .  74 LYS HZ2  1 1 
        1  1264 1 1  74 LYS HZ3  H  -3.598 -14.757  -4.696 1.00 . A A .  74 LYS HZ3  1 1 
        1  1265 1 1  74 LYS N    N  -0.518  -9.772  -8.960 1.00 . A A .  74 LYS N    1 1 
        1  1266 1 1  74 LYS NZ   N  -4.213 -14.300  -5.398 1.00 . A A .  74 LYS NZ   1 1 
        1  1267 1 1  74 LYS O    O  -2.613 -10.722 -11.561 1.00 . A A .  74 LYS O    1 1 
        1  1268 1 1  75 TYR C    C  -3.416  -7.907 -12.338 1.00 . A A .  75 TYR C    1 1 
        1  1269 1 1  75 TYR CA   C  -4.012  -8.313 -10.976 1.00 . A A .  75 TYR CA   1 1 
        1  1270 1 1  75 TYR CB   C  -4.563  -7.070 -10.228 1.00 . A A .  75 TYR CB   1 1 
        1  1271 1 1  75 TYR CD1  C  -5.915  -8.636  -8.675 1.00 . A A .  75 TYR CD1  1 1 
        1  1272 1 1  75 TYR CD2  C  -5.767  -6.321  -8.098 1.00 . A A .  75 TYR CD2  1 1 
        1  1273 1 1  75 TYR CE1  C  -6.696  -8.863  -7.558 1.00 . A A .  75 TYR CE1  1 1 
        1  1274 1 1  75 TYR CE2  C  -6.550  -6.553  -6.980 1.00 . A A .  75 TYR CE2  1 1 
        1  1275 1 1  75 TYR CG   C  -5.427  -7.354  -8.975 1.00 . A A .  75 TYR CG   1 1 
        1  1276 1 1  75 TYR CZ   C  -7.009  -7.822  -6.718 1.00 . A A .  75 TYR CZ   1 1 
        1  1277 1 1  75 TYR H    H  -2.762  -8.596  -9.281 1.00 . A A .  75 TYR H    1 1 
        1  1278 1 1  75 TYR HA   H  -4.835  -9.001 -11.149 1.00 . A A .  75 TYR HA   1 1 
        1  1279 1 1  75 TYR HB2  H  -3.725  -6.457  -9.915 1.00 . A A .  75 TYR HB2  1 1 
        1  1280 1 1  75 TYR HB3  H  -5.171  -6.490 -10.913 1.00 . A A .  75 TYR HB3  1 1 
        1  1281 1 1  75 TYR HD1  H  -5.674  -9.464  -9.330 1.00 . A A .  75 TYR HD1  1 1 
        1  1282 1 1  75 TYR HD2  H  -5.407  -5.318  -8.298 1.00 . A A .  75 TYR HD2  1 1 
        1  1283 1 1  75 TYR HE1  H  -7.059  -9.861  -7.350 1.00 . A A .  75 TYR HE1  1 1 
        1  1284 1 1  75 TYR HE2  H  -6.799  -5.734  -6.320 1.00 . A A .  75 TYR HE2  1 1 
        1  1285 1 1  75 TYR HH   H  -7.411  -8.799  -5.114 1.00 . A A .  75 TYR HH   1 1 
        1  1286 1 1  75 TYR N    N  -3.017  -9.005 -10.139 1.00 . A A .  75 TYR N    1 1 
        1  1287 1 1  75 TYR O    O  -4.035  -8.143 -13.388 1.00 . A A .  75 TYR O    1 1 
        1  1288 1 1  75 TYR OH   O  -7.782  -8.054  -5.599 1.00 . A A .  75 TYR OH   1 1 
        1  1289 1 1  76 ALA C    C  -1.063  -8.038 -14.375 1.00 . A A .  76 ALA C    1 1 
        1  1290 1 1  76 ALA CA   C  -1.500  -6.855 -13.503 1.00 . A A .  76 ALA CA   1 1 
        1  1291 1 1  76 ALA CB   C  -0.287  -6.010 -13.106 1.00 . A A .  76 ALA CB   1 1 
        1  1292 1 1  76 ALA H    H  -1.770  -7.216 -11.434 1.00 . A A .  76 ALA H    1 1 
        1  1293 1 1  76 ALA HA   H  -2.182  -6.224 -14.073 1.00 . A A .  76 ALA HA   1 1 
        1  1294 1 1  76 ALA HB1  H  -0.610  -5.172 -12.500 1.00 . A A .  76 ALA HB1  1 1 
        1  1295 1 1  76 ALA HB2  H   0.212  -5.638 -13.995 1.00 . A A .  76 ALA HB2  1 1 
        1  1296 1 1  76 ALA HB3  H   0.409  -6.609 -12.534 1.00 . A A .  76 ALA HB3  1 1 
        1  1297 1 1  76 ALA N    N  -2.209  -7.324 -12.300 1.00 . A A .  76 ALA N    1 1 
        1  1298 1 1  76 ALA O    O  -1.236  -8.015 -15.591 1.00 . A A .  76 ALA O    1 1 
        1  1299 1 1  77 ARG C    C  -1.204 -11.030 -15.094 1.00 . A A .  77 ARG C    1 1 
        1  1300 1 1  77 ARG CA   C  -0.031 -10.295 -14.420 1.00 . A A .  77 ARG CA   1 1 
        1  1301 1 1  77 ARG CB   C   0.692 -11.221 -13.412 1.00 . A A .  77 ARG CB   1 1 
        1  1302 1 1  77 ARG CD   C   2.127 -13.288 -12.969 1.00 . A A .  77 ARG CD   1 1 
        1  1303 1 1  77 ARG CG   C   1.466 -12.400 -14.037 1.00 . A A .  77 ARG CG   1 1 
        1  1304 1 1  77 ARG CZ   C   4.174 -14.725 -12.989 1.00 . A A .  77 ARG CZ   1 1 
        1  1305 1 1  77 ARG H    H  -0.442  -9.037 -12.749 1.00 . A A .  77 ARG H    1 1 
        1  1306 1 1  77 ARG HA   H   0.677  -9.984 -15.185 1.00 . A A .  77 ARG HA   1 1 
        1  1307 1 1  77 ARG HB2  H   1.402 -10.621 -12.846 1.00 . A A .  77 ARG HB2  1 1 
        1  1308 1 1  77 ARG HB3  H  -0.040 -11.623 -12.716 1.00 . A A .  77 ARG HB3  1 1 
        1  1309 1 1  77 ARG HD2  H   2.691 -12.659 -12.291 1.00 . A A .  77 ARG HD2  1 1 
        1  1310 1 1  77 ARG HD3  H   1.354 -13.804 -12.409 1.00 . A A .  77 ARG HD3  1 1 
        1  1311 1 1  77 ARG HE   H   2.771 -14.665 -14.422 1.00 . A A .  77 ARG HE   1 1 
        1  1312 1 1  77 ARG HG2  H   0.780 -13.002 -14.620 1.00 . A A .  77 ARG HG2  1 1 
        1  1313 1 1  77 ARG HG3  H   2.237 -12.005 -14.692 1.00 . A A .  77 ARG HG3  1 1 
        1  1314 1 1  77 ARG HH11 H   4.017 -13.565 -11.330 1.00 . A A .  77 ARG HH11 1 1 
        1  1315 1 1  77 ARG HH12 H   5.421 -14.583 -11.400 1.00 . A A .  77 ARG HH12 1 1 
        1  1316 1 1  77 ARG HH21 H   4.614 -15.990 -14.504 1.00 . A A .  77 ARG HH21 1 1 
        1  1317 1 1  77 ARG HH22 H   5.761 -15.958 -13.202 1.00 . A A .  77 ARG HH22 1 1 
        1  1318 1 1  77 ARG N    N  -0.516  -9.081 -13.729 1.00 . A A .  77 ARG N    1 1 
        1  1319 1 1  77 ARG NE   N   3.032 -14.291 -13.555 1.00 . A A .  77 ARG NE   1 1 
        1  1320 1 1  77 ARG NH1  N   4.568 -14.259 -11.811 1.00 . A A .  77 ARG NH1  1 1 
        1  1321 1 1  77 ARG NH2  N   4.910 -15.626 -13.617 1.00 . A A .  77 ARG NH2  1 1 
        1  1322 1 1  77 ARG O    O  -1.072 -11.541 -16.202 1.00 . A A .  77 ARG O    1 1 
        1  1323 1 1  78 GLN C    C  -4.154 -10.797 -16.086 1.00 . A A .  78 GLN C    1 1 
        1  1324 1 1  78 GLN CA   C  -3.615 -11.622 -14.903 1.00 . A A .  78 GLN CA   1 1 
        1  1325 1 1  78 GLN CB   C  -4.655 -11.665 -13.744 1.00 . A A .  78 GLN CB   1 1 
        1  1326 1 1  78 GLN CD   C  -7.035 -12.223 -12.931 1.00 . A A .  78 GLN CD   1 1 
        1  1327 1 1  78 GLN CG   C  -6.029 -12.275 -14.095 1.00 . A A .  78 GLN CG   1 1 
        1  1328 1 1  78 GLN H    H  -2.365 -10.630 -13.518 1.00 . A A .  78 GLN H    1 1 
        1  1329 1 1  78 GLN HA   H  -3.409 -12.634 -15.237 1.00 . A A .  78 GLN HA   1 1 
        1  1330 1 1  78 GLN HB2  H  -4.231 -12.243 -12.926 1.00 . A A .  78 GLN HB2  1 1 
        1  1331 1 1  78 GLN HB3  H  -4.816 -10.650 -13.391 1.00 . A A .  78 GLN HB3  1 1 
        1  1332 1 1  78 GLN HE21 H  -7.931 -13.879 -13.561 1.00 . A A .  78 GLN HE21 1 1 
        1  1333 1 1  78 GLN HE22 H  -8.593 -13.168 -12.134 1.00 . A A .  78 GLN HE22 1 1 
        1  1334 1 1  78 GLN HG2  H  -6.450 -11.726 -14.926 1.00 . A A .  78 GLN HG2  1 1 
        1  1335 1 1  78 GLN HG3  H  -5.885 -13.310 -14.391 1.00 . A A .  78 GLN HG3  1 1 
        1  1336 1 1  78 GLN N    N  -2.354 -11.038 -14.404 1.00 . A A .  78 GLN N    1 1 
        1  1337 1 1  78 GLN NE2  N  -7.946 -13.187 -12.870 1.00 . A A .  78 GLN NE2  1 1 
        1  1338 1 1  78 GLN O    O  -4.673 -11.359 -17.056 1.00 . A A .  78 GLN O    1 1 
        1  1339 1 1  78 GLN OE1  O  -6.985 -11.323 -12.092 1.00 . A A .  78 GLN OE1  1 1 
        1  1340 1 1  79 ALA C    C  -3.626  -8.753 -18.337 1.00 . A A .  79 ALA C    1 1 
        1  1341 1 1  79 ALA CA   C  -4.426  -8.519 -17.036 1.00 . A A .  79 ALA CA   1 1 
        1  1342 1 1  79 ALA CB   C  -4.281  -7.066 -16.546 1.00 . A A .  79 ALA CB   1 1 
        1  1343 1 1  79 ALA H    H  -3.624  -9.098 -15.152 1.00 . A A .  79 ALA H    1 1 
        1  1344 1 1  79 ALA HA   H  -5.481  -8.697 -17.236 1.00 . A A .  79 ALA HA   1 1 
        1  1345 1 1  79 ALA HB1  H  -4.635  -6.382 -17.307 1.00 . A A .  79 ALA HB1  1 1 
        1  1346 1 1  79 ALA HB2  H  -3.241  -6.853 -16.334 1.00 . A A .  79 ALA HB2  1 1 
        1  1347 1 1  79 ALA HB3  H  -4.864  -6.925 -15.643 1.00 . A A .  79 ALA HB3  1 1 
        1  1348 1 1  79 ALA N    N  -4.013  -9.461 -15.982 1.00 . A A .  79 ALA N    1 1 
        1  1349 1 1  79 ALA O    O  -4.210  -8.859 -19.418 1.00 . A A .  79 ALA O    1 1 
        1  1350 1 1  80 ILE C    C  -1.673 -10.529 -19.950 1.00 . A A .  80 ILE C    1 1 
        1  1351 1 1  80 ILE CA   C  -1.401  -9.124 -19.361 1.00 . A A .  80 ILE CA   1 1 
        1  1352 1 1  80 ILE CB   C   0.138  -8.931 -18.987 1.00 . A A .  80 ILE CB   1 1 
        1  1353 1 1  80 ILE CD1  C  -0.086  -6.501 -18.013 1.00 . A A .  80 ILE CD1  1 1 
        1  1354 1 1  80 ILE CG1  C   0.556  -7.419 -19.038 1.00 . A A .  80 ILE CG1  1 1 
        1  1355 1 1  80 ILE CG2  C   1.093  -9.769 -19.891 1.00 . A A .  80 ILE CG2  1 1 
        1  1356 1 1  80 ILE H    H  -1.903  -8.792 -17.316 1.00 . A A .  80 ILE H    1 1 
        1  1357 1 1  80 ILE HA   H  -1.652  -8.389 -20.127 1.00 . A A .  80 ILE HA   1 1 
        1  1358 1 1  80 ILE HB   H   0.270  -9.288 -17.969 1.00 . A A .  80 ILE HB   1 1 
        1  1359 1 1  80 ILE HD11 H   0.172  -6.828 -17.015 1.00 . A A .  80 ILE HD11 1 1 
        1  1360 1 1  80 ILE HD12 H  -1.162  -6.513 -18.131 1.00 . A A .  80 ILE HD12 1 1 
        1  1361 1 1  80 ILE HD13 H   0.275  -5.492 -18.161 1.00 . A A .  80 ILE HD13 1 1 
        1  1362 1 1  80 ILE HG12 H   1.624  -7.344 -18.885 1.00 . A A .  80 ILE HG12 1 1 
        1  1363 1 1  80 ILE HG13 H   0.324  -7.019 -20.020 1.00 . A A .  80 ILE HG13 1 1 
        1  1364 1 1  80 ILE HG21 H   2.124  -9.600 -19.597 1.00 . A A .  80 ILE HG21 1 1 
        1  1365 1 1  80 ILE HG22 H   0.969  -9.488 -20.929 1.00 . A A .  80 ILE HG22 1 1 
        1  1366 1 1  80 ILE HG23 H   0.869 -10.824 -19.781 1.00 . A A .  80 ILE HG23 1 1 
        1  1367 1 1  80 ILE N    N  -2.292  -8.868 -18.211 1.00 . A A .  80 ILE N    1 1 
        1  1368 1 1  80 ILE O    O  -1.820 -10.675 -21.172 1.00 . A A .  80 ILE O    1 1 
        1  1369 1 1  81 ASN C    C  -3.303 -13.121 -20.242 1.00 . A A .  81 ASN C    1 1 
        1  1370 1 1  81 ASN CA   C  -1.995 -12.953 -19.446 1.00 . A A .  81 ASN CA   1 1 
        1  1371 1 1  81 ASN CB   C  -2.014 -13.854 -18.183 1.00 . A A .  81 ASN CB   1 1 
        1  1372 1 1  81 ASN CG   C  -2.347 -15.322 -18.482 1.00 . A A .  81 ASN CG   1 1 
        1  1373 1 1  81 ASN H    H  -1.659 -11.324 -18.114 1.00 . A A .  81 ASN H    1 1 
        1  1374 1 1  81 ASN HA   H  -1.167 -13.257 -20.078 1.00 . A A .  81 ASN HA   1 1 
        1  1375 1 1  81 ASN HB2  H  -1.039 -13.820 -17.709 1.00 . A A .  81 ASN HB2  1 1 
        1  1376 1 1  81 ASN HB3  H  -2.746 -13.466 -17.480 1.00 . A A .  81 ASN HB3  1 1 
        1  1377 1 1  81 ASN HD21 H  -4.257 -15.028 -18.033 1.00 . A A .  81 ASN HD21 1 1 
        1  1378 1 1  81 ASN HD22 H  -3.841 -16.628 -18.529 1.00 . A A .  81 ASN HD22 1 1 
        1  1379 1 1  81 ASN N    N  -1.763 -11.539 -19.063 1.00 . A A .  81 ASN N    1 1 
        1  1380 1 1  81 ASN ND2  N  -3.607 -15.699 -18.329 1.00 . A A .  81 ASN ND2  1 1 
        1  1381 1 1  81 ASN O    O  -3.328 -13.805 -21.267 1.00 . A A .  81 ASN O    1 1 
        1  1382 1 1  81 ASN OD1  O  -1.469 -16.106 -18.824 1.00 . A A .  81 ASN OD1  1 1 
        1  1383 1 1  82 ASP C    C  -5.798 -11.612 -21.595 1.00 . A A .  82 ASP C    1 1 
        1  1384 1 1  82 ASP CA   C  -5.708 -12.562 -20.383 1.00 . A A .  82 ASP CA   1 1 
        1  1385 1 1  82 ASP CB   C  -6.804 -12.230 -19.339 1.00 . A A .  82 ASP CB   1 1 
        1  1386 1 1  82 ASP CG   C  -8.233 -12.458 -19.863 1.00 . A A .  82 ASP CG   1 1 
        1  1387 1 1  82 ASP H    H  -4.262 -11.921 -18.958 1.00 . A A .  82 ASP H    1 1 
        1  1388 1 1  82 ASP HA   H  -5.853 -13.584 -20.730 1.00 . A A .  82 ASP HA   1 1 
        1  1389 1 1  82 ASP HB2  H  -6.652 -12.859 -18.466 1.00 . A A .  82 ASP HB2  1 1 
        1  1390 1 1  82 ASP HB3  H  -6.697 -11.191 -19.032 1.00 . A A .  82 ASP HB3  1 1 
        1  1391 1 1  82 ASP N    N  -4.375 -12.482 -19.754 1.00 . A A .  82 ASP N    1 1 
        1  1392 1 1  82 ASP O    O  -6.552 -11.868 -22.538 1.00 . A A .  82 ASP O    1 1 
        1  1393 1 1  82 ASP OD1  O  -8.669 -13.626 -19.921 1.00 . A A .  82 ASP OD1  1 1 
        1  1394 1 1  82 ASP OD2  O  -8.906 -11.481 -20.246 1.00 . A A .  82 ASP OD2  1 1 
        1  1395 1 1  83 GLY C    C  -6.087  -8.459 -22.354 1.00 . A A .  83 GLY C    1 1 
        1  1396 1 1  83 GLY CA   C  -5.016  -9.512 -22.613 1.00 . A A .  83 GLY CA   1 1 
        1  1397 1 1  83 GLY H    H  -4.381 -10.422 -20.798 1.00 . A A .  83 GLY H    1 1 
        1  1398 1 1  83 GLY HA2  H  -4.048  -9.024 -22.634 1.00 . A A .  83 GLY HA2  1 1 
        1  1399 1 1  83 GLY HA3  H  -5.193  -9.975 -23.575 1.00 . A A .  83 GLY HA3  1 1 
        1  1400 1 1  83 GLY N    N  -4.994 -10.537 -21.565 1.00 . A A .  83 GLY N    1 1 
        1  1401 1 1  83 GLY O    O  -6.619  -7.854 -23.291 1.00 . A A .  83 GLY O    1 1 
        1  1402 1 1  84 VAL C    C  -6.813  -5.854 -20.961 1.00 . A A .  84 VAL C    1 1 
        1  1403 1 1  84 VAL CA   C  -7.326  -7.249 -20.556 1.00 . A A .  84 VAL CA   1 1 
        1  1404 1 1  84 VAL CB   C  -7.473  -7.337 -18.987 1.00 . A A .  84 VAL CB   1 1 
        1  1405 1 1  84 VAL CG1  C  -8.426  -6.261 -18.420 1.00 . A A .  84 VAL CG1  1 1 
        1  1406 1 1  84 VAL CG2  C  -7.923  -8.748 -18.558 1.00 . A A .  84 VAL CG2  1 1 
        1  1407 1 1  84 VAL H    H  -6.014  -8.897 -20.405 1.00 . A A .  84 VAL H    1 1 
        1  1408 1 1  84 VAL HA   H  -8.302  -7.426 -21.005 1.00 . A A .  84 VAL HA   1 1 
        1  1409 1 1  84 VAL HB   H  -6.491  -7.164 -18.552 1.00 . A A .  84 VAL HB   1 1 
        1  1410 1 1  84 VAL HG11 H  -8.058  -5.275 -18.676 1.00 . A A .  84 VAL HG11 1 1 
        1  1411 1 1  84 VAL HG12 H  -8.480  -6.345 -17.341 1.00 . A A .  84 VAL HG12 1 1 
        1  1412 1 1  84 VAL HG13 H  -9.419  -6.388 -18.834 1.00 . A A .  84 VAL HG13 1 1 
        1  1413 1 1  84 VAL HG21 H  -7.992  -8.803 -17.478 1.00 . A A .  84 VAL HG21 1 1 
        1  1414 1 1  84 VAL HG22 H  -7.202  -9.477 -18.904 1.00 . A A .  84 VAL HG22 1 1 
        1  1415 1 1  84 VAL HG23 H  -8.892  -8.976 -18.989 1.00 . A A .  84 VAL HG23 1 1 
        1  1416 1 1  84 VAL N    N  -6.408  -8.284 -21.056 1.00 . A A .  84 VAL N    1 1 
        1  1417 1 1  84 VAL O    O  -5.734  -5.437 -20.537 1.00 . A A .  84 VAL O    1 1 
        1  1418 1 1  85 THR C    C  -7.599  -2.698 -21.438 1.00 . A A .  85 THR C    1 1 
        1  1419 1 1  85 THR CA   C  -7.245  -3.871 -22.375 1.00 . A A .  85 THR CA   1 1 
        1  1420 1 1  85 THR CB   C  -7.970  -3.702 -23.753 1.00 . A A .  85 THR CB   1 1 
        1  1421 1 1  85 THR CG2  C  -7.489  -4.746 -24.787 1.00 . A A .  85 THR CG2  1 1 
        1  1422 1 1  85 THR H    H  -8.519  -5.503 -21.921 1.00 . A A .  85 THR H    1 1 
        1  1423 1 1  85 THR HA   H  -6.173  -3.864 -22.551 1.00 . A A .  85 THR HA   1 1 
        1  1424 1 1  85 THR HB   H  -7.758  -2.710 -24.144 1.00 . A A .  85 THR HB   1 1 
        1  1425 1 1  85 THR HG1  H  -9.800  -2.954 -23.616 1.00 . A A .  85 THR HG1  1 1 
        1  1426 1 1  85 THR HG21 H  -7.987  -4.580 -25.734 1.00 . A A .  85 THR HG21 1 1 
        1  1427 1 1  85 THR HG22 H  -7.715  -5.746 -24.432 1.00 . A A .  85 THR HG22 1 1 
        1  1428 1 1  85 THR HG23 H  -6.421  -4.655 -24.930 1.00 . A A .  85 THR HG23 1 1 
        1  1429 1 1  85 THR N    N  -7.614  -5.157 -21.770 1.00 . A A .  85 THR N    1 1 
        1  1430 1 1  85 THR O    O  -7.190  -1.558 -21.680 1.00 . A A .  85 THR O    1 1 
        1  1431 1 1  85 THR OG1  O  -9.392  -3.830 -23.572 1.00 . A A .  85 THR OG1  1 1 
        1  1432 1 1  86 SER C    C  -8.553  -2.414 -17.967 1.00 . A A .  86 SER C    1 1 
        1  1433 1 1  86 SER CA   C  -8.834  -1.972 -19.414 1.00 . A A .  86 SER CA   1 1 
        1  1434 1 1  86 SER CB   C -10.350  -1.733 -19.615 1.00 . A A .  86 SER CB   1 1 
        1  1435 1 1  86 SER H    H  -8.582  -3.922 -20.175 1.00 . A A .  86 SER H    1 1 
        1  1436 1 1  86 SER HA   H  -8.302  -1.040 -19.607 1.00 . A A .  86 SER HA   1 1 
        1  1437 1 1  86 SER HB2  H -10.894  -2.641 -19.396 1.00 . A A .  86 SER HB2  1 1 
        1  1438 1 1  86 SER HB3  H -10.687  -0.947 -18.947 1.00 . A A .  86 SER HB3  1 1 
        1  1439 1 1  86 SER HG   H -11.125  -2.058 -21.384 1.00 . A A .  86 SER HG   1 1 
        1  1440 1 1  86 SER N    N  -8.354  -2.988 -20.358 1.00 . A A .  86 SER N    1 1 
        1  1441 1 1  86 SER O    O  -9.186  -3.348 -17.461 1.00 . A A .  86 SER O    1 1 
        1  1442 1 1  86 SER OG   O -10.641  -1.350 -20.948 1.00 . A A .  86 SER OG   1 1 
        1  1443 1 1  87 THR C    C  -8.553  -1.532 -15.008 1.00 . A A .  87 THR C    1 1 
        1  1444 1 1  87 THR CA   C  -7.319  -1.886 -15.864 1.00 . A A .  87 THR CA   1 1 
        1  1445 1 1  87 THR CB   C  -6.123  -0.967 -15.440 1.00 . A A .  87 THR CB   1 1 
        1  1446 1 1  87 THR CG2  C  -4.770  -1.491 -15.935 1.00 . A A .  87 THR CG2  1 1 
        1  1447 1 1  87 THR H    H  -7.076  -1.061 -17.806 1.00 . A A .  87 THR H    1 1 
        1  1448 1 1  87 THR HA   H  -7.052  -2.919 -15.679 1.00 . A A .  87 THR HA   1 1 
        1  1449 1 1  87 THR HB   H  -6.087  -0.913 -14.352 1.00 . A A .  87 THR HB   1 1 
        1  1450 1 1  87 THR HG1  H  -5.572   0.912 -15.754 1.00 . A A .  87 THR HG1  1 1 
        1  1451 1 1  87 THR HG21 H  -4.762  -1.527 -17.017 1.00 . A A .  87 THR HG21 1 1 
        1  1452 1 1  87 THR HG22 H  -4.592  -2.484 -15.541 1.00 . A A .  87 THR HG22 1 1 
        1  1453 1 1  87 THR HG23 H  -3.979  -0.832 -15.594 1.00 . A A .  87 THR HG23 1 1 
        1  1454 1 1  87 THR N    N  -7.604  -1.721 -17.308 1.00 . A A .  87 THR N    1 1 
        1  1455 1 1  87 THR O    O  -8.692  -1.996 -13.872 1.00 . A A .  87 THR O    1 1 
        1  1456 1 1  87 THR OG1  O  -6.338   0.365 -15.949 1.00 . A A .  87 THR OG1  1 1 
        1  1457 1 1  88 GLU C    C -11.730  -1.267 -14.604 1.00 . A A .  88 GLU C    1 1 
        1  1458 1 1  88 GLU CA   C -10.673  -0.185 -14.957 1.00 . A A .  88 GLU CA   1 1 
        1  1459 1 1  88 GLU CB   C -11.273   0.894 -15.894 1.00 . A A .  88 GLU CB   1 1 
        1  1460 1 1  88 GLU CD   C -10.858   3.046 -17.251 1.00 . A A .  88 GLU CD   1 1 
        1  1461 1 1  88 GLU CG   C -10.283   2.026 -16.253 1.00 . A A .  88 GLU CG   1 1 
        1  1462 1 1  88 GLU H    H  -9.286  -0.475 -16.530 1.00 . A A .  88 GLU H    1 1 
        1  1463 1 1  88 GLU HA   H -10.363   0.297 -14.036 1.00 . A A .  88 GLU HA   1 1 
        1  1464 1 1  88 GLU HB2  H -11.594   0.416 -16.814 1.00 . A A .  88 GLU HB2  1 1 
        1  1465 1 1  88 GLU HB3  H -12.140   1.336 -15.411 1.00 . A A .  88 GLU HB3  1 1 
        1  1466 1 1  88 GLU HG2  H -10.002   2.548 -15.339 1.00 . A A .  88 GLU HG2  1 1 
        1  1467 1 1  88 GLU HG3  H  -9.393   1.579 -16.681 1.00 . A A .  88 GLU HG3  1 1 
        1  1468 1 1  88 GLU N    N  -9.457  -0.729 -15.601 1.00 . A A .  88 GLU N    1 1 
        1  1469 1 1  88 GLU O    O -12.800  -0.943 -14.075 1.00 . A A .  88 GLU O    1 1 
        1  1470 1 1  88 GLU OE1  O -11.583   3.968 -16.820 1.00 . A A .  88 GLU OE1  1 1 
        1  1471 1 1  88 GLU OE2  O -10.585   2.937 -18.467 1.00 . A A .  88 GLU OE2  1 1 
        1  1472 1 1  89 GLU C    C -11.866  -4.324 -13.221 1.00 . A A .  89 GLU C    1 1 
        1  1473 1 1  89 GLU CA   C -12.284  -3.689 -14.577 1.00 . A A .  89 GLU CA   1 1 
        1  1474 1 1  89 GLU CB   C -12.191  -4.715 -15.732 1.00 . A A .  89 GLU CB   1 1 
        1  1475 1 1  89 GLU CD   C -12.988  -6.908 -16.776 1.00 . A A .  89 GLU CD   1 1 
        1  1476 1 1  89 GLU CG   C -13.140  -5.923 -15.610 1.00 . A A .  89 GLU CG   1 1 
        1  1477 1 1  89 GLU H    H -10.542  -2.742 -15.263 1.00 . A A .  89 GLU H    1 1 
        1  1478 1 1  89 GLU HA   H -13.310  -3.332 -14.494 1.00 . A A .  89 GLU HA   1 1 
        1  1479 1 1  89 GLU HB2  H -12.413  -4.203 -16.663 1.00 . A A .  89 GLU HB2  1 1 
        1  1480 1 1  89 GLU HB3  H -11.169  -5.086 -15.784 1.00 . A A .  89 GLU HB3  1 1 
        1  1481 1 1  89 GLU HG2  H -12.926  -6.441 -14.679 1.00 . A A .  89 GLU HG2  1 1 
        1  1482 1 1  89 GLU HG3  H -14.163  -5.559 -15.578 1.00 . A A .  89 GLU HG3  1 1 
        1  1483 1 1  89 GLU N    N -11.414  -2.545 -14.885 1.00 . A A .  89 GLU N    1 1 
        1  1484 1 1  89 GLU O    O -12.659  -5.024 -12.574 1.00 . A A .  89 GLU O    1 1 
        1  1485 1 1  89 GLU OE1  O -12.017  -7.694 -16.778 1.00 . A A .  89 GLU OE1  1 1 
        1  1486 1 1  89 GLU OE2  O -13.809  -6.877 -17.713 1.00 . A A .  89 GLU OE2  1 1 
        1  1487 1 1  90 LEU C    C  -9.740  -3.486 -10.529 1.00 . A A .  90 LEU C    1 1 
        1  1488 1 1  90 LEU CA   C -10.018  -4.606 -11.571 1.00 . A A .  90 LEU CA   1 1 
        1  1489 1 1  90 LEU CB   C  -8.753  -5.510 -11.914 1.00 . A A .  90 LEU CB   1 1 
        1  1490 1 1  90 LEU CD1  C  -6.489  -5.817 -13.120 1.00 . A A .  90 LEU CD1  1 1 
        1  1491 1 1  90 LEU CD2  C  -8.565  -5.458 -14.510 1.00 . A A .  90 LEU CD2  1 1 
        1  1492 1 1  90 LEU CG   C  -7.867  -5.124 -13.166 1.00 . A A .  90 LEU CG   1 1 
        1  1493 1 1  90 LEU H    H -10.108  -3.369 -13.279 1.00 . A A .  90 LEU H    1 1 
        1  1494 1 1  90 LEU HA   H -10.767  -5.255 -11.115 1.00 . A A .  90 LEU HA   1 1 
        1  1495 1 1  90 LEU HB2  H  -8.105  -5.506 -11.040 1.00 . A A .  90 LEU HB2  1 1 
        1  1496 1 1  90 LEU HB3  H  -9.096  -6.531 -12.052 1.00 . A A .  90 LEU HB3  1 1 
        1  1497 1 1  90 LEU HD11 H  -6.612  -6.894 -13.113 1.00 . A A .  90 LEU HD11 1 1 
        1  1498 1 1  90 LEU HD12 H  -5.966  -5.514 -12.223 1.00 . A A .  90 LEU HD12 1 1 
        1  1499 1 1  90 LEU HD13 H  -5.899  -5.528 -13.982 1.00 . A A .  90 LEU HD13 1 1 
        1  1500 1 1  90 LEU HD21 H  -7.939  -5.146 -15.336 1.00 . A A .  90 LEU HD21 1 1 
        1  1501 1 1  90 LEU HD22 H  -9.508  -4.930 -14.565 1.00 . A A .  90 LEU HD22 1 1 
        1  1502 1 1  90 LEU HD23 H  -8.748  -6.522 -14.578 1.00 . A A .  90 LEU HD23 1 1 
        1  1503 1 1  90 LEU HG   H  -7.691  -4.054 -13.147 1.00 . A A .  90 LEU HG   1 1 
        1  1504 1 1  90 LEU N    N -10.628  -4.025 -12.781 1.00 . A A .  90 LEU N    1 1 
        1  1505 1 1  90 LEU O    O -10.698  -2.854 -10.046 1.00 . A A .  90 LEU O    1 1 
        1  1506 1 1  91 SER C    C  -7.815  -0.870  -9.504 1.00 . A A .  91 SER C    1 1 
        1  1507 1 1  91 SER CA   C  -8.112  -2.319  -9.062 1.00 . A A .  91 SER CA   1 1 
        1  1508 1 1  91 SER CB   C  -6.927  -2.908  -8.272 1.00 . A A .  91 SER CB   1 1 
        1  1509 1 1  91 SER H    H  -7.736  -3.583 -10.722 1.00 . A A .  91 SER H    1 1 
        1  1510 1 1  91 SER HA   H  -8.972  -2.286  -8.393 1.00 . A A .  91 SER HA   1 1 
        1  1511 1 1  91 SER HB2  H  -7.148  -3.923  -7.979 1.00 . A A .  91 SER HB2  1 1 
        1  1512 1 1  91 SER HB3  H  -6.031  -2.897  -8.883 1.00 . A A .  91 SER HB3  1 1 
        1  1513 1 1  91 SER HG   H  -6.234  -1.332  -7.350 1.00 . A A .  91 SER HG   1 1 
        1  1514 1 1  91 SER N    N  -8.461  -3.198 -10.200 1.00 . A A .  91 SER N    1 1 
        1  1515 1 1  91 SER O    O  -6.662  -0.415  -9.505 1.00 . A A .  91 SER O    1 1 
        1  1516 1 1  91 SER OG   O  -6.692  -2.146  -7.109 1.00 . A A .  91 SER OG   1 1 
        1  1517 1 1  92 ILE C    C  -9.974   1.903  -9.336 1.00 . A A .  92 ILE C    1 1 
        1  1518 1 1  92 ILE CA   C  -8.855   1.285 -10.218 1.00 . A A .  92 ILE CA   1 1 
        1  1519 1 1  92 ILE CB   C  -9.087   1.511 -11.782 1.00 . A A .  92 ILE CB   1 1 
        1  1520 1 1  92 ILE CD1  C  -6.552   1.294 -12.428 1.00 . A A .  92 ILE CD1  1 1 
        1  1521 1 1  92 ILE CG1  C  -7.976   0.789 -12.613 1.00 . A A .  92 ILE CG1  1 1 
        1  1522 1 1  92 ILE CG2  C  -9.169   2.995 -12.209 1.00 . A A .  92 ILE CG2  1 1 
        1  1523 1 1  92 ILE H    H  -9.713  -0.646 -10.046 1.00 . A A .  92 ILE H    1 1 
        1  1524 1 1  92 ILE HA   H  -7.891   1.709  -9.922 1.00 . A A .  92 ILE HA   1 1 
        1  1525 1 1  92 ILE HB   H -10.043   1.052 -12.033 1.00 . A A .  92 ILE HB   1 1 
        1  1526 1 1  92 ILE HD11 H  -6.489   2.332 -12.726 1.00 . A A .  92 ILE HD11 1 1 
        1  1527 1 1  92 ILE HD12 H  -5.883   0.706 -13.043 1.00 . A A .  92 ILE HD12 1 1 
        1  1528 1 1  92 ILE HD13 H  -6.259   1.197 -11.391 1.00 . A A .  92 ILE HD13 1 1 
        1  1529 1 1  92 ILE HG12 H  -7.971  -0.261 -12.346 1.00 . A A .  92 ILE HG12 1 1 
        1  1530 1 1  92 ILE HG13 H  -8.218   0.868 -13.666 1.00 . A A .  92 ILE HG13 1 1 
        1  1531 1 1  92 ILE HG21 H  -8.244   3.497 -11.964 1.00 . A A .  92 ILE HG21 1 1 
        1  1532 1 1  92 ILE HG22 H  -9.985   3.475 -11.689 1.00 . A A .  92 ILE HG22 1 1 
        1  1533 1 1  92 ILE HG23 H  -9.342   3.061 -13.278 1.00 . A A .  92 ILE HG23 1 1 
        1  1534 1 1  92 ILE N    N  -8.866  -0.170  -9.929 1.00 . A A .  92 ILE N    1 1 
        1  1535 1 1  92 ILE O    O -10.505   1.192  -8.480 1.00 . A A .  92 ILE O    1 1 
        1  1536 1 1  93 THR C    C -12.734   3.004  -9.472 1.00 . A A .  93 THR C    1 1 
        1  1537 1 1  93 THR CA   C -11.516   3.798  -8.951 1.00 . A A .  93 THR CA   1 1 
        1  1538 1 1  93 THR CB   C -11.614   5.305  -9.338 1.00 . A A .  93 THR CB   1 1 
        1  1539 1 1  93 THR CG2  C -12.839   5.986  -8.696 1.00 . A A .  93 THR CG2  1 1 
        1  1540 1 1  93 THR H    H  -9.610   3.808  -9.851 1.00 . A A .  93 THR H    1 1 
        1  1541 1 1  93 THR HA   H -11.493   3.728  -7.861 1.00 . A A .  93 THR HA   1 1 
        1  1542 1 1  93 THR HB   H -11.691   5.382 -10.418 1.00 . A A .  93 THR HB   1 1 
        1  1543 1 1  93 THR HG1  H -10.164   6.630  -9.561 1.00 . A A .  93 THR HG1  1 1 
        1  1544 1 1  93 THR HG21 H -13.750   5.504  -9.037 1.00 . A A .  93 THR HG21 1 1 
        1  1545 1 1  93 THR HG22 H -12.863   7.033  -8.973 1.00 . A A .  93 THR HG22 1 1 
        1  1546 1 1  93 THR HG23 H -12.780   5.907  -7.620 1.00 . A A .  93 THR HG23 1 1 
        1  1547 1 1  93 THR N    N -10.270   3.210  -9.459 1.00 . A A .  93 THR N    1 1 
        1  1548 1 1  93 THR O    O -13.319   3.322 -10.509 1.00 . A A .  93 THR O    1 1 
        1  1549 1 1  93 THR OG1  O -10.412   5.971  -8.912 1.00 . A A .  93 THR OG1  1 1 
        1  1550 1 1  94 ARG C    C -14.909   0.686  -7.852 1.00 . A A .  94 ARG C    1 1 
        1  1551 1 1  94 ARG CA   C -14.080   0.974  -9.103 1.00 . A A .  94 ARG CA   1 1 
        1  1552 1 1  94 ARG CB   C -13.450  -0.319  -9.709 1.00 . A A .  94 ARG CB   1 1 
        1  1553 1 1  94 ARG CD   C -15.194  -0.744 -11.571 1.00 . A A .  94 ARG CD   1 1 
        1  1554 1 1  94 ARG CG   C -14.478  -1.299 -10.318 1.00 . A A .  94 ARG CG   1 1 
        1  1555 1 1  94 ARG CZ   C -16.157  -2.848 -12.576 1.00 . A A .  94 ARG CZ   1 1 
        1  1556 1 1  94 ARG H    H -12.531   1.770  -7.921 1.00 . A A .  94 ARG H    1 1 
        1  1557 1 1  94 ARG HA   H -14.726   1.437  -9.857 1.00 . A A .  94 ARG HA   1 1 
        1  1558 1 1  94 ARG HB2  H -12.745  -0.039 -10.486 1.00 . A A .  94 ARG HB2  1 1 
        1  1559 1 1  94 ARG HB3  H -12.903  -0.842  -8.930 1.00 . A A .  94 ARG HB3  1 1 
        1  1560 1 1  94 ARG HD2  H -15.611   0.226 -11.336 1.00 . A A .  94 ARG HD2  1 1 
        1  1561 1 1  94 ARG HD3  H -14.471  -0.632 -12.372 1.00 . A A .  94 ARG HD3  1 1 
        1  1562 1 1  94 ARG HE   H -17.203  -1.260 -11.944 1.00 . A A .  94 ARG HE   1 1 
        1  1563 1 1  94 ARG HG2  H -13.964  -2.212 -10.597 1.00 . A A .  94 ARG HG2  1 1 
        1  1564 1 1  94 ARG HG3  H -15.222  -1.533  -9.566 1.00 . A A .  94 ARG HG3  1 1 
        1  1565 1 1  94 ARG HH11 H -14.143  -2.904 -12.471 1.00 . A A .  94 ARG HH11 1 1 
        1  1566 1 1  94 ARG HH12 H -14.890  -4.312 -13.149 1.00 . A A .  94 ARG HH12 1 1 
        1  1567 1 1  94 ARG HH21 H -18.140  -3.143 -12.788 1.00 . A A .  94 ARG HH21 1 1 
        1  1568 1 1  94 ARG HH22 H -17.134  -4.449 -13.331 1.00 . A A .  94 ARG HH22 1 1 
        1  1569 1 1  94 ARG N    N -13.047   1.928  -8.743 1.00 . A A .  94 ARG N    1 1 
        1  1570 1 1  94 ARG NE   N -16.294  -1.620 -12.034 1.00 . A A .  94 ARG NE   1 1 
        1  1571 1 1  94 ARG NH1  N -14.968  -3.396 -12.745 1.00 . A A .  94 ARG NH1  1 1 
        1  1572 1 1  94 ARG NH2  N -17.228  -3.533 -12.924 1.00 . A A .  94 ARG NH2  1 1 
        1  1573 1 1  94 ARG O    O -14.601  -0.222  -7.070 1.00 . A A .  94 ARG O    1 1 
        1  1574 1 1  95 ASP C    C -17.556   0.059  -6.540 1.00 . A A .  95 ASP C    1 1 
        1  1575 1 1  95 ASP CA   C -16.895   1.455  -6.558 1.00 . A A .  95 ASP CA   1 1 
        1  1576 1 1  95 ASP CB   C -17.959   2.572  -6.730 1.00 . A A .  95 ASP CB   1 1 
        1  1577 1 1  95 ASP CG   C -19.059   2.555  -5.650 1.00 . A A .  95 ASP CG   1 1 
        1  1578 1 1  95 ASP H    H -15.920   2.368  -8.200 1.00 . A A .  95 ASP H    1 1 
        1  1579 1 1  95 ASP HA   H -16.379   1.616  -5.620 1.00 . A A .  95 ASP HA   1 1 
        1  1580 1 1  95 ASP HB2  H -17.462   3.534  -6.687 1.00 . A A .  95 ASP HB2  1 1 
        1  1581 1 1  95 ASP HB3  H -18.420   2.470  -7.709 1.00 . A A .  95 ASP HB3  1 1 
        1  1582 1 1  95 ASP N    N -15.893   1.569  -7.630 1.00 . A A .  95 ASP N    1 1 
        1  1583 1 1  95 ASP O    O -17.774  -0.538  -7.610 1.00 . A A .  95 ASP O    1 1 
        1  1584 1 1  95 ASP OD1  O -18.749   2.846  -4.476 1.00 . A A .  95 ASP OD1  1 1 
        1  1585 1 1  95 ASP OD2  O -20.224   2.227  -5.963 1.00 . A A .  95 ASP OD2  1 1 
        1  1586 1 1  96 CYS C    C -17.363  -2.878  -5.192 1.00 . A A .  96 CYS C    1 1 
        1  1587 1 1  96 CYS CA   C -18.401  -1.755  -5.009 1.00 . A A .  96 CYS CA   1 1 
        1  1588 1 1  96 CYS CB   C -19.704  -2.037  -5.805 1.00 . A A .  96 CYS CB   1 1 
        1  1589 1 1  96 CYS H    H -17.639   0.155  -4.549 1.00 . A A .  96 CYS H    1 1 
        1  1590 1 1  96 CYS HA   H -18.664  -1.723  -3.958 1.00 . A A .  96 CYS HA   1 1 
        1  1591 1 1  96 CYS HB2  H -19.482  -2.055  -6.861 1.00 . A A .  96 CYS HB2  1 1 
        1  1592 1 1  96 CYS HB3  H -20.104  -3.001  -5.510 1.00 . A A .  96 CYS HB3  1 1 
        1  1593 1 1  96 CYS HG   H -20.455   0.268  -4.999 1.00 . A A .  96 CYS HG   1 1 
        1  1594 1 1  96 CYS N    N -17.830  -0.427  -5.310 1.00 . A A .  96 CYS N    1 1 
        1  1595 1 1  96 CYS O    O -17.001  -3.528  -4.223 1.00 . A A .  96 CYS O    1 1 
        1  1596 1 1  96 CYS SG   S -21.010  -0.806  -5.548 1.00 . A A .  96 CYS SG   1 1 
        1  1597 1 1  97 GLU C    C -14.655  -4.152  -6.005 1.00 . A A .  97 GLU C    1 1 
        1  1598 1 1  97 GLU CA   C -15.973  -4.182  -6.803 1.00 . A A .  97 GLU CA   1 1 
        1  1599 1 1  97 GLU CB   C -15.676  -4.123  -8.321 1.00 . A A .  97 GLU CB   1 1 
        1  1600 1 1  97 GLU CD   C -17.531  -5.673  -9.208 1.00 . A A .  97 GLU CD   1 1 
        1  1601 1 1  97 GLU CG   C -16.917  -4.263  -9.223 1.00 . A A .  97 GLU CG   1 1 
        1  1602 1 1  97 GLU H    H -17.232  -2.508  -7.149 1.00 . A A .  97 GLU H    1 1 
        1  1603 1 1  97 GLU HA   H -16.484  -5.114  -6.592 1.00 . A A .  97 GLU HA   1 1 
        1  1604 1 1  97 GLU HB2  H -15.205  -3.171  -8.541 1.00 . A A .  97 GLU HB2  1 1 
        1  1605 1 1  97 GLU HB3  H -14.978  -4.915  -8.577 1.00 . A A .  97 GLU HB3  1 1 
        1  1606 1 1  97 GLU HG2  H -17.668  -3.551  -8.894 1.00 . A A .  97 GLU HG2  1 1 
        1  1607 1 1  97 GLU HG3  H -16.632  -4.013 -10.241 1.00 . A A .  97 GLU HG3  1 1 
        1  1608 1 1  97 GLU N    N -16.898  -3.084  -6.438 1.00 . A A .  97 GLU N    1 1 
        1  1609 1 1  97 GLU O    O -14.345  -5.112  -5.279 1.00 . A A .  97 GLU O    1 1 
        1  1610 1 1  97 GLU OE1  O -18.329  -5.986  -8.300 1.00 . A A .  97 GLU OE1  1 1 
        1  1611 1 1  97 GLU OE2  O -17.215  -6.481 -10.107 1.00 . A A .  97 GLU OE2  1 1 
        1  1612 1 1  98 LEU C    C -12.742  -2.820  -3.917 1.00 . A A .  98 LEU C    1 1 
        1  1613 1 1  98 LEU CA   C -12.581  -2.936  -5.444 1.00 . A A .  98 LEU CA   1 1 
        1  1614 1 1  98 LEU CB   C -11.742  -1.754  -5.999 1.00 . A A .  98 LEU CB   1 1 
        1  1615 1 1  98 LEU CD1  C  -9.513  -2.993  -5.677 1.00 . A A .  98 LEU CD1  1 1 
        1  1616 1 1  98 LEU CD2  C  -9.517  -0.454  -5.977 1.00 . A A .  98 LEU CD2  1 1 
        1  1617 1 1  98 LEU CG   C -10.287  -1.673  -5.429 1.00 . A A .  98 LEU CG   1 1 
        1  1618 1 1  98 LEU H    H -14.231  -2.286  -6.637 1.00 . A A .  98 LEU H    1 1 
        1  1619 1 1  98 LEU HA   H -12.046  -3.860  -5.651 1.00 . A A .  98 LEU HA   1 1 
        1  1620 1 1  98 LEU HB2  H -11.690  -1.848  -7.082 1.00 . A A .  98 LEU HB2  1 1 
        1  1621 1 1  98 LEU HB3  H -12.256  -0.826  -5.765 1.00 . A A .  98 LEU HB3  1 1 
        1  1622 1 1  98 LEU HD11 H -10.007  -3.808  -5.164 1.00 . A A .  98 LEU HD11 1 1 
        1  1623 1 1  98 LEU HD12 H  -8.505  -2.902  -5.296 1.00 . A A .  98 LEU HD12 1 1 
        1  1624 1 1  98 LEU HD13 H  -9.474  -3.208  -6.738 1.00 . A A .  98 LEU HD13 1 1 
        1  1625 1 1  98 LEU HD21 H  -8.528  -0.420  -5.537 1.00 . A A .  98 LEU HD21 1 1 
        1  1626 1 1  98 LEU HD22 H -10.044   0.454  -5.720 1.00 . A A .  98 LEU HD22 1 1 
        1  1627 1 1  98 LEU HD23 H  -9.427  -0.522  -7.054 1.00 . A A .  98 LEU HD23 1 1 
        1  1628 1 1  98 LEU HG   H -10.356  -1.551  -4.353 1.00 . A A .  98 LEU HG   1 1 
        1  1629 1 1  98 LEU N    N -13.899  -3.041  -6.108 1.00 . A A .  98 LEU N    1 1 
        1  1630 1 1  98 LEU O    O -11.876  -3.258  -3.152 1.00 . A A .  98 LEU O    1 1 
        1  1631 1 1  99 TYR C    C -14.396  -3.503  -1.438 1.00 . A A .  99 TYR C    1 1 
        1  1632 1 1  99 TYR CA   C -14.205  -2.110  -2.058 1.00 . A A .  99 TYR CA   1 1 
        1  1633 1 1  99 TYR CB   C -15.474  -1.231  -1.876 1.00 . A A .  99 TYR CB   1 1 
        1  1634 1 1  99 TYR CD1  C -14.774   0.714  -3.402 1.00 . A A .  99 TYR CD1  1 1 
        1  1635 1 1  99 TYR CD2  C -15.549   1.248  -1.201 1.00 . A A .  99 TYR CD2  1 1 
        1  1636 1 1  99 TYR CE1  C -14.589   2.058  -3.656 1.00 . A A .  99 TYR CE1  1 1 
        1  1637 1 1  99 TYR CE2  C -15.363   2.589  -1.461 1.00 . A A .  99 TYR CE2  1 1 
        1  1638 1 1  99 TYR CG   C -15.260   0.271  -2.167 1.00 . A A .  99 TYR CG   1 1 
        1  1639 1 1  99 TYR CZ   C -14.884   2.986  -2.683 1.00 . A A .  99 TYR CZ   1 1 
        1  1640 1 1  99 TYR H    H -14.532  -1.961  -4.151 1.00 . A A .  99 TYR H    1 1 
        1  1641 1 1  99 TYR HA   H -13.367  -1.622  -1.567 1.00 . A A .  99 TYR HA   1 1 
        1  1642 1 1  99 TYR HB2  H -16.249  -1.587  -2.546 1.00 . A A .  99 TYR HB2  1 1 
        1  1643 1 1  99 TYR HB3  H -15.831  -1.331  -0.853 1.00 . A A .  99 TYR HB3  1 1 
        1  1644 1 1  99 TYR HD1  H -14.537  -0.017  -4.173 1.00 . A A .  99 TYR HD1  1 1 
        1  1645 1 1  99 TYR HD2  H -15.923   0.942  -0.232 1.00 . A A .  99 TYR HD2  1 1 
        1  1646 1 1  99 TYR HE1  H -14.211   2.375  -4.619 1.00 . A A .  99 TYR HE1  1 1 
        1  1647 1 1  99 TYR HE2  H -15.590   3.322  -0.700 1.00 . A A .  99 TYR HE2  1 1 
        1  1648 1 1  99 TYR HH   H -14.200   4.715  -2.206 1.00 . A A .  99 TYR HH   1 1 
        1  1649 1 1  99 TYR N    N -13.875  -2.254  -3.486 1.00 . A A .  99 TYR N    1 1 
        1  1650 1 1  99 TYR O    O -13.808  -3.813  -0.403 1.00 . A A .  99 TYR O    1 1 
        1  1651 1 1  99 TYR OH   O -14.699   4.321  -2.934 1.00 . A A .  99 TYR OH   1 1 
        1  1652 1 1 100 ARG C    C -14.167  -6.557  -1.769 1.00 . A A . 100 ARG C    1 1 
        1  1653 1 1 100 ARG CA   C -15.464  -5.738  -1.771 1.00 . A A . 100 ARG CA   1 1 
        1  1654 1 1 100 ARG CB   C -16.465  -6.356  -2.788 1.00 . A A . 100 ARG CB   1 1 
        1  1655 1 1 100 ARG CD   C -17.647  -8.448  -3.691 1.00 . A A . 100 ARG CD   1 1 
        1  1656 1 1 100 ARG CG   C -16.864  -7.829  -2.519 1.00 . A A . 100 ARG CG   1 1 
        1  1657 1 1 100 ARG CZ   C -18.177 -10.830  -4.292 1.00 . A A . 100 ARG CZ   1 1 
        1  1658 1 1 100 ARG H    H -15.609  -3.992  -2.944 1.00 . A A . 100 ARG H    1 1 
        1  1659 1 1 100 ARG HA   H -15.904  -5.752  -0.780 1.00 . A A . 100 ARG HA   1 1 
        1  1660 1 1 100 ARG HB2  H -17.371  -5.756  -2.783 1.00 . A A . 100 ARG HB2  1 1 
        1  1661 1 1 100 ARG HB3  H -16.027  -6.298  -3.783 1.00 . A A . 100 ARG HB3  1 1 
        1  1662 1 1 100 ARG HD2  H -18.526  -7.842  -3.887 1.00 . A A . 100 ARG HD2  1 1 
        1  1663 1 1 100 ARG HD3  H -17.014  -8.452  -4.574 1.00 . A A . 100 ARG HD3  1 1 
        1  1664 1 1 100 ARG HE   H -18.347 -10.010  -2.470 1.00 . A A . 100 ARG HE   1 1 
        1  1665 1 1 100 ARG HG2  H -15.965  -8.413  -2.354 1.00 . A A . 100 ARG HG2  1 1 
        1  1666 1 1 100 ARG HG3  H -17.479  -7.869  -1.624 1.00 . A A . 100 ARG HG3  1 1 
        1  1667 1 1 100 ARG HH11 H -17.502  -9.753  -5.870 1.00 . A A . 100 ARG HH11 1 1 
        1  1668 1 1 100 ARG HH12 H -17.901 -11.402  -6.218 1.00 . A A . 100 ARG HH12 1 1 
        1  1669 1 1 100 ARG HH21 H -18.913 -12.161  -2.952 1.00 . A A . 100 ARG HH21 1 1 
        1  1670 1 1 100 ARG HH22 H -18.701 -12.769  -4.564 1.00 . A A . 100 ARG HH22 1 1 
        1  1671 1 1 100 ARG N    N -15.191  -4.336  -2.136 1.00 . A A . 100 ARG N    1 1 
        1  1672 1 1 100 ARG NE   N -18.090  -9.827  -3.399 1.00 . A A . 100 ARG NE   1 1 
        1  1673 1 1 100 ARG NH1  N -17.833 -10.648  -5.563 1.00 . A A . 100 ARG NH1  1 1 
        1  1674 1 1 100 ARG NH2  N -18.629 -12.014  -3.905 1.00 . A A . 100 ARG NH2  1 1 
        1  1675 1 1 100 ARG O    O -13.950  -7.381  -0.874 1.00 . A A . 100 ARG O    1 1 
        1  1676 1 1 101 ALA C    C -11.104  -6.786  -1.767 1.00 . A A . 101 ALA C    1 1 
        1  1677 1 1 101 ALA CA   C -12.043  -7.035  -2.962 1.00 . A A . 101 ALA CA   1 1 
        1  1678 1 1 101 ALA CB   C -11.374  -6.621  -4.288 1.00 . A A . 101 ALA CB   1 1 
        1  1679 1 1 101 ALA H    H -13.541  -5.607  -3.436 1.00 . A A . 101 ALA H    1 1 
        1  1680 1 1 101 ALA HA   H -12.270  -8.095  -3.019 1.00 . A A . 101 ALA HA   1 1 
        1  1681 1 1 101 ALA HB1  H -11.134  -5.563  -4.263 1.00 . A A . 101 ALA HB1  1 1 
        1  1682 1 1 101 ALA HB2  H -12.051  -6.814  -5.111 1.00 . A A . 101 ALA HB2  1 1 
        1  1683 1 1 101 ALA HB3  H -10.466  -7.189  -4.436 1.00 . A A . 101 ALA HB3  1 1 
        1  1684 1 1 101 ALA N    N -13.315  -6.313  -2.787 1.00 . A A . 101 ALA N    1 1 
        1  1685 1 1 101 ALA O    O -10.762  -7.715  -1.033 1.00 . A A . 101 ALA O    1 1 
        1  1686 1 1 102 LEU C    C -10.370  -5.393   0.916 1.00 . A A . 102 LEU C    1 1 
        1  1687 1 1 102 LEU CA   C  -9.797  -5.117  -0.488 1.00 . A A . 102 LEU CA   1 1 
        1  1688 1 1 102 LEU CB   C  -9.392  -3.625  -0.642 1.00 . A A . 102 LEU CB   1 1 
        1  1689 1 1 102 LEU CD1  C  -8.349  -1.727  -2.037 1.00 . A A . 102 LEU CD1  1 1 
        1  1690 1 1 102 LEU CD2  C  -7.566  -4.143  -2.396 1.00 . A A . 102 LEU CD2  1 1 
        1  1691 1 1 102 LEU CG   C  -8.758  -3.222  -2.019 1.00 . A A . 102 LEU CG   1 1 
        1  1692 1 1 102 LEU H    H -11.130  -4.812  -2.114 1.00 . A A . 102 LEU H    1 1 
        1  1693 1 1 102 LEU HA   H  -8.903  -5.725  -0.612 1.00 . A A . 102 LEU HA   1 1 
        1  1694 1 1 102 LEU HB2  H -10.279  -3.017  -0.485 1.00 . A A . 102 LEU HB2  1 1 
        1  1695 1 1 102 LEU HB3  H  -8.678  -3.384   0.140 1.00 . A A . 102 LEU HB3  1 1 
        1  1696 1 1 102 LEU HD11 H  -9.219  -1.108  -1.850 1.00 . A A . 102 LEU HD11 1 1 
        1  1697 1 1 102 LEU HD12 H  -7.941  -1.470  -3.008 1.00 . A A . 102 LEU HD12 1 1 
        1  1698 1 1 102 LEU HD13 H  -7.603  -1.539  -1.276 1.00 . A A . 102 LEU HD13 1 1 
        1  1699 1 1 102 LEU HD21 H  -6.794  -4.074  -1.641 1.00 . A A . 102 LEU HD21 1 1 
        1  1700 1 1 102 LEU HD22 H  -7.159  -3.844  -3.355 1.00 . A A . 102 LEU HD22 1 1 
        1  1701 1 1 102 LEU HD23 H  -7.905  -5.168  -2.467 1.00 . A A . 102 LEU HD23 1 1 
        1  1702 1 1 102 LEU HG   H  -9.514  -3.346  -2.789 1.00 . A A . 102 LEU HG   1 1 
        1  1703 1 1 102 LEU N    N -10.745  -5.512  -1.547 1.00 . A A . 102 LEU N    1 1 
        1  1704 1 1 102 LEU O    O  -9.615  -5.688   1.844 1.00 . A A . 102 LEU O    1 1 
        1  1705 1 1 103 ASN C    C -12.180  -7.165   2.624 1.00 . A A . 103 ASN C    1 1 
        1  1706 1 1 103 ASN CA   C -12.397  -5.672   2.309 1.00 . A A . 103 ASN CA   1 1 
        1  1707 1 1 103 ASN CB   C -13.918  -5.327   2.219 1.00 . A A . 103 ASN CB   1 1 
        1  1708 1 1 103 ASN CG   C -14.720  -5.505   3.526 1.00 . A A . 103 ASN CG   1 1 
        1  1709 1 1 103 ASN H    H -12.254  -5.011   0.283 1.00 . A A . 103 ASN H    1 1 
        1  1710 1 1 103 ASN HA   H -11.947  -5.080   3.102 1.00 . A A . 103 ASN HA   1 1 
        1  1711 1 1 103 ASN HB2  H -14.011  -4.293   1.904 1.00 . A A . 103 ASN HB2  1 1 
        1  1712 1 1 103 ASN HB3  H -14.375  -5.954   1.461 1.00 . A A . 103 ASN HB3  1 1 
        1  1713 1 1 103 ASN HD21 H -15.864  -3.962   3.051 1.00 . A A . 103 ASN HD21 1 1 
        1  1714 1 1 103 ASN HD22 H -16.236  -4.748   4.542 1.00 . A A . 103 ASN HD22 1 1 
        1  1715 1 1 103 ASN N    N -11.712  -5.322   1.050 1.00 . A A . 103 ASN N    1 1 
        1  1716 1 1 103 ASN ND2  N -15.703  -4.654   3.729 1.00 . A A . 103 ASN ND2  1 1 
        1  1717 1 1 103 ASN O    O -11.506  -7.505   3.612 1.00 . A A . 103 ASN O    1 1 
        1  1718 1 1 103 ASN OD1  O -14.465  -6.384   4.340 1.00 . A A . 103 ASN OD1  1 1 
        1  1719 1 1 104 MET C    C -11.254 -10.038   2.097 1.00 . A A . 104 MET C    1 1 
        1  1720 1 1 104 MET CA   C -12.689  -9.503   1.918 1.00 . A A . 104 MET CA   1 1 
        1  1721 1 1 104 MET CB   C -13.381 -10.188   0.708 1.00 . A A . 104 MET CB   1 1 
        1  1722 1 1 104 MET CE   C -14.288 -14.090   2.008 1.00 . A A . 104 MET CE   1 1 
        1  1723 1 1 104 MET CG   C -13.452 -11.722   0.781 1.00 . A A . 104 MET CG   1 1 
        1  1724 1 1 104 MET H    H -13.158  -7.677   0.952 1.00 . A A . 104 MET H    1 1 
        1  1725 1 1 104 MET HA   H -13.252  -9.727   2.814 1.00 . A A . 104 MET HA   1 1 
        1  1726 1 1 104 MET HB2  H -14.392  -9.812   0.633 1.00 . A A . 104 MET HB2  1 1 
        1  1727 1 1 104 MET HB3  H -12.848  -9.915  -0.201 1.00 . A A . 104 MET HB3  1 1 
        1  1728 1 1 104 MET HE1  H -14.831 -14.573   2.808 1.00 . A A . 104 MET HE1  1 1 
        1  1729 1 1 104 MET HE2  H -13.251 -14.395   2.044 1.00 . A A . 104 MET HE2  1 1 
        1  1730 1 1 104 MET HE3  H -14.717 -14.380   1.059 1.00 . A A . 104 MET HE3  1 1 
        1  1731 1 1 104 MET HG2  H -13.920 -12.092  -0.123 1.00 . A A . 104 MET HG2  1 1 
        1  1732 1 1 104 MET HG3  H -12.445 -12.117   0.847 1.00 . A A . 104 MET HG3  1 1 
        1  1733 1 1 104 MET N    N -12.711  -8.036   1.744 1.00 . A A . 104 MET N    1 1 
        1  1734 1 1 104 MET O    O -11.012 -10.926   2.923 1.00 . A A . 104 MET O    1 1 
        1  1735 1 1 104 MET SD   S -14.399 -12.309   2.204 1.00 . A A . 104 MET SD   1 1 
        1  1736 1 1 105 HIS C    C  -8.228  -9.393   2.707 1.00 . A A . 105 HIS C    1 1 
        1  1737 1 1 105 HIS CA   C  -8.895  -9.869   1.394 1.00 . A A . 105 HIS CA   1 1 
        1  1738 1 1 105 HIS CB   C  -8.111  -9.364   0.144 1.00 . A A . 105 HIS CB   1 1 
        1  1739 1 1 105 HIS CD2  C  -9.449 -10.245  -1.937 1.00 . A A . 105 HIS CD2  1 1 
        1  1740 1 1 105 HIS CE1  C  -7.913 -11.548  -2.785 1.00 . A A . 105 HIS CE1  1 1 
        1  1741 1 1 105 HIS CG   C  -8.364 -10.167  -1.121 1.00 . A A . 105 HIS CG   1 1 
        1  1742 1 1 105 HIS H    H -10.580  -8.757   0.705 1.00 . A A . 105 HIS H    1 1 
        1  1743 1 1 105 HIS HA   H  -8.872 -10.959   1.388 1.00 . A A . 105 HIS HA   1 1 
        1  1744 1 1 105 HIS HB2  H  -8.388  -8.334  -0.058 1.00 . A A . 105 HIS HB2  1 1 
        1  1745 1 1 105 HIS HB3  H  -7.046  -9.399   0.351 1.00 . A A . 105 HIS HB3  1 1 
        1  1746 1 1 105 HIS HD1  H  -6.529 -11.191  -1.322 1.00 . A A . 105 HIS HD1  1 1 
        1  1747 1 1 105 HIS HD2  H -10.388  -9.720  -1.806 1.00 . A A . 105 HIS HD2  1 1 
        1  1748 1 1 105 HIS HE1  H  -7.393 -12.240  -3.436 1.00 . A A . 105 HIS HE1  1 1 
        1  1749 1 1 105 HIS HE2  H  -9.788 -11.476  -3.600 1.00 . A A . 105 HIS HE2  1 1 
        1  1750 1 1 105 HIS N    N -10.309  -9.468   1.329 1.00 . A A . 105 HIS N    1 1 
        1  1751 1 1 105 HIS ND1  N  -7.421 -11.005  -1.686 1.00 . A A . 105 HIS ND1  1 1 
        1  1752 1 1 105 HIS NE2  N  -9.139 -11.105  -2.957 1.00 . A A . 105 HIS NE2  1 1 
        1  1753 1 1 105 HIS O    O  -7.632 -10.204   3.422 1.00 . A A . 105 HIS O    1 1 
        1  1754 1 1 106 TYR C    C  -8.352  -7.411   5.470 1.00 . A A . 106 TYR C    1 1 
        1  1755 1 1 106 TYR CA   C  -7.564  -7.477   4.144 1.00 . A A . 106 TYR CA   1 1 
        1  1756 1 1 106 TYR CB   C  -7.044  -6.076   3.740 1.00 . A A . 106 TYR CB   1 1 
        1  1757 1 1 106 TYR CD1  C  -4.751  -6.534   2.685 1.00 . A A . 106 TYR CD1  1 1 
        1  1758 1 1 106 TYR CD2  C  -6.517  -5.820   1.245 1.00 . A A . 106 TYR CD2  1 1 
        1  1759 1 1 106 TYR CE1  C  -3.906  -6.624   1.598 1.00 . A A . 106 TYR CE1  1 1 
        1  1760 1 1 106 TYR CE2  C  -5.671  -5.903   0.164 1.00 . A A . 106 TYR CE2  1 1 
        1  1761 1 1 106 TYR CG   C  -6.084  -6.130   2.533 1.00 . A A . 106 TYR CG   1 1 
        1  1762 1 1 106 TYR CZ   C  -4.371  -6.306   0.345 1.00 . A A . 106 TYR CZ   1 1 
        1  1763 1 1 106 TYR H    H  -8.915  -7.509   2.485 1.00 . A A . 106 TYR H    1 1 
        1  1764 1 1 106 TYR HA   H  -6.691  -8.105   4.320 1.00 . A A . 106 TYR HA   1 1 
        1  1765 1 1 106 TYR HB2  H  -7.889  -5.441   3.488 1.00 . A A . 106 TYR HB2  1 1 
        1  1766 1 1 106 TYR HB3  H  -6.512  -5.629   4.576 1.00 . A A . 106 TYR HB3  1 1 
        1  1767 1 1 106 TYR HD1  H  -4.381  -6.783   3.674 1.00 . A A . 106 TYR HD1  1 1 
        1  1768 1 1 106 TYR HD2  H  -7.543  -5.502   1.095 1.00 . A A . 106 TYR HD2  1 1 
        1  1769 1 1 106 TYR HE1  H  -2.882  -6.939   1.736 1.00 . A A . 106 TYR HE1  1 1 
        1  1770 1 1 106 TYR HE2  H  -6.035  -5.649  -0.825 1.00 . A A . 106 TYR HE2  1 1 
        1  1771 1 1 106 TYR HH   H  -3.033  -7.226  -0.675 1.00 . A A . 106 TYR HH   1 1 
        1  1772 1 1 106 TYR N    N  -8.321  -8.084   3.017 1.00 . A A . 106 TYR N    1 1 
        1  1773 1 1 106 TYR O    O  -7.923  -8.000   6.476 1.00 . A A . 106 TYR O    1 1 
        1  1774 1 1 106 TYR OH   O  -3.544  -6.411  -0.739 1.00 . A A . 106 TYR OH   1 1 
        1  1775 1 1 107 ASN C    C -11.556  -5.677   6.453 1.00 . A A . 107 ASN C    1 1 
        1  1776 1 1 107 ASN CA   C -10.152  -6.249   6.747 1.00 . A A . 107 ASN CA   1 1 
        1  1777 1 1 107 ASN CB   C  -9.256  -5.164   7.428 1.00 . A A . 107 ASN CB   1 1 
        1  1778 1 1 107 ASN CG   C  -9.757  -4.646   8.787 1.00 . A A . 107 ASN CG   1 1 
        1  1779 1 1 107 ASN H    H  -9.965  -6.537   4.625 1.00 . A A . 107 ASN H    1 1 
        1  1780 1 1 107 ASN HA   H -10.253  -7.105   7.406 1.00 . A A . 107 ASN HA   1 1 
        1  1781 1 1 107 ASN HB2  H  -8.269  -5.585   7.586 1.00 . A A . 107 ASN HB2  1 1 
        1  1782 1 1 107 ASN HB3  H  -9.158  -4.324   6.751 1.00 . A A . 107 ASN HB3  1 1 
        1  1783 1 1 107 ASN HD21 H  -9.144  -2.807   8.350 1.00 . A A . 107 ASN HD21 1 1 
        1  1784 1 1 107 ASN HD22 H  -9.880  -3.010   9.901 1.00 . A A . 107 ASN HD22 1 1 
        1  1785 1 1 107 ASN N    N  -9.503  -6.708   5.481 1.00 . A A . 107 ASN N    1 1 
        1  1786 1 1 107 ASN ND2  N  -9.582  -3.357   9.040 1.00 . A A . 107 ASN ND2  1 1 
        1  1787 1 1 107 ASN O    O -11.841  -5.315   5.328 1.00 . A A . 107 ASN O    1 1 
        1  1788 1 1 107 ASN OD1  O -10.329  -5.394   9.579 1.00 . A A . 107 ASN OD1  1 1 
        1  1789 1 1 108 LYS C    C -13.881  -3.568   7.170 1.00 . A A . 108 LYS C    1 1 
        1  1790 1 1 108 LYS CA   C -13.804  -5.102   7.374 1.00 . A A . 108 LYS CA   1 1 
        1  1791 1 1 108 LYS CB   C -14.630  -5.581   8.611 1.00 . A A . 108 LYS CB   1 1 
        1  1792 1 1 108 LYS CD   C -16.934  -5.505   7.415 1.00 . A A . 108 LYS CD   1 1 
        1  1793 1 1 108 LYS CE   C -18.381  -4.978   7.486 1.00 . A A . 108 LYS CE   1 1 
        1  1794 1 1 108 LYS CG   C -16.110  -5.113   8.662 1.00 . A A . 108 LYS CG   1 1 
        1  1795 1 1 108 LYS H    H -12.010  -5.621   8.391 1.00 . A A . 108 LYS H    1 1 
        1  1796 1 1 108 LYS HA   H -14.212  -5.584   6.487 1.00 . A A . 108 LYS HA   1 1 
        1  1797 1 1 108 LYS HB2  H -14.620  -6.662   8.628 1.00 . A A . 108 LYS HB2  1 1 
        1  1798 1 1 108 LYS HB3  H -14.133  -5.223   9.507 1.00 . A A . 108 LYS HB3  1 1 
        1  1799 1 1 108 LYS HD2  H -16.455  -5.095   6.530 1.00 . A A . 108 LYS HD2  1 1 
        1  1800 1 1 108 LYS HD3  H -16.956  -6.586   7.337 1.00 . A A . 108 LYS HD3  1 1 
        1  1801 1 1 108 LYS HE2  H -18.873  -5.410   8.346 1.00 . A A . 108 LYS HE2  1 1 
        1  1802 1 1 108 LYS HE3  H -18.360  -3.899   7.588 1.00 . A A . 108 LYS HE3  1 1 
        1  1803 1 1 108 LYS HG2  H -16.578  -5.545   9.539 1.00 . A A . 108 LYS HG2  1 1 
        1  1804 1 1 108 LYS HG3  H -16.120  -4.029   8.763 1.00 . A A . 108 LYS HG3  1 1 
        1  1805 1 1 108 LYS HZ1  H -20.125  -4.950   6.334 1.00 . A A . 108 LYS HZ1  1 1 
        1  1806 1 1 108 LYS HZ2  H -19.205  -6.357   6.159 1.00 . A A . 108 LYS HZ2  1 1 
        1  1807 1 1 108 LYS HZ3  H -18.702  -4.922   5.426 1.00 . A A . 108 LYS HZ3  1 1 
        1  1808 1 1 108 LYS N    N -12.395  -5.530   7.502 1.00 . A A . 108 LYS N    1 1 
        1  1809 1 1 108 LYS NZ   N -19.158  -5.324   6.270 1.00 . A A . 108 LYS NZ   1 1 
        1  1810 1 1 108 LYS O    O -14.124  -2.809   8.119 1.00 . A A . 108 LYS O    1 1 
        1  1811 1 1 109 ALA C    C -13.219  -0.629   6.359 1.00 . A A . 109 ALA C    1 1 
        1  1812 1 1 109 ALA CA   C -13.699  -1.759   5.393 1.00 . A A . 109 ALA CA   1 1 
        1  1813 1 1 109 ALA CB   C -15.152  -1.515   4.926 1.00 . A A . 109 ALA CB   1 1 
        1  1814 1 1 109 ALA H    H -13.315  -3.847   5.285 1.00 . A A . 109 ALA H    1 1 
        1  1815 1 1 109 ALA HA   H -13.071  -1.717   4.512 1.00 . A A . 109 ALA HA   1 1 
        1  1816 1 1 109 ALA HB1  H -15.219  -0.565   4.408 1.00 . A A . 109 ALA HB1  1 1 
        1  1817 1 1 109 ALA HB2  H -15.814  -1.504   5.782 1.00 . A A . 109 ALA HB2  1 1 
        1  1818 1 1 109 ALA HB3  H -15.460  -2.305   4.251 1.00 . A A . 109 ALA HB3  1 1 
        1  1819 1 1 109 ALA N    N -13.587  -3.153   5.918 1.00 . A A . 109 ALA N    1 1 
        1  1820 1 1 109 ALA O    O -13.630   0.523   6.219 1.00 . A A . 109 ALA O    1 1 
        1  1821 1 1 110 ASN C    C -10.519   0.664   7.894 1.00 . A A . 110 ASN C    1 1 
        1  1822 1 1 110 ASN CA   C -11.845   0.013   8.335 1.00 . A A . 110 ASN CA   1 1 
        1  1823 1 1 110 ASN CB   C -11.688  -0.713   9.699 1.00 . A A . 110 ASN CB   1 1 
        1  1824 1 1 110 ASN CG   C -11.443   0.226  10.893 1.00 . A A . 110 ASN CG   1 1 
        1  1825 1 1 110 ASN H    H -11.990  -1.876   7.354 1.00 . A A . 110 ASN H    1 1 
        1  1826 1 1 110 ASN HA   H -12.589   0.798   8.444 1.00 . A A . 110 ASN HA   1 1 
        1  1827 1 1 110 ASN HB2  H -12.593  -1.274   9.902 1.00 . A A . 110 ASN HB2  1 1 
        1  1828 1 1 110 ASN HB3  H -10.857  -1.415   9.637 1.00 . A A . 110 ASN HB3  1 1 
        1  1829 1 1 110 ASN HD21 H -12.735   1.569  10.194 1.00 . A A . 110 ASN HD21 1 1 
        1  1830 1 1 110 ASN HD22 H -11.956   1.971  11.677 1.00 . A A . 110 ASN HD22 1 1 
        1  1831 1 1 110 ASN N    N -12.327  -0.953   7.315 1.00 . A A . 110 ASN N    1 1 
        1  1832 1 1 110 ASN ND2  N -12.112   1.370  10.924 1.00 . A A . 110 ASN ND2  1 1 
        1  1833 1 1 110 ASN O    O  -9.887   1.422   8.645 1.00 . A A . 110 ASN O    1 1 
        1  1834 1 1 110 ASN OD1  O -10.685  -0.101  11.801 1.00 . A A . 110 ASN OD1  1 1 
        1  1835 1 1 111 ASP C    C  -9.189   2.226   5.414 1.00 . A A . 111 ASP C    1 1 
        1  1836 1 1 111 ASP CA   C  -8.873   0.886   6.067 1.00 . A A . 111 ASP CA   1 1 
        1  1837 1 1 111 ASP CB   C  -8.307  -0.137   5.055 1.00 . A A . 111 ASP CB   1 1 
        1  1838 1 1 111 ASP CG   C  -7.945  -1.487   5.699 1.00 . A A . 111 ASP CG   1 1 
        1  1839 1 1 111 ASP H    H -10.662  -0.222   6.115 1.00 . A A . 111 ASP H    1 1 
        1  1840 1 1 111 ASP HA   H  -8.145   1.045   6.860 1.00 . A A . 111 ASP HA   1 1 
        1  1841 1 1 111 ASP HB2  H  -9.048  -0.314   4.286 1.00 . A A . 111 ASP HB2  1 1 
        1  1842 1 1 111 ASP HB3  H  -7.423   0.288   4.593 1.00 . A A . 111 ASP HB3  1 1 
        1  1843 1 1 111 ASP N    N -10.108   0.369   6.660 1.00 . A A . 111 ASP N    1 1 
        1  1844 1 1 111 ASP O    O  -9.253   2.353   4.182 1.00 . A A . 111 ASP O    1 1 
        1  1845 1 1 111 ASP OD1  O  -8.846  -2.138   6.270 1.00 . A A . 111 ASP OD1  1 1 
        1  1846 1 1 111 ASP OD2  O  -6.766  -1.881   5.679 1.00 . A A . 111 ASP OD2  1 1 
        1  1847 1 1 112 PHE C    C -11.415   4.531   5.363 1.00 . A A . 112 PHE C    1 1 
        1  1848 1 1 112 PHE CA   C  -9.978   4.560   5.962 1.00 . A A . 112 PHE CA   1 1 
        1  1849 1 1 112 PHE CB   C  -9.026   5.298   4.974 1.00 . A A . 112 PHE CB   1 1 
        1  1850 1 1 112 PHE CD1  C  -6.648   4.576   5.528 1.00 . A A . 112 PHE CD1  1 1 
        1  1851 1 1 112 PHE CD2  C  -7.228   6.868   5.837 1.00 . A A . 112 PHE CD2  1 1 
        1  1852 1 1 112 PHE CE1  C  -5.364   4.850   5.934 1.00 . A A . 112 PHE CE1  1 1 
        1  1853 1 1 112 PHE CE2  C  -5.935   7.141   6.236 1.00 . A A . 112 PHE CE2  1 1 
        1  1854 1 1 112 PHE CG   C  -7.609   5.584   5.475 1.00 . A A . 112 PHE CG   1 1 
        1  1855 1 1 112 PHE CZ   C  -5.006   6.132   6.284 1.00 . A A . 112 PHE CZ   1 1 
        1  1856 1 1 112 PHE H    H  -9.356   2.991   7.253 1.00 . A A . 112 PHE H    1 1 
        1  1857 1 1 112 PHE HA   H -10.014   5.121   6.891 1.00 . A A . 112 PHE HA   1 1 
        1  1858 1 1 112 PHE HB2  H  -8.934   4.698   4.074 1.00 . A A . 112 PHE HB2  1 1 
        1  1859 1 1 112 PHE HB3  H  -9.482   6.248   4.694 1.00 . A A . 112 PHE HB3  1 1 
        1  1860 1 1 112 PHE HD1  H  -6.920   3.561   5.256 1.00 . A A . 112 PHE HD1  1 1 
        1  1861 1 1 112 PHE HD2  H  -7.958   7.669   5.807 1.00 . A A . 112 PHE HD2  1 1 
        1  1862 1 1 112 PHE HE1  H  -4.630   4.053   5.970 1.00 . A A . 112 PHE HE1  1 1 
        1  1863 1 1 112 PHE HE2  H  -5.660   8.151   6.514 1.00 . A A . 112 PHE HE2  1 1 
        1  1864 1 1 112 PHE HZ   H  -3.991   6.343   6.593 1.00 . A A . 112 PHE HZ   1 1 
        1  1865 1 1 112 PHE N    N  -9.484   3.201   6.304 1.00 . A A . 112 PHE N    1 1 
        1  1866 1 1 112 PHE O    O -11.990   5.590   5.130 1.00 . A A . 112 PHE O    1 1 
        1  1867 1 1 113 GLU C    C -12.914   3.516   2.843 1.00 . A A . 113 GLU C    1 1 
        1  1868 1 1 113 GLU CA   C -13.177   3.066   4.312 1.00 . A A . 113 GLU CA   1 1 
        1  1869 1 1 113 GLU CB   C -14.439   3.729   4.965 1.00 . A A . 113 GLU CB   1 1 
        1  1870 1 1 113 GLU CD   C -17.015   3.812   5.141 1.00 . A A . 113 GLU CD   1 1 
        1  1871 1 1 113 GLU CG   C -15.791   3.255   4.392 1.00 . A A . 113 GLU CG   1 1 
        1  1872 1 1 113 GLU H    H -11.496   2.541   5.500 1.00 . A A . 113 GLU H    1 1 
        1  1873 1 1 113 GLU HA   H -13.318   1.988   4.297 1.00 . A A . 113 GLU HA   1 1 
        1  1874 1 1 113 GLU HB2  H -14.429   3.510   6.029 1.00 . A A . 113 GLU HB2  1 1 
        1  1875 1 1 113 GLU HB3  H -14.369   4.804   4.837 1.00 . A A . 113 GLU HB3  1 1 
        1  1876 1 1 113 GLU HG2  H -15.850   3.565   3.352 1.00 . A A . 113 GLU HG2  1 1 
        1  1877 1 1 113 GLU HG3  H -15.812   2.168   4.427 1.00 . A A . 113 GLU HG3  1 1 
        1  1878 1 1 113 GLU N    N -11.960   3.311   5.130 1.00 . A A . 113 GLU N    1 1 
        1  1879 1 1 113 GLU O    O -13.831   3.857   2.092 1.00 . A A . 113 GLU O    1 1 
        1  1880 1 1 113 GLU OE1  O -17.211   5.044   5.154 1.00 . A A . 113 GLU OE1  1 1 
        1  1881 1 1 113 GLU OE2  O -17.771   3.023   5.749 1.00 . A A . 113 GLU OE2  1 1 
        1  1882 1 1 114 VAL C    C -11.727   5.049   0.484 1.00 . A A . 114 VAL C    1 1 
        1  1883 1 1 114 VAL CA   C -11.011   3.842   1.180 1.00 . A A . 114 VAL CA   1 1 
        1  1884 1 1 114 VAL CB   C -10.743   2.634   0.178 1.00 . A A . 114 VAL CB   1 1 
        1  1885 1 1 114 VAL CG1  C  -9.610   1.717   0.713 1.00 . A A . 114 VAL CG1  1 1 
        1  1886 1 1 114 VAL CG2  C -12.021   1.799  -0.115 1.00 . A A . 114 VAL CG2  1 1 
        1  1887 1 1 114 VAL H    H -11.013   2.964   3.093 1.00 . A A . 114 VAL H    1 1 
        1  1888 1 1 114 VAL HA   H -10.031   4.216   1.463 1.00 . A A . 114 VAL HA   1 1 
        1  1889 1 1 114 VAL HB   H -10.397   3.057  -0.768 1.00 . A A . 114 VAL HB   1 1 
        1  1890 1 1 114 VAL HG11 H  -8.705   2.299   0.852 1.00 . A A . 114 VAL HG11 1 1 
        1  1891 1 1 114 VAL HG12 H  -9.411   0.924   0.006 1.00 . A A . 114 VAL HG12 1 1 
        1  1892 1 1 114 VAL HG13 H  -9.904   1.286   1.663 1.00 . A A . 114 VAL HG13 1 1 
        1  1893 1 1 114 VAL HG21 H -12.392   1.362   0.803 1.00 . A A . 114 VAL HG21 1 1 
        1  1894 1 1 114 VAL HG22 H -11.795   1.011  -0.824 1.00 . A A . 114 VAL HG22 1 1 
        1  1895 1 1 114 VAL HG23 H -12.786   2.439  -0.535 1.00 . A A . 114 VAL HG23 1 1 
        1  1896 1 1 114 VAL N    N -11.612   3.401   2.462 1.00 . A A . 114 VAL N    1 1 
        1  1897 1 1 114 VAL O    O -12.614   4.861  -0.369 1.00 . A A . 114 VAL O    1 1 
        1  1898 1 1 115 PRO C    C -11.041   7.538  -1.254 1.00 . A A . 115 PRO C    1 1 
        1  1899 1 1 115 PRO CA   C -11.710   7.550   0.134 1.00 . A A . 115 PRO CA   1 1 
        1  1900 1 1 115 PRO CB   C -11.139   8.693   1.021 1.00 . A A . 115 PRO CB   1 1 
        1  1901 1 1 115 PRO CD   C -10.788   6.661   2.216 1.00 . A A . 115 PRO CD   1 1 
        1  1902 1 1 115 PRO CG   C -11.118   8.118   2.400 1.00 . A A . 115 PRO CG   1 1 
        1  1903 1 1 115 PRO HA   H -12.783   7.676   0.009 1.00 . A A . 115 PRO HA   1 1 
        1  1904 1 1 115 PRO HB2  H -10.130   8.967   0.699 1.00 . A A . 115 PRO HB2  1 1 
        1  1905 1 1 115 PRO HB3  H -11.781   9.562   0.986 1.00 . A A . 115 PRO HB3  1 1 
        1  1906 1 1 115 PRO HD2  H  -9.715   6.509   2.182 1.00 . A A . 115 PRO HD2  1 1 
        1  1907 1 1 115 PRO HD3  H -11.221   6.065   3.009 1.00 . A A . 115 PRO HD3  1 1 
        1  1908 1 1 115 PRO HG2  H -10.358   8.613   3.001 1.00 . A A . 115 PRO HG2  1 1 
        1  1909 1 1 115 PRO HG3  H -12.092   8.223   2.870 1.00 . A A . 115 PRO HG3  1 1 
        1  1910 1 1 115 PRO N    N -11.403   6.322   0.913 1.00 . A A . 115 PRO N    1 1 
        1  1911 1 1 115 PRO O    O -10.173   6.697  -1.527 1.00 . A A . 115 PRO O    1 1 
        1  1912 1 1 116 GLU C    C  -9.423   8.631  -3.625 1.00 . A A . 116 GLU C    1 1 
        1  1913 1 1 116 GLU CA   C -10.968   8.612  -3.505 1.00 . A A . 116 GLU CA   1 1 
        1  1914 1 1 116 GLU CB   C -11.592   9.876  -4.161 1.00 . A A . 116 GLU CB   1 1 
        1  1915 1 1 116 GLU CD   C -11.910  11.291  -6.292 1.00 . A A . 116 GLU CD   1 1 
        1  1916 1 1 116 GLU CG   C -11.272  10.041  -5.656 1.00 . A A . 116 GLU CG   1 1 
        1  1917 1 1 116 GLU H    H -12.070   9.171  -1.788 1.00 . A A . 116 GLU H    1 1 
        1  1918 1 1 116 GLU HA   H -11.342   7.737  -4.031 1.00 . A A . 116 GLU HA   1 1 
        1  1919 1 1 116 GLU HB2  H -12.671   9.828  -4.049 1.00 . A A . 116 GLU HB2  1 1 
        1  1920 1 1 116 GLU HB3  H -11.232  10.755  -3.636 1.00 . A A . 116 GLU HB3  1 1 
        1  1921 1 1 116 GLU HG2  H -10.194  10.100  -5.768 1.00 . A A . 116 GLU HG2  1 1 
        1  1922 1 1 116 GLU HG3  H -11.626   9.161  -6.185 1.00 . A A . 116 GLU HG3  1 1 
        1  1923 1 1 116 GLU N    N -11.429   8.504  -2.108 1.00 . A A . 116 GLU N    1 1 
        1  1924 1 1 116 GLU O    O  -8.892   8.183  -4.630 1.00 . A A . 116 GLU O    1 1 
        1  1925 1 1 116 GLU OE1  O -13.111  11.254  -6.625 1.00 . A A . 116 GLU OE1  1 1 
        1  1926 1 1 116 GLU OE2  O -11.215  12.319  -6.455 1.00 . A A . 116 GLU OE2  1 1 
        1  1927 1 1 117 ARG C    C  -6.648   7.750  -2.675 1.00 . A A . 117 ARG C    1 1 
        1  1928 1 1 117 ARG CA   C  -7.249   9.164  -2.480 1.00 . A A . 117 ARG CA   1 1 
        1  1929 1 1 117 ARG CB   C  -6.833   9.741  -1.091 1.00 . A A . 117 ARG CB   1 1 
        1  1930 1 1 117 ARG CD   C  -4.937  10.511   0.482 1.00 . A A . 117 ARG CD   1 1 
        1  1931 1 1 117 ARG CG   C  -5.304   9.828  -0.852 1.00 . A A . 117 ARG CG   1 1 
        1  1932 1 1 117 ARG CZ   C  -5.717  10.303   2.868 1.00 . A A . 117 ARG CZ   1 1 
        1  1933 1 1 117 ARG H    H  -9.240   9.681  -1.925 1.00 . A A . 117 ARG H    1 1 
        1  1934 1 1 117 ARG HA   H  -6.858   9.819  -3.254 1.00 . A A . 117 ARG HA   1 1 
        1  1935 1 1 117 ARG HB2  H  -7.248  10.742  -0.994 1.00 . A A . 117 ARG HB2  1 1 
        1  1936 1 1 117 ARG HB3  H  -7.262   9.118  -0.315 1.00 . A A . 117 ARG HB3  1 1 
        1  1937 1 1 117 ARG HD2  H  -3.857  10.595   0.541 1.00 . A A . 117 ARG HD2  1 1 
        1  1938 1 1 117 ARG HD3  H  -5.366  11.509   0.491 1.00 . A A . 117 ARG HD3  1 1 
        1  1939 1 1 117 ARG HE   H  -5.503   8.799   1.553 1.00 . A A . 117 ARG HE   1 1 
        1  1940 1 1 117 ARG HG2  H  -4.896   8.825  -0.849 1.00 . A A . 117 ARG HG2  1 1 
        1  1941 1 1 117 ARG HG3  H  -4.852  10.387  -1.670 1.00 . A A . 117 ARG HG3  1 1 
        1  1942 1 1 117 ARG HH11 H  -5.276  12.204   2.324 1.00 . A A . 117 ARG HH11 1 1 
        1  1943 1 1 117 ARG HH12 H  -5.817  12.003   3.959 1.00 . A A . 117 ARG HH12 1 1 
        1  1944 1 1 117 ARG HH21 H  -6.265   8.549   3.714 1.00 . A A . 117 ARG HH21 1 1 
        1  1945 1 1 117 ARG HH22 H  -6.380   9.931   4.751 1.00 . A A . 117 ARG HH22 1 1 
        1  1946 1 1 117 ARG N    N  -8.735   9.173  -2.598 1.00 . A A . 117 ARG N    1 1 
        1  1947 1 1 117 ARG NE   N  -5.414   9.761   1.664 1.00 . A A . 117 ARG NE   1 1 
        1  1948 1 1 117 ARG NH1  N  -5.590  11.606   3.069 1.00 . A A . 117 ARG NH1  1 1 
        1  1949 1 1 117 ARG NH2  N  -6.157   9.532   3.854 1.00 . A A . 117 ARG NH2  1 1 
        1  1950 1 1 117 ARG O    O  -5.613   7.586  -3.322 1.00 . A A . 117 ARG O    1 1 
        1  1951 1 1 118 PHE C    C  -7.282   4.643  -3.437 1.00 . A A . 118 PHE C    1 1 
        1  1952 1 1 118 PHE CA   C  -6.886   5.332  -2.138 1.00 . A A . 118 PHE CA   1 1 
        1  1953 1 1 118 PHE CB   C  -7.465   4.590  -0.915 1.00 . A A . 118 PHE CB   1 1 
        1  1954 1 1 118 PHE CD1  C  -7.514   6.316   0.939 1.00 . A A . 118 PHE CD1  1 1 
        1  1955 1 1 118 PHE CD2  C  -5.793   4.673   0.977 1.00 . A A . 118 PHE CD2  1 1 
        1  1956 1 1 118 PHE CE1  C  -6.974   6.904   2.051 1.00 . A A . 118 PHE CE1  1 1 
        1  1957 1 1 118 PHE CE2  C  -5.259   5.254   2.100 1.00 . A A . 118 PHE CE2  1 1 
        1  1958 1 1 118 PHE CG   C  -6.930   5.188   0.379 1.00 . A A . 118 PHE CG   1 1 
        1  1959 1 1 118 PHE CZ   C  -5.845   6.372   2.632 1.00 . A A . 118 PHE CZ   1 1 
        1  1960 1 1 118 PHE H    H  -8.171   6.964  -1.669 1.00 . A A . 118 PHE H    1 1 
        1  1961 1 1 118 PHE HA   H  -5.799   5.318  -2.066 1.00 . A A . 118 PHE HA   1 1 
        1  1962 1 1 118 PHE HB2  H  -8.551   4.670  -0.920 1.00 . A A . 118 PHE HB2  1 1 
        1  1963 1 1 118 PHE HB3  H  -7.185   3.542  -0.955 1.00 . A A . 118 PHE HB3  1 1 
        1  1964 1 1 118 PHE HD1  H  -8.409   6.737   0.486 1.00 . A A . 118 PHE HD1  1 1 
        1  1965 1 1 118 PHE HD2  H  -5.327   3.789   0.562 1.00 . A A . 118 PHE HD2  1 1 
        1  1966 1 1 118 PHE HE1  H  -7.439   7.786   2.475 1.00 . A A . 118 PHE HE1  1 1 
        1  1967 1 1 118 PHE HE2  H  -4.368   4.835   2.557 1.00 . A A . 118 PHE HE2  1 1 
        1  1968 1 1 118 PHE HZ   H  -5.419   6.839   3.513 1.00 . A A . 118 PHE HZ   1 1 
        1  1969 1 1 118 PHE N    N  -7.330   6.747  -2.117 1.00 . A A . 118 PHE N    1 1 
        1  1970 1 1 118 PHE O    O  -6.624   3.698  -3.866 1.00 . A A . 118 PHE O    1 1 
        1  1971 1 1 119 LEU C    C  -7.872   5.350  -6.442 1.00 . A A . 119 LEU C    1 1 
        1  1972 1 1 119 LEU CA   C  -8.798   4.716  -5.393 1.00 . A A . 119 LEU CA   1 1 
        1  1973 1 1 119 LEU CB   C -10.280   5.115  -5.659 1.00 . A A . 119 LEU CB   1 1 
        1  1974 1 1 119 LEU CD1  C -11.261   2.758  -5.278 1.00 . A A . 119 LEU CD1  1 1 
        1  1975 1 1 119 LEU CD2  C -11.413   4.505  -3.421 1.00 . A A . 119 LEU CD2  1 1 
        1  1976 1 1 119 LEU CG   C -11.388   4.266  -4.946 1.00 . A A . 119 LEU CG   1 1 
        1  1977 1 1 119 LEU H    H  -8.918   5.787  -3.558 1.00 . A A . 119 LEU H    1 1 
        1  1978 1 1 119 LEU HA   H  -8.709   3.635  -5.466 1.00 . A A . 119 LEU HA   1 1 
        1  1979 1 1 119 LEU HB2  H -10.408   6.153  -5.368 1.00 . A A . 119 LEU HB2  1 1 
        1  1980 1 1 119 LEU HB3  H -10.462   5.054  -6.730 1.00 . A A . 119 LEU HB3  1 1 
        1  1981 1 1 119 LEU HD11 H -12.059   2.208  -4.795 1.00 . A A . 119 LEU HD11 1 1 
        1  1982 1 1 119 LEU HD12 H -10.308   2.379  -4.929 1.00 . A A . 119 LEU HD12 1 1 
        1  1983 1 1 119 LEU HD13 H -11.330   2.612  -6.348 1.00 . A A . 119 LEU HD13 1 1 
        1  1984 1 1 119 LEU HD21 H -11.581   5.557  -3.220 1.00 . A A . 119 LEU HD21 1 1 
        1  1985 1 1 119 LEU HD22 H -10.469   4.205  -2.980 1.00 . A A . 119 LEU HD22 1 1 
        1  1986 1 1 119 LEU HD23 H -12.214   3.933  -2.975 1.00 . A A . 119 LEU HD23 1 1 
        1  1987 1 1 119 LEU HG   H -12.350   4.586  -5.335 1.00 . A A . 119 LEU HG   1 1 
        1  1988 1 1 119 LEU N    N  -8.375   5.123  -4.039 1.00 . A A . 119 LEU N    1 1 
        1  1989 1 1 119 LEU O    O  -7.681   4.794  -7.522 1.00 . A A . 119 LEU O    1 1 
        1  1990 1 1 120 GLU C    C  -4.994   6.588  -6.903 1.00 . A A . 120 GLU C    1 1 
        1  1991 1 1 120 GLU CA   C  -6.368   7.267  -6.934 1.00 . A A . 120 GLU CA   1 1 
        1  1992 1 1 120 GLU CB   C  -6.252   8.741  -6.453 1.00 . A A . 120 GLU CB   1 1 
        1  1993 1 1 120 GLU CD   C  -5.894   9.915  -8.727 1.00 . A A . 120 GLU CD   1 1 
        1  1994 1 1 120 GLU CG   C  -5.342   9.643  -7.319 1.00 . A A . 120 GLU CG   1 1 
        1  1995 1 1 120 GLU H    H  -7.505   6.882  -5.206 1.00 . A A . 120 GLU H    1 1 
        1  1996 1 1 120 GLU HA   H  -6.748   7.254  -7.952 1.00 . A A . 120 GLU HA   1 1 
        1  1997 1 1 120 GLU HB2  H  -7.247   9.182  -6.434 1.00 . A A . 120 GLU HB2  1 1 
        1  1998 1 1 120 GLU HB3  H  -5.864   8.746  -5.437 1.00 . A A . 120 GLU HB3  1 1 
        1  1999 1 1 120 GLU HG2  H  -5.211  10.589  -6.806 1.00 . A A . 120 GLU HG2  1 1 
        1  2000 1 1 120 GLU HG3  H  -4.366   9.168  -7.409 1.00 . A A . 120 GLU HG3  1 1 
        1  2001 1 1 120 GLU N    N  -7.303   6.517  -6.088 1.00 . A A . 120 GLU N    1 1 
        1  2002 1 1 120 GLU O    O  -4.356   6.431  -7.946 1.00 . A A . 120 GLU O    1 1 
        1  2003 1 1 120 GLU OE1  O  -6.662  10.889  -8.893 1.00 . A A . 120 GLU OE1  1 1 
        1  2004 1 1 120 GLU OE2  O  -5.567   9.164  -9.670 1.00 . A A . 120 GLU OE2  1 1 
        1  2005 1 1 121 VAL C    C  -3.498   4.045  -6.258 1.00 . A A . 121 VAL C    1 1 
        1  2006 1 1 121 VAL CA   C  -3.323   5.392  -5.546 1.00 . A A . 121 VAL CA   1 1 
        1  2007 1 1 121 VAL CB   C  -2.892   5.160  -4.046 1.00 . A A . 121 VAL CB   1 1 
        1  2008 1 1 121 VAL CG1  C  -1.749   4.118  -3.953 1.00 . A A . 121 VAL CG1  1 1 
        1  2009 1 1 121 VAL CG2  C  -2.460   6.483  -3.368 1.00 . A A . 121 VAL CG2  1 1 
        1  2010 1 1 121 VAL H    H  -5.048   6.447  -4.893 1.00 . A A . 121 VAL H    1 1 
        1  2011 1 1 121 VAL HA   H  -2.520   5.939  -6.045 1.00 . A A . 121 VAL HA   1 1 
        1  2012 1 1 121 VAL HB   H  -3.750   4.766  -3.505 1.00 . A A . 121 VAL HB   1 1 
        1  2013 1 1 121 VAL HG11 H  -0.885   4.471  -4.503 1.00 . A A . 121 VAL HG11 1 1 
        1  2014 1 1 121 VAL HG12 H  -2.075   3.176  -4.372 1.00 . A A . 121 VAL HG12 1 1 
        1  2015 1 1 121 VAL HG13 H  -1.477   3.964  -2.920 1.00 . A A . 121 VAL HG13 1 1 
        1  2016 1 1 121 VAL HG21 H  -2.233   6.301  -2.324 1.00 . A A . 121 VAL HG21 1 1 
        1  2017 1 1 121 VAL HG22 H  -3.262   7.209  -3.435 1.00 . A A . 121 VAL HG22 1 1 
        1  2018 1 1 121 VAL HG23 H  -1.574   6.882  -3.854 1.00 . A A . 121 VAL HG23 1 1 
        1  2019 1 1 121 VAL N    N  -4.545   6.191  -5.692 1.00 . A A . 121 VAL N    1 1 
        1  2020 1 1 121 VAL O    O  -2.616   3.651  -6.998 1.00 . A A . 121 VAL O    1 1 
        1  2021 1 1 122 ALA C    C  -4.906   2.245  -8.243 1.00 . A A . 122 ALA C    1 1 
        1  2022 1 1 122 ALA CA   C  -4.973   2.087  -6.715 1.00 . A A . 122 ALA CA   1 1 
        1  2023 1 1 122 ALA CB   C  -6.364   1.589  -6.299 1.00 . A A . 122 ALA CB   1 1 
        1  2024 1 1 122 ALA H    H  -5.269   3.709  -5.361 1.00 . A A . 122 ALA H    1 1 
        1  2025 1 1 122 ALA HA   H  -4.242   1.342  -6.404 1.00 . A A . 122 ALA HA   1 1 
        1  2026 1 1 122 ALA HB1  H  -7.111   2.308  -6.611 1.00 . A A . 122 ALA HB1  1 1 
        1  2027 1 1 122 ALA HB2  H  -6.402   1.477  -5.223 1.00 . A A . 122 ALA HB2  1 1 
        1  2028 1 1 122 ALA HB3  H  -6.571   0.633  -6.764 1.00 . A A . 122 ALA HB3  1 1 
        1  2029 1 1 122 ALA N    N  -4.641   3.361  -6.025 1.00 . A A . 122 ALA N    1 1 
        1  2030 1 1 122 ALA O    O  -4.331   1.394  -8.946 1.00 . A A . 122 ALA O    1 1 
        1  2031 1 1 123 GLN C    C  -4.043   3.786 -10.679 1.00 . A A . 123 GLN C    1 1 
        1  2032 1 1 123 GLN CA   C  -5.480   3.751 -10.137 1.00 . A A . 123 GLN CA   1 1 
        1  2033 1 1 123 GLN CB   C  -6.213   5.127 -10.313 1.00 . A A . 123 GLN CB   1 1 
        1  2034 1 1 123 GLN CD   C  -5.277   6.188 -12.498 1.00 . A A . 123 GLN CD   1 1 
        1  2035 1 1 123 GLN CG   C  -6.494   5.618 -11.762 1.00 . A A . 123 GLN CG   1 1 
        1  2036 1 1 123 GLN H    H  -5.877   3.997  -8.072 1.00 . A A . 123 GLN H    1 1 
        1  2037 1 1 123 GLN HA   H  -6.043   2.989 -10.668 1.00 . A A . 123 GLN HA   1 1 
        1  2038 1 1 123 GLN HB2  H  -7.172   5.058  -9.810 1.00 . A A . 123 GLN HB2  1 1 
        1  2039 1 1 123 GLN HB3  H  -5.631   5.892  -9.809 1.00 . A A . 123 GLN HB3  1 1 
        1  2040 1 1 123 GLN HE21 H  -5.507   7.932 -11.581 1.00 . A A . 123 GLN HE21 1 1 
        1  2041 1 1 123 GLN HE22 H  -4.171   7.823 -12.670 1.00 . A A . 123 GLN HE22 1 1 
        1  2042 1 1 123 GLN HG2  H  -6.874   4.782 -12.337 1.00 . A A . 123 GLN HG2  1 1 
        1  2043 1 1 123 GLN HG3  H  -7.262   6.384 -11.726 1.00 . A A . 123 GLN HG3  1 1 
        1  2044 1 1 123 GLN N    N  -5.465   3.378  -8.719 1.00 . A A . 123 GLN N    1 1 
        1  2045 1 1 123 GLN NE2  N  -4.957   7.443 -12.230 1.00 . A A . 123 GLN NE2  1 1 
        1  2046 1 1 123 GLN O    O  -3.698   3.018 -11.577 1.00 . A A . 123 GLN O    1 1 
        1  2047 1 1 123 GLN OE1  O  -4.607   5.492 -13.259 1.00 . A A . 123 GLN OE1  1 1 
        1  2048 1 1 124 ILE C    C  -0.908   3.725 -10.330 1.00 . A A . 124 ILE C    1 1 
        1  2049 1 1 124 ILE CA   C  -1.854   4.934 -10.535 1.00 . A A . 124 ILE CA   1 1 
        1  2050 1 1 124 ILE CB   C  -1.306   6.233  -9.822 1.00 . A A . 124 ILE CB   1 1 
        1  2051 1 1 124 ILE CD1  C  -1.848   8.775  -9.545 1.00 . A A . 124 ILE CD1  1 1 
        1  2052 1 1 124 ILE CG1  C  -2.262   7.438 -10.128 1.00 . A A . 124 ILE CG1  1 1 
        1  2053 1 1 124 ILE CG2  C   0.151   6.555 -10.236 1.00 . A A . 124 ILE CG2  1 1 
        1  2054 1 1 124 ILE H    H  -3.540   5.084  -9.246 1.00 . A A . 124 ILE H    1 1 
        1  2055 1 1 124 ILE HA   H  -1.913   5.141 -11.601 1.00 . A A . 124 ILE HA   1 1 
        1  2056 1 1 124 ILE HB   H  -1.314   6.047  -8.750 1.00 . A A . 124 ILE HB   1 1 
        1  2057 1 1 124 ILE HD11 H  -0.896   9.072  -9.961 1.00 . A A . 124 ILE HD11 1 1 
        1  2058 1 1 124 ILE HD12 H  -1.768   8.700  -8.472 1.00 . A A . 124 ILE HD12 1 1 
        1  2059 1 1 124 ILE HD13 H  -2.593   9.517  -9.797 1.00 . A A . 124 ILE HD13 1 1 
        1  2060 1 1 124 ILE HG12 H  -2.335   7.571 -11.196 1.00 . A A . 124 ILE HG12 1 1 
        1  2061 1 1 124 ILE HG13 H  -3.253   7.211  -9.744 1.00 . A A . 124 ILE HG13 1 1 
        1  2062 1 1 124 ILE HG21 H   0.797   5.722  -9.988 1.00 . A A . 124 ILE HG21 1 1 
        1  2063 1 1 124 ILE HG22 H   0.497   7.434  -9.709 1.00 . A A . 124 ILE HG22 1 1 
        1  2064 1 1 124 ILE HG23 H   0.199   6.739 -11.303 1.00 . A A . 124 ILE HG23 1 1 
        1  2065 1 1 124 ILE N    N  -3.218   4.640 -10.066 1.00 . A A . 124 ILE N    1 1 
        1  2066 1 1 124 ILE O    O  -0.074   3.435 -11.203 1.00 . A A . 124 ILE O    1 1 
        1  2067 1 1 125 THR C    C  -0.436   0.709  -9.826 1.00 . A A . 125 THR C    1 1 
        1  2068 1 1 125 THR CA   C  -0.196   1.866  -8.859 1.00 . A A . 125 THR CA   1 1 
        1  2069 1 1 125 THR CB   C  -0.329   1.379  -7.355 1.00 . A A . 125 THR CB   1 1 
        1  2070 1 1 125 THR CG2  C  -1.615   0.590  -7.056 1.00 . A A . 125 THR CG2  1 1 
        1  2071 1 1 125 THR H    H  -1.847   3.178  -8.650 1.00 . A A . 125 THR H    1 1 
        1  2072 1 1 125 THR HA   H   0.828   2.217  -9.002 1.00 . A A . 125 THR HA   1 1 
        1  2073 1 1 125 THR HB   H  -0.313   2.259  -6.720 1.00 . A A . 125 THR HB   1 1 
        1  2074 1 1 125 THR HG1  H   1.102   0.084  -7.781 1.00 . A A . 125 THR HG1  1 1 
        1  2075 1 1 125 THR HG21 H  -1.648   0.321  -6.010 1.00 . A A . 125 THR HG21 1 1 
        1  2076 1 1 125 THR HG22 H  -1.639  -0.312  -7.657 1.00 . A A . 125 THR HG22 1 1 
        1  2077 1 1 125 THR HG23 H  -2.477   1.198  -7.299 1.00 . A A . 125 THR HG23 1 1 
        1  2078 1 1 125 THR N    N  -1.083   2.989  -9.212 1.00 . A A . 125 THR N    1 1 
        1  2079 1 1 125 THR O    O   0.519   0.176 -10.377 1.00 . A A . 125 THR O    1 1 
        1  2080 1 1 125 THR OG1  O   0.791   0.554  -7.001 1.00 . A A . 125 THR OG1  1 1 
        1  2081 1 1 126 LEU C    C  -1.810  -0.351 -12.425 1.00 . A A . 126 LEU C    1 1 
        1  2082 1 1 126 LEU CA   C  -2.083  -0.739 -10.969 1.00 . A A . 126 LEU CA   1 1 
        1  2083 1 1 126 LEU CB   C  -3.565  -1.145 -10.808 1.00 . A A . 126 LEU CB   1 1 
        1  2084 1 1 126 LEU CD1  C  -3.353  -3.694 -11.033 1.00 . A A . 126 LEU CD1  1 1 
        1  2085 1 1 126 LEU CD2  C  -5.508  -2.515 -11.746 1.00 . A A . 126 LEU CD2  1 1 
        1  2086 1 1 126 LEU CG   C  -3.983  -2.407 -11.623 1.00 . A A . 126 LEU CG   1 1 
        1  2087 1 1 126 LEU H    H  -2.444   0.813  -9.566 1.00 . A A . 126 LEU H    1 1 
        1  2088 1 1 126 LEU HA   H  -1.458  -1.596 -10.717 1.00 . A A . 126 LEU HA   1 1 
        1  2089 1 1 126 LEU HB2  H  -3.762  -1.330  -9.753 1.00 . A A . 126 LEU HB2  1 1 
        1  2090 1 1 126 LEU HB3  H  -4.186  -0.310 -11.124 1.00 . A A . 126 LEU HB3  1 1 
        1  2091 1 1 126 LEU HD11 H  -3.675  -3.827 -10.004 1.00 . A A . 126 LEU HD11 1 1 
        1  2092 1 1 126 LEU HD12 H  -2.274  -3.619 -11.062 1.00 . A A . 126 LEU HD12 1 1 
        1  2093 1 1 126 LEU HD13 H  -3.661  -4.551 -11.617 1.00 . A A . 126 LEU HD13 1 1 
        1  2094 1 1 126 LEU HD21 H  -5.766  -3.354 -12.373 1.00 . A A . 126 LEU HD21 1 1 
        1  2095 1 1 126 LEU HD22 H  -5.903  -1.609 -12.192 1.00 . A A . 126 LEU HD22 1 1 
        1  2096 1 1 126 LEU HD23 H  -5.948  -2.650 -10.765 1.00 . A A . 126 LEU HD23 1 1 
        1  2097 1 1 126 LEU HG   H  -3.590  -2.305 -12.628 1.00 . A A . 126 LEU HG   1 1 
        1  2098 1 1 126 LEU N    N  -1.723   0.354 -10.061 1.00 . A A . 126 LEU N    1 1 
        1  2099 1 1 126 LEU O    O  -1.489  -1.204 -13.240 1.00 . A A . 126 LEU O    1 1 
        1  2100 1 1 127 ARG C    C  -0.127   1.278 -14.343 1.00 . A A . 127 ARG C    1 1 
        1  2101 1 1 127 ARG CA   C  -1.625   1.497 -14.055 1.00 . A A . 127 ARG CA   1 1 
        1  2102 1 1 127 ARG CB   C  -1.962   3.003 -14.106 1.00 . A A . 127 ARG CB   1 1 
        1  2103 1 1 127 ARG CD   C  -2.153   5.157 -15.450 1.00 . A A . 127 ARG CD   1 1 
        1  2104 1 1 127 ARG CG   C  -1.916   3.641 -15.510 1.00 . A A . 127 ARG CG   1 1 
        1  2105 1 1 127 ARG CZ   C  -2.925   6.930 -17.034 1.00 . A A . 127 ARG CZ   1 1 
        1  2106 1 1 127 ARG H    H  -2.410   1.513 -12.064 1.00 . A A . 127 ARG H    1 1 
        1  2107 1 1 127 ARG HA   H  -2.218   0.974 -14.806 1.00 . A A . 127 ARG HA   1 1 
        1  2108 1 1 127 ARG HB2  H  -2.966   3.145 -13.707 1.00 . A A . 127 ARG HB2  1 1 
        1  2109 1 1 127 ARG HB3  H  -1.267   3.538 -13.463 1.00 . A A . 127 ARG HB3  1 1 
        1  2110 1 1 127 ARG HD2  H  -3.058   5.347 -14.883 1.00 . A A . 127 ARG HD2  1 1 
        1  2111 1 1 127 ARG HD3  H  -1.315   5.621 -14.941 1.00 . A A . 127 ARG HD3  1 1 
        1  2112 1 1 127 ARG HE   H  -1.887   5.285 -17.536 1.00 . A A . 127 ARG HE   1 1 
        1  2113 1 1 127 ARG HG2  H  -0.943   3.451 -15.952 1.00 . A A . 127 ARG HG2  1 1 
        1  2114 1 1 127 ARG HG3  H  -2.683   3.186 -16.131 1.00 . A A . 127 ARG HG3  1 1 
        1  2115 1 1 127 ARG HH11 H  -3.449   7.291 -15.101 1.00 . A A . 127 ARG HH11 1 1 
        1  2116 1 1 127 ARG HH12 H  -3.960   8.491 -16.245 1.00 . A A . 127 ARG HH12 1 1 
        1  2117 1 1 127 ARG HH21 H  -2.561   6.856 -19.020 1.00 . A A . 127 ARG HH21 1 1 
        1  2118 1 1 127 ARG HH22 H  -3.452   8.243 -18.481 1.00 . A A . 127 ARG HH22 1 1 
        1  2119 1 1 127 ARG N    N  -1.983   0.937 -12.736 1.00 . A A . 127 ARG N    1 1 
        1  2120 1 1 127 ARG NE   N  -2.291   5.768 -16.784 1.00 . A A . 127 ARG NE   1 1 
        1  2121 1 1 127 ARG NH1  N  -3.491   7.627 -16.047 1.00 . A A . 127 ARG NH1  1 1 
        1  2122 1 1 127 ARG NH2  N  -2.984   7.381 -18.276 1.00 . A A . 127 ARG NH2  1 1 
        1  2123 1 1 127 ARG O    O   0.243   0.884 -15.451 1.00 . A A . 127 ARG O    1 1 
        1  2124 1 1 128 GLU C    C   2.605  -0.133 -13.330 1.00 . A A . 128 GLU C    1 1 
        1  2125 1 1 128 GLU CA   C   2.179   1.342 -13.398 1.00 . A A . 128 GLU CA   1 1 
        1  2126 1 1 128 GLU CB   C   2.894   2.185 -12.306 1.00 . A A . 128 GLU CB   1 1 
        1  2127 1 1 128 GLU CD   C   3.704   4.026 -13.888 1.00 . A A . 128 GLU CD   1 1 
        1  2128 1 1 128 GLU CG   C   2.916   3.696 -12.607 1.00 . A A . 128 GLU CG   1 1 
        1  2129 1 1 128 GLU H    H   0.317   1.818 -12.453 1.00 . A A . 128 GLU H    1 1 
        1  2130 1 1 128 GLU HA   H   2.489   1.720 -14.368 1.00 . A A . 128 GLU HA   1 1 
        1  2131 1 1 128 GLU HB2  H   2.387   2.034 -11.359 1.00 . A A . 128 GLU HB2  1 1 
        1  2132 1 1 128 GLU HB3  H   3.923   1.849 -12.201 1.00 . A A . 128 GLU HB3  1 1 
        1  2133 1 1 128 GLU HG2  H   1.892   4.045 -12.714 1.00 . A A . 128 GLU HG2  1 1 
        1  2134 1 1 128 GLU HG3  H   3.373   4.215 -11.768 1.00 . A A . 128 GLU HG3  1 1 
        1  2135 1 1 128 GLU N    N   0.710   1.516 -13.310 1.00 . A A . 128 GLU N    1 1 
        1  2136 1 1 128 GLU O    O   3.611  -0.505 -13.941 1.00 . A A . 128 GLU O    1 1 
        1  2137 1 1 128 GLU OE1  O   4.947   4.078 -13.827 1.00 . A A . 128 GLU OE1  1 1 
        1  2138 1 1 128 GLU OE2  O   3.091   4.198 -14.967 1.00 . A A . 128 GLU OE2  1 1 
        1  2139 1 1 129 PHE C    C   1.795  -3.045 -13.878 1.00 . A A . 129 PHE C    1 1 
        1  2140 1 1 129 PHE CA   C   2.083  -2.424 -12.499 1.00 . A A . 129 PHE CA   1 1 
        1  2141 1 1 129 PHE CB   C   1.185  -3.086 -11.392 1.00 . A A . 129 PHE CB   1 1 
        1  2142 1 1 129 PHE CD1  C   2.722  -4.266  -9.737 1.00 . A A . 129 PHE CD1  1 1 
        1  2143 1 1 129 PHE CD2  C   1.578  -2.317  -8.976 1.00 . A A . 129 PHE CD2  1 1 
        1  2144 1 1 129 PHE CE1  C   3.309  -4.410  -8.488 1.00 . A A . 129 PHE CE1  1 1 
        1  2145 1 1 129 PHE CE2  C   2.163  -2.463  -7.731 1.00 . A A . 129 PHE CE2  1 1 
        1  2146 1 1 129 PHE CG   C   1.840  -3.219 -10.004 1.00 . A A . 129 PHE CG   1 1 
        1  2147 1 1 129 PHE CZ   C   3.033  -3.504  -7.489 1.00 . A A . 129 PHE CZ   1 1 
        1  2148 1 1 129 PHE H    H   1.132  -0.575 -12.055 1.00 . A A . 129 PHE H    1 1 
        1  2149 1 1 129 PHE HA   H   3.128  -2.589 -12.258 1.00 . A A . 129 PHE HA   1 1 
        1  2150 1 1 129 PHE HB2  H   0.280  -2.499 -11.282 1.00 . A A . 129 PHE HB2  1 1 
        1  2151 1 1 129 PHE HB3  H   0.896  -4.084 -11.709 1.00 . A A . 129 PHE HB3  1 1 
        1  2152 1 1 129 PHE HD1  H   2.949  -4.983 -10.518 1.00 . A A . 129 PHE HD1  1 1 
        1  2153 1 1 129 PHE HD2  H   0.896  -1.497  -9.152 1.00 . A A . 129 PHE HD2  1 1 
        1  2154 1 1 129 PHE HE1  H   3.992  -5.230  -8.304 1.00 . A A . 129 PHE HE1  1 1 
        1  2155 1 1 129 PHE HE2  H   1.942  -1.749  -6.948 1.00 . A A . 129 PHE HE2  1 1 
        1  2156 1 1 129 PHE HZ   H   3.491  -3.615  -6.512 1.00 . A A . 129 PHE HZ   1 1 
        1  2157 1 1 129 PHE N    N   1.860  -0.958 -12.569 1.00 . A A . 129 PHE N    1 1 
        1  2158 1 1 129 PHE O    O   2.606  -3.795 -14.414 1.00 . A A . 129 PHE O    1 1 
        1  2159 1 1 130 PHE C    C   1.283  -2.677 -16.794 1.00 . A A . 130 PHE C    1 1 
        1  2160 1 1 130 PHE CA   C   0.203  -3.084 -15.789 1.00 . A A . 130 PHE CA   1 1 
        1  2161 1 1 130 PHE CB   C  -1.163  -2.431 -16.141 1.00 . A A . 130 PHE CB   1 1 
        1  2162 1 1 130 PHE CD1  C  -2.538  -3.941 -17.667 1.00 . A A . 130 PHE CD1  1 1 
        1  2163 1 1 130 PHE CD2  C  -1.487  -2.028 -18.648 1.00 . A A . 130 PHE CD2  1 1 
        1  2164 1 1 130 PHE CE1  C  -3.065  -4.280 -18.896 1.00 . A A . 130 PHE CE1  1 1 
        1  2165 1 1 130 PHE CE2  C  -2.016  -2.368 -19.878 1.00 . A A . 130 PHE CE2  1 1 
        1  2166 1 1 130 PHE CG   C  -1.738  -2.810 -17.517 1.00 . A A . 130 PHE CG   1 1 
        1  2167 1 1 130 PHE CZ   C  -2.807  -3.493 -20.002 1.00 . A A . 130 PHE CZ   1 1 
        1  2168 1 1 130 PHE H    H   0.054  -2.097 -13.929 1.00 . A A . 130 PHE H    1 1 
        1  2169 1 1 130 PHE HA   H   0.091  -4.166 -15.793 1.00 . A A . 130 PHE HA   1 1 
        1  2170 1 1 130 PHE HB2  H  -1.887  -2.720 -15.385 1.00 . A A . 130 PHE HB2  1 1 
        1  2171 1 1 130 PHE HB3  H  -1.055  -1.351 -16.104 1.00 . A A . 130 PHE HB3  1 1 
        1  2172 1 1 130 PHE HD1  H  -2.744  -4.566 -16.804 1.00 . A A . 130 PHE HD1  1 1 
        1  2173 1 1 130 PHE HD2  H  -0.865  -1.143 -18.553 1.00 . A A . 130 PHE HD2  1 1 
        1  2174 1 1 130 PHE HE1  H  -3.685  -5.161 -18.990 1.00 . A A . 130 PHE HE1  1 1 
        1  2175 1 1 130 PHE HE2  H  -1.810  -1.751 -20.741 1.00 . A A . 130 PHE HE2  1 1 
        1  2176 1 1 130 PHE HZ   H  -3.225  -3.759 -20.963 1.00 . A A . 130 PHE HZ   1 1 
        1  2177 1 1 130 PHE N    N   0.633  -2.679 -14.439 1.00 . A A . 130 PHE N    1 1 
        1  2178 1 1 130 PHE O    O   1.812  -3.532 -17.495 1.00 . A A . 130 PHE O    1 1 
        1  2179 1 1 131 ASN C    C   4.016  -1.535 -17.487 1.00 . A A . 131 ASN C    1 1 
        1  2180 1 1 131 ASN CA   C   2.694  -0.741 -17.587 1.00 . A A . 131 ASN CA   1 1 
        1  2181 1 1 131 ASN CB   C   2.893   0.732 -17.111 1.00 . A A . 131 ASN CB   1 1 
        1  2182 1 1 131 ASN CG   C   3.984   1.518 -17.844 1.00 . A A . 131 ASN CG   1 1 
        1  2183 1 1 131 ASN H    H   1.142  -0.791 -16.137 1.00 . A A . 131 ASN H    1 1 
        1  2184 1 1 131 ASN HA   H   2.358  -0.737 -18.619 1.00 . A A . 131 ASN HA   1 1 
        1  2185 1 1 131 ASN HB2  H   1.964   1.272 -17.244 1.00 . A A . 131 ASN HB2  1 1 
        1  2186 1 1 131 ASN HB3  H   3.133   0.720 -16.054 1.00 . A A . 131 ASN HB3  1 1 
        1  2187 1 1 131 ASN HD21 H   4.324   2.625 -16.219 1.00 . A A . 131 ASN HD21 1 1 
        1  2188 1 1 131 ASN HD22 H   5.304   2.987 -17.598 1.00 . A A . 131 ASN HD22 1 1 
        1  2189 1 1 131 ASN N    N   1.629  -1.369 -16.762 1.00 . A A . 131 ASN N    1 1 
        1  2190 1 1 131 ASN ND2  N   4.599   2.473 -17.151 1.00 . A A . 131 ASN ND2  1 1 
        1  2191 1 1 131 ASN O    O   4.691  -1.782 -18.499 1.00 . A A . 131 ASN O    1 1 
        1  2192 1 1 131 ASN OD1  O   4.264   1.282 -19.022 1.00 . A A . 131 ASN OD1  1 1 
        1  2193 1 1 132 ALA C    C   5.588  -4.067 -16.654 1.00 . A A . 132 ALA C    1 1 
        1  2194 1 1 132 ALA CA   C   5.561  -2.701 -15.953 1.00 . A A . 132 ALA CA   1 1 
        1  2195 1 1 132 ALA CB   C   5.747  -2.853 -14.436 1.00 . A A . 132 ALA CB   1 1 
        1  2196 1 1 132 ALA H    H   3.684  -1.797 -15.549 1.00 . A A . 132 ALA H    1 1 
        1  2197 1 1 132 ALA HA   H   6.390  -2.103 -16.326 1.00 . A A . 132 ALA HA   1 1 
        1  2198 1 1 132 ALA HB1  H   4.940  -3.451 -14.024 1.00 . A A . 132 ALA HB1  1 1 
        1  2199 1 1 132 ALA HB2  H   5.745  -1.875 -13.972 1.00 . A A . 132 ALA HB2  1 1 
        1  2200 1 1 132 ALA HB3  H   6.690  -3.339 -14.224 1.00 . A A . 132 ALA HB3  1 1 
        1  2201 1 1 132 ALA N    N   4.325  -1.968 -16.263 1.00 . A A . 132 ALA N    1 1 
        1  2202 1 1 132 ALA O    O   6.443  -4.300 -17.499 1.00 . A A . 132 ALA O    1 1 
        1  2203 1 1 133 ILE C    C   4.465  -6.274 -18.455 1.00 . A A . 133 ILE C    1 1 
        1  2204 1 1 133 ILE CA   C   4.628  -6.316 -16.912 1.00 . A A . 133 ILE CA   1 1 
        1  2205 1 1 133 ILE CB   C   3.569  -7.317 -16.263 1.00 . A A . 133 ILE CB   1 1 
        1  2206 1 1 133 ILE CD1  C   3.688  -6.500 -13.764 1.00 . A A . 133 ILE CD1  1 1 
        1  2207 1 1 133 ILE CG1  C   3.862  -7.638 -14.750 1.00 . A A . 133 ILE CG1  1 1 
        1  2208 1 1 133 ILE CG2  C   3.549  -8.648 -17.062 1.00 . A A . 133 ILE CG2  1 1 
        1  2209 1 1 133 ILE H    H   3.841  -4.638 -15.821 1.00 . A A . 133 ILE H    1 1 
        1  2210 1 1 133 ILE HA   H   5.625  -6.720 -16.704 1.00 . A A . 133 ILE HA   1 1 
        1  2211 1 1 133 ILE HB   H   2.583  -6.861 -16.348 1.00 . A A . 133 ILE HB   1 1 
        1  2212 1 1 133 ILE HD11 H   2.669  -6.135 -13.801 1.00 . A A . 133 ILE HD11 1 1 
        1  2213 1 1 133 ILE HD12 H   4.365  -5.692 -14.013 1.00 . A A . 133 ILE HD12 1 1 
        1  2214 1 1 133 ILE HD13 H   3.905  -6.852 -12.767 1.00 . A A . 133 ILE HD13 1 1 
        1  2215 1 1 133 ILE HG12 H   3.200  -8.425 -14.424 1.00 . A A . 133 ILE HG12 1 1 
        1  2216 1 1 133 ILE HG13 H   4.883  -7.988 -14.661 1.00 . A A . 133 ILE HG13 1 1 
        1  2217 1 1 133 ILE HG21 H   3.228  -8.454 -18.077 1.00 . A A . 133 ILE HG21 1 1 
        1  2218 1 1 133 ILE HG22 H   2.869  -9.351 -16.601 1.00 . A A . 133 ILE HG22 1 1 
        1  2219 1 1 133 ILE HG23 H   4.551  -9.066 -17.081 1.00 . A A . 133 ILE HG23 1 1 
        1  2220 1 1 133 ILE N    N   4.609  -4.944 -16.360 1.00 . A A . 133 ILE N    1 1 
        1  2221 1 1 133 ILE O    O   5.168  -7.000 -19.173 1.00 . A A . 133 ILE O    1 1 
        1  2222 1 1 134 ILE C    C   4.546  -4.794 -21.187 1.00 . A A . 134 ILE C    1 1 
        1  2223 1 1 134 ILE CA   C   3.302  -5.280 -20.408 1.00 . A A . 134 ILE CA   1 1 
        1  2224 1 1 134 ILE CB   C   2.018  -4.390 -20.713 1.00 . A A . 134 ILE CB   1 1 
        1  2225 1 1 134 ILE CD1  C   2.065  -3.637 -23.215 1.00 . A A . 134 ILE CD1  1 1 
        1  2226 1 1 134 ILE CG1  C   1.475  -4.585 -22.177 1.00 . A A . 134 ILE CG1  1 1 
        1  2227 1 1 134 ILE CG2  C   2.270  -2.892 -20.428 1.00 . A A . 134 ILE CG2  1 1 
        1  2228 1 1 134 ILE H    H   3.092  -4.815 -18.337 1.00 . A A . 134 ILE H    1 1 
        1  2229 1 1 134 ILE HA   H   3.079  -6.289 -20.753 1.00 . A A . 134 ILE HA   1 1 
        1  2230 1 1 134 ILE HB   H   1.249  -4.714 -20.016 1.00 . A A . 134 ILE HB   1 1 
        1  2231 1 1 134 ILE HD11 H   1.672  -3.874 -24.190 1.00 . A A . 134 ILE HD11 1 1 
        1  2232 1 1 134 ILE HD12 H   3.144  -3.738 -23.223 1.00 . A A . 134 ILE HD12 1 1 
        1  2233 1 1 134 ILE HD13 H   1.807  -2.621 -22.953 1.00 . A A . 134 ILE HD13 1 1 
        1  2234 1 1 134 ILE HG12 H   1.683  -5.596 -22.505 1.00 . A A . 134 ILE HG12 1 1 
        1  2235 1 1 134 ILE HG13 H   0.404  -4.437 -22.175 1.00 . A A . 134 ILE HG13 1 1 
        1  2236 1 1 134 ILE HG21 H   1.367  -2.322 -20.613 1.00 . A A . 134 ILE HG21 1 1 
        1  2237 1 1 134 ILE HG22 H   3.065  -2.520 -21.063 1.00 . A A . 134 ILE HG22 1 1 
        1  2238 1 1 134 ILE HG23 H   2.563  -2.767 -19.395 1.00 . A A . 134 ILE HG23 1 1 
        1  2239 1 1 134 ILE N    N   3.580  -5.388 -18.957 1.00 . A A . 134 ILE N    1 1 
        1  2240 1 1 134 ILE O    O   4.834  -5.313 -22.271 1.00 . A A . 134 ILE O    1 1 
        1  2241 1 1 135 ALA C    C   7.758  -4.155 -20.973 1.00 . A A . 135 ALA C    1 1 
        1  2242 1 1 135 ALA CA   C   6.515  -3.295 -21.288 1.00 . A A . 135 ALA CA   1 1 
        1  2243 1 1 135 ALA CB   C   6.747  -1.832 -20.894 1.00 . A A . 135 ALA CB   1 1 
        1  2244 1 1 135 ALA H    H   5.009  -3.413 -19.775 1.00 . A A . 135 ALA H    1 1 
        1  2245 1 1 135 ALA HA   H   6.353  -3.322 -22.365 1.00 . A A . 135 ALA HA   1 1 
        1  2246 1 1 135 ALA HB1  H   7.605  -1.436 -21.422 1.00 . A A . 135 ALA HB1  1 1 
        1  2247 1 1 135 ALA HB2  H   6.924  -1.762 -19.827 1.00 . A A . 135 ALA HB2  1 1 
        1  2248 1 1 135 ALA HB3  H   5.873  -1.244 -21.146 1.00 . A A . 135 ALA HB3  1 1 
        1  2249 1 1 135 ALA N    N   5.292  -3.813 -20.633 1.00 . A A . 135 ALA N    1 1 
        1  2250 1 1 135 ALA O    O   8.798  -3.993 -21.619 1.00 . A A . 135 ALA O    1 1 
        1  2251 1 1 136 GLY C    C   9.718  -5.317 -18.618 1.00 . A A . 136 GLY C    1 1 
        1  2252 1 1 136 GLY CA   C   8.761  -5.961 -19.614 1.00 . A A . 136 GLY CA   1 1 
        1  2253 1 1 136 GLY H    H   6.831  -5.071 -19.431 1.00 . A A . 136 GLY H    1 1 
        1  2254 1 1 136 GLY HA2  H   8.343  -6.852 -19.164 1.00 . A A . 136 GLY HA2  1 1 
        1  2255 1 1 136 GLY HA3  H   9.311  -6.245 -20.505 1.00 . A A . 136 GLY HA3  1 1 
        1  2256 1 1 136 GLY N    N   7.653  -5.055 -19.974 1.00 . A A . 136 GLY N    1 1 
        1  2257 1 1 136 GLY O    O  10.887  -5.679 -18.523 1.00 . A A . 136 GLY O    1 1 
        1  2258 1 1 137 LYS C    C   9.858  -4.358 -15.506 1.00 . A A . 137 LYS C    1 1 
        1  2259 1 1 137 LYS CA   C   9.892  -3.588 -16.840 1.00 . A A . 137 LYS CA   1 1 
        1  2260 1 1 137 LYS CB   C   9.238  -2.176 -16.692 1.00 . A A . 137 LYS CB   1 1 
        1  2261 1 1 137 LYS CD   C  11.307  -0.902 -15.786 1.00 . A A . 137 LYS CD   1 1 
        1  2262 1 1 137 LYS CE   C  11.554  -0.087 -17.067 1.00 . A A . 137 LYS CE   1 1 
        1  2263 1 1 137 LYS CG   C   9.818  -1.264 -15.579 1.00 . A A . 137 LYS CG   1 1 
        1  2264 1 1 137 LYS H    H   8.243  -4.144 -18.054 1.00 . A A . 137 LYS H    1 1 
        1  2265 1 1 137 LYS HA   H  10.927  -3.469 -17.147 1.00 . A A . 137 LYS HA   1 1 
        1  2266 1 1 137 LYS HB2  H   9.337  -1.651 -17.636 1.00 . A A . 137 LYS HB2  1 1 
        1  2267 1 1 137 LYS HB3  H   8.178  -2.306 -16.495 1.00 . A A . 137 LYS HB3  1 1 
        1  2268 1 1 137 LYS HD2  H  11.644  -0.319 -14.934 1.00 . A A . 137 LYS HD2  1 1 
        1  2269 1 1 137 LYS HD3  H  11.888  -1.816 -15.833 1.00 . A A . 137 LYS HD3  1 1 
        1  2270 1 1 137 LYS HE2  H  11.234  -0.669 -17.921 1.00 . A A . 137 LYS HE2  1 1 
        1  2271 1 1 137 LYS HE3  H  10.980   0.831 -17.024 1.00 . A A . 137 LYS HE3  1 1 
        1  2272 1 1 137 LYS HG2  H   9.240  -0.348 -15.544 1.00 . A A . 137 LYS HG2  1 1 
        1  2273 1 1 137 LYS HG3  H   9.714  -1.776 -14.628 1.00 . A A . 137 LYS HG3  1 1 
        1  2274 1 1 137 LYS HZ1  H  13.111   0.923 -18.021 1.00 . A A . 137 LYS HZ1  1 1 
        1  2275 1 1 137 LYS HZ2  H  13.531  -0.609 -17.452 1.00 . A A . 137 LYS HZ2  1 1 
        1  2276 1 1 137 LYS HZ3  H  13.367   0.676 -16.370 1.00 . A A . 137 LYS HZ3  1 1 
        1  2277 1 1 137 LYS N    N   9.180  -4.348 -17.884 1.00 . A A . 137 LYS N    1 1 
        1  2278 1 1 137 LYS NZ   N  12.988   0.249 -17.240 1.00 . A A . 137 LYS NZ   1 1 
        1  2279 1 1 137 LYS O    O  10.688  -4.128 -14.633 1.00 . A A . 137 LYS O    1 1 
        1  2280 1 1 138 ASP C    C   9.919  -6.952 -13.801 1.00 . A A . 138 ASP C    1 1 
        1  2281 1 1 138 ASP CA   C   8.690  -6.093 -14.170 1.00 . A A . 138 ASP CA   1 1 
        1  2282 1 1 138 ASP CB   C   7.446  -6.984 -14.357 1.00 . A A . 138 ASP CB   1 1 
        1  2283 1 1 138 ASP CG   C   7.624  -8.066 -15.447 1.00 . A A . 138 ASP CG   1 1 
        1  2284 1 1 138 ASP H    H   8.310  -5.450 -16.150 1.00 . A A . 138 ASP H    1 1 
        1  2285 1 1 138 ASP HA   H   8.496  -5.403 -13.356 1.00 . A A . 138 ASP HA   1 1 
        1  2286 1 1 138 ASP HB2  H   7.211  -7.463 -13.411 1.00 . A A . 138 ASP HB2  1 1 
        1  2287 1 1 138 ASP HB3  H   6.602  -6.358 -14.636 1.00 . A A . 138 ASP HB3  1 1 
        1  2288 1 1 138 ASP N    N   8.904  -5.287 -15.385 1.00 . A A . 138 ASP N    1 1 
        1  2289 1 1 138 ASP O    O  10.210  -7.148 -12.623 1.00 . A A . 138 ASP O    1 1 
        1  2290 1 1 138 ASP OD1  O   7.787  -7.708 -16.636 1.00 . A A . 138 ASP OD1  1 1 
        1  2291 1 1 138 ASP OD2  O   7.624  -9.271 -15.116 1.00 . A A . 138 ASP OD2  1 1 
        1  2292 1 1 139 VAL C    C  13.081  -7.405 -14.323 1.00 . A A . 139 VAL C    1 1 
        1  2293 1 1 139 VAL CA   C  11.843  -8.274 -14.651 1.00 . A A . 139 VAL CA   1 1 
        1  2294 1 1 139 VAL CB   C  12.113  -9.155 -15.927 1.00 . A A . 139 VAL CB   1 1 
        1  2295 1 1 139 VAL CG1  C  11.026 -10.245 -16.093 1.00 . A A . 139 VAL CG1  1 1 
        1  2296 1 1 139 VAL CG2  C  12.218  -8.275 -17.198 1.00 . A A . 139 VAL CG2  1 1 
        1  2297 1 1 139 VAL H    H  10.369  -7.186 -15.734 1.00 . A A . 139 VAL H    1 1 
        1  2298 1 1 139 VAL HA   H  11.669  -8.945 -13.810 1.00 . A A . 139 VAL HA   1 1 
        1  2299 1 1 139 VAL HB   H  13.067  -9.663 -15.792 1.00 . A A . 139 VAL HB   1 1 
        1  2300 1 1 139 VAL HG11 H  10.052  -9.782 -16.214 1.00 . A A . 139 VAL HG11 1 1 
        1  2301 1 1 139 VAL HG12 H  11.009 -10.881 -15.217 1.00 . A A . 139 VAL HG12 1 1 
        1  2302 1 1 139 VAL HG13 H  11.244 -10.850 -16.964 1.00 . A A . 139 VAL HG13 1 1 
        1  2303 1 1 139 VAL HG21 H  11.278  -7.754 -17.365 1.00 . A A . 139 VAL HG21 1 1 
        1  2304 1 1 139 VAL HG22 H  12.439  -8.895 -18.057 1.00 . A A . 139 VAL HG22 1 1 
        1  2305 1 1 139 VAL HG23 H  13.011  -7.546 -17.077 1.00 . A A . 139 VAL HG23 1 1 
        1  2306 1 1 139 VAL N    N  10.636  -7.436 -14.826 1.00 . A A . 139 VAL N    1 1 
        1  2307 1 1 139 VAL O    O  14.147  -7.932 -13.977 1.00 . A A . 139 VAL O    1 1 
        1  2308 1 1 140 ASP C    C  13.764  -4.723 -12.596 1.00 . A A . 140 ASP C    1 1 
        1  2309 1 1 140 ASP CA   C  13.952  -5.093 -14.088 1.00 . A A . 140 ASP CA   1 1 
        1  2310 1 1 140 ASP CB   C  13.830  -3.832 -14.992 1.00 . A A . 140 ASP CB   1 1 
        1  2311 1 1 140 ASP CG   C  15.009  -2.844 -14.866 1.00 . A A . 140 ASP CG   1 1 
        1  2312 1 1 140 ASP H    H  12.067  -5.751 -14.778 1.00 . A A . 140 ASP H    1 1 
        1  2313 1 1 140 ASP HA   H  14.925  -5.555 -14.232 1.00 . A A . 140 ASP HA   1 1 
        1  2314 1 1 140 ASP HB2  H  13.756  -4.156 -16.027 1.00 . A A . 140 ASP HB2  1 1 
        1  2315 1 1 140 ASP HB3  H  12.914  -3.307 -14.742 1.00 . A A . 140 ASP HB3  1 1 
        1  2316 1 1 140 ASP N    N  12.922  -6.079 -14.451 1.00 . A A . 140 ASP N    1 1 
        1  2317 1 1 140 ASP O    O  12.636  -4.431 -12.196 1.00 . A A . 140 ASP O    1 1 
        1  2318 1 1 140 ASP OD1  O  15.092  -2.098 -13.869 1.00 . A A . 140 ASP OD1  1 1 
        1  2319 1 1 140 ASP OD2  O  15.864  -2.813 -15.775 1.00 . A A . 140 ASP OD2  1 1 
        1  2320 1 1 141 PRO C    C  14.063  -3.122  -9.930 1.00 . A A . 141 PRO C    1 1 
        1  2321 1 1 141 PRO CA   C  14.776  -4.450 -10.288 1.00 . A A . 141 PRO CA   1 1 
        1  2322 1 1 141 PRO CB   C  16.267  -4.410  -9.858 1.00 . A A . 141 PRO CB   1 1 
        1  2323 1 1 141 PRO CD   C  16.261  -5.042 -12.164 1.00 . A A . 141 PRO CD   1 1 
        1  2324 1 1 141 PRO CG   C  16.974  -5.274 -10.851 1.00 . A A . 141 PRO CG   1 1 
        1  2325 1 1 141 PRO HA   H  14.274  -5.268  -9.774 1.00 . A A . 141 PRO HA   1 1 
        1  2326 1 1 141 PRO HB2  H  16.648  -3.390  -9.897 1.00 . A A . 141 PRO HB2  1 1 
        1  2327 1 1 141 PRO HB3  H  16.389  -4.812  -8.860 1.00 . A A . 141 PRO HB3  1 1 
        1  2328 1 1 141 PRO HD2  H  16.698  -4.205 -12.698 1.00 . A A . 141 PRO HD2  1 1 
        1  2329 1 1 141 PRO HD3  H  16.298  -5.934 -12.780 1.00 . A A . 141 PRO HD3  1 1 
        1  2330 1 1 141 PRO HG2  H  18.019  -4.982 -10.922 1.00 . A A . 141 PRO HG2  1 1 
        1  2331 1 1 141 PRO HG3  H  16.899  -6.320 -10.565 1.00 . A A . 141 PRO HG3  1 1 
        1  2332 1 1 141 PRO N    N  14.858  -4.731 -11.755 1.00 . A A . 141 PRO N    1 1 
        1  2333 1 1 141 PRO O    O  13.395  -3.025  -8.889 1.00 . A A . 141 PRO O    1 1 
        1  2334 1 1 142 SER C    C  12.231  -0.539 -10.696 1.00 . A A . 142 SER C    1 1 
        1  2335 1 1 142 SER CA   C  13.757  -0.739 -10.591 1.00 . A A . 142 SER CA   1 1 
        1  2336 1 1 142 SER CB   C  14.490   0.192 -11.583 1.00 . A A . 142 SER CB   1 1 
        1  2337 1 1 142 SER H    H  14.649  -2.324 -11.670 1.00 . A A . 142 SER H    1 1 
        1  2338 1 1 142 SER HA   H  14.060  -0.457  -9.587 1.00 . A A . 142 SER HA   1 1 
        1  2339 1 1 142 SER HB2  H  14.123   0.020 -12.588 1.00 . A A . 142 SER HB2  1 1 
        1  2340 1 1 142 SER HB3  H  14.321   1.230 -11.312 1.00 . A A . 142 SER HB3  1 1 
        1  2341 1 1 142 SER HG   H  16.073  -0.823 -12.130 1.00 . A A . 142 SER HG   1 1 
        1  2342 1 1 142 SER N    N  14.202  -2.127 -10.816 1.00 . A A . 142 SER N    1 1 
        1  2343 1 1 142 SER O    O  11.747   0.542 -10.357 1.00 . A A . 142 SER O    1 1 
        1  2344 1 1 142 SER OG   O  15.889  -0.058 -11.572 1.00 . A A . 142 SER OG   1 1 
        1  2345 1 1 143 TRP C    C   9.289  -1.101 -10.053 1.00 . A A . 143 TRP C    1 1 
        1  2346 1 1 143 TRP CA   C  10.010  -1.426 -11.377 1.00 . A A . 143 TRP CA   1 1 
        1  2347 1 1 143 TRP CB   C   9.398  -2.690 -12.043 1.00 . A A . 143 TRP CB   1 1 
        1  2348 1 1 143 TRP CD1  C  10.190  -4.555 -10.430 1.00 . A A . 143 TRP CD1  1 1 
        1  2349 1 1 143 TRP CD2  C   8.013  -4.633 -10.916 1.00 . A A . 143 TRP CD2  1 1 
        1  2350 1 1 143 TRP CE2  C   8.319  -5.700 -10.064 1.00 . A A . 143 TRP CE2  1 1 
        1  2351 1 1 143 TRP CE3  C   6.702  -4.487 -11.364 1.00 . A A . 143 TRP CE3  1 1 
        1  2352 1 1 143 TRP CG   C   9.229  -3.909 -11.152 1.00 . A A . 143 TRP CG   1 1 
        1  2353 1 1 143 TRP CH2  C   6.082  -6.445 -10.089 1.00 . A A . 143 TRP CH2  1 1 
        1  2354 1 1 143 TRP CZ2  C   7.357  -6.609  -9.634 1.00 . A A . 143 TRP CZ2  1 1 
        1  2355 1 1 143 TRP CZ3  C   5.750  -5.388 -10.943 1.00 . A A . 143 TRP CZ3  1 1 
        1  2356 1 1 143 TRP H    H  11.921  -2.390 -11.447 1.00 . A A . 143 TRP H    1 1 
        1  2357 1 1 143 TRP HA   H   9.857  -0.588 -12.057 1.00 . A A . 143 TRP HA   1 1 
        1  2358 1 1 143 TRP HB2  H   8.421  -2.434 -12.438 1.00 . A A . 143 TRP HB2  1 1 
        1  2359 1 1 143 TRP HB3  H  10.031  -2.979 -12.874 1.00 . A A . 143 TRP HB3  1 1 
        1  2360 1 1 143 TRP HD1  H  11.222  -4.245 -10.382 1.00 . A A . 143 TRP HD1  1 1 
        1  2361 1 1 143 TRP HE1  H  10.144  -6.243  -9.192 1.00 . A A . 143 TRP HE1  1 1 
        1  2362 1 1 143 TRP HE3  H   6.427  -3.678 -12.025 1.00 . A A . 143 TRP HE3  1 1 
        1  2363 1 1 143 TRP HH2  H   5.302  -7.133  -9.784 1.00 . A A . 143 TRP HH2  1 1 
        1  2364 1 1 143 TRP HZ2  H   7.603  -7.430  -8.974 1.00 . A A . 143 TRP HZ2  1 1 
        1  2365 1 1 143 TRP HZ3  H   4.727  -5.292 -11.284 1.00 . A A . 143 TRP HZ3  1 1 
        1  2366 1 1 143 TRP N    N  11.481  -1.551 -11.190 1.00 . A A . 143 TRP N    1 1 
        1  2367 1 1 143 TRP NE1  N   9.650  -5.622  -9.770 1.00 . A A . 143 TRP NE1  1 1 
        1  2368 1 1 143 TRP O    O   8.427  -0.237 -10.024 1.00 . A A . 143 TRP O    1 1 
        1  2369 1 1 144 LYS C    C   9.502  -0.233  -7.035 1.00 . A A . 144 LYS C    1 1 
        1  2370 1 1 144 LYS CA   C   9.095  -1.592  -7.621 1.00 . A A . 144 LYS CA   1 1 
        1  2371 1 1 144 LYS CB   C   9.463  -2.766  -6.663 1.00 . A A . 144 LYS CB   1 1 
        1  2372 1 1 144 LYS CD   C  11.318  -4.180  -5.558 1.00 . A A . 144 LYS CD   1 1 
        1  2373 1 1 144 LYS CE   C  12.755  -4.712  -5.709 1.00 . A A . 144 LYS CE   1 1 
        1  2374 1 1 144 LYS CG   C  10.959  -3.145  -6.651 1.00 . A A . 144 LYS CG   1 1 
        1  2375 1 1 144 LYS H    H  10.443  -2.402  -9.052 1.00 . A A . 144 LYS H    1 1 
        1  2376 1 1 144 LYS HA   H   8.013  -1.588  -7.753 1.00 . A A . 144 LYS HA   1 1 
        1  2377 1 1 144 LYS HB2  H   9.170  -2.499  -5.653 1.00 . A A . 144 LYS HB2  1 1 
        1  2378 1 1 144 LYS HB3  H   8.896  -3.642  -6.960 1.00 . A A . 144 LYS HB3  1 1 
        1  2379 1 1 144 LYS HD2  H  11.219  -3.712  -4.584 1.00 . A A . 144 LYS HD2  1 1 
        1  2380 1 1 144 LYS HD3  H  10.628  -5.015  -5.622 1.00 . A A . 144 LYS HD3  1 1 
        1  2381 1 1 144 LYS HE2  H  13.452  -3.884  -5.677 1.00 . A A . 144 LYS HE2  1 1 
        1  2382 1 1 144 LYS HE3  H  12.968  -5.388  -4.891 1.00 . A A . 144 LYS HE3  1 1 
        1  2383 1 1 144 LYS HG2  H  11.216  -3.557  -7.622 1.00 . A A . 144 LYS HG2  1 1 
        1  2384 1 1 144 LYS HG3  H  11.544  -2.244  -6.489 1.00 . A A . 144 LYS HG3  1 1 
        1  2385 1 1 144 LYS HZ1  H  12.668  -4.841  -7.797 1.00 . A A . 144 LYS HZ1  1 1 
        1  2386 1 1 144 LYS HZ2  H  12.339  -6.297  -7.010 1.00 . A A . 144 LYS HZ2  1 1 
        1  2387 1 1 144 LYS HZ3  H  13.925  -5.730  -7.111 1.00 . A A . 144 LYS HZ3  1 1 
        1  2388 1 1 144 LYS N    N   9.699  -1.775  -8.957 1.00 . A A . 144 LYS N    1 1 
        1  2389 1 1 144 LYS NZ   N  12.937  -5.444  -6.997 1.00 . A A . 144 LYS NZ   1 1 
        1  2390 1 1 144 LYS O    O   8.677   0.437  -6.423 1.00 . A A . 144 LYS O    1 1 
        1  2391 1 1 145 LYS C    C  10.329   2.575  -7.582 1.00 . A A . 145 LYS C    1 1 
        1  2392 1 1 145 LYS CA   C  11.274   1.537  -6.952 1.00 . A A . 145 LYS CA   1 1 
        1  2393 1 1 145 LYS CB   C  12.713   1.723  -7.532 1.00 . A A . 145 LYS CB   1 1 
        1  2394 1 1 145 LYS CD   C  13.893   3.544  -6.065 1.00 . A A . 145 LYS CD   1 1 
        1  2395 1 1 145 LYS CE   C  15.304   2.953  -5.800 1.00 . A A . 145 LYS CE   1 1 
        1  2396 1 1 145 LYS CG   C  13.310   3.159  -7.453 1.00 . A A . 145 LYS CG   1 1 
        1  2397 1 1 145 LYS H    H  11.418  -0.509  -7.565 1.00 . A A . 145 LYS H    1 1 
        1  2398 1 1 145 LYS HA   H  11.301   1.676  -5.878 1.00 . A A . 145 LYS HA   1 1 
        1  2399 1 1 145 LYS HB2  H  13.382   1.053  -7.003 1.00 . A A . 145 LYS HB2  1 1 
        1  2400 1 1 145 LYS HB3  H  12.698   1.425  -8.574 1.00 . A A . 145 LYS HB3  1 1 
        1  2401 1 1 145 LYS HD2  H  13.959   4.626  -6.005 1.00 . A A . 145 LYS HD2  1 1 
        1  2402 1 1 145 LYS HD3  H  13.216   3.196  -5.290 1.00 . A A . 145 LYS HD3  1 1 
        1  2403 1 1 145 LYS HE2  H  15.966   3.252  -6.602 1.00 . A A . 145 LYS HE2  1 1 
        1  2404 1 1 145 LYS HE3  H  15.682   3.355  -4.867 1.00 . A A . 145 LYS HE3  1 1 
        1  2405 1 1 145 LYS HG2  H  14.103   3.247  -8.191 1.00 . A A . 145 LYS HG2  1 1 
        1  2406 1 1 145 LYS HG3  H  12.530   3.869  -7.712 1.00 . A A . 145 LYS HG3  1 1 
        1  2407 1 1 145 LYS HZ1  H  15.089   1.043  -6.637 1.00 . A A . 145 LYS HZ1  1 1 
        1  2408 1 1 145 LYS HZ2  H  14.630   1.134  -5.010 1.00 . A A . 145 LYS HZ2  1 1 
        1  2409 1 1 145 LYS HZ3  H  16.264   1.134  -5.427 1.00 . A A . 145 LYS HZ3  1 1 
        1  2410 1 1 145 LYS N    N  10.782   0.158  -7.236 1.00 . A A . 145 LYS N    1 1 
        1  2411 1 1 145 LYS NZ   N  15.320   1.463  -5.714 1.00 . A A . 145 LYS NZ   1 1 
        1  2412 1 1 145 LYS O    O   9.904   3.528  -6.923 1.00 . A A . 145 LYS O    1 1 
        1  2413 1 1 146 ALA C    C   7.694   3.250  -9.125 1.00 . A A . 146 ALA C    1 1 
        1  2414 1 1 146 ALA CA   C   9.139   3.187  -9.675 1.00 . A A . 146 ALA CA   1 1 
        1  2415 1 1 146 ALA CB   C   9.165   2.678 -11.128 1.00 . A A . 146 ALA CB   1 1 
        1  2416 1 1 146 ALA H    H  10.320   1.489  -9.265 1.00 . A A . 146 ALA H    1 1 
        1  2417 1 1 146 ALA HA   H   9.568   4.187  -9.664 1.00 . A A . 146 ALA HA   1 1 
        1  2418 1 1 146 ALA HB1  H  10.189   2.638 -11.484 1.00 . A A . 146 ALA HB1  1 1 
        1  2419 1 1 146 ALA HB2  H   8.596   3.342 -11.762 1.00 . A A . 146 ALA HB2  1 1 
        1  2420 1 1 146 ALA HB3  H   8.735   1.688 -11.179 1.00 . A A . 146 ALA HB3  1 1 
        1  2421 1 1 146 ALA N    N   9.991   2.321  -8.857 1.00 . A A . 146 ALA N    1 1 
        1  2422 1 1 146 ALA O    O   7.113   4.335  -9.046 1.00 . A A . 146 ALA O    1 1 
        1  2423 1 1 147 ILE C    C   5.696   2.819  -6.868 1.00 . A A . 147 ILE C    1 1 
        1  2424 1 1 147 ILE CA   C   5.778   1.973  -8.157 1.00 . A A . 147 ILE CA   1 1 
        1  2425 1 1 147 ILE CB   C   5.385   0.486  -7.776 1.00 . A A . 147 ILE CB   1 1 
        1  2426 1 1 147 ILE CD1  C   4.766  -0.168 -10.234 1.00 . A A . 147 ILE CD1  1 1 
        1  2427 1 1 147 ILE CG1  C   5.532  -0.512  -8.969 1.00 . A A . 147 ILE CG1  1 1 
        1  2428 1 1 147 ILE CG2  C   3.962   0.436  -7.182 1.00 . A A . 147 ILE CG2  1 1 
        1  2429 1 1 147 ILE H    H   7.662   1.253  -8.864 1.00 . A A . 147 ILE H    1 1 
        1  2430 1 1 147 ILE HA   H   5.061   2.350  -8.882 1.00 . A A . 147 ILE HA   1 1 
        1  2431 1 1 147 ILE HB   H   6.067   0.168  -6.987 1.00 . A A . 147 ILE HB   1 1 
        1  2432 1 1 147 ILE HD11 H   3.711  -0.098 -10.018 1.00 . A A . 147 ILE HD11 1 1 
        1  2433 1 1 147 ILE HD12 H   4.931  -0.943 -10.971 1.00 . A A . 147 ILE HD12 1 1 
        1  2434 1 1 147 ILE HD13 H   5.120   0.776 -10.630 1.00 . A A . 147 ILE HD13 1 1 
        1  2435 1 1 147 ILE HG12 H   6.572  -0.577  -9.240 1.00 . A A . 147 ILE HG12 1 1 
        1  2436 1 1 147 ILE HG13 H   5.205  -1.495  -8.649 1.00 . A A . 147 ILE HG13 1 1 
        1  2437 1 1 147 ILE HG21 H   3.243   0.775  -7.918 1.00 . A A . 147 ILE HG21 1 1 
        1  2438 1 1 147 ILE HG22 H   3.904   1.077  -6.311 1.00 . A A . 147 ILE HG22 1 1 
        1  2439 1 1 147 ILE HG23 H   3.725  -0.577  -6.886 1.00 . A A . 147 ILE HG23 1 1 
        1  2440 1 1 147 ILE N    N   7.139   2.073  -8.745 1.00 . A A . 147 ILE N    1 1 
        1  2441 1 1 147 ILE O    O   4.885   3.764  -6.747 1.00 . A A . 147 ILE O    1 1 
        1  2442 1 1 148 TYR C    C   6.871   4.567  -4.692 1.00 . A A . 148 TYR C    1 1 
        1  2443 1 1 148 TYR CA   C   6.616   3.063  -4.586 1.00 . A A . 148 TYR CA   1 1 
        1  2444 1 1 148 TYR CB   C   7.672   2.366  -3.693 1.00 . A A . 148 TYR CB   1 1 
        1  2445 1 1 148 TYR CD1  C   6.218   0.240  -3.542 1.00 . A A . 148 TYR CD1  1 1 
        1  2446 1 1 148 TYR CD2  C   8.592  -0.016  -3.392 1.00 . A A . 148 TYR CD2  1 1 
        1  2447 1 1 148 TYR CE1  C   6.068  -1.128  -3.410 1.00 . A A . 148 TYR CE1  1 1 
        1  2448 1 1 148 TYR CE2  C   8.439  -1.382  -3.261 1.00 . A A . 148 TYR CE2  1 1 
        1  2449 1 1 148 TYR CG   C   7.488   0.835  -3.536 1.00 . A A . 148 TYR CG   1 1 
        1  2450 1 1 148 TYR CZ   C   7.178  -1.933  -3.272 1.00 . A A . 148 TYR CZ   1 1 
        1  2451 1 1 148 TYR H    H   7.214   1.751  -6.123 1.00 . A A . 148 TYR H    1 1 
        1  2452 1 1 148 TYR HA   H   5.640   2.916  -4.134 1.00 . A A . 148 TYR HA   1 1 
        1  2453 1 1 148 TYR HB2  H   8.656   2.543  -4.115 1.00 . A A . 148 TYR HB2  1 1 
        1  2454 1 1 148 TYR HB3  H   7.638   2.802  -2.700 1.00 . A A . 148 TYR HB3  1 1 
        1  2455 1 1 148 TYR HD1  H   5.339   0.863  -3.652 1.00 . A A . 148 TYR HD1  1 1 
        1  2456 1 1 148 TYR HD2  H   9.588   0.409  -3.393 1.00 . A A . 148 TYR HD2  1 1 
        1  2457 1 1 148 TYR HE1  H   5.076  -1.564  -3.414 1.00 . A A . 148 TYR HE1  1 1 
        1  2458 1 1 148 TYR HE2  H   9.312  -2.013  -3.155 1.00 . A A . 148 TYR HE2  1 1 
        1  2459 1 1 148 TYR HH   H   6.441  -3.619  -3.834 1.00 . A A . 148 TYR HH   1 1 
        1  2460 1 1 148 TYR N    N   6.572   2.457  -5.916 1.00 . A A . 148 TYR N    1 1 
        1  2461 1 1 148 TYR O    O   6.315   5.333  -3.919 1.00 . A A . 148 TYR O    1 1 
        1  2462 1 1 148 TYR OH   O   7.023  -3.298  -3.142 1.00 . A A . 148 TYR OH   1 1 
        1  2463 1 1 149 LYS C    C   6.641   7.104  -6.430 1.00 . A A . 149 LYS C    1 1 
        1  2464 1 1 149 LYS CA   C   7.933   6.370  -6.016 1.00 . A A . 149 LYS CA   1 1 
        1  2465 1 1 149 LYS CB   C   8.989   6.500  -7.141 1.00 . A A . 149 LYS CB   1 1 
        1  2466 1 1 149 LYS CD   C  10.333   8.035  -8.694 1.00 . A A . 149 LYS CD   1 1 
        1  2467 1 1 149 LYS CE   C  10.559   9.477  -9.178 1.00 . A A . 149 LYS CE   1 1 
        1  2468 1 1 149 LYS CG   C   9.296   7.955  -7.562 1.00 . A A . 149 LYS CG   1 1 
        1  2469 1 1 149 LYS H    H   8.110   4.266  -6.248 1.00 . A A . 149 LYS H    1 1 
        1  2470 1 1 149 LYS HA   H   8.327   6.838  -5.118 1.00 . A A . 149 LYS HA   1 1 
        1  2471 1 1 149 LYS HB2  H   9.911   6.038  -6.800 1.00 . A A . 149 LYS HB2  1 1 
        1  2472 1 1 149 LYS HB3  H   8.636   5.958  -8.013 1.00 . A A . 149 LYS HB3  1 1 
        1  2473 1 1 149 LYS HD2  H  11.276   7.635  -8.337 1.00 . A A . 149 LYS HD2  1 1 
        1  2474 1 1 149 LYS HD3  H   9.989   7.434  -9.532 1.00 . A A . 149 LYS HD3  1 1 
        1  2475 1 1 149 LYS HE2  H   9.614   9.900  -9.501 1.00 . A A . 149 LYS HE2  1 1 
        1  2476 1 1 149 LYS HE3  H  10.955  10.069  -8.363 1.00 . A A . 149 LYS HE3  1 1 
        1  2477 1 1 149 LYS HG2  H   8.375   8.421  -7.901 1.00 . A A . 149 LYS HG2  1 1 
        1  2478 1 1 149 LYS HG3  H   9.671   8.500  -6.701 1.00 . A A . 149 LYS HG3  1 1 
        1  2479 1 1 149 LYS HZ1  H  12.471   9.303  -9.984 1.00 . A A . 149 LYS HZ1  1 1 
        1  2480 1 1 149 LYS HZ2  H  11.515  10.476 -10.736 1.00 . A A . 149 LYS HZ2  1 1 
        1  2481 1 1 149 LYS HZ3  H  11.240   8.834 -11.041 1.00 . A A . 149 LYS HZ3  1 1 
        1  2482 1 1 149 LYS N    N   7.674   4.960  -5.698 1.00 . A A . 149 LYS N    1 1 
        1  2483 1 1 149 LYS NZ   N  11.512   9.526 -10.313 1.00 . A A . 149 LYS NZ   1 1 
        1  2484 1 1 149 LYS O    O   6.316   8.132  -5.834 1.00 . A A . 149 LYS O    1 1 
        1  2485 1 1 150 VAL C    C   3.613   7.438  -6.963 1.00 . A A . 150 VAL C    1 1 
        1  2486 1 1 150 VAL CA   C   4.719   7.266  -8.017 1.00 . A A . 150 VAL CA   1 1 
        1  2487 1 1 150 VAL CB   C   4.119   6.577  -9.315 1.00 . A A . 150 VAL CB   1 1 
        1  2488 1 1 150 VAL CG1  C   5.187   6.436 -10.403 1.00 . A A . 150 VAL CG1  1 1 
        1  2489 1 1 150 VAL CG2  C   3.450   5.205  -9.030 1.00 . A A . 150 VAL CG2  1 1 
        1  2490 1 1 150 VAL H    H   6.176   5.695  -7.817 1.00 . A A . 150 VAL H    1 1 
        1  2491 1 1 150 VAL HA   H   5.055   8.262  -8.308 1.00 . A A . 150 VAL HA   1 1 
        1  2492 1 1 150 VAL HB   H   3.348   7.238  -9.708 1.00 . A A . 150 VAL HB   1 1 
        1  2493 1 1 150 VAL HG11 H   5.971   5.780 -10.047 1.00 . A A . 150 VAL HG11 1 1 
        1  2494 1 1 150 VAL HG12 H   5.607   7.404 -10.634 1.00 . A A . 150 VAL HG12 1 1 
        1  2495 1 1 150 VAL HG13 H   4.748   6.011 -11.297 1.00 . A A . 150 VAL HG13 1 1 
        1  2496 1 1 150 VAL HG21 H   4.190   4.506  -8.659 1.00 . A A . 150 VAL HG21 1 1 
        1  2497 1 1 150 VAL HG22 H   3.012   4.810  -9.940 1.00 . A A . 150 VAL HG22 1 1 
        1  2498 1 1 150 VAL HG23 H   2.672   5.322  -8.287 1.00 . A A . 150 VAL HG23 1 1 
        1  2499 1 1 150 VAL N    N   5.910   6.571  -7.451 1.00 . A A . 150 VAL N    1 1 
        1  2500 1 1 150 VAL O    O   2.960   8.488  -6.920 1.00 . A A . 150 VAL O    1 1 
        1  2501 1 1 151 ILE C    C   2.792   7.209  -3.818 1.00 . A A . 151 ILE C    1 1 
        1  2502 1 1 151 ILE CA   C   2.361   6.431  -5.077 1.00 . A A . 151 ILE CA   1 1 
        1  2503 1 1 151 ILE CB   C   1.899   4.970  -4.727 1.00 . A A . 151 ILE CB   1 1 
        1  2504 1 1 151 ILE CD1  C   2.899   2.626  -4.133 1.00 . A A . 151 ILE CD1  1 1 
        1  2505 1 1 151 ILE CG1  C   3.064   4.138  -4.082 1.00 . A A . 151 ILE CG1  1 1 
        1  2506 1 1 151 ILE CG2  C   1.345   4.281  -6.003 1.00 . A A . 151 ILE CG2  1 1 
        1  2507 1 1 151 ILE H    H   4.016   5.614  -6.183 1.00 . A A . 151 ILE H    1 1 
        1  2508 1 1 151 ILE HA   H   1.504   6.954  -5.501 1.00 . A A . 151 ILE HA   1 1 
        1  2509 1 1 151 ILE HB   H   1.078   5.043  -4.015 1.00 . A A . 151 ILE HB   1 1 
        1  2510 1 1 151 ILE HD11 H   3.708   2.161  -3.593 1.00 . A A . 151 ILE HD11 1 1 
        1  2511 1 1 151 ILE HD12 H   2.931   2.306  -5.171 1.00 . A A . 151 ILE HD12 1 1 
        1  2512 1 1 151 ILE HD13 H   1.955   2.340  -3.694 1.00 . A A . 151 ILE HD13 1 1 
        1  2513 1 1 151 ILE HG12 H   3.987   4.367  -4.599 1.00 . A A . 151 ILE HG12 1 1 
        1  2514 1 1 151 ILE HG13 H   3.171   4.425  -3.044 1.00 . A A . 151 ILE HG13 1 1 
        1  2515 1 1 151 ILE HG21 H   0.965   3.300  -5.749 1.00 . A A . 151 ILE HG21 1 1 
        1  2516 1 1 151 ILE HG22 H   2.136   4.175  -6.735 1.00 . A A . 151 ILE HG22 1 1 
        1  2517 1 1 151 ILE HG23 H   0.544   4.873  -6.427 1.00 . A A . 151 ILE HG23 1 1 
        1  2518 1 1 151 ILE N    N   3.428   6.413  -6.107 1.00 . A A . 151 ILE N    1 1 
        1  2519 1 1 151 ILE O    O   1.943   7.742  -3.090 1.00 . A A . 151 ILE O    1 1 
        1  2520 1 1 152 CYS C    C   4.601   9.626  -2.943 1.00 . A A . 152 CYS C    1 1 
        1  2521 1 1 152 CYS CA   C   4.697   8.154  -2.540 1.00 . A A . 152 CYS CA   1 1 
        1  2522 1 1 152 CYS CB   C   6.183   7.821  -2.302 1.00 . A A . 152 CYS CB   1 1 
        1  2523 1 1 152 CYS H    H   4.721   6.698  -4.100 1.00 . A A . 152 CYS H    1 1 
        1  2524 1 1 152 CYS HA   H   4.139   7.999  -1.619 1.00 . A A . 152 CYS HA   1 1 
        1  2525 1 1 152 CYS HB2  H   6.256   6.879  -1.769 1.00 . A A . 152 CYS HB2  1 1 
        1  2526 1 1 152 CYS HB3  H   6.683   7.718  -3.258 1.00 . A A . 152 CYS HB3  1 1 
        1  2527 1 1 152 CYS HG   H   6.321   9.413  -0.320 1.00 . A A . 152 CYS HG   1 1 
        1  2528 1 1 152 CYS N    N   4.117   7.273  -3.576 1.00 . A A . 152 CYS N    1 1 
        1  2529 1 1 152 CYS O    O   4.345  10.494  -2.116 1.00 . A A . 152 CYS O    1 1 
        1  2530 1 1 152 CYS SG   S   7.093   9.053  -1.342 1.00 . A A . 152 CYS SG   1 1 
        1  2531 1 1 153 LYS C    C   3.536  11.988  -4.716 1.00 . A A . 153 LYS C    1 1 
        1  2532 1 1 153 LYS CA   C   4.895  11.250  -4.805 1.00 . A A . 153 LYS CA   1 1 
        1  2533 1 1 153 LYS CB   C   5.415  11.142  -6.265 1.00 . A A . 153 LYS CB   1 1 
        1  2534 1 1 153 LYS CD   C   6.361  12.305  -8.358 1.00 . A A . 153 LYS CD   1 1 
        1  2535 1 1 153 LYS CE   C   6.379  13.608  -9.175 1.00 . A A . 153 LYS CE   1 1 
        1  2536 1 1 153 LYS CG   C   5.679  12.480  -6.978 1.00 . A A . 153 LYS CG   1 1 
        1  2537 1 1 153 LYS H    H   4.840   9.129  -4.865 1.00 . A A . 153 LYS H    1 1 
        1  2538 1 1 153 LYS HA   H   5.623  11.799  -4.212 1.00 . A A . 153 LYS HA   1 1 
        1  2539 1 1 153 LYS HB2  H   6.342  10.576  -6.252 1.00 . A A . 153 LYS HB2  1 1 
        1  2540 1 1 153 LYS HB3  H   4.687  10.582  -6.848 1.00 . A A . 153 LYS HB3  1 1 
        1  2541 1 1 153 LYS HD2  H   7.383  11.975  -8.208 1.00 . A A . 153 LYS HD2  1 1 
        1  2542 1 1 153 LYS HD3  H   5.826  11.547  -8.923 1.00 . A A . 153 LYS HD3  1 1 
        1  2543 1 1 153 LYS HE2  H   7.007  13.471 -10.046 1.00 . A A . 153 LYS HE2  1 1 
        1  2544 1 1 153 LYS HE3  H   5.370  13.835  -9.501 1.00 . A A . 153 LYS HE3  1 1 
        1  2545 1 1 153 LYS HG2  H   4.732  12.987  -7.113 1.00 . A A . 153 LYS HG2  1 1 
        1  2546 1 1 153 LYS HG3  H   6.317  13.091  -6.343 1.00 . A A . 153 LYS HG3  1 1 
        1  2547 1 1 153 LYS HZ1  H   7.003  15.593  -9.020 1.00 . A A . 153 LYS HZ1  1 1 
        1  2548 1 1 153 LYS HZ2  H   7.822  14.535  -7.988 1.00 . A A . 153 LYS HZ2  1 1 
        1  2549 1 1 153 LYS HZ3  H   6.238  15.008  -7.634 1.00 . A A . 153 LYS HZ3  1 1 
        1  2550 1 1 153 LYS N    N   4.795   9.886  -4.244 1.00 . A A . 153 LYS N    1 1 
        1  2551 1 1 153 LYS NZ   N   6.898  14.764  -8.399 1.00 . A A . 153 LYS NZ   1 1 
        1  2552 1 1 153 LYS O    O   3.472  13.223  -4.823 1.00 . A A . 153 LYS O    1 1 
        1  2553 1 1 154 LEU C    C   1.025  12.313  -2.835 1.00 . A A . 154 LEU C    1 1 
        1  2554 1 1 154 LEU CA   C   1.114  11.738  -4.265 1.00 . A A . 154 LEU CA   1 1 
        1  2555 1 1 154 LEU CB   C   0.053  10.619  -4.481 1.00 . A A . 154 LEU CB   1 1 
        1  2556 1 1 154 LEU CD1  C  -0.960   8.765  -5.940 1.00 . A A . 154 LEU CD1  1 1 
        1  2557 1 1 154 LEU CD2  C   0.119  10.808  -7.054 1.00 . A A . 154 LEU CD2  1 1 
        1  2558 1 1 154 LEU CG   C   0.141   9.844  -5.836 1.00 . A A . 154 LEU CG   1 1 
        1  2559 1 1 154 LEU H    H   2.585  10.237  -4.494 1.00 . A A . 154 LEU H    1 1 
        1  2560 1 1 154 LEU HA   H   0.936  12.536  -4.983 1.00 . A A . 154 LEU HA   1 1 
        1  2561 1 1 154 LEU HB2  H   0.151   9.898  -3.673 1.00 . A A . 154 LEU HB2  1 1 
        1  2562 1 1 154 LEU HB3  H  -0.932  11.071  -4.410 1.00 . A A . 154 LEU HB3  1 1 
        1  2563 1 1 154 LEU HD11 H  -0.858   8.063  -5.123 1.00 . A A . 154 LEU HD11 1 1 
        1  2564 1 1 154 LEU HD12 H  -0.859   8.230  -6.875 1.00 . A A . 154 LEU HD12 1 1 
        1  2565 1 1 154 LEU HD13 H  -1.941   9.225  -5.897 1.00 . A A . 154 LEU HD13 1 1 
        1  2566 1 1 154 LEU HD21 H   0.969  11.478  -7.006 1.00 . A A . 154 LEU HD21 1 1 
        1  2567 1 1 154 LEU HD22 H  -0.794  11.390  -7.053 1.00 . A A . 154 LEU HD22 1 1 
        1  2568 1 1 154 LEU HD23 H   0.176  10.238  -7.972 1.00 . A A . 154 LEU HD23 1 1 
        1  2569 1 1 154 LEU HG   H   1.090   9.324  -5.862 1.00 . A A . 154 LEU HG   1 1 
        1  2570 1 1 154 LEU N    N   2.460  11.209  -4.500 1.00 . A A . 154 LEU N    1 1 
        1  2571 1 1 154 LEU O    O   0.720  13.495  -2.653 1.00 . A A . 154 LEU O    1 1 
        1  2572 1 1 155 ASP C    C   2.457  11.159   0.351 1.00 . A A . 155 ASP C    1 1 
        1  2573 1 1 155 ASP CA   C   1.272  11.819  -0.388 1.00 . A A . 155 ASP CA   1 1 
        1  2574 1 1 155 ASP CB   C  -0.090  11.395   0.270 1.00 . A A . 155 ASP CB   1 1 
        1  2575 1 1 155 ASP CG   C  -1.277  12.320  -0.077 1.00 . A A . 155 ASP CG   1 1 
        1  2576 1 1 155 ASP H    H   1.594  10.548  -2.066 1.00 . A A . 155 ASP H    1 1 
        1  2577 1 1 155 ASP HA   H   1.384  12.898  -0.301 1.00 . A A . 155 ASP HA   1 1 
        1  2578 1 1 155 ASP HB2  H  -0.335  10.388  -0.052 1.00 . A A . 155 ASP HB2  1 1 
        1  2579 1 1 155 ASP HB3  H   0.030  11.381   1.351 1.00 . A A . 155 ASP HB3  1 1 
        1  2580 1 1 155 ASP N    N   1.318  11.460  -1.829 1.00 . A A . 155 ASP N    1 1 
        1  2581 1 1 155 ASP O    O   2.339  10.043   0.862 1.00 . A A . 155 ASP O    1 1 
        1  2582 1 1 155 ASP OD1  O  -1.906  12.149  -1.145 1.00 . A A . 155 ASP OD1  1 1 
        1  2583 1 1 155 ASP OD2  O  -1.580  13.238   0.720 1.00 . A A . 155 ASP OD2  1 1 
        1  2584 1 1 156 SER C    C   4.656  11.379   2.613 1.00 . A A . 156 SER C    1 1 
        1  2585 1 1 156 SER CA   C   4.837  11.378   1.079 1.00 . A A . 156 SER CA   1 1 
        1  2586 1 1 156 SER CB   C   6.050  12.245   0.682 1.00 . A A . 156 SER CB   1 1 
        1  2587 1 1 156 SER H    H   3.668  12.694  -0.132 1.00 . A A . 156 SER H    1 1 
        1  2588 1 1 156 SER HA   H   5.022  10.361   0.756 1.00 . A A . 156 SER HA   1 1 
        1  2589 1 1 156 SER HB2  H   5.905  13.260   1.027 1.00 . A A . 156 SER HB2  1 1 
        1  2590 1 1 156 SER HB3  H   6.951  11.842   1.129 1.00 . A A . 156 SER HB3  1 1 
        1  2591 1 1 156 SER HG   H   5.787  11.509  -1.117 1.00 . A A . 156 SER HG   1 1 
        1  2592 1 1 156 SER N    N   3.617  11.852   0.372 1.00 . A A . 156 SER N    1 1 
        1  2593 1 1 156 SER O    O   5.321  10.622   3.331 1.00 . A A . 156 SER O    1 1 
        1  2594 1 1 156 SER OG   O   6.221  12.269  -0.728 1.00 . A A . 156 SER OG   1 1 
        1  2595 1 1 157 GLU C    C   1.970  12.177   4.772 1.00 . A A . 157 GLU C    1 1 
        1  2596 1 1 157 GLU CA   C   3.454  12.454   4.501 1.00 . A A . 157 GLU CA   1 1 
        1  2597 1 1 157 GLU CB   C   3.818  13.929   4.837 1.00 . A A . 157 GLU CB   1 1 
        1  2598 1 1 157 GLU CD   C   3.924  15.832   6.560 1.00 . A A . 157 GLU CD   1 1 
        1  2599 1 1 157 GLU CG   C   3.476  14.391   6.266 1.00 . A A . 157 GLU CG   1 1 
        1  2600 1 1 157 GLU H    H   3.193  12.712   2.428 1.00 . A A . 157 GLU H    1 1 
        1  2601 1 1 157 GLU HA   H   4.067  11.783   5.103 1.00 . A A . 157 GLU HA   1 1 
        1  2602 1 1 157 GLU HB2  H   4.883  14.061   4.688 1.00 . A A . 157 GLU HB2  1 1 
        1  2603 1 1 157 GLU HB3  H   3.295  14.581   4.140 1.00 . A A . 157 GLU HB3  1 1 
        1  2604 1 1 157 GLU HG2  H   2.400  14.317   6.403 1.00 . A A . 157 GLU HG2  1 1 
        1  2605 1 1 157 GLU HG3  H   3.959  13.722   6.970 1.00 . A A . 157 GLU HG3  1 1 
        1  2606 1 1 157 GLU N    N   3.733  12.223   3.080 1.00 . A A . 157 GLU N    1 1 
        1  2607 1 1 157 GLU O    O   1.126  12.540   3.950 1.00 . A A . 157 GLU O    1 1 
        1  2608 1 1 157 GLU OE1  O   5.083  16.033   6.968 1.00 . A A . 157 GLU OE1  1 1 
        1  2609 1 1 157 GLU OE2  O   3.122  16.769   6.361 1.00 . A A . 157 GLU OE2  1 1 
        1  2610 1 1 158 VAL C    C  -0.346  12.669   6.814 1.00 . A A . 158 VAL C    1 1 
        1  2611 1 1 158 VAL CA   C   0.253  11.315   6.330 1.00 . A A . 158 VAL CA   1 1 
        1  2612 1 1 158 VAL CB   C   0.082  10.182   7.425 1.00 . A A . 158 VAL CB   1 1 
        1  2613 1 1 158 VAL CG1  C   0.476   8.805   6.851 1.00 . A A . 158 VAL CG1  1 1 
        1  2614 1 1 158 VAL CG2  C   0.874  10.478   8.724 1.00 . A A . 158 VAL CG2  1 1 
        1  2615 1 1 158 VAL H    H   2.369  11.152   6.463 1.00 . A A . 158 VAL H    1 1 
        1  2616 1 1 158 VAL HA   H  -0.298  10.996   5.444 1.00 . A A . 158 VAL HA   1 1 
        1  2617 1 1 158 VAL HB   H  -0.977  10.136   7.682 1.00 . A A . 158 VAL HB   1 1 
        1  2618 1 1 158 VAL HG11 H  -0.122   8.585   5.973 1.00 . A A . 158 VAL HG11 1 1 
        1  2619 1 1 158 VAL HG12 H   0.310   8.036   7.591 1.00 . A A . 158 VAL HG12 1 1 
        1  2620 1 1 158 VAL HG13 H   1.525   8.810   6.572 1.00 . A A . 158 VAL HG13 1 1 
        1  2621 1 1 158 VAL HG21 H   1.932  10.549   8.502 1.00 . A A . 158 VAL HG21 1 1 
        1  2622 1 1 158 VAL HG22 H   0.712   9.684   9.444 1.00 . A A . 158 VAL HG22 1 1 
        1  2623 1 1 158 VAL HG23 H   0.540  11.414   9.152 1.00 . A A . 158 VAL HG23 1 1 
        1  2624 1 1 158 VAL N    N   1.651  11.513   5.909 1.00 . A A . 158 VAL N    1 1 
        1  2625 1 1 158 VAL O    O   0.166  13.277   7.763 1.00 . A A . 158 VAL O    1 1 
        1  2626 1 1 159 PRO C    C  -3.252  14.270   7.463 1.00 . A A . 159 PRO C    1 1 
        1  2627 1 1 159 PRO CA   C  -2.055  14.475   6.510 1.00 . A A . 159 PRO CA   1 1 
        1  2628 1 1 159 PRO CB   C  -2.511  15.003   5.135 1.00 . A A . 159 PRO CB   1 1 
        1  2629 1 1 159 PRO CD   C  -2.043  12.638   4.891 1.00 . A A . 159 PRO CD   1 1 
        1  2630 1 1 159 PRO CG   C  -2.924  13.772   4.379 1.00 . A A . 159 PRO CG   1 1 
        1  2631 1 1 159 PRO HA   H  -1.353  15.174   6.956 1.00 . A A . 159 PRO HA   1 1 
        1  2632 1 1 159 PRO HB2  H  -3.341  15.700   5.248 1.00 . A A . 159 PRO HB2  1 1 
        1  2633 1 1 159 PRO HB3  H  -1.688  15.493   4.630 1.00 . A A . 159 PRO HB3  1 1 
        1  2634 1 1 159 PRO HD2  H  -2.642  11.767   5.136 1.00 . A A . 159 PRO HD2  1 1 
        1  2635 1 1 159 PRO HD3  H  -1.288  12.374   4.157 1.00 . A A . 159 PRO HD3  1 1 
        1  2636 1 1 159 PRO HG2  H  -3.974  13.559   4.573 1.00 . A A . 159 PRO HG2  1 1 
        1  2637 1 1 159 PRO HG3  H  -2.769  13.917   3.317 1.00 . A A . 159 PRO HG3  1 1 
        1  2638 1 1 159 PRO N    N  -1.407  13.203   6.123 1.00 . A A . 159 PRO N    1 1 
        1  2639 1 1 159 PRO O    O  -3.979  15.222   7.767 1.00 . A A . 159 PRO O    1 1 
        1  2640 1 1 160 GLU C    C  -4.266  12.069  10.046 1.00 . A A . 160 GLU C    1 1 
        1  2641 1 1 160 GLU CA   C  -4.641  12.613   8.660 1.00 . A A . 160 GLU CA   1 1 
        1  2642 1 1 160 GLU CB   C  -5.398  11.537   7.842 1.00 . A A . 160 GLU CB   1 1 
        1  2643 1 1 160 GLU CD   C  -7.532  10.097   7.620 1.00 . A A . 160 GLU CD   1 1 
        1  2644 1 1 160 GLU CG   C  -6.789  11.190   8.409 1.00 . A A . 160 GLU CG   1 1 
        1  2645 1 1 160 GLU H    H  -2.730  12.370   7.814 1.00 . A A . 160 GLU H    1 1 
        1  2646 1 1 160 GLU HA   H  -5.295  13.481   8.782 1.00 . A A . 160 GLU HA   1 1 
        1  2647 1 1 160 GLU HB2  H  -5.522  11.899   6.824 1.00 . A A . 160 GLU HB2  1 1 
        1  2648 1 1 160 GLU HB3  H  -4.800  10.631   7.813 1.00 . A A . 160 GLU HB3  1 1 
        1  2649 1 1 160 GLU HG2  H  -6.664  10.862   9.439 1.00 . A A . 160 GLU HG2  1 1 
        1  2650 1 1 160 GLU HG3  H  -7.401  12.087   8.408 1.00 . A A . 160 GLU HG3  1 1 
        1  2651 1 1 160 GLU N    N  -3.440  13.027   7.935 1.00 . A A . 160 GLU N    1 1 
        1  2652 1 1 160 GLU O    O  -3.521  11.086  10.153 1.00 . A A . 160 GLU O    1 1 
        1  2653 1 1 160 GLU OE1  O  -7.622  10.192   6.369 1.00 . A A . 160 GLU OE1  1 1 
        1  2654 1 1 160 GLU OE2  O  -8.036   9.144   8.247 1.00 . A A . 160 GLU OE2  1 1 
        1  2655 1 1 161 ILE C    C  -5.884  11.414  12.834 1.00 . A A . 161 ILE C    1 1 
        1  2656 1 1 161 ILE CA   C  -4.652  12.283  12.489 1.00 . A A . 161 ILE CA   1 1 
        1  2657 1 1 161 ILE CB   C  -4.508  13.505  13.477 1.00 . A A . 161 ILE CB   1 1 
        1  2658 1 1 161 ILE CD1  C  -4.183  14.125  15.992 1.00 . A A . 161 ILE CD1  1 1 
        1  2659 1 1 161 ILE CG1  C  -4.257  13.024  14.947 1.00 . A A . 161 ILE CG1  1 1 
        1  2660 1 1 161 ILE CG2  C  -5.725  14.450  13.385 1.00 . A A . 161 ILE CG2  1 1 
        1  2661 1 1 161 ILE H    H  -5.266  13.562  10.918 1.00 . A A . 161 ILE H    1 1 
        1  2662 1 1 161 ILE HA   H  -3.752  11.671  12.569 1.00 . A A . 161 ILE HA   1 1 
        1  2663 1 1 161 ILE HB   H  -3.640  14.074  13.150 1.00 . A A . 161 ILE HB   1 1 
        1  2664 1 1 161 ILE HD11 H  -5.113  14.677  16.006 1.00 . A A . 161 ILE HD11 1 1 
        1  2665 1 1 161 ILE HD12 H  -3.368  14.798  15.759 1.00 . A A . 161 ILE HD12 1 1 
        1  2666 1 1 161 ILE HD13 H  -4.017  13.683  16.963 1.00 . A A . 161 ILE HD13 1 1 
        1  2667 1 1 161 ILE HG12 H  -5.049  12.351  15.248 1.00 . A A . 161 ILE HG12 1 1 
        1  2668 1 1 161 ILE HG13 H  -3.314  12.490  14.978 1.00 . A A . 161 ILE HG13 1 1 
        1  2669 1 1 161 ILE HG21 H  -5.595  15.286  14.062 1.00 . A A . 161 ILE HG21 1 1 
        1  2670 1 1 161 ILE HG22 H  -6.626  13.914  13.652 1.00 . A A . 161 ILE HG22 1 1 
        1  2671 1 1 161 ILE HG23 H  -5.823  14.826  12.374 1.00 . A A . 161 ILE HG23 1 1 
        1  2672 1 1 161 ILE N    N  -4.774  12.735  11.095 1.00 . A A . 161 ILE N    1 1 
        1  2673 1 1 161 ILE O    O  -7.032  11.788  12.536 1.00 . A A . 161 ILE O    1 1 
        1  2674 1 1 162 PHE C    C  -7.386   9.397  15.009 1.00 . A A . 162 PHE C    1 1 
        1  2675 1 1 162 PHE CA   C  -6.680   9.212  13.662 1.00 . A A . 162 PHE CA   1 1 
        1  2676 1 1 162 PHE CB   C  -6.067   7.793  13.531 1.00 . A A . 162 PHE CB   1 1 
        1  2677 1 1 162 PHE CD1  C  -6.285   7.432  11.022 1.00 . A A . 162 PHE CD1  1 1 
        1  2678 1 1 162 PHE CD2  C  -4.085   7.488  11.953 1.00 . A A . 162 PHE CD2  1 1 
        1  2679 1 1 162 PHE CE1  C  -5.744   7.259   9.766 1.00 . A A . 162 PHE CE1  1 1 
        1  2680 1 1 162 PHE CE2  C  -3.549   7.309  10.693 1.00 . A A . 162 PHE CE2  1 1 
        1  2681 1 1 162 PHE CG   C  -5.463   7.554  12.142 1.00 . A A . 162 PHE CG   1 1 
        1  2682 1 1 162 PHE CZ   C  -4.376   7.195   9.602 1.00 . A A . 162 PHE CZ   1 1 
        1  2683 1 1 162 PHE H    H  -4.716  10.044  13.714 1.00 . A A . 162 PHE H    1 1 
        1  2684 1 1 162 PHE HA   H  -7.432   9.325  12.880 1.00 . A A . 162 PHE HA   1 1 
        1  2685 1 1 162 PHE HB2  H  -5.292   7.662  14.283 1.00 . A A . 162 PHE HB2  1 1 
        1  2686 1 1 162 PHE HB3  H  -6.839   7.047  13.693 1.00 . A A . 162 PHE HB3  1 1 
        1  2687 1 1 162 PHE HD1  H  -7.362   7.480  11.139 1.00 . A A . 162 PHE HD1  1 1 
        1  2688 1 1 162 PHE HD2  H  -3.427   7.581  12.810 1.00 . A A . 162 PHE HD2  1 1 
        1  2689 1 1 162 PHE HE1  H  -6.398   7.165   8.904 1.00 . A A . 162 PHE HE1  1 1 
        1  2690 1 1 162 PHE HE2  H  -2.477   7.260  10.568 1.00 . A A . 162 PHE HE2  1 1 
        1  2691 1 1 162 PHE HZ   H  -3.955   7.052   8.613 1.00 . A A . 162 PHE HZ   1 1 
        1  2692 1 1 162 PHE N    N  -5.635  10.236  13.426 1.00 . A A . 162 PHE N    1 1 
        1  2693 1 1 162 PHE O    O  -8.537   8.971  15.155 1.00 . A A . 162 PHE O    1 1 
        1  2694 1 1 163 LYS C    C  -8.549  11.116  17.252 1.00 . A A . 163 LYS C    1 1 
        1  2695 1 1 163 LYS CA   C  -7.223  10.331  17.324 1.00 . A A . 163 LYS CA   1 1 
        1  2696 1 1 163 LYS CB   C  -6.142  11.163  18.075 1.00 . A A . 163 LYS CB   1 1 
        1  2697 1 1 163 LYS CD   C  -5.342  12.384  20.180 1.00 . A A . 163 LYS CD   1 1 
        1  2698 1 1 163 LYS CE   C  -5.643  12.797  21.630 1.00 . A A . 163 LYS CE   1 1 
        1  2699 1 1 163 LYS CG   C  -6.491  11.583  19.521 1.00 . A A . 163 LYS CG   1 1 
        1  2700 1 1 163 LYS H    H  -5.731  10.164  15.850 1.00 . A A . 163 LYS H    1 1 
        1  2701 1 1 163 LYS HA   H  -7.379   9.398  17.856 1.00 . A A . 163 LYS HA   1 1 
        1  2702 1 1 163 LYS HB2  H  -5.226  10.578  18.112 1.00 . A A . 163 LYS HB2  1 1 
        1  2703 1 1 163 LYS HB3  H  -5.942  12.064  17.502 1.00 . A A . 163 LYS HB3  1 1 
        1  2704 1 1 163 LYS HD2  H  -4.444  11.774  20.175 1.00 . A A . 163 LYS HD2  1 1 
        1  2705 1 1 163 LYS HD3  H  -5.162  13.278  19.593 1.00 . A A . 163 LYS HD3  1 1 
        1  2706 1 1 163 LYS HE2  H  -6.500  13.460  21.645 1.00 . A A . 163 LYS HE2  1 1 
        1  2707 1 1 163 LYS HE3  H  -5.864  11.913  22.215 1.00 . A A . 163 LYS HE3  1 1 
        1  2708 1 1 163 LYS HG2  H  -7.384  12.201  19.504 1.00 . A A . 163 LYS HG2  1 1 
        1  2709 1 1 163 LYS HG3  H  -6.686  10.693  20.113 1.00 . A A . 163 LYS HG3  1 1 
        1  2710 1 1 163 LYS HZ1  H  -3.637  12.897  22.201 1.00 . A A . 163 LYS HZ1  1 1 
        1  2711 1 1 163 LYS HZ2  H  -4.686  13.718  23.242 1.00 . A A . 163 LYS HZ2  1 1 
        1  2712 1 1 163 LYS HZ3  H  -4.289  14.389  21.741 1.00 . A A . 163 LYS HZ3  1 1 
        1  2713 1 1 163 LYS N    N  -6.683  10.007  15.982 1.00 . A A . 163 LYS N    1 1 
        1  2714 1 1 163 LYS NZ   N  -4.484  13.499  22.245 1.00 . A A . 163 LYS NZ   1 1 
        1  2715 1 1 163 LYS O    O  -9.535  10.734  17.882 1.00 . A A . 163 LYS O    1 1 
        1  2716 1 1 164 SER C    C  -9.330  13.866  14.905 1.00 . A A . 164 SER C    1 1 
        1  2717 1 1 164 SER CA   C  -9.714  13.008  16.117 1.00 . A A . 164 SER CA   1 1 
        1  2718 1 1 164 SER CB   C -10.126  13.938  17.301 1.00 . A A . 164 SER CB   1 1 
        1  2719 1 1 164 SER H    H  -7.693  12.399  16.006 1.00 . A A . 164 SER H    1 1 
        1  2720 1 1 164 SER HA   H -10.538  12.352  15.862 1.00 . A A . 164 SER HA   1 1 
        1  2721 1 1 164 SER HB2  H  -9.279  14.533  17.607 1.00 . A A . 164 SER HB2  1 1 
        1  2722 1 1 164 SER HB3  H -10.924  14.596  16.983 1.00 . A A . 164 SER HB3  1 1 
        1  2723 1 1 164 SER HG   H  -9.841  12.720  18.801 1.00 . A A . 164 SER HG   1 1 
        1  2724 1 1 164 SER N    N  -8.544  12.168  16.434 1.00 . A A . 164 SER N    1 1 
        1  2725 1 1 164 SER O    O  -8.278  14.487  14.963 1.00 . A A . 164 SER O    1 1 
        1  2726 1 1 164 SER OG   O -10.573  13.215  18.430 1.00 . A A . 164 SER OG   1 1 
        1  2727 1 1 165 PRO C    C  -9.322  16.145  12.868 1.00 . A A . 165 PRO C    1 1 
        1  2728 1 1 165 PRO CA   C  -9.850  14.711  12.574 1.00 . A A . 165 PRO CA   1 1 
        1  2729 1 1 165 PRO CB   C -11.229  14.749  11.880 1.00 . A A . 165 PRO CB   1 1 
        1  2730 1 1 165 PRO CD   C -11.391  13.091  13.614 1.00 . A A . 165 PRO CD   1 1 
        1  2731 1 1 165 PRO CG   C -11.841  13.421  12.201 1.00 . A A . 165 PRO CG   1 1 
        1  2732 1 1 165 PRO HA   H  -9.133  14.203  11.928 1.00 . A A . 165 PRO HA   1 1 
        1  2733 1 1 165 PRO HB2  H -11.832  15.566  12.280 1.00 . A A . 165 PRO HB2  1 1 
        1  2734 1 1 165 PRO HB3  H -11.116  14.863  10.809 1.00 . A A . 165 PRO HB3  1 1 
        1  2735 1 1 165 PRO HD2  H -12.140  13.397  14.336 1.00 . A A . 165 PRO HD2  1 1 
        1  2736 1 1 165 PRO HD3  H -11.191  12.031  13.715 1.00 . A A . 165 PRO HD3  1 1 
        1  2737 1 1 165 PRO HG2  H -12.924  13.486  12.146 1.00 . A A . 165 PRO HG2  1 1 
        1  2738 1 1 165 PRO HG3  H -11.478  12.664  11.512 1.00 . A A . 165 PRO HG3  1 1 
        1  2739 1 1 165 PRO N    N -10.140  13.892  13.794 1.00 . A A . 165 PRO N    1 1 
        1  2740 1 1 165 PRO O    O  -8.235  16.527  12.416 1.00 . A A . 165 PRO O    1 1 
        1  2741 1 1 166 ASN C    C  -8.891  18.438  15.293 1.00 . A A . 166 ASN C    1 1 
        1  2742 1 1 166 ASN CA   C  -9.771  18.306  14.015 1.00 . A A . 166 ASN CA   1 1 
        1  2743 1 1 166 ASN CB   C -11.098  19.107  14.162 1.00 . A A . 166 ASN CB   1 1 
        1  2744 1 1 166 ASN CG   C -11.963  19.157  12.882 1.00 . A A . 166 ASN CG   1 1 
        1  2745 1 1 166 ASN H    H -10.941  16.525  13.972 1.00 . A A . 166 ASN H    1 1 
        1  2746 1 1 166 ASN HA   H  -9.214  18.736  13.189 1.00 . A A . 166 ASN HA   1 1 
        1  2747 1 1 166 ASN HB2  H -11.691  18.663  14.950 1.00 . A A . 166 ASN HB2  1 1 
        1  2748 1 1 166 ASN HB3  H -10.863  20.128  14.442 1.00 . A A . 166 ASN HB3  1 1 
        1  2749 1 1 166 ASN HD21 H -10.368  19.096  11.692 1.00 . A A . 166 ASN HD21 1 1 
        1  2750 1 1 166 ASN HD22 H -11.897  19.158  10.902 1.00 . A A . 166 ASN HD22 1 1 
        1  2751 1 1 166 ASN N    N -10.087  16.899  13.669 1.00 . A A . 166 ASN N    1 1 
        1  2752 1 1 166 ASN ND2  N -11.347  19.138  11.706 1.00 . A A . 166 ASN ND2  1 1 
        1  2753 1 1 166 ASN O    O  -8.998  19.425  16.015 1.00 . A A . 166 ASN O    1 1 
        1  2754 1 1 166 ASN OD1  O -13.184  19.244  12.958 1.00 . A A . 166 ASN OD1  1 1 
        1  2755 1 1 167 CYS C    C  -5.602  17.709  16.319 1.00 . A A . 167 CYS C    1 1 
        1  2756 1 1 167 CYS CA   C  -7.066  17.462  16.693 1.00 . A A . 167 CYS CA   1 1 
        1  2757 1 1 167 CYS CB   C  -7.176  16.101  17.394 1.00 . A A . 167 CYS CB   1 1 
        1  2758 1 1 167 CYS H    H  -7.829  16.819  14.796 1.00 . A A . 167 CYS H    1 1 
        1  2759 1 1 167 CYS HA   H  -7.379  18.242  17.383 1.00 . A A . 167 CYS HA   1 1 
        1  2760 1 1 167 CYS HB2  H  -8.209  15.914  17.640 1.00 . A A . 167 CYS HB2  1 1 
        1  2761 1 1 167 CYS HB3  H  -6.837  15.333  16.703 1.00 . A A . 167 CYS HB3  1 1 
        1  2762 1 1 167 CYS HG   H  -6.384  17.026  19.644 1.00 . A A . 167 CYS HG   1 1 
        1  2763 1 1 167 CYS N    N  -7.950  17.498  15.492 1.00 . A A . 167 CYS N    1 1 
        1  2764 1 1 167 CYS O    O  -4.745  17.861  17.191 1.00 . A A . 167 CYS O    1 1 
        1  2765 1 1 167 CYS SG   S  -6.216  15.925  18.922 1.00 . A A . 167 CYS SG   1 1 
        1  2766 1 1 168 LEU C    C  -3.512  19.393  14.736 1.00 . A A . 168 LEU C    1 1 
        1  2767 1 1 168 LEU CA   C  -3.964  17.929  14.500 1.00 . A A . 168 LEU CA   1 1 
        1  2768 1 1 168 LEU CB   C  -3.908  17.367  13.019 1.00 . A A . 168 LEU CB   1 1 
        1  2769 1 1 168 LEU CD1  C  -3.861  19.456  11.549 1.00 . A A . 168 LEU CD1  1 1 
        1  2770 1 1 168 LEU CD2  C  -1.637  18.262  12.148 1.00 . A A . 168 LEU CD2  1 1 
        1  2771 1 1 168 LEU CG   C  -3.162  18.117  11.867 1.00 . A A . 168 LEU CG   1 1 
        1  2772 1 1 168 LEU H    H  -6.066  17.680  14.377 1.00 . A A . 168 LEU H    1 1 
        1  2773 1 1 168 LEU HA   H  -3.317  17.307  15.120 1.00 . A A . 168 LEU HA   1 1 
        1  2774 1 1 168 LEU HB2  H  -3.465  16.379  13.082 1.00 . A A . 168 LEU HB2  1 1 
        1  2775 1 1 168 LEU HB3  H  -4.935  17.217  12.690 1.00 . A A . 168 LEU HB3  1 1 
        1  2776 1 1 168 LEU HD11 H  -3.701  20.147  12.368 1.00 . A A . 168 LEU HD11 1 1 
        1  2777 1 1 168 LEU HD12 H  -4.934  19.281  11.451 1.00 . A A . 168 LEU HD12 1 1 
        1  2778 1 1 168 LEU HD13 H  -3.473  19.874  10.633 1.00 . A A . 168 LEU HD13 1 1 
        1  2779 1 1 168 LEU HD21 H  -1.148  18.714  11.295 1.00 . A A . 168 LEU HD21 1 1 
        1  2780 1 1 168 LEU HD22 H  -1.207  17.280  12.328 1.00 . A A . 168 LEU HD22 1 1 
        1  2781 1 1 168 LEU HD23 H  -1.479  18.885  13.024 1.00 . A A . 168 LEU HD23 1 1 
        1  2782 1 1 168 LEU HG   H  -3.256  17.511  10.972 1.00 . A A . 168 LEU HG   1 1 
        1  2783 1 1 168 LEU N    N  -5.323  17.748  15.018 1.00 . A A . 168 LEU N    1 1 
        1  2784 1 1 168 LEU O    O  -2.329  19.650  14.938 1.00 . A A . 168 LEU O    1 1 
        1  2785 1 1 169 GLN C    C  -3.665  21.804  16.538 1.00 . A A . 169 GLN C    1 1 
        1  2786 1 1 169 GLN CA   C  -4.276  21.737  15.119 1.00 . A A . 169 GLN CA   1 1 
        1  2787 1 1 169 GLN CB   C  -5.641  22.504  15.054 1.00 . A A . 169 GLN CB   1 1 
        1  2788 1 1 169 GLN CD   C  -5.207  24.705  16.439 1.00 . A A . 169 GLN CD   1 1 
        1  2789 1 1 169 GLN CG   C  -5.570  24.060  15.085 1.00 . A A . 169 GLN CG   1 1 
        1  2790 1 1 169 GLN H    H  -5.365  20.054  14.425 1.00 . A A . 169 GLN H    1 1 
        1  2791 1 1 169 GLN HA   H  -3.582  22.173  14.413 1.00 . A A . 169 GLN HA   1 1 
        1  2792 1 1 169 GLN HB2  H  -6.138  22.219  14.137 1.00 . A A . 169 GLN HB2  1 1 
        1  2793 1 1 169 GLN HB3  H  -6.263  22.178  15.886 1.00 . A A . 169 GLN HB3  1 1 
        1  2794 1 1 169 GLN HE21 H  -6.155  23.280  17.446 1.00 . A A . 169 GLN HE21 1 1 
        1  2795 1 1 169 GLN HE22 H  -5.397  24.497  18.399 1.00 . A A . 169 GLN HE22 1 1 
        1  2796 1 1 169 GLN HG2  H  -4.841  24.379  14.353 1.00 . A A . 169 GLN HG2  1 1 
        1  2797 1 1 169 GLN HG3  H  -6.542  24.445  14.789 1.00 . A A . 169 GLN HG3  1 1 
        1  2798 1 1 169 GLN N    N  -4.481  20.325  14.729 1.00 . A A . 169 GLN N    1 1 
        1  2799 1 1 169 GLN NE2  N  -5.631  24.103  17.539 1.00 . A A . 169 GLN NE2  1 1 
        1  2800 1 1 169 GLN O    O  -2.771  22.615  16.807 1.00 . A A . 169 GLN O    1 1 
        1  2801 1 1 169 GLN OE1  O  -4.579  25.758  16.481 1.00 . A A . 169 GLN OE1  1 1 
        1  2802 1 1 170 GLU C    C  -2.277  20.289  18.974 1.00 . A A . 170 GLU C    1 1 
        1  2803 1 1 170 GLU CA   C  -3.714  20.824  18.827 1.00 . A A . 170 GLU CA   1 1 
        1  2804 1 1 170 GLU CB   C  -4.694  19.938  19.631 1.00 . A A . 170 GLU CB   1 1 
        1  2805 1 1 170 GLU CD   C  -7.061  19.607  20.550 1.00 . A A . 170 GLU CD   1 1 
        1  2806 1 1 170 GLU CG   C  -6.134  20.475  19.687 1.00 . A A . 170 GLU CG   1 1 
        1  2807 1 1 170 GLU H    H  -4.787  20.245  17.095 1.00 . A A . 170 GLU H    1 1 
        1  2808 1 1 170 GLU HA   H  -3.741  21.830  19.234 1.00 . A A . 170 GLU HA   1 1 
        1  2809 1 1 170 GLU HB2  H  -4.718  18.947  19.183 1.00 . A A . 170 GLU HB2  1 1 
        1  2810 1 1 170 GLU HB3  H  -4.326  19.844  20.648 1.00 . A A . 170 GLU HB3  1 1 
        1  2811 1 1 170 GLU HG2  H  -6.113  21.482  20.097 1.00 . A A . 170 GLU HG2  1 1 
        1  2812 1 1 170 GLU HG3  H  -6.527  20.521  18.677 1.00 . A A . 170 GLU HG3  1 1 
        1  2813 1 1 170 GLU N    N  -4.141  20.900  17.415 1.00 . A A . 170 GLU N    1 1 
        1  2814 1 1 170 GLU O    O  -1.675  20.437  20.043 1.00 . A A . 170 GLU O    1 1 
        1  2815 1 1 170 GLU OE1  O  -7.098  19.804  21.782 1.00 . A A . 170 GLU OE1  1 1 
        1  2816 1 1 170 GLU OE2  O  -7.731  18.705  20.005 1.00 . A A . 170 GLU OE2  1 1 
        1  2817 1 1 171 LEU C    C   0.585  20.448  17.772 1.00 . A A . 171 LEU C    1 1 
        1  2818 1 1 171 LEU CA   C  -0.326  19.204  17.884 1.00 . A A . 171 LEU CA   1 1 
        1  2819 1 1 171 LEU CB   C  -0.027  18.207  16.720 1.00 . A A . 171 LEU CB   1 1 
        1  2820 1 1 171 LEU CD1  C  -0.547  16.049  15.423 1.00 . A A . 171 LEU CD1  1 1 
        1  2821 1 1 171 LEU CD2  C  -1.493  16.356  17.783 1.00 . A A . 171 LEU CD2  1 1 
        1  2822 1 1 171 LEU CG   C  -1.061  17.057  16.478 1.00 . A A . 171 LEU CG   1 1 
        1  2823 1 1 171 LEU H    H  -2.318  19.438  17.148 1.00 . A A . 171 LEU H    1 1 
        1  2824 1 1 171 LEU HA   H  -0.116  18.706  18.830 1.00 . A A . 171 LEU HA   1 1 
        1  2825 1 1 171 LEU HB2  H   0.050  18.775  15.797 1.00 . A A . 171 LEU HB2  1 1 
        1  2826 1 1 171 LEU HB3  H   0.943  17.752  16.911 1.00 . A A . 171 LEU HB3  1 1 
        1  2827 1 1 171 LEU HD11 H  -0.358  16.567  14.492 1.00 . A A . 171 LEU HD11 1 1 
        1  2828 1 1 171 LEU HD12 H  -1.294  15.284  15.253 1.00 . A A . 171 LEU HD12 1 1 
        1  2829 1 1 171 LEU HD13 H   0.368  15.585  15.768 1.00 . A A . 171 LEU HD13 1 1 
        1  2830 1 1 171 LEU HD21 H  -0.637  15.912  18.270 1.00 . A A . 171 LEU HD21 1 1 
        1  2831 1 1 171 LEU HD22 H  -2.220  15.588  17.552 1.00 . A A . 171 LEU HD22 1 1 
        1  2832 1 1 171 LEU HD23 H  -1.950  17.080  18.447 1.00 . A A . 171 LEU HD23 1 1 
        1  2833 1 1 171 LEU HG   H  -1.949  17.504  16.062 1.00 . A A . 171 LEU HG   1 1 
        1  2834 1 1 171 LEU N    N  -1.743  19.636  17.915 1.00 . A A . 171 LEU N    1 1 
        1  2835 1 1 171 LEU O    O   1.688  20.468  18.323 1.00 . A A . 171 LEU O    1 1 
        1  2836 1 1 172 LEU C    C   0.423  23.608  18.239 1.00 . A A . 172 LEU C    1 1 
        1  2837 1 1 172 LEU CA   C   0.754  22.792  16.969 1.00 . A A . 172 LEU CA   1 1 
        1  2838 1 1 172 LEU CB   C   0.323  23.568  15.680 1.00 . A A . 172 LEU CB   1 1 
        1  2839 1 1 172 LEU CD1  C   2.139  22.416  14.241 1.00 . A A . 172 LEU CD1  1 1 
        1  2840 1 1 172 LEU CD2  C  -0.321  21.798  13.892 1.00 . A A . 172 LEU CD2  1 1 
        1  2841 1 1 172 LEU CG   C   0.674  22.917  14.290 1.00 . A A . 172 LEU CG   1 1 
        1  2842 1 1 172 LEU H    H  -0.771  21.356  16.603 1.00 . A A . 172 LEU H    1 1 
        1  2843 1 1 172 LEU HA   H   1.832  22.624  16.930 1.00 . A A . 172 LEU HA   1 1 
        1  2844 1 1 172 LEU HB2  H  -0.751  23.717  15.723 1.00 . A A . 172 LEU HB2  1 1 
        1  2845 1 1 172 LEU HB3  H   0.790  24.550  15.713 1.00 . A A . 172 LEU HB3  1 1 
        1  2846 1 1 172 LEU HD11 H   2.288  21.640  14.982 1.00 . A A . 172 LEU HD11 1 1 
        1  2847 1 1 172 LEU HD12 H   2.813  23.237  14.444 1.00 . A A . 172 LEU HD12 1 1 
        1  2848 1 1 172 LEU HD13 H   2.355  22.017  13.258 1.00 . A A . 172 LEU HD13 1 1 
        1  2849 1 1 172 LEU HD21 H  -1.326  22.201  13.855 1.00 . A A . 172 LEU HD21 1 1 
        1  2850 1 1 172 LEU HD22 H  -0.286  20.996  14.620 1.00 . A A . 172 LEU HD22 1 1 
        1  2851 1 1 172 LEU HD23 H  -0.064  21.408  12.917 1.00 . A A . 172 LEU HD23 1 1 
        1  2852 1 1 172 LEU HG   H   0.593  23.691  13.530 1.00 . A A . 172 LEU HG   1 1 
        1  2853 1 1 172 LEU N    N   0.089  21.480  17.060 1.00 . A A . 172 LEU N    1 1 
        1  2854 1 1 172 LEU O    O  -0.638  24.239  18.322 1.00 . A A . 172 LEU O    1 1 
        1  2855 1 1 173 HIS C    C   2.527  24.594  21.129 1.00 . A A . 173 HIS C    1 1 
        1  2856 1 1 173 HIS CA   C   1.154  24.248  20.530 1.00 . A A . 173 HIS CA   1 1 
        1  2857 1 1 173 HIS CB   C   0.328  23.383  21.529 1.00 . A A . 173 HIS CB   1 1 
        1  2858 1 1 173 HIS CD2  C   1.079  20.883  21.423 1.00 . A A . 173 HIS CD2  1 1 
        1  2859 1 1 173 HIS CE1  C   2.193  20.796  23.297 1.00 . A A . 173 HIS CE1  1 1 
        1  2860 1 1 173 HIS CG   C   1.010  22.111  21.986 1.00 . A A . 173 HIS CG   1 1 
        1  2861 1 1 173 HIS H    H   2.139  23.033  19.090 1.00 . A A . 173 HIS H    1 1 
        1  2862 1 1 173 HIS HA   H   0.623  25.180  20.346 1.00 . A A . 173 HIS HA   1 1 
        1  2863 1 1 173 HIS HB2  H   0.104  23.975  22.411 1.00 . A A . 173 HIS HB2  1 1 
        1  2864 1 1 173 HIS HB3  H  -0.608  23.106  21.060 1.00 . A A . 173 HIS HB3  1 1 
        1  2865 1 1 173 HIS HD1  H   1.867  22.749  23.804 1.00 . A A . 173 HIS HD1  1 1 
        1  2866 1 1 173 HIS HD2  H   0.628  20.583  20.486 1.00 . A A . 173 HIS HD2  1 1 
        1  2867 1 1 173 HIS HE1  H   2.779  20.434  24.128 1.00 . A A . 173 HIS HE1  1 1 
        1  2868 1 1 173 HIS HE2  H   1.855  19.103  22.206 1.00 . A A . 173 HIS HE2  1 1 
        1  2869 1 1 173 HIS N    N   1.322  23.553  19.235 1.00 . A A . 173 HIS N    1 1 
        1  2870 1 1 173 HIS ND1  N   1.722  22.020  23.163 1.00 . A A . 173 HIS ND1  1 1 
        1  2871 1 1 173 HIS NE2  N   1.817  20.085  22.255 1.00 . A A . 173 HIS NE2  1 1 
        1  2872 1 1 173 HIS O    O   3.540  23.998  20.752 1.00 . A A . 173 HIS O    1 1 
        1  2873 1 1 174 GLU C    C   3.606  25.955  24.271 1.00 . A A . 174 GLU C    1 1 
        1  2874 1 1 174 GLU CA   C   3.790  25.996  22.733 1.00 . A A . 174 GLU CA   1 1 
        1  2875 1 1 174 GLU CB   C   4.157  27.422  22.223 1.00 . A A . 174 GLU CB   1 1 
        1  2876 1 1 174 GLU CD   C   5.851  29.347  22.205 1.00 . A A . 174 GLU CD   1 1 
        1  2877 1 1 174 GLU CG   C   5.449  28.004  22.825 1.00 . A A . 174 GLU CG   1 1 
        1  2878 1 1 174 GLU H    H   1.711  25.947  22.356 1.00 . A A . 174 GLU H    1 1 
        1  2879 1 1 174 GLU HA   H   4.601  25.313  22.454 1.00 . A A . 174 GLU HA   1 1 
        1  2880 1 1 174 GLU HB2  H   4.274  27.382  21.143 1.00 . A A . 174 GLU HB2  1 1 
        1  2881 1 1 174 GLU HB3  H   3.337  28.096  22.453 1.00 . A A . 174 GLU HB3  1 1 
        1  2882 1 1 174 GLU HG2  H   5.303  28.138  23.893 1.00 . A A . 174 GLU HG2  1 1 
        1  2883 1 1 174 GLU HG3  H   6.252  27.288  22.673 1.00 . A A . 174 GLU HG3  1 1 
        1  2884 1 1 174 GLU N    N   2.553  25.537  22.080 1.00 . A A . 174 GLU N    1 1 
        1  2885 1 1 174 GLU O    O   2.944  26.854  24.835 1.00 . A A . 174 GLU O    1 1 
        1  2886 1 1 174 GLU OXT  O   4.093  25.001  24.907 1.00 . A A . 174 GLU OXT  1 1 
        1  2887 1 1 174 GLU OE1  O   5.293  30.389  22.603 1.00 . A A . 174 GLU OE1  1 1 
        1  2888 1 1 174 GLU OE2  O   6.708  29.359  21.295 1.00 . A A . 174 GLU OE2  1 1 
        2  2889 1 1   1 MET C    C  15.423   9.373   3.796 1.00 . A A .   1 MET C    1 1 
        2  2890 1 1   1 MET CA   C  14.237  10.324   3.583 1.00 . A A .   1 MET CA   1 1 
        2  2891 1 1   1 MET CB   C  14.356  11.566   4.515 1.00 . A A .   1 MET CB   1 1 
        2  2892 1 1   1 MET CE   C  10.614  13.487   4.280 1.00 . A A .   1 MET CE   1 1 
        2  2893 1 1   1 MET CG   C  13.270  12.634   4.300 1.00 . A A .   1 MET CG   1 1 
        2  2894 1 1   1 MET H1   H  12.946   9.258   4.820 1.00 . A A .   1 MET H1   1 1 
        2  2895 1 1   1 MET H2   H  12.907   8.764   3.208 1.00 . A A .   1 MET H2   1 1 
        2  2896 1 1   1 MET H3   H  12.153  10.204   3.665 1.00 . A A .   1 MET H3   1 1 
        2  2897 1 1   1 MET HA   H  14.222  10.655   2.550 1.00 . A A .   1 MET HA   1 1 
        2  2898 1 1   1 MET HB2  H  14.306  11.239   5.548 1.00 . A A .   1 MET HB2  1 1 
        2  2899 1 1   1 MET HB3  H  15.325  12.034   4.351 1.00 . A A .   1 MET HB3  1 1 
        2  2900 1 1   1 MET HE1  H   9.571  13.261   4.448 1.00 . A A .   1 MET HE1  1 1 
        2  2901 1 1   1 MET HE2  H  10.752  13.813   3.259 1.00 . A A .   1 MET HE2  1 1 
        2  2902 1 1   1 MET HE3  H  10.925  14.272   4.953 1.00 . A A .   1 MET HE3  1 1 
        2  2903 1 1   1 MET HG2  H  13.449  13.463   4.974 1.00 . A A .   1 MET HG2  1 1 
        2  2904 1 1   1 MET HG3  H  13.336  12.989   3.278 1.00 . A A .   1 MET HG3  1 1 
        2  2905 1 1   1 MET N    N  12.972   9.589   3.837 1.00 . A A .   1 MET N    1 1 
        2  2906 1 1   1 MET O    O  15.659   8.920   4.921 1.00 . A A .   1 MET O    1 1 
        2  2907 1 1   1 MET SD   S  11.596  12.019   4.584 1.00 . A A .   1 MET SD   1 1 
        2  2908 1 1   2 GLY C    C  16.813   6.694   2.365 1.00 . A A .   2 GLY C    1 1 
        2  2909 1 1   2 GLY CA   C  17.258   8.097   2.759 1.00 . A A .   2 GLY CA   1 1 
        2  2910 1 1   2 GLY H    H  15.935   9.486   1.851 1.00 . A A .   2 GLY H    1 1 
        2  2911 1 1   2 GLY HA2  H  18.032   8.428   2.075 1.00 . A A .   2 GLY HA2  1 1 
        2  2912 1 1   2 GLY HA3  H  17.676   8.060   3.759 1.00 . A A .   2 GLY HA3  1 1 
        2  2913 1 1   2 GLY N    N  16.154   9.059   2.709 1.00 . A A .   2 GLY N    1 1 
        2  2914 1 1   2 GLY O    O  15.632   6.340   2.510 1.00 . A A .   2 GLY O    1 1 
        2  2915 1 1   3 HIS C    C  18.448   3.536   2.117 1.00 . A A .   3 HIS C    1 1 
        2  2916 1 1   3 HIS CA   C  17.505   4.521   1.397 1.00 . A A .   3 HIS CA   1 1 
        2  2917 1 1   3 HIS CB   C  17.650   4.451  -0.152 1.00 . A A .   3 HIS CB   1 1 
        2  2918 1 1   3 HIS CD2  C  19.696   5.927  -0.801 1.00 . A A .   3 HIS CD2  1 1 
        2  2919 1 1   3 HIS CE1  C  20.981   4.351  -1.593 1.00 . A A .   3 HIS CE1  1 1 
        2  2920 1 1   3 HIS CG   C  19.027   4.756  -0.680 1.00 . A A .   3 HIS CG   1 1 
        2  2921 1 1   3 HIS H    H  18.686   6.221   1.854 1.00 . A A .   3 HIS H    1 1 
        2  2922 1 1   3 HIS HA   H  16.474   4.256   1.651 1.00 . A A .   3 HIS HA   1 1 
        2  2923 1 1   3 HIS HB2  H  17.386   3.456  -0.491 1.00 . A A .   3 HIS HB2  1 1 
        2  2924 1 1   3 HIS HB3  H  16.962   5.159  -0.593 1.00 . A A .   3 HIS HB3  1 1 
        2  2925 1 1   3 HIS HD1  H  19.657   2.834  -1.274 1.00 . A A .   3 HIS HD1  1 1 
        2  2926 1 1   3 HIS HD2  H  19.345   6.902  -0.496 1.00 . A A .   3 HIS HD2  1 1 
        2  2927 1 1   3 HIS HE1  H  21.815   3.839  -2.045 1.00 . A A .   3 HIS HE1  1 1 
        2  2928 1 1   3 HIS HE2  H  21.536   6.306  -1.724 1.00 . A A .   3 HIS HE2  1 1 
        2  2929 1 1   3 HIS N    N  17.763   5.888   1.878 1.00 . A A .   3 HIS N    1 1 
        2  2930 1 1   3 HIS ND1  N  19.862   3.793  -1.196 1.00 . A A .   3 HIS ND1  1 1 
        2  2931 1 1   3 HIS NE2  N  20.909   5.642  -1.362 1.00 . A A .   3 HIS NE2  1 1 
        2  2932 1 1   3 HIS O    O  19.671   3.562   1.922 1.00 . A A .   3 HIS O    1 1 
        2  2933 1 1   4 HIS C    C  17.748   0.437   3.915 1.00 . A A .   4 HIS C    1 1 
        2  2934 1 1   4 HIS CA   C  18.614   1.691   3.769 1.00 . A A .   4 HIS CA   1 1 
        2  2935 1 1   4 HIS CB   C  19.040   2.224   5.175 1.00 . A A .   4 HIS CB   1 1 
        2  2936 1 1   4 HIS CD2  C  20.422   4.437   4.948 1.00 . A A .   4 HIS CD2  1 1 
        2  2937 1 1   4 HIS CE1  C  22.411   3.594   5.297 1.00 . A A .   4 HIS CE1  1 1 
        2  2938 1 1   4 HIS CG   C  20.267   3.104   5.170 1.00 . A A .   4 HIS CG   1 1 
        2  2939 1 1   4 HIS H    H  16.902   2.792   3.156 1.00 . A A .   4 HIS H    1 1 
        2  2940 1 1   4 HIS HA   H  19.506   1.429   3.201 1.00 . A A .   4 HIS HA   1 1 
        2  2941 1 1   4 HIS HB2  H  18.226   2.798   5.596 1.00 . A A .   4 HIS HB2  1 1 
        2  2942 1 1   4 HIS HB3  H  19.248   1.388   5.836 1.00 . A A .   4 HIS HB3  1 1 
        2  2943 1 1   4 HIS HD1  H  21.766   1.676   5.586 1.00 . A A .   4 HIS HD1  1 1 
        2  2944 1 1   4 HIS HD2  H  19.639   5.149   4.737 1.00 . A A .   4 HIS HD2  1 1 
        2  2945 1 1   4 HIS HE1  H  23.480   3.499   5.409 1.00 . A A .   4 HIS HE1  1 1 
        2  2946 1 1   4 HIS HE2  H  22.185   5.581   4.877 1.00 . A A .   4 HIS HE2  1 1 
        2  2947 1 1   4 HIS N    N  17.874   2.714   3.005 1.00 . A A .   4 HIS N    1 1 
        2  2948 1 1   4 HIS ND1  N  21.538   2.611   5.380 1.00 . A A .   4 HIS ND1  1 1 
        2  2949 1 1   4 HIS NE2  N  21.763   4.707   5.039 1.00 . A A .   4 HIS NE2  1 1 
        2  2950 1 1   4 HIS O    O  16.528   0.541   4.109 1.00 . A A .   4 HIS O    1 1 
        2  2951 1 1   5 HIS C    C  17.388  -2.169   5.525 1.00 . A A .   5 HIS C    1 1 
        2  2952 1 1   5 HIS CA   C  17.728  -2.036   4.038 1.00 . A A .   5 HIS CA   1 1 
        2  2953 1 1   5 HIS CB   C  18.618  -3.214   3.570 1.00 . A A .   5 HIS CB   1 1 
        2  2954 1 1   5 HIS CD2  C  18.081  -2.973   1.030 1.00 . A A .   5 HIS CD2  1 1 
        2  2955 1 1   5 HIS CE1  C  20.085  -3.338   0.243 1.00 . A A .   5 HIS CE1  1 1 
        2  2956 1 1   5 HIS CG   C  18.902  -3.194   2.090 1.00 . A A .   5 HIS CG   1 1 
        2  2957 1 1   5 HIS H    H  19.345  -0.738   3.578 1.00 . A A .   5 HIS H    1 1 
        2  2958 1 1   5 HIS HA   H  16.808  -2.038   3.458 1.00 . A A .   5 HIS HA   1 1 
        2  2959 1 1   5 HIS HB2  H  19.566  -3.177   4.092 1.00 . A A .   5 HIS HB2  1 1 
        2  2960 1 1   5 HIS HB3  H  18.125  -4.152   3.801 1.00 . A A .   5 HIS HB3  1 1 
        2  2961 1 1   5 HIS HD1  H  20.966  -3.612   2.065 1.00 . A A .   5 HIS HD1  1 1 
        2  2962 1 1   5 HIS HD2  H  17.019  -2.769   1.069 1.00 . A A .   5 HIS HD2  1 1 
        2  2963 1 1   5 HIS HE1  H  20.911  -3.468  -0.439 1.00 . A A .   5 HIS HE1  1 1 
        2  2964 1 1   5 HIS HE2  H  18.555  -2.825  -1.004 1.00 . A A .   5 HIS HE2  1 1 
        2  2965 1 1   5 HIS N    N  18.391  -0.743   3.809 1.00 . A A .   5 HIS N    1 1 
        2  2966 1 1   5 HIS ND1  N  20.150  -3.421   1.554 1.00 . A A .   5 HIS ND1  1 1 
        2  2967 1 1   5 HIS NE2  N  18.847  -3.064  -0.099 1.00 . A A .   5 HIS NE2  1 1 
        2  2968 1 1   5 HIS O    O  18.276  -2.068   6.383 1.00 . A A .   5 HIS O    1 1 
        2  2969 1 1   6 HIS C    C  15.915  -3.753   7.835 1.00 . A A .   6 HIS C    1 1 
        2  2970 1 1   6 HIS CA   C  15.580  -2.396   7.186 1.00 . A A .   6 HIS CA   1 1 
        2  2971 1 1   6 HIS CB   C  14.055  -2.097   7.192 1.00 . A A .   6 HIS CB   1 1 
        2  2972 1 1   6 HIS CD2  C  13.971   0.461   6.653 1.00 . A A .   6 HIS CD2  1 1 
        2  2973 1 1   6 HIS CE1  C  12.871   0.345   4.765 1.00 . A A .   6 HIS CE1  1 1 
        2  2974 1 1   6 HIS CG   C  13.697  -0.848   6.422 1.00 . A A .   6 HIS CG   1 1 
        2  2975 1 1   6 HIS H    H  15.466  -2.507   5.073 1.00 . A A .   6 HIS H    1 1 
        2  2976 1 1   6 HIS HA   H  16.083  -1.609   7.749 1.00 . A A .   6 HIS HA   1 1 
        2  2977 1 1   6 HIS HB2  H  13.520  -2.930   6.749 1.00 . A A .   6 HIS HB2  1 1 
        2  2978 1 1   6 HIS HB3  H  13.716  -1.968   8.214 1.00 . A A .   6 HIS HB3  1 1 
        2  2979 1 1   6 HIS HD1  H  12.663  -1.684   4.789 1.00 . A A .   6 HIS HD1  1 1 
        2  2980 1 1   6 HIS HD2  H  14.502   0.869   7.505 1.00 . A A .   6 HIS HD2  1 1 
        2  2981 1 1   6 HIS HE1  H  12.370   0.619   3.850 1.00 . A A .   6 HIS HE1  1 1 
        2  2982 1 1   6 HIS HE2  H  13.685   2.113   5.381 1.00 . A A .   6 HIS HE2  1 1 
        2  2983 1 1   6 HIS N    N  16.095  -2.366   5.813 1.00 . A A .   6 HIS N    1 1 
        2  2984 1 1   6 HIS ND1  N  13.002  -0.877   5.233 1.00 . A A .   6 HIS ND1  1 1 
        2  2985 1 1   6 HIS NE2  N  13.452   1.181   5.599 1.00 . A A .   6 HIS NE2  1 1 
        2  2986 1 1   6 HIS O    O  15.150  -4.719   7.735 1.00 . A A .   6 HIS O    1 1 
        2  2987 1 1   7 HIS C    C  18.204  -4.497  10.469 1.00 . A A .   7 HIS C    1 1 
        2  2988 1 1   7 HIS CA   C  17.620  -4.990   9.145 1.00 . A A .   7 HIS CA   1 1 
        2  2989 1 1   7 HIS CB   C  18.695  -5.734   8.303 1.00 . A A .   7 HIS CB   1 1 
        2  2990 1 1   7 HIS CD2  C  20.284  -7.184   9.802 1.00 . A A .   7 HIS CD2  1 1 
        2  2991 1 1   7 HIS CE1  C  19.417  -9.147   9.391 1.00 . A A .   7 HIS CE1  1 1 
        2  2992 1 1   7 HIS CG   C  19.248  -6.995   8.945 1.00 . A A .   7 HIS CG   1 1 
        2  2993 1 1   7 HIS H    H  17.703  -3.032   8.362 1.00 . A A .   7 HIS H    1 1 
        2  2994 1 1   7 HIS HA   H  16.785  -5.666   9.348 1.00 . A A .   7 HIS HA   1 1 
        2  2995 1 1   7 HIS HB2  H  18.262  -6.017   7.354 1.00 . A A .   7 HIS HB2  1 1 
        2  2996 1 1   7 HIS HB3  H  19.525  -5.061   8.120 1.00 . A A .   7 HIS HB3  1 1 
        2  2997 1 1   7 HIS HD1  H  17.974  -8.464   8.118 1.00 . A A .   7 HIS HD1  1 1 
        2  2998 1 1   7 HIS HD2  H  20.921  -6.418  10.216 1.00 . A A .   7 HIS HD2  1 1 
        2  2999 1 1   7 HIS HE1  H  19.235 -10.210   9.400 1.00 . A A .   7 HIS HE1  1 1 
        2  3000 1 1   7 HIS HE2  H  21.144  -8.976  10.460 1.00 . A A .   7 HIS HE2  1 1 
        2  3001 1 1   7 HIS N    N  17.116  -3.819   8.422 1.00 . A A .   7 HIS N    1 1 
        2  3002 1 1   7 HIS ND1  N  18.729  -8.253   8.712 1.00 . A A .   7 HIS ND1  1 1 
        2  3003 1 1   7 HIS NE2  N  20.366  -8.530  10.058 1.00 . A A .   7 HIS NE2  1 1 
        2  3004 1 1   7 HIS O    O  19.064  -3.605  10.485 1.00 . A A .   7 HIS O    1 1 
        2  3005 1 1   8 HIS C    C  19.161  -5.844  13.341 1.00 . A A .   8 HIS C    1 1 
        2  3006 1 1   8 HIS CA   C  18.189  -4.739  12.924 1.00 . A A .   8 HIS CA   1 1 
        2  3007 1 1   8 HIS CB   C  17.004  -4.640  13.928 1.00 . A A .   8 HIS CB   1 1 
        2  3008 1 1   8 HIS CD2  C  14.951  -3.616  12.697 1.00 . A A .   8 HIS CD2  1 1 
        2  3009 1 1   8 HIS CE1  C  15.020  -1.616  13.569 1.00 . A A .   8 HIS CE1  1 1 
        2  3010 1 1   8 HIS CG   C  15.991  -3.587  13.563 1.00 . A A .   8 HIS CG   1 1 
        2  3011 1 1   8 HIS H    H  16.950  -5.671  11.471 1.00 . A A .   8 HIS H    1 1 
        2  3012 1 1   8 HIS HA   H  18.723  -3.786  12.904 1.00 . A A .   8 HIS HA   1 1 
        2  3013 1 1   8 HIS HB2  H  16.489  -5.593  13.973 1.00 . A A .   8 HIS HB2  1 1 
        2  3014 1 1   8 HIS HB3  H  17.388  -4.404  14.914 1.00 . A A .   8 HIS HB3  1 1 
        2  3015 1 1   8 HIS HD1  H  16.640  -1.973  14.760 1.00 . A A .   8 HIS HD1  1 1 
        2  3016 1 1   8 HIS HD2  H  14.641  -4.461  12.099 1.00 . A A .   8 HIS HD2  1 1 
        2  3017 1 1   8 HIS HE1  H  14.786  -0.588  13.800 1.00 . A A .   8 HIS HE1  1 1 
        2  3018 1 1   8 HIS HE2  H  13.722  -2.051  12.058 1.00 . A A .   8 HIS HE2  1 1 
        2  3019 1 1   8 HIS N    N  17.691  -5.038  11.570 1.00 . A A .   8 HIS N    1 1 
        2  3020 1 1   8 HIS ND1  N  16.003  -2.315  14.092 1.00 . A A .   8 HIS ND1  1 1 
        2  3021 1 1   8 HIS NE2  N  14.367  -2.378  12.717 1.00 . A A .   8 HIS NE2  1 1 
        2  3022 1 1   8 HIS O    O  20.308  -5.581  13.721 1.00 . A A .   8 HIS O    1 1 
        2  3023 1 1   9 SER C    C  18.548  -9.543  13.168 1.00 . A A .   9 SER C    1 1 
        2  3024 1 1   9 SER CA   C  19.371  -8.313  13.618 1.00 . A A .   9 SER CA   1 1 
        2  3025 1 1   9 SER CB   C  19.613  -8.289  15.153 1.00 . A A .   9 SER CB   1 1 
        2  3026 1 1   9 SER H    H  17.773  -7.189  12.829 1.00 . A A .   9 SER H    1 1 
        2  3027 1 1   9 SER HA   H  20.329  -8.342  13.103 1.00 . A A .   9 SER HA   1 1 
        2  3028 1 1   9 SER HB2  H  19.904  -9.272  15.497 1.00 . A A .   9 SER HB2  1 1 
        2  3029 1 1   9 SER HB3  H  20.403  -7.585  15.383 1.00 . A A .   9 SER HB3  1 1 
        2  3030 1 1   9 SER HG   H  18.690  -7.472  16.674 1.00 . A A .   9 SER HG   1 1 
        2  3031 1 1   9 SER N    N  18.670  -7.088  13.212 1.00 . A A .   9 SER N    1 1 
        2  3032 1 1   9 SER O    O  17.683  -9.425  12.289 1.00 . A A .   9 SER O    1 1 
        2  3033 1 1   9 SER OG   O  18.444  -7.894  15.843 1.00 . A A .   9 SER OG   1 1 
        2  3034 1 1  10 HIS C    C  17.129 -12.315  14.617 1.00 . A A .  10 HIS C    1 1 
        2  3035 1 1  10 HIS CA   C  18.093 -11.975  13.466 1.00 . A A .  10 HIS CA   1 1 
        2  3036 1 1  10 HIS CB   C  19.065 -13.162  13.187 1.00 . A A .  10 HIS CB   1 1 
        2  3037 1 1  10 HIS CD2  C  20.700 -12.398  11.297 1.00 . A A .  10 HIS CD2  1 1 
        2  3038 1 1  10 HIS CE1  C  20.011 -13.745   9.724 1.00 . A A .  10 HIS CE1  1 1 
        2  3039 1 1  10 HIS CG   C  19.691 -13.142  11.814 1.00 . A A .  10 HIS CG   1 1 
        2  3040 1 1  10 HIS H    H  19.610 -10.768  14.355 1.00 . A A .  10 HIS H    1 1 
        2  3041 1 1  10 HIS HA   H  17.483 -11.815  12.579 1.00 . A A .  10 HIS HA   1 1 
        2  3042 1 1  10 HIS HB2  H  19.865 -13.150  13.918 1.00 . A A .  10 HIS HB2  1 1 
        2  3043 1 1  10 HIS HB3  H  18.525 -14.099  13.284 1.00 . A A .  10 HIS HB3  1 1 
        2  3044 1 1  10 HIS HD1  H  18.569 -14.646  10.847 1.00 . A A .  10 HIS HD1  1 1 
        2  3045 1 1  10 HIS HD2  H  21.266 -11.634  11.812 1.00 . A A .  10 HIS HD2  1 1 
        2  3046 1 1  10 HIS HE1  H  19.913 -14.249   8.773 1.00 . A A .  10 HIS HE1  1 1 
        2  3047 1 1  10 HIS HE2  H  21.406 -12.314   9.323 1.00 . A A .  10 HIS HE2  1 1 
        2  3048 1 1  10 HIS N    N  18.849 -10.726  13.734 1.00 . A A .  10 HIS N    1 1 
        2  3049 1 1  10 HIS ND1  N  19.287 -13.976  10.794 1.00 . A A .  10 HIS ND1  1 1 
        2  3050 1 1  10 HIS NE2  N  20.871 -12.790   9.995 1.00 . A A .  10 HIS NE2  1 1 
        2  3051 1 1  10 HIS O    O  16.559 -13.415  14.644 1.00 . A A .  10 HIS O    1 1 
        2  3052 1 1  11 MET C    C  14.520 -11.071  16.132 1.00 . A A .  11 MET C    1 1 
        2  3053 1 1  11 MET CA   C  15.919 -11.519  16.633 1.00 . A A .  11 MET CA   1 1 
        2  3054 1 1  11 MET CB   C  16.382 -10.761  17.923 1.00 . A A .  11 MET CB   1 1 
        2  3055 1 1  11 MET CE   C  18.881  -9.047  19.285 1.00 . A A .  11 MET CE   1 1 
        2  3056 1 1  11 MET CG   C  16.487  -9.234  17.819 1.00 . A A .  11 MET CG   1 1 
        2  3057 1 1  11 MET H    H  17.447 -10.538  15.519 1.00 . A A .  11 MET H    1 1 
        2  3058 1 1  11 MET HA   H  15.856 -12.585  16.871 1.00 . A A .  11 MET HA   1 1 
        2  3059 1 1  11 MET HB2  H  15.694 -10.987  18.725 1.00 . A A .  11 MET HB2  1 1 
        2  3060 1 1  11 MET HB3  H  17.358 -11.139  18.200 1.00 . A A .  11 MET HB3  1 1 
        2  3061 1 1  11 MET HE1  H  19.407  -8.638  20.135 1.00 . A A .  11 MET HE1  1 1 
        2  3062 1 1  11 MET HE2  H  19.362  -8.719  18.375 1.00 . A A .  11 MET HE2  1 1 
        2  3063 1 1  11 MET HE3  H  18.905 -10.128  19.335 1.00 . A A .  11 MET HE3  1 1 
        2  3064 1 1  11 MET HG2  H  17.118  -8.984  16.981 1.00 . A A .  11 MET HG2  1 1 
        2  3065 1 1  11 MET HG3  H  15.499  -8.820  17.651 1.00 . A A .  11 MET HG3  1 1 
        2  3066 1 1  11 MET N    N  16.914 -11.363  15.552 1.00 . A A .  11 MET N    1 1 
        2  3067 1 1  11 MET O    O  13.850 -10.211  16.728 1.00 . A A .  11 MET O    1 1 
        2  3068 1 1  11 MET SD   S  17.178  -8.472  19.310 1.00 . A A .  11 MET SD   1 1 
        2  3069 1 1  12 ALA C    C  11.702 -12.161  15.307 1.00 . A A .  12 ALA C    1 1 
        2  3070 1 1  12 ALA CA   C  12.755 -11.437  14.438 1.00 . A A .  12 ALA CA   1 1 
        2  3071 1 1  12 ALA CB   C  12.702 -11.900  12.971 1.00 . A A .  12 ALA CB   1 1 
        2  3072 1 1  12 ALA H    H  14.684 -12.297  14.540 1.00 . A A .  12 ALA H    1 1 
        2  3073 1 1  12 ALA HA   H  12.560 -10.364  14.461 1.00 . A A .  12 ALA HA   1 1 
        2  3074 1 1  12 ALA HB1  H  13.439 -11.363  12.393 1.00 . A A .  12 ALA HB1  1 1 
        2  3075 1 1  12 ALA HB2  H  11.719 -11.709  12.564 1.00 . A A .  12 ALA HB2  1 1 
        2  3076 1 1  12 ALA HB3  H  12.910 -12.964  12.917 1.00 . A A .  12 ALA HB3  1 1 
        2  3077 1 1  12 ALA N    N  14.087 -11.671  15.003 1.00 . A A .  12 ALA N    1 1 
        2  3078 1 1  12 ALA O    O  11.279 -13.282  15.005 1.00 . A A .  12 ALA O    1 1 
        2  3079 1 1  13 MET C    C   9.069 -11.430  17.289 1.00 . A A .  13 MET C    1 1 
        2  3080 1 1  13 MET CA   C  10.448 -12.068  17.450 1.00 . A A .  13 MET CA   1 1 
        2  3081 1 1  13 MET CB   C  11.024 -11.796  18.871 1.00 . A A .  13 MET CB   1 1 
        2  3082 1 1  13 MET CE   C  11.687 -15.204  18.371 1.00 . A A .  13 MET CE   1 1 
        2  3083 1 1  13 MET CG   C  12.329 -12.553  19.227 1.00 . A A .  13 MET CG   1 1 
        2  3084 1 1  13 MET H    H  11.716 -10.620  16.572 1.00 . A A .  13 MET H    1 1 
        2  3085 1 1  13 MET HA   H  10.364 -13.146  17.301 1.00 . A A .  13 MET HA   1 1 
        2  3086 1 1  13 MET HB2  H  11.220 -10.734  18.961 1.00 . A A .  13 MET HB2  1 1 
        2  3087 1 1  13 MET HB3  H  10.275 -12.067  19.609 1.00 . A A .  13 MET HB3  1 1 
        2  3088 1 1  13 MET HE1  H  11.510 -16.233  18.650 1.00 . A A .  13 MET HE1  1 1 
        2  3089 1 1  13 MET HE2  H  12.515 -15.158  17.680 1.00 . A A .  13 MET HE2  1 1 
        2  3090 1 1  13 MET HE3  H  10.801 -14.805  17.898 1.00 . A A .  13 MET HE3  1 1 
        2  3091 1 1  13 MET HG2  H  12.957 -12.603  18.349 1.00 . A A .  13 MET HG2  1 1 
        2  3092 1 1  13 MET HG3  H  12.854 -11.995  19.996 1.00 . A A .  13 MET HG3  1 1 
        2  3093 1 1  13 MET N    N  11.356 -11.518  16.429 1.00 . A A .  13 MET N    1 1 
        2  3094 1 1  13 MET O    O   8.950 -10.192  17.249 1.00 . A A .  13 MET O    1 1 
        2  3095 1 1  13 MET SD   S  12.073 -14.249  19.844 1.00 . A A .  13 MET SD   1 1 
        2  3096 1 1  14 GLN C    C   5.993 -11.441  18.332 1.00 . A A .  14 GLN C    1 1 
        2  3097 1 1  14 GLN CA   C   6.640 -11.852  16.990 1.00 . A A .  14 GLN CA   1 1 
        2  3098 1 1  14 GLN CB   C   5.832 -12.942  16.225 1.00 . A A .  14 GLN CB   1 1 
        2  3099 1 1  14 GLN CD   C   5.204 -15.401  15.962 1.00 . A A .  14 GLN CD   1 1 
        2  3100 1 1  14 GLN CG   C   5.908 -14.359  16.822 1.00 . A A .  14 GLN CG   1 1 
        2  3101 1 1  14 GLN H    H   8.222 -13.248  17.221 1.00 . A A .  14 GLN H    1 1 
        2  3102 1 1  14 GLN HA   H   6.671 -10.961  16.363 1.00 . A A .  14 GLN HA   1 1 
        2  3103 1 1  14 GLN HB2  H   4.789 -12.645  16.189 1.00 . A A .  14 GLN HB2  1 1 
        2  3104 1 1  14 GLN HB3  H   6.207 -12.985  15.208 1.00 . A A .  14 GLN HB3  1 1 
        2  3105 1 1  14 GLN HE21 H   6.852 -15.677  14.876 1.00 . A A .  14 GLN HE21 1 1 
        2  3106 1 1  14 GLN HE22 H   5.481 -16.633  14.432 1.00 . A A .  14 GLN HE22 1 1 
        2  3107 1 1  14 GLN HG2  H   6.949 -14.641  16.926 1.00 . A A .  14 GLN HG2  1 1 
        2  3108 1 1  14 GLN HG3  H   5.448 -14.356  17.805 1.00 . A A .  14 GLN HG3  1 1 
        2  3109 1 1  14 GLN N    N   8.035 -12.286  17.180 1.00 . A A .  14 GLN N    1 1 
        2  3110 1 1  14 GLN NE2  N   5.915 -15.960  14.993 1.00 . A A .  14 GLN NE2  1 1 
        2  3111 1 1  14 GLN O    O   5.101 -12.116  18.878 1.00 . A A .  14 GLN O    1 1 
        2  3112 1 1  14 GLN OE1  O   4.020 -15.681  16.146 1.00 . A A .  14 GLN OE1  1 1 
        2  3113 1 1  15 GLU C    C   4.761  -8.974  19.927 1.00 . A A .  15 GLU C    1 1 
        2  3114 1 1  15 GLU CA   C   6.056  -9.751  20.141 1.00 . A A .  15 GLU CA   1 1 
        2  3115 1 1  15 GLU CB   C   7.150  -8.812  20.731 1.00 . A A .  15 GLU CB   1 1 
        2  3116 1 1  15 GLU CD   C   8.600 -10.711  21.704 1.00 . A A .  15 GLU CD   1 1 
        2  3117 1 1  15 GLU CG   C   8.556  -9.434  20.843 1.00 . A A .  15 GLU CG   1 1 
        2  3118 1 1  15 GLU H    H   7.219  -9.867  18.378 1.00 . A A .  15 GLU H    1 1 
        2  3119 1 1  15 GLU HA   H   5.876 -10.565  20.843 1.00 . A A .  15 GLU HA   1 1 
        2  3120 1 1  15 GLU HB2  H   7.230  -7.927  20.102 1.00 . A A .  15 GLU HB2  1 1 
        2  3121 1 1  15 GLU HB3  H   6.844  -8.495  21.721 1.00 . A A .  15 GLU HB3  1 1 
        2  3122 1 1  15 GLU HG2  H   8.905  -9.671  19.843 1.00 . A A .  15 GLU HG2  1 1 
        2  3123 1 1  15 GLU HG3  H   9.229  -8.698  21.272 1.00 . A A .  15 GLU HG3  1 1 
        2  3124 1 1  15 GLU N    N   6.503 -10.323  18.866 1.00 . A A .  15 GLU N    1 1 
        2  3125 1 1  15 GLU O    O   3.731  -9.265  20.555 1.00 . A A .  15 GLU O    1 1 
        2  3126 1 1  15 GLU OE1  O   8.789 -10.606  22.935 1.00 . A A .  15 GLU OE1  1 1 
        2  3127 1 1  15 GLU OE2  O   8.432 -11.824  21.155 1.00 . A A .  15 GLU OE2  1 1 
        2  3128 1 1  16 GLY C    C   3.728  -5.939  19.778 1.00 . A A .  16 GLY C    1 1 
        2  3129 1 1  16 GLY CA   C   3.729  -7.082  18.785 1.00 . A A .  16 GLY CA   1 1 
        2  3130 1 1  16 GLY H    H   5.665  -7.841  18.537 1.00 . A A .  16 GLY H    1 1 
        2  3131 1 1  16 GLY HA2  H   3.824  -6.690  17.777 1.00 . A A .  16 GLY HA2  1 1 
        2  3132 1 1  16 GLY HA3  H   2.790  -7.612  18.870 1.00 . A A .  16 GLY HA3  1 1 
        2  3133 1 1  16 GLY N    N   4.832  -7.979  19.028 1.00 . A A .  16 GLY N    1 1 
        2  3134 1 1  16 GLY O    O   3.958  -6.142  20.984 1.00 . A A .  16 GLY O    1 1 
        2  3135 1 1  17 LEU C    C   2.040  -3.529  20.797 1.00 . A A .  17 LEU C    1 1 
        2  3136 1 1  17 LEU CA   C   3.393  -3.523  20.078 1.00 . A A .  17 LEU CA   1 1 
        2  3137 1 1  17 LEU CB   C   3.568  -2.248  19.208 1.00 . A A .  17 LEU CB   1 1 
        2  3138 1 1  17 LEU CD1  C   5.309  -3.048  17.463 1.00 . A A .  17 LEU CD1  1 1 
        2  3139 1 1  17 LEU CD2  C   5.099  -0.590  18.044 1.00 . A A .  17 LEU CD2  1 1 
        2  3140 1 1  17 LEU CG   C   4.984  -2.024  18.573 1.00 . A A .  17 LEU CG   1 1 
        2  3141 1 1  17 LEU H    H   3.312  -4.684  18.299 1.00 . A A .  17 LEU H    1 1 
        2  3142 1 1  17 LEU HA   H   4.188  -3.553  20.824 1.00 . A A .  17 LEU HA   1 1 
        2  3143 1 1  17 LEU HB2  H   2.835  -2.280  18.404 1.00 . A A .  17 LEU HB2  1 1 
        2  3144 1 1  17 LEU HB3  H   3.339  -1.388  19.830 1.00 . A A .  17 LEU HB3  1 1 
        2  3145 1 1  17 LEU HD11 H   5.252  -4.050  17.866 1.00 . A A .  17 LEU HD11 1 1 
        2  3146 1 1  17 LEU HD12 H   6.308  -2.877  17.082 1.00 . A A .  17 LEU HD12 1 1 
        2  3147 1 1  17 LEU HD13 H   4.597  -2.952  16.652 1.00 . A A .  17 LEU HD13 1 1 
        2  3148 1 1  17 LEU HD21 H   6.089  -0.428  17.635 1.00 . A A .  17 LEU HD21 1 1 
        2  3149 1 1  17 LEU HD22 H   4.929   0.106  18.853 1.00 . A A .  17 LEU HD22 1 1 
        2  3150 1 1  17 LEU HD23 H   4.362  -0.427  17.270 1.00 . A A .  17 LEU HD23 1 1 
        2  3151 1 1  17 LEU HG   H   5.737  -2.144  19.344 1.00 . A A .  17 LEU HG   1 1 
        2  3152 1 1  17 LEU N    N   3.480  -4.739  19.263 1.00 . A A .  17 LEU N    1 1 
        2  3153 1 1  17 LEU O    O   1.970  -3.595  22.029 1.00 . A A .  17 LEU O    1 1 
        2  3154 1 1  18 SER C    C  -1.243  -4.015  19.194 1.00 . A A .  18 SER C    1 1 
        2  3155 1 1  18 SER CA   C  -0.407  -3.635  20.431 1.00 . A A .  18 SER CA   1 1 
        2  3156 1 1  18 SER CB   C  -0.947  -2.317  21.058 1.00 . A A .  18 SER CB   1 1 
        2  3157 1 1  18 SER H    H   1.136  -3.365  19.032 1.00 . A A .  18 SER H    1 1 
        2  3158 1 1  18 SER HA   H  -0.457  -4.435  21.166 1.00 . A A .  18 SER HA   1 1 
        2  3159 1 1  18 SER HB2  H  -0.813  -1.508  20.358 1.00 . A A .  18 SER HB2  1 1 
        2  3160 1 1  18 SER HB3  H  -2.004  -2.425  21.282 1.00 . A A .  18 SER HB3  1 1 
        2  3161 1 1  18 SER HG   H  -0.031  -2.793  22.728 1.00 . A A .  18 SER HG   1 1 
        2  3162 1 1  18 SER N    N   0.981  -3.496  19.991 1.00 . A A .  18 SER N    1 1 
        2  3163 1 1  18 SER O    O  -1.092  -3.364  18.152 1.00 . A A .  18 SER O    1 1 
        2  3164 1 1  18 SER OG   O  -0.270  -1.981  22.259 1.00 . A A .  18 SER OG   1 1 
        2  3165 1 1  19 PRO C    C  -3.912  -4.252  17.707 1.00 . A A .  19 PRO C    1 1 
        2  3166 1 1  19 PRO CA   C  -3.043  -5.439  18.160 1.00 . A A .  19 PRO CA   1 1 
        2  3167 1 1  19 PRO CB   C  -3.899  -6.566  18.783 1.00 . A A .  19 PRO CB   1 1 
        2  3168 1 1  19 PRO CD   C  -2.161  -6.085  20.365 1.00 . A A .  19 PRO CD   1 1 
        2  3169 1 1  19 PRO CG   C  -2.976  -7.217  19.770 1.00 . A A .  19 PRO CG   1 1 
        2  3170 1 1  19 PRO HA   H  -2.502  -5.828  17.300 1.00 . A A .  19 PRO HA   1 1 
        2  3171 1 1  19 PRO HB2  H  -4.783  -6.150  19.275 1.00 . A A .  19 PRO HB2  1 1 
        2  3172 1 1  19 PRO HB3  H  -4.204  -7.277  18.024 1.00 . A A .  19 PRO HB3  1 1 
        2  3173 1 1  19 PRO HD2  H  -2.659  -5.667  21.237 1.00 . A A .  19 PRO HD2  1 1 
        2  3174 1 1  19 PRO HD3  H  -1.167  -6.426  20.630 1.00 . A A .  19 PRO HD3  1 1 
        2  3175 1 1  19 PRO HG2  H  -3.550  -7.731  20.539 1.00 . A A .  19 PRO HG2  1 1 
        2  3176 1 1  19 PRO HG3  H  -2.319  -7.920  19.266 1.00 . A A .  19 PRO HG3  1 1 
        2  3177 1 1  19 PRO N    N  -2.097  -5.086  19.259 1.00 . A A .  19 PRO N    1 1 
        2  3178 1 1  19 PRO O    O  -4.168  -4.075  16.514 1.00 . A A .  19 PRO O    1 1 
        2  3179 1 1  20 ASN C    C  -4.354  -1.124  17.732 1.00 . A A .  20 ASN C    1 1 
        2  3180 1 1  20 ASN CA   C  -5.171  -2.236  18.416 1.00 . A A .  20 ASN CA   1 1 
        2  3181 1 1  20 ASN CB   C  -5.822  -1.716  19.726 1.00 . A A .  20 ASN CB   1 1 
        2  3182 1 1  20 ASN CG   C  -6.668  -2.783  20.439 1.00 . A A .  20 ASN CG   1 1 
        2  3183 1 1  20 ASN H    H  -4.089  -3.635  19.606 1.00 . A A .  20 ASN H    1 1 
        2  3184 1 1  20 ASN HA   H  -5.960  -2.539  17.735 1.00 . A A .  20 ASN HA   1 1 
        2  3185 1 1  20 ASN HB2  H  -5.041  -1.388  20.407 1.00 . A A .  20 ASN HB2  1 1 
        2  3186 1 1  20 ASN HB3  H  -6.462  -0.869  19.498 1.00 . A A .  20 ASN HB3  1 1 
        2  3187 1 1  20 ASN HD21 H  -6.504  -1.820  22.176 1.00 . A A .  20 ASN HD21 1 1 
        2  3188 1 1  20 ASN HD22 H  -7.413  -3.291  22.200 1.00 . A A .  20 ASN HD22 1 1 
        2  3189 1 1  20 ASN N    N  -4.339  -3.428  18.679 1.00 . A A .  20 ASN N    1 1 
        2  3190 1 1  20 ASN ND2  N  -6.886  -2.614  21.733 1.00 . A A .  20 ASN ND2  1 1 
        2  3191 1 1  20 ASN O    O  -4.904  -0.324  16.969 1.00 . A A .  20 ASN O    1 1 
        2  3192 1 1  20 ASN OD1  O  -7.151  -3.743  19.821 1.00 . A A .  20 ASN OD1  1 1 
        2  3193 1 1  21 HIS C    C  -1.689  -0.604  15.973 1.00 . A A .  21 HIS C    1 1 
        2  3194 1 1  21 HIS CA   C  -2.124  -0.109  17.361 1.00 . A A .  21 HIS CA   1 1 
        2  3195 1 1  21 HIS CB   C  -0.892   0.178  18.256 1.00 . A A .  21 HIS CB   1 1 
        2  3196 1 1  21 HIS CD2  C  -0.336   2.675  17.706 1.00 . A A .  21 HIS CD2  1 1 
        2  3197 1 1  21 HIS CE1  C   1.771   2.432  17.171 1.00 . A A .  21 HIS CE1  1 1 
        2  3198 1 1  21 HIS CG   C  -0.041   1.352  17.817 1.00 . A A .  21 HIS CG   1 1 
        2  3199 1 1  21 HIS H    H  -2.664  -1.718  18.650 1.00 . A A .  21 HIS H    1 1 
        2  3200 1 1  21 HIS HA   H  -2.678   0.818  17.229 1.00 . A A .  21 HIS HA   1 1 
        2  3201 1 1  21 HIS HB2  H  -1.236   0.397  19.257 1.00 . A A .  21 HIS HB2  1 1 
        2  3202 1 1  21 HIS HB3  H  -0.260  -0.700  18.290 1.00 . A A .  21 HIS HB3  1 1 
        2  3203 1 1  21 HIS HD1  H   1.815   0.413  17.464 1.00 . A A .  21 HIS HD1  1 1 
        2  3204 1 1  21 HIS HD2  H  -1.293   3.136  17.903 1.00 . A A .  21 HIS HD2  1 1 
        2  3205 1 1  21 HIS HE1  H   2.780   2.646  16.847 1.00 . A A .  21 HIS HE1  1 1 
        2  3206 1 1  21 HIS HE2  H   0.944   4.295  17.344 1.00 . A A .  21 HIS HE2  1 1 
        2  3207 1 1  21 HIS N    N  -3.034  -1.082  18.003 1.00 . A A .  21 HIS N    1 1 
        2  3208 1 1  21 HIS ND1  N   1.292   1.239  17.466 1.00 . A A .  21 HIS ND1  1 1 
        2  3209 1 1  21 HIS NE2  N   0.807   3.318  17.307 1.00 . A A .  21 HIS NE2  1 1 
        2  3210 1 1  21 HIS O    O  -1.249   0.195  15.158 1.00 . A A .  21 HIS O    1 1 
        2  3211 1 1  22 LEU C    C  -2.864  -2.215  13.528 1.00 . A A .  22 LEU C    1 1 
        2  3212 1 1  22 LEU CA   C  -1.624  -2.526  14.388 1.00 . A A .  22 LEU CA   1 1 
        2  3213 1 1  22 LEU CB   C  -1.371  -4.067  14.475 1.00 . A A .  22 LEU CB   1 1 
        2  3214 1 1  22 LEU CD1  C  -0.452  -4.247  12.059 1.00 . A A .  22 LEU CD1  1 1 
        2  3215 1 1  22 LEU CD2  C  -1.072  -6.361  13.328 1.00 . A A .  22 LEU CD2  1 1 
        2  3216 1 1  22 LEU CG   C  -1.394  -4.864  13.114 1.00 . A A .  22 LEU CG   1 1 
        2  3217 1 1  22 LEU H    H  -2.027  -2.526  16.474 1.00 . A A .  22 LEU H    1 1 
        2  3218 1 1  22 LEU HA   H  -0.754  -2.053  13.932 1.00 . A A .  22 LEU HA   1 1 
        2  3219 1 1  22 LEU HB2  H  -0.402  -4.218  14.941 1.00 . A A .  22 LEU HB2  1 1 
        2  3220 1 1  22 LEU HB3  H  -2.126  -4.493  15.130 1.00 . A A .  22 LEU HB3  1 1 
        2  3221 1 1  22 LEU HD11 H  -0.758  -3.229  11.853 1.00 . A A .  22 LEU HD11 1 1 
        2  3222 1 1  22 LEU HD12 H  -0.503  -4.819  11.144 1.00 . A A .  22 LEU HD12 1 1 
        2  3223 1 1  22 LEU HD13 H   0.561  -4.245  12.425 1.00 . A A .  22 LEU HD13 1 1 
        2  3224 1 1  22 LEU HD21 H  -1.784  -6.789  14.022 1.00 . A A .  22 LEU HD21 1 1 
        2  3225 1 1  22 LEU HD22 H  -0.072  -6.469  13.731 1.00 . A A .  22 LEU HD22 1 1 
        2  3226 1 1  22 LEU HD23 H  -1.139  -6.888  12.386 1.00 . A A .  22 LEU HD23 1 1 
        2  3227 1 1  22 LEU HG   H  -2.397  -4.808  12.704 1.00 . A A .  22 LEU HG   1 1 
        2  3228 1 1  22 LEU N    N  -1.804  -1.931  15.729 1.00 . A A .  22 LEU N    1 1 
        2  3229 1 1  22 LEU O    O  -2.739  -1.913  12.337 1.00 . A A .  22 LEU O    1 1 
        2  3230 1 1  23 LYS C    C  -5.228  -0.417  13.119 1.00 . A A .  23 LYS C    1 1 
        2  3231 1 1  23 LYS CA   C  -5.326  -1.888  13.542 1.00 . A A .  23 LYS CA   1 1 
        2  3232 1 1  23 LYS CB   C  -6.508  -2.137  14.541 1.00 . A A .  23 LYS CB   1 1 
        2  3233 1 1  23 LYS CD   C  -8.436  -0.650  13.604 1.00 . A A .  23 LYS CD   1 1 
        2  3234 1 1  23 LYS CE   C  -9.880  -0.641  13.101 1.00 . A A .  23 LYS CE   1 1 
        2  3235 1 1  23 LYS CG   C  -7.945  -2.076  13.945 1.00 . A A .  23 LYS CG   1 1 
        2  3236 1 1  23 LYS H    H  -4.067  -2.593  15.086 1.00 . A A .  23 LYS H    1 1 
        2  3237 1 1  23 LYS HA   H  -5.469  -2.508  12.660 1.00 . A A .  23 LYS HA   1 1 
        2  3238 1 1  23 LYS HB2  H  -6.376  -3.120  14.979 1.00 . A A .  23 LYS HB2  1 1 
        2  3239 1 1  23 LYS HB3  H  -6.444  -1.406  15.344 1.00 . A A .  23 LYS HB3  1 1 
        2  3240 1 1  23 LYS HD2  H  -8.373  -0.033  14.494 1.00 . A A .  23 LYS HD2  1 1 
        2  3241 1 1  23 LYS HD3  H  -7.791  -0.231  12.838 1.00 . A A .  23 LYS HD3  1 1 
        2  3242 1 1  23 LYS HE2  H -10.149   0.369  12.817 1.00 . A A .  23 LYS HE2  1 1 
        2  3243 1 1  23 LYS HE3  H  -9.956  -1.286  12.233 1.00 . A A .  23 LYS HE3  1 1 
        2  3244 1 1  23 LYS HG2  H  -7.961  -2.668  13.034 1.00 . A A .  23 LYS HG2  1 1 
        2  3245 1 1  23 LYS HG3  H  -8.634  -2.521  14.657 1.00 . A A .  23 LYS HG3  1 1 
        2  3246 1 1  23 LYS HZ1  H -10.810  -0.480  14.964 1.00 . A A .  23 LYS HZ1  1 1 
        2  3247 1 1  23 LYS HZ2  H -10.577  -2.073  14.449 1.00 . A A .  23 LYS HZ2  1 1 
        2  3248 1 1  23 LYS HZ3  H -11.794  -1.133  13.758 1.00 . A A .  23 LYS HZ3  1 1 
        2  3249 1 1  23 LYS N    N  -4.052  -2.277  14.164 1.00 . A A .  23 LYS N    1 1 
        2  3250 1 1  23 LYS NZ   N -10.831  -1.116  14.140 1.00 . A A .  23 LYS NZ   1 1 
        2  3251 1 1  23 LYS O    O  -5.485  -0.081  11.959 1.00 . A A .  23 LYS O    1 1 
        2  3252 1 1  24 LYS C    C  -3.507   2.107  12.808 1.00 . A A .  24 LYS C    1 1 
        2  3253 1 1  24 LYS CA   C  -4.605   1.870  13.856 1.00 . A A .  24 LYS CA   1 1 
        2  3254 1 1  24 LYS CB   C  -4.254   2.593  15.192 1.00 . A A .  24 LYS CB   1 1 
        2  3255 1 1  24 LYS CD   C  -5.344   4.987  15.031 1.00 . A A .  24 LYS CD   1 1 
        2  3256 1 1  24 LYS CE   C  -6.058   4.923  13.672 1.00 . A A .  24 LYS CE   1 1 
        2  3257 1 1  24 LYS CG   C  -4.038   4.142  15.121 1.00 . A A .  24 LYS CG   1 1 
        2  3258 1 1  24 LYS H    H  -4.680   0.082  14.989 1.00 . A A .  24 LYS H    1 1 
        2  3259 1 1  24 LYS HA   H  -5.537   2.276  13.477 1.00 . A A .  24 LYS HA   1 1 
        2  3260 1 1  24 LYS HB2  H  -5.053   2.407  15.900 1.00 . A A .  24 LYS HB2  1 1 
        2  3261 1 1  24 LYS HB3  H  -3.347   2.149  15.592 1.00 . A A .  24 LYS HB3  1 1 
        2  3262 1 1  24 LYS HD2  H  -6.032   4.639  15.793 1.00 . A A .  24 LYS HD2  1 1 
        2  3263 1 1  24 LYS HD3  H  -5.094   6.021  15.238 1.00 . A A .  24 LYS HD3  1 1 
        2  3264 1 1  24 LYS HE2  H  -5.402   5.323  12.910 1.00 . A A .  24 LYS HE2  1 1 
        2  3265 1 1  24 LYS HE3  H  -6.280   3.887  13.440 1.00 . A A .  24 LYS HE3  1 1 
        2  3266 1 1  24 LYS HG2  H  -3.511   4.448  16.015 1.00 . A A .  24 LYS HG2  1 1 
        2  3267 1 1  24 LYS HG3  H  -3.416   4.367  14.259 1.00 . A A .  24 LYS HG3  1 1 
        2  3268 1 1  24 LYS HZ1  H  -7.847   5.558  12.786 1.00 . A A .  24 LYS HZ1  1 1 
        2  3269 1 1  24 LYS HZ2  H  -7.137   6.707  13.804 1.00 . A A .  24 LYS HZ2  1 1 
        2  3270 1 1  24 LYS HZ3  H  -7.939   5.379  14.462 1.00 . A A .  24 LYS HZ3  1 1 
        2  3271 1 1  24 LYS N    N  -4.824   0.436  14.084 1.00 . A A .  24 LYS N    1 1 
        2  3272 1 1  24 LYS NZ   N  -7.330   5.695  13.675 1.00 . A A .  24 LYS NZ   1 1 
        2  3273 1 1  24 LYS O    O  -3.644   3.000  11.965 1.00 . A A .  24 LYS O    1 1 
        2  3274 1 1  25 ALA C    C  -1.780   1.235  10.482 1.00 . A A .  25 ALA C    1 1 
        2  3275 1 1  25 ALA CA   C  -1.305   1.366  11.921 1.00 . A A .  25 ALA CA   1 1 
        2  3276 1 1  25 ALA CB   C  -0.233   0.300  12.218 1.00 . A A .  25 ALA CB   1 1 
        2  3277 1 1  25 ALA H    H  -2.413   0.585  13.550 1.00 . A A .  25 ALA H    1 1 
        2  3278 1 1  25 ALA HA   H  -0.846   2.345  12.058 1.00 . A A .  25 ALA HA   1 1 
        2  3279 1 1  25 ALA HB1  H   0.615   0.440  11.559 1.00 . A A .  25 ALA HB1  1 1 
        2  3280 1 1  25 ALA HB2  H  -0.649  -0.690  12.070 1.00 . A A .  25 ALA HB2  1 1 
        2  3281 1 1  25 ALA HB3  H   0.097   0.395  13.243 1.00 . A A .  25 ALA HB3  1 1 
        2  3282 1 1  25 ALA N    N  -2.436   1.278  12.858 1.00 . A A .  25 ALA N    1 1 
        2  3283 1 1  25 ALA O    O  -1.578   2.141   9.698 1.00 . A A .  25 ALA O    1 1 
        2  3284 1 1  26 LYS C    C  -4.067   0.709   8.364 1.00 . A A .  26 LYS C    1 1 
        2  3285 1 1  26 LYS CA   C  -2.930  -0.213   8.829 1.00 . A A .  26 LYS CA   1 1 
        2  3286 1 1  26 LYS CB   C  -3.358  -1.693   8.788 1.00 . A A .  26 LYS CB   1 1 
        2  3287 1 1  26 LYS CD   C  -2.688  -4.127   9.288 1.00 . A A .  26 LYS CD   1 1 
        2  3288 1 1  26 LYS CE   C  -3.383  -4.730   8.066 1.00 . A A .  26 LYS CE   1 1 
        2  3289 1 1  26 LYS CG   C  -2.197  -2.679   9.072 1.00 . A A .  26 LYS CG   1 1 
        2  3290 1 1  26 LYS H    H  -2.680  -0.499  10.913 1.00 . A A .  26 LYS H    1 1 
        2  3291 1 1  26 LYS HA   H  -2.087  -0.081   8.158 1.00 . A A .  26 LYS HA   1 1 
        2  3292 1 1  26 LYS HB2  H  -4.136  -1.852   9.532 1.00 . A A .  26 LYS HB2  1 1 
        2  3293 1 1  26 LYS HB3  H  -3.765  -1.918   7.808 1.00 . A A .  26 LYS HB3  1 1 
        2  3294 1 1  26 LYS HD2  H  -1.841  -4.753   9.546 1.00 . A A .  26 LYS HD2  1 1 
        2  3295 1 1  26 LYS HD3  H  -3.386  -4.129  10.122 1.00 . A A .  26 LYS HD3  1 1 
        2  3296 1 1  26 LYS HE2  H  -4.201  -4.088   7.764 1.00 . A A .  26 LYS HE2  1 1 
        2  3297 1 1  26 LYS HE3  H  -2.670  -4.807   7.256 1.00 . A A .  26 LYS HE3  1 1 
        2  3298 1 1  26 LYS HG2  H  -1.504  -2.661   8.234 1.00 . A A .  26 LYS HG2  1 1 
        2  3299 1 1  26 LYS HG3  H  -1.673  -2.351   9.967 1.00 . A A .  26 LYS HG3  1 1 
        2  3300 1 1  26 LYS HZ1  H  -4.501  -6.420   7.563 1.00 . A A .  26 LYS HZ1  1 1 
        2  3301 1 1  26 LYS HZ2  H  -4.505  -6.069   9.218 1.00 . A A .  26 LYS HZ2  1 1 
        2  3302 1 1  26 LYS HZ3  H  -3.137  -6.756   8.501 1.00 . A A .  26 LYS HZ3  1 1 
        2  3303 1 1  26 LYS N    N  -2.470   0.123  10.187 1.00 . A A .  26 LYS N    1 1 
        2  3304 1 1  26 LYS NZ   N  -3.918  -6.088   8.358 1.00 . A A .  26 LYS NZ   1 1 
        2  3305 1 1  26 LYS O    O  -4.131   1.055   7.182 1.00 . A A .  26 LYS O    1 1 
        2  3306 1 1  27 LEU C    C  -5.412   3.449   8.634 1.00 . A A .  27 LEU C    1 1 
        2  3307 1 1  27 LEU CA   C  -6.013   2.089   9.059 1.00 . A A .  27 LEU CA   1 1 
        2  3308 1 1  27 LEU CB   C  -6.898   2.207  10.345 1.00 . A A .  27 LEU CB   1 1 
        2  3309 1 1  27 LEU CD1  C  -7.982   4.583  10.408 1.00 . A A .  27 LEU CD1  1 1 
        2  3310 1 1  27 LEU CD2  C  -9.066   2.725   9.028 1.00 . A A .  27 LEU CD2  1 1 
        2  3311 1 1  27 LEU CG   C  -8.226   3.059  10.288 1.00 . A A .  27 LEU CG   1 1 
        2  3312 1 1  27 LEU H    H  -4.851   0.738  10.211 1.00 . A A .  27 LEU H    1 1 
        2  3313 1 1  27 LEU HA   H  -6.624   1.702   8.246 1.00 . A A .  27 LEU HA   1 1 
        2  3314 1 1  27 LEU HB2  H  -7.173   1.197  10.636 1.00 . A A .  27 LEU HB2  1 1 
        2  3315 1 1  27 LEU HB3  H  -6.274   2.609  11.138 1.00 . A A .  27 LEU HB3  1 1 
        2  3316 1 1  27 LEU HD11 H  -7.415   4.943   9.558 1.00 . A A .  27 LEU HD11 1 1 
        2  3317 1 1  27 LEU HD12 H  -7.430   4.792  11.315 1.00 . A A .  27 LEU HD12 1 1 
        2  3318 1 1  27 LEU HD13 H  -8.931   5.101  10.452 1.00 . A A .  27 LEU HD13 1 1 
        2  3319 1 1  27 LEU HD21 H  -8.517   2.995   8.132 1.00 . A A .  27 LEU HD21 1 1 
        2  3320 1 1  27 LEU HD22 H  -9.999   3.270   9.054 1.00 . A A .  27 LEU HD22 1 1 
        2  3321 1 1  27 LEU HD23 H  -9.280   1.663   9.004 1.00 . A A .  27 LEU HD23 1 1 
        2  3322 1 1  27 LEU HG   H  -8.830   2.786  11.145 1.00 . A A .  27 LEU HG   1 1 
        2  3323 1 1  27 LEU N    N  -4.933   1.114   9.309 1.00 . A A .  27 LEU N    1 1 
        2  3324 1 1  27 LEU O    O  -5.960   4.138   7.766 1.00 . A A .  27 LEU O    1 1 
        2  3325 1 1  28 MET C    C  -2.503   4.862   7.843 1.00 . A A .  28 MET C    1 1 
        2  3326 1 1  28 MET CA   C  -3.566   5.079   8.958 1.00 . A A .  28 MET CA   1 1 
        2  3327 1 1  28 MET CB   C  -2.924   5.629  10.269 1.00 . A A .  28 MET CB   1 1 
        2  3328 1 1  28 MET CE   C  -0.358   6.876  11.949 1.00 . A A .  28 MET CE   1 1 
        2  3329 1 1  28 MET CG   C  -2.539   7.113  10.239 1.00 . A A .  28 MET CG   1 1 
        2  3330 1 1  28 MET H    H  -3.904   3.218   9.943 1.00 . A A .  28 MET H    1 1 
        2  3331 1 1  28 MET HA   H  -4.298   5.801   8.598 1.00 . A A .  28 MET HA   1 1 
        2  3332 1 1  28 MET HB2  H  -3.626   5.494  11.085 1.00 . A A .  28 MET HB2  1 1 
        2  3333 1 1  28 MET HB3  H  -2.033   5.056  10.495 1.00 . A A .  28 MET HB3  1 1 
        2  3334 1 1  28 MET HE1  H   0.262   7.161  11.111 1.00 . A A .  28 MET HE1  1 1 
        2  3335 1 1  28 MET HE2  H  -0.508   5.805  11.940 1.00 . A A .  28 MET HE2  1 1 
        2  3336 1 1  28 MET HE3  H   0.131   7.163  12.868 1.00 . A A .  28 MET HE3  1 1 
        2  3337 1 1  28 MET HG2  H  -1.765   7.263   9.497 1.00 . A A .  28 MET HG2  1 1 
        2  3338 1 1  28 MET HG3  H  -3.408   7.696   9.962 1.00 . A A .  28 MET HG3  1 1 
        2  3339 1 1  28 MET N    N  -4.279   3.816   9.256 1.00 . A A .  28 MET N    1 1 
        2  3340 1 1  28 MET O    O  -1.966   5.823   7.291 1.00 . A A .  28 MET O    1 1 
        2  3341 1 1  28 MET SD   S  -1.936   7.714  11.833 1.00 . A A .  28 MET SD   1 1 
        2  3342 1 1  29 PHE C    C  -2.064   3.090   5.109 1.00 . A A .  29 PHE C    1 1 
        2  3343 1 1  29 PHE CA   C  -1.284   3.179   6.441 1.00 . A A .  29 PHE CA   1 1 
        2  3344 1 1  29 PHE CB   C  -0.597   1.833   6.804 1.00 . A A .  29 PHE CB   1 1 
        2  3345 1 1  29 PHE CD1  C   1.853   2.195   6.240 1.00 . A A .  29 PHE CD1  1 1 
        2  3346 1 1  29 PHE CD2  C   0.685   0.450   5.092 1.00 . A A .  29 PHE CD2  1 1 
        2  3347 1 1  29 PHE CE1  C   3.007   1.871   5.558 1.00 . A A .  29 PHE CE1  1 1 
        2  3348 1 1  29 PHE CE2  C   1.842   0.130   4.408 1.00 . A A .  29 PHE CE2  1 1 
        2  3349 1 1  29 PHE CG   C   0.667   1.489   6.019 1.00 . A A .  29 PHE CG   1 1 
        2  3350 1 1  29 PHE CZ   C   2.999   0.839   4.643 1.00 . A A .  29 PHE CZ   1 1 
        2  3351 1 1  29 PHE H    H  -2.605   2.873   8.081 1.00 . A A .  29 PHE H    1 1 
        2  3352 1 1  29 PHE HA   H  -0.523   3.952   6.346 1.00 . A A .  29 PHE HA   1 1 
        2  3353 1 1  29 PHE HB2  H  -0.319   1.867   7.851 1.00 . A A .  29 PHE HB2  1 1 
        2  3354 1 1  29 PHE HB3  H  -1.310   1.027   6.675 1.00 . A A .  29 PHE HB3  1 1 
        2  3355 1 1  29 PHE HD1  H   1.867   3.004   6.957 1.00 . A A .  29 PHE HD1  1 1 
        2  3356 1 1  29 PHE HD2  H  -0.221  -0.113   4.902 1.00 . A A .  29 PHE HD2  1 1 
        2  3357 1 1  29 PHE HE1  H   3.921   2.427   5.737 1.00 . A A .  29 PHE HE1  1 1 
        2  3358 1 1  29 PHE HE2  H   1.839  -0.681   3.686 1.00 . A A .  29 PHE HE2  1 1 
        2  3359 1 1  29 PHE HZ   H   3.904   0.587   4.104 1.00 . A A .  29 PHE HZ   1 1 
        2  3360 1 1  29 PHE N    N  -2.206   3.581   7.535 1.00 . A A .  29 PHE N    1 1 
        2  3361 1 1  29 PHE O    O  -1.468   3.005   4.023 1.00 . A A .  29 PHE O    1 1 
        2  3362 1 1  30 PHE C    C  -4.050   4.946   3.806 1.00 . A A .  30 PHE C    1 1 
        2  3363 1 1  30 PHE CA   C  -4.318   3.465   4.135 1.00 . A A .  30 PHE CA   1 1 
        2  3364 1 1  30 PHE CB   C  -5.823   3.312   4.542 1.00 . A A .  30 PHE CB   1 1 
        2  3365 1 1  30 PHE CD1  C  -6.928   1.529   3.106 1.00 . A A .  30 PHE CD1  1 1 
        2  3366 1 1  30 PHE CD2  C  -6.600   1.050   5.421 1.00 . A A .  30 PHE CD2  1 1 
        2  3367 1 1  30 PHE CE1  C  -7.527   0.294   2.932 1.00 . A A .  30 PHE CE1  1 1 
        2  3368 1 1  30 PHE CE2  C  -7.201  -0.179   5.248 1.00 . A A .  30 PHE CE2  1 1 
        2  3369 1 1  30 PHE CG   C  -6.450   1.929   4.356 1.00 . A A .  30 PHE CG   1 1 
        2  3370 1 1  30 PHE CZ   C  -7.663  -0.557   4.006 1.00 . A A .  30 PHE CZ   1 1 
        2  3371 1 1  30 PHE H    H  -3.803   2.742   6.064 1.00 . A A .  30 PHE H    1 1 
        2  3372 1 1  30 PHE HA   H  -4.114   2.855   3.259 1.00 . A A .  30 PHE HA   1 1 
        2  3373 1 1  30 PHE HB2  H  -5.931   3.580   5.586 1.00 . A A .  30 PHE HB2  1 1 
        2  3374 1 1  30 PHE HB3  H  -6.420   4.011   3.962 1.00 . A A .  30 PHE HB3  1 1 
        2  3375 1 1  30 PHE HD1  H  -6.824   2.198   2.260 1.00 . A A .  30 PHE HD1  1 1 
        2  3376 1 1  30 PHE HD2  H  -6.238   1.335   6.401 1.00 . A A .  30 PHE HD2  1 1 
        2  3377 1 1  30 PHE HE1  H  -7.887  -0.004   1.955 1.00 . A A .  30 PHE HE1  1 1 
        2  3378 1 1  30 PHE HE2  H  -7.303  -0.848   6.088 1.00 . A A .  30 PHE HE2  1 1 
        2  3379 1 1  30 PHE HZ   H  -8.133  -1.527   3.876 1.00 . A A .  30 PHE HZ   1 1 
        2  3380 1 1  30 PHE N    N  -3.413   3.055   5.220 1.00 . A A .  30 PHE N    1 1 
        2  3381 1 1  30 PHE O    O  -3.737   5.743   4.707 1.00 . A A .  30 PHE O    1 1 
        2  3382 1 1  31 TYR C    C  -2.775   7.365   2.004 1.00 . A A .  31 TYR C    1 1 
        2  3383 1 1  31 TYR CA   C  -4.181   6.715   1.995 1.00 . A A .  31 TYR CA   1 1 
        2  3384 1 1  31 TYR CB   C  -5.202   7.636   2.771 1.00 . A A .  31 TYR CB   1 1 
        2  3385 1 1  31 TYR CD1  C  -7.174   6.086   2.333 1.00 . A A .  31 TYR CD1  1 1 
        2  3386 1 1  31 TYR CD2  C  -7.042   7.102   4.490 1.00 . A A .  31 TYR CD2  1 1 
        2  3387 1 1  31 TYR CE1  C  -8.298   5.408   2.725 1.00 . A A .  31 TYR CE1  1 1 
        2  3388 1 1  31 TYR CE2  C  -8.189   6.430   4.879 1.00 . A A .  31 TYR CE2  1 1 
        2  3389 1 1  31 TYR CG   C  -6.511   6.942   3.199 1.00 . A A .  31 TYR CG   1 1 
        2  3390 1 1  31 TYR CZ   C  -8.810   5.578   3.990 1.00 . A A .  31 TYR CZ   1 1 
        2  3391 1 1  31 TYR H    H  -4.252   4.586   1.849 1.00 . A A .  31 TYR H    1 1 
        2  3392 1 1  31 TYR HA   H  -4.503   6.655   0.961 1.00 . A A .  31 TYR HA   1 1 
        2  3393 1 1  31 TYR HB2  H  -4.718   8.012   3.665 1.00 . A A .  31 TYR HB2  1 1 
        2  3394 1 1  31 TYR HB3  H  -5.471   8.476   2.144 1.00 . A A .  31 TYR HB3  1 1 
        2  3395 1 1  31 TYR HD1  H  -6.780   5.940   1.335 1.00 . A A .  31 TYR HD1  1 1 
        2  3396 1 1  31 TYR HD2  H  -6.548   7.772   5.189 1.00 . A A .  31 TYR HD2  1 1 
        2  3397 1 1  31 TYR HE1  H  -8.793   4.751   2.027 1.00 . A A .  31 TYR HE1  1 1 
        2  3398 1 1  31 TYR HE2  H  -8.587   6.569   5.877 1.00 . A A .  31 TYR HE2  1 1 
        2  3399 1 1  31 TYR HH   H -10.530   5.456   4.831 1.00 . A A .  31 TYR HH   1 1 
        2  3400 1 1  31 TYR N    N  -4.171   5.303   2.505 1.00 . A A .  31 TYR N    1 1 
        2  3401 1 1  31 TYR O    O  -2.551   8.363   1.311 1.00 . A A .  31 TYR O    1 1 
        2  3402 1 1  31 TYR OH   O  -9.934   4.875   4.364 1.00 . A A .  31 TYR OH   1 1 
        2  3403 1 1  32 THR C    C   0.402   6.168   3.453 1.00 . A A .  32 THR C    1 1 
        2  3404 1 1  32 THR CA   C  -0.505   7.325   3.016 1.00 . A A .  32 THR CA   1 1 
        2  3405 1 1  32 THR CB   C  -0.513   8.444   4.105 1.00 . A A .  32 THR CB   1 1 
        2  3406 1 1  32 THR CG2  C   0.903   8.882   4.517 1.00 . A A .  32 THR CG2  1 1 
        2  3407 1 1  32 THR H    H  -2.070   5.950   3.236 1.00 . A A .  32 THR H    1 1 
        2  3408 1 1  32 THR HA   H  -0.136   7.748   2.079 1.00 . A A .  32 THR HA   1 1 
        2  3409 1 1  32 THR HB   H  -1.019   8.058   4.983 1.00 . A A .  32 THR HB   1 1 
        2  3410 1 1  32 THR HG1  H  -0.976   9.781   2.734 1.00 . A A .  32 THR HG1  1 1 
        2  3411 1 1  32 THR HG21 H   1.439   9.241   3.649 1.00 . A A .  32 THR HG21 1 1 
        2  3412 1 1  32 THR HG22 H   1.439   8.046   4.948 1.00 . A A .  32 THR HG22 1 1 
        2  3413 1 1  32 THR HG23 H   0.842   9.679   5.251 1.00 . A A .  32 THR HG23 1 1 
        2  3414 1 1  32 THR N    N  -1.849   6.791   2.791 1.00 . A A .  32 THR N    1 1 
        2  3415 1 1  32 THR O    O   0.084   5.443   4.404 1.00 . A A .  32 THR O    1 1 
        2  3416 1 1  32 THR OG1  O  -1.251   9.583   3.634 1.00 . A A .  32 THR OG1  1 1 
        2  3417 1 1  33 ARG C    C   3.879   5.233   2.874 1.00 . A A .  33 ARG C    1 1 
        2  3418 1 1  33 ARG CA   C   2.400   4.843   2.917 1.00 . A A .  33 ARG CA   1 1 
        2  3419 1 1  33 ARG CB   C   2.031   3.861   1.782 1.00 . A A .  33 ARG CB   1 1 
        2  3420 1 1  33 ARG CD   C   2.732   2.000   0.188 1.00 . A A .  33 ARG CD   1 1 
        2  3421 1 1  33 ARG CG   C   3.011   2.689   1.534 1.00 . A A .  33 ARG CG   1 1 
        2  3422 1 1  33 ARG CZ   C   1.524   3.061  -1.730 1.00 . A A .  33 ARG CZ   1 1 
        2  3423 1 1  33 ARG H    H   1.814   6.743   2.169 1.00 . A A .  33 ARG H    1 1 
        2  3424 1 1  33 ARG HA   H   2.197   4.362   3.871 1.00 . A A .  33 ARG HA   1 1 
        2  3425 1 1  33 ARG HB2  H   1.056   3.438   1.997 1.00 . A A .  33 ARG HB2  1 1 
        2  3426 1 1  33 ARG HB3  H   1.953   4.430   0.859 1.00 . A A .  33 ARG HB3  1 1 
        2  3427 1 1  33 ARG HD2  H   3.582   1.383  -0.085 1.00 . A A .  33 ARG HD2  1 1 
        2  3428 1 1  33 ARG HD3  H   1.846   1.382   0.277 1.00 . A A .  33 ARG HD3  1 1 
        2  3429 1 1  33 ARG HE   H   3.180   3.762  -0.868 1.00 . A A .  33 ARG HE   1 1 
        2  3430 1 1  33 ARG HG2  H   4.027   3.073   1.524 1.00 . A A .  33 ARG HG2  1 1 
        2  3431 1 1  33 ARG HG3  H   2.912   1.965   2.334 1.00 . A A .  33 ARG HG3  1 1 
        2  3432 1 1  33 ARG HH11 H   0.676   1.314  -1.147 1.00 . A A .  33 ARG HH11 1 1 
        2  3433 1 1  33 ARG HH12 H  -0.134   2.115  -2.452 1.00 . A A .  33 ARG HH12 1 1 
        2  3434 1 1  33 ARG HH21 H   2.028   4.907  -2.385 1.00 . A A .  33 ARG HH21 1 1 
        2  3435 1 1  33 ARG HH22 H   0.657   4.200  -3.157 1.00 . A A .  33 ARG HH22 1 1 
        2  3436 1 1  33 ARG N    N   1.542   6.026   2.785 1.00 . A A .  33 ARG N    1 1 
        2  3437 1 1  33 ARG NE   N   2.521   3.030  -0.844 1.00 . A A .  33 ARG NE   1 1 
        2  3438 1 1  33 ARG NH1  N   0.618   2.083  -1.781 1.00 . A A .  33 ARG NH1  1 1 
        2  3439 1 1  33 ARG NH2  N   1.391   4.141  -2.486 1.00 . A A .  33 ARG NH2  1 1 
        2  3440 1 1  33 ARG O    O   4.654   4.769   3.722 1.00 . A A .  33 ARG O    1 1 
        2  3441 1 1  34 TYR C    C   6.650   5.275   1.529 1.00 . A A .  34 TYR C    1 1 
        2  3442 1 1  34 TYR CA   C   5.679   6.503   1.680 1.00 . A A .  34 TYR CA   1 1 
        2  3443 1 1  34 TYR CB   C   6.091   7.431   2.870 1.00 . A A .  34 TYR CB   1 1 
        2  3444 1 1  34 TYR CD1  C   5.770   9.718   1.806 1.00 . A A .  34 TYR CD1  1 1 
        2  3445 1 1  34 TYR CD2  C   4.600   9.273   3.844 1.00 . A A .  34 TYR CD2  1 1 
        2  3446 1 1  34 TYR CE1  C   5.245  10.994   1.783 1.00 . A A .  34 TYR CE1  1 1 
        2  3447 1 1  34 TYR CE2  C   4.069  10.547   3.816 1.00 . A A .  34 TYR CE2  1 1 
        2  3448 1 1  34 TYR CG   C   5.462   8.828   2.837 1.00 . A A .  34 TYR CG   1 1 
        2  3449 1 1  34 TYR CZ   C   4.397  11.403   2.785 1.00 . A A .  34 TYR CZ   1 1 
        2  3450 1 1  34 TYR H    H   3.588   6.421   1.265 1.00 . A A .  34 TYR H    1 1 
        2  3451 1 1  34 TYR HA   H   5.717   7.068   0.762 1.00 . A A .  34 TYR HA   1 1 
        2  3452 1 1  34 TYR HB2  H   5.806   6.953   3.799 1.00 . A A .  34 TYR HB2  1 1 
        2  3453 1 1  34 TYR HB3  H   7.167   7.558   2.868 1.00 . A A .  34 TYR HB3  1 1 
        2  3454 1 1  34 TYR HD1  H   6.435   9.403   1.013 1.00 . A A .  34 TYR HD1  1 1 
        2  3455 1 1  34 TYR HD2  H   4.342   8.598   4.655 1.00 . A A .  34 TYR HD2  1 1 
        2  3456 1 1  34 TYR HE1  H   5.500  11.669   0.975 1.00 . A A .  34 TYR HE1  1 1 
        2  3457 1 1  34 TYR HE2  H   3.399  10.871   4.607 1.00 . A A .  34 TYR HE2  1 1 
        2  3458 1 1  34 TYR HH   H   3.975  13.070   3.631 1.00 . A A .  34 TYR HH   1 1 
        2  3459 1 1  34 TYR N    N   4.270   6.068   1.874 1.00 . A A .  34 TYR N    1 1 
        2  3460 1 1  34 TYR O    O   6.185   4.167   1.254 1.00 . A A .  34 TYR O    1 1 
        2  3461 1 1  34 TYR OH   O   3.884  12.678   2.762 1.00 . A A .  34 TYR OH   1 1 
        2  3462 1 1  35 PRO C    C   8.668   4.070   3.550 1.00 . A A .  35 PRO C    1 1 
        2  3463 1 1  35 PRO CA   C   8.918   4.367   2.052 1.00 . A A .  35 PRO CA   1 1 
        2  3464 1 1  35 PRO CB   C  10.338   4.947   1.813 1.00 . A A .  35 PRO CB   1 1 
        2  3465 1 1  35 PRO CD   C   8.795   6.606   1.044 1.00 . A A .  35 PRO CD   1 1 
        2  3466 1 1  35 PRO CG   C  10.145   5.995   0.751 1.00 . A A .  35 PRO CG   1 1 
        2  3467 1 1  35 PRO HA   H   8.775   3.461   1.468 1.00 . A A .  35 PRO HA   1 1 
        2  3468 1 1  35 PRO HB2  H  10.730   5.390   2.729 1.00 . A A .  35 PRO HB2  1 1 
        2  3469 1 1  35 PRO HB3  H  11.014   4.176   1.462 1.00 . A A .  35 PRO HB3  1 1 
        2  3470 1 1  35 PRO HD2  H   8.882   7.396   1.789 1.00 . A A .  35 PRO HD2  1 1 
        2  3471 1 1  35 PRO HD3  H   8.343   6.991   0.142 1.00 . A A .  35 PRO HD3  1 1 
        2  3472 1 1  35 PRO HG2  H  10.932   6.742   0.816 1.00 . A A .  35 PRO HG2  1 1 
        2  3473 1 1  35 PRO HG3  H  10.142   5.540  -0.234 1.00 . A A .  35 PRO HG3  1 1 
        2  3474 1 1  35 PRO N    N   8.015   5.450   1.579 1.00 . A A .  35 PRO N    1 1 
        2  3475 1 1  35 PRO O    O   8.430   5.014   4.320 1.00 . A A .  35 PRO O    1 1 
        2  3476 1 1  36 SER C    C   8.953   3.136   6.425 1.00 . A A .  36 SER C    1 1 
        2  3477 1 1  36 SER CA   C   8.385   2.271   5.290 1.00 . A A .  36 SER CA   1 1 
        2  3478 1 1  36 SER CB   C   8.896   0.818   5.418 1.00 . A A .  36 SER CB   1 1 
        2  3479 1 1  36 SER H    H   8.819   2.083   3.237 1.00 . A A .  36 SER H    1 1 
        2  3480 1 1  36 SER HA   H   7.303   2.258   5.377 1.00 . A A .  36 SER HA   1 1 
        2  3481 1 1  36 SER HB2  H   9.981   0.802   5.389 1.00 . A A .  36 SER HB2  1 1 
        2  3482 1 1  36 SER HB3  H   8.555   0.389   6.351 1.00 . A A .  36 SER HB3  1 1 
        2  3483 1 1  36 SER HG   H   8.113  -0.823   4.689 1.00 . A A .  36 SER HG   1 1 
        2  3484 1 1  36 SER N    N   8.696   2.768   3.927 1.00 . A A .  36 SER N    1 1 
        2  3485 1 1  36 SER O    O   8.187   3.720   7.186 1.00 . A A .  36 SER O    1 1 
        2  3486 1 1  36 SER OG   O   8.408   0.025   4.349 1.00 . A A .  36 SER OG   1 1 
        2  3487 1 1  37 SER C    C  10.595   5.441   7.700 1.00 . A A .  37 SER C    1 1 
        2  3488 1 1  37 SER CA   C  11.014   3.962   7.538 1.00 . A A .  37 SER CA   1 1 
        2  3489 1 1  37 SER CB   C  12.525   3.845   7.278 1.00 . A A .  37 SER CB   1 1 
        2  3490 1 1  37 SER H    H  10.813   2.886   5.724 1.00 . A A .  37 SER H    1 1 
        2  3491 1 1  37 SER HA   H  10.783   3.439   8.463 1.00 . A A .  37 SER HA   1 1 
        2  3492 1 1  37 SER HB2  H  13.072   4.552   7.892 1.00 . A A .  37 SER HB2  1 1 
        2  3493 1 1  37 SER HB3  H  12.850   2.841   7.510 1.00 . A A .  37 SER HB3  1 1 
        2  3494 1 1  37 SER HG   H  12.875   5.055   5.773 1.00 . A A .  37 SER HG   1 1 
        2  3495 1 1  37 SER N    N  10.290   3.267   6.460 1.00 . A A .  37 SER N    1 1 
        2  3496 1 1  37 SER O    O  10.557   5.945   8.831 1.00 . A A .  37 SER O    1 1 
        2  3497 1 1  37 SER OG   O  12.821   4.103   5.913 1.00 . A A .  37 SER OG   1 1 
        2  3498 1 1  38 ASN C    C   8.488   7.676   7.327 1.00 . A A .  38 ASN C    1 1 
        2  3499 1 1  38 ASN CA   C   9.825   7.523   6.575 1.00 . A A .  38 ASN CA   1 1 
        2  3500 1 1  38 ASN CB   C   9.711   8.062   5.117 1.00 . A A .  38 ASN CB   1 1 
        2  3501 1 1  38 ASN CG   C   9.235   9.524   5.039 1.00 . A A .  38 ASN CG   1 1 
        2  3502 1 1  38 ASN H    H  10.286   5.633   5.714 1.00 . A A .  38 ASN H    1 1 
        2  3503 1 1  38 ASN HA   H  10.589   8.090   7.099 1.00 . A A .  38 ASN HA   1 1 
        2  3504 1 1  38 ASN HB2  H  10.683   8.003   4.643 1.00 . A A .  38 ASN HB2  1 1 
        2  3505 1 1  38 ASN HB3  H   9.015   7.434   4.561 1.00 . A A .  38 ASN HB3  1 1 
        2  3506 1 1  38 ASN HD21 H   8.271   9.175   3.340 1.00 . A A .  38 ASN HD21 1 1 
        2  3507 1 1  38 ASN HD22 H   8.165  10.787   3.949 1.00 . A A .  38 ASN HD22 1 1 
        2  3508 1 1  38 ASN N    N  10.253   6.110   6.572 1.00 . A A .  38 ASN N    1 1 
        2  3509 1 1  38 ASN ND2  N   8.484   9.860   4.005 1.00 . A A .  38 ASN ND2  1 1 
        2  3510 1 1  38 ASN O    O   8.450   8.277   8.402 1.00 . A A .  38 ASN O    1 1 
        2  3511 1 1  38 ASN OD1  O   9.533  10.343   5.913 1.00 . A A .  38 ASN OD1  1 1 
        2  3512 1 1  39 MET C    C   6.075   6.607   8.824 1.00 . A A .  39 MET C    1 1 
        2  3513 1 1  39 MET CA   C   6.062   7.058   7.347 1.00 . A A .  39 MET CA   1 1 
        2  3514 1 1  39 MET CB   C   5.162   6.129   6.482 1.00 . A A .  39 MET CB   1 1 
        2  3515 1 1  39 MET CE   C   2.031   4.808   8.964 1.00 . A A .  39 MET CE   1 1 
        2  3516 1 1  39 MET CG   C   3.739   5.868   7.017 1.00 . A A .  39 MET CG   1 1 
        2  3517 1 1  39 MET H    H   7.578   6.607   5.911 1.00 . A A .  39 MET H    1 1 
        2  3518 1 1  39 MET HA   H   5.681   8.072   7.290 1.00 . A A .  39 MET HA   1 1 
        2  3519 1 1  39 MET HB2  H   5.077   6.566   5.492 1.00 . A A .  39 MET HB2  1 1 
        2  3520 1 1  39 MET HB3  H   5.660   5.169   6.381 1.00 . A A .  39 MET HB3  1 1 
        2  3521 1 1  39 MET HE1  H   1.373   4.559   8.145 1.00 . A A .  39 MET HE1  1 1 
        2  3522 1 1  39 MET HE2  H   1.823   5.809   9.303 1.00 . A A .  39 MET HE2  1 1 
        2  3523 1 1  39 MET HE3  H   1.885   4.115   9.774 1.00 . A A .  39 MET HE3  1 1 
        2  3524 1 1  39 MET HG2  H   3.305   6.806   7.338 1.00 . A A .  39 MET HG2  1 1 
        2  3525 1 1  39 MET HG3  H   3.132   5.449   6.220 1.00 . A A .  39 MET HG3  1 1 
        2  3526 1 1  39 MET N    N   7.429   7.062   6.768 1.00 . A A .  39 MET N    1 1 
        2  3527 1 1  39 MET O    O   5.465   7.244   9.703 1.00 . A A .  39 MET O    1 1 
        2  3528 1 1  39 MET SD   S   3.725   4.714   8.411 1.00 . A A .  39 MET SD   1 1 
        2  3529 1 1  40 LEU C    C   7.542   5.856  11.417 1.00 . A A .  40 LEU C    1 1 
        2  3530 1 1  40 LEU CA   C   7.004   4.886  10.353 1.00 . A A .  40 LEU CA   1 1 
        2  3531 1 1  40 LEU CB   C   7.950   3.669  10.200 1.00 . A A .  40 LEU CB   1 1 
        2  3532 1 1  40 LEU CD1  C   6.910   2.315  12.070 1.00 . A A .  40 LEU CD1  1 1 
        2  3533 1 1  40 LEU CD2  C   9.198   1.672  11.179 1.00 . A A .  40 LEU CD2  1 1 
        2  3534 1 1  40 LEU CG   C   8.221   2.831  11.474 1.00 . A A .  40 LEU CG   1 1 
        2  3535 1 1  40 LEU H    H   7.408   5.237   8.310 1.00 . A A .  40 LEU H    1 1 
        2  3536 1 1  40 LEU HA   H   6.020   4.533  10.653 1.00 . A A .  40 LEU HA   1 1 
        2  3537 1 1  40 LEU HB2  H   7.528   3.009   9.447 1.00 . A A .  40 LEU HB2  1 1 
        2  3538 1 1  40 LEU HB3  H   8.905   4.030   9.824 1.00 . A A .  40 LEU HB3  1 1 
        2  3539 1 1  40 LEU HD11 H   7.121   1.749  12.960 1.00 . A A .  40 LEU HD11 1 1 
        2  3540 1 1  40 LEU HD12 H   6.399   1.683  11.355 1.00 . A A .  40 LEU HD12 1 1 
        2  3541 1 1  40 LEU HD13 H   6.273   3.153  12.327 1.00 . A A .  40 LEU HD13 1 1 
        2  3542 1 1  40 LEU HD21 H  10.130   2.070  10.800 1.00 . A A .  40 LEU HD21 1 1 
        2  3543 1 1  40 LEU HD22 H   8.767   1.007  10.439 1.00 . A A .  40 LEU HD22 1 1 
        2  3544 1 1  40 LEU HD23 H   9.396   1.115  12.086 1.00 . A A .  40 LEU HD23 1 1 
        2  3545 1 1  40 LEU HG   H   8.682   3.466  12.222 1.00 . A A .  40 LEU HG   1 1 
        2  3546 1 1  40 LEU N    N   6.860   5.549   9.056 1.00 . A A .  40 LEU N    1 1 
        2  3547 1 1  40 LEU O    O   6.900   6.072  12.440 1.00 . A A .  40 LEU O    1 1 
        2  3548 1 1  41 LYS C    C   8.652   8.684  12.272 1.00 . A A .  41 LYS C    1 1 
        2  3549 1 1  41 LYS CA   C   9.394   7.340  12.104 1.00 . A A .  41 LYS CA   1 1 
        2  3550 1 1  41 LYS CB   C  10.867   7.555  11.671 1.00 . A A .  41 LYS CB   1 1 
        2  3551 1 1  41 LYS CD   C  13.202   8.433  12.349 1.00 . A A .  41 LYS CD   1 1 
        2  3552 1 1  41 LYS CE   C  13.810   7.100  12.828 1.00 . A A .  41 LYS CE   1 1 
        2  3553 1 1  41 LYS CG   C  11.675   8.516  12.575 1.00 . A A .  41 LYS CG   1 1 
        2  3554 1 1  41 LYS H    H   9.135   6.299  10.268 1.00 . A A .  41 LYS H    1 1 
        2  3555 1 1  41 LYS HA   H   9.395   6.835  13.067 1.00 . A A .  41 LYS HA   1 1 
        2  3556 1 1  41 LYS HB2  H  11.362   6.591  11.663 1.00 . A A .  41 LYS HB2  1 1 
        2  3557 1 1  41 LYS HB3  H  10.877   7.951  10.658 1.00 . A A .  41 LYS HB3  1 1 
        2  3558 1 1  41 LYS HD2  H  13.403   8.550  11.292 1.00 . A A .  41 LYS HD2  1 1 
        2  3559 1 1  41 LYS HD3  H  13.679   9.248  12.887 1.00 . A A .  41 LYS HD3  1 1 
        2  3560 1 1  41 LYS HE2  H  13.306   6.280  12.335 1.00 . A A .  41 LYS HE2  1 1 
        2  3561 1 1  41 LYS HE3  H  14.859   7.080  12.563 1.00 . A A .  41 LYS HE3  1 1 
        2  3562 1 1  41 LYS HG2  H  11.351   9.532  12.373 1.00 . A A .  41 LYS HG2  1 1 
        2  3563 1 1  41 LYS HG3  H  11.460   8.285  13.613 1.00 . A A .  41 LYS HG3  1 1 
        2  3564 1 1  41 LYS HZ1  H  12.695   6.964  14.599 1.00 . A A .  41 LYS HZ1  1 1 
        2  3565 1 1  41 LYS HZ2  H  14.222   7.660  14.801 1.00 . A A .  41 LYS HZ2  1 1 
        2  3566 1 1  41 LYS HZ3  H  14.078   5.991  14.585 1.00 . A A .  41 LYS HZ3  1 1 
        2  3567 1 1  41 LYS N    N   8.713   6.456  11.144 1.00 . A A .  41 LYS N    1 1 
        2  3568 1 1  41 LYS NZ   N  13.692   6.915  14.305 1.00 . A A .  41 LYS NZ   1 1 
        2  3569 1 1  41 LYS O    O   8.602   9.239  13.384 1.00 . A A .  41 LYS O    1 1 
        2  3570 1 1  42 THR C    C   6.068  10.439  11.984 1.00 . A A .  42 THR C    1 1 
        2  3571 1 1  42 THR CA   C   7.374  10.491  11.164 1.00 . A A .  42 THR CA   1 1 
        2  3572 1 1  42 THR CB   C   7.087  10.970   9.697 1.00 . A A .  42 THR CB   1 1 
        2  3573 1 1  42 THR CG2  C   6.361  12.328   9.633 1.00 . A A .  42 THR CG2  1 1 
        2  3574 1 1  42 THR H    H   8.057   8.650  10.352 1.00 . A A .  42 THR H    1 1 
        2  3575 1 1  42 THR HA   H   8.045  11.214  11.626 1.00 . A A .  42 THR HA   1 1 
        2  3576 1 1  42 THR HB   H   6.470  10.223   9.207 1.00 . A A .  42 THR HB   1 1 
        2  3577 1 1  42 THR HG1  H   8.538  10.238   8.574 1.00 . A A .  42 THR HG1  1 1 
        2  3578 1 1  42 THR HG21 H   6.967  13.090  10.100 1.00 . A A .  42 THR HG21 1 1 
        2  3579 1 1  42 THR HG22 H   5.410  12.261  10.150 1.00 . A A .  42 THR HG22 1 1 
        2  3580 1 1  42 THR HG23 H   6.182  12.596   8.598 1.00 . A A .  42 THR HG23 1 1 
        2  3581 1 1  42 THR N    N   8.054   9.185  11.175 1.00 . A A .  42 THR N    1 1 
        2  3582 1 1  42 THR O    O   5.767  11.372  12.736 1.00 . A A .  42 THR O    1 1 
        2  3583 1 1  42 THR OG1  O   8.325  11.080   8.977 1.00 . A A .  42 THR OG1  1 1 
        2  3584 1 1  43 TYR C    C   4.099   8.484  13.863 1.00 . A A .  43 TYR C    1 1 
        2  3585 1 1  43 TYR CA   C   3.986   9.211  12.513 1.00 . A A .  43 TYR CA   1 1 
        2  3586 1 1  43 TYR CB   C   2.971   8.515  11.577 1.00 . A A .  43 TYR CB   1 1 
        2  3587 1 1  43 TYR CD1  C   2.873  10.646  10.116 1.00 . A A .  43 TYR CD1  1 1 
        2  3588 1 1  43 TYR CD2  C   2.316   8.565   9.095 1.00 . A A .  43 TYR CD2  1 1 
        2  3589 1 1  43 TYR CE1  C   2.646  11.297   8.916 1.00 . A A .  43 TYR CE1  1 1 
        2  3590 1 1  43 TYR CE2  C   2.090   9.217   7.897 1.00 . A A .  43 TYR CE2  1 1 
        2  3591 1 1  43 TYR CG   C   2.715   9.258  10.238 1.00 . A A .  43 TYR CG   1 1 
        2  3592 1 1  43 TYR CZ   C   2.256  10.579   7.812 1.00 . A A .  43 TYR CZ   1 1 
        2  3593 1 1  43 TYR H    H   5.615   8.605  11.266 1.00 . A A .  43 TYR H    1 1 
        2  3594 1 1  43 TYR HA   H   3.616  10.219  12.712 1.00 . A A .  43 TYR HA   1 1 
        2  3595 1 1  43 TYR HB2  H   3.334   7.518  11.345 1.00 . A A .  43 TYR HB2  1 1 
        2  3596 1 1  43 TYR HB3  H   2.019   8.427  12.087 1.00 . A A .  43 TYR HB3  1 1 
        2  3597 1 1  43 TYR HD1  H   3.183  11.220  10.981 1.00 . A A .  43 TYR HD1  1 1 
        2  3598 1 1  43 TYR HD2  H   2.182   7.496   9.150 1.00 . A A .  43 TYR HD2  1 1 
        2  3599 1 1  43 TYR HE1  H   2.776  12.371   8.849 1.00 . A A .  43 TYR HE1  1 1 
        2  3600 1 1  43 TYR HE2  H   1.782   8.652   7.027 1.00 . A A .  43 TYR HE2  1 1 
        2  3601 1 1  43 TYR HH   H   2.775  11.812   6.419 1.00 . A A .  43 TYR HH   1 1 
        2  3602 1 1  43 TYR N    N   5.298   9.342  11.844 1.00 . A A .  43 TYR N    1 1 
        2  3603 1 1  43 TYR O    O   3.541   8.945  14.871 1.00 . A A .  43 TYR O    1 1 
        2  3604 1 1  43 TYR OH   O   2.031  11.231   6.615 1.00 . A A .  43 TYR OH   1 1 
        2  3605 1 1  44 PHE C    C   6.262   7.100  15.884 1.00 . A A .  44 PHE C    1 1 
        2  3606 1 1  44 PHE CA   C   5.013   6.590  15.152 1.00 . A A .  44 PHE CA   1 1 
        2  3607 1 1  44 PHE CB   C   5.057   5.061  14.876 1.00 . A A .  44 PHE CB   1 1 
        2  3608 1 1  44 PHE CD1  C   2.514   5.071  14.613 1.00 . A A .  44 PHE CD1  1 1 
        2  3609 1 1  44 PHE CD2  C   3.751   3.326  13.539 1.00 . A A .  44 PHE CD2  1 1 
        2  3610 1 1  44 PHE CE1  C   1.340   4.540  14.126 1.00 . A A .  44 PHE CE1  1 1 
        2  3611 1 1  44 PHE CE2  C   2.573   2.797  13.053 1.00 . A A .  44 PHE CE2  1 1 
        2  3612 1 1  44 PHE CG   C   3.748   4.475  14.329 1.00 . A A .  44 PHE CG   1 1 
        2  3613 1 1  44 PHE CZ   C   1.370   3.407  13.348 1.00 . A A .  44 PHE CZ   1 1 
        2  3614 1 1  44 PHE H    H   5.230   7.019  13.076 1.00 . A A .  44 PHE H    1 1 
        2  3615 1 1  44 PHE HA   H   4.154   6.787  15.799 1.00 . A A .  44 PHE HA   1 1 
        2  3616 1 1  44 PHE HB2  H   5.840   4.860  14.153 1.00 . A A .  44 PHE HB2  1 1 
        2  3617 1 1  44 PHE HB3  H   5.287   4.538  15.794 1.00 . A A .  44 PHE HB3  1 1 
        2  3618 1 1  44 PHE HD1  H   2.478   5.964  15.225 1.00 . A A .  44 PHE HD1  1 1 
        2  3619 1 1  44 PHE HD2  H   4.691   2.843  13.304 1.00 . A A .  44 PHE HD2  1 1 
        2  3620 1 1  44 PHE HE1  H   0.393   5.015  14.354 1.00 . A A .  44 PHE HE1  1 1 
        2  3621 1 1  44 PHE HE2  H   2.591   1.903  12.441 1.00 . A A .  44 PHE HE2  1 1 
        2  3622 1 1  44 PHE HZ   H   0.446   2.993  12.968 1.00 . A A .  44 PHE HZ   1 1 
        2  3623 1 1  44 PHE N    N   4.817   7.353  13.901 1.00 . A A .  44 PHE N    1 1 
        2  3624 1 1  44 PHE O    O   7.302   6.445  15.933 1.00 . A A .  44 PHE O    1 1 
        2  3625 1 1  45 SER C    C   7.037   8.647  18.688 1.00 . A A .  45 SER C    1 1 
        2  3626 1 1  45 SER CA   C   7.180   9.002  17.197 1.00 . A A .  45 SER CA   1 1 
        2  3627 1 1  45 SER CB   C   7.063  10.517  16.970 1.00 . A A .  45 SER CB   1 1 
        2  3628 1 1  45 SER H    H   5.252   8.752  16.377 1.00 . A A .  45 SER H    1 1 
        2  3629 1 1  45 SER HA   H   8.152   8.662  16.844 1.00 . A A .  45 SER HA   1 1 
        2  3630 1 1  45 SER HB2  H   6.144  10.883  17.404 1.00 . A A .  45 SER HB2  1 1 
        2  3631 1 1  45 SER HB3  H   7.905  11.022  17.430 1.00 . A A .  45 SER HB3  1 1 
        2  3632 1 1  45 SER HG   H   7.162   9.997  15.070 1.00 . A A .  45 SER HG   1 1 
        2  3633 1 1  45 SER N    N   6.129   8.319  16.424 1.00 . A A .  45 SER N    1 1 
        2  3634 1 1  45 SER O    O   7.981   8.775  19.473 1.00 . A A .  45 SER O    1 1 
        2  3635 1 1  45 SER OG   O   7.056  10.817  15.577 1.00 . A A .  45 SER OG   1 1 
        2  3636 1 1  46 ASP C    C   6.239   6.316  20.568 1.00 . A A .  46 ASP C    1 1 
        2  3637 1 1  46 ASP CA   C   5.476   7.634  20.360 1.00 . A A .  46 ASP CA   1 1 
        2  3638 1 1  46 ASP CB   C   3.937   7.395  20.450 1.00 . A A .  46 ASP CB   1 1 
        2  3639 1 1  46 ASP CG   C   3.363   6.574  19.261 1.00 . A A .  46 ASP CG   1 1 
        2  3640 1 1  46 ASP H    H   5.088   8.328  18.398 1.00 . A A .  46 ASP H    1 1 
        2  3641 1 1  46 ASP HA   H   5.776   8.338  21.134 1.00 . A A .  46 ASP HA   1 1 
        2  3642 1 1  46 ASP HB2  H   3.707   6.880  21.382 1.00 . A A .  46 ASP HB2  1 1 
        2  3643 1 1  46 ASP HB3  H   3.435   8.359  20.472 1.00 . A A .  46 ASP HB3  1 1 
        2  3644 1 1  46 ASP N    N   5.812   8.232  19.052 1.00 . A A .  46 ASP N    1 1 
        2  3645 1 1  46 ASP O    O   6.568   5.946  21.704 1.00 . A A .  46 ASP O    1 1 
        2  3646 1 1  46 ASP OD1  O   3.299   7.121  18.134 1.00 . A A .  46 ASP OD1  1 1 
        2  3647 1 1  46 ASP OD2  O   2.964   5.402  19.442 1.00 . A A .  46 ASP OD2  1 1 
        2  3648 1 1  47 VAL C    C   8.784   4.798  19.320 1.00 . A A .  47 VAL C    1 1 
        2  3649 1 1  47 VAL CA   C   7.312   4.395  19.444 1.00 . A A .  47 VAL CA   1 1 
        2  3650 1 1  47 VAL CB   C   6.899   3.453  18.245 1.00 . A A .  47 VAL CB   1 1 
        2  3651 1 1  47 VAL CG1  C   7.617   2.088  18.316 1.00 . A A .  47 VAL CG1  1 1 
        2  3652 1 1  47 VAL CG2  C   5.365   3.279  18.177 1.00 . A A .  47 VAL CG2  1 1 
        2  3653 1 1  47 VAL H    H   6.225   5.979  18.585 1.00 . A A .  47 VAL H    1 1 
        2  3654 1 1  47 VAL HA   H   7.148   3.858  20.384 1.00 . A A .  47 VAL HA   1 1 
        2  3655 1 1  47 VAL HB   H   7.213   3.938  17.320 1.00 . A A .  47 VAL HB   1 1 
        2  3656 1 1  47 VAL HG11 H   7.333   1.481  17.465 1.00 . A A .  47 VAL HG11 1 1 
        2  3657 1 1  47 VAL HG12 H   7.339   1.576  19.228 1.00 . A A .  47 VAL HG12 1 1 
        2  3658 1 1  47 VAL HG13 H   8.691   2.238  18.305 1.00 . A A .  47 VAL HG13 1 1 
        2  3659 1 1  47 VAL HG21 H   4.894   4.248  18.058 1.00 . A A .  47 VAL HG21 1 1 
        2  3660 1 1  47 VAL HG22 H   5.008   2.820  19.088 1.00 . A A .  47 VAL HG22 1 1 
        2  3661 1 1  47 VAL HG23 H   5.101   2.652  17.333 1.00 . A A .  47 VAL HG23 1 1 
        2  3662 1 1  47 VAL N    N   6.525   5.623  19.451 1.00 . A A .  47 VAL N    1 1 
        2  3663 1 1  47 VAL O    O   9.201   5.257  18.257 1.00 . A A .  47 VAL O    1 1 
        2  3664 1 1  48 LYS C    C  11.813   3.959  19.690 1.00 . A A .  48 LYS C    1 1 
        2  3665 1 1  48 LYS CA   C  10.987   5.017  20.447 1.00 . A A .  48 LYS CA   1 1 
        2  3666 1 1  48 LYS CB   C  11.487   5.192  21.911 1.00 . A A .  48 LYS CB   1 1 
        2  3667 1 1  48 LYS CD   C  11.521   6.711  24.047 1.00 . A A .  48 LYS CD   1 1 
        2  3668 1 1  48 LYS CE   C  10.625   6.060  25.118 1.00 . A A .  48 LYS CE   1 1 
        2  3669 1 1  48 LYS CG   C  11.009   6.513  22.581 1.00 . A A .  48 LYS CG   1 1 
        2  3670 1 1  48 LYS H    H   9.122   4.409  21.258 1.00 . A A .  48 LYS H    1 1 
        2  3671 1 1  48 LYS HA   H  11.115   5.966  19.929 1.00 . A A .  48 LYS HA   1 1 
        2  3672 1 1  48 LYS HB2  H  11.135   4.351  22.508 1.00 . A A .  48 LYS HB2  1 1 
        2  3673 1 1  48 LYS HB3  H  12.573   5.184  21.918 1.00 . A A .  48 LYS HB3  1 1 
        2  3674 1 1  48 LYS HD2  H  12.512   6.285  24.133 1.00 . A A .  48 LYS HD2  1 1 
        2  3675 1 1  48 LYS HD3  H  11.584   7.777  24.254 1.00 . A A .  48 LYS HD3  1 1 
        2  3676 1 1  48 LYS HE2  H  10.999   6.329  26.094 1.00 . A A .  48 LYS HE2  1 1 
        2  3677 1 1  48 LYS HE3  H   9.617   6.449  25.012 1.00 . A A .  48 LYS HE3  1 1 
        2  3678 1 1  48 LYS HG2  H  11.359   7.346  21.979 1.00 . A A .  48 LYS HG2  1 1 
        2  3679 1 1  48 LYS HG3  H   9.923   6.526  22.584 1.00 . A A .  48 LYS HG3  1 1 
        2  3680 1 1  48 LYS HZ1  H   9.941   4.197  25.759 1.00 . A A .  48 LYS HZ1  1 1 
        2  3681 1 1  48 LYS HZ2  H  11.523   4.176  25.173 1.00 . A A .  48 LYS HZ2  1 1 
        2  3682 1 1  48 LYS HZ3  H  10.227   4.281  24.097 1.00 . A A .  48 LYS HZ3  1 1 
        2  3683 1 1  48 LYS N    N   9.543   4.698  20.426 1.00 . A A .  48 LYS N    1 1 
        2  3684 1 1  48 LYS NZ   N  10.577   4.575  25.030 1.00 . A A .  48 LYS NZ   1 1 
        2  3685 1 1  48 LYS O    O  12.980   4.213  19.374 1.00 . A A .  48 LYS O    1 1 
        2  3686 1 1  49 PHE C    C  12.710   0.800  19.298 1.00 . A A .  49 PHE C    1 1 
        2  3687 1 1  49 PHE CA   C  11.690   1.698  18.563 1.00 . A A .  49 PHE CA   1 1 
        2  3688 1 1  49 PHE CB   C  12.256   2.218  17.197 1.00 . A A .  49 PHE CB   1 1 
        2  3689 1 1  49 PHE CD1  C  10.174   2.270  15.726 1.00 . A A .  49 PHE CD1  1 1 
        2  3690 1 1  49 PHE CD2  C  11.282   4.350  16.149 1.00 . A A .  49 PHE CD2  1 1 
        2  3691 1 1  49 PHE CE1  C   9.231   2.932  14.968 1.00 . A A .  49 PHE CE1  1 1 
        2  3692 1 1  49 PHE CE2  C  10.330   5.010  15.384 1.00 . A A .  49 PHE CE2  1 1 
        2  3693 1 1  49 PHE CG   C  11.221   2.961  16.336 1.00 . A A .  49 PHE CG   1 1 
        2  3694 1 1  49 PHE CZ   C   9.305   4.299  14.799 1.00 . A A .  49 PHE CZ   1 1 
        2  3695 1 1  49 PHE H    H  10.343   2.616  19.914 1.00 . A A .  49 PHE H    1 1 
        2  3696 1 1  49 PHE HA   H  10.822   1.086  18.338 1.00 . A A .  49 PHE HA   1 1 
        2  3697 1 1  49 PHE HB2  H  13.086   2.886  17.392 1.00 . A A .  49 PHE HB2  1 1 
        2  3698 1 1  49 PHE HB3  H  12.620   1.373  16.620 1.00 . A A .  49 PHE HB3  1 1 
        2  3699 1 1  49 PHE HD1  H  10.101   1.195  15.854 1.00 . A A .  49 PHE HD1  1 1 
        2  3700 1 1  49 PHE HD2  H  12.087   4.913  16.607 1.00 . A A .  49 PHE HD2  1 1 
        2  3701 1 1  49 PHE HE1  H   8.422   2.377  14.507 1.00 . A A .  49 PHE HE1  1 1 
        2  3702 1 1  49 PHE HE2  H  10.373   6.088  15.263 1.00 . A A .  49 PHE HE2  1 1 
        2  3703 1 1  49 PHE HZ   H   8.560   4.812  14.200 1.00 . A A .  49 PHE HZ   1 1 
        2  3704 1 1  49 PHE N    N  11.182   2.783  19.436 1.00 . A A .  49 PHE N    1 1 
        2  3705 1 1  49 PHE O    O  13.693   1.286  19.865 1.00 . A A .  49 PHE O    1 1 
        2  3706 1 1  50 ASN C    C  13.402  -2.733  18.890 1.00 . A A .  50 ASN C    1 1 
        2  3707 1 1  50 ASN CA   C  13.269  -1.575  19.892 1.00 . A A .  50 ASN CA   1 1 
        2  3708 1 1  50 ASN CB   C  12.590  -2.052  21.208 1.00 . A A .  50 ASN CB   1 1 
        2  3709 1 1  50 ASN CG   C  13.306  -3.219  21.912 1.00 . A A .  50 ASN CG   1 1 
        2  3710 1 1  50 ASN H    H  11.651  -0.807  18.760 1.00 . A A .  50 ASN H    1 1 
        2  3711 1 1  50 ASN HA   H  14.256  -1.170  20.115 1.00 . A A .  50 ASN HA   1 1 
        2  3712 1 1  50 ASN HB2  H  12.558  -1.222  21.902 1.00 . A A .  50 ASN HB2  1 1 
        2  3713 1 1  50 ASN HB3  H  11.574  -2.355  20.986 1.00 . A A .  50 ASN HB3  1 1 
        2  3714 1 1  50 ASN HD21 H  11.576  -3.922  22.599 1.00 . A A .  50 ASN HD21 1 1 
        2  3715 1 1  50 ASN HD22 H  12.983  -4.826  23.035 1.00 . A A .  50 ASN HD22 1 1 
        2  3716 1 1  50 ASN N    N  12.447  -0.519  19.258 1.00 . A A .  50 ASN N    1 1 
        2  3717 1 1  50 ASN ND2  N  12.544  -4.074  22.582 1.00 . A A .  50 ASN ND2  1 1 
        2  3718 1 1  50 ASN O    O  12.471  -2.958  18.129 1.00 . A A .  50 ASN O    1 1 
        2  3719 1 1  50 ASN OD1  O  14.533  -3.353  21.857 1.00 . A A .  50 ASN OD1  1 1 
        2  3720 1 1  51 ARG C    C  13.774  -5.394  17.475 1.00 . A A .  51 ARG C    1 1 
        2  3721 1 1  51 ARG CA   C  14.935  -4.460  17.890 1.00 . A A .  51 ARG CA   1 1 
        2  3722 1 1  51 ARG CB   C  16.135  -5.337  18.376 1.00 . A A .  51 ARG CB   1 1 
        2  3723 1 1  51 ARG CD   C  17.954  -3.534  18.066 1.00 . A A .  51 ARG CD   1 1 
        2  3724 1 1  51 ARG CG   C  17.318  -4.572  19.004 1.00 . A A .  51 ARG CG   1 1 
        2  3725 1 1  51 ARG CZ   C  19.371  -1.523  18.573 1.00 . A A .  51 ARG CZ   1 1 
        2  3726 1 1  51 ARG H    H  15.130  -3.358  19.714 1.00 . A A .  51 ARG H    1 1 
        2  3727 1 1  51 ARG HA   H  15.252  -3.891  17.023 1.00 . A A .  51 ARG HA   1 1 
        2  3728 1 1  51 ARG HB2  H  15.771  -6.048  19.115 1.00 . A A .  51 ARG HB2  1 1 
        2  3729 1 1  51 ARG HB3  H  16.512  -5.902  17.530 1.00 . A A .  51 ARG HB3  1 1 
        2  3730 1 1  51 ARG HD2  H  18.363  -4.039  17.196 1.00 . A A .  51 ARG HD2  1 1 
        2  3731 1 1  51 ARG HD3  H  17.196  -2.826  17.747 1.00 . A A .  51 ARG HD3  1 1 
        2  3732 1 1  51 ARG HE   H  19.556  -3.330  19.414 1.00 . A A .  51 ARG HE   1 1 
        2  3733 1 1  51 ARG HG2  H  16.966  -4.062  19.892 1.00 . A A .  51 ARG HG2  1 1 
        2  3734 1 1  51 ARG HG3  H  18.078  -5.289  19.295 1.00 . A A .  51 ARG HG3  1 1 
        2  3735 1 1  51 ARG HH11 H  17.957  -1.135  17.171 1.00 . A A .  51 ARG HH11 1 1 
        2  3736 1 1  51 ARG HH12 H  18.976   0.204  17.583 1.00 . A A .  51 ARG HH12 1 1 
        2  3737 1 1  51 ARG HH21 H  20.875  -1.574  19.929 1.00 . A A .  51 ARG HH21 1 1 
        2  3738 1 1  51 ARG HH22 H  20.629  -0.043  19.146 1.00 . A A .  51 ARG HH22 1 1 
        2  3739 1 1  51 ARG N    N  14.538  -3.476  18.936 1.00 . A A .  51 ARG N    1 1 
        2  3740 1 1  51 ARG NE   N  19.038  -2.810  18.755 1.00 . A A .  51 ARG NE   1 1 
        2  3741 1 1  51 ARG NH1  N  18.715  -0.758  17.705 1.00 . A A .  51 ARG NH1  1 1 
        2  3742 1 1  51 ARG NH2  N  20.370  -1.006  19.274 1.00 . A A .  51 ARG NH2  1 1 
        2  3743 1 1  51 ARG O    O  13.344  -5.372  16.323 1.00 . A A .  51 ARG O    1 1 
        2  3744 1 1  52 CYS C    C  10.900  -6.591  17.700 1.00 . A A .  52 CYS C    1 1 
        2  3745 1 1  52 CYS CA   C  12.215  -7.174  18.261 1.00 . A A .  52 CYS CA   1 1 
        2  3746 1 1  52 CYS CB   C  11.958  -7.893  19.603 1.00 . A A .  52 CYS CB   1 1 
        2  3747 1 1  52 CYS H    H  13.575  -5.993  19.376 1.00 . A A .  52 CYS H    1 1 
        2  3748 1 1  52 CYS HA   H  12.606  -7.896  17.550 1.00 . A A .  52 CYS HA   1 1 
        2  3749 1 1  52 CYS HB2  H  11.154  -8.610  19.486 1.00 . A A .  52 CYS HB2  1 1 
        2  3750 1 1  52 CYS HB3  H  12.856  -8.417  19.900 1.00 . A A .  52 CYS HB3  1 1 
        2  3751 1 1  52 CYS HG   H  10.819  -7.494  21.844 1.00 . A A .  52 CYS HG   1 1 
        2  3752 1 1  52 CYS N    N  13.249  -6.141  18.461 1.00 . A A .  52 CYS N    1 1 
        2  3753 1 1  52 CYS O    O  10.419  -7.026  16.639 1.00 . A A .  52 CYS O    1 1 
        2  3754 1 1  52 CYS SG   S  11.501  -6.783  20.961 1.00 . A A .  52 CYS SG   1 1 
        2  3755 1 1  53 ILE C    C   9.074  -4.140  16.777 1.00 . A A .  53 ILE C    1 1 
        2  3756 1 1  53 ILE CA   C   9.035  -4.999  18.061 1.00 . A A .  53 ILE CA   1 1 
        2  3757 1 1  53 ILE CB   C   8.430  -4.159  19.253 1.00 . A A .  53 ILE CB   1 1 
        2  3758 1 1  53 ILE CD1  C   8.704  -1.948  20.592 1.00 . A A .  53 ILE CD1  1 1 
        2  3759 1 1  53 ILE CG1  C   9.288  -2.889  19.547 1.00 . A A .  53 ILE CG1  1 1 
        2  3760 1 1  53 ILE CG2  C   8.284  -5.035  20.527 1.00 . A A .  53 ILE CG2  1 1 
        2  3761 1 1  53 ILE H    H  10.838  -5.211  19.167 1.00 . A A .  53 ILE H    1 1 
        2  3762 1 1  53 ILE HA   H   8.360  -5.835  17.878 1.00 . A A .  53 ILE HA   1 1 
        2  3763 1 1  53 ILE HB   H   7.430  -3.845  18.960 1.00 . A A .  53 ILE HB   1 1 
        2  3764 1 1  53 ILE HD11 H   9.368  -1.105  20.718 1.00 . A A .  53 ILE HD11 1 1 
        2  3765 1 1  53 ILE HD12 H   8.600  -2.464  21.536 1.00 . A A .  53 ILE HD12 1 1 
        2  3766 1 1  53 ILE HD13 H   7.736  -1.594  20.264 1.00 . A A .  53 ILE HD13 1 1 
        2  3767 1 1  53 ILE HG12 H  10.265  -3.192  19.892 1.00 . A A .  53 ILE HG12 1 1 
        2  3768 1 1  53 ILE HG13 H   9.405  -2.323  18.631 1.00 . A A .  53 ILE HG13 1 1 
        2  3769 1 1  53 ILE HG21 H   9.259  -5.388  20.840 1.00 . A A .  53 ILE HG21 1 1 
        2  3770 1 1  53 ILE HG22 H   7.646  -5.887  20.324 1.00 . A A .  53 ILE HG22 1 1 
        2  3771 1 1  53 ILE HG23 H   7.846  -4.450  21.328 1.00 . A A .  53 ILE HG23 1 1 
        2  3772 1 1  53 ILE N    N  10.350  -5.574  18.395 1.00 . A A .  53 ILE N    1 1 
        2  3773 1 1  53 ILE O    O   8.064  -4.030  16.096 1.00 . A A .  53 ILE O    1 1 
        2  3774 1 1  54 THR C    C  10.661  -3.606  14.028 1.00 . A A .  54 THR C    1 1 
        2  3775 1 1  54 THR CA   C  10.392  -2.716  15.251 1.00 . A A .  54 THR CA   1 1 
        2  3776 1 1  54 THR CB   C  11.508  -1.637  15.433 1.00 . A A .  54 THR CB   1 1 
        2  3777 1 1  54 THR CG2  C  11.612  -0.681  14.227 1.00 . A A .  54 THR CG2  1 1 
        2  3778 1 1  54 THR H    H  11.007  -3.676  17.041 1.00 . A A .  54 THR H    1 1 
        2  3779 1 1  54 THR HA   H   9.447  -2.194  15.091 1.00 . A A .  54 THR HA   1 1 
        2  3780 1 1  54 THR HB   H  12.461  -2.141  15.564 1.00 . A A .  54 THR HB   1 1 
        2  3781 1 1  54 THR HG1  H  10.352  -0.490  16.554 1.00 . A A .  54 THR HG1  1 1 
        2  3782 1 1  54 THR HG21 H  11.844  -1.246  13.332 1.00 . A A .  54 THR HG21 1 1 
        2  3783 1 1  54 THR HG22 H  12.397   0.043  14.407 1.00 . A A .  54 THR HG22 1 1 
        2  3784 1 1  54 THR HG23 H  10.674  -0.161  14.086 1.00 . A A .  54 THR HG23 1 1 
        2  3785 1 1  54 THR N    N  10.236  -3.547  16.456 1.00 . A A .  54 THR N    1 1 
        2  3786 1 1  54 THR O    O  10.240  -3.272  12.933 1.00 . A A .  54 THR O    1 1 
        2  3787 1 1  54 THR OG1  O  11.229  -0.873  16.621 1.00 . A A .  54 THR OG1  1 1 
        2  3788 1 1  55 SER C    C  10.018  -6.361  12.904 1.00 . A A .  55 SER C    1 1 
        2  3789 1 1  55 SER CA   C  11.426  -5.806  13.188 1.00 . A A .  55 SER CA   1 1 
        2  3790 1 1  55 SER CB   C  12.372  -6.945  13.625 1.00 . A A .  55 SER CB   1 1 
        2  3791 1 1  55 SER H    H  11.798  -4.900  15.086 1.00 . A A .  55 SER H    1 1 
        2  3792 1 1  55 SER HA   H  11.816  -5.347  12.283 1.00 . A A .  55 SER HA   1 1 
        2  3793 1 1  55 SER HB2  H  12.006  -7.393  14.543 1.00 . A A .  55 SER HB2  1 1 
        2  3794 1 1  55 SER HB3  H  12.419  -7.700  12.850 1.00 . A A .  55 SER HB3  1 1 
        2  3795 1 1  55 SER HG   H  13.918  -6.590  14.778 1.00 . A A .  55 SER HG   1 1 
        2  3796 1 1  55 SER N    N  11.341  -4.756  14.229 1.00 . A A .  55 SER N    1 1 
        2  3797 1 1  55 SER O    O   9.664  -6.611  11.753 1.00 . A A .  55 SER O    1 1 
        2  3798 1 1  55 SER OG   O  13.684  -6.454  13.856 1.00 . A A .  55 SER OG   1 1 
        2  3799 1 1  56 GLN C    C   6.935  -5.914  13.221 1.00 . A A .  56 GLN C    1 1 
        2  3800 1 1  56 GLN CA   C   7.823  -6.962  13.928 1.00 . A A .  56 GLN CA   1 1 
        2  3801 1 1  56 GLN CB   C   7.314  -7.263  15.368 1.00 . A A .  56 GLN CB   1 1 
        2  3802 1 1  56 GLN CD   C   5.556  -9.076  14.708 1.00 . A A .  56 GLN CD   1 1 
        2  3803 1 1  56 GLN CG   C   5.859  -7.786  15.488 1.00 . A A .  56 GLN CG   1 1 
        2  3804 1 1  56 GLN H    H   9.619  -6.341  14.874 1.00 . A A .  56 GLN H    1 1 
        2  3805 1 1  56 GLN HA   H   7.799  -7.885  13.350 1.00 . A A .  56 GLN HA   1 1 
        2  3806 1 1  56 GLN HB2  H   7.969  -8.011  15.807 1.00 . A A .  56 GLN HB2  1 1 
        2  3807 1 1  56 GLN HB3  H   7.397  -6.358  15.960 1.00 . A A .  56 GLN HB3  1 1 
        2  3808 1 1  56 GLN HE21 H   7.453  -9.702  14.816 1.00 . A A .  56 GLN HE21 1 1 
        2  3809 1 1  56 GLN HE22 H   6.350 -10.753  14.004 1.00 . A A .  56 GLN HE22 1 1 
        2  3810 1 1  56 GLN HG2  H   5.648  -7.981  16.532 1.00 . A A .  56 GLN HG2  1 1 
        2  3811 1 1  56 GLN HG3  H   5.185  -7.011  15.140 1.00 . A A .  56 GLN HG3  1 1 
        2  3812 1 1  56 GLN N    N   9.227  -6.518  13.989 1.00 . A A .  56 GLN N    1 1 
        2  3813 1 1  56 GLN NE2  N   6.553  -9.926  14.483 1.00 . A A .  56 GLN NE2  1 1 
        2  3814 1 1  56 GLN O    O   6.084  -6.276  12.413 1.00 . A A .  56 GLN O    1 1 
        2  3815 1 1  56 GLN OE1  O   4.418  -9.307  14.293 1.00 . A A .  56 GLN OE1  1 1 
        2  3816 1 1  57 LEU C    C   6.711  -3.341  11.436 1.00 . A A .  57 LEU C    1 1 
        2  3817 1 1  57 LEU CA   C   6.408  -3.488  12.945 1.00 . A A .  57 LEU CA   1 1 
        2  3818 1 1  57 LEU CB   C   6.745  -2.165  13.722 1.00 . A A .  57 LEU CB   1 1 
        2  3819 1 1  57 LEU CD1  C   6.061   0.090  14.723 1.00 . A A .  57 LEU CD1  1 1 
        2  3820 1 1  57 LEU CD2  C   4.934  -0.702  12.585 1.00 . A A .  57 LEU CD2  1 1 
        2  3821 1 1  57 LEU CG   C   5.580  -1.133  13.921 1.00 . A A .  57 LEU CG   1 1 
        2  3822 1 1  57 LEU H    H   7.906  -4.412  14.134 1.00 . A A .  57 LEU H    1 1 
        2  3823 1 1  57 LEU HA   H   5.352  -3.713  13.075 1.00 . A A .  57 LEU HA   1 1 
        2  3824 1 1  57 LEU HB2  H   7.108  -2.441  14.708 1.00 . A A .  57 LEU HB2  1 1 
        2  3825 1 1  57 LEU HB3  H   7.560  -1.659  13.209 1.00 . A A .  57 LEU HB3  1 1 
        2  3826 1 1  57 LEU HD11 H   5.246   0.792  14.843 1.00 . A A .  57 LEU HD11 1 1 
        2  3827 1 1  57 LEU HD12 H   6.878   0.572  14.208 1.00 . A A .  57 LEU HD12 1 1 
        2  3828 1 1  57 LEU HD13 H   6.400  -0.230  15.699 1.00 . A A .  57 LEU HD13 1 1 
        2  3829 1 1  57 LEU HD21 H   5.688  -0.286  11.926 1.00 . A A .  57 LEU HD21 1 1 
        2  3830 1 1  57 LEU HD22 H   4.166   0.038  12.768 1.00 . A A .  57 LEU HD22 1 1 
        2  3831 1 1  57 LEU HD23 H   4.485  -1.564  12.108 1.00 . A A .  57 LEU HD23 1 1 
        2  3832 1 1  57 LEU HG   H   4.805  -1.608  14.514 1.00 . A A .  57 LEU HG   1 1 
        2  3833 1 1  57 LEU N    N   7.180  -4.619  13.510 1.00 . A A .  57 LEU N    1 1 
        2  3834 1 1  57 LEU O    O   5.808  -3.138  10.613 1.00 . A A .  57 LEU O    1 1 
        2  3835 1 1  58 ILE C    C   8.045  -4.679   8.954 1.00 . A A .  58 ILE C    1 1 
        2  3836 1 1  58 ILE CA   C   8.463  -3.396   9.703 1.00 . A A .  58 ILE CA   1 1 
        2  3837 1 1  58 ILE CB   C  10.017  -3.136   9.634 1.00 . A A .  58 ILE CB   1 1 
        2  3838 1 1  58 ILE CD1  C  11.815  -1.358  10.265 1.00 . A A .  58 ILE CD1  1 1 
        2  3839 1 1  58 ILE CG1  C  10.341  -1.725  10.234 1.00 . A A .  58 ILE CG1  1 1 
        2  3840 1 1  58 ILE CG2  C  10.576  -3.270   8.194 1.00 . A A .  58 ILE CG2  1 1 
        2  3841 1 1  58 ILE H    H   8.656  -3.595  11.799 1.00 . A A .  58 ILE H    1 1 
        2  3842 1 1  58 ILE HA   H   7.962  -2.552   9.226 1.00 . A A .  58 ILE HA   1 1 
        2  3843 1 1  58 ILE HB   H  10.506  -3.889  10.247 1.00 . A A .  58 ILE HB   1 1 
        2  3844 1 1  58 ILE HD11 H  12.357  -2.084  10.855 1.00 . A A .  58 ILE HD11 1 1 
        2  3845 1 1  58 ILE HD12 H  11.928  -0.381  10.709 1.00 . A A .  58 ILE HD12 1 1 
        2  3846 1 1  58 ILE HD13 H  12.209  -1.342   9.259 1.00 . A A .  58 ILE HD13 1 1 
        2  3847 1 1  58 ILE HG12 H   9.829  -0.965   9.661 1.00 . A A .  58 ILE HG12 1 1 
        2  3848 1 1  58 ILE HG13 H   9.980  -1.686  11.257 1.00 . A A .  58 ILE HG13 1 1 
        2  3849 1 1  58 ILE HG21 H  11.646  -3.110   8.197 1.00 . A A .  58 ILE HG21 1 1 
        2  3850 1 1  58 ILE HG22 H  10.109  -2.536   7.551 1.00 . A A .  58 ILE HG22 1 1 
        2  3851 1 1  58 ILE HG23 H  10.364  -4.262   7.812 1.00 . A A .  58 ILE HG23 1 1 
        2  3852 1 1  58 ILE N    N   7.999  -3.455  11.092 1.00 . A A .  58 ILE N    1 1 
        2  3853 1 1  58 ILE O    O   7.836  -4.638   7.755 1.00 . A A .  58 ILE O    1 1 
        2  3854 1 1  59 LYS C    C   5.819  -6.876   8.851 1.00 . A A .  59 LYS C    1 1 
        2  3855 1 1  59 LYS CA   C   7.323  -7.055   9.137 1.00 . A A .  59 LYS CA   1 1 
        2  3856 1 1  59 LYS CB   C   7.606  -8.252  10.099 1.00 . A A .  59 LYS CB   1 1 
        2  3857 1 1  59 LYS CD   C   5.751 -10.077   9.794 1.00 . A A .  59 LYS CD   1 1 
        2  3858 1 1  59 LYS CE   C   5.341 -10.018  11.270 1.00 . A A .  59 LYS CE   1 1 
        2  3859 1 1  59 LYS CG   C   7.233  -9.681   9.583 1.00 . A A .  59 LYS CG   1 1 
        2  3860 1 1  59 LYS H    H   8.165  -5.788  10.631 1.00 . A A .  59 LYS H    1 1 
        2  3861 1 1  59 LYS HA   H   7.830  -7.244   8.193 1.00 . A A .  59 LYS HA   1 1 
        2  3862 1 1  59 LYS HB2  H   8.668  -8.251  10.320 1.00 . A A .  59 LYS HB2  1 1 
        2  3863 1 1  59 LYS HB3  H   7.078  -8.076  11.031 1.00 . A A .  59 LYS HB3  1 1 
        2  3864 1 1  59 LYS HD2  H   5.120  -9.403   9.224 1.00 . A A .  59 LYS HD2  1 1 
        2  3865 1 1  59 LYS HD3  H   5.602 -11.088   9.428 1.00 . A A .  59 LYS HD3  1 1 
        2  3866 1 1  59 LYS HE2  H   5.939 -10.725  11.834 1.00 . A A .  59 LYS HE2  1 1 
        2  3867 1 1  59 LYS HE3  H   5.522  -9.018  11.652 1.00 . A A .  59 LYS HE3  1 1 
        2  3868 1 1  59 LYS HG2  H   7.451  -9.732   8.523 1.00 . A A .  59 LYS HG2  1 1 
        2  3869 1 1  59 LYS HG3  H   7.857 -10.407  10.094 1.00 . A A .  59 LYS HG3  1 1 
        2  3870 1 1  59 LYS HZ1  H   3.312  -9.746  10.866 1.00 . A A .  59 LYS HZ1  1 1 
        2  3871 1 1  59 LYS HZ2  H   3.631 -10.207  12.462 1.00 . A A .  59 LYS HZ2  1 1 
        2  3872 1 1  59 LYS HZ3  H   3.732 -11.340  11.218 1.00 . A A .  59 LYS HZ3  1 1 
        2  3873 1 1  59 LYS N    N   7.884  -5.801   9.690 1.00 . A A .  59 LYS N    1 1 
        2  3874 1 1  59 LYS NZ   N   3.906 -10.348  11.467 1.00 . A A .  59 LYS NZ   1 1 
        2  3875 1 1  59 LYS O    O   5.312  -7.443   7.889 1.00 . A A .  59 LYS O    1 1 
        2  3876 1 1  60 TRP C    C   3.631  -4.913   8.101 1.00 . A A .  60 TRP C    1 1 
        2  3877 1 1  60 TRP CA   C   3.713  -5.701   9.426 1.00 . A A .  60 TRP CA   1 1 
        2  3878 1 1  60 TRP CB   C   3.135  -4.840  10.586 1.00 . A A .  60 TRP CB   1 1 
        2  3879 1 1  60 TRP CD1  C   3.004  -6.890  12.158 1.00 . A A .  60 TRP CD1  1 1 
        2  3880 1 1  60 TRP CD2  C   2.795  -4.920  13.206 1.00 . A A .  60 TRP CD2  1 1 
        2  3881 1 1  60 TRP CE2  C   2.685  -5.943  14.155 1.00 . A A .  60 TRP CE2  1 1 
        2  3882 1 1  60 TRP CE3  C   2.686  -3.590  13.636 1.00 . A A .  60 TRP CE3  1 1 
        2  3883 1 1  60 TRP CG   C   3.000  -5.544  11.921 1.00 . A A .  60 TRP CG   1 1 
        2  3884 1 1  60 TRP CH2  C   2.369  -4.381  15.904 1.00 . A A .  60 TRP CH2  1 1 
        2  3885 1 1  60 TRP CZ2  C   2.477  -5.689  15.511 1.00 . A A .  60 TRP CZ2  1 1 
        2  3886 1 1  60 TRP CZ3  C   2.477  -3.335  14.980 1.00 . A A .  60 TRP CZ3  1 1 
        2  3887 1 1  60 TRP H    H   5.540  -5.781  10.528 1.00 . A A .  60 TRP H    1 1 
        2  3888 1 1  60 TRP HA   H   3.130  -6.611   9.336 1.00 . A A .  60 TRP HA   1 1 
        2  3889 1 1  60 TRP HB2  H   3.779  -3.983  10.738 1.00 . A A .  60 TRP HB2  1 1 
        2  3890 1 1  60 TRP HB3  H   2.149  -4.483  10.305 1.00 . A A .  60 TRP HB3  1 1 
        2  3891 1 1  60 TRP HD1  H   3.137  -7.647  11.393 1.00 . A A .  60 TRP HD1  1 1 
        2  3892 1 1  60 TRP HE1  H   2.798  -8.014  13.909 1.00 . A A .  60 TRP HE1  1 1 
        2  3893 1 1  60 TRP HE3  H   2.769  -2.766  12.936 1.00 . A A .  60 TRP HE3  1 1 
        2  3894 1 1  60 TRP HH2  H   2.204  -4.138  16.949 1.00 . A A .  60 TRP HH2  1 1 
        2  3895 1 1  60 TRP HZ2  H   2.391  -6.486  16.236 1.00 . A A .  60 TRP HZ2  1 1 
        2  3896 1 1  60 TRP HZ3  H   2.388  -2.311  15.328 1.00 . A A .  60 TRP HZ3  1 1 
        2  3897 1 1  60 TRP N    N   5.114  -6.092   9.695 1.00 . A A .  60 TRP N    1 1 
        2  3898 1 1  60 TRP NE1  N   2.825  -7.131  13.494 1.00 . A A .  60 TRP NE1  1 1 
        2  3899 1 1  60 TRP O    O   2.864  -5.274   7.196 1.00 . A A .  60 TRP O    1 1 
        2  3900 1 1  61 PHE C    C   5.095  -3.820   5.587 1.00 . A A .  61 PHE C    1 1 
        2  3901 1 1  61 PHE CA   C   4.593  -3.014   6.802 1.00 . A A .  61 PHE CA   1 1 
        2  3902 1 1  61 PHE CB   C   5.530  -1.794   7.076 1.00 . A A .  61 PHE CB   1 1 
        2  3903 1 1  61 PHE CD1  C   3.737  -0.836   8.663 1.00 . A A .  61 PHE CD1  1 1 
        2  3904 1 1  61 PHE CD2  C   5.570   0.569   8.014 1.00 . A A .  61 PHE CD2  1 1 
        2  3905 1 1  61 PHE CE1  C   3.213   0.195   9.420 1.00 . A A .  61 PHE CE1  1 1 
        2  3906 1 1  61 PHE CE2  C   5.043   1.595   8.775 1.00 . A A .  61 PHE CE2  1 1 
        2  3907 1 1  61 PHE CG   C   4.932  -0.669   7.940 1.00 . A A .  61 PHE CG   1 1 
        2  3908 1 1  61 PHE CZ   C   3.866   1.410   9.476 1.00 . A A .  61 PHE CZ   1 1 
        2  3909 1 1  61 PHE H    H   4.999  -3.625   8.800 1.00 . A A .  61 PHE H    1 1 
        2  3910 1 1  61 PHE HA   H   3.600  -2.637   6.577 1.00 . A A .  61 PHE HA   1 1 
        2  3911 1 1  61 PHE HB2  H   6.426  -2.144   7.579 1.00 . A A .  61 PHE HB2  1 1 
        2  3912 1 1  61 PHE HB3  H   5.820  -1.355   6.126 1.00 . A A .  61 PHE HB3  1 1 
        2  3913 1 1  61 PHE HD1  H   3.218  -1.787   8.625 1.00 . A A .  61 PHE HD1  1 1 
        2  3914 1 1  61 PHE HD2  H   6.493   0.728   7.466 1.00 . A A .  61 PHE HD2  1 1 
        2  3915 1 1  61 PHE HE1  H   2.291   0.052   9.970 1.00 . A A .  61 PHE HE1  1 1 
        2  3916 1 1  61 PHE HE2  H   5.553   2.552   8.821 1.00 . A A .  61 PHE HE2  1 1 
        2  3917 1 1  61 PHE HZ   H   3.456   2.219  10.070 1.00 . A A .  61 PHE HZ   1 1 
        2  3918 1 1  61 PHE N    N   4.468  -3.858   8.009 1.00 . A A .  61 PHE N    1 1 
        2  3919 1 1  61 PHE O    O   4.652  -3.572   4.471 1.00 . A A .  61 PHE O    1 1 
        2  3920 1 1  62 SER C    C   5.528  -6.523   4.153 1.00 . A A .  62 SER C    1 1 
        2  3921 1 1  62 SER CA   C   6.589  -5.626   4.764 1.00 . A A .  62 SER CA   1 1 
        2  3922 1 1  62 SER CB   C   7.782  -6.471   5.285 1.00 . A A .  62 SER CB   1 1 
        2  3923 1 1  62 SER H    H   6.116  -5.082   6.765 1.00 . A A .  62 SER H    1 1 
        2  3924 1 1  62 SER HA   H   6.954  -4.937   4.004 1.00 . A A .  62 SER HA   1 1 
        2  3925 1 1  62 SER HB2  H   8.501  -5.820   5.763 1.00 . A A .  62 SER HB2  1 1 
        2  3926 1 1  62 SER HB3  H   7.435  -7.205   6.010 1.00 . A A .  62 SER HB3  1 1 
        2  3927 1 1  62 SER HG   H   8.611  -6.534   3.500 1.00 . A A .  62 SER HG   1 1 
        2  3928 1 1  62 SER N    N   5.962  -4.827   5.832 1.00 . A A .  62 SER N    1 1 
        2  3929 1 1  62 SER O    O   5.250  -6.415   2.973 1.00 . A A .  62 SER O    1 1 
        2  3930 1 1  62 SER OG   O   8.437  -7.155   4.223 1.00 . A A .  62 SER OG   1 1 
        2  3931 1 1  63 ASN C    C   2.695  -7.474   3.877 1.00 . A A .  63 ASN C    1 1 
        2  3932 1 1  63 ASN CA   C   3.777  -8.228   4.663 1.00 . A A .  63 ASN CA   1 1 
        2  3933 1 1  63 ASN CB   C   3.170  -8.854   5.945 1.00 . A A .  63 ASN CB   1 1 
        2  3934 1 1  63 ASN CG   C   1.940  -9.744   5.700 1.00 . A A .  63 ASN CG   1 1 
        2  3935 1 1  63 ASN H    H   5.166  -7.316   5.964 1.00 . A A .  63 ASN H    1 1 
        2  3936 1 1  63 ASN HA   H   4.188  -9.018   4.041 1.00 . A A .  63 ASN HA   1 1 
        2  3937 1 1  63 ASN HB2  H   3.928  -9.461   6.425 1.00 . A A .  63 ASN HB2  1 1 
        2  3938 1 1  63 ASN HB3  H   2.888  -8.056   6.629 1.00 . A A .  63 ASN HB3  1 1 
        2  3939 1 1  63 ASN HD21 H   2.790 -10.630   4.130 1.00 . A A .  63 ASN HD21 1 1 
        2  3940 1 1  63 ASN HD22 H   1.188 -11.147   4.516 1.00 . A A .  63 ASN HD22 1 1 
        2  3941 1 1  63 ASN N    N   4.884  -7.333   5.026 1.00 . A A .  63 ASN N    1 1 
        2  3942 1 1  63 ASN ND2  N   1.980 -10.594   4.681 1.00 . A A .  63 ASN ND2  1 1 
        2  3943 1 1  63 ASN O    O   2.322  -7.911   2.785 1.00 . A A .  63 ASN O    1 1 
        2  3944 1 1  63 ASN OD1  O   0.974  -9.704   6.467 1.00 . A A .  63 ASN OD1  1 1 
        2  3945 1 1  64 PHE C    C   1.659  -5.077   2.363 1.00 . A A .  64 PHE C    1 1 
        2  3946 1 1  64 PHE CA   C   1.242  -5.434   3.803 1.00 . A A .  64 PHE CA   1 1 
        2  3947 1 1  64 PHE CB   C   1.055  -4.142   4.659 1.00 . A A .  64 PHE CB   1 1 
        2  3948 1 1  64 PHE CD1  C  -0.207  -2.518   3.120 1.00 . A A .  64 PHE CD1  1 1 
        2  3949 1 1  64 PHE CD2  C  -1.258  -3.175   5.173 1.00 . A A .  64 PHE CD2  1 1 
        2  3950 1 1  64 PHE CE1  C  -1.298  -1.722   2.816 1.00 . A A .  64 PHE CE1  1 1 
        2  3951 1 1  64 PHE CE2  C  -2.344  -2.373   4.866 1.00 . A A .  64 PHE CE2  1 1 
        2  3952 1 1  64 PHE CG   C  -0.164  -3.268   4.305 1.00 . A A .  64 PHE CG   1 1 
        2  3953 1 1  64 PHE CZ   C  -2.362  -1.646   3.691 1.00 . A A .  64 PHE CZ   1 1 
        2  3954 1 1  64 PHE H    H   2.639  -6.032   5.291 1.00 . A A .  64 PHE H    1 1 
        2  3955 1 1  64 PHE HA   H   0.304  -5.984   3.779 1.00 . A A .  64 PHE HA   1 1 
        2  3956 1 1  64 PHE HB2  H   0.963  -4.430   5.699 1.00 . A A .  64 PHE HB2  1 1 
        2  3957 1 1  64 PHE HB3  H   1.944  -3.524   4.561 1.00 . A A .  64 PHE HB3  1 1 
        2  3958 1 1  64 PHE HD1  H   0.622  -2.572   2.430 1.00 . A A .  64 PHE HD1  1 1 
        2  3959 1 1  64 PHE HD2  H  -1.256  -3.738   6.097 1.00 . A A .  64 PHE HD2  1 1 
        2  3960 1 1  64 PHE HE1  H  -1.314  -1.151   1.893 1.00 . A A .  64 PHE HE1  1 1 
        2  3961 1 1  64 PHE HE2  H  -3.185  -2.315   5.549 1.00 . A A .  64 PHE HE2  1 1 
        2  3962 1 1  64 PHE HZ   H  -3.217  -1.021   3.452 1.00 . A A .  64 PHE HZ   1 1 
        2  3963 1 1  64 PHE N    N   2.259  -6.310   4.427 1.00 . A A .  64 PHE N    1 1 
        2  3964 1 1  64 PHE O    O   0.951  -5.404   1.411 1.00 . A A .  64 PHE O    1 1 
        2  3965 1 1  65 ARG C    C   3.688  -5.155  -0.024 1.00 . A A .  65 ARG C    1 1 
        2  3966 1 1  65 ARG CA   C   3.412  -4.000   0.951 1.00 . A A .  65 ARG CA   1 1 
        2  3967 1 1  65 ARG CB   C   4.725  -3.214   1.189 1.00 . A A .  65 ARG CB   1 1 
        2  3968 1 1  65 ARG CD   C   5.906  -1.252   2.318 1.00 . A A .  65 ARG CD   1 1 
        2  3969 1 1  65 ARG CG   C   4.556  -1.871   1.926 1.00 . A A .  65 ARG CG   1 1 
        2  3970 1 1  65 ARG CZ   C   6.032   1.223   2.566 1.00 . A A .  65 ARG CZ   1 1 
        2  3971 1 1  65 ARG H    H   3.383  -4.333   3.059 1.00 . A A .  65 ARG H    1 1 
        2  3972 1 1  65 ARG HA   H   2.683  -3.334   0.503 1.00 . A A .  65 ARG HA   1 1 
        2  3973 1 1  65 ARG HB2  H   5.394  -3.838   1.772 1.00 . A A .  65 ARG HB2  1 1 
        2  3974 1 1  65 ARG HB3  H   5.195  -3.011   0.229 1.00 . A A .  65 ARG HB3  1 1 
        2  3975 1 1  65 ARG HD2  H   6.434  -1.944   2.964 1.00 . A A .  65 ARG HD2  1 1 
        2  3976 1 1  65 ARG HD3  H   6.497  -1.083   1.422 1.00 . A A .  65 ARG HD3  1 1 
        2  3977 1 1  65 ARG HE   H   5.369  -0.053   3.946 1.00 . A A .  65 ARG HE   1 1 
        2  3978 1 1  65 ARG HG2  H   4.028  -1.176   1.285 1.00 . A A .  65 ARG HG2  1 1 
        2  3979 1 1  65 ARG HG3  H   3.972  -2.035   2.828 1.00 . A A .  65 ARG HG3  1 1 
        2  3980 1 1  65 ARG HH11 H   6.731   0.584   0.770 1.00 . A A .  65 ARG HH11 1 1 
        2  3981 1 1  65 ARG HH12 H   6.775   2.302   1.011 1.00 . A A .  65 ARG HH12 1 1 
        2  3982 1 1  65 ARG HH21 H   5.365   2.175   4.222 1.00 . A A .  65 ARG HH21 1 1 
        2  3983 1 1  65 ARG HH22 H   5.994   3.207   2.981 1.00 . A A .  65 ARG HH22 1 1 
        2  3984 1 1  65 ARG N    N   2.855  -4.465   2.239 1.00 . A A .  65 ARG N    1 1 
        2  3985 1 1  65 ARG NE   N   5.732   0.011   3.039 1.00 . A A .  65 ARG NE   1 1 
        2  3986 1 1  65 ARG NH1  N   6.557   1.381   1.351 1.00 . A A .  65 ARG NH1  1 1 
        2  3987 1 1  65 ARG NH2  N   5.778   2.283   3.315 1.00 . A A .  65 ARG NH2  1 1 
        2  3988 1 1  65 ARG O    O   3.595  -4.962  -1.234 1.00 . A A .  65 ARG O    1 1 
        2  3989 1 1  66 GLU C    C   3.202  -8.222  -0.871 1.00 . A A .  66 GLU C    1 1 
        2  3990 1 1  66 GLU CA   C   4.424  -7.497  -0.304 1.00 . A A .  66 GLU CA   1 1 
        2  3991 1 1  66 GLU CB   C   5.331  -8.474   0.493 1.00 . A A .  66 GLU CB   1 1 
        2  3992 1 1  66 GLU CD   C   7.630  -7.795  -0.510 1.00 . A A .  66 GLU CD   1 1 
        2  3993 1 1  66 GLU CG   C   6.764  -7.950   0.761 1.00 . A A .  66 GLU CG   1 1 
        2  3994 1 1  66 GLU H    H   3.998  -6.437   1.485 1.00 . A A .  66 GLU H    1 1 
        2  3995 1 1  66 GLU HA   H   5.004  -7.110  -1.143 1.00 . A A .  66 GLU HA   1 1 
        2  3996 1 1  66 GLU HB2  H   4.863  -8.684   1.452 1.00 . A A .  66 GLU HB2  1 1 
        2  3997 1 1  66 GLU HB3  H   5.418  -9.406  -0.053 1.00 . A A .  66 GLU HB3  1 1 
        2  3998 1 1  66 GLU HG2  H   6.687  -6.989   1.259 1.00 . A A .  66 GLU HG2  1 1 
        2  3999 1 1  66 GLU HG3  H   7.259  -8.642   1.435 1.00 . A A .  66 GLU HG3  1 1 
        2  4000 1 1  66 GLU N    N   4.028  -6.339   0.512 1.00 . A A .  66 GLU N    1 1 
        2  4001 1 1  66 GLU O    O   3.267  -8.682  -1.999 1.00 . A A .  66 GLU O    1 1 
        2  4002 1 1  66 GLU OE1  O   8.119  -8.826  -1.029 1.00 . A A .  66 GLU OE1  1 1 
        2  4003 1 1  66 GLU OE2  O   7.862  -6.652  -0.966 1.00 . A A .  66 GLU OE2  1 1 
        2  4004 1 1  67 PHE C    C   0.044  -7.933  -1.477 1.00 . A A .  67 PHE C    1 1 
        2  4005 1 1  67 PHE CA   C   0.851  -8.962  -0.678 1.00 . A A .  67 PHE CA   1 1 
        2  4006 1 1  67 PHE CB   C  -0.027  -9.743   0.363 1.00 . A A .  67 PHE CB   1 1 
        2  4007 1 1  67 PHE CD1  C  -1.893  -8.165   1.159 1.00 . A A .  67 PHE CD1  1 1 
        2  4008 1 1  67 PHE CD2  C  -0.421  -9.081   2.799 1.00 . A A .  67 PHE CD2  1 1 
        2  4009 1 1  67 PHE CE1  C  -2.597  -7.519   2.160 1.00 . A A .  67 PHE CE1  1 1 
        2  4010 1 1  67 PHE CE2  C  -1.122  -8.425   3.796 1.00 . A A .  67 PHE CE2  1 1 
        2  4011 1 1  67 PHE CG   C  -0.781  -8.961   1.456 1.00 . A A .  67 PHE CG   1 1 
        2  4012 1 1  67 PHE CZ   C  -2.208  -7.645   3.477 1.00 . A A .  67 PHE CZ   1 1 
        2  4013 1 1  67 PHE H    H   2.071  -7.989   0.801 1.00 . A A .  67 PHE H    1 1 
        2  4014 1 1  67 PHE HA   H   1.203  -9.699  -1.406 1.00 . A A .  67 PHE HA   1 1 
        2  4015 1 1  67 PHE HB2  H  -0.774 -10.306  -0.184 1.00 . A A .  67 PHE HB2  1 1 
        2  4016 1 1  67 PHE HB3  H   0.618 -10.461   0.860 1.00 . A A .  67 PHE HB3  1 1 
        2  4017 1 1  67 PHE HD1  H  -2.204  -8.047   0.130 1.00 . A A .  67 PHE HD1  1 1 
        2  4018 1 1  67 PHE HD2  H   0.435  -9.692   3.066 1.00 . A A .  67 PHE HD2  1 1 
        2  4019 1 1  67 PHE HE1  H  -3.456  -6.906   1.910 1.00 . A A .  67 PHE HE1  1 1 
        2  4020 1 1  67 PHE HE2  H  -0.814  -8.528   4.833 1.00 . A A .  67 PHE HE2  1 1 
        2  4021 1 1  67 PHE HZ   H  -2.764  -7.135   4.260 1.00 . A A .  67 PHE HZ   1 1 
        2  4022 1 1  67 PHE N    N   2.077  -8.338  -0.114 1.00 . A A .  67 PHE N    1 1 
        2  4023 1 1  67 PHE O    O  -0.737  -8.318  -2.324 1.00 . A A .  67 PHE O    1 1 
        2  4024 1 1  68 TYR C    C   0.456  -5.609  -3.405 1.00 . A A .  68 TYR C    1 1 
        2  4025 1 1  68 TYR CA   C  -0.218  -5.497  -2.021 1.00 . A A .  68 TYR CA   1 1 
        2  4026 1 1  68 TYR CB   C   0.161  -4.163  -1.305 1.00 . A A .  68 TYR CB   1 1 
        2  4027 1 1  68 TYR CD1  C   0.852  -2.268  -2.898 1.00 . A A .  68 TYR CD1  1 1 
        2  4028 1 1  68 TYR CD2  C  -1.313  -2.152  -1.889 1.00 . A A .  68 TYR CD2  1 1 
        2  4029 1 1  68 TYR CE1  C   0.616  -1.066  -3.544 1.00 . A A .  68 TYR CE1  1 1 
        2  4030 1 1  68 TYR CE2  C  -1.546  -0.950  -2.526 1.00 . A A .  68 TYR CE2  1 1 
        2  4031 1 1  68 TYR CG   C  -0.112  -2.844  -2.056 1.00 . A A .  68 TYR CG   1 1 
        2  4032 1 1  68 TYR CZ   C  -0.585  -0.412  -3.351 1.00 . A A .  68 TYR CZ   1 1 
        2  4033 1 1  68 TYR H    H   0.684  -6.415  -0.320 1.00 . A A .  68 TYR H    1 1 
        2  4034 1 1  68 TYR HA   H  -1.294  -5.557  -2.132 1.00 . A A .  68 TYR HA   1 1 
        2  4035 1 1  68 TYR HB2  H  -0.386  -4.115  -0.370 1.00 . A A .  68 TYR HB2  1 1 
        2  4036 1 1  68 TYR HB3  H   1.221  -4.189  -1.063 1.00 . A A .  68 TYR HB3  1 1 
        2  4037 1 1  68 TYR HD1  H   1.794  -2.780  -3.051 1.00 . A A .  68 TYR HD1  1 1 
        2  4038 1 1  68 TYR HD2  H  -2.074  -2.568  -1.245 1.00 . A A .  68 TYR HD2  1 1 
        2  4039 1 1  68 TYR HE1  H   1.375  -0.641  -4.198 1.00 . A A .  68 TYR HE1  1 1 
        2  4040 1 1  68 TYR HE2  H  -2.486  -0.436  -2.377 1.00 . A A .  68 TYR HE2  1 1 
        2  4041 1 1  68 TYR HH   H  -0.542   0.744  -4.890 1.00 . A A .  68 TYR HH   1 1 
        2  4042 1 1  68 TYR N    N   0.233  -6.629  -1.168 1.00 . A A .  68 TYR N    1 1 
        2  4043 1 1  68 TYR O    O  -0.219  -5.602  -4.463 1.00 . A A .  68 TYR O    1 1 
        2  4044 1 1  68 TYR OH   O  -0.815   0.799  -3.968 1.00 . A A .  68 TYR OH   1 1 
        2  4045 1 1  69 TYR C    C   2.200  -7.129  -5.319 1.00 . A A .  69 TYR C    1 1 
        2  4046 1 1  69 TYR CA   C   2.667  -5.919  -4.519 1.00 . A A .  69 TYR CA   1 1 
        2  4047 1 1  69 TYR CB   C   4.155  -6.071  -4.082 1.00 . A A .  69 TYR CB   1 1 
        2  4048 1 1  69 TYR CD1  C   5.760  -5.214  -5.905 1.00 . A A .  69 TYR CD1  1 1 
        2  4049 1 1  69 TYR CD2  C   5.538  -7.580  -5.628 1.00 . A A .  69 TYR CD2  1 1 
        2  4050 1 1  69 TYR CE1  C   6.666  -5.430  -6.932 1.00 . A A .  69 TYR CE1  1 1 
        2  4051 1 1  69 TYR CE2  C   6.440  -7.793  -6.652 1.00 . A A .  69 TYR CE2  1 1 
        2  4052 1 1  69 TYR CG   C   5.171  -6.289  -5.226 1.00 . A A .  69 TYR CG   1 1 
        2  4053 1 1  69 TYR CZ   C   6.998  -6.721  -7.301 1.00 . A A .  69 TYR CZ   1 1 
        2  4054 1 1  69 TYR H    H   2.217  -5.775  -2.461 1.00 . A A .  69 TYR H    1 1 
        2  4055 1 1  69 TYR HA   H   2.570  -5.026  -5.129 1.00 . A A .  69 TYR HA   1 1 
        2  4056 1 1  69 TYR HB2  H   4.448  -5.174  -3.548 1.00 . A A .  69 TYR HB2  1 1 
        2  4057 1 1  69 TYR HB3  H   4.233  -6.912  -3.399 1.00 . A A .  69 TYR HB3  1 1 
        2  4058 1 1  69 TYR HD1  H   5.508  -4.203  -5.621 1.00 . A A .  69 TYR HD1  1 1 
        2  4059 1 1  69 TYR HD2  H   5.102  -8.429  -5.119 1.00 . A A .  69 TYR HD2  1 1 
        2  4060 1 1  69 TYR HE1  H   7.107  -4.586  -7.450 1.00 . A A .  69 TYR HE1  1 1 
        2  4061 1 1  69 TYR HE2  H   6.701  -8.806  -6.945 1.00 . A A .  69 TYR HE2  1 1 
        2  4062 1 1  69 TYR HH   H   7.492  -7.513  -8.992 1.00 . A A .  69 TYR HH   1 1 
        2  4063 1 1  69 TYR N    N   1.800  -5.756  -3.347 1.00 . A A .  69 TYR N    1 1 
        2  4064 1 1  69 TYR O    O   1.798  -6.973  -6.447 1.00 . A A .  69 TYR O    1 1 
        2  4065 1 1  69 TYR OH   O   7.893  -6.940  -8.327 1.00 . A A .  69 TYR OH   1 1 
        2  4066 1 1  70 ILE C    C   0.314  -9.602  -5.718 1.00 . A A .  70 ILE C    1 1 
        2  4067 1 1  70 ILE CA   C   1.813  -9.588  -5.309 1.00 . A A .  70 ILE CA   1 1 
        2  4068 1 1  70 ILE CB   C   2.183 -10.816  -4.375 1.00 . A A .  70 ILE CB   1 1 
        2  4069 1 1  70 ILE CD1  C   4.605 -11.053  -5.332 1.00 . A A .  70 ILE CD1  1 1 
        2  4070 1 1  70 ILE CG1  C   3.725 -10.857  -4.103 1.00 . A A .  70 ILE CG1  1 1 
        2  4071 1 1  70 ILE CG2  C   1.707 -12.180  -4.939 1.00 . A A .  70 ILE CG2  1 1 
        2  4072 1 1  70 ILE H    H   2.456  -8.326  -3.737 1.00 . A A .  70 ILE H    1 1 
        2  4073 1 1  70 ILE HA   H   2.409  -9.673  -6.215 1.00 . A A .  70 ILE HA   1 1 
        2  4074 1 1  70 ILE HB   H   1.675 -10.664  -3.424 1.00 . A A .  70 ILE HB   1 1 
        2  4075 1 1  70 ILE HD11 H   4.380 -12.005  -5.794 1.00 . A A .  70 ILE HD11 1 1 
        2  4076 1 1  70 ILE HD12 H   5.641 -11.041  -5.030 1.00 . A A .  70 ILE HD12 1 1 
        2  4077 1 1  70 ILE HD13 H   4.430 -10.257  -6.040 1.00 . A A .  70 ILE HD13 1 1 
        2  4078 1 1  70 ILE HG12 H   4.025  -9.926  -3.643 1.00 . A A .  70 ILE HG12 1 1 
        2  4079 1 1  70 ILE HG13 H   3.941 -11.663  -3.412 1.00 . A A .  70 ILE HG13 1 1 
        2  4080 1 1  70 ILE HG21 H   1.982 -12.975  -4.255 1.00 . A A .  70 ILE HG21 1 1 
        2  4081 1 1  70 ILE HG22 H   2.170 -12.361  -5.898 1.00 . A A .  70 ILE HG22 1 1 
        2  4082 1 1  70 ILE HG23 H   0.631 -12.172  -5.062 1.00 . A A .  70 ILE HG23 1 1 
        2  4083 1 1  70 ILE N    N   2.191  -8.313  -4.673 1.00 . A A .  70 ILE N    1 1 
        2  4084 1 1  70 ILE O    O  -0.052 -10.318  -6.650 1.00 . A A .  70 ILE O    1 1 
        2  4085 1 1  71 GLN C    C  -2.075  -8.059  -6.835 1.00 . A A .  71 GLN C    1 1 
        2  4086 1 1  71 GLN CA   C  -1.976  -8.672  -5.441 1.00 . A A .  71 GLN CA   1 1 
        2  4087 1 1  71 GLN CB   C  -2.805  -7.823  -4.436 1.00 . A A .  71 GLN CB   1 1 
        2  4088 1 1  71 GLN CD   C  -5.119  -6.876  -3.780 1.00 . A A .  71 GLN CD   1 1 
        2  4089 1 1  71 GLN CG   C  -4.334  -7.832  -4.685 1.00 . A A .  71 GLN CG   1 1 
        2  4090 1 1  71 GLN H    H  -0.209  -8.257  -4.295 1.00 . A A .  71 GLN H    1 1 
        2  4091 1 1  71 GLN HA   H  -2.386  -9.676  -5.470 1.00 . A A .  71 GLN HA   1 1 
        2  4092 1 1  71 GLN HB2  H  -2.624  -8.202  -3.438 1.00 . A A .  71 GLN HB2  1 1 
        2  4093 1 1  71 GLN HB3  H  -2.458  -6.794  -4.477 1.00 . A A .  71 GLN HB3  1 1 
        2  4094 1 1  71 GLN HE21 H  -3.666  -5.515  -3.876 1.00 . A A .  71 GLN HE21 1 1 
        2  4095 1 1  71 GLN HE22 H  -5.041  -5.085  -2.924 1.00 . A A .  71 GLN HE22 1 1 
        2  4096 1 1  71 GLN HG2  H  -4.521  -7.546  -5.711 1.00 . A A .  71 GLN HG2  1 1 
        2  4097 1 1  71 GLN HG3  H  -4.705  -8.841  -4.530 1.00 . A A .  71 GLN HG3  1 1 
        2  4098 1 1  71 GLN N    N  -0.546  -8.785  -5.053 1.00 . A A .  71 GLN N    1 1 
        2  4099 1 1  71 GLN NE2  N  -4.552  -5.709  -3.496 1.00 . A A .  71 GLN NE2  1 1 
        2  4100 1 1  71 GLN O    O  -2.577  -8.698  -7.754 1.00 . A A .  71 GLN O    1 1 
        2  4101 1 1  71 GLN OE1  O  -6.254  -7.154  -3.385 1.00 . A A .  71 GLN OE1  1 1 
        2  4102 1 1  72 MET C    C  -0.621  -6.796  -9.337 1.00 . A A .  72 MET C    1 1 
        2  4103 1 1  72 MET CA   C  -1.545  -6.137  -8.294 1.00 . A A .  72 MET CA   1 1 
        2  4104 1 1  72 MET CB   C  -1.212  -4.636  -8.109 1.00 . A A .  72 MET CB   1 1 
        2  4105 1 1  72 MET CE   C  -4.605  -3.441  -5.988 1.00 . A A .  72 MET CE   1 1 
        2  4106 1 1  72 MET CG   C  -2.397  -3.791  -7.625 1.00 . A A .  72 MET CG   1 1 
        2  4107 1 1  72 MET H    H  -1.089  -6.407  -6.217 1.00 . A A .  72 MET H    1 1 
        2  4108 1 1  72 MET HA   H  -2.567  -6.218  -8.669 1.00 . A A .  72 MET HA   1 1 
        2  4109 1 1  72 MET HB2  H  -0.415  -4.541  -7.381 1.00 . A A .  72 MET HB2  1 1 
        2  4110 1 1  72 MET HB3  H  -0.865  -4.223  -9.055 1.00 . A A .  72 MET HB3  1 1 
        2  4111 1 1  72 MET HE1  H  -4.382  -2.385  -5.958 1.00 . A A .  72 MET HE1  1 1 
        2  4112 1 1  72 MET HE2  H  -5.152  -3.721  -5.099 1.00 . A A .  72 MET HE2  1 1 
        2  4113 1 1  72 MET HE3  H  -5.200  -3.662  -6.863 1.00 . A A .  72 MET HE3  1 1 
        2  4114 1 1  72 MET HG2  H  -2.065  -2.769  -7.496 1.00 . A A .  72 MET HG2  1 1 
        2  4115 1 1  72 MET HG3  H  -3.180  -3.816  -8.380 1.00 . A A .  72 MET HG3  1 1 
        2  4116 1 1  72 MET N    N  -1.516  -6.845  -6.995 1.00 . A A .  72 MET N    1 1 
        2  4117 1 1  72 MET O    O  -0.889  -6.705 -10.535 1.00 . A A .  72 MET O    1 1 
        2  4118 1 1  72 MET SD   S  -3.080  -4.373  -6.060 1.00 . A A .  72 MET SD   1 1 
        2  4119 1 1  73 GLU C    C   0.722  -9.346 -10.396 1.00 . A A .  73 GLU C    1 1 
        2  4120 1 1  73 GLU CA   C   1.427  -8.184  -9.701 1.00 . A A .  73 GLU CA   1 1 
        2  4121 1 1  73 GLU CB   C   2.624  -8.669  -8.810 1.00 . A A .  73 GLU CB   1 1 
        2  4122 1 1  73 GLU CD   C   4.137 -10.037 -10.420 1.00 . A A .  73 GLU CD   1 1 
        2  4123 1 1  73 GLU CG   C   3.999  -8.816  -9.500 1.00 . A A .  73 GLU CG   1 1 
        2  4124 1 1  73 GLU H    H   0.661  -7.368  -7.919 1.00 . A A .  73 GLU H    1 1 
        2  4125 1 1  73 GLU HA   H   1.800  -7.496 -10.452 1.00 . A A .  73 GLU HA   1 1 
        2  4126 1 1  73 GLU HB2  H   2.753  -7.950  -8.011 1.00 . A A .  73 GLU HB2  1 1 
        2  4127 1 1  73 GLU HB3  H   2.366  -9.620  -8.356 1.00 . A A .  73 GLU HB3  1 1 
        2  4128 1 1  73 GLU HG2  H   4.180  -7.913 -10.078 1.00 . A A .  73 GLU HG2  1 1 
        2  4129 1 1  73 GLU HG3  H   4.765  -8.885  -8.731 1.00 . A A .  73 GLU HG3  1 1 
        2  4130 1 1  73 GLU N    N   0.461  -7.441  -8.863 1.00 . A A .  73 GLU N    1 1 
        2  4131 1 1  73 GLU O    O   0.735  -9.428 -11.616 1.00 . A A .  73 GLU O    1 1 
        2  4132 1 1  73 GLU OE1  O   3.774 -11.161  -9.994 1.00 . A A .  73 GLU OE1  1 1 
        2  4133 1 1  73 GLU OE2  O   4.660  -9.887 -11.549 1.00 . A A .  73 GLU OE2  1 1 
        2  4134 1 1  74 LYS C    C  -1.931 -10.941 -10.895 1.00 . A A .  74 LYS C    1 1 
        2  4135 1 1  74 LYS CA   C  -0.679 -11.361 -10.110 1.00 . A A .  74 LYS CA   1 1 
        2  4136 1 1  74 LYS CB   C  -1.057 -12.319  -8.957 1.00 . A A .  74 LYS CB   1 1 
        2  4137 1 1  74 LYS CD   C   0.833 -14.052  -9.358 1.00 . A A .  74 LYS CD   1 1 
        2  4138 1 1  74 LYS CE   C  -0.122 -15.110  -9.959 1.00 . A A .  74 LYS CE   1 1 
        2  4139 1 1  74 LYS CG   C   0.134 -13.099  -8.350 1.00 . A A .  74 LYS CG   1 1 
        2  4140 1 1  74 LYS H    H   0.054 -10.035  -8.635 1.00 . A A .  74 LYS H    1 1 
        2  4141 1 1  74 LYS HA   H  -0.009 -11.889 -10.789 1.00 . A A .  74 LYS HA   1 1 
        2  4142 1 1  74 LYS HB2  H  -1.520 -11.737  -8.164 1.00 . A A .  74 LYS HB2  1 1 
        2  4143 1 1  74 LYS HB3  H  -1.784 -13.040  -9.316 1.00 . A A .  74 LYS HB3  1 1 
        2  4144 1 1  74 LYS HD2  H   1.256 -13.463 -10.164 1.00 . A A .  74 LYS HD2  1 1 
        2  4145 1 1  74 LYS HD3  H   1.640 -14.566  -8.843 1.00 . A A .  74 LYS HD3  1 1 
        2  4146 1 1  74 LYS HE2  H  -0.838 -14.610 -10.596 1.00 . A A .  74 LYS HE2  1 1 
        2  4147 1 1  74 LYS HE3  H   0.456 -15.803 -10.558 1.00 . A A .  74 LYS HE3  1 1 
        2  4148 1 1  74 LYS HG2  H   0.865 -12.384  -7.986 1.00 . A A .  74 LYS HG2  1 1 
        2  4149 1 1  74 LYS HG3  H  -0.226 -13.684  -7.509 1.00 . A A .  74 LYS HG3  1 1 
        2  4150 1 1  74 LYS HZ1  H  -1.573 -15.275  -8.458 1.00 . A A .  74 LYS HZ1  1 1 
        2  4151 1 1  74 LYS HZ2  H  -0.210 -16.248  -8.202 1.00 . A A .  74 LYS HZ2  1 1 
        2  4152 1 1  74 LYS HZ3  H  -1.354 -16.683  -9.359 1.00 . A A .  74 LYS HZ3  1 1 
        2  4153 1 1  74 LYS N    N   0.057 -10.198  -9.598 1.00 . A A .  74 LYS N    1 1 
        2  4154 1 1  74 LYS NZ   N  -0.864 -15.880  -8.920 1.00 . A A .  74 LYS NZ   1 1 
        2  4155 1 1  74 LYS O    O  -2.255 -11.577 -11.889 1.00 . A A .  74 LYS O    1 1 
        2  4156 1 1  75 TYR C    C  -3.321  -8.904 -12.625 1.00 . A A .  75 TYR C    1 1 
        2  4157 1 1  75 TYR CA   C  -3.749  -9.262 -11.186 1.00 . A A .  75 TYR CA   1 1 
        2  4158 1 1  75 TYR CB   C  -4.284  -7.994 -10.441 1.00 . A A .  75 TYR CB   1 1 
        2  4159 1 1  75 TYR CD1  C  -5.444  -9.492  -8.663 1.00 . A A .  75 TYR CD1  1 1 
        2  4160 1 1  75 TYR CD2  C  -6.078  -7.186  -8.807 1.00 . A A .  75 TYR CD2  1 1 
        2  4161 1 1  75 TYR CE1  C  -6.349  -9.673  -7.622 1.00 . A A .  75 TYR CE1  1 1 
        2  4162 1 1  75 TYR CE2  C  -6.979  -7.369  -7.774 1.00 . A A .  75 TYR CE2  1 1 
        2  4163 1 1  75 TYR CG   C  -5.285  -8.239  -9.282 1.00 . A A .  75 TYR CG   1 1 
        2  4164 1 1  75 TYR CZ   C  -7.111  -8.610  -7.185 1.00 . A A .  75 TYR CZ   1 1 
        2  4165 1 1  75 TYR H    H  -2.299  -9.423  -9.627 1.00 . A A .  75 TYR H    1 1 
        2  4166 1 1  75 TYR HA   H  -4.534 -10.010 -11.228 1.00 . A A .  75 TYR HA   1 1 
        2  4167 1 1  75 TYR HB2  H  -3.439  -7.457 -10.023 1.00 . A A .  75 TYR HB2  1 1 
        2  4168 1 1  75 TYR HB3  H  -4.768  -7.342 -11.158 1.00 . A A .  75 TYR HB3  1 1 
        2  4169 1 1  75 TYR HD1  H  -4.847 -10.331  -9.001 1.00 . A A .  75 TYR HD1  1 1 
        2  4170 1 1  75 TYR HD2  H  -5.983  -6.210  -9.264 1.00 . A A .  75 TYR HD2  1 1 
        2  4171 1 1  75 TYR HE1  H  -6.457 -10.648  -7.160 1.00 . A A .  75 TYR HE1  1 1 
        2  4172 1 1  75 TYR HE2  H  -7.579  -6.535  -7.429 1.00 . A A .  75 TYR HE2  1 1 
        2  4173 1 1  75 TYR HH   H  -8.853  -8.385  -6.377 1.00 . A A .  75 TYR HH   1 1 
        2  4174 1 1  75 TYR N    N  -2.602  -9.854 -10.456 1.00 . A A .  75 TYR N    1 1 
        2  4175 1 1  75 TYR O    O  -3.968  -9.312 -13.604 1.00 . A A .  75 TYR O    1 1 
        2  4176 1 1  75 TYR OH   O  -8.006  -8.787  -6.146 1.00 . A A .  75 TYR OH   1 1 
        2  4177 1 1  76 ALA C    C  -1.119  -8.931 -14.844 1.00 . A A .  76 ALA C    1 1 
        2  4178 1 1  76 ALA CA   C  -1.617  -7.748 -13.989 1.00 . A A .  76 ALA CA   1 1 
        2  4179 1 1  76 ALA CB   C  -0.495  -6.743 -13.732 1.00 . A A .  76 ALA CB   1 1 
        2  4180 1 1  76 ALA H    H  -1.702  -7.976 -11.892 1.00 . A A .  76 ALA H    1 1 
        2  4181 1 1  76 ALA HA   H  -2.406  -7.228 -14.531 1.00 . A A .  76 ALA HA   1 1 
        2  4182 1 1  76 ALA HB1  H  -0.881  -5.907 -13.165 1.00 . A A .  76 ALA HB1  1 1 
        2  4183 1 1  76 ALA HB2  H  -0.105  -6.380 -14.673 1.00 . A A .  76 ALA HB2  1 1 
        2  4184 1 1  76 ALA HB3  H   0.302  -7.217 -13.168 1.00 . A A .  76 ALA HB3  1 1 
        2  4185 1 1  76 ALA N    N  -2.185  -8.198 -12.718 1.00 . A A .  76 ALA N    1 1 
        2  4186 1 1  76 ALA O    O  -1.413  -8.985 -16.031 1.00 . A A .  76 ALA O    1 1 
        2  4187 1 1  77 ARG C    C  -1.021 -11.893 -15.573 1.00 . A A .  77 ARG C    1 1 
        2  4188 1 1  77 ARG CA   C   0.123 -11.086 -14.955 1.00 . A A .  77 ARG CA   1 1 
        2  4189 1 1  77 ARG CB   C   0.982 -12.029 -14.064 1.00 . A A .  77 ARG CB   1 1 
        2  4190 1 1  77 ARG CD   C   3.366 -12.418 -13.164 1.00 . A A .  77 ARG CD   1 1 
        2  4191 1 1  77 ARG CG   C   2.251 -11.394 -13.456 1.00 . A A .  77 ARG CG   1 1 
        2  4192 1 1  77 ARG CZ   C   5.256 -12.085 -14.768 1.00 . A A .  77 ARG CZ   1 1 
        2  4193 1 1  77 ARG H    H  -0.275  -9.850 -13.261 1.00 . A A .  77 ARG H    1 1 
        2  4194 1 1  77 ARG HA   H   0.749 -10.703 -15.759 1.00 . A A .  77 ARG HA   1 1 
        2  4195 1 1  77 ARG HB2  H   0.363 -12.387 -13.245 1.00 . A A .  77 ARG HB2  1 1 
        2  4196 1 1  77 ARG HB3  H   1.282 -12.886 -14.659 1.00 . A A .  77 ARG HB3  1 1 
        2  4197 1 1  77 ARG HD2  H   4.033 -12.012 -12.406 1.00 . A A .  77 ARG HD2  1 1 
        2  4198 1 1  77 ARG HD3  H   2.924 -13.329 -12.783 1.00 . A A .  77 ARG HD3  1 1 
        2  4199 1 1  77 ARG HE   H   3.824 -13.487 -14.922 1.00 . A A .  77 ARG HE   1 1 
        2  4200 1 1  77 ARG HG2  H   2.641 -10.648 -14.142 1.00 . A A .  77 ARG HG2  1 1 
        2  4201 1 1  77 ARG HG3  H   1.982 -10.902 -12.527 1.00 . A A .  77 ARG HG3  1 1 
        2  4202 1 1  77 ARG HH11 H   5.295 -10.764 -13.216 1.00 . A A .  77 ARG HH11 1 1 
        2  4203 1 1  77 ARG HH12 H   6.579 -10.590 -14.374 1.00 . A A .  77 ARG HH12 1 1 
        2  4204 1 1  77 ARG HH21 H   5.483 -13.197 -16.442 1.00 . A A .  77 ARG HH21 1 1 
        2  4205 1 1  77 ARG HH22 H   6.682 -11.962 -16.195 1.00 . A A .  77 ARG HH22 1 1 
        2  4206 1 1  77 ARG N    N  -0.412  -9.910 -14.222 1.00 . A A .  77 ARG N    1 1 
        2  4207 1 1  77 ARG NE   N   4.146 -12.737 -14.371 1.00 . A A .  77 ARG NE   1 1 
        2  4208 1 1  77 ARG NH1  N   5.749 -11.063 -14.064 1.00 . A A .  77 ARG NH1  1 1 
        2  4209 1 1  77 ARG NH2  N   5.854 -12.441 -15.890 1.00 . A A .  77 ARG NH2  1 1 
        2  4210 1 1  77 ARG O    O  -0.947 -12.286 -16.735 1.00 . A A .  77 ARG O    1 1 
        2  4211 1 1  78 GLN C    C  -4.066 -12.051 -16.271 1.00 . A A .  78 GLN C    1 1 
        2  4212 1 1  78 GLN CA   C  -3.268 -12.856 -15.234 1.00 . A A .  78 GLN CA   1 1 
        2  4213 1 1  78 GLN CB   C  -4.164 -13.275 -14.040 1.00 . A A .  78 GLN CB   1 1 
        2  4214 1 1  78 GLN CD   C  -2.695 -15.364 -13.590 1.00 . A A .  78 GLN CD   1 1 
        2  4215 1 1  78 GLN CG   C  -3.482 -14.196 -12.993 1.00 . A A .  78 GLN CG   1 1 
        2  4216 1 1  78 GLN H    H  -2.079 -11.742 -13.874 1.00 . A A .  78 GLN H    1 1 
        2  4217 1 1  78 GLN HA   H  -2.904 -13.759 -15.721 1.00 . A A .  78 GLN HA   1 1 
        2  4218 1 1  78 GLN HB2  H  -4.502 -12.377 -13.527 1.00 . A A .  78 GLN HB2  1 1 
        2  4219 1 1  78 GLN HB3  H  -5.034 -13.792 -14.426 1.00 . A A .  78 GLN HB3  1 1 
        2  4220 1 1  78 GLN HE21 H  -4.347 -16.461 -13.682 1.00 . A A .  78 GLN HE21 1 1 
        2  4221 1 1  78 GLN HE22 H  -2.910 -17.207 -14.285 1.00 . A A .  78 GLN HE22 1 1 
        2  4222 1 1  78 GLN HG2  H  -2.799 -13.600 -12.401 1.00 . A A .  78 GLN HG2  1 1 
        2  4223 1 1  78 GLN HG3  H  -4.246 -14.600 -12.334 1.00 . A A .  78 GLN HG3  1 1 
        2  4224 1 1  78 GLN N    N  -2.089 -12.105 -14.784 1.00 . A A .  78 GLN N    1 1 
        2  4225 1 1  78 GLN NE2  N  -3.382 -16.457 -13.874 1.00 . A A .  78 GLN NE2  1 1 
        2  4226 1 1  78 GLN O    O  -4.701 -12.642 -17.147 1.00 . A A .  78 GLN O    1 1 
        2  4227 1 1  78 GLN OE1  O  -1.484 -15.272 -13.817 1.00 . A A .  78 GLN OE1  1 1 
        2  4228 1 1  79 ALA C    C  -3.953 -10.054 -18.576 1.00 . A A .  79 ALA C    1 1 
        2  4229 1 1  79 ALA CA   C  -4.606  -9.811 -17.198 1.00 . A A .  79 ALA CA   1 1 
        2  4230 1 1  79 ALA CB   C  -4.493  -8.334 -16.775 1.00 . A A .  79 ALA CB   1 1 
        2  4231 1 1  79 ALA H    H  -3.582 -10.293 -15.389 1.00 . A A .  79 ALA H    1 1 
        2  4232 1 1  79 ALA HA   H  -5.664 -10.053 -17.265 1.00 . A A .  79 ALA HA   1 1 
        2  4233 1 1  79 ALA HB1  H  -4.997  -7.703 -17.498 1.00 . A A .  79 ALA HB1  1 1 
        2  4234 1 1  79 ALA HB2  H  -3.447  -8.050 -16.711 1.00 . A A .  79 ALA HB2  1 1 
        2  4235 1 1  79 ALA HB3  H  -4.952  -8.198 -15.806 1.00 . A A .  79 ALA HB3  1 1 
        2  4236 1 1  79 ALA N    N  -4.017 -10.700 -16.179 1.00 . A A .  79 ALA N    1 1 
        2  4237 1 1  79 ALA O    O  -4.643 -10.423 -19.532 1.00 . A A .  79 ALA O    1 1 
        2  4238 1 1  80 ILE C    C  -1.994 -11.565 -20.420 1.00 . A A .  80 ILE C    1 1 
        2  4239 1 1  80 ILE CA   C  -1.841 -10.108 -19.888 1.00 . A A .  80 ILE CA   1 1 
        2  4240 1 1  80 ILE CB   C  -0.312  -9.722 -19.686 1.00 . A A .  80 ILE CB   1 1 
        2  4241 1 1  80 ILE CD1  C  -0.681  -7.407 -18.491 1.00 . A A .  80 ILE CD1  1 1 
        2  4242 1 1  80 ILE CG1  C  -0.092  -8.171 -19.657 1.00 . A A .  80 ILE CG1  1 1 
        2  4243 1 1  80 ILE CG2  C   0.599 -10.336 -20.776 1.00 . A A .  80 ILE CG2  1 1 
        2  4244 1 1  80 ILE H    H  -2.130  -9.685 -17.813 1.00 . A A .  80 ILE H    1 1 
        2  4245 1 1  80 ILE HA   H  -2.263  -9.431 -20.627 1.00 . A A .  80 ILE HA   1 1 
        2  4246 1 1  80 ILE HB   H   0.004 -10.130 -18.731 1.00 . A A .  80 ILE HB   1 1 
        2  4247 1 1  80 ILE HD11 H  -0.475  -6.350 -18.614 1.00 . A A .  80 ILE HD11 1 1 
        2  4248 1 1  80 ILE HD12 H  -0.235  -7.752 -17.570 1.00 . A A .  80 ILE HD12 1 1 
        2  4249 1 1  80 ILE HD13 H  -1.750  -7.560 -18.454 1.00 . A A .  80 ILE HD13 1 1 
        2  4250 1 1  80 ILE HG12 H   0.970  -7.969 -19.641 1.00 . A A .  80 ILE HG12 1 1 
        2  4251 1 1  80 ILE HG13 H  -0.505  -7.745 -20.566 1.00 . A A .  80 ILE HG13 1 1 
        2  4252 1 1  80 ILE HG21 H   1.627 -10.044 -20.602 1.00 . A A .  80 ILE HG21 1 1 
        2  4253 1 1  80 ILE HG22 H   0.290  -9.986 -21.751 1.00 . A A .  80 ILE HG22 1 1 
        2  4254 1 1  80 ILE HG23 H   0.526 -11.419 -20.751 1.00 . A A .  80 ILE HG23 1 1 
        2  4255 1 1  80 ILE N    N  -2.614  -9.917 -18.638 1.00 . A A .  80 ILE N    1 1 
        2  4256 1 1  80 ILE O    O  -2.220 -11.780 -21.624 1.00 . A A .  80 ILE O    1 1 
        2  4257 1 1  81 ASN C    C  -3.382 -14.364 -20.393 1.00 . A A .  81 ASN C    1 1 
        2  4258 1 1  81 ASN CA   C  -2.016 -13.988 -19.780 1.00 . A A .  81 ASN CA   1 1 
        2  4259 1 1  81 ASN CB   C  -1.760 -14.793 -18.472 1.00 . A A .  81 ASN CB   1 1 
        2  4260 1 1  81 ASN CG   C  -1.944 -16.310 -18.616 1.00 . A A .  81 ASN CG   1 1 
        2  4261 1 1  81 ASN H    H  -1.742 -12.266 -18.562 1.00 . A A .  81 ASN H    1 1 
        2  4262 1 1  81 ASN HA   H  -1.237 -14.232 -20.495 1.00 . A A .  81 ASN HA   1 1 
        2  4263 1 1  81 ASN HB2  H  -0.745 -14.606 -18.141 1.00 . A A .  81 ASN HB2  1 1 
        2  4264 1 1  81 ASN HB3  H  -2.439 -14.435 -17.701 1.00 . A A .  81 ASN HB3  1 1 
        2  4265 1 1  81 ASN HD21 H  -0.093 -16.515 -19.322 1.00 . A A .  81 ASN HD21 1 1 
        2  4266 1 1  81 ASN HD22 H  -1.003 -17.972 -19.162 1.00 . A A .  81 ASN HD22 1 1 
        2  4267 1 1  81 ASN N    N  -1.906 -12.536 -19.487 1.00 . A A .  81 ASN N    1 1 
        2  4268 1 1  81 ASN ND2  N  -0.913 -17.002 -19.083 1.00 . A A .  81 ASN ND2  1 1 
        2  4269 1 1  81 ASN O    O  -3.446 -15.155 -21.343 1.00 . A A .  81 ASN O    1 1 
        2  4270 1 1  81 ASN OD1  O  -3.018 -16.852 -18.337 1.00 . A A .  81 ASN OD1  1 1 
        2  4271 1 1  82 ASP C    C  -6.218 -13.269 -21.534 1.00 . A A .  82 ASP C    1 1 
        2  4272 1 1  82 ASP CA   C  -5.840 -14.091 -20.284 1.00 . A A .  82 ASP CA   1 1 
        2  4273 1 1  82 ASP CB   C  -6.827 -13.823 -19.124 1.00 . A A .  82 ASP CB   1 1 
        2  4274 1 1  82 ASP CG   C  -8.245 -14.356 -19.393 1.00 . A A .  82 ASP CG   1 1 
        2  4275 1 1  82 ASP H    H  -4.325 -13.138 -19.113 1.00 . A A .  82 ASP H    1 1 
        2  4276 1 1  82 ASP HA   H  -5.885 -15.149 -20.537 1.00 . A A .  82 ASP HA   1 1 
        2  4277 1 1  82 ASP HB2  H  -6.446 -14.299 -18.223 1.00 . A A .  82 ASP HB2  1 1 
        2  4278 1 1  82 ASP HB3  H  -6.881 -12.752 -18.937 1.00 . A A .  82 ASP HB3  1 1 
        2  4279 1 1  82 ASP N    N  -4.460 -13.786 -19.843 1.00 . A A .  82 ASP N    1 1 
        2  4280 1 1  82 ASP O    O  -7.050 -13.699 -22.349 1.00 . A A .  82 ASP O    1 1 
        2  4281 1 1  82 ASP OD1  O  -8.478 -15.573 -19.211 1.00 . A A .  82 ASP OD1  1 1 
        2  4282 1 1  82 ASP OD2  O  -9.127 -13.573 -19.794 1.00 . A A .  82 ASP OD2  1 1 
        2  4283 1 1  83 GLY C    C  -6.681  -9.990 -22.437 1.00 . A A .  83 GLY C    1 1 
        2  4284 1 1  83 GLY CA   C  -5.836 -11.191 -22.823 1.00 . A A .  83 GLY CA   1 1 
        2  4285 1 1  83 GLY H    H  -4.903 -11.832 -21.018 1.00 . A A .  83 GLY H    1 1 
        2  4286 1 1  83 GLY HA2  H  -4.893 -10.833 -23.203 1.00 . A A .  83 GLY HA2  1 1 
        2  4287 1 1  83 GLY HA3  H  -6.344 -11.732 -23.615 1.00 . A A .  83 GLY HA3  1 1 
        2  4288 1 1  83 GLY N    N  -5.573 -12.094 -21.690 1.00 . A A .  83 GLY N    1 1 
        2  4289 1 1  83 GLY O    O  -7.218  -9.291 -23.310 1.00 . A A .  83 GLY O    1 1 
        2  4290 1 1  84 VAL C    C  -6.442  -7.389 -20.772 1.00 . A A .  84 VAL C    1 1 
        2  4291 1 1  84 VAL CA   C  -7.422  -8.561 -20.559 1.00 . A A .  84 VAL CA   1 1 
        2  4292 1 1  84 VAL CB   C  -7.739  -8.757 -19.025 1.00 . A A .  84 VAL CB   1 1 
        2  4293 1 1  84 VAL CG1  C  -8.332  -7.487 -18.386 1.00 . A A .  84 VAL CG1  1 1 
        2  4294 1 1  84 VAL CG2  C  -8.667  -9.976 -18.798 1.00 . A A .  84 VAL CG2  1 1 
        2  4295 1 1  84 VAL H    H  -6.528 -10.471 -20.499 1.00 . A A .  84 VAL H    1 1 
        2  4296 1 1  84 VAL HA   H  -8.357  -8.360 -21.086 1.00 . A A .  84 VAL HA   1 1 
        2  4297 1 1  84 VAL HB   H  -6.801  -8.967 -18.520 1.00 . A A .  84 VAL HB   1 1 
        2  4298 1 1  84 VAL HG11 H  -7.638  -6.663 -18.498 1.00 . A A .  84 VAL HG11 1 1 
        2  4299 1 1  84 VAL HG12 H  -8.515  -7.657 -17.332 1.00 . A A .  84 VAL HG12 1 1 
        2  4300 1 1  84 VAL HG13 H  -9.266  -7.235 -18.873 1.00 . A A .  84 VAL HG13 1 1 
        2  4301 1 1  84 VAL HG21 H  -9.615  -9.811 -19.300 1.00 . A A .  84 VAL HG21 1 1 
        2  4302 1 1  84 VAL HG22 H  -8.845 -10.111 -17.738 1.00 . A A .  84 VAL HG22 1 1 
        2  4303 1 1  84 VAL HG23 H  -8.206 -10.869 -19.198 1.00 . A A .  84 VAL HG23 1 1 
        2  4304 1 1  84 VAL N    N  -6.829  -9.775 -21.121 1.00 . A A .  84 VAL N    1 1 
        2  4305 1 1  84 VAL O    O  -5.265  -7.478 -20.396 1.00 . A A .  84 VAL O    1 1 
        2  4306 1 1  85 THR C    C  -6.641  -3.837 -21.228 1.00 . A A .  85 THR C    1 1 
        2  4307 1 1  85 THR CA   C  -6.113  -5.159 -21.811 1.00 . A A .  85 THR CA   1 1 
        2  4308 1 1  85 THR CB   C  -6.024  -5.090 -23.378 1.00 . A A .  85 THR CB   1 1 
        2  4309 1 1  85 THR CG2  C  -5.205  -6.262 -23.967 1.00 . A A .  85 THR CG2  1 1 
        2  4310 1 1  85 THR H    H  -7.906  -6.244 -21.474 1.00 . A A .  85 THR H    1 1 
        2  4311 1 1  85 THR HA   H  -5.106  -5.299 -21.425 1.00 . A A .  85 THR HA   1 1 
        2  4312 1 1  85 THR HB   H  -5.536  -4.159 -23.657 1.00 . A A .  85 THR HB   1 1 
        2  4313 1 1  85 THR HG1  H  -7.487  -4.265 -24.415 1.00 . A A .  85 THR HG1  1 1 
        2  4314 1 1  85 THR HG21 H  -5.151  -6.165 -25.044 1.00 . A A .  85 THR HG21 1 1 
        2  4315 1 1  85 THR HG22 H  -5.680  -7.204 -23.717 1.00 . A A .  85 THR HG22 1 1 
        2  4316 1 1  85 THR HG23 H  -4.202  -6.251 -23.560 1.00 . A A .  85 THR HG23 1 1 
        2  4317 1 1  85 THR N    N  -6.938  -6.301 -21.373 1.00 . A A .  85 THR N    1 1 
        2  4318 1 1  85 THR O    O  -6.250  -2.750 -21.676 1.00 . A A .  85 THR O    1 1 
        2  4319 1 1  85 THR OG1  O  -7.343  -5.092 -23.943 1.00 . A A .  85 THR OG1  1 1 
        2  4320 1 1  86 SER C    C  -7.968  -3.058 -17.970 1.00 . A A .  86 SER C    1 1 
        2  4321 1 1  86 SER CA   C  -8.046  -2.774 -19.480 1.00 . A A .  86 SER CA   1 1 
        2  4322 1 1  86 SER CB   C  -9.513  -2.525 -19.907 1.00 . A A .  86 SER CB   1 1 
        2  4323 1 1  86 SER H    H  -7.773  -4.831 -19.892 1.00 . A A .  86 SER H    1 1 
        2  4324 1 1  86 SER HA   H  -7.442  -1.897 -19.718 1.00 . A A .  86 SER HA   1 1 
        2  4325 1 1  86 SER HB2  H -10.166  -3.235 -19.412 1.00 . A A .  86 SER HB2  1 1 
        2  4326 1 1  86 SER HB3  H  -9.808  -1.521 -19.628 1.00 . A A .  86 SER HB3  1 1 
        2  4327 1 1  86 SER HG   H  -9.661  -3.612 -21.527 1.00 . A A .  86 SER HG   1 1 
        2  4328 1 1  86 SER N    N  -7.501  -3.938 -20.194 1.00 . A A .  86 SER N    1 1 
        2  4329 1 1  86 SER O    O  -8.524  -4.060 -17.511 1.00 . A A .  86 SER O    1 1 
        2  4330 1 1  86 SER OG   O  -9.686  -2.672 -21.309 1.00 . A A .  86 SER OG   1 1 
        2  4331 1 1  87 THR C    C  -8.522  -2.169 -15.037 1.00 . A A .  87 THR C    1 1 
        2  4332 1 1  87 THR CA   C  -7.149  -2.316 -15.739 1.00 . A A .  87 THR CA   1 1 
        2  4333 1 1  87 THR CB   C  -6.141  -1.265 -15.168 1.00 . A A .  87 THR CB   1 1 
        2  4334 1 1  87 THR CG2  C  -4.695  -1.513 -15.647 1.00 . A A .  87 THR CG2  1 1 
        2  4335 1 1  87 THR H    H  -6.829  -1.424 -17.648 1.00 . A A .  87 THR H    1 1 
        2  4336 1 1  87 THR HA   H  -6.762  -3.309 -15.528 1.00 . A A .  87 THR HA   1 1 
        2  4337 1 1  87 THR HB   H  -6.157  -1.330 -14.082 1.00 . A A .  87 THR HB   1 1 
        2  4338 1 1  87 THR HG1  H  -7.249   0.364 -14.992 1.00 . A A .  87 THR HG1  1 1 
        2  4339 1 1  87 THR HG21 H  -4.043  -0.757 -15.227 1.00 . A A .  87 THR HG21 1 1 
        2  4340 1 1  87 THR HG22 H  -4.655  -1.462 -16.726 1.00 . A A .  87 THR HG22 1 1 
        2  4341 1 1  87 THR HG23 H  -4.359  -2.489 -15.320 1.00 . A A .  87 THR HG23 1 1 
        2  4342 1 1  87 THR N    N  -7.274  -2.188 -17.210 1.00 . A A .  87 THR N    1 1 
        2  4343 1 1  87 THR O    O  -8.735  -2.707 -13.948 1.00 . A A .  87 THR O    1 1 
        2  4344 1 1  87 THR OG1  O  -6.537   0.060 -15.560 1.00 . A A .  87 THR OG1  1 1 
        2  4345 1 1  88 GLU C    C -11.748  -2.440 -15.135 1.00 . A A .  88 GLU C    1 1 
        2  4346 1 1  88 GLU CA   C -10.831  -1.199 -15.234 1.00 . A A .  88 GLU CA   1 1 
        2  4347 1 1  88 GLU CB   C -11.469  -0.119 -16.142 1.00 . A A .  88 GLU CB   1 1 
        2  4348 1 1  88 GLU CD   C -12.029   0.636 -18.538 1.00 . A A .  88 GLU CD   1 1 
        2  4349 1 1  88 GLU CG   C -11.611  -0.529 -17.625 1.00 . A A .  88 GLU CG   1 1 
        2  4350 1 1  88 GLU H    H  -9.215  -1.168 -16.628 1.00 . A A .  88 GLU H    1 1 
        2  4351 1 1  88 GLU HA   H -10.730  -0.788 -14.235 1.00 . A A .  88 GLU HA   1 1 
        2  4352 1 1  88 GLU HB2  H -12.455   0.123 -15.762 1.00 . A A .  88 GLU HB2  1 1 
        2  4353 1 1  88 GLU HB3  H -10.856   0.773 -16.097 1.00 . A A .  88 GLU HB3  1 1 
        2  4354 1 1  88 GLU HG2  H -10.662  -0.920 -17.970 1.00 . A A .  88 GLU HG2  1 1 
        2  4355 1 1  88 GLU HG3  H -12.355  -1.319 -17.691 1.00 . A A .  88 GLU HG3  1 1 
        2  4356 1 1  88 GLU N    N  -9.459  -1.497 -15.730 1.00 . A A .  88 GLU N    1 1 
        2  4357 1 1  88 GLU O    O -12.925  -2.310 -14.775 1.00 . A A .  88 GLU O    1 1 
        2  4358 1 1  88 GLU OE1  O -11.157   1.450 -18.914 1.00 . A A .  88 GLU OE1  1 1 
        2  4359 1 1  88 GLU OE2  O -13.231   0.746 -18.875 1.00 . A A .  88 GLU OE2  1 1 
        2  4360 1 1  89 GLU C    C -11.648  -5.715 -14.162 1.00 . A A .  89 GLU C    1 1 
        2  4361 1 1  89 GLU CA   C -11.970  -4.898 -15.434 1.00 . A A .  89 GLU CA   1 1 
        2  4362 1 1  89 GLU CB   C -11.624  -5.707 -16.714 1.00 . A A .  89 GLU CB   1 1 
        2  4363 1 1  89 GLU CD   C -11.675  -5.806 -19.292 1.00 . A A .  89 GLU CD   1 1 
        2  4364 1 1  89 GLU CG   C -11.968  -4.974 -18.032 1.00 . A A .  89 GLU CG   1 1 
        2  4365 1 1  89 GLU H    H -10.252  -3.672 -15.641 1.00 . A A .  89 GLU H    1 1 
        2  4366 1 1  89 GLU HA   H -13.038  -4.673 -15.437 1.00 . A A .  89 GLU HA   1 1 
        2  4367 1 1  89 GLU HB2  H -10.559  -5.924 -16.713 1.00 . A A .  89 GLU HB2  1 1 
        2  4368 1 1  89 GLU HB3  H -12.167  -6.645 -16.694 1.00 . A A .  89 GLU HB3  1 1 
        2  4369 1 1  89 GLU HG2  H -13.023  -4.717 -18.026 1.00 . A A .  89 GLU HG2  1 1 
        2  4370 1 1  89 GLU HG3  H -11.392  -4.054 -18.075 1.00 . A A .  89 GLU HG3  1 1 
        2  4371 1 1  89 GLU N    N -11.211  -3.629 -15.445 1.00 . A A .  89 GLU N    1 1 
        2  4372 1 1  89 GLU O    O -12.455  -6.539 -13.719 1.00 . A A .  89 GLU O    1 1 
        2  4373 1 1  89 GLU OE1  O -12.507  -6.664 -19.655 1.00 . A A .  89 GLU OE1  1 1 
        2  4374 1 1  89 GLU OE2  O -10.618  -5.602 -19.936 1.00 . A A .  89 GLU OE2  1 1 
        2  4375 1 1  90 LEU C    C  -9.793  -5.354 -11.171 1.00 . A A .  90 LEU C    1 1 
        2  4376 1 1  90 LEU CA   C  -9.935  -6.235 -12.430 1.00 . A A .  90 LEU CA   1 1 
        2  4377 1 1  90 LEU CB   C  -8.570  -6.915 -12.784 1.00 . A A .  90 LEU CB   1 1 
        2  4378 1 1  90 LEU CD1  C  -6.080  -6.525 -13.306 1.00 . A A .  90 LEU CD1  1 1 
        2  4379 1 1  90 LEU CD2  C  -7.785  -6.012 -15.070 1.00 . A A .  90 LEU CD2  1 1 
        2  4380 1 1  90 LEU CG   C  -7.513  -6.036 -13.553 1.00 . A A .  90 LEU CG   1 1 
        2  4381 1 1  90 LEU H    H  -9.914  -4.742 -13.950 1.00 . A A .  90 LEU H    1 1 
        2  4382 1 1  90 LEU HA   H -10.652  -7.024 -12.203 1.00 . A A .  90 LEU HA   1 1 
        2  4383 1 1  90 LEU HB2  H  -8.122  -7.255 -11.853 1.00 . A A .  90 LEU HB2  1 1 
        2  4384 1 1  90 LEU HB3  H  -8.779  -7.795 -13.383 1.00 . A A .  90 LEU HB3  1 1 
        2  4385 1 1  90 LEU HD11 H  -5.381  -5.898 -13.848 1.00 . A A .  90 LEU HD11 1 1 
        2  4386 1 1  90 LEU HD12 H  -5.976  -7.550 -13.638 1.00 . A A .  90 LEU HD12 1 1 
        2  4387 1 1  90 LEU HD13 H  -5.863  -6.467 -12.251 1.00 . A A .  90 LEU HD13 1 1 
        2  4388 1 1  90 LEU HD21 H  -7.066  -5.365 -15.555 1.00 . A A .  90 LEU HD21 1 1 
        2  4389 1 1  90 LEU HD22 H  -8.782  -5.632 -15.257 1.00 . A A .  90 LEU HD22 1 1 
        2  4390 1 1  90 LEU HD23 H  -7.700  -7.010 -15.479 1.00 . A A .  90 LEU HD23 1 1 
        2  4391 1 1  90 LEU HG   H  -7.576  -5.013 -13.195 1.00 . A A .  90 LEU HG   1 1 
        2  4392 1 1  90 LEU N    N -10.460  -5.467 -13.583 1.00 . A A .  90 LEU N    1 1 
        2  4393 1 1  90 LEU O    O -10.017  -5.843 -10.054 1.00 . A A .  90 LEU O    1 1 
        2  4394 1 1  91 SER C    C  -8.869  -1.708 -10.827 1.00 . A A .  91 SER C    1 1 
        2  4395 1 1  91 SER CA   C  -9.154  -3.116 -10.264 1.00 . A A .  91 SER CA   1 1 
        2  4396 1 1  91 SER CB   C  -7.925  -3.617  -9.433 1.00 . A A .  91 SER CB   1 1 
        2  4397 1 1  91 SER H    H  -9.480  -3.717 -12.286 1.00 . A A .  91 SER H    1 1 
        2  4398 1 1  91 SER HA   H -10.022  -3.068  -9.613 1.00 . A A .  91 SER HA   1 1 
        2  4399 1 1  91 SER HB2  H  -8.170  -4.559  -8.963 1.00 . A A .  91 SER HB2  1 1 
        2  4400 1 1  91 SER HB3  H  -7.081  -3.763 -10.089 1.00 . A A .  91 SER HB3  1 1 
        2  4401 1 1  91 SER HG   H  -7.822  -3.045  -7.552 1.00 . A A .  91 SER HG   1 1 
        2  4402 1 1  91 SER N    N  -9.463  -4.058 -11.367 1.00 . A A .  91 SER N    1 1 
        2  4403 1 1  91 SER O    O  -7.868  -1.527 -11.518 1.00 . A A .  91 SER O    1 1 
        2  4404 1 1  91 SER OG   O  -7.547  -2.701  -8.405 1.00 . A A .  91 SER OG   1 1 
        2  4405 1 1  92 ILE C    C -10.492   1.625 -10.091 1.00 . A A .  92 ILE C    1 1 
        2  4406 1 1  92 ILE CA   C  -9.482   0.714 -10.839 1.00 . A A .  92 ILE CA   1 1 
        2  4407 1 1  92 ILE CB   C  -9.448   1.032 -12.408 1.00 . A A .  92 ILE CB   1 1 
        2  4408 1 1  92 ILE CD1  C  -6.874   1.363 -12.439 1.00 . A A .  92 ILE CD1  1 1 
        2  4409 1 1  92 ILE CG1  C  -8.242   1.952 -12.775 1.00 . A A .  92 ILE CG1  1 1 
        2  4410 1 1  92 ILE CG2  C -10.775   1.643 -12.932 1.00 . A A .  92 ILE CG2  1 1 
        2  4411 1 1  92 ILE H    H -10.640  -0.960 -10.187 1.00 . A A .  92 ILE H    1 1 
        2  4412 1 1  92 ILE HA   H  -8.499   0.921 -10.424 1.00 . A A .  92 ILE HA   1 1 
        2  4413 1 1  92 ILE HB   H  -9.310   0.085 -12.925 1.00 . A A .  92 ILE HB   1 1 
        2  4414 1 1  92 ILE HD11 H  -6.776   1.252 -11.364 1.00 . A A .  92 ILE HD11 1 1 
        2  4415 1 1  92 ILE HD12 H  -6.104   2.031 -12.798 1.00 . A A .  92 ILE HD12 1 1 
        2  4416 1 1  92 ILE HD13 H  -6.758   0.397 -12.913 1.00 . A A .  92 ILE HD13 1 1 
        2  4417 1 1  92 ILE HG12 H  -8.255   2.152 -13.837 1.00 . A A .  92 ILE HG12 1 1 
        2  4418 1 1  92 ILE HG13 H  -8.336   2.887 -12.238 1.00 . A A .  92 ILE HG13 1 1 
        2  4419 1 1  92 ILE HG21 H -10.963   2.592 -12.441 1.00 . A A .  92 ILE HG21 1 1 
        2  4420 1 1  92 ILE HG22 H -11.593   0.969 -12.720 1.00 . A A .  92 ILE HG22 1 1 
        2  4421 1 1  92 ILE HG23 H -10.718   1.800 -14.004 1.00 . A A .  92 ILE HG23 1 1 
        2  4422 1 1  92 ILE N    N  -9.764  -0.720 -10.561 1.00 . A A .  92 ILE N    1 1 
        2  4423 1 1  92 ILE O    O -11.514   1.145  -9.571 1.00 . A A .  92 ILE O    1 1 
        2  4424 1 1  93 THR C    C -12.434   4.039 -10.004 1.00 . A A .  93 THR C    1 1 
        2  4425 1 1  93 THR CA   C -10.996   3.975  -9.411 1.00 . A A .  93 THR CA   1 1 
        2  4426 1 1  93 THR CB   C -10.311   5.376  -9.582 1.00 . A A .  93 THR CB   1 1 
        2  4427 1 1  93 THR CG2  C -10.958   6.454  -8.694 1.00 . A A .  93 THR CG2  1 1 
        2  4428 1 1  93 THR H    H  -9.332   3.226 -10.451 1.00 . A A .  93 THR H    1 1 
        2  4429 1 1  93 THR HA   H -11.053   3.744  -8.345 1.00 . A A .  93 THR HA   1 1 
        2  4430 1 1  93 THR HB   H -10.403   5.681 -10.618 1.00 . A A .  93 THR HB   1 1 
        2  4431 1 1  93 THR HG1  H  -8.560   6.172  -9.184 1.00 . A A .  93 THR HG1  1 1 
        2  4432 1 1  93 THR HG21 H -10.865   6.171  -7.653 1.00 . A A .  93 THR HG21 1 1 
        2  4433 1 1  93 THR HG22 H -12.009   6.554  -8.942 1.00 . A A .  93 THR HG22 1 1 
        2  4434 1 1  93 THR HG23 H -10.459   7.400  -8.852 1.00 . A A .  93 THR HG23 1 1 
        2  4435 1 1  93 THR N    N -10.176   2.940 -10.049 1.00 . A A .  93 THR N    1 1 
        2  4436 1 1  93 THR O    O -12.618   4.563 -11.109 1.00 . A A .  93 THR O    1 1 
        2  4437 1 1  93 THR OG1  O  -8.918   5.286  -9.276 1.00 . A A .  93 THR OG1  1 1 
        2  4438 1 1  94 ARG C    C -15.604   2.389  -8.745 1.00 . A A .  94 ARG C    1 1 
        2  4439 1 1  94 ARG CA   C -14.872   3.555  -9.437 1.00 . A A .  94 ARG CA   1 1 
        2  4440 1 1  94 ARG CB   C -15.335   3.599 -10.935 1.00 . A A .  94 ARG CB   1 1 
        2  4441 1 1  94 ARG CD   C -16.974   5.579 -10.775 1.00 . A A .  94 ARG CD   1 1 
        2  4442 1 1  94 ARG CG   C -16.787   4.093 -11.155 1.00 . A A .  94 ARG CG   1 1 
        2  4443 1 1  94 ARG CZ   C -18.740   7.286 -11.295 1.00 . A A .  94 ARG CZ   1 1 
        2  4444 1 1  94 ARG H    H -13.038   2.868  -8.525 1.00 . A A .  94 ARG H    1 1 
        2  4445 1 1  94 ARG HA   H -15.156   4.488  -8.948 1.00 . A A .  94 ARG HA   1 1 
        2  4446 1 1  94 ARG HB2  H -14.671   4.259 -11.480 1.00 . A A .  94 ARG HB2  1 1 
        2  4447 1 1  94 ARG HB3  H -15.243   2.606 -11.366 1.00 . A A .  94 ARG HB3  1 1 
        2  4448 1 1  94 ARG HD2  H -16.692   5.715  -9.737 1.00 . A A .  94 ARG HD2  1 1 
        2  4449 1 1  94 ARG HD3  H -16.318   6.186 -11.398 1.00 . A A .  94 ARG HD3  1 1 
        2  4450 1 1  94 ARG HE   H -19.079   5.378 -10.767 1.00 . A A .  94 ARG HE   1 1 
        2  4451 1 1  94 ARG HG2  H -17.042   3.965 -12.199 1.00 . A A .  94 ARG HG2  1 1 
        2  4452 1 1  94 ARG HG3  H -17.457   3.493 -10.550 1.00 . A A .  94 ARG HG3  1 1 
        2  4453 1 1  94 ARG HH11 H -16.848   8.001 -11.478 1.00 . A A .  94 ARG HH11 1 1 
        2  4454 1 1  94 ARG HH12 H -18.104   9.146 -11.811 1.00 . A A .  94 ARG HH12 1 1 
        2  4455 1 1  94 ARG HH21 H -20.734   6.915 -11.163 1.00 . A A .  94 ARG HH21 1 1 
        2  4456 1 1  94 ARG HH22 H -20.308   8.535 -11.632 1.00 . A A .  94 ARG HH22 1 1 
        2  4457 1 1  94 ARG N    N -13.389   3.422  -9.254 1.00 . A A .  94 ARG N    1 1 
        2  4458 1 1  94 ARG NE   N -18.370   6.041 -10.936 1.00 . A A .  94 ARG NE   1 1 
        2  4459 1 1  94 ARG NH1  N -17.824   8.220 -11.546 1.00 . A A .  94 ARG NH1  1 1 
        2  4460 1 1  94 ARG NH2  N -20.030   7.605 -11.367 1.00 . A A .  94 ARG NH2  1 1 
        2  4461 1 1  94 ARG O    O -16.667   2.577  -8.141 1.00 . A A .  94 ARG O    1 1 
        2  4462 1 1  95 ASP C    C -15.920  -0.245  -7.005 1.00 . A A .  95 ASP C    1 1 
        2  4463 1 1  95 ASP CA   C -15.694  -0.089  -8.509 1.00 . A A .  95 ASP CA   1 1 
        2  4464 1 1  95 ASP CB   C -14.908  -1.302  -9.086 1.00 . A A .  95 ASP CB   1 1 
        2  4465 1 1  95 ASP CG   C -15.647  -2.648  -8.921 1.00 . A A .  95 ASP CG   1 1 
        2  4466 1 1  95 ASP H    H -14.073   1.147  -9.139 1.00 . A A .  95 ASP H    1 1 
        2  4467 1 1  95 ASP HA   H -16.658  -0.063  -8.983 1.00 . A A .  95 ASP HA   1 1 
        2  4468 1 1  95 ASP HB2  H -14.741  -1.135 -10.144 1.00 . A A .  95 ASP HB2  1 1 
        2  4469 1 1  95 ASP HB3  H -13.938  -1.364  -8.594 1.00 . A A .  95 ASP HB3  1 1 
        2  4470 1 1  95 ASP N    N -15.006   1.181  -8.841 1.00 . A A .  95 ASP N    1 1 
        2  4471 1 1  95 ASP O    O -14.989  -0.585  -6.286 1.00 . A A .  95 ASP O    1 1 
        2  4472 1 1  95 ASP OD1  O -16.712  -2.826  -9.537 1.00 . A A .  95 ASP OD1  1 1 
        2  4473 1 1  95 ASP OD2  O -15.173  -3.528  -8.179 1.00 . A A .  95 ASP OD2  1 1 
        2  4474 1 1  96 CYS C    C -17.208  -1.397  -4.477 1.00 . A A .  96 CYS C    1 1 
        2  4475 1 1  96 CYS CA   C -17.587  -0.061  -5.142 1.00 . A A .  96 CYS CA   1 1 
        2  4476 1 1  96 CYS CB   C -19.110   0.189  -5.026 1.00 . A A .  96 CYS CB   1 1 
        2  4477 1 1  96 CYS H    H -17.856   0.244  -7.229 1.00 . A A .  96 CYS H    1 1 
        2  4478 1 1  96 CYS HA   H -17.072   0.743  -4.628 1.00 . A A .  96 CYS HA   1 1 
        2  4479 1 1  96 CYS HB2  H -19.654  -0.555  -5.597 1.00 . A A .  96 CYS HB2  1 1 
        2  4480 1 1  96 CYS HB3  H -19.414   0.128  -3.984 1.00 . A A .  96 CYS HB3  1 1 
        2  4481 1 1  96 CYS HG   H -19.550   1.786  -6.961 1.00 . A A .  96 CYS HG   1 1 
        2  4482 1 1  96 CYS N    N -17.173   0.003  -6.562 1.00 . A A .  96 CYS N    1 1 
        2  4483 1 1  96 CYS O    O -16.797  -1.421  -3.309 1.00 . A A .  96 CYS O    1 1 
        2  4484 1 1  96 CYS SG   S -19.609   1.810  -5.635 1.00 . A A .  96 CYS SG   1 1 
        2  4485 1 1  97 GLU C    C -15.418  -3.878  -4.481 1.00 . A A .  97 GLU C    1 1 
        2  4486 1 1  97 GLU CA   C -16.918  -3.833  -4.806 1.00 . A A .  97 GLU CA   1 1 
        2  4487 1 1  97 GLU CB   C -17.269  -4.891  -5.878 1.00 . A A .  97 GLU CB   1 1 
        2  4488 1 1  97 GLU CD   C -17.151  -7.354  -6.602 1.00 . A A .  97 GLU CD   1 1 
        2  4489 1 1  97 GLU CG   C -16.914  -6.340  -5.479 1.00 . A A .  97 GLU CG   1 1 
        2  4490 1 1  97 GLU H    H -17.566  -2.374  -6.194 1.00 . A A .  97 GLU H    1 1 
        2  4491 1 1  97 GLU HA   H -17.486  -4.045  -3.904 1.00 . A A .  97 GLU HA   1 1 
        2  4492 1 1  97 GLU HB2  H -18.334  -4.841  -6.074 1.00 . A A .  97 GLU HB2  1 1 
        2  4493 1 1  97 GLU HB3  H -16.739  -4.645  -6.795 1.00 . A A .  97 GLU HB3  1 1 
        2  4494 1 1  97 GLU HG2  H -15.866  -6.373  -5.190 1.00 . A A .  97 GLU HG2  1 1 
        2  4495 1 1  97 GLU HG3  H -17.514  -6.620  -4.618 1.00 . A A .  97 GLU HG3  1 1 
        2  4496 1 1  97 GLU N    N -17.289  -2.491  -5.260 1.00 . A A .  97 GLU N    1 1 
        2  4497 1 1  97 GLU O    O -15.032  -4.436  -3.467 1.00 . A A .  97 GLU O    1 1 
        2  4498 1 1  97 GLU OE1  O -18.294  -7.834  -6.751 1.00 . A A .  97 GLU OE1  1 1 
        2  4499 1 1  97 GLU OE2  O -16.191  -7.678  -7.333 1.00 . A A .  97 GLU OE2  1 1 
        2  4500 1 1  98 LEU C    C -12.782  -2.305  -3.938 1.00 . A A .  98 LEU C    1 1 
        2  4501 1 1  98 LEU CA   C -13.138  -3.136  -5.175 1.00 . A A .  98 LEU CA   1 1 
        2  4502 1 1  98 LEU CB   C -12.479  -2.483  -6.413 1.00 . A A .  98 LEU CB   1 1 
        2  4503 1 1  98 LEU CD1  C -10.228  -3.696  -6.518 1.00 . A A .  98 LEU CD1  1 1 
        2  4504 1 1  98 LEU CD2  C -10.424  -1.276  -7.346 1.00 . A A .  98 LEU CD2  1 1 
        2  4505 1 1  98 LEU CG   C -10.930  -2.333  -6.347 1.00 . A A .  98 LEU CG   1 1 
        2  4506 1 1  98 LEU H    H -15.007  -2.823  -6.143 1.00 . A A .  98 LEU H    1 1 
        2  4507 1 1  98 LEU HA   H -12.751  -4.145  -5.057 1.00 . A A .  98 LEU HA   1 1 
        2  4508 1 1  98 LEU HB2  H -12.738  -3.076  -7.288 1.00 . A A .  98 LEU HB2  1 1 
        2  4509 1 1  98 LEU HB3  H -12.918  -1.495  -6.543 1.00 . A A .  98 LEU HB3  1 1 
        2  4510 1 1  98 LEU HD11 H -10.479  -4.125  -7.479 1.00 . A A .  98 LEU HD11 1 1 
        2  4511 1 1  98 LEU HD12 H -10.544  -4.370  -5.731 1.00 . A A .  98 LEU HD12 1 1 
        2  4512 1 1  98 LEU HD13 H  -9.157  -3.561  -6.454 1.00 . A A .  98 LEU HD13 1 1 
        2  4513 1 1  98 LEU HD21 H  -9.348  -1.184  -7.265 1.00 . A A .  98 LEU HD21 1 1 
        2  4514 1 1  98 LEU HD22 H -10.879  -0.318  -7.119 1.00 . A A .  98 LEU HD22 1 1 
        2  4515 1 1  98 LEU HD23 H -10.684  -1.564  -8.355 1.00 . A A .  98 LEU HD23 1 1 
        2  4516 1 1  98 LEU HG   H -10.665  -1.979  -5.355 1.00 . A A .  98 LEU HG   1 1 
        2  4517 1 1  98 LEU N    N -14.602  -3.239  -5.347 1.00 . A A .  98 LEU N    1 1 
        2  4518 1 1  98 LEU O    O -11.838  -2.636  -3.230 1.00 . A A .  98 LEU O    1 1 
        2  4519 1 1  99 TYR C    C -13.552  -1.256  -1.252 1.00 . A A .  99 TYR C    1 1 
        2  4520 1 1  99 TYR CA   C -13.402  -0.369  -2.508 1.00 . A A .  99 TYR CA   1 1 
        2  4521 1 1  99 TYR CB   C -14.471   0.773  -2.508 1.00 . A A .  99 TYR CB   1 1 
        2  4522 1 1  99 TYR CD1  C -13.916   1.709  -4.861 1.00 . A A .  99 TYR CD1  1 1 
        2  4523 1 1  99 TYR CD2  C -14.354   3.267  -3.112 1.00 . A A .  99 TYR CD2  1 1 
        2  4524 1 1  99 TYR CE1  C -13.717   2.755  -5.737 1.00 . A A .  99 TYR CE1  1 1 
        2  4525 1 1  99 TYR CE2  C -14.157   4.312  -3.995 1.00 . A A .  99 TYR CE2  1 1 
        2  4526 1 1  99 TYR CG   C -14.241   1.933  -3.517 1.00 . A A .  99 TYR CG   1 1 
        2  4527 1 1  99 TYR CZ   C -13.836   4.048  -5.305 1.00 . A A .  99 TYR CZ   1 1 
        2  4528 1 1  99 TYR H    H -14.231  -0.982  -4.375 1.00 . A A .  99 TYR H    1 1 
        2  4529 1 1  99 TYR HA   H -12.406   0.067  -2.516 1.00 . A A .  99 TYR HA   1 1 
        2  4530 1 1  99 TYR HB2  H -15.440   0.343  -2.736 1.00 . A A .  99 TYR HB2  1 1 
        2  4531 1 1  99 TYR HB3  H -14.517   1.202  -1.510 1.00 . A A .  99 TYR HB3  1 1 
        2  4532 1 1  99 TYR HD1  H -13.836   0.690  -5.231 1.00 . A A .  99 TYR HD1  1 1 
        2  4533 1 1  99 TYR HD2  H -14.607   3.480  -2.081 1.00 . A A .  99 TYR HD2  1 1 
        2  4534 1 1  99 TYR HE1  H -13.459   2.552  -6.765 1.00 . A A .  99 TYR HE1  1 1 
        2  4535 1 1  99 TYR HE2  H -14.252   5.336  -3.654 1.00 . A A .  99 TYR HE2  1 1 
        2  4536 1 1  99 TYR HH   H -13.023   5.730  -5.793 1.00 . A A .  99 TYR HH   1 1 
        2  4537 1 1  99 TYR N    N -13.542  -1.216  -3.712 1.00 . A A .  99 TYR N    1 1 
        2  4538 1 1  99 TYR O    O -12.642  -1.346  -0.414 1.00 . A A .  99 TYR O    1 1 
        2  4539 1 1  99 TYR OH   O -13.619   5.084  -6.191 1.00 . A A .  99 TYR OH   1 1 
        2  4540 1 1 100 ARG C    C -14.123  -4.137  -0.046 1.00 . A A . 100 ARG C    1 1 
        2  4541 1 1 100 ARG CA   C -15.027  -2.888  -0.097 1.00 . A A . 100 ARG CA   1 1 
        2  4542 1 1 100 ARG CB   C -16.519  -3.295  -0.165 1.00 . A A . 100 ARG CB   1 1 
        2  4543 1 1 100 ARG CD   C -17.315  -1.053   0.844 1.00 . A A . 100 ARG CD   1 1 
        2  4544 1 1 100 ARG CG   C -17.496  -2.099  -0.275 1.00 . A A . 100 ARG CG   1 1 
        2  4545 1 1 100 ARG CZ   C -17.978   1.302   1.301 1.00 . A A . 100 ARG CZ   1 1 
        2  4546 1 1 100 ARG H    H -15.284  -1.937  -1.998 1.00 . A A . 100 ARG H    1 1 
        2  4547 1 1 100 ARG HA   H -14.869  -2.320   0.817 1.00 . A A . 100 ARG HA   1 1 
        2  4548 1 1 100 ARG HB2  H -16.671  -3.937  -1.028 1.00 . A A . 100 ARG HB2  1 1 
        2  4549 1 1 100 ARG HB3  H -16.770  -3.856   0.728 1.00 . A A . 100 ARG HB3  1 1 
        2  4550 1 1 100 ARG HD2  H -17.692  -1.458   1.778 1.00 . A A . 100 ARG HD2  1 1 
        2  4551 1 1 100 ARG HD3  H -16.259  -0.827   0.958 1.00 . A A . 100 ARG HD3  1 1 
        2  4552 1 1 100 ARG HE   H -18.574   0.207  -0.266 1.00 . A A . 100 ARG HE   1 1 
        2  4553 1 1 100 ARG HG2  H -17.336  -1.614  -1.228 1.00 . A A . 100 ARG HG2  1 1 
        2  4554 1 1 100 ARG HG3  H -18.512  -2.477  -0.241 1.00 . A A . 100 ARG HG3  1 1 
        2  4555 1 1 100 ARG HH11 H -16.717   0.574   2.723 1.00 . A A . 100 ARG HH11 1 1 
        2  4556 1 1 100 ARG HH12 H -17.237   2.214   2.963 1.00 . A A . 100 ARG HH12 1 1 
        2  4557 1 1 100 ARG HH21 H -19.201   2.331   0.075 1.00 . A A . 100 ARG HH21 1 1 
        2  4558 1 1 100 ARG HH22 H -18.637   3.198   1.468 1.00 . A A . 100 ARG HH22 1 1 
        2  4559 1 1 100 ARG N    N -14.678  -1.997  -1.222 1.00 . A A . 100 ARG N    1 1 
        2  4560 1 1 100 ARG NE   N -18.029   0.192   0.553 1.00 . A A . 100 ARG NE   1 1 
        2  4561 1 1 100 ARG NH1  N -17.254   1.365   2.419 1.00 . A A . 100 ARG NH1  1 1 
        2  4562 1 1 100 ARG NH2  N -18.663   2.360   0.918 1.00 . A A . 100 ARG NH2  1 1 
        2  4563 1 1 100 ARG O    O -13.907  -4.696   1.032 1.00 . A A . 100 ARG O    1 1 
        2  4564 1 1 101 ALA C    C -11.332  -5.420  -0.729 1.00 . A A . 101 ALA C    1 1 
        2  4565 1 1 101 ALA CA   C -12.703  -5.724  -1.324 1.00 . A A . 101 ALA CA   1 1 
        2  4566 1 1 101 ALA CB   C -12.563  -6.176  -2.788 1.00 . A A . 101 ALA CB   1 1 
        2  4567 1 1 101 ALA H    H -13.692  -3.982  -2.009 1.00 . A A . 101 ALA H    1 1 
        2  4568 1 1 101 ALA HA   H -13.174  -6.533  -0.762 1.00 . A A . 101 ALA HA   1 1 
        2  4569 1 1 101 ALA HB1  H -13.542  -6.403  -3.192 1.00 . A A . 101 ALA HB1  1 1 
        2  4570 1 1 101 ALA HB2  H -11.944  -7.061  -2.839 1.00 . A A . 101 ALA HB2  1 1 
        2  4571 1 1 101 ALA HB3  H -12.111  -5.385  -3.377 1.00 . A A . 101 ALA HB3  1 1 
        2  4572 1 1 101 ALA N    N -13.563  -4.535  -1.210 1.00 . A A . 101 ALA N    1 1 
        2  4573 1 1 101 ALA O    O -10.887  -6.121   0.176 1.00 . A A . 101 ALA O    1 1 
        2  4574 1 1 102 LEU C    C  -9.473  -3.565   0.775 1.00 . A A . 102 LEU C    1 1 
        2  4575 1 1 102 LEU CA   C  -9.394  -3.853  -0.730 1.00 . A A . 102 LEU CA   1 1 
        2  4576 1 1 102 LEU CB   C  -8.939  -2.582  -1.504 1.00 . A A . 102 LEU CB   1 1 
        2  4577 1 1 102 LEU CD1  C  -8.175  -1.457  -3.685 1.00 . A A . 102 LEU CD1  1 1 
        2  4578 1 1 102 LEU CD2  C  -7.539  -3.884  -3.224 1.00 . A A . 102 LEU CD2  1 1 
        2  4579 1 1 102 LEU CG   C  -8.606  -2.786  -3.021 1.00 . A A . 102 LEU CG   1 1 
        2  4580 1 1 102 LEU H    H -11.047  -3.901  -2.028 1.00 . A A . 102 LEU H    1 1 
        2  4581 1 1 102 LEU HA   H  -8.662  -4.640  -0.896 1.00 . A A . 102 LEU HA   1 1 
        2  4582 1 1 102 LEU HB2  H  -9.733  -1.842  -1.428 1.00 . A A . 102 LEU HB2  1 1 
        2  4583 1 1 102 LEU HB3  H  -8.058  -2.178  -1.016 1.00 . A A . 102 LEU HB3  1 1 
        2  4584 1 1 102 LEU HD11 H  -7.975  -1.621  -4.737 1.00 . A A . 102 LEU HD11 1 1 
        2  4585 1 1 102 LEU HD12 H  -7.283  -1.074  -3.207 1.00 . A A . 102 LEU HD12 1 1 
        2  4586 1 1 102 LEU HD13 H  -8.971  -0.730  -3.585 1.00 . A A . 102 LEU HD13 1 1 
        2  4587 1 1 102 LEU HD21 H  -6.624  -3.615  -2.711 1.00 . A A . 102 LEU HD21 1 1 
        2  4588 1 1 102 LEU HD22 H  -7.334  -3.999  -4.281 1.00 . A A . 102 LEU HD22 1 1 
        2  4589 1 1 102 LEU HD23 H  -7.906  -4.824  -2.834 1.00 . A A . 102 LEU HD23 1 1 
        2  4590 1 1 102 LEU HG   H  -9.507  -3.115  -3.528 1.00 . A A . 102 LEU HG   1 1 
        2  4591 1 1 102 LEU N    N -10.676  -4.354  -1.249 1.00 . A A . 102 LEU N    1 1 
        2  4592 1 1 102 LEU O    O  -8.580  -3.978   1.519 1.00 . A A . 102 LEU O    1 1 
        2  4593 1 1 103 ASN C    C -10.815  -4.027   3.414 1.00 . A A . 103 ASN C    1 1 
        2  4594 1 1 103 ASN CA   C -10.821  -2.683   2.662 1.00 . A A . 103 ASN CA   1 1 
        2  4595 1 1 103 ASN CB   C -12.148  -1.916   2.911 1.00 . A A . 103 ASN CB   1 1 
        2  4596 1 1 103 ASN CG   C -12.085  -0.455   2.459 1.00 . A A . 103 ASN CG   1 1 
        2  4597 1 1 103 ASN H    H -11.197  -2.516   0.557 1.00 . A A . 103 ASN H    1 1 
        2  4598 1 1 103 ASN HA   H  -9.997  -2.080   3.040 1.00 . A A . 103 ASN HA   1 1 
        2  4599 1 1 103 ASN HB2  H -12.952  -2.407   2.367 1.00 . A A . 103 ASN HB2  1 1 
        2  4600 1 1 103 ASN HB3  H -12.385  -1.928   3.969 1.00 . A A . 103 ASN HB3  1 1 
        2  4601 1 1 103 ASN HD21 H -14.055  -0.397   2.209 1.00 . A A . 103 ASN HD21 1 1 
        2  4602 1 1 103 ASN HD22 H -13.207   1.062   1.844 1.00 . A A . 103 ASN HD22 1 1 
        2  4603 1 1 103 ASN N    N -10.563  -2.893   1.217 1.00 . A A . 103 ASN N    1 1 
        2  4604 1 1 103 ASN ND2  N -13.230   0.131   2.139 1.00 . A A . 103 ASN ND2  1 1 
        2  4605 1 1 103 ASN O    O -10.015  -4.212   4.323 1.00 . A A . 103 ASN O    1 1 
        2  4606 1 1 103 ASN OD1  O -11.012   0.144   2.413 1.00 . A A . 103 ASN OD1  1 1 
        2  4607 1 1 104 MET C    C -10.355  -7.058   3.589 1.00 . A A . 104 MET C    1 1 
        2  4608 1 1 104 MET CA   C -11.733  -6.342   3.520 1.00 . A A . 104 MET CA   1 1 
        2  4609 1 1 104 MET CB   C -12.740  -7.197   2.704 1.00 . A A . 104 MET CB   1 1 
        2  4610 1 1 104 MET CE   C -13.932 -11.215   2.972 1.00 . A A . 104 MET CE   1 1 
        2  4611 1 1 104 MET CG   C -12.935  -8.629   3.217 1.00 . A A . 104 MET CG   1 1 
        2  4612 1 1 104 MET H    H -12.159  -4.780   2.125 1.00 . A A . 104 MET H    1 1 
        2  4613 1 1 104 MET HA   H -12.111  -6.223   4.528 1.00 . A A . 104 MET HA   1 1 
        2  4614 1 1 104 MET HB2  H -13.702  -6.702   2.715 1.00 . A A . 104 MET HB2  1 1 
        2  4615 1 1 104 MET HB3  H -12.397  -7.252   1.675 1.00 . A A . 104 MET HB3  1 1 
        2  4616 1 1 104 MET HE1  H -14.346 -11.149   3.968 1.00 . A A . 104 MET HE1  1 1 
        2  4617 1 1 104 MET HE2  H -12.899 -11.531   3.031 1.00 . A A . 104 MET HE2  1 1 
        2  4618 1 1 104 MET HE3  H -14.494 -11.934   2.397 1.00 . A A . 104 MET HE3  1 1 
        2  4619 1 1 104 MET HG2  H -11.972  -9.121   3.255 1.00 . A A . 104 MET HG2  1 1 
        2  4620 1 1 104 MET HG3  H -13.354  -8.589   4.213 1.00 . A A . 104 MET HG3  1 1 
        2  4621 1 1 104 MET N    N -11.624  -4.988   2.927 1.00 . A A . 104 MET N    1 1 
        2  4622 1 1 104 MET O    O -10.071  -7.777   4.557 1.00 . A A . 104 MET O    1 1 
        2  4623 1 1 104 MET SD   S -14.026  -9.612   2.172 1.00 . A A . 104 MET SD   1 1 
        2  4624 1 1 105 HIS C    C  -7.173  -6.913   3.446 1.00 . A A . 105 HIS C    1 1 
        2  4625 1 1 105 HIS CA   C  -8.184  -7.481   2.439 1.00 . A A . 105 HIS CA   1 1 
        2  4626 1 1 105 HIS CB   C  -7.609  -7.313   1.005 1.00 . A A . 105 HIS CB   1 1 
        2  4627 1 1 105 HIS CD2  C  -9.373  -8.899  -0.087 1.00 . A A . 105 HIS CD2  1 1 
        2  4628 1 1 105 HIS CE1  C  -9.251  -8.135  -2.133 1.00 . A A . 105 HIS CE1  1 1 
        2  4629 1 1 105 HIS CG   C  -8.452  -7.900  -0.097 1.00 . A A . 105 HIS CG   1 1 
        2  4630 1 1 105 HIS H    H  -9.773  -6.179   1.878 1.00 . A A . 105 HIS H    1 1 
        2  4631 1 1 105 HIS HA   H  -8.321  -8.540   2.640 1.00 . A A . 105 HIS HA   1 1 
        2  4632 1 1 105 HIS HB2  H  -7.492  -6.255   0.797 1.00 . A A . 105 HIS HB2  1 1 
        2  4633 1 1 105 HIS HB3  H  -6.635  -7.786   0.955 1.00 . A A . 105 HIS HB3  1 1 
        2  4634 1 1 105 HIS HD1  H  -7.806  -6.748  -1.741 1.00 . A A . 105 HIS HD1  1 1 
        2  4635 1 1 105 HIS HD2  H  -9.675  -9.490   0.770 1.00 . A A . 105 HIS HD2  1 1 
        2  4636 1 1 105 HIS HE1  H  -9.426  -7.997  -3.188 1.00 . A A . 105 HIS HE1  1 1 
        2  4637 1 1 105 HIS HE2  H -10.636  -9.548  -1.627 1.00 . A A . 105 HIS HE2  1 1 
        2  4638 1 1 105 HIS N    N  -9.506  -6.826   2.566 1.00 . A A . 105 HIS N    1 1 
        2  4639 1 1 105 HIS ND1  N  -8.400  -7.449  -1.399 1.00 . A A . 105 HIS ND1  1 1 
        2  4640 1 1 105 HIS NE2  N  -9.849  -9.019  -1.365 1.00 . A A . 105 HIS NE2  1 1 
        2  4641 1 1 105 HIS O    O  -6.435  -7.671   4.085 1.00 . A A . 105 HIS O    1 1 
        2  4642 1 1 106 TYR C    C  -6.672  -4.761   5.857 1.00 . A A . 106 TYR C    1 1 
        2  4643 1 1 106 TYR CA   C  -6.144  -4.888   4.412 1.00 . A A . 106 TYR CA   1 1 
        2  4644 1 1 106 TYR CB   C  -5.788  -3.504   3.806 1.00 . A A . 106 TYR CB   1 1 
        2  4645 1 1 106 TYR CD1  C  -4.162  -4.371   2.028 1.00 . A A . 106 TYR CD1  1 1 
        2  4646 1 1 106 TYR CD2  C  -5.859  -2.846   1.318 1.00 . A A . 106 TYR CD2  1 1 
        2  4647 1 1 106 TYR CE1  C  -3.699  -4.457   0.729 1.00 . A A . 106 TYR CE1  1 1 
        2  4648 1 1 106 TYR CE2  C  -5.393  -2.930   0.021 1.00 . A A . 106 TYR CE2  1 1 
        2  4649 1 1 106 TYR CG   C  -5.256  -3.569   2.356 1.00 . A A . 106 TYR CG   1 1 
        2  4650 1 1 106 TYR CZ   C  -4.319  -3.738  -0.267 1.00 . A A . 106 TYR CZ   1 1 
        2  4651 1 1 106 TYR H    H  -7.773  -5.036   3.048 1.00 . A A . 106 TYR H    1 1 
        2  4652 1 1 106 TYR HA   H  -5.238  -5.492   4.429 1.00 . A A . 106 TYR HA   1 1 
        2  4653 1 1 106 TYR HB2  H  -6.676  -2.882   3.812 1.00 . A A . 106 TYR HB2  1 1 
        2  4654 1 1 106 TYR HB3  H  -5.029  -3.031   4.418 1.00 . A A . 106 TYR HB3  1 1 
        2  4655 1 1 106 TYR HD1  H  -3.670  -4.942   2.809 1.00 . A A . 106 TYR HD1  1 1 
        2  4656 1 1 106 TYR HD2  H  -6.706  -2.211   1.543 1.00 . A A . 106 TYR HD2  1 1 
        2  4657 1 1 106 TYR HE1  H  -2.849  -5.089   0.499 1.00 . A A . 106 TYR HE1  1 1 
        2  4658 1 1 106 TYR HE2  H  -5.880  -2.366  -0.766 1.00 . A A . 106 TYR HE2  1 1 
        2  4659 1 1 106 TYR HH   H  -3.614  -4.748  -1.739 1.00 . A A . 106 TYR HH   1 1 
        2  4660 1 1 106 TYR N    N  -7.128  -5.577   3.557 1.00 . A A . 106 TYR N    1 1 
        2  4661 1 1 106 TYR O    O  -6.109  -5.361   6.775 1.00 . A A . 106 TYR O    1 1 
        2  4662 1 1 106 TYR OH   O  -3.870  -3.839  -1.561 1.00 . A A . 106 TYR OH   1 1 
        2  4663 1 1 107 ASN C    C  -9.912  -3.930   7.283 1.00 . A A . 107 ASN C    1 1 
        2  4664 1 1 107 ASN CA   C  -8.387  -3.802   7.382 1.00 . A A . 107 ASN CA   1 1 
        2  4665 1 1 107 ASN CB   C  -7.973  -2.412   7.949 1.00 . A A . 107 ASN CB   1 1 
        2  4666 1 1 107 ASN CG   C  -8.640  -2.040   9.287 1.00 . A A . 107 ASN CG   1 1 
        2  4667 1 1 107 ASN H    H  -8.273  -3.693   5.250 1.00 . A A . 107 ASN H    1 1 
        2  4668 1 1 107 ASN HA   H  -8.020  -4.576   8.055 1.00 . A A . 107 ASN HA   1 1 
        2  4669 1 1 107 ASN HB2  H  -6.902  -2.405   8.104 1.00 . A A . 107 ASN HB2  1 1 
        2  4670 1 1 107 ASN HB3  H  -8.221  -1.653   7.214 1.00 . A A . 107 ASN HB3  1 1 
        2  4671 1 1 107 ASN HD21 H  -8.623  -0.115   8.794 1.00 . A A . 107 ASN HD21 1 1 
        2  4672 1 1 107 ASN HD22 H  -9.316  -0.493  10.330 1.00 . A A . 107 ASN HD22 1 1 
        2  4673 1 1 107 ASN N    N  -7.793  -4.039   6.041 1.00 . A A . 107 ASN N    1 1 
        2  4674 1 1 107 ASN ND2  N  -8.882  -0.753   9.494 1.00 . A A . 107 ASN ND2  1 1 
        2  4675 1 1 107 ASN O    O -10.580  -3.035   6.751 1.00 . A A . 107 ASN O    1 1 
        2  4676 1 1 107 ASN OD1  O  -8.941  -2.896  10.129 1.00 . A A . 107 ASN OD1  1 1 
        2  4677 1 1 108 LYS C    C -12.770  -4.356   8.374 1.00 . A A . 108 LYS C    1 1 
        2  4678 1 1 108 LYS CA   C -11.870  -5.423   7.724 1.00 . A A . 108 LYS CA   1 1 
        2  4679 1 1 108 LYS CB   C -12.113  -6.810   8.387 1.00 . A A . 108 LYS CB   1 1 
        2  4680 1 1 108 LYS CD   C -11.607  -9.333   8.420 1.00 . A A . 108 LYS CD   1 1 
        2  4681 1 1 108 LYS CE   C -10.761 -10.478   7.839 1.00 . A A . 108 LYS CE   1 1 
        2  4682 1 1 108 LYS CG   C -11.304  -7.966   7.760 1.00 . A A . 108 LYS CG   1 1 
        2  4683 1 1 108 LYS H    H  -9.824  -5.646   8.291 1.00 . A A . 108 LYS H    1 1 
        2  4684 1 1 108 LYS HA   H -12.123  -5.494   6.668 1.00 . A A . 108 LYS HA   1 1 
        2  4685 1 1 108 LYS HB2  H -11.855  -6.748   9.441 1.00 . A A . 108 LYS HB2  1 1 
        2  4686 1 1 108 LYS HB3  H -13.168  -7.057   8.307 1.00 . A A . 108 LYS HB3  1 1 
        2  4687 1 1 108 LYS HD2  H -11.405  -9.259   9.482 1.00 . A A . 108 LYS HD2  1 1 
        2  4688 1 1 108 LYS HD3  H -12.659  -9.568   8.276 1.00 . A A . 108 LYS HD3  1 1 
        2  4689 1 1 108 LYS HE2  H  -9.715 -10.274   8.028 1.00 . A A . 108 LYS HE2  1 1 
        2  4690 1 1 108 LYS HE3  H -11.035 -11.402   8.329 1.00 . A A . 108 LYS HE3  1 1 
        2  4691 1 1 108 LYS HG2  H -11.544  -8.028   6.703 1.00 . A A . 108 LYS HG2  1 1 
        2  4692 1 1 108 LYS HG3  H -10.247  -7.750   7.870 1.00 . A A . 108 LYS HG3  1 1 
        2  4693 1 1 108 LYS HZ1  H -10.581  -9.818   5.862 1.00 . A A . 108 LYS HZ1  1 1 
        2  4694 1 1 108 LYS HZ2  H -11.966 -10.746   6.152 1.00 . A A . 108 LYS HZ2  1 1 
        2  4695 1 1 108 LYS HZ3  H -10.456 -11.493   6.038 1.00 . A A . 108 LYS HZ3  1 1 
        2  4696 1 1 108 LYS N    N -10.438  -5.053   7.812 1.00 . A A . 108 LYS N    1 1 
        2  4697 1 1 108 LYS NZ   N -10.955 -10.641   6.371 1.00 . A A . 108 LYS NZ   1 1 
        2  4698 1 1 108 LYS O    O -13.922  -4.169   7.972 1.00 . A A . 108 LYS O    1 1 
        2  4699 1 1 109 ALA C    C -12.308  -1.191   9.657 1.00 . A A . 109 ALA C    1 1 
        2  4700 1 1 109 ALA CA   C -12.890  -2.554  10.075 1.00 . A A . 109 ALA CA   1 1 
        2  4701 1 1 109 ALA CB   C -12.784  -2.775  11.598 1.00 . A A . 109 ALA CB   1 1 
        2  4702 1 1 109 ALA H    H -11.302  -3.886   9.649 1.00 . A A . 109 ALA H    1 1 
        2  4703 1 1 109 ALA HA   H -13.945  -2.566   9.810 1.00 . A A . 109 ALA HA   1 1 
        2  4704 1 1 109 ALA HB1  H -11.743  -2.770  11.898 1.00 . A A . 109 ALA HB1  1 1 
        2  4705 1 1 109 ALA HB2  H -13.224  -3.729  11.859 1.00 . A A . 109 ALA HB2  1 1 
        2  4706 1 1 109 ALA HB3  H -13.310  -1.988  12.122 1.00 . A A . 109 ALA HB3  1 1 
        2  4707 1 1 109 ALA N    N -12.212  -3.654   9.375 1.00 . A A . 109 ALA N    1 1 
        2  4708 1 1 109 ALA O    O -12.062  -0.326  10.514 1.00 . A A . 109 ALA O    1 1 
        2  4709 1 1 110 ASN C    C -12.998   1.215   7.971 1.00 . A A . 110 ASN C    1 1 
        2  4710 1 1 110 ASN CA   C -11.757   0.327   7.763 1.00 . A A . 110 ASN CA   1 1 
        2  4711 1 1 110 ASN CB   C -11.366   0.283   6.248 1.00 . A A . 110 ASN CB   1 1 
        2  4712 1 1 110 ASN CG   C -10.849   1.644   5.696 1.00 . A A . 110 ASN CG   1 1 
        2  4713 1 1 110 ASN H    H -12.001  -1.794   7.742 1.00 . A A . 110 ASN H    1 1 
        2  4714 1 1 110 ASN HA   H -10.921   0.744   8.328 1.00 . A A . 110 ASN HA   1 1 
        2  4715 1 1 110 ASN HB2  H -10.589  -0.462   6.110 1.00 . A A . 110 ASN HB2  1 1 
        2  4716 1 1 110 ASN HB3  H -12.232  -0.014   5.664 1.00 . A A . 110 ASN HB3  1 1 
        2  4717 1 1 110 ASN HD21 H  -9.899   0.745   4.214 1.00 . A A . 110 ASN HD21 1 1 
        2  4718 1 1 110 ASN HD22 H  -9.767   2.467   4.267 1.00 . A A . 110 ASN HD22 1 1 
        2  4719 1 1 110 ASN N    N -12.047  -1.011   8.331 1.00 . A A . 110 ASN N    1 1 
        2  4720 1 1 110 ASN ND2  N -10.096   1.613   4.621 1.00 . A A . 110 ASN ND2  1 1 
        2  4721 1 1 110 ASN O    O -13.993   1.099   7.246 1.00 . A A . 110 ASN O    1 1 
        2  4722 1 1 110 ASN OD1  O -11.147   2.723   6.219 1.00 . A A . 110 ASN OD1  1 1 
        2  4723 1 1 111 ASP C    C -14.379   4.008   8.417 1.00 . A A . 111 ASP C    1 1 
        2  4724 1 1 111 ASP CA   C -14.006   2.933   9.460 1.00 . A A . 111 ASP CA   1 1 
        2  4725 1 1 111 ASP CB   C -13.555   3.592  10.790 1.00 . A A . 111 ASP CB   1 1 
        2  4726 1 1 111 ASP CG   C -14.587   4.551  11.407 1.00 . A A . 111 ASP CG   1 1 
        2  4727 1 1 111 ASP H    H -12.058   2.119   9.470 1.00 . A A . 111 ASP H    1 1 
        2  4728 1 1 111 ASP HA   H -14.875   2.308   9.650 1.00 . A A . 111 ASP HA   1 1 
        2  4729 1 1 111 ASP HB2  H -13.343   2.811  11.514 1.00 . A A . 111 ASP HB2  1 1 
        2  4730 1 1 111 ASP HB3  H -12.630   4.141  10.612 1.00 . A A . 111 ASP HB3  1 1 
        2  4731 1 1 111 ASP N    N -12.910   2.068   8.994 1.00 . A A . 111 ASP N    1 1 
        2  4732 1 1 111 ASP O    O -15.511   4.509   8.402 1.00 . A A . 111 ASP O    1 1 
        2  4733 1 1 111 ASP OD1  O -15.503   4.086  12.120 1.00 . A A . 111 ASP OD1  1 1 
        2  4734 1 1 111 ASP OD2  O -14.481   5.773  11.194 1.00 . A A . 111 ASP OD2  1 1 
        2  4735 1 1 112 PHE C    C -13.925   5.057   5.209 1.00 . A A . 112 PHE C    1 1 
        2  4736 1 1 112 PHE CA   C -13.530   5.484   6.620 1.00 . A A . 112 PHE CA   1 1 
        2  4737 1 1 112 PHE CB   C -12.198   6.273   6.597 1.00 . A A . 112 PHE CB   1 1 
        2  4738 1 1 112 PHE CD1  C -12.295   8.202   8.246 1.00 . A A . 112 PHE CD1  1 1 
        2  4739 1 1 112 PHE CD2  C -11.120   6.225   8.904 1.00 . A A . 112 PHE CD2  1 1 
        2  4740 1 1 112 PHE CE1  C -12.008   8.777   9.470 1.00 . A A . 112 PHE CE1  1 1 
        2  4741 1 1 112 PHE CE2  C -10.835   6.807  10.123 1.00 . A A . 112 PHE CE2  1 1 
        2  4742 1 1 112 PHE CG   C -11.855   6.913   7.940 1.00 . A A . 112 PHE CG   1 1 
        2  4743 1 1 112 PHE CZ   C -11.279   8.081  10.404 1.00 . A A . 112 PHE CZ   1 1 
        2  4744 1 1 112 PHE H    H -12.599   3.798   7.510 1.00 . A A . 112 PHE H    1 1 
        2  4745 1 1 112 PHE HA   H -14.304   6.144   6.986 1.00 . A A . 112 PHE HA   1 1 
        2  4746 1 1 112 PHE HB2  H -11.389   5.602   6.320 1.00 . A A . 112 PHE HB2  1 1 
        2  4747 1 1 112 PHE HB3  H -12.260   7.060   5.854 1.00 . A A . 112 PHE HB3  1 1 
        2  4748 1 1 112 PHE HD1  H -12.868   8.760   7.513 1.00 . A A . 112 PHE HD1  1 1 
        2  4749 1 1 112 PHE HD2  H -10.767   5.223   8.692 1.00 . A A . 112 PHE HD2  1 1 
        2  4750 1 1 112 PHE HE1  H -12.357   9.777   9.693 1.00 . A A . 112 PHE HE1  1 1 
        2  4751 1 1 112 PHE HE2  H -10.258   6.263  10.861 1.00 . A A . 112 PHE HE2  1 1 
        2  4752 1 1 112 PHE HZ   H -11.053   8.534  11.364 1.00 . A A . 112 PHE HZ   1 1 
        2  4753 1 1 112 PHE N    N -13.416   4.345   7.544 1.00 . A A . 112 PHE N    1 1 
        2  4754 1 1 112 PHE O    O -13.581   3.966   4.741 1.00 . A A . 112 PHE O    1 1 
        2  4755 1 1 113 GLU C    C -13.684   6.303   2.400 1.00 . A A . 113 GLU C    1 1 
        2  4756 1 1 113 GLU CA   C -14.949   5.882   3.130 1.00 . A A . 113 GLU CA   1 1 
        2  4757 1 1 113 GLU CB   C -16.126   6.824   2.777 1.00 . A A . 113 GLU CB   1 1 
        2  4758 1 1 113 GLU CD   C -18.023   5.093   2.870 1.00 . A A . 113 GLU CD   1 1 
        2  4759 1 1 113 GLU CG   C -17.468   6.418   3.407 1.00 . A A . 113 GLU CG   1 1 
        2  4760 1 1 113 GLU H    H -14.979   6.741   5.028 1.00 . A A . 113 GLU H    1 1 
        2  4761 1 1 113 GLU HA   H -15.216   4.858   2.876 1.00 . A A . 113 GLU HA   1 1 
        2  4762 1 1 113 GLU HB2  H -15.880   7.823   3.129 1.00 . A A . 113 GLU HB2  1 1 
        2  4763 1 1 113 GLU HB3  H -16.247   6.864   1.698 1.00 . A A . 113 GLU HB3  1 1 
        2  4764 1 1 113 GLU HG2  H -17.327   6.330   4.477 1.00 . A A . 113 GLU HG2  1 1 
        2  4765 1 1 113 GLU HG3  H -18.193   7.205   3.218 1.00 . A A . 113 GLU HG3  1 1 
        2  4766 1 1 113 GLU N    N -14.655   5.962   4.546 1.00 . A A . 113 GLU N    1 1 
        2  4767 1 1 113 GLU O    O -13.402   7.504   2.303 1.00 . A A . 113 GLU O    1 1 
        2  4768 1 1 113 GLU OE1  O -18.642   5.107   1.786 1.00 . A A . 113 GLU OE1  1 1 
        2  4769 1 1 113 GLU OE2  O -17.858   4.036   3.521 1.00 . A A . 113 GLU OE2  1 1 
        2  4770 1 1 114 VAL C    C -11.702   6.596   0.174 1.00 . A A . 114 VAL C    1 1 
        2  4771 1 1 114 VAL CA   C -11.651   5.437   1.215 1.00 . A A . 114 VAL CA   1 1 
        2  4772 1 1 114 VAL CB   C -11.301   4.070   0.473 1.00 . A A . 114 VAL CB   1 1 
        2  4773 1 1 114 VAL CG1  C -10.593   3.068   1.406 1.00 . A A . 114 VAL CG1  1 1 
        2  4774 1 1 114 VAL CG2  C -12.580   3.429  -0.120 1.00 . A A . 114 VAL CG2  1 1 
        2  4775 1 1 114 VAL H    H -13.206   4.378   2.178 1.00 . A A . 114 VAL H    1 1 
        2  4776 1 1 114 VAL HA   H -10.868   5.646   1.928 1.00 . A A . 114 VAL HA   1 1 
        2  4777 1 1 114 VAL HB   H -10.624   4.287  -0.352 1.00 . A A . 114 VAL HB   1 1 
        2  4778 1 1 114 VAL HG11 H -11.214   2.863   2.268 1.00 . A A . 114 VAL HG11 1 1 
        2  4779 1 1 114 VAL HG12 H  -9.650   3.480   1.735 1.00 . A A . 114 VAL HG12 1 1 
        2  4780 1 1 114 VAL HG13 H -10.403   2.144   0.871 1.00 . A A . 114 VAL HG13 1 1 
        2  4781 1 1 114 VAL HG21 H -12.336   2.492  -0.605 1.00 . A A . 114 VAL HG21 1 1 
        2  4782 1 1 114 VAL HG22 H -13.020   4.105  -0.846 1.00 . A A . 114 VAL HG22 1 1 
        2  4783 1 1 114 VAL HG23 H -13.297   3.251   0.673 1.00 . A A . 114 VAL HG23 1 1 
        2  4784 1 1 114 VAL N    N -12.910   5.292   1.983 1.00 . A A . 114 VAL N    1 1 
        2  4785 1 1 114 VAL O    O -12.381   6.469  -0.856 1.00 . A A . 114 VAL O    1 1 
        2  4786 1 1 115 PRO C    C -10.449   8.496  -1.852 1.00 . A A . 115 PRO C    1 1 
        2  4787 1 1 115 PRO CA   C -10.972   8.918  -0.475 1.00 . A A . 115 PRO CA   1 1 
        2  4788 1 1 115 PRO CB   C  -9.987   9.904   0.219 1.00 . A A . 115 PRO CB   1 1 
        2  4789 1 1 115 PRO CD   C -10.335   8.100   1.748 1.00 . A A . 115 PRO CD   1 1 
        2  4790 1 1 115 PRO CG   C -10.117   9.596   1.679 1.00 . A A . 115 PRO CG   1 1 
        2  4791 1 1 115 PRO HA   H -11.948   9.388  -0.584 1.00 . A A . 115 PRO HA   1 1 
        2  4792 1 1 115 PRO HB2  H  -8.967   9.730  -0.126 1.00 . A A . 115 PRO HB2  1 1 
        2  4793 1 1 115 PRO HB3  H -10.271  10.933   0.023 1.00 . A A . 115 PRO HB3  1 1 
        2  4794 1 1 115 PRO HD2  H  -9.388   7.579   1.801 1.00 . A A . 115 PRO HD2  1 1 
        2  4795 1 1 115 PRO HD3  H -10.947   7.843   2.607 1.00 . A A . 115 PRO HD3  1 1 
        2  4796 1 1 115 PRO HG2  H  -9.211   9.886   2.209 1.00 . A A . 115 PRO HG2  1 1 
        2  4797 1 1 115 PRO HG3  H -10.973  10.117   2.102 1.00 . A A . 115 PRO HG3  1 1 
        2  4798 1 1 115 PRO N    N -11.037   7.775   0.468 1.00 . A A . 115 PRO N    1 1 
        2  4799 1 1 115 PRO O    O  -9.726   7.486  -1.962 1.00 . A A . 115 PRO O    1 1 
        2  4800 1 1 116 GLU C    C  -8.842   8.883  -4.332 1.00 . A A . 116 GLU C    1 1 
        2  4801 1 1 116 GLU CA   C -10.366   9.094  -4.265 1.00 . A A . 116 GLU CA   1 1 
        2  4802 1 1 116 GLU CB   C -10.786  10.316  -5.123 1.00 . A A . 116 GLU CB   1 1 
        2  4803 1 1 116 GLU CD   C -10.683  11.491  -7.393 1.00 . A A . 116 GLU CD   1 1 
        2  4804 1 1 116 GLU CG   C -10.488  10.179  -6.626 1.00 . A A . 116 GLU CG   1 1 
        2  4805 1 1 116 GLU H    H -11.400  10.048  -2.687 1.00 . A A . 116 GLU H    1 1 
        2  4806 1 1 116 GLU HA   H -10.866   8.208  -4.641 1.00 . A A . 116 GLU HA   1 1 
        2  4807 1 1 116 GLU HB2  H -11.850  10.468  -5.006 1.00 . A A . 116 GLU HB2  1 1 
        2  4808 1 1 116 GLU HB3  H -10.269  11.201  -4.750 1.00 . A A . 116 GLU HB3  1 1 
        2  4809 1 1 116 GLU HG2  H  -9.459   9.850  -6.751 1.00 . A A . 116 GLU HG2  1 1 
        2  4810 1 1 116 GLU HG3  H -11.143   9.421  -7.047 1.00 . A A . 116 GLU HG3  1 1 
        2  4811 1 1 116 GLU N    N -10.805   9.293  -2.877 1.00 . A A . 116 GLU N    1 1 
        2  4812 1 1 116 GLU O    O  -8.382   8.042  -5.080 1.00 . A A . 116 GLU O    1 1 
        2  4813 1 1 116 GLU OE1  O -11.822  11.789  -7.809 1.00 . A A . 116 GLU OE1  1 1 
        2  4814 1 1 116 GLU OE2  O  -9.701  12.251  -7.557 1.00 . A A . 116 GLU OE2  1 1 
        2  4815 1 1 117 ARG C    C  -6.085   8.102  -3.204 1.00 . A A . 117 ARG C    1 1 
        2  4816 1 1 117 ARG CA   C  -6.649   9.555  -3.288 1.00 . A A . 117 ARG CA   1 1 
        2  4817 1 1 117 ARG CB   C  -6.259  10.311  -1.990 1.00 . A A . 117 ARG CB   1 1 
        2  4818 1 1 117 ARG CD   C  -6.302  12.733  -2.885 1.00 . A A . 117 ARG CD   1 1 
        2  4819 1 1 117 ARG CG   C  -6.845  11.731  -1.853 1.00 . A A . 117 ARG CG   1 1 
        2  4820 1 1 117 ARG CZ   C  -4.229  14.100  -3.241 1.00 . A A . 117 ARG CZ   1 1 
        2  4821 1 1 117 ARG H    H  -8.605  10.295  -2.931 1.00 . A A . 117 ARG H    1 1 
        2  4822 1 1 117 ARG HA   H  -6.202  10.057  -4.135 1.00 . A A . 117 ARG HA   1 1 
        2  4823 1 1 117 ARG HB2  H  -6.598   9.728  -1.135 1.00 . A A . 117 ARG HB2  1 1 
        2  4824 1 1 117 ARG HB3  H  -5.182  10.383  -1.944 1.00 . A A . 117 ARG HB3  1 1 
        2  4825 1 1 117 ARG HD2  H  -6.371  12.298  -3.879 1.00 . A A . 117 ARG HD2  1 1 
        2  4826 1 1 117 ARG HD3  H  -6.916  13.627  -2.852 1.00 . A A . 117 ARG HD3  1 1 
        2  4827 1 1 117 ARG HE   H  -4.424  12.600  -1.917 1.00 . A A . 117 ARG HE   1 1 
        2  4828 1 1 117 ARG HG2  H  -7.923  11.670  -1.961 1.00 . A A . 117 ARG HG2  1 1 
        2  4829 1 1 117 ARG HG3  H  -6.619  12.099  -0.861 1.00 . A A . 117 ARG HG3  1 1 
        2  4830 1 1 117 ARG HH11 H  -5.775  14.634  -4.454 1.00 . A A . 117 ARG HH11 1 1 
        2  4831 1 1 117 ARG HH12 H  -4.315  15.555  -4.654 1.00 . A A . 117 ARG HH12 1 1 
        2  4832 1 1 117 ARG HH21 H  -2.513  13.860  -2.163 1.00 . A A . 117 ARG HH21 1 1 
        2  4833 1 1 117 ARG HH22 H  -2.472  15.122  -3.361 1.00 . A A . 117 ARG HH22 1 1 
        2  4834 1 1 117 ARG N    N  -8.118   9.625  -3.465 1.00 . A A . 117 ARG N    1 1 
        2  4835 1 1 117 ARG NE   N  -4.894  13.109  -2.616 1.00 . A A . 117 ARG NE   1 1 
        2  4836 1 1 117 ARG NH1  N  -4.822  14.821  -4.192 1.00 . A A . 117 ARG NH1  1 1 
        2  4837 1 1 117 ARG NH2  N  -2.971  14.381  -2.895 1.00 . A A . 117 ARG NH2  1 1 
        2  4838 1 1 117 ARG O    O  -5.089   7.786  -3.863 1.00 . A A . 117 ARG O    1 1 
        2  4839 1 1 118 PHE C    C  -6.431   5.063  -3.546 1.00 . A A . 118 PHE C    1 1 
        2  4840 1 1 118 PHE CA   C  -6.340   5.818  -2.209 1.00 . A A . 118 PHE CA   1 1 
        2  4841 1 1 118 PHE CB   C  -7.250   5.127  -1.154 1.00 . A A . 118 PHE CB   1 1 
        2  4842 1 1 118 PHE CD1  C  -5.764   3.243  -0.295 1.00 . A A . 118 PHE CD1  1 1 
        2  4843 1 1 118 PHE CD2  C  -7.833   2.640  -1.351 1.00 . A A . 118 PHE CD2  1 1 
        2  4844 1 1 118 PHE CE1  C  -5.479   1.903  -0.103 1.00 . A A . 118 PHE CE1  1 1 
        2  4845 1 1 118 PHE CE2  C  -7.544   1.303  -1.152 1.00 . A A . 118 PHE CE2  1 1 
        2  4846 1 1 118 PHE CG   C  -6.946   3.641  -0.925 1.00 . A A . 118 PHE CG   1 1 
        2  4847 1 1 118 PHE CZ   C  -6.367   0.933  -0.530 1.00 . A A . 118 PHE CZ   1 1 
        2  4848 1 1 118 PHE H    H  -7.508   7.568  -1.882 1.00 . A A . 118 PHE H    1 1 
        2  4849 1 1 118 PHE HA   H  -5.311   5.801  -1.857 1.00 . A A . 118 PHE HA   1 1 
        2  4850 1 1 118 PHE HB2  H  -7.134   5.633  -0.204 1.00 . A A . 118 PHE HB2  1 1 
        2  4851 1 1 118 PHE HB3  H  -8.286   5.217  -1.464 1.00 . A A . 118 PHE HB3  1 1 
        2  4852 1 1 118 PHE HD1  H  -5.062   3.993   0.046 1.00 . A A . 118 PHE HD1  1 1 
        2  4853 1 1 118 PHE HD2  H  -8.756   2.921  -1.839 1.00 . A A . 118 PHE HD2  1 1 
        2  4854 1 1 118 PHE HE1  H  -4.555   1.611   0.389 1.00 . A A . 118 PHE HE1  1 1 
        2  4855 1 1 118 PHE HE2  H  -8.240   0.541  -1.488 1.00 . A A . 118 PHE HE2  1 1 
        2  4856 1 1 118 PHE HZ   H  -6.141  -0.117  -0.376 1.00 . A A . 118 PHE HZ   1 1 
        2  4857 1 1 118 PHE N    N  -6.735   7.240  -2.382 1.00 . A A . 118 PHE N    1 1 
        2  4858 1 1 118 PHE O    O  -5.546   4.273  -3.894 1.00 . A A . 118 PHE O    1 1 
        2  4859 1 1 119 LEU C    C  -6.954   5.388  -6.701 1.00 . A A . 119 LEU C    1 1 
        2  4860 1 1 119 LEU CA   C  -7.789   4.729  -5.586 1.00 . A A . 119 LEU CA   1 1 
        2  4861 1 1 119 LEU CB   C  -9.302   4.789  -5.923 1.00 . A A . 119 LEU CB   1 1 
        2  4862 1 1 119 LEU CD1  C  -9.796   2.386  -5.111 1.00 . A A . 119 LEU CD1  1 1 
        2  4863 1 1 119 LEU CD2  C -10.473   4.385  -3.645 1.00 . A A . 119 LEU CD2  1 1 
        2  4864 1 1 119 LEU CG   C -10.255   3.867  -5.090 1.00 . A A . 119 LEU CG   1 1 
        2  4865 1 1 119 LEU H    H  -8.178   5.958  -3.908 1.00 . A A . 119 LEU H    1 1 
        2  4866 1 1 119 LEU HA   H  -7.496   3.682  -5.526 1.00 . A A . 119 LEU HA   1 1 
        2  4867 1 1 119 LEU HB2  H  -9.632   5.818  -5.806 1.00 . A A . 119 LEU HB2  1 1 
        2  4868 1 1 119 LEU HB3  H  -9.422   4.528  -6.973 1.00 . A A . 119 LEU HB3  1 1 
        2  4869 1 1 119 LEU HD11 H -10.510   1.775  -4.572 1.00 . A A . 119 LEU HD11 1 1 
        2  4870 1 1 119 LEU HD12 H  -8.823   2.290  -4.648 1.00 . A A . 119 LEU HD12 1 1 
        2  4871 1 1 119 LEU HD13 H  -9.741   2.037  -6.138 1.00 . A A . 119 LEU HD13 1 1 
        2  4872 1 1 119 LEU HD21 H  -9.545   4.347  -3.090 1.00 . A A . 119 LEU HD21 1 1 
        2  4873 1 1 119 LEU HD22 H -11.215   3.768  -3.150 1.00 . A A . 119 LEU HD22 1 1 
        2  4874 1 1 119 LEU HD23 H -10.831   5.406  -3.675 1.00 . A A . 119 LEU HD23 1 1 
        2  4875 1 1 119 LEU HG   H -11.228   3.881  -5.575 1.00 . A A . 119 LEU HG   1 1 
        2  4876 1 1 119 LEU N    N  -7.519   5.333  -4.276 1.00 . A A . 119 LEU N    1 1 
        2  4877 1 1 119 LEU O    O  -6.703   4.744  -7.718 1.00 . A A . 119 LEU O    1 1 
        2  4878 1 1 120 GLU C    C  -4.250   6.618  -7.408 1.00 . A A . 120 GLU C    1 1 
        2  4879 1 1 120 GLU CA   C  -5.594   7.334  -7.442 1.00 . A A . 120 GLU CA   1 1 
        2  4880 1 1 120 GLU CB   C  -5.395   8.836  -7.082 1.00 . A A . 120 GLU CB   1 1 
        2  4881 1 1 120 GLU CD   C  -7.226   9.791  -8.624 1.00 . A A . 120 GLU CD   1 1 
        2  4882 1 1 120 GLU CG   C  -6.657   9.709  -7.197 1.00 . A A . 120 GLU CG   1 1 
        2  4883 1 1 120 GLU H    H  -6.794   7.144  -5.704 1.00 . A A . 120 GLU H    1 1 
        2  4884 1 1 120 GLU HA   H  -6.017   7.255  -8.439 1.00 . A A . 120 GLU HA   1 1 
        2  4885 1 1 120 GLU HB2  H  -5.031   8.905  -6.058 1.00 . A A . 120 GLU HB2  1 1 
        2  4886 1 1 120 GLU HB3  H  -4.635   9.255  -7.736 1.00 . A A . 120 GLU HB3  1 1 
        2  4887 1 1 120 GLU HG2  H  -7.413   9.299  -6.539 1.00 . A A . 120 GLU HG2  1 1 
        2  4888 1 1 120 GLU HG3  H  -6.415  10.714  -6.853 1.00 . A A . 120 GLU HG3  1 1 
        2  4889 1 1 120 GLU N    N  -6.515   6.656  -6.504 1.00 . A A . 120 GLU N    1 1 
        2  4890 1 1 120 GLU O    O  -3.683   6.283  -8.454 1.00 . A A . 120 GLU O    1 1 
        2  4891 1 1 120 GLU OE1  O  -6.719  10.612  -9.425 1.00 . A A . 120 GLU OE1  1 1 
        2  4892 1 1 120 GLU OE2  O  -8.173   9.043  -8.951 1.00 . A A . 120 GLU OE2  1 1 
        2  4893 1 1 121 VAL C    C  -2.779   4.162  -6.547 1.00 . A A . 121 VAL C    1 1 
        2  4894 1 1 121 VAL CA   C  -2.604   5.554  -5.909 1.00 . A A . 121 VAL CA   1 1 
        2  4895 1 1 121 VAL CB   C  -2.327   5.464  -4.357 1.00 . A A . 121 VAL CB   1 1 
        2  4896 1 1 121 VAL CG1  C  -1.467   4.239  -3.982 1.00 . A A . 121 VAL CG1  1 1 
        2  4897 1 1 121 VAL CG2  C  -1.661   6.769  -3.844 1.00 . A A . 121 VAL CG2  1 1 
        2  4898 1 1 121 VAL H    H  -4.253   6.766  -5.407 1.00 . A A . 121 VAL H    1 1 
        2  4899 1 1 121 VAL HA   H  -1.756   6.048  -6.381 1.00 . A A . 121 VAL HA   1 1 
        2  4900 1 1 121 VAL HB   H  -3.285   5.361  -3.848 1.00 . A A . 121 VAL HB   1 1 
        2  4901 1 1 121 VAL HG11 H  -1.296   4.228  -2.911 1.00 . A A . 121 VAL HG11 1 1 
        2  4902 1 1 121 VAL HG12 H  -0.518   4.288  -4.494 1.00 . A A . 121 VAL HG12 1 1 
        2  4903 1 1 121 VAL HG13 H  -1.982   3.328  -4.269 1.00 . A A . 121 VAL HG13 1 1 
        2  4904 1 1 121 VAL HG21 H  -0.690   6.893  -4.318 1.00 . A A . 121 VAL HG21 1 1 
        2  4905 1 1 121 VAL HG22 H  -1.528   6.717  -2.769 1.00 . A A . 121 VAL HG22 1 1 
        2  4906 1 1 121 VAL HG23 H  -2.285   7.620  -4.082 1.00 . A A . 121 VAL HG23 1 1 
        2  4907 1 1 121 VAL N    N  -3.778   6.373  -6.173 1.00 . A A . 121 VAL N    1 1 
        2  4908 1 1 121 VAL O    O  -1.960   3.786  -7.360 1.00 . A A . 121 VAL O    1 1 
        2  4909 1 1 122 ALA C    C  -4.267   2.116  -8.319 1.00 . A A . 122 ALA C    1 1 
        2  4910 1 1 122 ALA CA   C  -4.223   2.127  -6.775 1.00 . A A . 122 ALA CA   1 1 
        2  4911 1 1 122 ALA CB   C  -5.564   1.629  -6.220 1.00 . A A . 122 ALA CB   1 1 
        2  4912 1 1 122 ALA H    H  -4.510   3.842  -5.560 1.00 . A A . 122 ALA H    1 1 
        2  4913 1 1 122 ALA HA   H  -3.447   1.445  -6.440 1.00 . A A . 122 ALA HA   1 1 
        2  4914 1 1 122 ALA HB1  H  -6.362   2.283  -6.558 1.00 . A A . 122 ALA HB1  1 1 
        2  4915 1 1 122 ALA HB2  H  -5.538   1.634  -5.141 1.00 . A A . 122 ALA HB2  1 1 
        2  4916 1 1 122 ALA HB3  H  -5.758   0.622  -6.574 1.00 . A A . 122 ALA HB3  1 1 
        2  4917 1 1 122 ALA N    N  -3.894   3.460  -6.218 1.00 . A A . 122 ALA N    1 1 
        2  4918 1 1 122 ALA O    O  -3.912   1.106  -8.942 1.00 . A A . 122 ALA O    1 1 
        2  4919 1 1 123 GLN C    C  -3.405   3.425 -10.983 1.00 . A A . 123 GLN C    1 1 
        2  4920 1 1 123 GLN CA   C  -4.799   3.403 -10.369 1.00 . A A . 123 GLN CA   1 1 
        2  4921 1 1 123 GLN CB   C  -5.566   4.693 -10.779 1.00 . A A . 123 GLN CB   1 1 
        2  4922 1 1 123 GLN CD   C  -6.400   6.152 -12.754 1.00 . A A . 123 GLN CD   1 1 
        2  4923 1 1 123 GLN CG   C  -5.648   4.899 -12.314 1.00 . A A . 123 GLN CG   1 1 
        2  4924 1 1 123 GLN H    H  -4.947   3.994  -8.343 1.00 . A A . 123 GLN H    1 1 
        2  4925 1 1 123 GLN HA   H  -5.339   2.540 -10.749 1.00 . A A . 123 GLN HA   1 1 
        2  4926 1 1 123 GLN HB2  H  -6.575   4.636 -10.383 1.00 . A A . 123 GLN HB2  1 1 
        2  4927 1 1 123 GLN HB3  H  -5.071   5.555 -10.341 1.00 . A A . 123 GLN HB3  1 1 
        2  4928 1 1 123 GLN HE21 H  -6.971   5.253 -14.432 1.00 . A A . 123 GLN HE21 1 1 
        2  4929 1 1 123 GLN HE22 H  -7.516   6.880 -14.219 1.00 . A A . 123 GLN HE22 1 1 
        2  4930 1 1 123 GLN HG2  H  -4.639   4.961 -12.709 1.00 . A A . 123 GLN HG2  1 1 
        2  4931 1 1 123 GLN HG3  H  -6.136   4.030 -12.746 1.00 . A A . 123 GLN HG3  1 1 
        2  4932 1 1 123 GLN N    N  -4.697   3.245  -8.911 1.00 . A A . 123 GLN N    1 1 
        2  4933 1 1 123 GLN NE2  N  -7.024   6.090 -13.918 1.00 . A A . 123 GLN NE2  1 1 
        2  4934 1 1 123 GLN O    O  -3.110   2.632 -11.853 1.00 . A A . 123 GLN O    1 1 
        2  4935 1 1 123 GLN OE1  O  -6.408   7.171 -12.064 1.00 . A A . 123 GLN OE1  1 1 
        2  4936 1 1 124 ILE C    C  -0.294   3.319 -10.577 1.00 . A A . 124 ILE C    1 1 
        2  4937 1 1 124 ILE CA   C  -1.174   4.545 -10.931 1.00 . A A . 124 ILE CA   1 1 
        2  4938 1 1 124 ILE CB   C  -0.626   5.882 -10.299 1.00 . A A . 124 ILE CB   1 1 
        2  4939 1 1 124 ILE CD1  C  -1.323   8.371  -9.994 1.00 . A A . 124 ILE CD1  1 1 
        2  4940 1 1 124 ILE CG1  C  -1.573   7.062 -10.708 1.00 . A A . 124 ILE CG1  1 1 
        2  4941 1 1 124 ILE CG2  C   0.844   6.176 -10.697 1.00 . A A . 124 ILE CG2  1 1 
        2  4942 1 1 124 ILE H    H  -2.898   4.907  -9.744 1.00 . A A . 124 ILE H    1 1 
        2  4943 1 1 124 ILE HA   H  -1.197   4.660 -12.013 1.00 . A A . 124 ILE HA   1 1 
        2  4944 1 1 124 ILE HB   H  -0.658   5.773  -9.217 1.00 . A A . 124 ILE HB   1 1 
        2  4945 1 1 124 ILE HD11 H  -2.067   9.092 -10.298 1.00 . A A . 124 ILE HD11 1 1 
        2  4946 1 1 124 ILE HD12 H  -0.339   8.740 -10.245 1.00 . A A . 124 ILE HD12 1 1 
        2  4947 1 1 124 ILE HD13 H  -1.389   8.220  -8.925 1.00 . A A . 124 ILE HD13 1 1 
        2  4948 1 1 124 ILE HG12 H  -1.476   7.250 -11.767 1.00 . A A . 124 ILE HG12 1 1 
        2  4949 1 1 124 ILE HG13 H  -2.601   6.777 -10.502 1.00 . A A . 124 ILE HG13 1 1 
        2  4950 1 1 124 ILE HG21 H   0.921   6.274 -11.773 1.00 . A A . 124 ILE HG21 1 1 
        2  4951 1 1 124 ILE HG22 H   1.486   5.368 -10.368 1.00 . A A . 124 ILE HG22 1 1 
        2  4952 1 1 124 ILE HG23 H   1.173   7.099 -10.232 1.00 . A A . 124 ILE HG23 1 1 
        2  4953 1 1 124 ILE N    N  -2.564   4.338 -10.472 1.00 . A A . 124 ILE N    1 1 
        2  4954 1 1 124 ILE O    O   0.676   2.996 -11.287 1.00 . A A . 124 ILE O    1 1 
        2  4955 1 1 125 THR C    C  -0.302   0.264 -10.100 1.00 . A A . 125 THR C    1 1 
        2  4956 1 1 125 THR CA   C  -0.094   1.365  -9.052 1.00 . A A . 125 THR CA   1 1 
        2  4957 1 1 125 THR CB   C  -0.709   0.962  -7.660 1.00 . A A . 125 THR CB   1 1 
        2  4958 1 1 125 THR CG2  C  -0.471  -0.490  -7.254 1.00 . A A . 125 THR CG2  1 1 
        2  4959 1 1 125 THR H    H  -1.502   2.917  -9.034 1.00 . A A . 125 THR H    1 1 
        2  4960 1 1 125 THR HA   H   0.971   1.542  -8.917 1.00 . A A . 125 THR HA   1 1 
        2  4961 1 1 125 THR HB   H  -1.783   1.120  -7.715 1.00 . A A . 125 THR HB   1 1 
        2  4962 1 1 125 THR HG1  H  -0.224   2.735  -6.955 1.00 . A A . 125 THR HG1  1 1 
        2  4963 1 1 125 THR HG21 H   0.589  -0.677  -7.165 1.00 . A A . 125 THR HG21 1 1 
        2  4964 1 1 125 THR HG22 H  -0.895  -1.147  -8.000 1.00 . A A . 125 THR HG22 1 1 
        2  4965 1 1 125 THR HG23 H  -0.953  -0.677  -6.301 1.00 . A A . 125 THR HG23 1 1 
        2  4966 1 1 125 THR N    N  -0.713   2.605  -9.516 1.00 . A A . 125 THR N    1 1 
        2  4967 1 1 125 THR O    O   0.661  -0.151 -10.730 1.00 . A A . 125 THR O    1 1 
        2  4968 1 1 125 THR OG1  O  -0.206   1.827  -6.635 1.00 . A A . 125 THR OG1  1 1 
        2  4969 1 1 126 LEU C    C  -1.589  -0.740 -12.768 1.00 . A A . 126 LEU C    1 1 
        2  4970 1 1 126 LEU CA   C  -1.891  -1.193 -11.325 1.00 . A A . 126 LEU CA   1 1 
        2  4971 1 1 126 LEU CB   C  -3.359  -1.665 -11.179 1.00 . A A . 126 LEU CB   1 1 
        2  4972 1 1 126 LEU CD1  C  -2.977  -4.195 -11.555 1.00 . A A . 126 LEU CD1  1 1 
        2  4973 1 1 126 LEU CD2  C  -5.257  -3.176 -11.982 1.00 . A A . 126 LEU CD2  1 1 
        2  4974 1 1 126 LEU CG   C  -3.746  -2.934 -12.016 1.00 . A A . 126 LEU CG   1 1 
        2  4975 1 1 126 LEU H    H  -2.304   0.277  -9.843 1.00 . A A . 126 LEU H    1 1 
        2  4976 1 1 126 LEU HA   H  -1.238  -2.031 -11.095 1.00 . A A . 126 LEU HA   1 1 
        2  4977 1 1 126 LEU HB2  H  -3.545  -1.874 -10.131 1.00 . A A . 126 LEU HB2  1 1 
        2  4978 1 1 126 LEU HB3  H  -4.011  -0.847 -11.477 1.00 . A A . 126 LEU HB3  1 1 
        2  4979 1 1 126 LEU HD11 H  -3.207  -4.409 -10.515 1.00 . A A . 126 LEU HD11 1 1 
        2  4980 1 1 126 LEU HD12 H  -1.913  -4.038 -11.661 1.00 . A A . 126 LEU HD12 1 1 
        2  4981 1 1 126 LEU HD13 H  -3.272  -5.043 -12.164 1.00 . A A . 126 LEU HD13 1 1 
        2  4982 1 1 126 LEU HD21 H  -5.506  -4.012 -12.618 1.00 . A A . 126 LEU HD21 1 1 
        2  4983 1 1 126 LEU HD22 H  -5.774  -2.294 -12.338 1.00 . A A . 126 LEU HD22 1 1 
        2  4984 1 1 126 LEU HD23 H  -5.572  -3.390 -10.970 1.00 . A A . 126 LEU HD23 1 1 
        2  4985 1 1 126 LEU HG   H  -3.473  -2.762 -13.050 1.00 . A A . 126 LEU HG   1 1 
        2  4986 1 1 126 LEU N    N  -1.573  -0.127 -10.353 1.00 . A A . 126 LEU N    1 1 
        2  4987 1 1 126 LEU O    O  -1.373  -1.567 -13.636 1.00 . A A . 126 LEU O    1 1 
        2  4988 1 1 127 ARG C    C   0.403   0.783 -14.446 1.00 . A A . 127 ARG C    1 1 
        2  4989 1 1 127 ARG CA   C  -1.062   1.183 -14.247 1.00 . A A . 127 ARG CA   1 1 
        2  4990 1 1 127 ARG CB   C  -1.215   2.733 -14.218 1.00 . A A . 127 ARG CB   1 1 
        2  4991 1 1 127 ARG CD   C  -0.769   3.204 -16.730 1.00 . A A . 127 ARG CD   1 1 
        2  4992 1 1 127 ARG CG   C  -0.401   3.529 -15.271 1.00 . A A . 127 ARG CG   1 1 
        2  4993 1 1 127 ARG CZ   C   0.357   3.501 -18.946 1.00 . A A . 127 ARG CZ   1 1 
        2  4994 1 1 127 ARG H    H  -1.936   1.170 -12.305 1.00 . A A . 127 ARG H    1 1 
        2  4995 1 1 127 ARG HA   H  -1.652   0.785 -15.068 1.00 . A A . 127 ARG HA   1 1 
        2  4996 1 1 127 ARG HB2  H  -2.262   2.975 -14.352 1.00 . A A . 127 ARG HB2  1 1 
        2  4997 1 1 127 ARG HB3  H  -0.917   3.080 -13.234 1.00 . A A . 127 ARG HB3  1 1 
        2  4998 1 1 127 ARG HD2  H  -0.701   2.130 -16.883 1.00 . A A . 127 ARG HD2  1 1 
        2  4999 1 1 127 ARG HD3  H  -1.785   3.528 -16.922 1.00 . A A . 127 ARG HD3  1 1 
        2  5000 1 1 127 ARG HE   H   0.604   4.681 -17.346 1.00 . A A . 127 ARG HE   1 1 
        2  5001 1 1 127 ARG HG2  H  -0.563   4.588 -15.104 1.00 . A A . 127 ARG HG2  1 1 
        2  5002 1 1 127 ARG HG3  H   0.654   3.315 -15.120 1.00 . A A . 127 ARG HG3  1 1 
        2  5003 1 1 127 ARG HH11 H  -0.882   1.887 -18.893 1.00 . A A . 127 ARG HH11 1 1 
        2  5004 1 1 127 ARG HH12 H  -0.067   2.139 -20.403 1.00 . A A . 127 ARG HH12 1 1 
        2  5005 1 1 127 ARG HH21 H   1.676   4.995 -19.322 1.00 . A A . 127 ARG HH21 1 1 
        2  5006 1 1 127 ARG HH22 H   1.391   3.910 -20.646 1.00 . A A . 127 ARG HH22 1 1 
        2  5007 1 1 127 ARG N    N  -1.577   0.585 -12.999 1.00 . A A . 127 ARG N    1 1 
        2  5008 1 1 127 ARG NE   N   0.132   3.884 -17.678 1.00 . A A . 127 ARG NE   1 1 
        2  5009 1 1 127 ARG NH1  N  -0.245   2.420 -19.451 1.00 . A A . 127 ARG NH1  1 1 
        2  5010 1 1 127 ARG NH2  N   1.210   4.188 -19.696 1.00 . A A . 127 ARG NH2  1 1 
        2  5011 1 1 127 ARG O    O   0.755   0.273 -15.503 1.00 . A A . 127 ARG O    1 1 
        2  5012 1 1 128 GLU C    C   2.859  -0.868 -13.642 1.00 . A A . 128 GLU C    1 1 
        2  5013 1 1 128 GLU CA   C   2.664   0.657 -13.473 1.00 . A A . 128 GLU CA   1 1 
        2  5014 1 1 128 GLU CB   C   3.407   1.169 -12.215 1.00 . A A . 128 GLU CB   1 1 
        2  5015 1 1 128 GLU CD   C   5.511   1.840 -13.543 1.00 . A A . 128 GLU CD   1 1 
        2  5016 1 1 128 GLU CG   C   4.941   1.096 -12.319 1.00 . A A . 128 GLU CG   1 1 
        2  5017 1 1 128 GLU H    H   0.874   1.370 -12.574 1.00 . A A . 128 GLU H    1 1 
        2  5018 1 1 128 GLU HA   H   3.070   1.163 -14.347 1.00 . A A . 128 GLU HA   1 1 
        2  5019 1 1 128 GLU HB2  H   3.130   2.202 -12.043 1.00 . A A . 128 GLU HB2  1 1 
        2  5020 1 1 128 GLU HB3  H   3.092   0.582 -11.355 1.00 . A A . 128 GLU HB3  1 1 
        2  5021 1 1 128 GLU HG2  H   5.372   1.533 -11.422 1.00 . A A . 128 GLU HG2  1 1 
        2  5022 1 1 128 GLU HG3  H   5.232   0.050 -12.367 1.00 . A A . 128 GLU HG3  1 1 
        2  5023 1 1 128 GLU N    N   1.237   0.990 -13.407 1.00 . A A . 128 GLU N    1 1 
        2  5024 1 1 128 GLU O    O   3.535  -1.293 -14.574 1.00 . A A . 128 GLU O    1 1 
        2  5025 1 1 128 GLU OE1  O   5.453   3.091 -13.567 1.00 . A A . 128 GLU OE1  1 1 
        2  5026 1 1 128 GLU OE2  O   6.045   1.181 -14.464 1.00 . A A . 128 GLU OE2  1 1 
        2  5027 1 1 129 PHE C    C   1.901  -3.688 -14.186 1.00 . A A . 129 PHE C    1 1 
        2  5028 1 1 129 PHE CA   C   2.254  -3.143 -12.780 1.00 . A A . 129 PHE CA   1 1 
        2  5029 1 1 129 PHE CB   C   1.289  -3.748 -11.709 1.00 . A A . 129 PHE CB   1 1 
        2  5030 1 1 129 PHE CD1  C   1.652  -2.691  -9.409 1.00 . A A . 129 PHE CD1  1 1 
        2  5031 1 1 129 PHE CD2  C   2.539  -4.848  -9.792 1.00 . A A . 129 PHE CD2  1 1 
        2  5032 1 1 129 PHE CE1  C   2.142  -2.720  -8.115 1.00 . A A . 129 PHE CE1  1 1 
        2  5033 1 1 129 PHE CE2  C   3.035  -4.877  -8.501 1.00 . A A . 129 PHE CE2  1 1 
        2  5034 1 1 129 PHE CG   C   1.838  -3.757 -10.273 1.00 . A A . 129 PHE CG   1 1 
        2  5035 1 1 129 PHE CZ   C   2.834  -3.811  -7.663 1.00 . A A . 129 PHE CZ   1 1 
        2  5036 1 1 129 PHE H    H   1.688  -1.230 -12.053 1.00 . A A . 129 PHE H    1 1 
        2  5037 1 1 129 PHE HA   H   3.274  -3.430 -12.532 1.00 . A A . 129 PHE HA   1 1 
        2  5038 1 1 129 PHE HB2  H   0.363  -3.182 -11.710 1.00 . A A . 129 PHE HB2  1 1 
        2  5039 1 1 129 PHE HB3  H   1.056  -4.776 -11.981 1.00 . A A . 129 PHE HB3  1 1 
        2  5040 1 1 129 PHE HD1  H   1.108  -1.828  -9.748 1.00 . A A . 129 PHE HD1  1 1 
        2  5041 1 1 129 PHE HD2  H   2.705  -5.695 -10.446 1.00 . A A . 129 PHE HD2  1 1 
        2  5042 1 1 129 PHE HE1  H   1.985  -1.870  -7.459 1.00 . A A . 129 PHE HE1  1 1 
        2  5043 1 1 129 PHE HE2  H   3.579  -5.743  -8.150 1.00 . A A . 129 PHE HE2  1 1 
        2  5044 1 1 129 PHE HZ   H   3.219  -3.831  -6.648 1.00 . A A . 129 PHE HZ   1 1 
        2  5045 1 1 129 PHE N    N   2.212  -1.663 -12.751 1.00 . A A . 129 PHE N    1 1 
        2  5046 1 1 129 PHE O    O   2.743  -4.321 -14.850 1.00 . A A . 129 PHE O    1 1 
        2  5047 1 1 130 PHE C    C   1.019  -3.409 -17.091 1.00 . A A . 130 PHE C    1 1 
        2  5048 1 1 130 PHE CA   C   0.107  -3.818 -15.927 1.00 . A A . 130 PHE CA   1 1 
        2  5049 1 1 130 PHE CB   C  -1.329  -3.239 -16.122 1.00 . A A . 130 PHE CB   1 1 
        2  5050 1 1 130 PHE CD1  C  -1.834  -2.960 -18.608 1.00 . A A . 130 PHE CD1  1 1 
        2  5051 1 1 130 PHE CD2  C  -2.921  -4.739 -17.429 1.00 . A A . 130 PHE CD2  1 1 
        2  5052 1 1 130 PHE CE1  C  -2.461  -3.342 -19.772 1.00 . A A . 130 PHE CE1  1 1 
        2  5053 1 1 130 PHE CE2  C  -3.554  -5.113 -18.598 1.00 . A A . 130 PHE CE2  1 1 
        2  5054 1 1 130 PHE CG   C  -2.044  -3.654 -17.410 1.00 . A A . 130 PHE CG   1 1 
        2  5055 1 1 130 PHE CZ   C  -3.318  -4.416 -19.767 1.00 . A A . 130 PHE CZ   1 1 
        2  5056 1 1 130 PHE H    H   0.113  -2.802 -14.073 1.00 . A A . 130 PHE H    1 1 
        2  5057 1 1 130 PHE HA   H   0.041  -4.902 -15.890 1.00 . A A . 130 PHE HA   1 1 
        2  5058 1 1 130 PHE HB2  H  -1.945  -3.552 -15.289 1.00 . A A . 130 PHE HB2  1 1 
        2  5059 1 1 130 PHE HB3  H  -1.276  -2.153 -16.105 1.00 . A A . 130 PHE HB3  1 1 
        2  5060 1 1 130 PHE HD1  H  -1.159  -2.114 -18.621 1.00 . A A . 130 PHE HD1  1 1 
        2  5061 1 1 130 PHE HD2  H  -3.114  -5.290 -16.518 1.00 . A A . 130 PHE HD2  1 1 
        2  5062 1 1 130 PHE HE1  H  -2.287  -2.791 -20.691 1.00 . A A . 130 PHE HE1  1 1 
        2  5063 1 1 130 PHE HE2  H  -4.233  -5.959 -18.602 1.00 . A A . 130 PHE HE2  1 1 
        2  5064 1 1 130 PHE HZ   H  -3.805  -4.719 -20.684 1.00 . A A . 130 PHE HZ   1 1 
        2  5065 1 1 130 PHE N    N   0.667  -3.370 -14.636 1.00 . A A . 130 PHE N    1 1 
        2  5066 1 1 130 PHE O    O   1.530  -4.285 -17.795 1.00 . A A . 130 PHE O    1 1 
        2  5067 1 1 131 ASN C    C   3.413  -2.086 -18.463 1.00 . A A . 131 ASN C    1 1 
        2  5068 1 1 131 ASN CA   C   2.011  -1.481 -18.365 1.00 . A A . 131 ASN CA   1 1 
        2  5069 1 1 131 ASN CB   C   2.109   0.061 -18.212 1.00 . A A . 131 ASN CB   1 1 
        2  5070 1 1 131 ASN CG   C   2.831   0.760 -19.375 1.00 . A A . 131 ASN CG   1 1 
        2  5071 1 1 131 ASN H    H   0.887  -1.464 -16.556 1.00 . A A . 131 ASN H    1 1 
        2  5072 1 1 131 ASN HA   H   1.464  -1.706 -19.274 1.00 . A A . 131 ASN HA   1 1 
        2  5073 1 1 131 ASN HB2  H   1.105   0.466 -18.145 1.00 . A A . 131 ASN HB2  1 1 
        2  5074 1 1 131 ASN HB3  H   2.632   0.291 -17.286 1.00 . A A . 131 ASN HB3  1 1 
        2  5075 1 1 131 ASN HD21 H   4.588   0.632 -18.446 1.00 . A A . 131 ASN HD21 1 1 
        2  5076 1 1 131 ASN HD22 H   4.610   1.396 -19.993 1.00 . A A . 131 ASN HD22 1 1 
        2  5077 1 1 131 ASN N    N   1.244  -2.072 -17.239 1.00 . A A . 131 ASN N    1 1 
        2  5078 1 1 131 ASN ND2  N   4.143   0.946 -19.259 1.00 . A A . 131 ASN ND2  1 1 
        2  5079 1 1 131 ASN O    O   3.909  -2.359 -19.558 1.00 . A A . 131 ASN O    1 1 
        2  5080 1 1 131 ASN OD1  O   2.213   1.130 -20.374 1.00 . A A . 131 ASN OD1  1 1 
        2  5081 1 1 132 ALA C    C   5.407  -4.323 -17.688 1.00 . A A . 132 ALA C    1 1 
        2  5082 1 1 132 ALA CA   C   5.366  -2.869 -17.210 1.00 . A A . 132 ALA CA   1 1 
        2  5083 1 1 132 ALA CB   C   5.893  -2.742 -15.790 1.00 . A A . 132 ALA CB   1 1 
        2  5084 1 1 132 ALA H    H   3.527  -2.126 -16.474 1.00 . A A . 132 ALA H    1 1 
        2  5085 1 1 132 ALA HA   H   6.006  -2.271 -17.852 1.00 . A A . 132 ALA HA   1 1 
        2  5086 1 1 132 ALA HB1  H   5.879  -1.704 -15.490 1.00 . A A . 132 ALA HB1  1 1 
        2  5087 1 1 132 ALA HB2  H   6.911  -3.111 -15.742 1.00 . A A . 132 ALA HB2  1 1 
        2  5088 1 1 132 ALA HB3  H   5.270  -3.315 -15.108 1.00 . A A . 132 ALA HB3  1 1 
        2  5089 1 1 132 ALA N    N   4.017  -2.323 -17.302 1.00 . A A . 132 ALA N    1 1 
        2  5090 1 1 132 ALA O    O   6.192  -4.651 -18.562 1.00 . A A . 132 ALA O    1 1 
        2  5091 1 1 133 ILE C    C   4.168  -6.854 -18.971 1.00 . A A . 133 ILE C    1 1 
        2  5092 1 1 133 ILE CA   C   4.511  -6.619 -17.479 1.00 . A A . 133 ILE CA   1 1 
        2  5093 1 1 133 ILE CB   C   3.534  -7.420 -16.530 1.00 . A A . 133 ILE CB   1 1 
        2  5094 1 1 133 ILE CD1  C   3.012  -7.755 -13.988 1.00 . A A . 133 ILE CD1  1 1 
        2  5095 1 1 133 ILE CG1  C   3.942  -7.186 -15.038 1.00 . A A . 133 ILE CG1  1 1 
        2  5096 1 1 133 ILE CG2  C   3.536  -8.931 -16.872 1.00 . A A . 133 ILE CG2  1 1 
        2  5097 1 1 133 ILE H    H   3.791  -4.799 -16.591 1.00 . A A . 133 ILE H    1 1 
        2  5098 1 1 133 ILE HA   H   5.536  -6.984 -17.303 1.00 . A A . 133 ILE HA   1 1 
        2  5099 1 1 133 ILE HB   H   2.531  -7.041 -16.683 1.00 . A A . 133 ILE HB   1 1 
        2  5100 1 1 133 ILE HD11 H   3.400  -7.517 -13.003 1.00 . A A . 133 ILE HD11 1 1 
        2  5101 1 1 133 ILE HD12 H   2.944  -8.829 -14.096 1.00 . A A . 133 ILE HD12 1 1 
        2  5102 1 1 133 ILE HD13 H   2.035  -7.316 -14.102 1.00 . A A . 133 ILE HD13 1 1 
        2  5103 1 1 133 ILE HG12 H   4.914  -7.620 -14.862 1.00 . A A . 133 ILE HG12 1 1 
        2  5104 1 1 133 ILE HG13 H   4.008  -6.121 -14.856 1.00 . A A . 133 ILE HG13 1 1 
        2  5105 1 1 133 ILE HG21 H   4.543  -9.322 -16.771 1.00 . A A . 133 ILE HG21 1 1 
        2  5106 1 1 133 ILE HG22 H   3.201  -9.076 -17.891 1.00 . A A . 133 ILE HG22 1 1 
        2  5107 1 1 133 ILE HG23 H   2.879  -9.465 -16.198 1.00 . A A . 133 ILE HG23 1 1 
        2  5108 1 1 133 ILE N    N   4.504  -5.170 -17.165 1.00 . A A . 133 ILE N    1 1 
        2  5109 1 1 133 ILE O    O   4.794  -7.690 -19.630 1.00 . A A . 133 ILE O    1 1 
        2  5110 1 1 134 ILE C    C   3.998  -5.564 -21.829 1.00 . A A . 134 ILE C    1 1 
        2  5111 1 1 134 ILE CA   C   2.851  -6.130 -20.948 1.00 . A A . 134 ILE CA   1 1 
        2  5112 1 1 134 ILE CB   C   1.450  -5.428 -21.224 1.00 . A A . 134 ILE CB   1 1 
        2  5113 1 1 134 ILE CD1  C   1.321  -4.641 -23.720 1.00 . A A . 134 ILE CD1  1 1 
        2  5114 1 1 134 ILE CG1  C   0.889  -5.664 -22.679 1.00 . A A . 134 ILE CG1  1 1 
        2  5115 1 1 134 ILE CG2  C   1.494  -3.933 -20.899 1.00 . A A . 134 ILE CG2  1 1 
        2  5116 1 1 134 ILE H    H   2.714  -5.461 -18.920 1.00 . A A . 134 ILE H    1 1 
        2  5117 1 1 134 ILE HA   H   2.736  -7.187 -21.195 1.00 . A A . 134 ILE HA   1 1 
        2  5118 1 1 134 ILE HB   H   0.747  -5.870 -20.522 1.00 . A A . 134 ILE HB   1 1 
        2  5119 1 1 134 ILE HD11 H   0.960  -3.661 -23.431 1.00 . A A . 134 ILE HD11 1 1 
        2  5120 1 1 134 ILE HD12 H   0.910  -4.909 -24.679 1.00 . A A . 134 ILE HD12 1 1 
        2  5121 1 1 134 ILE HD13 H   2.400  -4.620 -23.778 1.00 . A A . 134 ILE HD13 1 1 
        2  5122 1 1 134 ILE HG12 H   1.203  -6.634 -23.032 1.00 . A A . 134 ILE HG12 1 1 
        2  5123 1 1 134 ILE HG13 H  -0.196  -5.647 -22.640 1.00 . A A . 134 ILE HG13 1 1 
        2  5124 1 1 134 ILE HG21 H   2.223  -3.442 -21.536 1.00 . A A . 134 ILE HG21 1 1 
        2  5125 1 1 134 ILE HG22 H   1.782  -3.792 -19.869 1.00 . A A . 134 ILE HG22 1 1 
        2  5126 1 1 134 ILE HG23 H   0.520  -3.488 -21.060 1.00 . A A . 134 ILE HG23 1 1 
        2  5127 1 1 134 ILE N    N   3.209  -6.072 -19.509 1.00 . A A . 134 ILE N    1 1 
        2  5128 1 1 134 ILE O    O   4.201  -6.035 -22.954 1.00 . A A . 134 ILE O    1 1 
        2  5129 1 1 135 ALA C    C   7.166  -5.027 -21.906 1.00 . A A . 135 ALA C    1 1 
        2  5130 1 1 135 ALA CA   C   5.969  -4.049 -21.996 1.00 . A A . 135 ALA CA   1 1 
        2  5131 1 1 135 ALA CB   C   6.357  -2.687 -21.412 1.00 . A A . 135 ALA CB   1 1 
        2  5132 1 1 135 ALA H    H   4.496  -4.150 -20.450 1.00 . A A . 135 ALA H    1 1 
        2  5133 1 1 135 ALA HA   H   5.716  -3.903 -23.046 1.00 . A A . 135 ALA HA   1 1 
        2  5134 1 1 135 ALA HB1  H   5.521  -2.005 -21.500 1.00 . A A . 135 ALA HB1  1 1 
        2  5135 1 1 135 ALA HB2  H   7.205  -2.280 -21.952 1.00 . A A . 135 ALA HB2  1 1 
        2  5136 1 1 135 ALA HB3  H   6.616  -2.795 -20.365 1.00 . A A . 135 ALA HB3  1 1 
        2  5137 1 1 135 ALA N    N   4.763  -4.572 -21.307 1.00 . A A . 135 ALA N    1 1 
        2  5138 1 1 135 ALA O    O   8.083  -4.967 -22.736 1.00 . A A . 135 ALA O    1 1 
        2  5139 1 1 136 GLY C    C   9.311  -6.326 -19.694 1.00 . A A . 136 GLY C    1 1 
        2  5140 1 1 136 GLY CA   C   8.245  -6.871 -20.640 1.00 . A A . 136 GLY CA   1 1 
        2  5141 1 1 136 GLY H    H   6.404  -5.864 -20.241 1.00 . A A . 136 GLY H    1 1 
        2  5142 1 1 136 GLY HA2  H   7.818  -7.764 -20.201 1.00 . A A . 136 GLY HA2  1 1 
        2  5143 1 1 136 GLY HA3  H   8.706  -7.137 -21.583 1.00 . A A . 136 GLY HA3  1 1 
        2  5144 1 1 136 GLY N    N   7.159  -5.898 -20.875 1.00 . A A . 136 GLY N    1 1 
        2  5145 1 1 136 GLY O    O  10.474  -6.731 -19.734 1.00 . A A . 136 GLY O    1 1 
        2  5146 1 1 137 LYS C    C   9.636  -5.439 -16.492 1.00 . A A . 137 LYS C    1 1 
        2  5147 1 1 137 LYS CA   C   9.722  -4.702 -17.848 1.00 . A A . 137 LYS CA   1 1 
        2  5148 1 1 137 LYS CB   C   9.300  -3.200 -17.734 1.00 . A A . 137 LYS CB   1 1 
        2  5149 1 1 137 LYS CD   C   9.930  -0.803 -16.962 1.00 . A A . 137 LYS CD   1 1 
        2  5150 1 1 137 LYS CE   C   8.534  -0.369 -16.482 1.00 . A A . 137 LYS CE   1 1 
        2  5151 1 1 137 LYS CG   C  10.205  -2.324 -16.825 1.00 . A A . 137 LYS CG   1 1 
        2  5152 1 1 137 LYS H    H   7.968  -5.075 -18.961 1.00 . A A . 137 LYS H    1 1 
        2  5153 1 1 137 LYS HA   H  10.751  -4.743 -18.185 1.00 . A A . 137 LYS HA   1 1 
        2  5154 1 1 137 LYS HB2  H   9.309  -2.769 -18.732 1.00 . A A . 137 LYS HB2  1 1 
        2  5155 1 1 137 LYS HB3  H   8.283  -3.150 -17.357 1.00 . A A . 137 LYS HB3  1 1 
        2  5156 1 1 137 LYS HD2  H  10.670  -0.262 -16.379 1.00 . A A . 137 LYS HD2  1 1 
        2  5157 1 1 137 LYS HD3  H  10.044  -0.526 -18.004 1.00 . A A . 137 LYS HD3  1 1 
        2  5158 1 1 137 LYS HE2  H   8.385   0.673 -16.733 1.00 . A A . 137 LYS HE2  1 1 
        2  5159 1 1 137 LYS HE3  H   7.783  -0.967 -16.984 1.00 . A A . 137 LYS HE3  1 1 
        2  5160 1 1 137 LYS HG2  H  10.049  -2.613 -15.789 1.00 . A A . 137 LYS HG2  1 1 
        2  5161 1 1 137 LYS HG3  H  11.242  -2.514 -17.085 1.00 . A A . 137 LYS HG3  1 1 
        2  5162 1 1 137 LYS HZ1  H   8.456  -1.519 -14.734 1.00 . A A . 137 LYS HZ1  1 1 
        2  5163 1 1 137 LYS HZ2  H   7.437  -0.171 -14.710 1.00 . A A . 137 LYS HZ2  1 1 
        2  5164 1 1 137 LYS HZ3  H   9.106   0.020 -14.510 1.00 . A A . 137 LYS HZ3  1 1 
        2  5165 1 1 137 LYS N    N   8.884  -5.365 -18.861 1.00 . A A . 137 LYS N    1 1 
        2  5166 1 1 137 LYS NZ   N   8.371  -0.523 -15.008 1.00 . A A . 137 LYS NZ   1 1 
        2  5167 1 1 137 LYS O    O  10.413  -5.156 -15.587 1.00 . A A . 137 LYS O    1 1 
        2  5168 1 1 138 ASP C    C   9.785  -8.003 -14.717 1.00 . A A . 138 ASP C    1 1 
        2  5169 1 1 138 ASP CA   C   8.517  -7.253 -15.154 1.00 . A A . 138 ASP CA   1 1 
        2  5170 1 1 138 ASP CB   C   7.363  -8.251 -15.379 1.00 . A A . 138 ASP CB   1 1 
        2  5171 1 1 138 ASP CG   C   7.597  -9.212 -16.561 1.00 . A A . 138 ASP CG   1 1 
        2  5172 1 1 138 ASP H    H   8.112  -6.588 -17.145 1.00 . A A . 138 ASP H    1 1 
        2  5173 1 1 138 ASP HA   H   8.239  -6.583 -14.353 1.00 . A A . 138 ASP HA   1 1 
        2  5174 1 1 138 ASP HB2  H   7.210  -8.833 -14.473 1.00 . A A . 138 ASP HB2  1 1 
        2  5175 1 1 138 ASP HB3  H   6.458  -7.687 -15.573 1.00 . A A . 138 ASP HB3  1 1 
        2  5176 1 1 138 ASP N    N   8.710  -6.415 -16.380 1.00 . A A . 138 ASP N    1 1 
        2  5177 1 1 138 ASP O    O   9.962  -8.330 -13.536 1.00 . A A . 138 ASP O    1 1 
        2  5178 1 1 138 ASP OD1  O   7.464  -8.771 -17.723 1.00 . A A . 138 ASP OD1  1 1 
        2  5179 1 1 138 ASP OD2  O   7.923 -10.400 -16.332 1.00 . A A . 138 ASP OD2  1 1 
        2  5180 1 1 139 VAL C    C  13.070  -8.060 -14.983 1.00 . A A . 139 VAL C    1 1 
        2  5181 1 1 139 VAL CA   C  11.927  -8.972 -15.509 1.00 . A A . 139 VAL CA   1 1 
        2  5182 1 1 139 VAL CB   C  12.326  -9.633 -16.874 1.00 . A A . 139 VAL CB   1 1 
        2  5183 1 1 139 VAL CG1  C  11.346 -10.774 -17.242 1.00 . A A . 139 VAL CG1  1 1 
        2  5184 1 1 139 VAL CG2  C  12.367  -8.571 -17.998 1.00 . A A . 139 VAL CG2  1 1 
        2  5185 1 1 139 VAL H    H  10.431  -7.924 -16.590 1.00 . A A . 139 VAL H    1 1 
        2  5186 1 1 139 VAL HA   H  11.768  -9.765 -14.782 1.00 . A A . 139 VAL HA   1 1 
        2  5187 1 1 139 VAL HB   H  13.321 -10.063 -16.774 1.00 . A A . 139 VAL HB   1 1 
        2  5188 1 1 139 VAL HG11 H  10.340 -10.379 -17.343 1.00 . A A . 139 VAL HG11 1 1 
        2  5189 1 1 139 VAL HG12 H  11.354 -11.530 -16.468 1.00 . A A . 139 VAL HG12 1 1 
        2  5190 1 1 139 VAL HG13 H  11.646 -11.228 -18.181 1.00 . A A . 139 VAL HG13 1 1 
        2  5191 1 1 139 VAL HG21 H  12.626  -9.041 -18.938 1.00 . A A . 139 VAL HG21 1 1 
        2  5192 1 1 139 VAL HG22 H  13.106  -7.815 -17.758 1.00 . A A . 139 VAL HG22 1 1 
        2  5193 1 1 139 VAL HG23 H  11.389  -8.099 -18.089 1.00 . A A . 139 VAL HG23 1 1 
        2  5194 1 1 139 VAL N    N  10.656  -8.246 -15.689 1.00 . A A . 139 VAL N    1 1 
        2  5195 1 1 139 VAL O    O  14.209  -8.520 -14.816 1.00 . A A . 139 VAL O    1 1 
        2  5196 1 1 140 ASP C    C  13.706  -5.878 -12.605 1.00 . A A . 140 ASP C    1 1 
        2  5197 1 1 140 ASP CA   C  13.698  -5.787 -14.156 1.00 . A A . 140 ASP CA   1 1 
        2  5198 1 1 140 ASP CB   C  13.306  -4.359 -14.638 1.00 . A A . 140 ASP CB   1 1 
        2  5199 1 1 140 ASP CG   C  13.961  -3.212 -13.848 1.00 . A A . 140 ASP CG   1 1 
        2  5200 1 1 140 ASP H    H  11.839  -6.480 -14.915 1.00 . A A . 140 ASP H    1 1 
        2  5201 1 1 140 ASP HA   H  14.695  -6.023 -14.533 1.00 . A A . 140 ASP HA   1 1 
        2  5202 1 1 140 ASP HB2  H  13.594  -4.252 -15.680 1.00 . A A . 140 ASP HB2  1 1 
        2  5203 1 1 140 ASP HB3  H  12.227  -4.252 -14.578 1.00 . A A . 140 ASP HB3  1 1 
        2  5204 1 1 140 ASP N    N  12.752  -6.775 -14.725 1.00 . A A . 140 ASP N    1 1 
        2  5205 1 1 140 ASP O    O  12.640  -5.885 -11.987 1.00 . A A . 140 ASP O    1 1 
        2  5206 1 1 140 ASP OD1  O  15.177  -2.968 -14.013 1.00 . A A . 140 ASP OD1  1 1 
        2  5207 1 1 140 ASP OD2  O  13.263  -2.551 -13.055 1.00 . A A . 140 ASP OD2  1 1 
        2  5208 1 1 141 PRO C    C  14.609  -4.881  -9.613 1.00 . A A . 141 PRO C    1 1 
        2  5209 1 1 141 PRO CA   C  15.019  -6.117 -10.465 1.00 . A A . 141 PRO CA   1 1 
        2  5210 1 1 141 PRO CB   C  16.521  -6.465 -10.239 1.00 . A A . 141 PRO CB   1 1 
        2  5211 1 1 141 PRO CD   C  16.250  -6.015 -12.580 1.00 . A A . 141 PRO CD   1 1 
        2  5212 1 1 141 PRO CG   C  17.047  -6.837 -11.595 1.00 . A A . 141 PRO CG   1 1 
        2  5213 1 1 141 PRO HA   H  14.410  -6.955 -10.141 1.00 . A A . 141 PRO HA   1 1 
        2  5214 1 1 141 PRO HB2  H  17.061  -5.604  -9.834 1.00 . A A . 141 PRO HB2  1 1 
        2  5215 1 1 141 PRO HB3  H  16.613  -7.301  -9.559 1.00 . A A . 141 PRO HB3  1 1 
        2  5216 1 1 141 PRO HD2  H  16.667  -5.020 -12.678 1.00 . A A . 141 PRO HD2  1 1 
        2  5217 1 1 141 PRO HD3  H  16.212  -6.506 -13.547 1.00 . A A . 141 PRO HD3  1 1 
        2  5218 1 1 141 PRO HG2  H  18.107  -6.606 -11.669 1.00 . A A . 141 PRO HG2  1 1 
        2  5219 1 1 141 PRO HG3  H  16.885  -7.895 -11.782 1.00 . A A . 141 PRO HG3  1 1 
        2  5220 1 1 141 PRO N    N  14.908  -5.969 -11.949 1.00 . A A . 141 PRO N    1 1 
        2  5221 1 1 141 PRO O    O  14.365  -5.041  -8.409 1.00 . A A . 141 PRO O    1 1 
        2  5222 1 1 142 SER C    C  12.779  -2.355  -8.889 1.00 . A A . 142 SER C    1 1 
        2  5223 1 1 142 SER CA   C  14.212  -2.410  -9.478 1.00 . A A . 142 SER CA   1 1 
        2  5224 1 1 142 SER CB   C  14.419  -1.191 -10.405 1.00 . A A . 142 SER CB   1 1 
        2  5225 1 1 142 SER H    H  14.712  -3.616 -11.175 1.00 . A A . 142 SER H    1 1 
        2  5226 1 1 142 SER HA   H  14.922  -2.338  -8.662 1.00 . A A . 142 SER HA   1 1 
        2  5227 1 1 142 SER HB2  H  13.632  -1.152 -11.153 1.00 . A A . 142 SER HB2  1 1 
        2  5228 1 1 142 SER HB3  H  14.398  -0.281  -9.817 1.00 . A A . 142 SER HB3  1 1 
        2  5229 1 1 142 SER HG   H  15.511  -1.348 -12.023 1.00 . A A . 142 SER HG   1 1 
        2  5230 1 1 142 SER N    N  14.525  -3.676 -10.213 1.00 . A A . 142 SER N    1 1 
        2  5231 1 1 142 SER O    O  12.484  -1.471  -8.075 1.00 . A A . 142 SER O    1 1 
        2  5232 1 1 142 SER OG   O  15.667  -1.266 -11.071 1.00 . A A . 142 SER OG   1 1 
        2  5233 1 1 143 TRP C    C   9.845  -2.713  -7.957 1.00 . A A . 143 TRP C    1 1 
        2  5234 1 1 143 TRP CA   C  10.472  -3.277  -9.241 1.00 . A A . 143 TRP CA   1 1 
        2  5235 1 1 143 TRP CB   C   9.863  -4.674  -9.596 1.00 . A A . 143 TRP CB   1 1 
        2  5236 1 1 143 TRP CD1  C   9.934  -4.529 -12.142 1.00 . A A . 143 TRP CD1  1 1 
        2  5237 1 1 143 TRP CD2  C   7.885  -4.859 -11.322 1.00 . A A . 143 TRP CD2  1 1 
        2  5238 1 1 143 TRP CE2  C   7.797  -4.774 -12.710 1.00 . A A . 143 TRP CE2  1 1 
        2  5239 1 1 143 TRP CE3  C   6.717  -5.076 -10.597 1.00 . A A . 143 TRP CE3  1 1 
        2  5240 1 1 143 TRP CG   C   9.265  -4.699 -10.974 1.00 . A A . 143 TRP CG   1 1 
        2  5241 1 1 143 TRP CH2  C   5.469  -5.100 -12.648 1.00 . A A . 143 TRP CH2  1 1 
        2  5242 1 1 143 TRP CZ2  C   6.590  -4.889 -13.380 1.00 . A A . 143 TRP CZ2  1 1 
        2  5243 1 1 143 TRP CZ3  C   5.529  -5.190 -11.269 1.00 . A A . 143 TRP CZ3  1 1 
        2  5244 1 1 143 TRP H    H  12.335  -4.159  -9.631 1.00 . A A . 143 TRP H    1 1 
        2  5245 1 1 143 TRP HA   H  10.211  -2.584 -10.039 1.00 . A A . 143 TRP HA   1 1 
        2  5246 1 1 143 TRP HB2  H  10.639  -5.434  -9.554 1.00 . A A . 143 TRP HB2  1 1 
        2  5247 1 1 143 TRP HB3  H   9.089  -4.940  -8.885 1.00 . A A . 143 TRP HB3  1 1 
        2  5248 1 1 143 TRP HD1  H  11.009  -4.382 -12.213 1.00 . A A . 143 TRP HD1  1 1 
        2  5249 1 1 143 TRP HE1  H   9.294  -4.449 -14.125 1.00 . A A . 143 TRP HE1  1 1 
        2  5250 1 1 143 TRP HE3  H   6.733  -5.152  -9.523 1.00 . A A . 143 TRP HE3  1 1 
        2  5251 1 1 143 TRP HH2  H   4.504  -5.196 -13.135 1.00 . A A . 143 TRP HH2  1 1 
        2  5252 1 1 143 TRP HZ2  H   6.532  -4.823 -14.455 1.00 . A A . 143 TRP HZ2  1 1 
        2  5253 1 1 143 TRP HZ3  H   4.618  -5.362 -10.722 1.00 . A A . 143 TRP HZ3  1 1 
        2  5254 1 1 143 TRP N    N  11.940  -3.335  -9.283 1.00 . A A . 143 TRP N    1 1 
        2  5255 1 1 143 TRP NE1  N   9.057  -4.556 -13.189 1.00 . A A . 143 TRP NE1  1 1 
        2  5256 1 1 143 TRP O    O   9.094  -1.757  -8.066 1.00 . A A . 143 TRP O    1 1 
        2  5257 1 1 144 LYS C    C   9.741  -1.280  -5.296 1.00 . A A . 144 LYS C    1 1 
        2  5258 1 1 144 LYS CA   C   9.493  -2.791  -5.506 1.00 . A A . 144 LYS CA   1 1 
        2  5259 1 1 144 LYS CB   C   9.922  -3.616  -4.254 1.00 . A A . 144 LYS CB   1 1 
        2  5260 1 1 144 LYS CD   C  11.830  -4.498  -2.736 1.00 . A A . 144 LYS CD   1 1 
        2  5261 1 1 144 LYS CE   C  11.194  -5.901  -2.668 1.00 . A A . 144 LYS CE   1 1 
        2  5262 1 1 144 LYS CG   C  11.447  -3.709  -4.013 1.00 . A A . 144 LYS CG   1 1 
        2  5263 1 1 144 LYS H    H  10.817  -3.985  -6.712 1.00 . A A . 144 LYS H    1 1 
        2  5264 1 1 144 LYS HA   H   8.424  -2.933  -5.658 1.00 . A A . 144 LYS HA   1 1 
        2  5265 1 1 144 LYS HB2  H   9.465  -3.171  -3.372 1.00 . A A . 144 LYS HB2  1 1 
        2  5266 1 1 144 LYS HB3  H   9.539  -4.621  -4.365 1.00 . A A . 144 LYS HB3  1 1 
        2  5267 1 1 144 LYS HD2  H  12.909  -4.607  -2.705 1.00 . A A . 144 LYS HD2  1 1 
        2  5268 1 1 144 LYS HD3  H  11.512  -3.926  -1.872 1.00 . A A . 144 LYS HD3  1 1 
        2  5269 1 1 144 LYS HE2  H  11.610  -6.430  -1.819 1.00 . A A . 144 LYS HE2  1 1 
        2  5270 1 1 144 LYS HE3  H  10.124  -5.799  -2.529 1.00 . A A . 144 LYS HE3  1 1 
        2  5271 1 1 144 LYS HG2  H  11.908  -4.191  -4.869 1.00 . A A . 144 LYS HG2  1 1 
        2  5272 1 1 144 LYS HG3  H  11.844  -2.700  -3.927 1.00 . A A . 144 LYS HG3  1 1 
        2  5273 1 1 144 LYS HZ1  H  10.928  -7.613  -3.850 1.00 . A A . 144 LYS HZ1  1 1 
        2  5274 1 1 144 LYS HZ2  H  12.462  -6.917  -3.988 1.00 . A A . 144 LYS HZ2  1 1 
        2  5275 1 1 144 LYS HZ3  H  11.138  -6.195  -4.742 1.00 . A A . 144 LYS HZ3  1 1 
        2  5276 1 1 144 LYS N    N  10.147  -3.268  -6.758 1.00 . A A . 144 LYS N    1 1 
        2  5277 1 1 144 LYS NZ   N  11.448  -6.714  -3.898 1.00 . A A . 144 LYS NZ   1 1 
        2  5278 1 1 144 LYS O    O   8.788  -0.517  -5.129 1.00 . A A . 144 LYS O    1 1 
        2  5279 1 1 145 LYS C    C  10.864   1.426  -6.408 1.00 . A A . 145 LYS C    1 1 
        2  5280 1 1 145 LYS CA   C  11.448   0.537  -5.285 1.00 . A A . 145 LYS CA   1 1 
        2  5281 1 1 145 LYS CB   C  12.999   0.600  -5.289 1.00 . A A . 145 LYS CB   1 1 
        2  5282 1 1 145 LYS CD   C  13.403   0.292  -2.720 1.00 . A A . 145 LYS CD   1 1 
        2  5283 1 1 145 LYS CE   C  14.186   1.581  -2.348 1.00 . A A . 145 LYS CE   1 1 
        2  5284 1 1 145 LYS CG   C  13.681  -0.221  -4.165 1.00 . A A . 145 LYS CG   1 1 
        2  5285 1 1 145 LYS H    H  11.701  -1.544  -5.589 1.00 . A A . 145 LYS H    1 1 
        2  5286 1 1 145 LYS HA   H  11.080   0.902  -4.332 1.00 . A A . 145 LYS HA   1 1 
        2  5287 1 1 145 LYS HB2  H  13.358   0.224  -6.245 1.00 . A A . 145 LYS HB2  1 1 
        2  5288 1 1 145 LYS HB3  H  13.310   1.632  -5.192 1.00 . A A . 145 LYS HB3  1 1 
        2  5289 1 1 145 LYS HD2  H  12.342   0.485  -2.612 1.00 . A A . 145 LYS HD2  1 1 
        2  5290 1 1 145 LYS HD3  H  13.683  -0.492  -2.023 1.00 . A A . 145 LYS HD3  1 1 
        2  5291 1 1 145 LYS HE2  H  14.003   1.811  -1.307 1.00 . A A . 145 LYS HE2  1 1 
        2  5292 1 1 145 LYS HE3  H  15.244   1.395  -2.485 1.00 . A A . 145 LYS HE3  1 1 
        2  5293 1 1 145 LYS HG2  H  13.335  -1.247  -4.236 1.00 . A A . 145 LYS HG2  1 1 
        2  5294 1 1 145 LYS HG3  H  14.753  -0.211  -4.334 1.00 . A A . 145 LYS HG3  1 1 
        2  5295 1 1 145 LYS HZ1  H  12.766   2.859  -3.210 1.00 . A A . 145 LYS HZ1  1 1 
        2  5296 1 1 145 LYS HZ2  H  14.172   2.694  -4.129 1.00 . A A . 145 LYS HZ2  1 1 
        2  5297 1 1 145 LYS HZ3  H  14.180   3.641  -2.732 1.00 . A A . 145 LYS HZ3  1 1 
        2  5298 1 1 145 LYS N    N  11.018  -0.869  -5.417 1.00 . A A . 145 LYS N    1 1 
        2  5299 1 1 145 LYS NZ   N  13.800   2.775  -3.160 1.00 . A A . 145 LYS NZ   1 1 
        2  5300 1 1 145 LYS O    O  10.524   2.593  -6.167 1.00 . A A . 145 LYS O    1 1 
        2  5301 1 1 146 ALA C    C   8.699   1.891  -8.619 1.00 . A A . 146 ALA C    1 1 
        2  5302 1 1 146 ALA CA   C  10.189   1.540  -8.801 1.00 . A A . 146 ALA CA   1 1 
        2  5303 1 1 146 ALA CB   C  10.416   0.671 -10.046 1.00 . A A . 146 ALA CB   1 1 
        2  5304 1 1 146 ALA H    H  11.052  -0.072  -7.726 1.00 . A A . 146 ALA H    1 1 
        2  5305 1 1 146 ALA HA   H  10.751   2.464  -8.930 1.00 . A A . 146 ALA HA   1 1 
        2  5306 1 1 146 ALA HB1  H  11.467   0.429 -10.129 1.00 . A A . 146 ALA HB1  1 1 
        2  5307 1 1 146 ALA HB2  H  10.102   1.208 -10.930 1.00 . A A . 146 ALA HB2  1 1 
        2  5308 1 1 146 ALA HB3  H   9.846  -0.247  -9.960 1.00 . A A . 146 ALA HB3  1 1 
        2  5309 1 1 146 ALA N    N  10.738   0.849  -7.617 1.00 . A A . 146 ALA N    1 1 
        2  5310 1 1 146 ALA O    O   8.298   3.059  -8.804 1.00 . A A . 146 ALA O    1 1 
        2  5311 1 1 147 ILE C    C   6.352   2.147  -6.787 1.00 . A A . 147 ILE C    1 1 
        2  5312 1 1 147 ILE CA   C   6.467   1.090  -7.906 1.00 . A A . 147 ILE CA   1 1 
        2  5313 1 1 147 ILE CB   C   5.726  -0.232  -7.444 1.00 . A A . 147 ILE CB   1 1 
        2  5314 1 1 147 ILE CD1  C   5.474  -1.394  -9.789 1.00 . A A . 147 ILE CD1  1 1 
        2  5315 1 1 147 ILE CG1  C   6.021  -1.463  -8.369 1.00 . A A . 147 ILE CG1  1 1 
        2  5316 1 1 147 ILE CG2  C   4.199  -0.006  -7.362 1.00 . A A . 147 ILE CG2  1 1 
        2  5317 1 1 147 ILE H    H   8.274   0.006  -8.068 1.00 . A A . 147 ILE H    1 1 
        2  5318 1 1 147 ILE HA   H   5.991   1.465  -8.812 1.00 . A A . 147 ILE HA   1 1 
        2  5319 1 1 147 ILE HB   H   6.073  -0.466  -6.438 1.00 . A A . 147 ILE HB   1 1 
        2  5320 1 1 147 ILE HD11 H   5.701  -2.321 -10.300 1.00 . A A . 147 ILE HD11 1 1 
        2  5321 1 1 147 ILE HD12 H   5.931  -0.574 -10.319 1.00 . A A . 147 ILE HD12 1 1 
        2  5322 1 1 147 ILE HD13 H   4.401  -1.259  -9.766 1.00 . A A . 147 ILE HD13 1 1 
        2  5323 1 1 147 ILE HG12 H   7.085  -1.590  -8.448 1.00 . A A . 147 ILE HG12 1 1 
        2  5324 1 1 147 ILE HG13 H   5.607  -2.355  -7.906 1.00 . A A . 147 ILE HG13 1 1 
        2  5325 1 1 147 ILE HG21 H   3.803   0.182  -8.353 1.00 . A A . 147 ILE HG21 1 1 
        2  5326 1 1 147 ILE HG22 H   3.987   0.842  -6.727 1.00 . A A . 147 ILE HG22 1 1 
        2  5327 1 1 147 ILE HG23 H   3.721  -0.886  -6.953 1.00 . A A . 147 ILE HG23 1 1 
        2  5328 1 1 147 ILE N    N   7.892   0.889  -8.199 1.00 . A A . 147 ILE N    1 1 
        2  5329 1 1 147 ILE O    O   5.624   3.143  -6.934 1.00 . A A . 147 ILE O    1 1 
        2  5330 1 1 148 TYR C    C   7.389   4.295  -4.972 1.00 . A A . 148 TYR C    1 1 
        2  5331 1 1 148 TYR CA   C   7.211   2.836  -4.543 1.00 . A A . 148 TYR CA   1 1 
        2  5332 1 1 148 TYR CB   C   8.333   2.454  -3.533 1.00 . A A . 148 TYR CB   1 1 
        2  5333 1 1 148 TYR CD1  C   6.825   0.642  -2.480 1.00 . A A . 148 TYR CD1  1 1 
        2  5334 1 1 148 TYR CD2  C   9.189   0.521  -2.103 1.00 . A A . 148 TYR CD2  1 1 
        2  5335 1 1 148 TYR CE1  C   6.651  -0.500  -1.712 1.00 . A A . 148 TYR CE1  1 1 
        2  5336 1 1 148 TYR CE2  C   9.012  -0.612  -1.340 1.00 . A A . 148 TYR CE2  1 1 
        2  5337 1 1 148 TYR CG   C   8.103   1.179  -2.694 1.00 . A A . 148 TYR CG   1 1 
        2  5338 1 1 148 TYR CZ   C   7.748  -1.120  -1.147 1.00 . A A . 148 TYR CZ   1 1 
        2  5339 1 1 148 TYR H    H   7.754   1.153  -5.713 1.00 . A A . 148 TYR H    1 1 
        2  5340 1 1 148 TYR HA   H   6.250   2.741  -4.039 1.00 . A A . 148 TYR HA   1 1 
        2  5341 1 1 148 TYR HB2  H   9.258   2.317  -4.084 1.00 . A A . 148 TYR HB2  1 1 
        2  5342 1 1 148 TYR HB3  H   8.477   3.273  -2.834 1.00 . A A . 148 TYR HB3  1 1 
        2  5343 1 1 148 TYR HD1  H   5.962   1.126  -2.922 1.00 . A A . 148 TYR HD1  1 1 
        2  5344 1 1 148 TYR HD2  H  10.189   0.913  -2.252 1.00 . A A . 148 TYR HD2  1 1 
        2  5345 1 1 148 TYR HE1  H   5.657  -0.902  -1.557 1.00 . A A . 148 TYR HE1  1 1 
        2  5346 1 1 148 TYR HE2  H   9.870  -1.103  -0.895 1.00 . A A . 148 TYR HE2  1 1 
        2  5347 1 1 148 TYR HH   H   7.047  -2.884  -0.864 1.00 . A A . 148 TYR HH   1 1 
        2  5348 1 1 148 TYR N    N   7.165   1.940  -5.709 1.00 . A A . 148 TYR N    1 1 
        2  5349 1 1 148 TYR O    O   6.583   5.113  -4.596 1.00 . A A . 148 TYR O    1 1 
        2  5350 1 1 148 TYR OH   O   7.582  -2.247  -0.379 1.00 . A A . 148 TYR OH   1 1 
        2  5351 1 1 149 LYS C    C   7.578   6.568  -7.126 1.00 . A A . 149 LYS C    1 1 
        2  5352 1 1 149 LYS CA   C   8.680   5.990  -6.213 1.00 . A A . 149 LYS CA   1 1 
        2  5353 1 1 149 LYS CB   C  10.090   6.155  -6.853 1.00 . A A . 149 LYS CB   1 1 
        2  5354 1 1 149 LYS CD   C  11.760   5.546  -8.738 1.00 . A A . 149 LYS CD   1 1 
        2  5355 1 1 149 LYS CE   C  11.961   6.971  -9.290 1.00 . A A . 149 LYS CE   1 1 
        2  5356 1 1 149 LYS CG   C  10.352   5.321  -8.125 1.00 . A A . 149 LYS CG   1 1 
        2  5357 1 1 149 LYS H    H   8.945   3.869  -6.182 1.00 . A A . 149 LYS H    1 1 
        2  5358 1 1 149 LYS HA   H   8.672   6.573  -5.292 1.00 . A A . 149 LYS HA   1 1 
        2  5359 1 1 149 LYS HB2  H  10.233   7.201  -7.102 1.00 . A A . 149 LYS HB2  1 1 
        2  5360 1 1 149 LYS HB3  H  10.833   5.879  -6.110 1.00 . A A . 149 LYS HB3  1 1 
        2  5361 1 1 149 LYS HD2  H  12.510   5.356  -7.978 1.00 . A A . 149 LYS HD2  1 1 
        2  5362 1 1 149 LYS HD3  H  11.901   4.839  -9.550 1.00 . A A . 149 LYS HD3  1 1 
        2  5363 1 1 149 LYS HE2  H  11.756   7.687  -8.505 1.00 . A A . 149 LYS HE2  1 1 
        2  5364 1 1 149 LYS HE3  H  12.985   7.081  -9.614 1.00 . A A . 149 LYS HE3  1 1 
        2  5365 1 1 149 LYS HG2  H  10.250   4.272  -7.873 1.00 . A A . 149 LYS HG2  1 1 
        2  5366 1 1 149 LYS HG3  H   9.601   5.573  -8.870 1.00 . A A . 149 LYS HG3  1 1 
        2  5367 1 1 149 LYS HZ1  H  10.069   7.259 -10.146 1.00 . A A . 149 LYS HZ1  1 1 
        2  5368 1 1 149 LYS HZ2  H  11.193   6.543 -11.186 1.00 . A A . 149 LYS HZ2  1 1 
        2  5369 1 1 149 LYS HZ3  H  11.291   8.192 -10.845 1.00 . A A . 149 LYS HZ3  1 1 
        2  5370 1 1 149 LYS N    N   8.397   4.597  -5.817 1.00 . A A . 149 LYS N    1 1 
        2  5371 1 1 149 LYS NZ   N  11.064   7.260 -10.445 1.00 . A A . 149 LYS NZ   1 1 
        2  5372 1 1 149 LYS O    O   7.212   7.742  -6.952 1.00 . A A . 149 LYS O    1 1 
        2  5373 1 1 150 VAL C    C   4.645   6.614  -8.204 1.00 . A A . 150 VAL C    1 1 
        2  5374 1 1 150 VAL CA   C   5.936   6.278  -8.977 1.00 . A A . 150 VAL CA   1 1 
        2  5375 1 1 150 VAL CB   C   5.593   5.334 -10.196 1.00 . A A . 150 VAL CB   1 1 
        2  5376 1 1 150 VAL CG1  C   6.864   4.964 -10.963 1.00 . A A . 150 VAL CG1  1 1 
        2  5377 1 1 150 VAL CG2  C   4.810   4.072  -9.782 1.00 . A A . 150 VAL CG2  1 1 
        2  5378 1 1 150 VAL H    H   7.301   4.812  -8.147 1.00 . A A . 150 VAL H    1 1 
        2  5379 1 1 150 VAL HA   H   6.318   7.213  -9.393 1.00 . A A . 150 VAL HA   1 1 
        2  5380 1 1 150 VAL HB   H   4.961   5.901 -10.884 1.00 . A A . 150 VAL HB   1 1 
        2  5381 1 1 150 VAL HG11 H   7.512   4.388 -10.314 1.00 . A A . 150 VAL HG11 1 1 
        2  5382 1 1 150 VAL HG12 H   7.377   5.860 -11.279 1.00 . A A . 150 VAL HG12 1 1 
        2  5383 1 1 150 VAL HG13 H   6.609   4.370 -11.832 1.00 . A A . 150 VAL HG13 1 1 
        2  5384 1 1 150 VAL HG21 H   4.561   3.490 -10.662 1.00 . A A . 150 VAL HG21 1 1 
        2  5385 1 1 150 VAL HG22 H   3.898   4.361  -9.275 1.00 . A A . 150 VAL HG22 1 1 
        2  5386 1 1 150 VAL HG23 H   5.412   3.474  -9.115 1.00 . A A . 150 VAL HG23 1 1 
        2  5387 1 1 150 VAL N    N   7.004   5.757  -8.068 1.00 . A A . 150 VAL N    1 1 
        2  5388 1 1 150 VAL O    O   3.869   7.475  -8.631 1.00 . A A . 150 VAL O    1 1 
        2  5389 1 1 151 ILE C    C   3.591   7.121  -5.004 1.00 . A A . 151 ILE C    1 1 
        2  5390 1 1 151 ILE CA   C   3.235   6.215  -6.207 1.00 . A A . 151 ILE CA   1 1 
        2  5391 1 1 151 ILE CB   C   2.572   4.876  -5.728 1.00 . A A . 151 ILE CB   1 1 
        2  5392 1 1 151 ILE CD1  C   3.278   2.564  -4.718 1.00 . A A . 151 ILE CD1  1 1 
        2  5393 1 1 151 ILE CG1  C   3.562   4.054  -4.832 1.00 . A A . 151 ILE CG1  1 1 
        2  5394 1 1 151 ILE CG2  C   2.086   4.054  -6.950 1.00 . A A . 151 ILE CG2  1 1 
        2  5395 1 1 151 ILE H    H   5.018   5.180  -6.823 1.00 . A A . 151 ILE H    1 1 
        2  5396 1 1 151 ILE HA   H   2.503   6.745  -6.812 1.00 . A A . 151 ILE HA   1 1 
        2  5397 1 1 151 ILE HB   H   1.691   5.129  -5.140 1.00 . A A . 151 ILE HB   1 1 
        2  5398 1 1 151 ILE HD11 H   3.987   2.119  -4.036 1.00 . A A . 151 ILE HD11 1 1 
        2  5399 1 1 151 ILE HD12 H   3.390   2.108  -5.695 1.00 . A A . 151 ILE HD12 1 1 
        2  5400 1 1 151 ILE HD13 H   2.276   2.407  -4.356 1.00 . A A . 151 ILE HD13 1 1 
        2  5401 1 1 151 ILE HG12 H   4.563   4.153  -5.229 1.00 . A A . 151 ILE HG12 1 1 
        2  5402 1 1 151 ILE HG13 H   3.549   4.465  -3.831 1.00 . A A . 151 ILE HG13 1 1 
        2  5403 1 1 151 ILE HG21 H   1.389   4.637  -7.536 1.00 . A A . 151 ILE HG21 1 1 
        2  5404 1 1 151 ILE HG22 H   1.592   3.152  -6.609 1.00 . A A . 151 ILE HG22 1 1 
        2  5405 1 1 151 ILE HG23 H   2.935   3.780  -7.564 1.00 . A A . 151 ILE HG23 1 1 
        2  5406 1 1 151 ILE N    N   4.410   5.930  -7.066 1.00 . A A . 151 ILE N    1 1 
        2  5407 1 1 151 ILE O    O   2.699   7.730  -4.416 1.00 . A A . 151 ILE O    1 1 
        2  5408 1 1 152 CYS C    C   5.678   9.480  -3.948 1.00 . A A . 152 CYS C    1 1 
        2  5409 1 1 152 CYS CA   C   5.369   8.053  -3.511 1.00 . A A . 152 CYS CA   1 1 
        2  5410 1 1 152 CYS CB   C   6.595   7.451  -2.798 1.00 . A A . 152 CYS CB   1 1 
        2  5411 1 1 152 CYS H    H   5.553   6.710  -5.164 1.00 . A A . 152 CYS H    1 1 
        2  5412 1 1 152 CYS HA   H   4.561   8.102  -2.794 1.00 . A A . 152 CYS HA   1 1 
        2  5413 1 1 152 CYS HB2  H   6.364   6.440  -2.497 1.00 . A A . 152 CYS HB2  1 1 
        2  5414 1 1 152 CYS HB3  H   7.441   7.429  -3.479 1.00 . A A . 152 CYS HB3  1 1 
        2  5415 1 1 152 CYS HG   H   6.177   9.275  -1.052 1.00 . A A . 152 CYS HG   1 1 
        2  5416 1 1 152 CYS N    N   4.897   7.218  -4.652 1.00 . A A . 152 CYS N    1 1 
        2  5417 1 1 152 CYS O    O   5.735  10.379  -3.105 1.00 . A A . 152 CYS O    1 1 
        2  5418 1 1 152 CYS SG   S   7.103   8.358  -1.313 1.00 . A A . 152 CYS SG   1 1 
        2  5419 1 1 153 LYS C    C   4.696  11.853  -5.702 1.00 . A A . 153 LYS C    1 1 
        2  5420 1 1 153 LYS CA   C   6.014  11.056  -5.828 1.00 . A A . 153 LYS CA   1 1 
        2  5421 1 1 153 LYS CB   C   6.459  10.994  -7.312 1.00 . A A . 153 LYS CB   1 1 
        2  5422 1 1 153 LYS CD   C   5.837  10.441  -9.757 1.00 . A A . 153 LYS CD   1 1 
        2  5423 1 1 153 LYS CE   C   4.739   9.926 -10.701 1.00 . A A . 153 LYS CE   1 1 
        2  5424 1 1 153 LYS CG   C   5.409  10.393  -8.273 1.00 . A A . 153 LYS CG   1 1 
        2  5425 1 1 153 LYS H    H   5.860   8.921  -5.883 1.00 . A A . 153 LYS H    1 1 
        2  5426 1 1 153 LYS HA   H   6.780  11.564  -5.248 1.00 . A A . 153 LYS HA   1 1 
        2  5427 1 1 153 LYS HB2  H   6.698  11.998  -7.647 1.00 . A A . 153 LYS HB2  1 1 
        2  5428 1 1 153 LYS HB3  H   7.360  10.391  -7.375 1.00 . A A . 153 LYS HB3  1 1 
        2  5429 1 1 153 LYS HD2  H   6.072  11.464 -10.027 1.00 . A A . 153 LYS HD2  1 1 
        2  5430 1 1 153 LYS HD3  H   6.724   9.828  -9.889 1.00 . A A . 153 LYS HD3  1 1 
        2  5431 1 1 153 LYS HE2  H   4.486   8.906 -10.429 1.00 . A A . 153 LYS HE2  1 1 
        2  5432 1 1 153 LYS HE3  H   3.858  10.549 -10.596 1.00 . A A . 153 LYS HE3  1 1 
        2  5433 1 1 153 LYS HG2  H   5.238   9.358  -7.994 1.00 . A A . 153 LYS HG2  1 1 
        2  5434 1 1 153 LYS HG3  H   4.478  10.944  -8.159 1.00 . A A . 153 LYS HG3  1 1 
        2  5435 1 1 153 LYS HZ1  H   5.522  10.885 -12.379 1.00 . A A . 153 LYS HZ1  1 1 
        2  5436 1 1 153 LYS HZ2  H   4.376   9.698 -12.741 1.00 . A A . 153 LYS HZ2  1 1 
        2  5437 1 1 153 LYS HZ3  H   5.928   9.252 -12.270 1.00 . A A . 153 LYS HZ3  1 1 
        2  5438 1 1 153 LYS N    N   5.853   9.695  -5.270 1.00 . A A . 153 LYS N    1 1 
        2  5439 1 1 153 LYS NZ   N   5.172   9.944 -12.120 1.00 . A A . 153 LYS NZ   1 1 
        2  5440 1 1 153 LYS O    O   4.690  13.083  -5.800 1.00 . A A . 153 LYS O    1 1 
        2  5441 1 1 154 LEU C    C   1.502  11.089  -4.143 1.00 . A A . 154 LEU C    1 1 
        2  5442 1 1 154 LEU CA   C   2.240  11.692  -5.355 1.00 . A A . 154 LEU CA   1 1 
        2  5443 1 1 154 LEU CB   C   1.474  11.483  -6.698 1.00 . A A . 154 LEU CB   1 1 
        2  5444 1 1 154 LEU CD1  C   0.494   9.065  -6.767 1.00 . A A . 154 LEU CD1  1 1 
        2  5445 1 1 154 LEU CD2  C   1.492  10.110  -8.876 1.00 . A A . 154 LEU CD2  1 1 
        2  5446 1 1 154 LEU CG   C   1.554  10.038  -7.337 1.00 . A A . 154 LEU CG   1 1 
        2  5447 1 1 154 LEU H    H   3.676  10.145  -5.424 1.00 . A A . 154 LEU H    1 1 
        2  5448 1 1 154 LEU HA   H   2.339  12.757  -5.172 1.00 . A A . 154 LEU HA   1 1 
        2  5449 1 1 154 LEU HB2  H   0.430  11.737  -6.536 1.00 . A A . 154 LEU HB2  1 1 
        2  5450 1 1 154 LEU HB3  H   1.877  12.197  -7.410 1.00 . A A . 154 LEU HB3  1 1 
        2  5451 1 1 154 LEU HD11 H  -0.501   9.438  -6.978 1.00 . A A . 154 LEU HD11 1 1 
        2  5452 1 1 154 LEU HD12 H   0.622   8.976  -5.698 1.00 . A A . 154 LEU HD12 1 1 
        2  5453 1 1 154 LEU HD13 H   0.615   8.088  -7.219 1.00 . A A . 154 LEU HD13 1 1 
        2  5454 1 1 154 LEU HD21 H   2.313  10.712  -9.243 1.00 . A A . 154 LEU HD21 1 1 
        2  5455 1 1 154 LEU HD22 H   0.555  10.552  -9.189 1.00 . A A . 154 LEU HD22 1 1 
        2  5456 1 1 154 LEU HD23 H   1.575   9.113  -9.291 1.00 . A A . 154 LEU HD23 1 1 
        2  5457 1 1 154 LEU HG   H   2.522   9.612  -7.086 1.00 . A A . 154 LEU HG   1 1 
        2  5458 1 1 154 LEU N    N   3.586  11.122  -5.487 1.00 . A A . 154 LEU N    1 1 
        2  5459 1 1 154 LEU O    O   0.281  11.245  -4.022 1.00 . A A . 154 LEU O    1 1 
        2  5460 1 1 155 ASP C    C   1.566  11.166  -1.027 1.00 . A A . 155 ASP C    1 1 
        2  5461 1 1 155 ASP CA   C   1.741   9.941  -1.936 1.00 . A A . 155 ASP CA   1 1 
        2  5462 1 1 155 ASP CB   C   2.737   8.915  -1.304 1.00 . A A . 155 ASP CB   1 1 
        2  5463 1 1 155 ASP CG   C   2.214   8.122  -0.077 1.00 . A A . 155 ASP CG   1 1 
        2  5464 1 1 155 ASP H    H   3.203  10.261  -3.432 1.00 . A A . 155 ASP H    1 1 
        2  5465 1 1 155 ASP HA   H   0.779   9.465  -2.107 1.00 . A A . 155 ASP HA   1 1 
        2  5466 1 1 155 ASP HB2  H   3.002   8.194  -2.070 1.00 . A A . 155 ASP HB2  1 1 
        2  5467 1 1 155 ASP HB3  H   3.647   9.438  -1.016 1.00 . A A . 155 ASP HB3  1 1 
        2  5468 1 1 155 ASP N    N   2.260  10.422  -3.241 1.00 . A A . 155 ASP N    1 1 
        2  5469 1 1 155 ASP O    O   2.399  12.093  -1.063 1.00 . A A . 155 ASP O    1 1 
        2  5470 1 1 155 ASP OD1  O   2.216   8.662   1.049 1.00 . A A . 155 ASP OD1  1 1 
        2  5471 1 1 155 ASP OD2  O   1.852   6.924  -0.229 1.00 . A A . 155 ASP OD2  1 1 
        2  5472 1 1 156 SER C    C   0.464  12.130   2.047 1.00 . A A . 156 SER C    1 1 
        2  5473 1 1 156 SER CA   C   0.115  12.352   0.571 1.00 . A A . 156 SER CA   1 1 
        2  5474 1 1 156 SER CB   C  -1.402  12.596   0.383 1.00 . A A . 156 SER CB   1 1 
        2  5475 1 1 156 SER H    H   0.039  10.328  -0.038 1.00 . A A . 156 SER H    1 1 
        2  5476 1 1 156 SER HA   H   0.663  13.223   0.215 1.00 . A A . 156 SER HA   1 1 
        2  5477 1 1 156 SER HB2  H  -1.968  11.799   0.849 1.00 . A A . 156 SER HB2  1 1 
        2  5478 1 1 156 SER HB3  H  -1.676  13.542   0.832 1.00 . A A . 156 SER HB3  1 1 
        2  5479 1 1 156 SER HG   H  -1.443  11.817  -1.412 1.00 . A A . 156 SER HG   1 1 
        2  5480 1 1 156 SER N    N   0.515  11.166  -0.212 1.00 . A A . 156 SER N    1 1 
        2  5481 1 1 156 SER O    O   1.109  11.142   2.390 1.00 . A A . 156 SER O    1 1 
        2  5482 1 1 156 SER OG   O  -1.734  12.637  -0.997 1.00 . A A . 156 SER OG   1 1 
        2  5483 1 1 157 GLU C    C  -1.203  12.578   4.943 1.00 . A A . 157 GLU C    1 1 
        2  5484 1 1 157 GLU CA   C   0.174  12.930   4.368 1.00 . A A . 157 GLU CA   1 1 
        2  5485 1 1 157 GLU CB   C   0.701  14.242   5.006 1.00 . A A . 157 GLU CB   1 1 
        2  5486 1 1 157 GLU CD   C   2.520  16.049   5.020 1.00 . A A . 157 GLU CD   1 1 
        2  5487 1 1 157 GLU CG   C   2.020  14.744   4.397 1.00 . A A . 157 GLU CG   1 1 
        2  5488 1 1 157 GLU H    H  -0.370  13.878   2.549 1.00 . A A . 157 GLU H    1 1 
        2  5489 1 1 157 GLU HA   H   0.869  12.124   4.589 1.00 . A A . 157 GLU HA   1 1 
        2  5490 1 1 157 GLU HB2  H  -0.050  15.023   4.888 1.00 . A A . 157 GLU HB2  1 1 
        2  5491 1 1 157 GLU HB3  H   0.858  14.076   6.066 1.00 . A A . 157 GLU HB3  1 1 
        2  5492 1 1 157 GLU HG2  H   2.776  13.976   4.531 1.00 . A A . 157 GLU HG2  1 1 
        2  5493 1 1 157 GLU HG3  H   1.868  14.899   3.332 1.00 . A A . 157 GLU HG3  1 1 
        2  5494 1 1 157 GLU N    N   0.053  13.070   2.905 1.00 . A A . 157 GLU N    1 1 
        2  5495 1 1 157 GLU O    O  -2.233  12.967   4.369 1.00 . A A . 157 GLU O    1 1 
        2  5496 1 1 157 GLU OE1  O   1.955  17.117   4.704 1.00 . A A . 157 GLU OE1  1 1 
        2  5497 1 1 157 GLU OE2  O   3.485  16.021   5.825 1.00 . A A . 157 GLU OE2  1 1 
        2  5498 1 1 158 VAL C    C  -3.022  12.811   7.457 1.00 . A A . 158 VAL C    1 1 
        2  5499 1 1 158 VAL CA   C  -2.481  11.533   6.782 1.00 . A A . 158 VAL CA   1 1 
        2  5500 1 1 158 VAL CB   C  -2.287  10.415   7.883 1.00 . A A . 158 VAL CB   1 1 
        2  5501 1 1 158 VAL CG1  C  -1.893   9.081   7.242 1.00 . A A . 158 VAL CG1  1 1 
        2  5502 1 1 158 VAL CG2  C  -1.263  10.843   8.968 1.00 . A A . 158 VAL CG2  1 1 
        2  5503 1 1 158 VAL H    H  -0.382  11.466   6.402 1.00 . A A . 158 VAL H    1 1 
        2  5504 1 1 158 VAL HA   H  -3.214  11.179   6.059 1.00 . A A . 158 VAL HA   1 1 
        2  5505 1 1 158 VAL HB   H  -3.246  10.257   8.380 1.00 . A A . 158 VAL HB   1 1 
        2  5506 1 1 158 VAL HG11 H  -2.664   8.768   6.546 1.00 . A A . 158 VAL HG11 1 1 
        2  5507 1 1 158 VAL HG12 H  -1.782   8.324   8.007 1.00 . A A . 158 VAL HG12 1 1 
        2  5508 1 1 158 VAL HG13 H  -0.958   9.193   6.711 1.00 . A A . 158 VAL HG13 1 1 
        2  5509 1 1 158 VAL HG21 H  -1.171  10.064   9.715 1.00 . A A . 158 VAL HG21 1 1 
        2  5510 1 1 158 VAL HG22 H  -1.601  11.757   9.444 1.00 . A A . 158 VAL HG22 1 1 
        2  5511 1 1 158 VAL HG23 H  -0.299  11.016   8.511 1.00 . A A . 158 VAL HG23 1 1 
        2  5512 1 1 158 VAL N    N  -1.227  11.828   6.058 1.00 . A A . 158 VAL N    1 1 
        2  5513 1 1 158 VAL O    O  -2.241  13.736   7.737 1.00 . A A . 158 VAL O    1 1 
        2  5514 1 1 159 PRO C    C  -4.157  13.556  10.043 1.00 . A A . 159 PRO C    1 1 
        2  5515 1 1 159 PRO CA   C  -4.931  13.782   8.734 1.00 . A A . 159 PRO CA   1 1 
        2  5516 1 1 159 PRO CB   C  -6.398  13.300   8.830 1.00 . A A . 159 PRO CB   1 1 
        2  5517 1 1 159 PRO CD   C  -5.440  12.264   6.875 1.00 . A A . 159 PRO CD   1 1 
        2  5518 1 1 159 PRO CG   C  -6.728  12.851   7.434 1.00 . A A . 159 PRO CG   1 1 
        2  5519 1 1 159 PRO HA   H  -4.893  14.832   8.451 1.00 . A A . 159 PRO HA   1 1 
        2  5520 1 1 159 PRO HB2  H  -6.481  12.474   9.540 1.00 . A A . 159 PRO HB2  1 1 
        2  5521 1 1 159 PRO HB3  H  -7.049  14.113   9.133 1.00 . A A . 159 PRO HB3  1 1 
        2  5522 1 1 159 PRO HD2  H  -5.418  11.190   7.016 1.00 . A A . 159 PRO HD2  1 1 
        2  5523 1 1 159 PRO HD3  H  -5.330  12.507   5.824 1.00 . A A . 159 PRO HD3  1 1 
        2  5524 1 1 159 PRO HG2  H  -7.515  12.099   7.461 1.00 . A A . 159 PRO HG2  1 1 
        2  5525 1 1 159 PRO HG3  H  -7.047  13.696   6.828 1.00 . A A . 159 PRO HG3  1 1 
        2  5526 1 1 159 PRO N    N  -4.371  12.916   7.677 1.00 . A A . 159 PRO N    1 1 
        2  5527 1 1 159 PRO O    O  -4.106  12.414  10.532 1.00 . A A . 159 PRO O    1 1 
        2  5528 1 1 160 GLU C    C  -2.972  13.781  12.848 1.00 . A A . 160 GLU C    1 1 
        2  5529 1 1 160 GLU CA   C  -2.514  14.597  11.633 1.00 . A A . 160 GLU CA   1 1 
        2  5530 1 1 160 GLU CB   C  -2.112  16.038  12.048 1.00 . A A . 160 GLU CB   1 1 
        2  5531 1 1 160 GLU CD   C  -0.973  18.241  11.374 1.00 . A A . 160 GLU CD   1 1 
        2  5532 1 1 160 GLU CG   C  -1.411  16.840  10.928 1.00 . A A . 160 GLU CG   1 1 
        2  5533 1 1 160 GLU H    H  -3.854  15.524  10.256 1.00 . A A . 160 GLU H    1 1 
        2  5534 1 1 160 GLU HA   H  -1.646  14.107  11.209 1.00 . A A . 160 GLU HA   1 1 
        2  5535 1 1 160 GLU HB2  H  -3.008  16.579  12.347 1.00 . A A . 160 GLU HB2  1 1 
        2  5536 1 1 160 GLU HB3  H  -1.442  15.985  12.900 1.00 . A A . 160 GLU HB3  1 1 
        2  5537 1 1 160 GLU HG2  H  -0.533  16.291  10.601 1.00 . A A . 160 GLU HG2  1 1 
        2  5538 1 1 160 GLU HG3  H  -2.092  16.930  10.088 1.00 . A A . 160 GLU HG3  1 1 
        2  5539 1 1 160 GLU N    N  -3.552  14.646  10.568 1.00 . A A . 160 GLU N    1 1 
        2  5540 1 1 160 GLU O    O  -2.164  13.140  13.524 1.00 . A A . 160 GLU O    1 1 
        2  5541 1 1 160 GLU OE1  O  -0.001  18.344  12.151 1.00 . A A . 160 GLU OE1  1 1 
        2  5542 1 1 160 GLU OE2  O  -1.599  19.241  10.963 1.00 . A A . 160 GLU OE2  1 1 
        2  5543 1 1 161 ILE C    C  -6.419  12.747  13.627 1.00 . A A . 161 ILE C    1 1 
        2  5544 1 1 161 ILE CA   C  -4.952  12.963  14.066 1.00 . A A . 161 ILE CA   1 1 
        2  5545 1 1 161 ILE CB   C  -4.858  13.590  15.506 1.00 . A A . 161 ILE CB   1 1 
        2  5546 1 1 161 ILE CD1  C  -5.738  13.322  17.949 1.00 . A A . 161 ILE CD1  1 1 
        2  5547 1 1 161 ILE CG1  C  -5.654  12.742  16.544 1.00 . A A . 161 ILE CG1  1 1 
        2  5548 1 1 161 ILE CG2  C  -5.295  15.066  15.506 1.00 . A A . 161 ILE CG2  1 1 
        2  5549 1 1 161 ILE H    H  -4.837  14.409  12.543 1.00 . A A . 161 ILE H    1 1 
        2  5550 1 1 161 ILE HA   H  -4.448  11.998  14.081 1.00 . A A . 161 ILE HA   1 1 
        2  5551 1 1 161 ILE HB   H  -3.807  13.577  15.789 1.00 . A A . 161 ILE HB   1 1 
        2  5552 1 1 161 ILE HD11 H  -4.743  13.431  18.354 1.00 . A A . 161 ILE HD11 1 1 
        2  5553 1 1 161 ILE HD12 H  -6.305  12.649  18.575 1.00 . A A . 161 ILE HD12 1 1 
        2  5554 1 1 161 ILE HD13 H  -6.227  14.285  17.923 1.00 . A A . 161 ILE HD13 1 1 
        2  5555 1 1 161 ILE HG12 H  -6.670  12.609  16.197 1.00 . A A . 161 ILE HG12 1 1 
        2  5556 1 1 161 ILE HG13 H  -5.187  11.770  16.627 1.00 . A A . 161 ILE HG13 1 1 
        2  5557 1 1 161 ILE HG21 H  -5.180  15.486  16.497 1.00 . A A . 161 ILE HG21 1 1 
        2  5558 1 1 161 ILE HG22 H  -6.335  15.138  15.209 1.00 . A A . 161 ILE HG22 1 1 
        2  5559 1 1 161 ILE HG23 H  -4.687  15.629  14.807 1.00 . A A . 161 ILE HG23 1 1 
        2  5560 1 1 161 ILE N    N  -4.286  13.800  13.077 1.00 . A A . 161 ILE N    1 1 
        2  5561 1 1 161 ILE O    O  -7.219  13.695  13.562 1.00 . A A . 161 ILE O    1 1 
        2  5562 1 1 162 PHE C    C  -9.083  11.205  14.107 1.00 . A A . 162 PHE C    1 1 
        2  5563 1 1 162 PHE CA   C  -8.121  11.091  12.907 1.00 . A A . 162 PHE CA   1 1 
        2  5564 1 1 162 PHE CB   C  -8.138   9.638  12.353 1.00 . A A . 162 PHE CB   1 1 
        2  5565 1 1 162 PHE CD1  C  -8.280   9.640   9.812 1.00 . A A . 162 PHE CD1  1 1 
        2  5566 1 1 162 PHE CD2  C  -6.177   9.086  10.808 1.00 . A A . 162 PHE CD2  1 1 
        2  5567 1 1 162 PHE CE1  C  -7.740   9.443   8.556 1.00 . A A . 162 PHE CE1  1 1 
        2  5568 1 1 162 PHE CE2  C  -5.637   8.899   9.545 1.00 . A A . 162 PHE CE2  1 1 
        2  5569 1 1 162 PHE CG   C  -7.511   9.461  10.965 1.00 . A A . 162 PHE CG   1 1 
        2  5570 1 1 162 PHE CZ   C  -6.418   9.072   8.423 1.00 . A A . 162 PHE CZ   1 1 
        2  5571 1 1 162 PHE H    H  -6.044  10.817  13.281 1.00 . A A . 162 PHE H    1 1 
        2  5572 1 1 162 PHE HA   H  -8.463  11.767  12.128 1.00 . A A . 162 PHE HA   1 1 
        2  5573 1 1 162 PHE HB2  H  -7.606   8.994  13.044 1.00 . A A . 162 PHE HB2  1 1 
        2  5574 1 1 162 PHE HB3  H  -9.169   9.294  12.296 1.00 . A A . 162 PHE HB3  1 1 
        2  5575 1 1 162 PHE HD1  H  -9.320   9.932   9.907 1.00 . A A . 162 PHE HD1  1 1 
        2  5576 1 1 162 PHE HD2  H  -5.556   8.948  11.682 1.00 . A A . 162 PHE HD2  1 1 
        2  5577 1 1 162 PHE HE1  H  -8.353   9.585   7.674 1.00 . A A . 162 PHE HE1  1 1 
        2  5578 1 1 162 PHE HE2  H  -4.597   8.608   9.439 1.00 . A A . 162 PHE HE2  1 1 
        2  5579 1 1 162 PHE HZ   H  -5.993   8.918   7.436 1.00 . A A . 162 PHE HZ   1 1 
        2  5580 1 1 162 PHE N    N  -6.749  11.495  13.283 1.00 . A A . 162 PHE N    1 1 
        2  5581 1 1 162 PHE O    O -10.279  11.463  13.924 1.00 . A A . 162 PHE O    1 1 
        2  5582 1 1 163 LYS C    C -10.075  12.264  16.868 1.00 . A A . 163 LYS C    1 1 
        2  5583 1 1 163 LYS CA   C  -9.303  10.959  16.580 1.00 . A A . 163 LYS CA   1 1 
        2  5584 1 1 163 LYS CB   C  -8.347  10.644  17.761 1.00 . A A . 163 LYS CB   1 1 
        2  5585 1 1 163 LYS CD   C  -6.375   9.222  18.661 1.00 . A A . 163 LYS CD   1 1 
        2  5586 1 1 163 LYS CE   C  -6.997   9.123  20.063 1.00 . A A . 163 LYS CE   1 1 
        2  5587 1 1 163 LYS CG   C  -7.422   9.419  17.539 1.00 . A A . 163 LYS CG   1 1 
        2  5588 1 1 163 LYS H    H  -7.561  10.922  15.374 1.00 . A A . 163 LYS H    1 1 
        2  5589 1 1 163 LYS HA   H -10.015  10.148  16.484 1.00 . A A . 163 LYS HA   1 1 
        2  5590 1 1 163 LYS HB2  H  -7.720  11.511  17.945 1.00 . A A . 163 LYS HB2  1 1 
        2  5591 1 1 163 LYS HB3  H  -8.945  10.461  18.644 1.00 . A A . 163 LYS HB3  1 1 
        2  5592 1 1 163 LYS HD2  H  -5.824   8.308  18.466 1.00 . A A . 163 LYS HD2  1 1 
        2  5593 1 1 163 LYS HD3  H  -5.686  10.058  18.641 1.00 . A A . 163 LYS HD3  1 1 
        2  5594 1 1 163 LYS HE2  H  -6.217   8.894  20.775 1.00 . A A . 163 LYS HE2  1 1 
        2  5595 1 1 163 LYS HE3  H  -7.439  10.077  20.321 1.00 . A A . 163 LYS HE3  1 1 
        2  5596 1 1 163 LYS HG2  H  -8.034   8.525  17.474 1.00 . A A . 163 LYS HG2  1 1 
        2  5597 1 1 163 LYS HG3  H  -6.899   9.549  16.595 1.00 . A A . 163 LYS HG3  1 1 
        2  5598 1 1 163 LYS HZ1  H  -7.634   7.147  19.917 1.00 . A A . 163 LYS HZ1  1 1 
        2  5599 1 1 163 LYS HZ2  H  -8.816   8.275  19.503 1.00 . A A . 163 LYS HZ2  1 1 
        2  5600 1 1 163 LYS HZ3  H  -8.418   8.028  21.125 1.00 . A A . 163 LYS HZ3  1 1 
        2  5601 1 1 163 LYS N    N  -8.532  11.025  15.322 1.00 . A A . 163 LYS N    1 1 
        2  5602 1 1 163 LYS NZ   N  -8.040   8.070  20.158 1.00 . A A . 163 LYS NZ   1 1 
        2  5603 1 1 163 LYS O    O -11.235  12.224  17.303 1.00 . A A . 163 LYS O    1 1 
        2  5604 1 1 164 SER C    C  -9.098  15.810  16.168 1.00 . A A . 164 SER C    1 1 
        2  5605 1 1 164 SER CA   C  -9.970  14.747  16.882 1.00 . A A . 164 SER CA   1 1 
        2  5606 1 1 164 SER CB   C  -9.995  14.988  18.415 1.00 . A A . 164 SER CB   1 1 
        2  5607 1 1 164 SER H    H  -8.534  13.352  16.183 1.00 . A A . 164 SER H    1 1 
        2  5608 1 1 164 SER HA   H -10.988  14.789  16.500 1.00 . A A . 164 SER HA   1 1 
        2  5609 1 1 164 SER HB2  H -10.570  14.205  18.895 1.00 . A A . 164 SER HB2  1 1 
        2  5610 1 1 164 SER HB3  H  -8.984  14.975  18.799 1.00 . A A . 164 SER HB3  1 1 
        2  5611 1 1 164 SER HG   H -11.219  16.114  19.450 1.00 . A A . 164 SER HG   1 1 
        2  5612 1 1 164 SER N    N  -9.421  13.408  16.597 1.00 . A A . 164 SER N    1 1 
        2  5613 1 1 164 SER O    O  -7.962  16.016  16.592 1.00 . A A . 164 SER O    1 1 
        2  5614 1 1 164 SER OG   O -10.581  16.236  18.742 1.00 . A A . 164 SER OG   1 1 
        2  5615 1 1 165 PRO C    C  -7.854  18.367  14.899 1.00 . A A . 165 PRO C    1 1 
        2  5616 1 1 165 PRO CA   C  -8.827  17.397  14.182 1.00 . A A . 165 PRO CA   1 1 
        2  5617 1 1 165 PRO CB   C  -9.915  18.187  13.412 1.00 . A A . 165 PRO CB   1 1 
        2  5618 1 1 165 PRO CD   C -11.057  16.467  14.654 1.00 . A A . 165 PRO CD   1 1 
        2  5619 1 1 165 PRO CG   C -11.080  17.245  13.343 1.00 . A A . 165 PRO CG   1 1 
        2  5620 1 1 165 PRO HA   H  -8.262  16.796  13.474 1.00 . A A . 165 PRO HA   1 1 
        2  5621 1 1 165 PRO HB2  H -10.178  19.101  13.954 1.00 . A A . 165 PRO HB2  1 1 
        2  5622 1 1 165 PRO HB3  H  -9.575  18.443  12.415 1.00 . A A . 165 PRO HB3  1 1 
        2  5623 1 1 165 PRO HD2  H -11.695  16.950  15.394 1.00 . A A . 165 PRO HD2  1 1 
        2  5624 1 1 165 PRO HD3  H -11.383  15.447  14.494 1.00 . A A . 165 PRO HD3  1 1 
        2  5625 1 1 165 PRO HG2  H -12.008  17.806  13.235 1.00 . A A . 165 PRO HG2  1 1 
        2  5626 1 1 165 PRO HG3  H -10.963  16.563  12.507 1.00 . A A . 165 PRO HG3  1 1 
        2  5627 1 1 165 PRO N    N  -9.625  16.504  15.087 1.00 . A A . 165 PRO N    1 1 
        2  5628 1 1 165 PRO O    O  -8.292  19.314  15.572 1.00 . A A . 165 PRO O    1 1 
        2  5629 1 1 166 ASN C    C  -5.423  19.119  16.805 1.00 . A A . 166 ASN C    1 1 
        2  5630 1 1 166 ASN CA   C  -5.411  18.907  15.270 1.00 . A A . 166 ASN CA   1 1 
        2  5631 1 1 166 ASN CB   C  -5.374  20.265  14.518 1.00 . A A . 166 ASN CB   1 1 
        2  5632 1 1 166 ASN CG   C  -4.991  20.108  13.042 1.00 . A A . 166 ASN CG   1 1 
        2  5633 1 1 166 ASN H    H  -6.302  17.241  14.298 1.00 . A A . 166 ASN H    1 1 
        2  5634 1 1 166 ASN HA   H  -4.501  18.366  15.034 1.00 . A A . 166 ASN HA   1 1 
        2  5635 1 1 166 ASN HB2  H  -6.351  20.728  14.573 1.00 . A A . 166 ASN HB2  1 1 
        2  5636 1 1 166 ASN HB3  H  -4.650  20.922  14.993 1.00 . A A . 166 ASN HB3  1 1 
        2  5637 1 1 166 ASN HD21 H  -3.075  20.407  13.465 1.00 . A A . 166 ASN HD21 1 1 
        2  5638 1 1 166 ASN HD22 H  -3.442  20.089  11.806 1.00 . A A . 166 ASN HD22 1 1 
        2  5639 1 1 166 ASN N    N  -6.535  18.065  14.770 1.00 . A A . 166 ASN N    1 1 
        2  5640 1 1 166 ASN ND2  N  -3.709  20.222  12.739 1.00 . A A . 166 ASN ND2  1 1 
        2  5641 1 1 166 ASN O    O  -4.717  20.001  17.315 1.00 . A A . 166 ASN O    1 1 
        2  5642 1 1 166 ASN OD1  O  -5.843  19.884  12.182 1.00 . A A . 166 ASN OD1  1 1 
        2  5643 1 1 167 CYS C    C  -5.088  17.667  19.680 1.00 . A A . 167 CYS C    1 1 
        2  5644 1 1 167 CYS CA   C  -6.283  18.369  19.005 1.00 . A A . 167 CYS CA   1 1 
        2  5645 1 1 167 CYS CB   C  -7.622  17.772  19.476 1.00 . A A . 167 CYS CB   1 1 
        2  5646 1 1 167 CYS H    H  -6.711  17.599  17.073 1.00 . A A . 167 CYS H    1 1 
        2  5647 1 1 167 CYS HA   H  -6.259  19.417  19.287 1.00 . A A . 167 CYS HA   1 1 
        2  5648 1 1 167 CYS HB2  H  -8.426  18.233  18.923 1.00 . A A . 167 CYS HB2  1 1 
        2  5649 1 1 167 CYS HB3  H  -7.630  16.704  19.282 1.00 . A A . 167 CYS HB3  1 1 
        2  5650 1 1 167 CYS HG   H  -8.471  16.879  21.704 1.00 . A A . 167 CYS HG   1 1 
        2  5651 1 1 167 CYS N    N  -6.186  18.286  17.536 1.00 . A A . 167 CYS N    1 1 
        2  5652 1 1 167 CYS O    O  -4.842  17.864  20.876 1.00 . A A . 167 CYS O    1 1 
        2  5653 1 1 167 CYS SG   S  -7.977  18.012  21.233 1.00 . A A . 167 CYS SG   1 1 
        2  5654 1 1 168 LEU C    C  -1.975  17.262  19.634 1.00 . A A . 168 LEU C    1 1 
        2  5655 1 1 168 LEU CA   C  -3.086  16.215  19.375 1.00 . A A . 168 LEU CA   1 1 
        2  5656 1 1 168 LEU CB   C  -2.624  15.055  18.412 1.00 . A A . 168 LEU CB   1 1 
        2  5657 1 1 168 LEU CD1  C  -2.115  16.630  16.383 1.00 . A A . 168 LEU CD1  1 1 
        2  5658 1 1 168 LEU CD2  C  -0.212  15.317  17.484 1.00 . A A . 168 LEU CD2  1 1 
        2  5659 1 1 168 LEU CG   C  -1.722  15.346  17.143 1.00 . A A . 168 LEU CG   1 1 
        2  5660 1 1 168 LEU H    H  -4.676  16.629  18.006 1.00 . A A . 168 LEU H    1 1 
        2  5661 1 1 168 LEU HA   H  -3.330  15.773  20.339 1.00 . A A . 168 LEU HA   1 1 
        2  5662 1 1 168 LEU HB2  H  -2.103  14.324  19.021 1.00 . A A . 168 LEU HB2  1 1 
        2  5663 1 1 168 LEU HB3  H  -3.529  14.575  18.058 1.00 . A A . 168 LEU HB3  1 1 
        2  5664 1 1 168 LEU HD11 H  -1.511  16.724  15.490 1.00 . A A . 168 LEU HD11 1 1 
        2  5665 1 1 168 LEU HD12 H  -1.950  17.492  17.016 1.00 . A A . 168 LEU HD12 1 1 
        2  5666 1 1 168 LEU HD13 H  -3.159  16.585  16.107 1.00 . A A . 168 LEU HD13 1 1 
        2  5667 1 1 168 LEU HD21 H   0.057  14.337  17.864 1.00 . A A . 168 LEU HD21 1 1 
        2  5668 1 1 168 LEU HD22 H   0.014  16.062  18.235 1.00 . A A . 168 LEU HD22 1 1 
        2  5669 1 1 168 LEU HD23 H   0.369  15.519  16.593 1.00 . A A . 168 LEU HD23 1 1 
        2  5670 1 1 168 LEU HG   H  -1.883  14.532  16.445 1.00 . A A . 168 LEU HG   1 1 
        2  5671 1 1 168 LEU N    N  -4.338  16.852  18.899 1.00 . A A . 168 LEU N    1 1 
        2  5672 1 1 168 LEU O    O  -0.950  16.937  20.212 1.00 . A A . 168 LEU O    1 1 
        2  5673 1 1 169 GLN C    C  -1.036  19.886  20.908 1.00 . A A . 169 GLN C    1 1 
        2  5674 1 1 169 GLN CA   C  -1.242  19.636  19.389 1.00 . A A . 169 GLN CA   1 1 
        2  5675 1 1 169 GLN CB   C  -1.774  20.900  18.662 1.00 . A A . 169 GLN CB   1 1 
        2  5676 1 1 169 GLN CD   C  -1.329  23.332  17.915 1.00 . A A . 169 GLN CD   1 1 
        2  5677 1 1 169 GLN CG   C  -0.787  22.082  18.622 1.00 . A A . 169 GLN CG   1 1 
        2  5678 1 1 169 GLN H    H  -2.998  18.693  18.648 1.00 . A A . 169 GLN H    1 1 
        2  5679 1 1 169 GLN HA   H  -0.287  19.353  18.951 1.00 . A A . 169 GLN HA   1 1 
        2  5680 1 1 169 GLN HB2  H  -2.013  20.627  17.638 1.00 . A A . 169 GLN HB2  1 1 
        2  5681 1 1 169 GLN HB3  H  -2.691  21.228  19.149 1.00 . A A . 169 GLN HB3  1 1 
        2  5682 1 1 169 GLN HE21 H   0.498  23.842  17.310 1.00 . A A . 169 GLN HE21 1 1 
        2  5683 1 1 169 GLN HE22 H  -0.775  24.914  16.845 1.00 . A A . 169 GLN HE22 1 1 
        2  5684 1 1 169 GLN HG2  H  -0.533  22.355  19.638 1.00 . A A . 169 GLN HG2  1 1 
        2  5685 1 1 169 GLN HG3  H   0.111  21.754  18.111 1.00 . A A . 169 GLN HG3  1 1 
        2  5686 1 1 169 GLN N    N  -2.181  18.515  19.163 1.00 . A A . 169 GLN N    1 1 
        2  5687 1 1 169 GLN NE2  N  -0.448  24.104  17.292 1.00 . A A . 169 GLN NE2  1 1 
        2  5688 1 1 169 GLN O    O   0.013  20.386  21.327 1.00 . A A . 169 GLN O    1 1 
        2  5689 1 1 169 GLN OE1  O  -2.530  23.604  17.922 1.00 . A A . 169 GLN OE1  1 1 
        2  5690 1 1 170 GLU C    C  -0.853  18.594  23.716 1.00 . A A . 170 GLU C    1 1 
        2  5691 1 1 170 GLU CA   C  -1.996  19.488  23.175 1.00 . A A . 170 GLU CA   1 1 
        2  5692 1 1 170 GLU CB   C  -3.359  18.991  23.730 1.00 . A A . 170 GLU CB   1 1 
        2  5693 1 1 170 GLU CD   C  -3.464  20.551  25.784 1.00 . A A . 170 GLU CD   1 1 
        2  5694 1 1 170 GLU CG   C  -3.525  19.101  25.263 1.00 . A A . 170 GLU CG   1 1 
        2  5695 1 1 170 GLU H    H  -2.868  19.155  21.270 1.00 . A A . 170 GLU H    1 1 
        2  5696 1 1 170 GLU HA   H  -1.837  20.512  23.495 1.00 . A A . 170 GLU HA   1 1 
        2  5697 1 1 170 GLU HB2  H  -4.156  19.563  23.263 1.00 . A A . 170 GLU HB2  1 1 
        2  5698 1 1 170 GLU HB3  H  -3.488  17.947  23.451 1.00 . A A . 170 GLU HB3  1 1 
        2  5699 1 1 170 GLU HG2  H  -4.482  18.674  25.546 1.00 . A A . 170 GLU HG2  1 1 
        2  5700 1 1 170 GLU HG3  H  -2.735  18.522  25.737 1.00 . A A . 170 GLU HG3  1 1 
        2  5701 1 1 170 GLU N    N  -2.042  19.476  21.704 1.00 . A A . 170 GLU N    1 1 
        2  5702 1 1 170 GLU O    O  -0.215  18.933  24.719 1.00 . A A . 170 GLU O    1 1 
        2  5703 1 1 170 GLU OE1  O  -4.453  21.299  25.601 1.00 . A A . 170 GLU OE1  1 1 
        2  5704 1 1 170 GLU OE2  O  -2.434  20.949  26.379 1.00 . A A . 170 GLU OE2  1 1 
        2  5705 1 1 171 LEU C    C   1.802  17.022  23.395 1.00 . A A . 171 LEU C    1 1 
        2  5706 1 1 171 LEU CA   C   0.380  16.440  23.449 1.00 . A A . 171 LEU CA   1 1 
        2  5707 1 1 171 LEU CB   C   0.297  15.143  22.573 1.00 . A A . 171 LEU CB   1 1 
        2  5708 1 1 171 LEU CD1  C  -1.057  13.146  21.680 1.00 . A A . 171 LEU CD1  1 1 
        2  5709 1 1 171 LEU CD2  C  -2.058  14.623  23.508 1.00 . A A . 171 LEU CD2  1 1 
        2  5710 1 1 171 LEU CG   C  -1.134  14.570  22.274 1.00 . A A . 171 LEU CG   1 1 
        2  5711 1 1 171 LEU H    H  -1.105  17.303  22.189 1.00 . A A . 171 LEU H    1 1 
        2  5712 1 1 171 LEU HA   H   0.152  16.177  24.480 1.00 . A A . 171 LEU HA   1 1 
        2  5713 1 1 171 LEU HB2  H   0.776  15.346  21.615 1.00 . A A . 171 LEU HB2  1 1 
        2  5714 1 1 171 LEU HB3  H   0.869  14.369  23.070 1.00 . A A . 171 LEU HB3  1 1 
        2  5715 1 1 171 LEU HD11 H  -0.591  12.475  22.391 1.00 . A A . 171 LEU HD11 1 1 
        2  5716 1 1 171 LEU HD12 H  -0.472  13.167  20.773 1.00 . A A . 171 LEU HD12 1 1 
        2  5717 1 1 171 LEU HD13 H  -2.053  12.789  21.449 1.00 . A A . 171 LEU HD13 1 1 
        2  5718 1 1 171 LEU HD21 H  -2.184  15.653  23.816 1.00 . A A . 171 LEU HD21 1 1 
        2  5719 1 1 171 LEU HD22 H  -1.629  14.053  24.322 1.00 . A A . 171 LEU HD22 1 1 
        2  5720 1 1 171 LEU HD23 H  -3.027  14.215  23.252 1.00 . A A . 171 LEU HD23 1 1 
        2  5721 1 1 171 LEU HG   H  -1.589  15.195  21.511 1.00 . A A . 171 LEU HG   1 1 
        2  5722 1 1 171 LEU N    N  -0.606  17.456  23.020 1.00 . A A . 171 LEU N    1 1 
        2  5723 1 1 171 LEU O    O   2.621  16.747  24.282 1.00 . A A . 171 LEU O    1 1 
        2  5724 1 1 172 LEU C    C   3.492  19.697  23.129 1.00 . A A . 172 LEU C    1 1 
        2  5725 1 1 172 LEU CA   C   3.381  18.496  22.164 1.00 . A A . 172 LEU CA   1 1 
        2  5726 1 1 172 LEU CB   C   3.608  18.959  20.687 1.00 . A A . 172 LEU CB   1 1 
        2  5727 1 1 172 LEU CD1  C   4.169  16.559  19.873 1.00 . A A . 172 LEU CD1  1 1 
        2  5728 1 1 172 LEU CD2  C   1.968  17.645  19.201 1.00 . A A . 172 LEU CD2  1 1 
        2  5729 1 1 172 LEU CG   C   3.447  17.887  19.550 1.00 . A A . 172 LEU CG   1 1 
        2  5730 1 1 172 LEU H    H   1.355  18.037  21.720 1.00 . A A . 172 LEU H    1 1 
        2  5731 1 1 172 LEU HA   H   4.151  17.768  22.423 1.00 . A A . 172 LEU HA   1 1 
        2  5732 1 1 172 LEU HB2  H   2.919  19.779  20.484 1.00 . A A . 172 LEU HB2  1 1 
        2  5733 1 1 172 LEU HB3  H   4.615  19.364  20.625 1.00 . A A . 172 LEU HB3  1 1 
        2  5734 1 1 172 LEU HD11 H   3.738  16.109  20.758 1.00 . A A . 172 LEU HD11 1 1 
        2  5735 1 1 172 LEU HD12 H   5.220  16.745  20.040 1.00 . A A . 172 LEU HD12 1 1 
        2  5736 1 1 172 LEU HD13 H   4.059  15.878  19.036 1.00 . A A . 172 LEU HD13 1 1 
        2  5737 1 1 172 LEU HD21 H   1.895  16.926  18.395 1.00 . A A . 172 LEU HD21 1 1 
        2  5738 1 1 172 LEU HD22 H   1.512  18.576  18.886 1.00 . A A . 172 LEU HD22 1 1 
        2  5739 1 1 172 LEU HD23 H   1.440  17.265  20.067 1.00 . A A . 172 LEU HD23 1 1 
        2  5740 1 1 172 LEU HG   H   3.919  18.275  18.652 1.00 . A A . 172 LEU HG   1 1 
        2  5741 1 1 172 LEU N    N   2.069  17.848  22.358 1.00 . A A . 172 LEU N    1 1 
        2  5742 1 1 172 LEU O    O   3.257  20.859  22.744 1.00 . A A . 172 LEU O    1 1 
        2  5743 1 1 173 HIS C    C   4.661  19.780  26.631 1.00 . A A . 173 HIS C    1 1 
        2  5744 1 1 173 HIS CA   C   3.843  20.374  25.474 1.00 . A A . 173 HIS CA   1 1 
        2  5745 1 1 173 HIS CB   C   2.400  20.753  25.924 1.00 . A A . 173 HIS CB   1 1 
        2  5746 1 1 173 HIS CD2  C   2.090  21.592  28.384 1.00 . A A . 173 HIS CD2  1 1 
        2  5747 1 1 173 HIS CE1  C   2.441  23.720  28.037 1.00 . A A . 173 HIS CE1  1 1 
        2  5748 1 1 173 HIS CG   C   2.338  21.753  27.056 1.00 . A A . 173 HIS CG   1 1 
        2  5749 1 1 173 HIS H    H   4.049  18.455  24.598 1.00 . A A . 173 HIS H    1 1 
        2  5750 1 1 173 HIS HA   H   4.350  21.265  25.098 1.00 . A A . 173 HIS HA   1 1 
        2  5751 1 1 173 HIS HB2  H   1.868  21.181  25.082 1.00 . A A . 173 HIS HB2  1 1 
        2  5752 1 1 173 HIS HB3  H   1.882  19.855  26.239 1.00 . A A . 173 HIS HB3  1 1 
        2  5753 1 1 173 HIS HD1  H   2.734  23.546  26.028 1.00 . A A . 173 HIS HD1  1 1 
        2  5754 1 1 173 HIS HD2  H   1.879  20.662  28.890 1.00 . A A . 173 HIS HD2  1 1 
        2  5755 1 1 173 HIS HE1  H   2.554  24.781  28.197 1.00 . A A . 173 HIS HE1  1 1 
        2  5756 1 1 173 HIS HE2  H   1.878  23.048  29.878 1.00 . A A . 173 HIS HE2  1 1 
        2  5757 1 1 173 HIS N    N   3.808  19.390  24.391 1.00 . A A . 173 HIS N    1 1 
        2  5758 1 1 173 HIS ND1  N   2.550  23.101  26.882 1.00 . A A . 173 HIS ND1  1 1 
        2  5759 1 1 173 HIS NE2  N   2.166  22.831  28.962 1.00 . A A . 173 HIS NE2  1 1 
        2  5760 1 1 173 HIS O    O   4.145  18.990  27.436 1.00 . A A . 173 HIS O    1 1 
        2  5761 1 1 174 GLU C    C   7.251  20.772  28.650 1.00 . A A . 174 GLU C    1 1 
        2  5762 1 1 174 GLU CA   C   6.924  19.637  27.644 1.00 . A A . 174 GLU CA   1 1 
        2  5763 1 1 174 GLU CB   C   8.213  19.067  26.945 1.00 . A A . 174 GLU CB   1 1 
        2  5764 1 1 174 GLU CD   C   8.140  20.015  24.514 1.00 . A A . 174 GLU CD   1 1 
        2  5765 1 1 174 GLU CG   C   8.894  19.962  25.867 1.00 . A A . 174 GLU CG   1 1 
        2  5766 1 1 174 GLU H    H   6.266  20.762  25.977 1.00 . A A . 174 GLU H    1 1 
        2  5767 1 1 174 GLU HA   H   6.449  18.819  28.195 1.00 . A A . 174 GLU HA   1 1 
        2  5768 1 1 174 GLU HB2  H   8.949  18.859  27.713 1.00 . A A . 174 GLU HB2  1 1 
        2  5769 1 1 174 GLU HB3  H   7.952  18.126  26.475 1.00 . A A . 174 GLU HB3  1 1 
        2  5770 1 1 174 GLU HG2  H   8.983  20.970  26.262 1.00 . A A . 174 GLU HG2  1 1 
        2  5771 1 1 174 GLU HG3  H   9.894  19.582  25.686 1.00 . A A . 174 GLU HG3  1 1 
        2  5772 1 1 174 GLU N    N   5.952  20.126  26.653 1.00 . A A . 174 GLU N    1 1 
        2  5773 1 1 174 GLU O    O   6.948  20.620  29.849 1.00 . A A . 174 GLU O    1 1 
        2  5774 1 1 174 GLU OXT  O   7.742  21.839  28.228 1.00 . A A . 174 GLU OXT  1 1 
        2  5775 1 1 174 GLU OE1  O   8.208  19.028  23.748 1.00 . A A . 174 GLU OE1  1 1 
        2  5776 1 1 174 GLU OE2  O   7.459  21.027  24.227 1.00 . A A . 174 GLU OE2  1 1 
        3  5777 1 1   1 MET C    C  18.200   2.551   3.426 1.00 . A A .   1 MET C    1 1 
        3  5778 1 1   1 MET CA   C  17.184   3.685   3.559 1.00 . A A .   1 MET CA   1 1 
        3  5779 1 1   1 MET CB   C  15.732   3.142   3.442 1.00 . A A .   1 MET CB   1 1 
        3  5780 1 1   1 MET CE   C  13.756   6.782   3.005 1.00 . A A .   1 MET CE   1 1 
        3  5781 1 1   1 MET CG   C  14.657   4.220   3.612 1.00 . A A .   1 MET CG   1 1 
        3  5782 1 1   1 MET H1   H  18.425   5.073   2.641 1.00 . A A .   1 MET H1   1 1 
        3  5783 1 1   1 MET H2   H  16.799   5.515   2.633 1.00 . A A .   1 MET H2   1 1 
        3  5784 1 1   1 MET H3   H  17.352   4.314   1.588 1.00 . A A .   1 MET H3   1 1 
        3  5785 1 1   1 MET HA   H  17.308   4.156   4.529 1.00 . A A .   1 MET HA   1 1 
        3  5786 1 1   1 MET HB2  H  15.603   2.688   2.468 1.00 . A A .   1 MET HB2  1 1 
        3  5787 1 1   1 MET HB3  H  15.576   2.384   4.207 1.00 . A A .   1 MET HB3  1 1 
        3  5788 1 1   1 MET HE1  H  14.171   7.076   3.958 1.00 . A A .   1 MET HE1  1 1 
        3  5789 1 1   1 MET HE2  H  12.738   6.443   3.145 1.00 . A A .   1 MET HE2  1 1 
        3  5790 1 1   1 MET HE3  H  13.764   7.627   2.334 1.00 . A A .   1 MET HE3  1 1 
        3  5791 1 1   1 MET HG2  H  13.681   3.753   3.586 1.00 . A A .   1 MET HG2  1 1 
        3  5792 1 1   1 MET HG3  H  14.793   4.711   4.570 1.00 . A A .   1 MET HG3  1 1 
        3  5793 1 1   1 MET N    N  17.456   4.717   2.534 1.00 . A A .   1 MET N    1 1 
        3  5794 1 1   1 MET O    O  18.774   2.111   4.427 1.00 . A A .   1 MET O    1 1 
        3  5795 1 1   1 MET SD   S  14.731   5.463   2.304 1.00 . A A .   1 MET SD   1 1 
        3  5796 1 1   2 GLY C    C  18.667  -0.329   1.642 1.00 . A A .   2 GLY C    1 1 
        3  5797 1 1   2 GLY CA   C  19.354   1.008   1.884 1.00 . A A .   2 GLY CA   1 1 
        3  5798 1 1   2 GLY H    H  17.887   2.469   1.440 1.00 . A A .   2 GLY H    1 1 
        3  5799 1 1   2 GLY HA2  H  19.907   1.275   0.992 1.00 . A A .   2 GLY HA2  1 1 
        3  5800 1 1   2 GLY HA3  H  20.061   0.896   2.700 1.00 . A A .   2 GLY HA3  1 1 
        3  5801 1 1   2 GLY N    N  18.405   2.083   2.181 1.00 . A A .   2 GLY N    1 1 
        3  5802 1 1   2 GLY O    O  17.440  -0.439   1.759 1.00 . A A .   2 GLY O    1 1 
        3  5803 1 1   3 HIS C    C  18.734  -3.561   2.296 1.00 . A A .   3 HIS C    1 1 
        3  5804 1 1   3 HIS CA   C  18.985  -2.716   1.019 1.00 . A A .   3 HIS CA   1 1 
        3  5805 1 1   3 HIS CB   C  19.976  -3.443   0.047 1.00 . A A .   3 HIS CB   1 1 
        3  5806 1 1   3 HIS CD2  C  21.870  -4.469   1.546 1.00 . A A .   3 HIS CD2  1 1 
        3  5807 1 1   3 HIS CE1  C  23.574  -3.431   0.665 1.00 . A A .   3 HIS CE1  1 1 
        3  5808 1 1   3 HIS CG   C  21.387  -3.660   0.568 1.00 . A A .   3 HIS CG   1 1 
        3  5809 1 1   3 HIS H    H  20.447  -1.202   1.341 1.00 . A A .   3 HIS H    1 1 
        3  5810 1 1   3 HIS HA   H  18.034  -2.603   0.505 1.00 . A A .   3 HIS HA   1 1 
        3  5811 1 1   3 HIS HB2  H  19.577  -4.419  -0.202 1.00 . A A .   3 HIS HB2  1 1 
        3  5812 1 1   3 HIS HB3  H  20.054  -2.868  -0.869 1.00 . A A .   3 HIS HB3  1 1 
        3  5813 1 1   3 HIS HD1  H  22.481  -2.377  -0.695 1.00 . A A .   3 HIS HD1  1 1 
        3  5814 1 1   3 HIS HD2  H  21.291  -5.124   2.180 1.00 . A A .   3 HIS HD2  1 1 
        3  5815 1 1   3 HIS HE1  H  24.580  -3.091   0.465 1.00 . A A .   3 HIS HE1  1 1 
        3  5816 1 1   3 HIS HE2  H  23.808  -4.588   2.321 1.00 . A A .   3 HIS HE2  1 1 
        3  5817 1 1   3 HIS N    N  19.478  -1.360   1.342 1.00 . A A .   3 HIS N    1 1 
        3  5818 1 1   3 HIS ND1  N  22.489  -3.027   0.040 1.00 . A A .   3 HIS ND1  1 1 
        3  5819 1 1   3 HIS NE2  N  23.228  -4.306   1.584 1.00 . A A .   3 HIS NE2  1 1 
        3  5820 1 1   3 HIS O    O  18.644  -4.795   2.208 1.00 . A A .   3 HIS O    1 1 
        3  5821 1 1   4 HIS C    C  16.934  -4.224   4.720 1.00 . A A .   4 HIS C    1 1 
        3  5822 1 1   4 HIS CA   C  18.338  -3.577   4.744 1.00 . A A .   4 HIS CA   1 1 
        3  5823 1 1   4 HIS CB   C  18.524  -2.620   5.964 1.00 . A A .   4 HIS CB   1 1 
        3  5824 1 1   4 HIS CD2  C  17.176  -0.482   5.258 1.00 . A A .   4 HIS CD2  1 1 
        3  5825 1 1   4 HIS CE1  C  15.970  -0.278   7.067 1.00 . A A .   4 HIS CE1  1 1 
        3  5826 1 1   4 HIS CG   C  17.509  -1.501   6.093 1.00 . A A .   4 HIS CG   1 1 
        3  5827 1 1   4 HIS H    H  18.716  -1.927   3.473 1.00 . A A .   4 HIS H    1 1 
        3  5828 1 1   4 HIS HA   H  19.078  -4.377   4.834 1.00 . A A .   4 HIS HA   1 1 
        3  5829 1 1   4 HIS HB2  H  18.486  -3.202   6.874 1.00 . A A .   4 HIS HB2  1 1 
        3  5830 1 1   4 HIS HB3  H  19.503  -2.165   5.896 1.00 . A A .   4 HIS HB3  1 1 
        3  5831 1 1   4 HIS HD1  H  16.737  -1.904   8.006 1.00 . A A .   4 HIS HD1  1 1 
        3  5832 1 1   4 HIS HD2  H  17.585  -0.291   4.276 1.00 . A A .   4 HIS HD2  1 1 
        3  5833 1 1   4 HIS HE1  H  15.267   0.103   7.799 1.00 . A A .   4 HIS HE1  1 1 
        3  5834 1 1   4 HIS HE2  H  15.742   1.027   5.513 1.00 . A A .   4 HIS HE2  1 1 
        3  5835 1 1   4 HIS N    N  18.609  -2.896   3.469 1.00 . A A .   4 HIS N    1 1 
        3  5836 1 1   4 HIS ND1  N  16.731  -1.328   7.217 1.00 . A A .   4 HIS ND1  1 1 
        3  5837 1 1   4 HIS NE2  N  16.213   0.257   5.889 1.00 . A A .   4 HIS NE2  1 1 
        3  5838 1 1   4 HIS O    O  15.901  -3.556   4.841 1.00 . A A .   4 HIS O    1 1 
        3  5839 1 1   5 HIS C    C  15.876  -7.372   5.666 1.00 . A A .   5 HIS C    1 1 
        3  5840 1 1   5 HIS CA   C  15.714  -6.364   4.527 1.00 . A A .   5 HIS CA   1 1 
        3  5841 1 1   5 HIS CB   C  15.459  -7.068   3.162 1.00 . A A .   5 HIS CB   1 1 
        3  5842 1 1   5 HIS CD2  C  16.047  -5.976   0.875 1.00 . A A .   5 HIS CD2  1 1 
        3  5843 1 1   5 HIS CE1  C  14.561  -4.369   0.907 1.00 . A A .   5 HIS CE1  1 1 
        3  5844 1 1   5 HIS CG   C  15.325  -6.111   2.010 1.00 . A A .   5 HIS CG   1 1 
        3  5845 1 1   5 HIS H    H  17.765  -5.961   4.208 1.00 . A A .   5 HIS H    1 1 
        3  5846 1 1   5 HIS HA   H  14.860  -5.729   4.761 1.00 . A A .   5 HIS HA   1 1 
        3  5847 1 1   5 HIS HB2  H  16.281  -7.741   2.942 1.00 . A A .   5 HIS HB2  1 1 
        3  5848 1 1   5 HIS HB3  H  14.543  -7.643   3.220 1.00 . A A .   5 HIS HB3  1 1 
        3  5849 1 1   5 HIS HD1  H  13.718  -4.926   2.680 1.00 . A A .   5 HIS HD1  1 1 
        3  5850 1 1   5 HIS HD2  H  16.868  -6.603   0.553 1.00 . A A .   5 HIS HD2  1 1 
        3  5851 1 1   5 HIS HE1  H  13.981  -3.499   0.633 1.00 . A A .   5 HIS HE1  1 1 
        3  5852 1 1   5 HIS HE2  H  15.819  -4.602  -0.684 1.00 . A A .   5 HIS HE2  1 1 
        3  5853 1 1   5 HIS N    N  16.920  -5.533   4.461 1.00 . A A .   5 HIS N    1 1 
        3  5854 1 1   5 HIS ND1  N  14.398  -5.091   1.994 1.00 . A A .   5 HIS ND1  1 1 
        3  5855 1 1   5 HIS NE2  N  15.551  -4.888   0.212 1.00 . A A .   5 HIS NE2  1 1 
        3  5856 1 1   5 HIS O    O  15.303  -8.466   5.620 1.00 . A A .   5 HIS O    1 1 
        3  5857 1 1   6 HIS C    C  15.580  -7.826   8.730 1.00 . A A .   6 HIS C    1 1 
        3  5858 1 1   6 HIS CA   C  16.881  -7.762   7.913 1.00 . A A .   6 HIS CA   1 1 
        3  5859 1 1   6 HIS CB   C  18.052  -7.178   8.752 1.00 . A A .   6 HIS CB   1 1 
        3  5860 1 1   6 HIS CD2  C  19.063  -9.164  10.105 1.00 . A A .   6 HIS CD2  1 1 
        3  5861 1 1   6 HIS CE1  C  18.498  -8.517  12.117 1.00 . A A .   6 HIS CE1  1 1 
        3  5862 1 1   6 HIS CG   C  18.400  -7.990   9.978 1.00 . A A .   6 HIS CG   1 1 
        3  5863 1 1   6 HIS H    H  17.107  -6.103   6.627 1.00 . A A .   6 HIS H    1 1 
        3  5864 1 1   6 HIS HA   H  17.148  -8.773   7.601 1.00 . A A .   6 HIS HA   1 1 
        3  5865 1 1   6 HIS HB2  H  18.938  -7.120   8.133 1.00 . A A .   6 HIS HB2  1 1 
        3  5866 1 1   6 HIS HB3  H  17.792  -6.177   9.079 1.00 . A A .   6 HIS HB3  1 1 
        3  5867 1 1   6 HIS HD1  H  17.577  -6.797  11.511 1.00 . A A .   6 HIS HD1  1 1 
        3  5868 1 1   6 HIS HD2  H  19.479  -9.756   9.304 1.00 . A A .   6 HIS HD2  1 1 
        3  5869 1 1   6 HIS HE1  H  18.381  -8.483  13.193 1.00 . A A .   6 HIS HE1  1 1 
        3  5870 1 1   6 HIS HE2  H  19.439 -10.308  11.822 1.00 . A A .   6 HIS HE2  1 1 
        3  5871 1 1   6 HIS N    N  16.661  -6.967   6.698 1.00 . A A .   6 HIS N    1 1 
        3  5872 1 1   6 HIS ND1  N  18.056  -7.615  11.265 1.00 . A A .   6 HIS ND1  1 1 
        3  5873 1 1   6 HIS NE2  N  19.104  -9.467  11.442 1.00 . A A .   6 HIS NE2  1 1 
        3  5874 1 1   6 HIS O    O  15.345  -7.033   9.652 1.00 . A A .   6 HIS O    1 1 
        3  5875 1 1   7 HIS C    C  13.446 -10.295   9.656 1.00 . A A .   7 HIS C    1 1 
        3  5876 1 1   7 HIS CA   C  13.404  -8.965   8.915 1.00 . A A .   7 HIS CA   1 1 
        3  5877 1 1   7 HIS CB   C  12.313  -8.993   7.817 1.00 . A A .   7 HIS CB   1 1 
        3  5878 1 1   7 HIS CD2  C  10.151 -10.276   8.543 1.00 . A A .   7 HIS CD2  1 1 
        3  5879 1 1   7 HIS CE1  C   8.963  -8.558   9.176 1.00 . A A .   7 HIS CE1  1 1 
        3  5880 1 1   7 HIS CG   C  10.908  -9.167   8.349 1.00 . A A .   7 HIS CG   1 1 
        3  5881 1 1   7 HIS H    H  14.971  -9.312   7.556 1.00 . A A .   7 HIS H    1 1 
        3  5882 1 1   7 HIS HA   H  13.187  -8.157   9.616 1.00 . A A .   7 HIS HA   1 1 
        3  5883 1 1   7 HIS HB2  H  12.344  -8.061   7.267 1.00 . A A .   7 HIS HB2  1 1 
        3  5884 1 1   7 HIS HB3  H  12.515  -9.806   7.128 1.00 . A A .   7 HIS HB3  1 1 
        3  5885 1 1   7 HIS HD1  H  10.394  -7.168   8.741 1.00 . A A .   7 HIS HD1  1 1 
        3  5886 1 1   7 HIS HD2  H  10.443 -11.297   8.341 1.00 . A A .   7 HIS HD2  1 1 
        3  5887 1 1   7 HIS HE1  H   8.150  -7.949   9.544 1.00 . A A .   7 HIS HE1  1 1 
        3  5888 1 1   7 HIS HE2  H   8.133 -10.414   9.060 1.00 . A A .   7 HIS HE2  1 1 
        3  5889 1 1   7 HIS N    N  14.712  -8.742   8.314 1.00 . A A .   7 HIS N    1 1 
        3  5890 1 1   7 HIS ND1  N  10.129  -8.110   8.756 1.00 . A A .   7 HIS ND1  1 1 
        3  5891 1 1   7 HIS NE2  N   8.948  -9.867   9.056 1.00 . A A .   7 HIS NE2  1 1 
        3  5892 1 1   7 HIS O    O  13.746 -11.331   9.060 1.00 . A A .   7 HIS O    1 1 
        3  5893 1 1   8 HIS C    C  11.857 -11.296  12.689 1.00 . A A .   8 HIS C    1 1 
        3  5894 1 1   8 HIS CA   C  13.077 -11.445  11.789 1.00 . A A .   8 HIS CA   1 1 
        3  5895 1 1   8 HIS CB   C  14.377 -11.618  12.614 1.00 . A A .   8 HIS CB   1 1 
        3  5896 1 1   8 HIS CD2  C  14.795 -14.159  12.992 1.00 . A A .   8 HIS CD2  1 1 
        3  5897 1 1   8 HIS CE1  C  14.206 -14.275  15.090 1.00 . A A .   8 HIS CE1  1 1 
        3  5898 1 1   8 HIS CG   C  14.429 -12.914  13.379 1.00 . A A .   8 HIS CG   1 1 
        3  5899 1 1   8 HIS H    H  12.942  -9.383  11.354 1.00 . A A .   8 HIS H    1 1 
        3  5900 1 1   8 HIS HA   H  12.940 -12.318  11.146 1.00 . A A .   8 HIS HA   1 1 
        3  5901 1 1   8 HIS HB2  H  15.226 -11.599  11.939 1.00 . A A .   8 HIS HB2  1 1 
        3  5902 1 1   8 HIS HB3  H  14.476 -10.803  13.323 1.00 . A A .   8 HIS HB3  1 1 
        3  5903 1 1   8 HIS HD1  H  13.763 -12.295  15.279 1.00 . A A .   8 HIS HD1  1 1 
        3  5904 1 1   8 HIS HD2  H  15.142 -14.452  12.011 1.00 . A A .   8 HIS HD2  1 1 
        3  5905 1 1   8 HIS HE1  H  14.001 -14.658  16.077 1.00 . A A .   8 HIS HE1  1 1 
        3  5906 1 1   8 HIS HE2  H  14.653 -15.960  14.039 1.00 . A A .   8 HIS HE2  1 1 
        3  5907 1 1   8 HIS N    N  13.148 -10.252  10.949 1.00 . A A .   8 HIS N    1 1 
        3  5908 1 1   8 HIS ND1  N  14.067 -13.025  14.703 1.00 . A A .   8 HIS ND1  1 1 
        3  5909 1 1   8 HIS NE2  N  14.646 -14.981  14.073 1.00 . A A .   8 HIS NE2  1 1 
        3  5910 1 1   8 HIS O    O  11.799 -10.358  13.495 1.00 . A A .   8 HIS O    1 1 
        3  5911 1 1   9 SER C    C   9.799 -12.688  14.679 1.00 . A A .   9 SER C    1 1 
        3  5912 1 1   9 SER CA   C   9.611 -12.172  13.238 1.00 . A A .   9 SER CA   1 1 
        3  5913 1 1   9 SER CB   C   8.544 -12.991  12.464 1.00 . A A .   9 SER CB   1 1 
        3  5914 1 1   9 SER H    H  11.043 -12.934  11.887 1.00 . A A .   9 SER H    1 1 
        3  5915 1 1   9 SER HA   H   9.282 -11.134  13.284 1.00 . A A .   9 SER HA   1 1 
        3  5916 1 1   9 SER HB2  H   8.495 -12.653  11.438 1.00 . A A .   9 SER HB2  1 1 
        3  5917 1 1   9 SER HB3  H   8.813 -14.040  12.476 1.00 . A A .   9 SER HB3  1 1 
        3  5918 1 1   9 SER HG   H   6.720 -13.619  12.801 1.00 . A A .   9 SER HG   1 1 
        3  5919 1 1   9 SER N    N  10.889 -12.209  12.523 1.00 . A A .   9 SER N    1 1 
        3  5920 1 1   9 SER O    O   9.531 -13.858  14.989 1.00 . A A .   9 SER O    1 1 
        3  5921 1 1   9 SER OG   O   7.254 -12.851  13.036 1.00 . A A .   9 SER OG   1 1 
        3  5922 1 1  10 HIS C    C   9.057 -11.844  17.582 1.00 . A A .  10 HIS C    1 1 
        3  5923 1 1  10 HIS CA   C  10.456 -12.032  16.975 1.00 . A A .  10 HIS CA   1 1 
        3  5924 1 1  10 HIS CB   C  11.469 -11.038  17.612 1.00 . A A .  10 HIS CB   1 1 
        3  5925 1 1  10 HIS CD2  C  11.226 -10.427  20.137 1.00 . A A .  10 HIS CD2  1 1 
        3  5926 1 1  10 HIS CE1  C  12.244 -12.163  20.977 1.00 . A A .  10 HIS CE1  1 1 
        3  5927 1 1  10 HIS CG   C  11.631 -11.200  19.104 1.00 . A A .  10 HIS CG   1 1 
        3  5928 1 1  10 HIS H    H  10.683 -10.956  15.169 1.00 . A A .  10 HIS H    1 1 
        3  5929 1 1  10 HIS HA   H  10.795 -13.054  17.144 1.00 . A A .  10 HIS HA   1 1 
        3  5930 1 1  10 HIS HB2  H  12.445 -11.182  17.166 1.00 . A A .  10 HIS HB2  1 1 
        3  5931 1 1  10 HIS HB3  H  11.144 -10.023  17.417 1.00 . A A .  10 HIS HB3  1 1 
        3  5932 1 1  10 HIS HD1  H  12.651 -13.031  19.185 1.00 . A A .  10 HIS HD1  1 1 
        3  5933 1 1  10 HIS HD2  H  10.690  -9.497  20.072 1.00 . A A .  10 HIS HD2  1 1 
        3  5934 1 1  10 HIS HE1  H  12.674 -12.865  21.677 1.00 . A A .  10 HIS HE1  1 1 
        3  5935 1 1  10 HIS HE2  H  11.660 -10.624  22.165 1.00 . A A .  10 HIS HE2  1 1 
        3  5936 1 1  10 HIS N    N  10.354 -11.807  15.531 1.00 . A A .  10 HIS N    1 1 
        3  5937 1 1  10 HIS ND1  N  12.268 -12.274  19.670 1.00 . A A .  10 HIS ND1  1 1 
        3  5938 1 1  10 HIS NE2  N  11.621 -11.050  21.290 1.00 . A A .  10 HIS NE2  1 1 
        3  5939 1 1  10 HIS O    O   8.411 -10.814  17.334 1.00 . A A .  10 HIS O    1 1 
        3  5940 1 1  11 MET C    C   7.046 -11.754  19.975 1.00 . A A .  11 MET C    1 1 
        3  5941 1 1  11 MET CA   C   7.262 -12.890  18.950 1.00 . A A .  11 MET CA   1 1 
        3  5942 1 1  11 MET CB   C   6.997 -14.285  19.596 1.00 . A A .  11 MET CB   1 1 
        3  5943 1 1  11 MET CE   C   7.984 -17.141  16.653 1.00 . A A .  11 MET CE   1 1 
        3  5944 1 1  11 MET CG   C   6.901 -15.450  18.596 1.00 . A A .  11 MET CG   1 1 
        3  5945 1 1  11 MET H    H   9.208 -13.602  18.515 1.00 . A A .  11 MET H    1 1 
        3  5946 1 1  11 MET HA   H   6.550 -12.743  18.144 1.00 . A A .  11 MET HA   1 1 
        3  5947 1 1  11 MET HB2  H   7.803 -14.507  20.286 1.00 . A A .  11 MET HB2  1 1 
        3  5948 1 1  11 MET HB3  H   6.066 -14.247  20.158 1.00 . A A .  11 MET HB3  1 1 
        3  5949 1 1  11 MET HE1  H   8.818 -17.405  16.020 1.00 . A A .  11 MET HE1  1 1 
        3  5950 1 1  11 MET HE2  H   7.131 -16.891  16.037 1.00 . A A .  11 MET HE2  1 1 
        3  5951 1 1  11 MET HE3  H   7.735 -17.981  17.288 1.00 . A A .  11 MET HE3  1 1 
        3  5952 1 1  11 MET HG2  H   6.658 -16.357  19.133 1.00 . A A .  11 MET HG2  1 1 
        3  5953 1 1  11 MET HG3  H   6.106 -15.235  17.891 1.00 . A A .  11 MET HG3  1 1 
        3  5954 1 1  11 MET N    N   8.609 -12.849  18.349 1.00 . A A .  11 MET N    1 1 
        3  5955 1 1  11 MET O    O   7.976 -11.008  20.319 1.00 . A A .  11 MET O    1 1 
        3  5956 1 1  11 MET SD   S   8.432 -15.730  17.668 1.00 . A A .  11 MET SD   1 1 
        3  5957 1 1  12 ALA C    C   5.590 -10.994  22.825 1.00 . A A .  12 ALA C    1 1 
        3  5958 1 1  12 ALA CA   C   5.378 -10.569  21.360 1.00 . A A .  12 ALA CA   1 1 
        3  5959 1 1  12 ALA CB   C   3.900 -10.235  21.094 1.00 . A A .  12 ALA CB   1 1 
        3  5960 1 1  12 ALA H    H   5.154 -12.341  20.230 1.00 . A A .  12 ALA H    1 1 
        3  5961 1 1  12 ALA HA   H   5.973  -9.683  21.147 1.00 . A A .  12 ALA HA   1 1 
        3  5962 1 1  12 ALA HB1  H   3.780  -9.916  20.067 1.00 . A A .  12 ALA HB1  1 1 
        3  5963 1 1  12 ALA HB2  H   3.584  -9.437  21.754 1.00 . A A .  12 ALA HB2  1 1 
        3  5964 1 1  12 ALA HB3  H   3.284 -11.109  21.269 1.00 . A A .  12 ALA HB3  1 1 
        3  5965 1 1  12 ALA N    N   5.804 -11.644  20.453 1.00 . A A .  12 ALA N    1 1 
        3  5966 1 1  12 ALA O    O   5.264 -12.133  23.185 1.00 . A A .  12 ALA O    1 1 
        3  5967 1 1  13 MET C    C   6.018  -9.020  25.883 1.00 . A A .  13 MET C    1 1 
        3  5968 1 1  13 MET CA   C   6.341 -10.317  25.117 1.00 . A A .  13 MET CA   1 1 
        3  5969 1 1  13 MET CB   C   7.808 -10.755  25.463 1.00 . A A .  13 MET CB   1 1 
        3  5970 1 1  13 MET CE   C   9.137 -13.464  22.573 1.00 . A A .  13 MET CE   1 1 
        3  5971 1 1  13 MET CG   C   8.298 -12.053  24.803 1.00 . A A .  13 MET CG   1 1 
        3  5972 1 1  13 MET H    H   6.311  -9.191  23.313 1.00 . A A .  13 MET H    1 1 
        3  5973 1 1  13 MET HA   H   5.653 -11.100  25.446 1.00 . A A .  13 MET HA   1 1 
        3  5974 1 1  13 MET HB2  H   8.483  -9.961  25.160 1.00 . A A .  13 MET HB2  1 1 
        3  5975 1 1  13 MET HB3  H   7.887 -10.876  26.539 1.00 . A A .  13 MET HB3  1 1 
        3  5976 1 1  13 MET HE1  H   9.887 -13.915  23.200 1.00 . A A .  13 MET HE1  1 1 
        3  5977 1 1  13 MET HE2  H   9.475 -13.457  21.549 1.00 . A A .  13 MET HE2  1 1 
        3  5978 1 1  13 MET HE3  H   8.214 -14.027  22.642 1.00 . A A .  13 MET HE3  1 1 
        3  5979 1 1  13 MET HG2  H   9.130 -12.455  25.368 1.00 . A A .  13 MET HG2  1 1 
        3  5980 1 1  13 MET HG3  H   7.487 -12.776  24.802 1.00 . A A .  13 MET HG3  1 1 
        3  5981 1 1  13 MET N    N   6.128 -10.083  23.662 1.00 . A A .  13 MET N    1 1 
        3  5982 1 1  13 MET O    O   5.173  -8.999  26.786 1.00 . A A .  13 MET O    1 1 
        3  5983 1 1  13 MET SD   S   8.833 -11.787  23.101 1.00 . A A .  13 MET SD   1 1 
        3  5984 1 1  14 GLN C    C   6.166  -5.565  25.177 1.00 . A A .  14 GLN C    1 1 
        3  5985 1 1  14 GLN CA   C   6.676  -6.628  26.169 1.00 . A A .  14 GLN CA   1 1 
        3  5986 1 1  14 GLN CB   C   8.098  -6.288  26.686 1.00 . A A .  14 GLN CB   1 1 
        3  5987 1 1  14 GLN CD   C   9.692  -4.571  27.763 1.00 . A A .  14 GLN CD   1 1 
        3  5988 1 1  14 GLN CG   C   8.250  -4.911  27.366 1.00 . A A .  14 GLN CG   1 1 
        3  5989 1 1  14 GLN H    H   7.274  -8.019  24.687 1.00 . A A .  14 GLN H    1 1 
        3  5990 1 1  14 GLN HA   H   5.991  -6.680  27.013 1.00 . A A .  14 GLN HA   1 1 
        3  5991 1 1  14 GLN HB2  H   8.391  -7.046  27.404 1.00 . A A .  14 GLN HB2  1 1 
        3  5992 1 1  14 GLN HB3  H   8.789  -6.327  25.850 1.00 . A A .  14 GLN HB3  1 1 
        3  5993 1 1  14 GLN HE21 H  10.088  -6.462  28.268 1.00 . A A .  14 GLN HE21 1 1 
        3  5994 1 1  14 GLN HE22 H  11.387  -5.341  28.461 1.00 . A A .  14 GLN HE22 1 1 
        3  5995 1 1  14 GLN HG2  H   7.898  -4.144  26.684 1.00 . A A .  14 GLN HG2  1 1 
        3  5996 1 1  14 GLN HG3  H   7.638  -4.890  28.258 1.00 . A A .  14 GLN HG3  1 1 
        3  5997 1 1  14 GLN N    N   6.716  -7.939  25.489 1.00 . A A .  14 GLN N    1 1 
        3  5998 1 1  14 GLN NE2  N  10.463  -5.560  28.208 1.00 . A A .  14 GLN NE2  1 1 
        3  5999 1 1  14 GLN O    O   6.949  -4.920  24.470 1.00 . A A .  14 GLN O    1 1 
        3  6000 1 1  14 GLN OE1  O  10.107  -3.407  27.708 1.00 . A A .  14 GLN OE1  1 1 
        3  6001 1 1  15 GLU C    C   3.656  -3.282  24.557 1.00 . A A .  15 GLU C    1 1 
        3  6002 1 1  15 GLU CA   C   4.162  -4.637  24.041 1.00 . A A .  15 GLU CA   1 1 
        3  6003 1 1  15 GLU CB   C   3.007  -5.456  23.405 1.00 . A A .  15 GLU CB   1 1 
        3  6004 1 1  15 GLU CD   C   4.685  -6.807  21.957 1.00 . A A .  15 GLU CD   1 1 
        3  6005 1 1  15 GLU CG   C   3.431  -6.843  22.862 1.00 . A A .  15 GLU CG   1 1 
        3  6006 1 1  15 GLU H    H   4.287  -5.862  25.786 1.00 . A A .  15 GLU H    1 1 
        3  6007 1 1  15 GLU HA   H   4.895  -4.448  23.262 1.00 . A A .  15 GLU HA   1 1 
        3  6008 1 1  15 GLU HB2  H   2.231  -5.605  24.151 1.00 . A A .  15 GLU HB2  1 1 
        3  6009 1 1  15 GLU HB3  H   2.588  -4.883  22.585 1.00 . A A .  15 GLU HB3  1 1 
        3  6010 1 1  15 GLU HG2  H   3.626  -7.493  23.708 1.00 . A A .  15 GLU HG2  1 1 
        3  6011 1 1  15 GLU HG3  H   2.603  -7.260  22.293 1.00 . A A .  15 GLU HG3  1 1 
        3  6012 1 1  15 GLU N    N   4.832  -5.425  25.104 1.00 . A A .  15 GLU N    1 1 
        3  6013 1 1  15 GLU O    O   2.789  -3.226  25.432 1.00 . A A .  15 GLU O    1 1 
        3  6014 1 1  15 GLU OE1  O   4.597  -6.301  20.815 1.00 . A A .  15 GLU OE1  1 1 
        3  6015 1 1  15 GLU OE2  O   5.760  -7.284  22.387 1.00 . A A .  15 GLU OE2  1 1 
        3  6016 1 1  16 GLY C    C   2.872  -0.274  23.151 1.00 . A A .  16 GLY C    1 1 
        3  6017 1 1  16 GLY CA   C   3.755  -0.823  24.267 1.00 . A A .  16 GLY CA   1 1 
        3  6018 1 1  16 GLY H    H   4.990  -2.321  23.407 1.00 . A A .  16 GLY H    1 1 
        3  6019 1 1  16 GLY HA2  H   3.194  -0.795  25.195 1.00 . A A .  16 GLY HA2  1 1 
        3  6020 1 1  16 GLY HA3  H   4.618  -0.184  24.368 1.00 . A A .  16 GLY HA3  1 1 
        3  6021 1 1  16 GLY N    N   4.224  -2.193  24.003 1.00 . A A .  16 GLY N    1 1 
        3  6022 1 1  16 GLY O    O   2.420   0.874  23.216 1.00 . A A .  16 GLY O    1 1 
        3  6023 1 1  17 LEU C    C   0.292  -1.102  21.173 1.00 . A A .  17 LEU C    1 1 
        3  6024 1 1  17 LEU CA   C   1.778  -0.741  20.962 1.00 . A A .  17 LEU CA   1 1 
        3  6025 1 1  17 LEU CB   C   2.335  -1.422  19.672 1.00 . A A .  17 LEU CB   1 1 
        3  6026 1 1  17 LEU CD1  C   4.178  -1.689  17.907 1.00 . A A .  17 LEU CD1  1 1 
        3  6027 1 1  17 LEU CD2  C   3.948   0.516  19.171 1.00 . A A .  17 LEU CD2  1 1 
        3  6028 1 1  17 LEU CG   C   3.783  -1.018  19.245 1.00 . A A .  17 LEU CG   1 1 
        3  6029 1 1  17 LEU H    H   2.973  -2.023  22.159 1.00 . A A .  17 LEU H    1 1 
        3  6030 1 1  17 LEU HA   H   1.835   0.336  20.835 1.00 . A A .  17 LEU HA   1 1 
        3  6031 1 1  17 LEU HB2  H   2.313  -2.495  19.820 1.00 . A A .  17 LEU HB2  1 1 
        3  6032 1 1  17 LEU HB3  H   1.666  -1.183  18.847 1.00 . A A .  17 LEU HB3  1 1 
        3  6033 1 1  17 LEU HD11 H   5.202  -1.439  17.661 1.00 . A A .  17 LEU HD11 1 1 
        3  6034 1 1  17 LEU HD12 H   3.527  -1.346  17.113 1.00 . A A .  17 LEU HD12 1 1 
        3  6035 1 1  17 LEU HD13 H   4.089  -2.765  18.000 1.00 . A A .  17 LEU HD13 1 1 
        3  6036 1 1  17 LEU HD21 H   3.254   0.928  18.447 1.00 . A A .  17 LEU HD21 1 1 
        3  6037 1 1  17 LEU HD22 H   4.959   0.763  18.881 1.00 . A A .  17 LEU HD22 1 1 
        3  6038 1 1  17 LEU HD23 H   3.745   0.948  20.143 1.00 . A A .  17 LEU HD23 1 1 
        3  6039 1 1  17 LEU HG   H   4.479  -1.381  19.995 1.00 . A A .  17 LEU HG   1 1 
        3  6040 1 1  17 LEU N    N   2.601  -1.111  22.125 1.00 . A A .  17 LEU N    1 1 
        3  6041 1 1  17 LEU O    O  -0.441  -1.332  20.206 1.00 . A A .  17 LEU O    1 1 
        3  6042 1 1  18 SER C    C  -2.563  -0.309  22.575 1.00 . A A .  18 SER C    1 1 
        3  6043 1 1  18 SER CA   C  -1.521  -1.459  22.821 1.00 . A A .  18 SER CA   1 1 
        3  6044 1 1  18 SER CB   C  -1.542  -1.955  24.289 1.00 . A A .  18 SER CB   1 1 
        3  6045 1 1  18 SER H    H   0.455  -0.787  23.139 1.00 . A A .  18 SER H    1 1 
        3  6046 1 1  18 SER HA   H  -1.807  -2.299  22.186 1.00 . A A .  18 SER HA   1 1 
        3  6047 1 1  18 SER HB2  H  -0.772  -2.703  24.428 1.00 . A A .  18 SER HB2  1 1 
        3  6048 1 1  18 SER HB3  H  -1.353  -1.125  24.957 1.00 . A A .  18 SER HB3  1 1 
        3  6049 1 1  18 SER HG   H  -2.931  -3.318  24.073 1.00 . A A .  18 SER HG   1 1 
        3  6050 1 1  18 SER N    N  -0.151  -1.080  22.438 1.00 . A A .  18 SER N    1 1 
        3  6051 1 1  18 SER O    O  -3.650  -0.597  22.054 1.00 . A A .  18 SER O    1 1 
        3  6052 1 1  18 SER OG   O  -2.786  -2.536  24.627 1.00 . A A .  18 SER OG   1 1 
        3  6053 1 1  19 PRO C    C  -3.292   2.603  21.230 1.00 . A A .  19 PRO C    1 1 
        3  6054 1 1  19 PRO CA   C  -3.285   2.098  22.700 1.00 . A A .  19 PRO CA   1 1 
        3  6055 1 1  19 PRO CB   C  -2.834   3.203  23.692 1.00 . A A .  19 PRO CB   1 1 
        3  6056 1 1  19 PRO CD   C  -1.080   1.537  23.651 1.00 . A A .  19 PRO CD   1 1 
        3  6057 1 1  19 PRO CG   C  -1.348   3.025  23.831 1.00 . A A .  19 PRO CG   1 1 
        3  6058 1 1  19 PRO HA   H  -4.288   1.770  22.966 1.00 . A A .  19 PRO HA   1 1 
        3  6059 1 1  19 PRO HB2  H  -3.085   4.192  23.304 1.00 . A A .  19 PRO HB2  1 1 
        3  6060 1 1  19 PRO HB3  H  -3.315   3.061  24.651 1.00 . A A .  19 PRO HB3  1 1 
        3  6061 1 1  19 PRO HD2  H  -0.192   1.385  23.047 1.00 . A A .  19 PRO HD2  1 1 
        3  6062 1 1  19 PRO HD3  H  -0.961   1.054  24.611 1.00 . A A .  19 PRO HD3  1 1 
        3  6063 1 1  19 PRO HG2  H  -0.836   3.605  23.060 1.00 . A A .  19 PRO HG2  1 1 
        3  6064 1 1  19 PRO HG3  H  -1.017   3.350  24.811 1.00 . A A .  19 PRO HG3  1 1 
        3  6065 1 1  19 PRO N    N  -2.297   1.012  22.945 1.00 . A A .  19 PRO N    1 1 
        3  6066 1 1  19 PRO O    O  -2.468   3.442  20.844 1.00 . A A .  19 PRO O    1 1 
        3  6067 1 1  20 ASN C    C  -3.481   2.203  17.971 1.00 . A A .  20 ASN C    1 1 
        3  6068 1 1  20 ASN CA   C  -4.560   2.509  19.052 1.00 . A A .  20 ASN CA   1 1 
        3  6069 1 1  20 ASN CB   C  -4.938   4.037  19.103 1.00 . A A .  20 ASN CB   1 1 
        3  6070 1 1  20 ASN CG   C  -5.253   4.687  17.738 1.00 . A A .  20 ASN CG   1 1 
        3  6071 1 1  20 ASN H    H  -4.651   1.202  20.744 1.00 . A A .  20 ASN H    1 1 
        3  6072 1 1  20 ASN HA   H  -5.450   1.956  18.769 1.00 . A A .  20 ASN HA   1 1 
        3  6073 1 1  20 ASN HB2  H  -5.810   4.153  19.731 1.00 . A A .  20 ASN HB2  1 1 
        3  6074 1 1  20 ASN HB3  H  -4.117   4.584  19.563 1.00 . A A .  20 ASN HB3  1 1 
        3  6075 1 1  20 ASN HD21 H  -3.392   5.366  17.567 1.00 . A A .  20 ASN HD21 1 1 
        3  6076 1 1  20 ASN HD22 H  -4.453   5.732  16.253 1.00 . A A .  20 ASN HD22 1 1 
        3  6077 1 1  20 ASN N    N  -4.198   2.015  20.413 1.00 . A A .  20 ASN N    1 1 
        3  6078 1 1  20 ASN ND2  N  -4.267   5.329  17.128 1.00 . A A .  20 ASN ND2  1 1 
        3  6079 1 1  20 ASN O    O  -3.779   2.287  16.786 1.00 . A A .  20 ASN O    1 1 
        3  6080 1 1  20 ASN OD1  O  -6.375   4.620  17.247 1.00 . A A .  20 ASN OD1  1 1 
        3  6081 1 1  21 HIS C    C  -1.262   0.752  16.275 1.00 . A A .  21 HIS C    1 1 
        3  6082 1 1  21 HIS CA   C  -1.087   1.712  17.467 1.00 . A A .  21 HIS CA   1 1 
        3  6083 1 1  21 HIS CB   C   0.193   1.332  18.236 1.00 . A A .  21 HIS CB   1 1 
        3  6084 1 1  21 HIS CD2  C   0.472   2.666  20.450 1.00 . A A .  21 HIS CD2  1 1 
        3  6085 1 1  21 HIS CE1  C   1.947   4.111  19.757 1.00 . A A .  21 HIS CE1  1 1 
        3  6086 1 1  21 HIS CG   C   0.715   2.402  19.148 1.00 . A A .  21 HIS CG   1 1 
        3  6087 1 1  21 HIS H    H  -2.155   1.484  19.302 1.00 . A A .  21 HIS H    1 1 
        3  6088 1 1  21 HIS HA   H  -0.953   2.713  17.061 1.00 . A A .  21 HIS HA   1 1 
        3  6089 1 1  21 HIS HB2  H  -0.001   0.454  18.837 1.00 . A A .  21 HIS HB2  1 1 
        3  6090 1 1  21 HIS HB3  H   0.988   1.094  17.533 1.00 . A A .  21 HIS HB3  1 1 
        3  6091 1 1  21 HIS HD1  H   2.012   3.425  17.843 1.00 . A A .  21 HIS HD1  1 1 
        3  6092 1 1  21 HIS HD2  H  -0.216   2.138  21.096 1.00 . A A .  21 HIS HD2  1 1 
        3  6093 1 1  21 HIS HE1  H   2.648   4.933  19.726 1.00 . A A .  21 HIS HE1  1 1 
        3  6094 1 1  21 HIS HE2  H   1.142   4.258  21.620 1.00 . A A .  21 HIS HE2  1 1 
        3  6095 1 1  21 HIS N    N  -2.265   1.775  18.377 1.00 . A A .  21 HIS N    1 1 
        3  6096 1 1  21 HIS ND1  N   1.643   3.331  18.744 1.00 . A A .  21 HIS ND1  1 1 
        3  6097 1 1  21 HIS NE2  N   1.249   3.730  20.802 1.00 . A A .  21 HIS NE2  1 1 
        3  6098 1 1  21 HIS O    O  -0.690   1.009  15.224 1.00 . A A .  21 HIS O    1 1 
        3  6099 1 1  22 LEU C    C  -3.060  -0.500  14.226 1.00 . A A .  22 LEU C    1 1 
        3  6100 1 1  22 LEU CA   C  -2.336  -1.288  15.341 1.00 . A A .  22 LEU CA   1 1 
        3  6101 1 1  22 LEU CB   C  -3.252  -2.463  15.841 1.00 . A A .  22 LEU CB   1 1 
        3  6102 1 1  22 LEU CD1  C  -2.771  -3.806  13.616 1.00 . A A .  22 LEU CD1  1 1 
        3  6103 1 1  22 LEU CD2  C  -2.073  -4.764  15.866 1.00 . A A .  22 LEU CD2  1 1 
        3  6104 1 1  22 LEU CG   C  -3.096  -3.880  15.135 1.00 . A A .  22 LEU CG   1 1 
        3  6105 1 1  22 LEU H    H  -2.391  -0.532  17.338 1.00 . A A .  22 LEU H    1 1 
        3  6106 1 1  22 LEU HA   H  -1.402  -1.688  14.965 1.00 . A A .  22 LEU HA   1 1 
        3  6107 1 1  22 LEU HB2  H  -3.070  -2.596  16.908 1.00 . A A .  22 LEU HB2  1 1 
        3  6108 1 1  22 LEU HB3  H  -4.293  -2.155  15.745 1.00 . A A .  22 LEU HB3  1 1 
        3  6109 1 1  22 LEU HD11 H  -2.736  -4.807  13.200 1.00 . A A .  22 LEU HD11 1 1 
        3  6110 1 1  22 LEU HD12 H  -1.810  -3.329  13.461 1.00 . A A .  22 LEU HD12 1 1 
        3  6111 1 1  22 LEU HD13 H  -3.537  -3.236  13.106 1.00 . A A .  22 LEU HD13 1 1 
        3  6112 1 1  22 LEU HD21 H  -1.998  -5.727  15.371 1.00 . A A .  22 LEU HD21 1 1 
        3  6113 1 1  22 LEU HD22 H  -2.388  -4.919  16.888 1.00 . A A .  22 LEU HD22 1 1 
        3  6114 1 1  22 LEU HD23 H  -1.103  -4.288  15.861 1.00 . A A .  22 LEU HD23 1 1 
        3  6115 1 1  22 LEU HG   H  -4.051  -4.393  15.212 1.00 . A A .  22 LEU HG   1 1 
        3  6116 1 1  22 LEU N    N  -2.026  -0.347  16.449 1.00 . A A .  22 LEU N    1 1 
        3  6117 1 1  22 LEU O    O  -2.613  -0.455  13.075 1.00 . A A .  22 LEU O    1 1 
        3  6118 1 1  23 LYS C    C  -4.291   2.070  13.116 1.00 . A A .  23 LYS C    1 1 
        3  6119 1 1  23 LYS CA   C  -5.056   0.927  13.786 1.00 . A A .  23 LYS CA   1 1 
        3  6120 1 1  23 LYS CB   C  -6.232   1.495  14.629 1.00 . A A .  23 LYS CB   1 1 
        3  6121 1 1  23 LYS CD   C  -8.090   1.000  16.355 1.00 . A A .  23 LYS CD   1 1 
        3  6122 1 1  23 LYS CE   C  -9.191   1.706  15.552 1.00 . A A .  23 LYS CE   1 1 
        3  6123 1 1  23 LYS CG   C  -6.965   0.426  15.467 1.00 . A A .  23 LYS CG   1 1 
        3  6124 1 1  23 LYS H    H  -4.363   0.123  15.610 1.00 . A A .  23 LYS H    1 1 
        3  6125 1 1  23 LYS HA   H  -5.453   0.258  13.028 1.00 . A A .  23 LYS HA   1 1 
        3  6126 1 1  23 LYS HB2  H  -5.848   2.256  15.305 1.00 . A A .  23 LYS HB2  1 1 
        3  6127 1 1  23 LYS HB3  H  -6.952   1.957  13.961 1.00 . A A .  23 LYS HB3  1 1 
        3  6128 1 1  23 LYS HD2  H  -8.538   0.186  16.915 1.00 . A A .  23 LYS HD2  1 1 
        3  6129 1 1  23 LYS HD3  H  -7.655   1.707  17.055 1.00 . A A .  23 LYS HD3  1 1 
        3  6130 1 1  23 LYS HE2  H  -8.785   2.602  15.099 1.00 . A A .  23 LYS HE2  1 1 
        3  6131 1 1  23 LYS HE3  H  -9.548   1.043  14.774 1.00 . A A .  23 LYS HE3  1 1 
        3  6132 1 1  23 LYS HG2  H  -7.391  -0.313  14.798 1.00 . A A .  23 LYS HG2  1 1 
        3  6133 1 1  23 LYS HG3  H  -6.232  -0.063  16.107 1.00 . A A .  23 LYS HG3  1 1 
        3  6134 1 1  23 LYS HZ1  H -10.034   2.729  17.171 1.00 . A A .  23 LYS HZ1  1 1 
        3  6135 1 1  23 LYS HZ2  H -10.754   1.237  16.850 1.00 . A A .  23 LYS HZ2  1 1 
        3  6136 1 1  23 LYS HZ3  H -11.071   2.556  15.852 1.00 . A A .  23 LYS HZ3  1 1 
        3  6137 1 1  23 LYS N    N  -4.158   0.154  14.650 1.00 . A A .  23 LYS N    1 1 
        3  6138 1 1  23 LYS NZ   N -10.340   2.085  16.415 1.00 . A A .  23 LYS NZ   1 1 
        3  6139 1 1  23 LYS O    O  -4.309   2.188  11.898 1.00 . A A .  23 LYS O    1 1 
        3  6140 1 1  24 LYS C    C  -1.784   3.620  12.442 1.00 . A A .  24 LYS C    1 1 
        3  6141 1 1  24 LYS CA   C  -2.795   4.013  13.523 1.00 . A A .  24 LYS CA   1 1 
        3  6142 1 1  24 LYS CB   C  -2.045   4.650  14.727 1.00 . A A .  24 LYS CB   1 1 
        3  6143 1 1  24 LYS CD   C  -0.241   6.341  15.468 1.00 . A A .  24 LYS CD   1 1 
        3  6144 1 1  24 LYS CE   C   0.668   7.505  15.027 1.00 . A A .  24 LYS CE   1 1 
        3  6145 1 1  24 LYS CG   C  -1.195   5.886  14.346 1.00 . A A .  24 LYS CG   1 1 
        3  6146 1 1  24 LYS H    H  -3.573   2.623  14.897 1.00 . A A .  24 LYS H    1 1 
        3  6147 1 1  24 LYS HA   H  -3.491   4.742  13.118 1.00 . A A .  24 LYS HA   1 1 
        3  6148 1 1  24 LYS HB2  H  -2.775   4.951  15.474 1.00 . A A .  24 LYS HB2  1 1 
        3  6149 1 1  24 LYS HB3  H  -1.392   3.902  15.169 1.00 . A A .  24 LYS HB3  1 1 
        3  6150 1 1  24 LYS HD2  H  -0.826   6.662  16.325 1.00 . A A .  24 LYS HD2  1 1 
        3  6151 1 1  24 LYS HD3  H   0.383   5.501  15.759 1.00 . A A .  24 LYS HD3  1 1 
        3  6152 1 1  24 LYS HE2  H   1.375   7.717  15.817 1.00 . A A .  24 LYS HE2  1 1 
        3  6153 1 1  24 LYS HE3  H   1.209   7.212  14.136 1.00 . A A .  24 LYS HE3  1 1 
        3  6154 1 1  24 LYS HG2  H  -0.602   5.643  13.469 1.00 . A A .  24 LYS HG2  1 1 
        3  6155 1 1  24 LYS HG3  H  -1.866   6.703  14.099 1.00 . A A .  24 LYS HG3  1 1 
        3  6156 1 1  24 LYS HZ1  H  -0.786   8.564  13.972 1.00 . A A .  24 LYS HZ1  1 1 
        3  6157 1 1  24 LYS HZ2  H   0.524   9.500  14.450 1.00 . A A .  24 LYS HZ2  1 1 
        3  6158 1 1  24 LYS HZ3  H  -0.620   9.046  15.590 1.00 . A A .  24 LYS HZ3  1 1 
        3  6159 1 1  24 LYS N    N  -3.577   2.850  13.952 1.00 . A A .  24 LYS N    1 1 
        3  6160 1 1  24 LYS NZ   N  -0.107   8.737  14.738 1.00 . A A .  24 LYS NZ   1 1 
        3  6161 1 1  24 LYS O    O  -1.846   4.132  11.329 1.00 . A A .  24 LYS O    1 1 
        3  6162 1 1  25 ALA C    C  -0.302   1.689  10.580 1.00 . A A .  25 ALA C    1 1 
        3  6163 1 1  25 ALA CA   C   0.206   2.213  11.930 1.00 . A A .  25 ALA CA   1 1 
        3  6164 1 1  25 ALA CB   C   1.029   1.130  12.646 1.00 . A A .  25 ALA CB   1 1 
        3  6165 1 1  25 ALA H    H  -1.001   2.233  13.666 1.00 . A A .  25 ALA H    1 1 
        3  6166 1 1  25 ALA HA   H   0.859   3.067  11.762 1.00 . A A .  25 ALA HA   1 1 
        3  6167 1 1  25 ALA HB1  H   0.412   0.255  12.820 1.00 . A A .  25 ALA HB1  1 1 
        3  6168 1 1  25 ALA HB2  H   1.379   1.506  13.597 1.00 . A A .  25 ALA HB2  1 1 
        3  6169 1 1  25 ALA HB3  H   1.880   0.852  12.037 1.00 . A A .  25 ALA HB3  1 1 
        3  6170 1 1  25 ALA N    N  -0.900   2.661  12.790 1.00 . A A .  25 ALA N    1 1 
        3  6171 1 1  25 ALA O    O   0.174   2.104   9.522 1.00 . A A .  25 ALA O    1 1 
        3  6172 1 1  26 LYS C    C  -2.576   1.185   8.527 1.00 . A A .  26 LYS C    1 1 
        3  6173 1 1  26 LYS CA   C  -1.921   0.165   9.493 1.00 . A A .  26 LYS CA   1 1 
        3  6174 1 1  26 LYS CB   C  -2.937  -0.865  10.029 1.00 . A A .  26 LYS CB   1 1 
        3  6175 1 1  26 LYS CD   C  -4.539  -2.792   9.563 1.00 . A A .  26 LYS CD   1 1 
        3  6176 1 1  26 LYS CE   C  -5.283  -2.566  10.893 1.00 . A A .  26 LYS CE   1 1 
        3  6177 1 1  26 LYS CG   C  -3.870  -1.521   9.001 1.00 . A A .  26 LYS CG   1 1 
        3  6178 1 1  26 LYS H    H  -1.658   0.589  11.551 1.00 . A A .  26 LYS H    1 1 
        3  6179 1 1  26 LYS HA   H  -1.136  -0.368   8.959 1.00 . A A .  26 LYS HA   1 1 
        3  6180 1 1  26 LYS HB2  H  -2.379  -1.653  10.523 1.00 . A A .  26 LYS HB2  1 1 
        3  6181 1 1  26 LYS HB3  H  -3.557  -0.375  10.780 1.00 . A A .  26 LYS HB3  1 1 
        3  6182 1 1  26 LYS HD2  H  -5.246  -3.161   8.833 1.00 . A A .  26 LYS HD2  1 1 
        3  6183 1 1  26 LYS HD3  H  -3.772  -3.547   9.716 1.00 . A A .  26 LYS HD3  1 1 
        3  6184 1 1  26 LYS HE2  H  -5.684  -3.511  11.229 1.00 . A A .  26 LYS HE2  1 1 
        3  6185 1 1  26 LYS HE3  H  -4.587  -2.199  11.636 1.00 . A A .  26 LYS HE3  1 1 
        3  6186 1 1  26 LYS HG2  H  -4.640  -0.811   8.711 1.00 . A A .  26 LYS HG2  1 1 
        3  6187 1 1  26 LYS HG3  H  -3.287  -1.788   8.122 1.00 . A A .  26 LYS HG3  1 1 
        3  6188 1 1  26 LYS HZ1  H  -7.098  -1.943  10.070 1.00 . A A .  26 LYS HZ1  1 1 
        3  6189 1 1  26 LYS HZ2  H  -6.063  -0.672  10.495 1.00 . A A .  26 LYS HZ2  1 1 
        3  6190 1 1  26 LYS HZ3  H  -6.896  -1.522  11.696 1.00 . A A .  26 LYS HZ3  1 1 
        3  6191 1 1  26 LYS N    N  -1.309   0.815  10.656 1.00 . A A .  26 LYS N    1 1 
        3  6192 1 1  26 LYS NZ   N  -6.413  -1.606  10.778 1.00 . A A .  26 LYS NZ   1 1 
        3  6193 1 1  26 LYS O    O  -2.345   1.128   7.308 1.00 . A A .  26 LYS O    1 1 
        3  6194 1 1  27 LEU C    C  -3.074   4.124   7.641 1.00 . A A .  27 LEU C    1 1 
        3  6195 1 1  27 LEU CA   C  -4.064   3.156   8.294 1.00 . A A .  27 LEU CA   1 1 
        3  6196 1 1  27 LEU CB   C  -5.101   3.926   9.164 1.00 . A A .  27 LEU CB   1 1 
        3  6197 1 1  27 LEU CD1  C  -7.247   3.932  10.576 1.00 . A A .  27 LEU CD1  1 1 
        3  6198 1 1  27 LEU CD2  C  -7.030   2.360   8.571 1.00 . A A .  27 LEU CD2  1 1 
        3  6199 1 1  27 LEU CG   C  -6.290   3.077   9.715 1.00 . A A .  27 LEU CG   1 1 
        3  6200 1 1  27 LEU H    H  -3.426   2.164  10.067 1.00 . A A .  27 LEU H    1 1 
        3  6201 1 1  27 LEU HA   H  -4.602   2.632   7.505 1.00 . A A .  27 LEU HA   1 1 
        3  6202 1 1  27 LEU HB2  H  -4.575   4.360  10.011 1.00 . A A .  27 LEU HB2  1 1 
        3  6203 1 1  27 LEU HB3  H  -5.515   4.739   8.574 1.00 . A A .  27 LEU HB3  1 1 
        3  6204 1 1  27 LEU HD11 H  -8.045   3.312  10.965 1.00 . A A .  27 LEU HD11 1 1 
        3  6205 1 1  27 LEU HD12 H  -7.674   4.728   9.977 1.00 . A A .  27 LEU HD12 1 1 
        3  6206 1 1  27 LEU HD13 H  -6.698   4.364  11.403 1.00 . A A .  27 LEU HD13 1 1 
        3  6207 1 1  27 LEU HD21 H  -7.849   1.784   8.976 1.00 . A A .  27 LEU HD21 1 1 
        3  6208 1 1  27 LEU HD22 H  -6.346   1.693   8.060 1.00 . A A .  27 LEU HD22 1 1 
        3  6209 1 1  27 LEU HD23 H  -7.416   3.083   7.864 1.00 . A A .  27 LEU HD23 1 1 
        3  6210 1 1  27 LEU HG   H  -5.891   2.306  10.365 1.00 . A A .  27 LEU HG   1 1 
        3  6211 1 1  27 LEU N    N  -3.350   2.137   9.089 1.00 . A A .  27 LEU N    1 1 
        3  6212 1 1  27 LEU O    O  -3.108   4.311   6.426 1.00 . A A .  27 LEU O    1 1 
        3  6213 1 1  28 MET C    C  -0.201   5.029   6.959 1.00 . A A .  28 MET C    1 1 
        3  6214 1 1  28 MET CA   C  -1.144   5.665   7.989 1.00 . A A .  28 MET CA   1 1 
        3  6215 1 1  28 MET CB   C  -0.337   6.261   9.179 1.00 . A A .  28 MET CB   1 1 
        3  6216 1 1  28 MET CE   C   1.683   7.461  11.321 1.00 . A A .  28 MET CE   1 1 
        3  6217 1 1  28 MET CG   C   0.651   5.308   9.867 1.00 . A A .  28 MET CG   1 1 
        3  6218 1 1  28 MET H    H  -2.166   4.441   9.402 1.00 . A A .  28 MET H    1 1 
        3  6219 1 1  28 MET HA   H  -1.686   6.474   7.504 1.00 . A A .  28 MET HA   1 1 
        3  6220 1 1  28 MET HB2  H   0.222   7.120   8.821 1.00 . A A .  28 MET HB2  1 1 
        3  6221 1 1  28 MET HB3  H  -1.039   6.610   9.927 1.00 . A A .  28 MET HB3  1 1 
        3  6222 1 1  28 MET HE1  H   2.002   7.860  12.273 1.00 . A A .  28 MET HE1  1 1 
        3  6223 1 1  28 MET HE2  H   0.909   8.091  10.907 1.00 . A A .  28 MET HE2  1 1 
        3  6224 1 1  28 MET HE3  H   2.527   7.437  10.643 1.00 . A A .  28 MET HE3  1 1 
        3  6225 1 1  28 MET HG2  H   0.212   4.318   9.909 1.00 . A A .  28 MET HG2  1 1 
        3  6226 1 1  28 MET HG3  H   1.566   5.260   9.287 1.00 . A A .  28 MET HG3  1 1 
        3  6227 1 1  28 MET N    N  -2.159   4.690   8.457 1.00 . A A .  28 MET N    1 1 
        3  6228 1 1  28 MET O    O   0.333   5.726   6.103 1.00 . A A .  28 MET O    1 1 
        3  6229 1 1  28 MET SD   S   1.062   5.804  11.554 1.00 . A A .  28 MET SD   1 1 
        3  6230 1 1  29 PHE C    C  -0.060   2.838   4.738 1.00 . A A .  29 PHE C    1 1 
        3  6231 1 1  29 PHE CA   C   0.738   2.928   6.054 1.00 . A A .  29 PHE CA   1 1 
        3  6232 1 1  29 PHE CB   C   1.076   1.514   6.579 1.00 . A A .  29 PHE CB   1 1 
        3  6233 1 1  29 PHE CD1  C   3.358   1.045   5.619 1.00 . A A .  29 PHE CD1  1 1 
        3  6234 1 1  29 PHE CD2  C   1.505  -0.216   4.772 1.00 . A A .  29 PHE CD2  1 1 
        3  6235 1 1  29 PHE CE1  C   4.197   0.391   4.750 1.00 . A A .  29 PHE CE1  1 1 
        3  6236 1 1  29 PHE CE2  C   2.350  -0.869   3.910 1.00 . A A .  29 PHE CE2  1 1 
        3  6237 1 1  29 PHE CG   C   1.995   0.754   5.648 1.00 . A A .  29 PHE CG   1 1 
        3  6238 1 1  29 PHE CZ   C   3.690  -0.564   3.900 1.00 . A A .  29 PHE CZ   1 1 
        3  6239 1 1  29 PHE H    H  -0.373   3.216   7.842 1.00 . A A .  29 PHE H    1 1 
        3  6240 1 1  29 PHE HA   H   1.666   3.463   5.866 1.00 . A A .  29 PHE HA   1 1 
        3  6241 1 1  29 PHE HB2  H   1.566   1.597   7.544 1.00 . A A .  29 PHE HB2  1 1 
        3  6242 1 1  29 PHE HB3  H   0.160   0.943   6.706 1.00 . A A .  29 PHE HB3  1 1 
        3  6243 1 1  29 PHE HD1  H   3.760   1.793   6.293 1.00 . A A .  29 PHE HD1  1 1 
        3  6244 1 1  29 PHE HD2  H   0.449  -0.461   4.777 1.00 . A A .  29 PHE HD2  1 1 
        3  6245 1 1  29 PHE HE1  H   5.258   0.626   4.736 1.00 . A A .  29 PHE HE1  1 1 
        3  6246 1 1  29 PHE HE2  H   1.962  -1.623   3.232 1.00 . A A .  29 PHE HE2  1 1 
        3  6247 1 1  29 PHE HZ   H   4.345  -1.073   3.217 1.00 . A A .  29 PHE HZ   1 1 
        3  6248 1 1  29 PHE N    N  -0.012   3.694   7.055 1.00 . A A .  29 PHE N    1 1 
        3  6249 1 1  29 PHE O    O   0.507   2.982   3.654 1.00 . A A .  29 PHE O    1 1 
        3  6250 1 1  30 PHE C    C  -2.376   3.967   2.998 1.00 . A A .  30 PHE C    1 1 
        3  6251 1 1  30 PHE CA   C  -2.296   2.574   3.674 1.00 . A A .  30 PHE CA   1 1 
        3  6252 1 1  30 PHE CB   C  -3.727   2.098   4.063 1.00 . A A .  30 PHE CB   1 1 
        3  6253 1 1  30 PHE CD1  C  -2.894  -0.318   4.227 1.00 . A A .  30 PHE CD1  1 1 
        3  6254 1 1  30 PHE CD2  C  -5.004   0.233   5.232 1.00 . A A .  30 PHE CD2  1 1 
        3  6255 1 1  30 PHE CE1  C  -3.046  -1.626   4.642 1.00 . A A .  30 PHE CE1  1 1 
        3  6256 1 1  30 PHE CE2  C  -5.151  -1.079   5.641 1.00 . A A .  30 PHE CE2  1 1 
        3  6257 1 1  30 PHE CG   C  -3.867   0.643   4.520 1.00 . A A .  30 PHE CG   1 1 
        3  6258 1 1  30 PHE CZ   C  -4.174  -2.008   5.343 1.00 . A A .  30 PHE CZ   1 1 
        3  6259 1 1  30 PHE H    H  -1.758   2.384   5.740 1.00 . A A .  30 PHE H    1 1 
        3  6260 1 1  30 PHE HA   H  -1.884   1.878   2.954 1.00 . A A .  30 PHE HA   1 1 
        3  6261 1 1  30 PHE HB2  H  -4.091   2.726   4.867 1.00 . A A .  30 PHE HB2  1 1 
        3  6262 1 1  30 PHE HB3  H  -4.383   2.229   3.206 1.00 . A A .  30 PHE HB3  1 1 
        3  6263 1 1  30 PHE HD1  H  -2.006  -0.032   3.677 1.00 . A A .  30 PHE HD1  1 1 
        3  6264 1 1  30 PHE HD2  H  -5.774   0.960   5.469 1.00 . A A .  30 PHE HD2  1 1 
        3  6265 1 1  30 PHE HE1  H  -2.283  -2.358   4.412 1.00 . A A .  30 PHE HE1  1 1 
        3  6266 1 1  30 PHE HE2  H  -6.035  -1.382   6.191 1.00 . A A .  30 PHE HE2  1 1 
        3  6267 1 1  30 PHE HZ   H  -4.290  -3.038   5.662 1.00 . A A .  30 PHE HZ   1 1 
        3  6268 1 1  30 PHE N    N  -1.386   2.588   4.848 1.00 . A A .  30 PHE N    1 1 
        3  6269 1 1  30 PHE O    O  -2.798   4.071   1.838 1.00 . A A .  30 PHE O    1 1 
        3  6270 1 1  31 TYR C    C  -0.507   6.538   2.471 1.00 . A A .  31 TYR C    1 1 
        3  6271 1 1  31 TYR CA   C  -1.862   6.389   3.184 1.00 . A A .  31 TYR CA   1 1 
        3  6272 1 1  31 TYR CB   C  -1.998   7.485   4.282 1.00 . A A .  31 TYR CB   1 1 
        3  6273 1 1  31 TYR CD1  C  -4.218   8.727   4.078 1.00 . A A .  31 TYR CD1  1 1 
        3  6274 1 1  31 TYR CD2  C  -4.022   7.073   5.776 1.00 . A A .  31 TYR CD2  1 1 
        3  6275 1 1  31 TYR CE1  C  -5.520   8.971   4.472 1.00 . A A .  31 TYR CE1  1 1 
        3  6276 1 1  31 TYR CE2  C  -5.319   7.313   6.167 1.00 . A A .  31 TYR CE2  1 1 
        3  6277 1 1  31 TYR CG   C  -3.440   7.765   4.724 1.00 . A A .  31 TYR CG   1 1 
        3  6278 1 1  31 TYR CZ   C  -6.064   8.261   5.516 1.00 . A A .  31 TYR CZ   1 1 
        3  6279 1 1  31 TYR H    H  -1.835   4.894   4.697 1.00 . A A .  31 TYR H    1 1 
        3  6280 1 1  31 TYR HA   H  -2.655   6.534   2.450 1.00 . A A .  31 TYR HA   1 1 
        3  6281 1 1  31 TYR HB2  H  -1.431   7.185   5.158 1.00 . A A .  31 TYR HB2  1 1 
        3  6282 1 1  31 TYR HB3  H  -1.579   8.419   3.914 1.00 . A A .  31 TYR HB3  1 1 
        3  6283 1 1  31 TYR HD1  H  -3.795   9.288   3.255 1.00 . A A .  31 TYR HD1  1 1 
        3  6284 1 1  31 TYR HD2  H  -3.441   6.331   6.296 1.00 . A A .  31 TYR HD2  1 1 
        3  6285 1 1  31 TYR HE1  H  -6.111   9.718   3.959 1.00 . A A .  31 TYR HE1  1 1 
        3  6286 1 1  31 TYR HE2  H  -5.748   6.753   6.990 1.00 . A A .  31 TYR HE2  1 1 
        3  6287 1 1  31 TYR HH   H  -7.930   8.546   5.130 1.00 . A A .  31 TYR HH   1 1 
        3  6288 1 1  31 TYR N    N  -2.012   5.030   3.743 1.00 . A A .  31 TYR N    1 1 
        3  6289 1 1  31 TYR O    O  -0.468   6.903   1.288 1.00 . A A .  31 TYR O    1 1 
        3  6290 1 1  31 TYR OH   O  -7.363   8.502   5.907 1.00 . A A .  31 TYR OH   1 1 
        3  6291 1 1  32 THR C    C   2.647   5.506   1.927 1.00 . A A .  32 THR C    1 1 
        3  6292 1 1  32 THR CA   C   1.949   6.599   2.751 1.00 . A A .  32 THR CA   1 1 
        3  6293 1 1  32 THR CB   C   2.856   7.048   3.947 1.00 . A A .  32 THR CB   1 1 
        3  6294 1 1  32 THR CG2  C   3.317   5.866   4.817 1.00 . A A .  32 THR CG2  1 1 
        3  6295 1 1  32 THR H    H   0.494   5.692   4.005 1.00 . A A .  32 THR H    1 1 
        3  6296 1 1  32 THR HA   H   1.839   7.471   2.107 1.00 . A A .  32 THR HA   1 1 
        3  6297 1 1  32 THR HB   H   2.283   7.727   4.568 1.00 . A A .  32 THR HB   1 1 
        3  6298 1 1  32 THR HG1  H   3.745   8.300   2.686 1.00 . A A .  32 THR HG1  1 1 
        3  6299 1 1  32 THR HG21 H   3.931   6.226   5.634 1.00 . A A .  32 THR HG21 1 1 
        3  6300 1 1  32 THR HG22 H   3.895   5.173   4.219 1.00 . A A .  32 THR HG22 1 1 
        3  6301 1 1  32 THR HG23 H   2.453   5.351   5.223 1.00 . A A .  32 THR HG23 1 1 
        3  6302 1 1  32 THR N    N   0.594   6.216   3.185 1.00 . A A .  32 THR N    1 1 
        3  6303 1 1  32 THR O    O   2.332   4.311   2.017 1.00 . A A .  32 THR O    1 1 
        3  6304 1 1  32 THR OG1  O   4.007   7.761   3.452 1.00 . A A .  32 THR OG1  1 1 
        3  6305 1 1  33 ARG C    C   5.929   5.453   0.585 1.00 . A A .  33 ARG C    1 1 
        3  6306 1 1  33 ARG CA   C   4.462   5.145   0.240 1.00 . A A .  33 ARG CA   1 1 
        3  6307 1 1  33 ARG CB   C   4.218   5.377  -1.294 1.00 . A A .  33 ARG CB   1 1 
        3  6308 1 1  33 ARG CD   C   1.633   5.220  -1.411 1.00 . A A .  33 ARG CD   1 1 
        3  6309 1 1  33 ARG CG   C   2.982   4.661  -1.885 1.00 . A A .  33 ARG CG   1 1 
        3  6310 1 1  33 ARG CZ   C  -0.444   3.892  -1.067 1.00 . A A .  33 ARG CZ   1 1 
        3  6311 1 1  33 ARG H    H   3.669   6.933   1.013 1.00 . A A .  33 ARG H    1 1 
        3  6312 1 1  33 ARG HA   H   4.283   4.097   0.469 1.00 . A A .  33 ARG HA   1 1 
        3  6313 1 1  33 ARG HB2  H   4.113   6.441  -1.476 1.00 . A A .  33 ARG HB2  1 1 
        3  6314 1 1  33 ARG HB3  H   5.093   5.029  -1.844 1.00 . A A .  33 ARG HB3  1 1 
        3  6315 1 1  33 ARG HD2  H   1.634   5.284  -0.330 1.00 . A A .  33 ARG HD2  1 1 
        3  6316 1 1  33 ARG HD3  H   1.492   6.212  -1.826 1.00 . A A .  33 ARG HD3  1 1 
        3  6317 1 1  33 ARG HE   H   0.521   4.119  -2.788 1.00 . A A .  33 ARG HE   1 1 
        3  6318 1 1  33 ARG HG2  H   3.021   4.749  -2.966 1.00 . A A .  33 ARG HG2  1 1 
        3  6319 1 1  33 ARG HG3  H   3.035   3.605  -1.626 1.00 . A A .  33 ARG HG3  1 1 
        3  6320 1 1  33 ARG HH11 H   0.232   4.760   0.640 1.00 . A A .  33 ARG HH11 1 1 
        3  6321 1 1  33 ARG HH12 H  -1.214   3.821   0.803 1.00 . A A .  33 ARG HH12 1 1 
        3  6322 1 1  33 ARG HH21 H  -1.342   2.895  -2.569 1.00 . A A .  33 ARG HH21 1 1 
        3  6323 1 1  33 ARG HH22 H  -2.112   2.756  -1.027 1.00 . A A .  33 ARG HH22 1 1 
        3  6324 1 1  33 ARG N    N   3.570   5.967   1.076 1.00 . A A .  33 ARG N    1 1 
        3  6325 1 1  33 ARG NE   N   0.527   4.365  -1.846 1.00 . A A .  33 ARG NE   1 1 
        3  6326 1 1  33 ARG NH1  N  -0.480   4.181   0.229 1.00 . A A .  33 ARG NH1  1 1 
        3  6327 1 1  33 ARG NH2  N  -1.374   3.119  -1.594 1.00 . A A .  33 ARG NH2  1 1 
        3  6328 1 1  33 ARG O    O   6.840   4.819   0.020 1.00 . A A .  33 ARG O    1 1 
        3  6329 1 1  34 TYR C    C   8.008   5.399   2.707 1.00 . A A .  34 TYR C    1 1 
        3  6330 1 1  34 TYR CA   C   7.463   6.714   2.100 1.00 . A A .  34 TYR CA   1 1 
        3  6331 1 1  34 TYR CB   C   7.365   7.829   3.190 1.00 . A A .  34 TYR CB   1 1 
        3  6332 1 1  34 TYR CD1  C   8.591   9.782   2.144 1.00 . A A .  34 TYR CD1  1 1 
        3  6333 1 1  34 TYR CD2  C   6.244  10.054   2.547 1.00 . A A .  34 TYR CD2  1 1 
        3  6334 1 1  34 TYR CE1  C   8.651  11.052   1.620 1.00 . A A .  34 TYR CE1  1 1 
        3  6335 1 1  34 TYR CE2  C   6.303  11.330   2.019 1.00 . A A .  34 TYR CE2  1 1 
        3  6336 1 1  34 TYR CG   C   7.394   9.250   2.617 1.00 . A A .  34 TYR CG   1 1 
        3  6337 1 1  34 TYR CZ   C   7.512  11.824   1.558 1.00 . A A .  34 TYR CZ   1 1 
        3  6338 1 1  34 TYR H    H   5.421   7.087   1.661 1.00 . A A .  34 TYR H    1 1 
        3  6339 1 1  34 TYR HA   H   8.135   7.048   1.315 1.00 . A A .  34 TYR HA   1 1 
        3  6340 1 1  34 TYR HB2  H   6.441   7.703   3.740 1.00 . A A .  34 TYR HB2  1 1 
        3  6341 1 1  34 TYR HB3  H   8.195   7.737   3.886 1.00 . A A .  34 TYR HB3  1 1 
        3  6342 1 1  34 TYR HD1  H   9.490   9.180   2.187 1.00 . A A .  34 TYR HD1  1 1 
        3  6343 1 1  34 TYR HD2  H   5.303   9.662   2.911 1.00 . A A .  34 TYR HD2  1 1 
        3  6344 1 1  34 TYR HE1  H   9.591  11.443   1.257 1.00 . A A .  34 TYR HE1  1 1 
        3  6345 1 1  34 TYR HE2  H   5.409  11.938   1.970 1.00 . A A .  34 TYR HE2  1 1 
        3  6346 1 1  34 TYR HH   H   7.154  13.713   1.604 1.00 . A A .  34 TYR HH   1 1 
        3  6347 1 1  34 TYR N    N   6.153   6.470   1.469 1.00 . A A .  34 TYR N    1 1 
        3  6348 1 1  34 TYR O    O   7.322   4.794   3.549 1.00 . A A .  34 TYR O    1 1 
        3  6349 1 1  34 TYR OH   O   7.583  13.093   1.013 1.00 . A A .  34 TYR OH   1 1 
        3  6350 1 1  35 PRO C    C   9.834   3.534   4.242 1.00 . A A .  35 PRO C    1 1 
        3  6351 1 1  35 PRO CA   C   9.817   3.648   2.707 1.00 . A A .  35 PRO CA   1 1 
        3  6352 1 1  35 PRO CB   C  11.247   3.691   2.121 1.00 . A A .  35 PRO CB   1 1 
        3  6353 1 1  35 PRO CD   C  10.109   5.607   1.254 1.00 . A A .  35 PRO CD   1 1 
        3  6354 1 1  35 PRO CG   C  11.132   4.549   0.896 1.00 . A A .  35 PRO CG   1 1 
        3  6355 1 1  35 PRO HA   H   9.270   2.806   2.287 1.00 . A A .  35 PRO HA   1 1 
        3  6356 1 1  35 PRO HB2  H  11.941   4.131   2.842 1.00 . A A .  35 PRO HB2  1 1 
        3  6357 1 1  35 PRO HB3  H  11.584   2.696   1.858 1.00 . A A .  35 PRO HB3  1 1 
        3  6358 1 1  35 PRO HD2  H  10.592   6.470   1.707 1.00 . A A .  35 PRO HD2  1 1 
        3  6359 1 1  35 PRO HD3  H   9.548   5.912   0.375 1.00 . A A .  35 PRO HD3  1 1 
        3  6360 1 1  35 PRO HG2  H  12.101   4.998   0.666 1.00 . A A .  35 PRO HG2  1 1 
        3  6361 1 1  35 PRO HG3  H  10.787   3.960   0.054 1.00 . A A .  35 PRO HG3  1 1 
        3  6362 1 1  35 PRO N    N   9.224   4.924   2.251 1.00 . A A .  35 PRO N    1 1 
        3  6363 1 1  35 PRO O    O  10.103   4.534   4.926 1.00 . A A .  35 PRO O    1 1 
        3  6364 1 1  36 SER C    C  10.146   2.764   7.143 1.00 . A A .  36 SER C    1 1 
        3  6365 1 1  36 SER CA   C   9.266   1.988   6.140 1.00 . A A .  36 SER CA   1 1 
        3  6366 1 1  36 SER CB   C   9.371   0.454   6.352 1.00 . A A .  36 SER CB   1 1 
        3  6367 1 1  36 SER H    H   9.487   1.576   4.082 1.00 . A A .  36 SER H    1 1 
        3  6368 1 1  36 SER HA   H   8.231   2.276   6.307 1.00 . A A .  36 SER HA   1 1 
        3  6369 1 1  36 SER HB2  H   9.356   0.224   7.408 1.00 . A A .  36 SER HB2  1 1 
        3  6370 1 1  36 SER HB3  H   8.528  -0.040   5.876 1.00 . A A .  36 SER HB3  1 1 
        3  6371 1 1  36 SER HG   H  11.104  -0.456   6.490 1.00 . A A .  36 SER HG   1 1 
        3  6372 1 1  36 SER N    N   9.560   2.305   4.728 1.00 . A A .  36 SER N    1 1 
        3  6373 1 1  36 SER O    O   9.606   3.432   8.006 1.00 . A A .  36 SER O    1 1 
        3  6374 1 1  36 SER OG   O  10.569  -0.068   5.791 1.00 . A A .  36 SER OG   1 1 
        3  6375 1 1  37 SER C    C  12.105   4.917   8.104 1.00 . A A .  37 SER C    1 1 
        3  6376 1 1  37 SER CA   C  12.471   3.432   7.808 1.00 . A A .  37 SER CA   1 1 
        3  6377 1 1  37 SER CB   C  13.863   3.370   7.130 1.00 . A A .  37 SER CB   1 1 
        3  6378 1 1  37 SER H    H  11.819   2.270   6.146 1.00 . A A .  37 SER H    1 1 
        3  6379 1 1  37 SER HA   H  12.509   2.872   8.733 1.00 . A A .  37 SER HA   1 1 
        3  6380 1 1  37 SER HB2  H  13.911   4.086   6.318 1.00 . A A .  37 SER HB2  1 1 
        3  6381 1 1  37 SER HB3  H  14.637   3.602   7.855 1.00 . A A .  37 SER HB3  1 1 
        3  6382 1 1  37 SER HG   H  13.664   1.426   7.133 1.00 . A A .  37 SER HG   1 1 
        3  6383 1 1  37 SER N    N  11.478   2.758   6.928 1.00 . A A .  37 SER N    1 1 
        3  6384 1 1  37 SER O    O  12.029   5.334   9.276 1.00 . A A .  37 SER O    1 1 
        3  6385 1 1  37 SER OG   O  14.119   2.084   6.598 1.00 . A A .  37 SER OG   1 1 
        3  6386 1 1  38 ASN C    C  10.258   7.347   7.880 1.00 . A A .  38 ASN C    1 1 
        3  6387 1 1  38 ASN CA   C  11.517   7.111   7.043 1.00 . A A .  38 ASN CA   1 1 
        3  6388 1 1  38 ASN CB   C  11.332   7.653   5.587 1.00 . A A .  38 ASN CB   1 1 
        3  6389 1 1  38 ASN CG   C  11.107   9.177   5.469 1.00 . A A .  38 ASN CG   1 1 
        3  6390 1 1  38 ASN H    H  11.821   5.218   6.134 1.00 . A A .  38 ASN H    1 1 
        3  6391 1 1  38 ASN HA   H  12.357   7.622   7.504 1.00 . A A .  38 ASN HA   1 1 
        3  6392 1 1  38 ASN HB2  H  12.212   7.409   5.012 1.00 . A A .  38 ASN HB2  1 1 
        3  6393 1 1  38 ASN HB3  H  10.484   7.150   5.130 1.00 . A A .  38 ASN HB3  1 1 
        3  6394 1 1  38 ASN HD21 H  12.031   9.217   3.709 1.00 . A A .  38 ASN HD21 1 1 
        3  6395 1 1  38 ASN HD22 H  11.432  10.736   4.274 1.00 . A A .  38 ASN HD22 1 1 
        3  6396 1 1  38 ASN N    N  11.831   5.669   7.009 1.00 . A A .  38 ASN N    1 1 
        3  6397 1 1  38 ASN ND2  N  11.571   9.768   4.375 1.00 . A A .  38 ASN ND2  1 1 
        3  6398 1 1  38 ASN O    O  10.329   7.962   8.939 1.00 . A A .  38 ASN O    1 1 
        3  6399 1 1  38 ASN OD1  O  10.511   9.825   6.332 1.00 . A A .  38 ASN OD1  1 1 
        3  6400 1 1  39 MET C    C   7.802   6.464   9.505 1.00 . A A .  39 MET C    1 1 
        3  6401 1 1  39 MET CA   C   7.808   6.977   8.038 1.00 . A A .  39 MET CA   1 1 
        3  6402 1 1  39 MET CB   C   6.680   6.288   7.220 1.00 . A A .  39 MET CB   1 1 
        3  6403 1 1  39 MET CE   C   4.085   4.850   8.316 1.00 . A A .  39 MET CE   1 1 
        3  6404 1 1  39 MET CG   C   6.669   4.749   7.263 1.00 . A A .  39 MET CG   1 1 
        3  6405 1 1  39 MET H    H   9.203   6.253   6.580 1.00 . A A .  39 MET H    1 1 
        3  6406 1 1  39 MET HA   H   7.615   8.050   8.051 1.00 . A A .  39 MET HA   1 1 
        3  6407 1 1  39 MET HB2  H   5.730   6.639   7.598 1.00 . A A .  39 MET HB2  1 1 
        3  6408 1 1  39 MET HB3  H   6.765   6.598   6.184 1.00 . A A .  39 MET HB3  1 1 
        3  6409 1 1  39 MET HE1  H   3.063   4.502   8.290 1.00 . A A .  39 MET HE1  1 1 
        3  6410 1 1  39 MET HE2  H   4.104   5.922   8.186 1.00 . A A .  39 MET HE2  1 1 
        3  6411 1 1  39 MET HE3  H   4.527   4.597   9.273 1.00 . A A .  39 MET HE3  1 1 
        3  6412 1 1  39 MET HG2  H   7.330   4.366   6.495 1.00 . A A .  39 MET HG2  1 1 
        3  6413 1 1  39 MET HG3  H   7.021   4.412   8.231 1.00 . A A .  39 MET HG3  1 1 
        3  6414 1 1  39 MET N    N   9.128   6.787   7.401 1.00 . A A .  39 MET N    1 1 
        3  6415 1 1  39 MET O    O   7.119   7.031  10.368 1.00 . A A .  39 MET O    1 1 
        3  6416 1 1  39 MET SD   S   5.019   4.063   6.992 1.00 . A A .  39 MET SD   1 1 
        3  6417 1 1  40 LEU C    C   9.327   5.792  12.093 1.00 . A A .  40 LEU C    1 1 
        3  6418 1 1  40 LEU CA   C   8.765   4.786  11.079 1.00 . A A .  40 LEU CA   1 1 
        3  6419 1 1  40 LEU CB   C   9.702   3.545  10.960 1.00 . A A .  40 LEU CB   1 1 
        3  6420 1 1  40 LEU CD1  C   8.318   1.862  12.284 1.00 . A A .  40 LEU CD1  1 1 
        3  6421 1 1  40 LEU CD2  C  10.813   1.466  11.951 1.00 . A A .  40 LEU CD2  1 1 
        3  6422 1 1  40 LEU CG   C   9.700   2.525  12.129 1.00 . A A .  40 LEU CG   1 1 
        3  6423 1 1  40 LEU H    H   9.260   5.176   9.052 1.00 . A A .  40 LEU H    1 1 
        3  6424 1 1  40 LEU HA   H   7.773   4.466  11.391 1.00 . A A .  40 LEU HA   1 1 
        3  6425 1 1  40 LEU HB2  H   9.429   3.006  10.059 1.00 . A A .  40 LEU HB2  1 1 
        3  6426 1 1  40 LEU HB3  H  10.721   3.905  10.828 1.00 . A A .  40 LEU HB3  1 1 
        3  6427 1 1  40 LEU HD11 H   7.573   2.622  12.487 1.00 . A A .  40 LEU HD11 1 1 
        3  6428 1 1  40 LEU HD12 H   8.339   1.164  13.109 1.00 . A A .  40 LEU HD12 1 1 
        3  6429 1 1  40 LEU HD13 H   8.052   1.337  11.375 1.00 . A A .  40 LEU HD13 1 1 
        3  6430 1 1  40 LEU HD21 H  11.776   1.958  11.910 1.00 . A A .  40 LEU HD21 1 1 
        3  6431 1 1  40 LEU HD22 H  10.655   0.910  11.033 1.00 . A A .  40 LEU HD22 1 1 
        3  6432 1 1  40 LEU HD23 H  10.804   0.782  12.790 1.00 . A A .  40 LEU HD23 1 1 
        3  6433 1 1  40 LEU HG   H   9.903   3.054  13.050 1.00 . A A .  40 LEU HG   1 1 
        3  6434 1 1  40 LEU N    N   8.650   5.446   9.768 1.00 . A A .  40 LEU N    1 1 
        3  6435 1 1  40 LEU O    O   8.640   6.188  13.043 1.00 . A A .  40 LEU O    1 1 
        3  6436 1 1  41 LYS C    C  10.718   8.574  12.779 1.00 . A A .  41 LYS C    1 1 
        3  6437 1 1  41 LYS CA   C  11.300   7.152  12.724 1.00 . A A .  41 LYS CA   1 1 
        3  6438 1 1  41 LYS CB   C  12.801   7.193  12.330 1.00 . A A .  41 LYS CB   1 1 
        3  6439 1 1  41 LYS CD   C  13.255   5.047  13.683 1.00 . A A .  41 LYS CD   1 1 
        3  6440 1 1  41 LYS CE   C  14.150   3.818  13.844 1.00 . A A .  41 LYS CE   1 1 
        3  6441 1 1  41 LYS CG   C  13.503   5.813  12.358 1.00 . A A .  41 LYS CG   1 1 
        3  6442 1 1  41 LYS H    H  10.968   6.025  10.940 1.00 . A A .  41 LYS H    1 1 
        3  6443 1 1  41 LYS HA   H  11.219   6.714  13.720 1.00 . A A .  41 LYS HA   1 1 
        3  6444 1 1  41 LYS HB2  H  12.894   7.599  11.325 1.00 . A A .  41 LYS HB2  1 1 
        3  6445 1 1  41 LYS HB3  H  13.328   7.850  13.016 1.00 . A A .  41 LYS HB3  1 1 
        3  6446 1 1  41 LYS HD2  H  13.440   5.716  14.519 1.00 . A A .  41 LYS HD2  1 1 
        3  6447 1 1  41 LYS HD3  H  12.216   4.731  13.711 1.00 . A A .  41 LYS HD3  1 1 
        3  6448 1 1  41 LYS HE2  H  13.835   3.264  14.719 1.00 . A A .  41 LYS HE2  1 1 
        3  6449 1 1  41 LYS HE3  H  14.055   3.185  12.970 1.00 . A A .  41 LYS HE3  1 1 
        3  6450 1 1  41 LYS HG2  H  13.127   5.216  11.534 1.00 . A A .  41 LYS HG2  1 1 
        3  6451 1 1  41 LYS HG3  H  14.570   5.962  12.227 1.00 . A A .  41 LYS HG3  1 1 
        3  6452 1 1  41 LYS HZ1  H  15.687   4.855  14.809 1.00 . A A .  41 LYS HZ1  1 1 
        3  6453 1 1  41 LYS HZ2  H  15.933   4.654  13.148 1.00 . A A .  41 LYS HZ2  1 1 
        3  6454 1 1  41 LYS HZ3  H  16.150   3.350  14.197 1.00 . A A .  41 LYS HZ3  1 1 
        3  6455 1 1  41 LYS N    N  10.553   6.274  11.805 1.00 . A A .  41 LYS N    1 1 
        3  6456 1 1  41 LYS NZ   N  15.578   4.197  14.009 1.00 . A A .  41 LYS NZ   1 1 
        3  6457 1 1  41 LYS O    O  10.808   9.240  13.817 1.00 . A A .  41 LYS O    1 1 
        3  6458 1 1  42 THR C    C   8.222  10.444  12.352 1.00 . A A .  42 THR C    1 1 
        3  6459 1 1  42 THR CA   C   9.545  10.380  11.569 1.00 . A A .  42 THR CA   1 1 
        3  6460 1 1  42 THR CB   C   9.312  10.807  10.077 1.00 . A A .  42 THR CB   1 1 
        3  6461 1 1  42 THR CG2  C   8.761  12.241   9.948 1.00 . A A .  42 THR CG2  1 1 
        3  6462 1 1  42 THR H    H  10.088   8.455  10.879 1.00 . A A .  42 THR H    1 1 
        3  6463 1 1  42 THR HA   H  10.256  11.082  12.010 1.00 . A A .  42 THR HA   1 1 
        3  6464 1 1  42 THR HB   H   8.600  10.121   9.627 1.00 . A A .  42 THR HB   1 1 
        3  6465 1 1  42 THR HG1  H  10.451  10.102   8.625 1.00 . A A .  42 THR HG1  1 1 
        3  6466 1 1  42 THR HG21 H   7.802  12.319  10.455 1.00 . A A .  42 THR HG21 1 1 
        3  6467 1 1  42 THR HG22 H   8.628  12.489   8.900 1.00 . A A .  42 THR HG22 1 1 
        3  6468 1 1  42 THR HG23 H   9.453  12.942  10.393 1.00 . A A .  42 THR HG23 1 1 
        3  6469 1 1  42 THR N    N  10.132   9.035  11.660 1.00 . A A .  42 THR N    1 1 
        3  6470 1 1  42 THR O    O   8.084  11.260  13.274 1.00 . A A .  42 THR O    1 1 
        3  6471 1 1  42 THR OG1  O  10.553  10.720   9.358 1.00 . A A .  42 THR OG1  1 1 
        3  6472 1 1  43 TYR C    C   5.832   9.021  13.969 1.00 . A A .  43 TYR C    1 1 
        3  6473 1 1  43 TYR CA   C   5.909   9.621  12.551 1.00 . A A .  43 TYR CA   1 1 
        3  6474 1 1  43 TYR CB   C   4.897   8.942  11.597 1.00 . A A .  43 TYR CB   1 1 
        3  6475 1 1  43 TYR CD1  C   5.145  10.861   9.894 1.00 . A A .  43 TYR CD1  1 1 
        3  6476 1 1  43 TYR CD2  C   4.528   8.705   9.068 1.00 . A A .  43 TYR CD2  1 1 
        3  6477 1 1  43 TYR CE1  C   5.107  11.366   8.606 1.00 . A A .  43 TYR CE1  1 1 
        3  6478 1 1  43 TYR CE2  C   4.491   9.210   7.778 1.00 . A A .  43 TYR CE2  1 1 
        3  6479 1 1  43 TYR CG   C   4.858   9.518  10.160 1.00 . A A .  43 TYR CG   1 1 
        3  6480 1 1  43 TYR CZ   C   4.780  10.537   7.552 1.00 . A A .  43 TYR CZ   1 1 
        3  6481 1 1  43 TYR H    H   7.506   8.822  11.389 1.00 . A A .  43 TYR H    1 1 
        3  6482 1 1  43 TYR HA   H   5.646  10.679  12.619 1.00 . A A .  43 TYR HA   1 1 
        3  6483 1 1  43 TYR HB2  H   5.135   7.884  11.530 1.00 . A A .  43 TYR HB2  1 1 
        3  6484 1 1  43 TYR HB3  H   3.900   9.042  12.012 1.00 . A A .  43 TYR HB3  1 1 
        3  6485 1 1  43 TYR HD1  H   5.410  11.515  10.716 1.00 . A A .  43 TYR HD1  1 1 
        3  6486 1 1  43 TYR HD2  H   4.301   7.660   9.239 1.00 . A A .  43 TYR HD2  1 1 
        3  6487 1 1  43 TYR HE1  H   5.334  12.409   8.429 1.00 . A A .  43 TYR HE1  1 1 
        3  6488 1 1  43 TYR HE2  H   4.232   8.558   6.951 1.00 . A A .  43 TYR HE2  1 1 
        3  6489 1 1  43 TYR HH   H   4.027  10.639   5.774 1.00 . A A .  43 TYR HH   1 1 
        3  6490 1 1  43 TYR N    N   7.276   9.547  12.010 1.00 . A A .  43 TYR N    1 1 
        3  6491 1 1  43 TYR O    O   5.241   9.637  14.866 1.00 . A A .  43 TYR O    1 1 
        3  6492 1 1  43 TYR OH   O   4.747  11.046   6.266 1.00 . A A .  43 TYR OH   1 1 
        3  6493 1 1  44 PHE C    C   7.498   7.756  16.417 1.00 . A A .  44 PHE C    1 1 
        3  6494 1 1  44 PHE CA   C   6.412   7.165  15.499 1.00 . A A .  44 PHE CA   1 1 
        3  6495 1 1  44 PHE CB   C   6.554   5.627  15.371 1.00 . A A .  44 PHE CB   1 1 
        3  6496 1 1  44 PHE CD1  C   4.132   4.956  15.140 1.00 . A A .  44 PHE CD1  1 1 
        3  6497 1 1  44 PHE CD2  C   5.616   4.421  13.342 1.00 . A A .  44 PHE CD2  1 1 
        3  6498 1 1  44 PHE CE1  C   3.086   4.398  14.446 1.00 . A A .  44 PHE CE1  1 1 
        3  6499 1 1  44 PHE CE2  C   4.567   3.868  12.643 1.00 . A A .  44 PHE CE2  1 1 
        3  6500 1 1  44 PHE CG   C   5.417   4.975  14.604 1.00 . A A .  44 PHE CG   1 1 
        3  6501 1 1  44 PHE CZ   C   3.304   3.857  13.193 1.00 . A A .  44 PHE CZ   1 1 
        3  6502 1 1  44 PHE H    H   6.944   7.403  13.436 1.00 . A A .  44 PHE H    1 1 
        3  6503 1 1  44 PHE HA   H   5.440   7.379  15.952 1.00 . A A .  44 PHE HA   1 1 
        3  6504 1 1  44 PHE HB2  H   7.485   5.397  14.870 1.00 . A A .  44 PHE HB2  1 1 
        3  6505 1 1  44 PHE HB3  H   6.579   5.188  16.363 1.00 . A A .  44 PHE HB3  1 1 
        3  6506 1 1  44 PHE HD1  H   3.957   5.373  16.123 1.00 . A A .  44 PHE HD1  1 1 
        3  6507 1 1  44 PHE HD2  H   6.611   4.420  12.914 1.00 . A A .  44 PHE HD2  1 1 
        3  6508 1 1  44 PHE HE1  H   2.090   4.391  14.880 1.00 . A A .  44 PHE HE1  1 1 
        3  6509 1 1  44 PHE HE2  H   4.736   3.439  11.661 1.00 . A A .  44 PHE HE2  1 1 
        3  6510 1 1  44 PHE HZ   H   2.482   3.427  12.639 1.00 . A A .  44 PHE HZ   1 1 
        3  6511 1 1  44 PHE N    N   6.443   7.831  14.179 1.00 . A A .  44 PHE N    1 1 
        3  6512 1 1  44 PHE O    O   8.635   7.273  16.456 1.00 . A A .  44 PHE O    1 1 
        3  6513 1 1  45 SER C    C   7.930   8.965  19.470 1.00 . A A .  45 SER C    1 1 
        3  6514 1 1  45 SER CA   C   8.007   9.563  18.050 1.00 . A A .  45 SER CA   1 1 
        3  6515 1 1  45 SER CB   C   7.588  11.048  18.046 1.00 . A A .  45 SER CB   1 1 
        3  6516 1 1  45 SER H    H   6.190   9.104  17.093 1.00 . A A .  45 SER H    1 1 
        3  6517 1 1  45 SER HA   H   9.029   9.485  17.686 1.00 . A A .  45 SER HA   1 1 
        3  6518 1 1  45 SER HB2  H   6.587  11.156  18.455 1.00 . A A .  45 SER HB2  1 1 
        3  6519 1 1  45 SER HB3  H   8.282  11.626  18.643 1.00 . A A .  45 SER HB3  1 1 
        3  6520 1 1  45 SER HG   H   6.788  11.290  16.261 1.00 . A A .  45 SER HG   1 1 
        3  6521 1 1  45 SER N    N   7.122   8.827  17.132 1.00 . A A .  45 SER N    1 1 
        3  6522 1 1  45 SER O    O   8.936   8.906  20.182 1.00 . A A .  45 SER O    1 1 
        3  6523 1 1  45 SER OG   O   7.591  11.567  16.723 1.00 . A A .  45 SER OG   1 1 
        3  6524 1 1  46 ASP C    C   7.106   6.521  21.261 1.00 . A A .  46 ASP C    1 1 
        3  6525 1 1  46 ASP CA   C   6.425   7.888  21.161 1.00 . A A .  46 ASP CA   1 1 
        3  6526 1 1  46 ASP CB   C   4.895   7.703  21.362 1.00 . A A .  46 ASP CB   1 1 
        3  6527 1 1  46 ASP CG   C   4.131   9.027  21.490 1.00 . A A .  46 ASP CG   1 1 
        3  6528 1 1  46 ASP H    H   5.958   8.658  19.238 1.00 . A A .  46 ASP H    1 1 
        3  6529 1 1  46 ASP HA   H   6.809   8.537  21.944 1.00 . A A .  46 ASP HA   1 1 
        3  6530 1 1  46 ASP HB2  H   4.487   7.149  20.518 1.00 . A A .  46 ASP HB2  1 1 
        3  6531 1 1  46 ASP HB3  H   4.718   7.119  22.263 1.00 . A A .  46 ASP HB3  1 1 
        3  6532 1 1  46 ASP N    N   6.705   8.532  19.856 1.00 . A A .  46 ASP N    1 1 
        3  6533 1 1  46 ASP O    O   7.626   6.146  22.320 1.00 . A A .  46 ASP O    1 1 
        3  6534 1 1  46 ASP OD1  O   3.698   9.587  20.460 1.00 . A A .  46 ASP OD1  1 1 
        3  6535 1 1  46 ASP OD2  O   3.957   9.514  22.622 1.00 . A A .  46 ASP OD2  1 1 
        3  6536 1 1  47 VAL C    C   9.075   4.401  20.144 1.00 . A A .  47 VAL C    1 1 
        3  6537 1 1  47 VAL CA   C   7.547   4.411  20.072 1.00 . A A .  47 VAL CA   1 1 
        3  6538 1 1  47 VAL CB   C   7.021   3.730  18.748 1.00 . A A .  47 VAL CB   1 1 
        3  6539 1 1  47 VAL CG1  C   7.421   2.239  18.648 1.00 . A A .  47 VAL CG1  1 1 
        3  6540 1 1  47 VAL CG2  C   5.486   3.913  18.617 1.00 . A A .  47 VAL CG2  1 1 
        3  6541 1 1  47 VAL H    H   6.829   6.238  19.309 1.00 . A A .  47 VAL H    1 1 
        3  6542 1 1  47 VAL HA   H   7.136   3.871  20.930 1.00 . A A .  47 VAL HA   1 1 
        3  6543 1 1  47 VAL HB   H   7.481   4.249  17.906 1.00 . A A .  47 VAL HB   1 1 
        3  6544 1 1  47 VAL HG11 H   6.970   1.678  19.456 1.00 . A A .  47 VAL HG11 1 1 
        3  6545 1 1  47 VAL HG12 H   8.500   2.145  18.706 1.00 . A A .  47 VAL HG12 1 1 
        3  6546 1 1  47 VAL HG13 H   7.085   1.837  17.698 1.00 . A A .  47 VAL HG13 1 1 
        3  6547 1 1  47 VAL HG21 H   5.243   4.971  18.622 1.00 . A A .  47 VAL HG21 1 1 
        3  6548 1 1  47 VAL HG22 H   4.987   3.429  19.446 1.00 . A A .  47 VAL HG22 1 1 
        3  6549 1 1  47 VAL HG23 H   5.141   3.478  17.687 1.00 . A A .  47 VAL HG23 1 1 
        3  6550 1 1  47 VAL N    N   7.097   5.798  20.138 1.00 . A A .  47 VAL N    1 1 
        3  6551 1 1  47 VAL O    O   9.725   4.841  19.204 1.00 . A A .  47 VAL O    1 1 
        3  6552 1 1  48 LYS C    C  11.757   2.870  20.611 1.00 . A A .  48 LYS C    1 1 
        3  6553 1 1  48 LYS CA   C  11.095   3.927  21.515 1.00 . A A .  48 LYS CA   1 1 
        3  6554 1 1  48 LYS CB   C  11.410   3.618  23.008 1.00 . A A .  48 LYS CB   1 1 
        3  6555 1 1  48 LYS CD   C  11.290   6.059  23.861 1.00 . A A .  48 LYS CD   1 1 
        3  6556 1 1  48 LYS CE   C  12.803   6.212  24.119 1.00 . A A .  48 LYS CE   1 1 
        3  6557 1 1  48 LYS CG   C  10.790   4.605  24.025 1.00 . A A .  48 LYS CG   1 1 
        3  6558 1 1  48 LYS H    H   9.039   3.733  22.038 1.00 . A A .  48 LYS H    1 1 
        3  6559 1 1  48 LYS HA   H  11.503   4.904  21.267 1.00 . A A .  48 LYS HA   1 1 
        3  6560 1 1  48 LYS HB2  H  11.042   2.624  23.243 1.00 . A A .  48 LYS HB2  1 1 
        3  6561 1 1  48 LYS HB3  H  12.486   3.624  23.145 1.00 . A A .  48 LYS HB3  1 1 
        3  6562 1 1  48 LYS HD2  H  11.070   6.399  22.855 1.00 . A A .  48 LYS HD2  1 1 
        3  6563 1 1  48 LYS HD3  H  10.751   6.684  24.565 1.00 . A A .  48 LYS HD3  1 1 
        3  6564 1 1  48 LYS HE2  H  13.019   5.929  25.144 1.00 . A A .  48 LYS HE2  1 1 
        3  6565 1 1  48 LYS HE3  H  13.345   5.557  23.450 1.00 . A A .  48 LYS HE3  1 1 
        3  6566 1 1  48 LYS HG2  H   9.713   4.596  23.901 1.00 . A A .  48 LYS HG2  1 1 
        3  6567 1 1  48 LYS HG3  H  11.029   4.265  25.026 1.00 . A A .  48 LYS HG3  1 1 
        3  6568 1 1  48 LYS HZ1  H  12.838   8.248  24.605 1.00 . A A .  48 LYS HZ1  1 1 
        3  6569 1 1  48 LYS HZ2  H  12.990   7.934  22.953 1.00 . A A .  48 LYS HZ2  1 1 
        3  6570 1 1  48 LYS HZ3  H  14.300   7.667  23.986 1.00 . A A .  48 LYS HZ3  1 1 
        3  6571 1 1  48 LYS N    N   9.631   3.986  21.296 1.00 . A A .  48 LYS N    1 1 
        3  6572 1 1  48 LYS NZ   N  13.267   7.612  23.902 1.00 . A A .  48 LYS NZ   1 1 
        3  6573 1 1  48 LYS O    O  12.954   2.955  20.325 1.00 . A A .  48 LYS O    1 1 
        3  6574 1 1  49 PHE C    C  12.049  -0.337  20.005 1.00 . A A .  49 PHE C    1 1 
        3  6575 1 1  49 PHE CA   C  11.296   0.788  19.282 1.00 . A A .  49 PHE CA   1 1 
        3  6576 1 1  49 PHE CB   C  12.055   1.282  17.994 1.00 . A A .  49 PHE CB   1 1 
        3  6577 1 1  49 PHE CD1  C  10.144   1.768  16.395 1.00 . A A .  49 PHE CD1  1 1 
        3  6578 1 1  49 PHE CD2  C  11.540   3.599  17.048 1.00 . A A .  49 PHE CD2  1 1 
        3  6579 1 1  49 PHE CE1  C   9.383   2.630  15.633 1.00 . A A .  49 PHE CE1  1 1 
        3  6580 1 1  49 PHE CE2  C  10.775   4.457  16.279 1.00 . A A .  49 PHE CE2  1 1 
        3  6581 1 1  49 PHE CG   C  11.236   2.237  17.121 1.00 . A A .  49 PHE CG   1 1 
        3  6582 1 1  49 PHE CZ   C   9.699   3.972  15.578 1.00 . A A .  49 PHE CZ   1 1 
        3  6583 1 1  49 PHE H    H  10.069   1.802  20.665 1.00 . A A .  49 PHE H    1 1 
        3  6584 1 1  49 PHE HA   H  10.348   0.368  18.962 1.00 . A A .  49 PHE HA   1 1 
        3  6585 1 1  49 PHE HB2  H  12.968   1.787  18.289 1.00 . A A .  49 PHE HB2  1 1 
        3  6586 1 1  49 PHE HB3  H  12.317   0.424  17.388 1.00 . A A .  49 PHE HB3  1 1 
        3  6587 1 1  49 PHE HD1  H   9.883   0.716  16.434 1.00 . A A .  49 PHE HD1  1 1 
        3  6588 1 1  49 PHE HD2  H  12.386   3.986  17.599 1.00 . A A .  49 PHE HD2  1 1 
        3  6589 1 1  49 PHE HE1  H   8.534   2.255  15.075 1.00 . A A .  49 PHE HE1  1 1 
        3  6590 1 1  49 PHE HE2  H  11.014   5.517  16.240 1.00 . A A .  49 PHE HE2  1 1 
        3  6591 1 1  49 PHE HZ   H   9.102   4.646  14.973 1.00 . A A .  49 PHE HZ   1 1 
        3  6592 1 1  49 PHE N    N  10.944   1.863  20.228 1.00 . A A .  49 PHE N    1 1 
        3  6593 1 1  49 PHE O    O  13.219  -0.599  19.749 1.00 . A A .  49 PHE O    1 1 
        3  6594 1 1  50 ASN C    C  11.670  -3.378  20.528 1.00 . A A .  50 ASN C    1 1 
        3  6595 1 1  50 ASN CA   C  11.789  -2.244  21.574 1.00 . A A .  50 ASN CA   1 1 
        3  6596 1 1  50 ASN CB   C  10.919  -2.541  22.829 1.00 . A A .  50 ASN CB   1 1 
        3  6597 1 1  50 ASN CG   C  11.346  -3.794  23.598 1.00 . A A .  50 ASN CG   1 1 
        3  6598 1 1  50 ASN H    H  10.489  -0.595  21.237 1.00 . A A .  50 ASN H    1 1 
        3  6599 1 1  50 ASN HA   H  12.830  -2.132  21.869 1.00 . A A .  50 ASN HA   1 1 
        3  6600 1 1  50 ASN HB2  H  10.988  -1.698  23.507 1.00 . A A .  50 ASN HB2  1 1 
        3  6601 1 1  50 ASN HB3  H   9.881  -2.656  22.525 1.00 . A A .  50 ASN HB3  1 1 
        3  6602 1 1  50 ASN HD21 H   9.489  -4.076  24.260 1.00 . A A .  50 ASN HD21 1 1 
        3  6603 1 1  50 ASN HD22 H  10.657  -5.241  24.772 1.00 . A A .  50 ASN HD22 1 1 
        3  6604 1 1  50 ASN N    N  11.343  -0.982  20.949 1.00 . A A .  50 ASN N    1 1 
        3  6605 1 1  50 ASN ND2  N  10.405  -4.436  24.279 1.00 . A A .  50 ASN ND2  1 1 
        3  6606 1 1  50 ASN O    O  10.692  -3.406  19.791 1.00 . A A .  50 ASN O    1 1 
        3  6607 1 1  50 ASN OD1  O  12.517  -4.177  23.591 1.00 . A A .  50 ASN OD1  1 1 
        3  6608 1 1  51 ARG C    C  11.529  -6.104  19.082 1.00 . A A .  51 ARG C    1 1 
        3  6609 1 1  51 ARG CA   C  12.812  -5.289  19.375 1.00 . A A .  51 ARG CA   1 1 
        3  6610 1 1  51 ARG CB   C  14.009  -6.242  19.665 1.00 . A A .  51 ARG CB   1 1 
        3  6611 1 1  51 ARG CD   C  14.606  -6.560  17.162 1.00 . A A .  51 ARG CD   1 1 
        3  6612 1 1  51 ARG CG   C  14.367  -7.242  18.527 1.00 . A A .  51 ARG CG   1 1 
        3  6613 1 1  51 ARG CZ   C  15.924  -4.634  16.253 1.00 . A A .  51 ARG CZ   1 1 
        3  6614 1 1  51 ARG H    H  13.297  -4.329  21.229 1.00 . A A .  51 ARG H    1 1 
        3  6615 1 1  51 ARG HA   H  13.051  -4.703  18.490 1.00 . A A .  51 ARG HA   1 1 
        3  6616 1 1  51 ARG HB2  H  14.890  -5.641  19.869 1.00 . A A .  51 ARG HB2  1 1 
        3  6617 1 1  51 ARG HB3  H  13.781  -6.817  20.558 1.00 . A A .  51 ARG HB3  1 1 
        3  6618 1 1  51 ARG HD2  H  14.997  -7.297  16.470 1.00 . A A .  51 ARG HD2  1 1 
        3  6619 1 1  51 ARG HD3  H  13.661  -6.185  16.788 1.00 . A A .  51 ARG HD3  1 1 
        3  6620 1 1  51 ARG HE   H  15.965  -5.286  18.142 1.00 . A A .  51 ARG HE   1 1 
        3  6621 1 1  51 ARG HG2  H  15.271  -7.773  18.806 1.00 . A A .  51 ARG HG2  1 1 
        3  6622 1 1  51 ARG HG3  H  13.558  -7.959  18.423 1.00 . A A .  51 ARG HG3  1 1 
        3  6623 1 1  51 ARG HH11 H  14.790  -5.534  14.820 1.00 . A A .  51 ARG HH11 1 1 
        3  6624 1 1  51 ARG HH12 H  15.731  -4.183  14.280 1.00 . A A .  51 ARG HH12 1 1 
        3  6625 1 1  51 ARG HH21 H  17.121  -3.501  17.430 1.00 . A A .  51 ARG HH21 1 1 
        3  6626 1 1  51 ARG HH22 H  17.054  -3.027  15.760 1.00 . A A .  51 ARG HH22 1 1 
        3  6627 1 1  51 ARG N    N  12.653  -4.305  20.487 1.00 . A A .  51 ARG N    1 1 
        3  6628 1 1  51 ARG NE   N  15.563  -5.444  17.258 1.00 . A A .  51 ARG NE   1 1 
        3  6629 1 1  51 ARG NH1  N  15.444  -4.800  15.018 1.00 . A A .  51 ARG NH1  1 1 
        3  6630 1 1  51 ARG NH2  N  16.770  -3.643  16.500 1.00 . A A .  51 ARG NH2  1 1 
        3  6631 1 1  51 ARG O    O  11.239  -6.389  17.918 1.00 . A A .  51 ARG O    1 1 
        3  6632 1 1  52 CYS C    C   8.457  -6.345  19.262 1.00 . A A .  52 CYS C    1 1 
        3  6633 1 1  52 CYS CA   C   9.502  -7.190  20.003 1.00 . A A .  52 CYS CA   1 1 
        3  6634 1 1  52 CYS CB   C   8.984  -7.638  21.389 1.00 . A A .  52 CYS CB   1 1 
        3  6635 1 1  52 CYS H    H  11.072  -6.194  21.039 1.00 . A A .  52 CYS H    1 1 
        3  6636 1 1  52 CYS HA   H   9.710  -8.079  19.414 1.00 . A A .  52 CYS HA   1 1 
        3  6637 1 1  52 CYS HB2  H   8.009  -8.102  21.284 1.00 . A A .  52 CYS HB2  1 1 
        3  6638 1 1  52 CYS HB3  H   9.671  -8.364  21.809 1.00 . A A .  52 CYS HB3  1 1 
        3  6639 1 1  52 CYS HG   H   7.526  -5.997  22.668 1.00 . A A .  52 CYS HG   1 1 
        3  6640 1 1  52 CYS N    N  10.769  -6.451  20.138 1.00 . A A .  52 CYS N    1 1 
        3  6641 1 1  52 CYS O    O   7.987  -6.742  18.200 1.00 . A A .  52 CYS O    1 1 
        3  6642 1 1  52 CYS SG   S   8.816  -6.301  22.588 1.00 . A A .  52 CYS SG   1 1 
        3  6643 1 1  53 ILE C    C   7.566  -3.722  17.817 1.00 . A A .  53 ILE C    1 1 
        3  6644 1 1  53 ILE CA   C   7.162  -4.222  19.220 1.00 . A A .  53 ILE CA   1 1 
        3  6645 1 1  53 ILE CB   C   6.848  -2.987  20.163 1.00 . A A .  53 ILE CB   1 1 
        3  6646 1 1  53 ILE CD1  C   7.706  -0.684  21.017 1.00 . A A .  53 ILE CD1  1 1 
        3  6647 1 1  53 ILE CG1  C   7.993  -1.926  20.182 1.00 . A A .  53 ILE CG1  1 1 
        3  6648 1 1  53 ILE CG2  C   6.542  -3.467  21.591 1.00 . A A .  53 ILE CG2  1 1 
        3  6649 1 1  53 ILE H    H   8.685  -4.835  20.580 1.00 . A A .  53 ILE H    1 1 
        3  6650 1 1  53 ILE HA   H   6.246  -4.804  19.123 1.00 . A A .  53 ILE HA   1 1 
        3  6651 1 1  53 ILE HB   H   5.948  -2.514  19.786 1.00 . A A .  53 ILE HB   1 1 
        3  6652 1 1  53 ILE HD11 H   6.840  -0.168  20.619 1.00 . A A .  53 ILE HD11 1 1 
        3  6653 1 1  53 ILE HD12 H   8.561  -0.024  20.978 1.00 . A A .  53 ILE HD12 1 1 
        3  6654 1 1  53 ILE HD13 H   7.517  -0.962  22.045 1.00 . A A .  53 ILE HD13 1 1 
        3  6655 1 1  53 ILE HG12 H   8.892  -2.376  20.580 1.00 . A A .  53 ILE HG12 1 1 
        3  6656 1 1  53 ILE HG13 H   8.190  -1.597  19.170 1.00 . A A .  53 ILE HG13 1 1 
        3  6657 1 1  53 ILE HG21 H   6.278  -2.622  22.220 1.00 . A A .  53 ILE HG21 1 1 
        3  6658 1 1  53 ILE HG22 H   7.413  -3.958  22.009 1.00 . A A .  53 ILE HG22 1 1 
        3  6659 1 1  53 ILE HG23 H   5.715  -4.167  21.575 1.00 . A A .  53 ILE HG23 1 1 
        3  6660 1 1  53 ILE N    N   8.186  -5.125  19.785 1.00 . A A .  53 ILE N    1 1 
        3  6661 1 1  53 ILE O    O   6.713  -3.444  16.989 1.00 . A A .  53 ILE O    1 1 
        3  6662 1 1  54 THR C    C   9.310  -4.323  15.252 1.00 . A A .  54 THR C    1 1 
        3  6663 1 1  54 THR CA   C   9.450  -3.201  16.283 1.00 . A A .  54 THR CA   1 1 
        3  6664 1 1  54 THR CB   C  10.949  -2.788  16.432 1.00 . A A .  54 THR CB   1 1 
        3  6665 1 1  54 THR CG2  C  11.532  -2.194  15.137 1.00 . A A .  54 THR CG2  1 1 
        3  6666 1 1  54 THR H    H   9.507  -3.889  18.281 1.00 . A A .  54 THR H    1 1 
        3  6667 1 1  54 THR HA   H   8.887  -2.330  15.950 1.00 . A A .  54 THR HA   1 1 
        3  6668 1 1  54 THR HB   H  11.533  -3.661  16.720 1.00 . A A .  54 THR HB   1 1 
        3  6669 1 1  54 THR HG1  H  10.402  -2.004  18.151 1.00 . A A .  54 THR HG1  1 1 
        3  6670 1 1  54 THR HG21 H  10.954  -1.327  14.845 1.00 . A A .  54 THR HG21 1 1 
        3  6671 1 1  54 THR HG22 H  11.491  -2.933  14.346 1.00 . A A .  54 THR HG22 1 1 
        3  6672 1 1  54 THR HG23 H  12.560  -1.901  15.297 1.00 . A A .  54 THR HG23 1 1 
        3  6673 1 1  54 THR N    N   8.888  -3.638  17.571 1.00 . A A .  54 THR N    1 1 
        3  6674 1 1  54 THR O    O   8.994  -4.065  14.099 1.00 . A A .  54 THR O    1 1 
        3  6675 1 1  54 THR OG1  O  11.055  -1.815  17.469 1.00 . A A .  54 THR OG1  1 1 
        3  6676 1 1  55 SER C    C   7.852  -6.882  14.443 1.00 . A A .  55 SER C    1 1 
        3  6677 1 1  55 SER CA   C   9.322  -6.773  14.872 1.00 . A A .  55 SER CA   1 1 
        3  6678 1 1  55 SER CB   C   9.750  -8.044  15.637 1.00 . A A .  55 SER CB   1 1 
        3  6679 1 1  55 SER H    H   9.819  -5.693  16.629 1.00 . A A .  55 SER H    1 1 
        3  6680 1 1  55 SER HA   H   9.944  -6.668  13.987 1.00 . A A .  55 SER HA   1 1 
        3  6681 1 1  55 SER HB2  H  10.812  -8.003  15.848 1.00 . A A .  55 SER HB2  1 1 
        3  6682 1 1  55 SER HB3  H   9.206  -8.107  16.576 1.00 . A A .  55 SER HB3  1 1 
        3  6683 1 1  55 SER HG   H   8.787  -9.721  15.306 1.00 . A A .  55 SER HG   1 1 
        3  6684 1 1  55 SER N    N   9.521  -5.574  15.703 1.00 . A A .  55 SER N    1 1 
        3  6685 1 1  55 SER O    O   7.568  -7.177  13.284 1.00 . A A .  55 SER O    1 1 
        3  6686 1 1  55 SER OG   O   9.491  -9.213  14.883 1.00 . A A .  55 SER OG   1 1 
        3  6687 1 1  56 GLN C    C   5.029  -5.507  14.234 1.00 . A A .  56 GLN C    1 1 
        3  6688 1 1  56 GLN CA   C   5.478  -6.657  15.160 1.00 . A A .  56 GLN CA   1 1 
        3  6689 1 1  56 GLN CB   C   4.706  -6.593  16.504 1.00 . A A .  56 GLN CB   1 1 
        3  6690 1 1  56 GLN CD   C   4.846  -9.146  16.967 1.00 . A A .  56 GLN CD   1 1 
        3  6691 1 1  56 GLN CG   C   5.059  -7.721  17.505 1.00 . A A .  56 GLN CG   1 1 
        3  6692 1 1  56 GLN H    H   7.251  -6.398  16.306 1.00 . A A .  56 GLN H    1 1 
        3  6693 1 1  56 GLN HA   H   5.254  -7.607  14.678 1.00 . A A .  56 GLN HA   1 1 
        3  6694 1 1  56 GLN HB2  H   4.917  -5.639  16.982 1.00 . A A .  56 GLN HB2  1 1 
        3  6695 1 1  56 GLN HB3  H   3.640  -6.643  16.299 1.00 . A A .  56 GLN HB3  1 1 
        3  6696 1 1  56 GLN HE21 H   6.362  -9.816  18.052 1.00 . A A .  56 GLN HE21 1 1 
        3  6697 1 1  56 GLN HE22 H   5.580 -10.989  17.054 1.00 . A A .  56 GLN HE22 1 1 
        3  6698 1 1  56 GLN HG2  H   6.095  -7.613  17.790 1.00 . A A .  56 GLN HG2  1 1 
        3  6699 1 1  56 GLN HG3  H   4.443  -7.599  18.390 1.00 . A A .  56 GLN HG3  1 1 
        3  6700 1 1  56 GLN N    N   6.933  -6.617  15.399 1.00 . A A .  56 GLN N    1 1 
        3  6701 1 1  56 GLN NE2  N   5.673 -10.078  17.407 1.00 . A A .  56 GLN NE2  1 1 
        3  6702 1 1  56 GLN O    O   4.234  -5.716  13.327 1.00 . A A .  56 GLN O    1 1 
        3  6703 1 1  56 GLN OE1  O   3.950  -9.412  16.162 1.00 . A A .  56 GLN OE1  1 1 
        3  6704 1 1  57 LEU C    C   5.669  -3.260  12.214 1.00 . A A .  57 LEU C    1 1 
        3  6705 1 1  57 LEU CA   C   5.231  -3.083  13.693 1.00 . A A .  57 LEU CA   1 1 
        3  6706 1 1  57 LEU CB   C   5.900  -1.833  14.368 1.00 . A A .  57 LEU CB   1 1 
        3  6707 1 1  57 LEU CD1  C   5.812   0.625  15.127 1.00 . A A .  57 LEU CD1  1 1 
        3  6708 1 1  57 LEU CD2  C   5.198   0.037  12.734 1.00 . A A .  57 LEU CD2  1 1 
        3  6709 1 1  57 LEU CG   C   5.189  -0.442  14.195 1.00 . A A .  57 LEU CG   1 1 
        3  6710 1 1  57 LEU H    H   6.218  -4.218  15.197 1.00 . A A .  57 LEU H    1 1 
        3  6711 1 1  57 LEU HA   H   4.154  -2.966  13.733 1.00 . A A .  57 LEU HA   1 1 
        3  6712 1 1  57 LEU HB2  H   5.966  -2.030  15.435 1.00 . A A .  57 LEU HB2  1 1 
        3  6713 1 1  57 LEU HB3  H   6.918  -1.741  13.996 1.00 . A A .  57 LEU HB3  1 1 
        3  6714 1 1  57 LEU HD11 H   5.684   0.318  16.156 1.00 . A A .  57 LEU HD11 1 1 
        3  6715 1 1  57 LEU HD12 H   5.315   1.574  14.977 1.00 . A A .  57 LEU HD12 1 1 
        3  6716 1 1  57 LEU HD13 H   6.869   0.733  14.914 1.00 . A A .  57 LEU HD13 1 1 
        3  6717 1 1  57 LEU HD21 H   4.652  -0.667  12.120 1.00 . A A .  57 LEU HD21 1 1 
        3  6718 1 1  57 LEU HD22 H   6.217   0.106  12.374 1.00 . A A .  57 LEU HD22 1 1 
        3  6719 1 1  57 LEU HD23 H   4.725   1.008  12.661 1.00 . A A .  57 LEU HD23 1 1 
        3  6720 1 1  57 LEU HG   H   4.150  -0.550  14.492 1.00 . A A .  57 LEU HG   1 1 
        3  6721 1 1  57 LEU N    N   5.573  -4.300  14.468 1.00 . A A .  57 LEU N    1 1 
        3  6722 1 1  57 LEU O    O   4.865  -3.085  11.272 1.00 . A A .  57 LEU O    1 1 
        3  6723 1 1  58 ILE C    C   6.806  -5.193  10.108 1.00 . A A .  58 ILE C    1 1 
        3  6724 1 1  58 ILE CA   C   7.533  -3.983  10.735 1.00 . A A .  58 ILE CA   1 1 
        3  6725 1 1  58 ILE CB   C   9.096  -4.246  10.839 1.00 . A A .  58 ILE CB   1 1 
        3  6726 1 1  58 ILE CD1  C  11.357  -3.119  11.470 1.00 . A A .  58 ILE CD1  1 1 
        3  6727 1 1  58 ILE CG1  C   9.854  -2.948  11.289 1.00 . A A .  58 ILE CG1  1 1 
        3  6728 1 1  58 ILE CG2  C   9.687  -4.782   9.511 1.00 . A A .  58 ILE CG2  1 1 
        3  6729 1 1  58 ILE H    H   7.508  -3.752  12.836 1.00 . A A .  58 ILE H    1 1 
        3  6730 1 1  58 ILE HA   H   7.379  -3.115  10.092 1.00 . A A .  58 ILE HA   1 1 
        3  6731 1 1  58 ILE HB   H   9.250  -5.013  11.594 1.00 . A A .  58 ILE HB   1 1 
        3  6732 1 1  58 ILE HD11 H  11.788  -2.186  11.807 1.00 . A A .  58 ILE HD11 1 1 
        3  6733 1 1  58 ILE HD12 H  11.810  -3.405  10.530 1.00 . A A .  58 ILE HD12 1 1 
        3  6734 1 1  58 ILE HD13 H  11.546  -3.885  12.207 1.00 . A A .  58 ILE HD13 1 1 
        3  6735 1 1  58 ILE HG12 H   9.706  -2.172  10.551 1.00 . A A .  58 ILE HG12 1 1 
        3  6736 1 1  58 ILE HG13 H   9.451  -2.609  12.237 1.00 . A A .  58 ILE HG13 1 1 
        3  6737 1 1  58 ILE HG21 H  10.748  -4.974   9.626 1.00 . A A .  58 ILE HG21 1 1 
        3  6738 1 1  58 ILE HG22 H   9.543  -4.051   8.728 1.00 . A A .  58 ILE HG22 1 1 
        3  6739 1 1  58 ILE HG23 H   9.186  -5.703   9.231 1.00 . A A .  58 ILE HG23 1 1 
        3  6740 1 1  58 ILE N    N   6.946  -3.662  12.043 1.00 . A A .  58 ILE N    1 1 
        3  6741 1 1  58 ILE O    O   6.675  -5.250   8.898 1.00 . A A .  58 ILE O    1 1 
        3  6742 1 1  59 LYS C    C   4.229  -6.783   9.765 1.00 . A A .  59 LYS C    1 1 
        3  6743 1 1  59 LYS CA   C   5.496  -7.282  10.482 1.00 . A A .  59 LYS CA   1 1 
        3  6744 1 1  59 LYS CB   C   5.130  -8.265  11.640 1.00 . A A .  59 LYS CB   1 1 
        3  6745 1 1  59 LYS CD   C   4.370 -10.208  10.110 1.00 . A A .  59 LYS CD   1 1 
        3  6746 1 1  59 LYS CE   C   3.178 -11.050   9.637 1.00 . A A .  59 LYS CE   1 1 
        3  6747 1 1  59 LYS CG   C   4.021  -9.300  11.311 1.00 . A A .  59 LYS CG   1 1 
        3  6748 1 1  59 LYS H    H   6.511  -6.072  11.913 1.00 . A A .  59 LYS H    1 1 
        3  6749 1 1  59 LYS HA   H   6.107  -7.822   9.756 1.00 . A A .  59 LYS HA   1 1 
        3  6750 1 1  59 LYS HB2  H   6.022  -8.812  11.927 1.00 . A A .  59 LYS HB2  1 1 
        3  6751 1 1  59 LYS HB3  H   4.802  -7.684  12.493 1.00 . A A .  59 LYS HB3  1 1 
        3  6752 1 1  59 LYS HD2  H   4.698  -9.588   9.284 1.00 . A A .  59 LYS HD2  1 1 
        3  6753 1 1  59 LYS HD3  H   5.177 -10.872  10.396 1.00 . A A .  59 LYS HD3  1 1 
        3  6754 1 1  59 LYS HE2  H   2.892 -11.738  10.424 1.00 . A A .  59 LYS HE2  1 1 
        3  6755 1 1  59 LYS HE3  H   2.344 -10.393   9.418 1.00 . A A .  59 LYS HE3  1 1 
        3  6756 1 1  59 LYS HG2  H   3.859  -9.923  12.182 1.00 . A A .  59 LYS HG2  1 1 
        3  6757 1 1  59 LYS HG3  H   3.101  -8.759  11.092 1.00 . A A .  59 LYS HG3  1 1 
        3  6758 1 1  59 LYS HZ1  H   2.679 -12.379   8.104 1.00 . A A .  59 LYS HZ1  1 1 
        3  6759 1 1  59 LYS HZ2  H   4.290 -12.486   8.603 1.00 . A A .  59 LYS HZ2  1 1 
        3  6760 1 1  59 LYS HZ3  H   3.789 -11.194   7.640 1.00 . A A .  59 LYS HZ3  1 1 
        3  6761 1 1  59 LYS N    N   6.316  -6.142  10.950 1.00 . A A .  59 LYS N    1 1 
        3  6762 1 1  59 LYS NZ   N   3.505 -11.831   8.413 1.00 . A A .  59 LYS NZ   1 1 
        3  6763 1 1  59 LYS O    O   4.007  -7.179   8.621 1.00 . A A .  59 LYS O    1 1 
        3  6764 1 1  60 TRP C    C   2.574  -4.652   8.484 1.00 . A A .  60 TRP C    1 1 
        3  6765 1 1  60 TRP CA   C   2.204  -5.340   9.817 1.00 . A A .  60 TRP CA   1 1 
        3  6766 1 1  60 TRP CB   C   1.497  -4.311  10.758 1.00 . A A .  60 TRP CB   1 1 
        3  6767 1 1  60 TRP CD1  C   1.219  -5.971  12.744 1.00 . A A .  60 TRP CD1  1 1 
        3  6768 1 1  60 TRP CD2  C   1.441  -3.817  13.343 1.00 . A A .  60 TRP CD2  1 1 
        3  6769 1 1  60 TRP CE2  C   1.334  -4.596  14.506 1.00 . A A .  60 TRP CE2  1 1 
        3  6770 1 1  60 TRP CE3  C   1.578  -2.431  13.470 1.00 . A A .  60 TRP CE3  1 1 
        3  6771 1 1  60 TRP CG   C   1.395  -4.713  12.217 1.00 . A A .  60 TRP CG   1 1 
        3  6772 1 1  60 TRP CH2  C   1.488  -2.679  15.876 1.00 . A A .  60 TRP CH2  1 1 
        3  6773 1 1  60 TRP CZ2  C   1.362  -4.038  15.781 1.00 . A A .  60 TRP CZ2  1 1 
        3  6774 1 1  60 TRP CZ3  C   1.595  -1.877  14.735 1.00 . A A .  60 TRP CZ3  1 1 
        3  6775 1 1  60 TRP H    H   3.649  -5.657  11.362 1.00 . A A .  60 TRP H    1 1 
        3  6776 1 1  60 TRP HA   H   1.521  -6.169   9.622 1.00 . A A .  60 TRP HA   1 1 
        3  6777 1 1  60 TRP HB2  H   2.039  -3.374  10.724 1.00 . A A .  60 TRP HB2  1 1 
        3  6778 1 1  60 TRP HB3  H   0.488  -4.138  10.394 1.00 . A A .  60 TRP HB3  1 1 
        3  6779 1 1  60 TRP HD1  H   1.141  -6.876  12.154 1.00 . A A .  60 TRP HD1  1 1 
        3  6780 1 1  60 TRP HE1  H   1.131  -6.667  14.724 1.00 . A A .  60 TRP HE1  1 1 
        3  6781 1 1  60 TRP HE3  H   1.668  -1.796  12.599 1.00 . A A .  60 TRP HE3  1 1 
        3  6782 1 1  60 TRP HH2  H   1.504  -2.203  16.850 1.00 . A A .  60 TRP HH2  1 1 
        3  6783 1 1  60 TRP HZ2  H   1.280  -4.646  16.673 1.00 . A A .  60 TRP HZ2  1 1 
        3  6784 1 1  60 TRP HZ3  H   1.694  -0.805  14.855 1.00 . A A .  60 TRP HZ3  1 1 
        3  6785 1 1  60 TRP N    N   3.426  -5.909  10.429 1.00 . A A .  60 TRP N    1 1 
        3  6786 1 1  60 TRP NE1  N   1.215  -5.904  14.118 1.00 . A A .  60 TRP NE1  1 1 
        3  6787 1 1  60 TRP O    O   2.049  -5.007   7.423 1.00 . A A .  60 TRP O    1 1 
        3  6788 1 1  61 PHE C    C   4.529  -3.846   6.232 1.00 . A A .  61 PHE C    1 1 
        3  6789 1 1  61 PHE CA   C   4.071  -2.961   7.408 1.00 . A A .  61 PHE CA   1 1 
        3  6790 1 1  61 PHE CB   C   5.229  -2.011   7.856 1.00 . A A .  61 PHE CB   1 1 
        3  6791 1 1  61 PHE CD1  C   3.503  -0.616   9.141 1.00 . A A .  61 PHE CD1  1 1 
        3  6792 1 1  61 PHE CD2  C   5.633   0.366   8.641 1.00 . A A .  61 PHE CD2  1 1 
        3  6793 1 1  61 PHE CE1  C   3.111   0.551   9.750 1.00 . A A .  61 PHE CE1  1 1 
        3  6794 1 1  61 PHE CE2  C   5.233   1.531   9.260 1.00 . A A .  61 PHE CE2  1 1 
        3  6795 1 1  61 PHE CG   C   4.778  -0.733   8.569 1.00 . A A .  61 PHE CG   1 1 
        3  6796 1 1  61 PHE CZ   C   3.972   1.623   9.810 1.00 . A A .  61 PHE CZ   1 1 
        3  6797 1 1  61 PHE H    H   3.988  -3.587   9.446 1.00 . A A .  61 PHE H    1 1 
        3  6798 1 1  61 PHE HA   H   3.244  -2.345   7.065 1.00 . A A .  61 PHE HA   1 1 
        3  6799 1 1  61 PHE HB2  H   5.886  -2.544   8.533 1.00 . A A .  61 PHE HB2  1 1 
        3  6800 1 1  61 PHE HB3  H   5.804  -1.711   6.982 1.00 . A A .  61 PHE HB3  1 1 
        3  6801 1 1  61 PHE HD1  H   2.818  -1.455   9.102 1.00 . A A .  61 PHE HD1  1 1 
        3  6802 1 1  61 PHE HD2  H   6.627   0.300   8.207 1.00 . A A .  61 PHE HD2  1 1 
        3  6803 1 1  61 PHE HE1  H   2.122   0.626  10.186 1.00 . A A .  61 PHE HE1  1 1 
        3  6804 1 1  61 PHE HE2  H   5.906   2.376   9.309 1.00 . A A .  61 PHE HE2  1 1 
        3  6805 1 1  61 PHE HZ   H   3.657   2.542  10.292 1.00 . A A .  61 PHE HZ   1 1 
        3  6806 1 1  61 PHE N    N   3.576  -3.746   8.563 1.00 . A A .  61 PHE N    1 1 
        3  6807 1 1  61 PHE O    O   4.177  -3.578   5.084 1.00 . A A .  61 PHE O    1 1 
        3  6808 1 1  62 SER C    C   4.825  -6.738   4.907 1.00 . A A .  62 SER C    1 1 
        3  6809 1 1  62 SER CA   C   5.874  -5.791   5.506 1.00 . A A .  62 SER CA   1 1 
        3  6810 1 1  62 SER CB   C   7.053  -6.597   6.090 1.00 . A A .  62 SER CB   1 1 
        3  6811 1 1  62 SER H    H   5.303  -5.203   7.471 1.00 . A A .  62 SER H    1 1 
        3  6812 1 1  62 SER HA   H   6.250  -5.145   4.711 1.00 . A A .  62 SER HA   1 1 
        3  6813 1 1  62 SER HB2  H   7.506  -7.197   5.314 1.00 . A A .  62 SER HB2  1 1 
        3  6814 1 1  62 SER HB3  H   7.791  -5.909   6.485 1.00 . A A .  62 SER HB3  1 1 
        3  6815 1 1  62 SER HG   H   6.111  -6.959   7.766 1.00 . A A .  62 SER HG   1 1 
        3  6816 1 1  62 SER N    N   5.255  -4.931   6.537 1.00 . A A .  62 SER N    1 1 
        3  6817 1 1  62 SER O    O   4.922  -7.125   3.740 1.00 . A A .  62 SER O    1 1 
        3  6818 1 1  62 SER OG   O   6.636  -7.459   7.134 1.00 . A A .  62 SER OG   1 1 
        3  6819 1 1  63 ASN C    C   1.803  -7.131   4.342 1.00 . A A .  63 ASN C    1 1 
        3  6820 1 1  63 ASN CA   C   2.681  -7.915   5.327 1.00 . A A .  63 ASN CA   1 1 
        3  6821 1 1  63 ASN CB   C   1.851  -8.343   6.571 1.00 . A A .  63 ASN CB   1 1 
        3  6822 1 1  63 ASN CG   C   0.641  -9.240   6.264 1.00 . A A .  63 ASN CG   1 1 
        3  6823 1 1  63 ASN H    H   3.850  -6.767   6.658 1.00 . A A .  63 ASN H    1 1 
        3  6824 1 1  63 ASN HA   H   3.069  -8.803   4.836 1.00 . A A .  63 ASN HA   1 1 
        3  6825 1 1  63 ASN HB2  H   2.496  -8.883   7.253 1.00 . A A .  63 ASN HB2  1 1 
        3  6826 1 1  63 ASN HB3  H   1.495  -7.449   7.077 1.00 . A A .  63 ASN HB3  1 1 
        3  6827 1 1  63 ASN HD21 H   1.614 -10.224   4.818 1.00 . A A .  63 ASN HD21 1 1 
        3  6828 1 1  63 ASN HD22 H  -0.016 -10.714   5.106 1.00 . A A .  63 ASN HD22 1 1 
        3  6829 1 1  63 ASN N    N   3.824  -7.090   5.734 1.00 . A A .  63 ASN N    1 1 
        3  6830 1 1  63 ASN ND2  N   0.761 -10.152   5.299 1.00 . A A .  63 ASN ND2  1 1 
        3  6831 1 1  63 ASN O    O   1.272  -7.705   3.404 1.00 . A A .  63 ASN O    1 1 
        3  6832 1 1  63 ASN OD1  O  -0.396  -9.140   6.920 1.00 . A A .  63 ASN OD1  1 1 
        3  6833 1 1  64 PHE C    C   1.744  -4.453   2.469 1.00 . A A .  64 PHE C    1 1 
        3  6834 1 1  64 PHE CA   C   0.898  -4.918   3.669 1.00 . A A .  64 PHE CA   1 1 
        3  6835 1 1  64 PHE CB   C   0.318  -3.703   4.432 1.00 . A A .  64 PHE CB   1 1 
        3  6836 1 1  64 PHE CD1  C  -1.407  -5.148   5.626 1.00 . A A .  64 PHE CD1  1 1 
        3  6837 1 1  64 PHE CD2  C  -0.409  -3.337   6.844 1.00 . A A .  64 PHE CD2  1 1 
        3  6838 1 1  64 PHE CE1  C  -2.141  -5.488   6.743 1.00 . A A .  64 PHE CE1  1 1 
        3  6839 1 1  64 PHE CE2  C  -1.141  -3.686   7.957 1.00 . A A .  64 PHE CE2  1 1 
        3  6840 1 1  64 PHE CG   C  -0.524  -4.065   5.655 1.00 . A A .  64 PHE CG   1 1 
        3  6841 1 1  64 PHE CZ   C  -2.003  -4.759   7.907 1.00 . A A .  64 PHE CZ   1 1 
        3  6842 1 1  64 PHE H    H   2.066  -5.423   5.388 1.00 . A A .  64 PHE H    1 1 
        3  6843 1 1  64 PHE HA   H   0.065  -5.502   3.278 1.00 . A A .  64 PHE HA   1 1 
        3  6844 1 1  64 PHE HB2  H   1.140  -3.071   4.759 1.00 . A A .  64 PHE HB2  1 1 
        3  6845 1 1  64 PHE HB3  H  -0.311  -3.130   3.760 1.00 . A A .  64 PHE HB3  1 1 
        3  6846 1 1  64 PHE HD1  H  -1.519  -5.726   4.716 1.00 . A A .  64 PHE HD1  1 1 
        3  6847 1 1  64 PHE HD2  H   0.269  -2.493   6.889 1.00 . A A .  64 PHE HD2  1 1 
        3  6848 1 1  64 PHE HE1  H  -2.824  -6.329   6.710 1.00 . A A .  64 PHE HE1  1 1 
        3  6849 1 1  64 PHE HE2  H  -1.044  -3.113   8.875 1.00 . A A .  64 PHE HE2  1 1 
        3  6850 1 1  64 PHE HZ   H  -2.582  -5.029   8.785 1.00 . A A .  64 PHE HZ   1 1 
        3  6851 1 1  64 PHE N    N   1.668  -5.805   4.569 1.00 . A A .  64 PHE N    1 1 
        3  6852 1 1  64 PHE O    O   1.186  -4.057   1.460 1.00 . A A .  64 PHE O    1 1 
        3  6853 1 1  65 ARG C    C   3.808  -5.481   0.474 1.00 . A A .  65 ARG C    1 1 
        3  6854 1 1  65 ARG CA   C   4.017  -4.310   1.443 1.00 . A A .  65 ARG CA   1 1 
        3  6855 1 1  65 ARG CB   C   5.522  -4.278   1.879 1.00 . A A .  65 ARG CB   1 1 
        3  6856 1 1  65 ARG CD   C   6.141  -1.787   1.597 1.00 . A A .  65 ARG CD   1 1 
        3  6857 1 1  65 ARG CG   C   5.992  -2.982   2.567 1.00 . A A .  65 ARG CG   1 1 
        3  6858 1 1  65 ARG CZ   C   8.553  -1.806   0.928 1.00 . A A .  65 ARG CZ   1 1 
        3  6859 1 1  65 ARG H    H   3.476  -4.614   3.494 1.00 . A A .  65 ARG H    1 1 
        3  6860 1 1  65 ARG HA   H   3.762  -3.381   0.945 1.00 . A A .  65 ARG HA   1 1 
        3  6861 1 1  65 ARG HB2  H   5.698  -5.101   2.565 1.00 . A A .  65 ARG HB2  1 1 
        3  6862 1 1  65 ARG HB3  H   6.146  -4.435   1.001 1.00 . A A .  65 ARG HB3  1 1 
        3  6863 1 1  65 ARG HD2  H   5.221  -1.663   1.040 1.00 . A A .  65 ARG HD2  1 1 
        3  6864 1 1  65 ARG HD3  H   6.322  -0.887   2.177 1.00 . A A .  65 ARG HD3  1 1 
        3  6865 1 1  65 ARG HE   H   7.006  -2.226  -0.273 1.00 . A A .  65 ARG HE   1 1 
        3  6866 1 1  65 ARG HG2  H   5.276  -2.718   3.334 1.00 . A A .  65 ARG HG2  1 1 
        3  6867 1 1  65 ARG HG3  H   6.954  -3.165   3.038 1.00 . A A .  65 ARG HG3  1 1 
        3  6868 1 1  65 ARG HH11 H   8.285  -1.289   2.883 1.00 . A A .  65 ARG HH11 1 1 
        3  6869 1 1  65 ARG HH12 H   9.932  -1.331   2.351 1.00 . A A .  65 ARG HH12 1 1 
        3  6870 1 1  65 ARG HH21 H   9.166  -2.294  -0.931 1.00 . A A .  65 ARG HH21 1 1 
        3  6871 1 1  65 ARG HH22 H  10.434  -1.902   0.183 1.00 . A A .  65 ARG HH22 1 1 
        3  6872 1 1  65 ARG N    N   3.098  -4.479   2.601 1.00 . A A .  65 ARG N    1 1 
        3  6873 1 1  65 ARG NE   N   7.252  -1.973   0.643 1.00 . A A .  65 ARG NE   1 1 
        3  6874 1 1  65 ARG NH1  N   8.956  -1.445   2.155 1.00 . A A .  65 ARG NH1  1 1 
        3  6875 1 1  65 ARG NH2  N   9.456  -2.017  -0.012 1.00 . A A .  65 ARG NH2  1 1 
        3  6876 1 1  65 ARG O    O   3.697  -5.298  -0.738 1.00 . A A .  65 ARG O    1 1 
        3  6877 1 1  66 GLU C    C   2.155  -7.964  -0.304 1.00 . A A .  66 GLU C    1 1 
        3  6878 1 1  66 GLU CA   C   3.543  -7.952   0.355 1.00 . A A .  66 GLU CA   1 1 
        3  6879 1 1  66 GLU CB   C   3.693  -9.130   1.346 1.00 . A A .  66 GLU CB   1 1 
        3  6880 1 1  66 GLU CD   C   3.634 -11.639   1.763 1.00 . A A .  66 GLU CD   1 1 
        3  6881 1 1  66 GLU CG   C   3.453 -10.520   0.736 1.00 . A A .  66 GLU CG   1 1 
        3  6882 1 1  66 GLU H    H   3.865  -6.731   2.044 1.00 . A A .  66 GLU H    1 1 
        3  6883 1 1  66 GLU HA   H   4.310  -8.038  -0.412 1.00 . A A .  66 GLU HA   1 1 
        3  6884 1 1  66 GLU HB2  H   4.702  -9.113   1.759 1.00 . A A .  66 GLU HB2  1 1 
        3  6885 1 1  66 GLU HB3  H   2.991  -8.992   2.165 1.00 . A A .  66 GLU HB3  1 1 
        3  6886 1 1  66 GLU HG2  H   2.440 -10.560   0.343 1.00 . A A .  66 GLU HG2  1 1 
        3  6887 1 1  66 GLU HG3  H   4.148 -10.672  -0.088 1.00 . A A .  66 GLU HG3  1 1 
        3  6888 1 1  66 GLU N    N   3.757  -6.691   1.068 1.00 . A A .  66 GLU N    1 1 
        3  6889 1 1  66 GLU O    O   2.051  -8.161  -1.505 1.00 . A A .  66 GLU O    1 1 
        3  6890 1 1  66 GLU OE1  O   2.671 -11.941   2.496 1.00 . A A .  66 GLU OE1  1 1 
        3  6891 1 1  66 GLU OE2  O   4.743 -12.205   1.861 1.00 . A A .  66 GLU OE2  1 1 
        3  6892 1 1  67 PHE C    C  -0.444  -6.624  -1.119 1.00 . A A .  67 PHE C    1 1 
        3  6893 1 1  67 PHE CA   C  -0.289  -7.634   0.028 1.00 . A A .  67 PHE CA   1 1 
        3  6894 1 1  67 PHE CB   C  -1.262  -7.308   1.212 1.00 . A A .  67 PHE CB   1 1 
        3  6895 1 1  67 PHE CD1  C  -0.973  -9.605   2.303 1.00 . A A .  67 PHE CD1  1 1 
        3  6896 1 1  67 PHE CD2  C  -3.159  -8.621   2.289 1.00 . A A .  67 PHE CD2  1 1 
        3  6897 1 1  67 PHE CE1  C  -1.478 -10.711   2.964 1.00 . A A .  67 PHE CE1  1 1 
        3  6898 1 1  67 PHE CE2  C  -3.657  -9.727   2.950 1.00 . A A .  67 PHE CE2  1 1 
        3  6899 1 1  67 PHE CG   C  -1.805  -8.535   1.956 1.00 . A A .  67 PHE CG   1 1 
        3  6900 1 1  67 PHE CZ   C  -2.820 -10.774   3.283 1.00 . A A .  67 PHE CZ   1 1 
        3  6901 1 1  67 PHE H    H   1.287  -7.509   1.439 1.00 . A A .  67 PHE H    1 1 
        3  6902 1 1  67 PHE HA   H  -0.530  -8.625  -0.358 1.00 . A A .  67 PHE HA   1 1 
        3  6903 1 1  67 PHE HB2  H  -0.747  -6.691   1.939 1.00 . A A .  67 PHE HB2  1 1 
        3  6904 1 1  67 PHE HB3  H  -2.113  -6.748   0.832 1.00 . A A .  67 PHE HB3  1 1 
        3  6905 1 1  67 PHE HD1  H   0.080  -9.567   2.052 1.00 . A A .  67 PHE HD1  1 1 
        3  6906 1 1  67 PHE HD2  H  -3.827  -7.807   2.030 1.00 . A A .  67 PHE HD2  1 1 
        3  6907 1 1  67 PHE HE1  H  -0.821 -11.533   3.224 1.00 . A A .  67 PHE HE1  1 1 
        3  6908 1 1  67 PHE HE2  H  -4.712  -9.778   3.205 1.00 . A A .  67 PHE HE2  1 1 
        3  6909 1 1  67 PHE HZ   H  -3.214 -11.641   3.801 1.00 . A A .  67 PHE HZ   1 1 
        3  6910 1 1  67 PHE N    N   1.109  -7.687   0.497 1.00 . A A .  67 PHE N    1 1 
        3  6911 1 1  67 PHE O    O  -1.003  -6.960  -2.156 1.00 . A A .  67 PHE O    1 1 
        3  6912 1 1  68 TYR C    C   0.707  -4.794  -3.256 1.00 . A A .  68 TYR C    1 1 
        3  6913 1 1  68 TYR CA   C   0.044  -4.339  -1.940 1.00 . A A .  68 TYR CA   1 1 
        3  6914 1 1  68 TYR CB   C   0.732  -3.054  -1.403 1.00 . A A .  68 TYR CB   1 1 
        3  6915 1 1  68 TYR CD1  C  -0.213  -1.107  -2.753 1.00 . A A .  68 TYR CD1  1 1 
        3  6916 1 1  68 TYR CD2  C   2.074  -1.727  -3.128 1.00 . A A .  68 TYR CD2  1 1 
        3  6917 1 1  68 TYR CE1  C  -0.096  -0.127  -3.711 1.00 . A A .  68 TYR CE1  1 1 
        3  6918 1 1  68 TYR CE2  C   2.189  -0.744  -4.078 1.00 . A A .  68 TYR CE2  1 1 
        3  6919 1 1  68 TYR CG   C   0.868  -1.934  -2.437 1.00 . A A .  68 TYR CG   1 1 
        3  6920 1 1  68 TYR CZ   C   1.102   0.047  -4.366 1.00 . A A .  68 TYR CZ   1 1 
        3  6921 1 1  68 TYR H    H   0.503  -5.213  -0.064 1.00 . A A .  68 TYR H    1 1 
        3  6922 1 1  68 TYR HA   H  -1.003  -4.115  -2.135 1.00 . A A .  68 TYR HA   1 1 
        3  6923 1 1  68 TYR HB2  H   0.158  -2.662  -0.571 1.00 . A A .  68 TYR HB2  1 1 
        3  6924 1 1  68 TYR HB3  H   1.726  -3.305  -1.046 1.00 . A A .  68 TYR HB3  1 1 
        3  6925 1 1  68 TYR HD1  H  -1.148  -1.241  -2.237 1.00 . A A .  68 TYR HD1  1 1 
        3  6926 1 1  68 TYR HD2  H   2.933  -2.348  -2.898 1.00 . A A .  68 TYR HD2  1 1 
        3  6927 1 1  68 TYR HE1  H  -0.944   0.504  -3.947 1.00 . A A .  68 TYR HE1  1 1 
        3  6928 1 1  68 TYR HE2  H   3.130  -0.599  -4.605 1.00 . A A .  68 TYR HE2  1 1 
        3  6929 1 1  68 TYR HH   H   1.650   0.640  -6.102 1.00 . A A .  68 TYR HH   1 1 
        3  6930 1 1  68 TYR N    N   0.083  -5.406  -0.925 1.00 . A A .  68 TYR N    1 1 
        3  6931 1 1  68 TYR O    O   0.042  -4.878  -4.292 1.00 . A A .  68 TYR O    1 1 
        3  6932 1 1  68 TYR OH   O   1.212   1.010  -5.326 1.00 . A A .  68 TYR OH   1 1 
        3  6933 1 1  69 TYR C    C   2.337  -6.612  -5.135 1.00 . A A .  69 TYR C    1 1 
        3  6934 1 1  69 TYR CA   C   2.842  -5.377  -4.375 1.00 . A A .  69 TYR CA   1 1 
        3  6935 1 1  69 TYR CB   C   4.340  -5.546  -3.998 1.00 . A A .  69 TYR CB   1 1 
        3  6936 1 1  69 TYR CD1  C   5.728  -4.320  -5.765 1.00 . A A .  69 TYR CD1  1 1 
        3  6937 1 1  69 TYR CD2  C   5.689  -6.715  -5.853 1.00 . A A .  69 TYR CD2  1 1 
        3  6938 1 1  69 TYR CE1  C   6.546  -4.295  -6.882 1.00 . A A .  69 TYR CE1  1 1 
        3  6939 1 1  69 TYR CE2  C   6.501  -6.687  -6.976 1.00 . A A .  69 TYR CE2  1 1 
        3  6940 1 1  69 TYR CG   C   5.280  -5.529  -5.219 1.00 . A A .  69 TYR CG   1 1 
        3  6941 1 1  69 TYR CZ   C   6.925  -5.475  -7.484 1.00 . A A .  69 TYR CZ   1 1 
        3  6942 1 1  69 TYR H    H   2.411  -5.251  -2.295 1.00 . A A .  69 TYR H    1 1 
        3  6943 1 1  69 TYR HA   H   2.742  -4.505  -5.016 1.00 . A A .  69 TYR HA   1 1 
        3  6944 1 1  69 TYR HB2  H   4.635  -4.740  -3.337 1.00 . A A .  69 TYR HB2  1 1 
        3  6945 1 1  69 TYR HB3  H   4.478  -6.488  -3.472 1.00 . A A .  69 TYR HB3  1 1 
        3  6946 1 1  69 TYR HD1  H   5.441  -3.392  -5.300 1.00 . A A .  69 TYR HD1  1 1 
        3  6947 1 1  69 TYR HD2  H   5.362  -7.670  -5.454 1.00 . A A .  69 TYR HD2  1 1 
        3  6948 1 1  69 TYR HE1  H   6.878  -3.346  -7.289 1.00 . A A .  69 TYR HE1  1 1 
        3  6949 1 1  69 TYR HE2  H   6.801  -7.616  -7.453 1.00 . A A .  69 TYR HE2  1 1 
        3  6950 1 1  69 TYR HH   H   7.293  -5.973  -9.309 1.00 . A A .  69 TYR HH   1 1 
        3  6951 1 1  69 TYR N    N   2.010  -5.132  -3.182 1.00 . A A .  69 TYR N    1 1 
        3  6952 1 1  69 TYR O    O   2.117  -6.550  -6.346 1.00 . A A .  69 TYR O    1 1 
        3  6953 1 1  69 TYR OH   O   7.714  -5.441  -8.616 1.00 . A A .  69 TYR OH   1 1 
        3  6954 1 1  70 ILE C    C   0.275  -8.860  -5.540 1.00 . A A .  70 ILE C    1 1 
        3  6955 1 1  70 ILE CA   C   1.681  -8.993  -4.928 1.00 . A A .  70 ILE CA   1 1 
        3  6956 1 1  70 ILE CB   C   1.758 -10.181  -3.862 1.00 . A A .  70 ILE CB   1 1 
        3  6957 1 1  70 ILE CD1  C   4.270  -9.689  -3.253 1.00 . A A .  70 ILE CD1  1 1 
        3  6958 1 1  70 ILE CG1  C   3.230 -10.713  -3.690 1.00 . A A .  70 ILE CG1  1 1 
        3  6959 1 1  70 ILE CG2  C   0.807 -11.360  -4.210 1.00 . A A .  70 ILE CG2  1 1 
        3  6960 1 1  70 ILE H    H   2.287  -7.644  -3.419 1.00 . A A .  70 ILE H    1 1 
        3  6961 1 1  70 ILE HA   H   2.371  -9.237  -5.738 1.00 . A A .  70 ILE HA   1 1 
        3  6962 1 1  70 ILE HB   H   1.429  -9.779  -2.909 1.00 . A A .  70 ILE HB   1 1 
        3  6963 1 1  70 ILE HD11 H   3.983  -9.264  -2.302 1.00 . A A .  70 ILE HD11 1 1 
        3  6964 1 1  70 ILE HD12 H   4.346  -8.904  -3.991 1.00 . A A .  70 ILE HD12 1 1 
        3  6965 1 1  70 ILE HD13 H   5.232 -10.174  -3.148 1.00 . A A .  70 ILE HD13 1 1 
        3  6966 1 1  70 ILE HG12 H   3.240 -11.502  -2.945 1.00 . A A .  70 ILE HG12 1 1 
        3  6967 1 1  70 ILE HG13 H   3.563 -11.131  -4.632 1.00 . A A .  70 ILE HG13 1 1 
        3  6968 1 1  70 ILE HG21 H  -0.219 -11.011  -4.237 1.00 . A A .  70 ILE HG21 1 1 
        3  6969 1 1  70 ILE HG22 H   0.895 -12.141  -3.463 1.00 . A A .  70 ILE HG22 1 1 
        3  6970 1 1  70 ILE HG23 H   1.070 -11.763  -5.180 1.00 . A A .  70 ILE HG23 1 1 
        3  6971 1 1  70 ILE N    N   2.128  -7.709  -4.380 1.00 . A A .  70 ILE N    1 1 
        3  6972 1 1  70 ILE O    O   0.088  -9.329  -6.637 1.00 . A A .  70 ILE O    1 1 
        3  6973 1 1  71 GLN C    C  -2.158  -7.179  -6.636 1.00 . A A .  71 GLN C    1 1 
        3  6974 1 1  71 GLN CA   C  -2.088  -8.068  -5.388 1.00 . A A .  71 GLN CA   1 1 
        3  6975 1 1  71 GLN CB   C  -3.098  -7.572  -4.316 1.00 . A A .  71 GLN CB   1 1 
        3  6976 1 1  71 GLN CD   C  -4.459  -8.112  -2.228 1.00 . A A .  71 GLN CD   1 1 
        3  6977 1 1  71 GLN CG   C  -3.490  -8.642  -3.282 1.00 . A A .  71 GLN CG   1 1 
        3  6978 1 1  71 GLN H    H  -0.452  -7.733  -4.016 1.00 . A A .  71 GLN H    1 1 
        3  6979 1 1  71 GLN HA   H  -2.386  -9.074  -5.683 1.00 . A A .  71 GLN HA   1 1 
        3  6980 1 1  71 GLN HB2  H  -2.659  -6.728  -3.789 1.00 . A A .  71 GLN HB2  1 1 
        3  6981 1 1  71 GLN HB3  H  -4.009  -7.231  -4.807 1.00 . A A .  71 GLN HB3  1 1 
        3  6982 1 1  71 GLN HE21 H  -2.952  -7.587  -1.058 1.00 . A A .  71 GLN HE21 1 1 
        3  6983 1 1  71 GLN HE22 H  -4.529  -7.250  -0.448 1.00 . A A .  71 GLN HE22 1 1 
        3  6984 1 1  71 GLN HG2  H  -3.957  -9.474  -3.797 1.00 . A A .  71 GLN HG2  1 1 
        3  6985 1 1  71 GLN HG3  H  -2.593  -8.999  -2.784 1.00 . A A .  71 GLN HG3  1 1 
        3  6986 1 1  71 GLN N    N  -0.691  -8.182  -4.861 1.00 . A A .  71 GLN N    1 1 
        3  6987 1 1  71 GLN NE2  N  -3.926  -7.599  -1.132 1.00 . A A .  71 GLN NE2  1 1 
        3  6988 1 1  71 GLN O    O  -2.810  -7.548  -7.608 1.00 . A A .  71 GLN O    1 1 
        3  6989 1 1  71 GLN OE1  O  -5.680  -8.160  -2.398 1.00 . A A .  71 GLN OE1  1 1 
        3  6990 1 1  72 MET C    C  -0.805  -5.748  -9.004 1.00 . A A .  72 MET C    1 1 
        3  6991 1 1  72 MET CA   C  -1.460  -5.078  -7.769 1.00 . A A .  72 MET CA   1 1 
        3  6992 1 1  72 MET CB   C  -0.728  -3.757  -7.399 1.00 . A A .  72 MET CB   1 1 
        3  6993 1 1  72 MET CE   C  -4.208  -3.272  -6.351 1.00 . A A .  72 MET CE   1 1 
        3  6994 1 1  72 MET CG   C  -1.396  -2.912  -6.287 1.00 . A A .  72 MET CG   1 1 
        3  6995 1 1  72 MET H    H  -0.992  -5.771  -5.799 1.00 . A A .  72 MET H    1 1 
        3  6996 1 1  72 MET HA   H  -2.495  -4.842  -8.006 1.00 . A A .  72 MET HA   1 1 
        3  6997 1 1  72 MET HB2  H   0.280  -3.996  -7.072 1.00 . A A .  72 MET HB2  1 1 
        3  6998 1 1  72 MET HB3  H  -0.657  -3.136  -8.287 1.00 . A A .  72 MET HB3  1 1 
        3  6999 1 1  72 MET HE1  H  -5.177  -2.866  -6.589 1.00 . A A .  72 MET HE1  1 1 
        3  7000 1 1  72 MET HE2  H  -4.154  -3.488  -5.294 1.00 . A A .  72 MET HE2  1 1 
        3  7001 1 1  72 MET HE3  H  -4.055  -4.185  -6.913 1.00 . A A .  72 MET HE3  1 1 
        3  7002 1 1  72 MET HG2  H  -1.615  -3.554  -5.449 1.00 . A A .  72 MET HG2  1 1 
        3  7003 1 1  72 MET HG3  H  -0.695  -2.149  -5.963 1.00 . A A .  72 MET HG3  1 1 
        3  7004 1 1  72 MET N    N  -1.483  -6.013  -6.612 1.00 . A A .  72 MET N    1 1 
        3  7005 1 1  72 MET O    O  -1.388  -5.770 -10.109 1.00 . A A .  72 MET O    1 1 
        3  7006 1 1  72 MET SD   S  -2.934  -2.084  -6.791 1.00 . A A .  72 MET SD   1 1 
        3  7007 1 1  73 GLU C    C   0.347  -8.365 -10.216 1.00 . A A .  73 GLU C    1 1 
        3  7008 1 1  73 GLU CA   C   1.123  -7.101  -9.815 1.00 . A A .  73 GLU CA   1 1 
        3  7009 1 1  73 GLU CB   C   2.564  -7.460  -9.343 1.00 . A A .  73 GLU CB   1 1 
        3  7010 1 1  73 GLU CD   C   4.908  -8.356  -9.996 1.00 . A A .  73 GLU CD   1 1 
        3  7011 1 1  73 GLU CG   C   3.447  -8.121 -10.432 1.00 . A A .  73 GLU CG   1 1 
        3  7012 1 1  73 GLU H    H   0.777  -6.308  -7.872 1.00 . A A .  73 GLU H    1 1 
        3  7013 1 1  73 GLU HA   H   1.199  -6.449 -10.682 1.00 . A A .  73 GLU HA   1 1 
        3  7014 1 1  73 GLU HB2  H   3.057  -6.548  -9.016 1.00 . A A .  73 GLU HB2  1 1 
        3  7015 1 1  73 GLU HB3  H   2.503  -8.135  -8.492 1.00 . A A .  73 GLU HB3  1 1 
        3  7016 1 1  73 GLU HG2  H   3.005  -9.076 -10.706 1.00 . A A .  73 GLU HG2  1 1 
        3  7017 1 1  73 GLU HG3  H   3.442  -7.487 -11.315 1.00 . A A .  73 GLU HG3  1 1 
        3  7018 1 1  73 GLU N    N   0.387  -6.357  -8.777 1.00 . A A .  73 GLU N    1 1 
        3  7019 1 1  73 GLU O    O   0.423  -8.771 -11.363 1.00 . A A .  73 GLU O    1 1 
        3  7020 1 1  73 GLU OE1  O   5.742  -7.429 -10.138 1.00 . A A .  73 GLU OE1  1 1 
        3  7021 1 1  73 GLU OE2  O   5.236  -9.480  -9.540 1.00 . A A .  73 GLU OE2  1 1 
        3  7022 1 1  74 LYS C    C  -2.329  -9.790 -10.577 1.00 . A A .  74 LYS C    1 1 
        3  7023 1 1  74 LYS CA   C  -1.263 -10.142  -9.560 1.00 . A A .  74 LYS CA   1 1 
        3  7024 1 1  74 LYS CB   C  -1.953 -10.702  -8.281 1.00 . A A .  74 LYS CB   1 1 
        3  7025 1 1  74 LYS CD   C  -2.089 -13.154  -9.063 1.00 . A A .  74 LYS CD   1 1 
        3  7026 1 1  74 LYS CE   C  -3.022 -14.333  -9.379 1.00 . A A .  74 LYS CE   1 1 
        3  7027 1 1  74 LYS CG   C  -2.860 -11.934  -8.507 1.00 . A A .  74 LYS CG   1 1 
        3  7028 1 1  74 LYS H    H  -0.495  -8.547  -8.392 1.00 . A A .  74 LYS H    1 1 
        3  7029 1 1  74 LYS HA   H  -0.605 -10.906  -9.974 1.00 . A A .  74 LYS HA   1 1 
        3  7030 1 1  74 LYS HB2  H  -1.182 -10.980  -7.567 1.00 . A A .  74 LYS HB2  1 1 
        3  7031 1 1  74 LYS HB3  H  -2.555  -9.913  -7.835 1.00 . A A .  74 LYS HB3  1 1 
        3  7032 1 1  74 LYS HD2  H  -1.577 -12.865  -9.976 1.00 . A A .  74 LYS HD2  1 1 
        3  7033 1 1  74 LYS HD3  H  -1.354 -13.473  -8.331 1.00 . A A .  74 LYS HD3  1 1 
        3  7034 1 1  74 LYS HE2  H  -3.569 -14.607  -8.484 1.00 . A A .  74 LYS HE2  1 1 
        3  7035 1 1  74 LYS HE3  H  -3.728 -14.032 -10.147 1.00 . A A .  74 LYS HE3  1 1 
        3  7036 1 1  74 LYS HG2  H  -3.313 -12.210  -7.562 1.00 . A A .  74 LYS HG2  1 1 
        3  7037 1 1  74 LYS HG3  H  -3.644 -11.660  -9.209 1.00 . A A .  74 LYS HG3  1 1 
        3  7038 1 1  74 LYS HZ1  H  -1.644 -15.875  -9.111 1.00 . A A .  74 LYS HZ1  1 1 
        3  7039 1 1  74 LYS HZ2  H  -1.697 -15.276 -10.688 1.00 . A A .  74 LYS HZ2  1 1 
        3  7040 1 1  74 LYS HZ3  H  -2.932 -16.280 -10.125 1.00 . A A .  74 LYS HZ3  1 1 
        3  7041 1 1  74 LYS N    N  -0.439  -8.946  -9.279 1.00 . A A .  74 LYS N    1 1 
        3  7042 1 1  74 LYS NZ   N  -2.272 -15.520  -9.858 1.00 . A A .  74 LYS NZ   1 1 
        3  7043 1 1  74 LYS O    O  -2.427 -10.440 -11.591 1.00 . A A .  74 LYS O    1 1 
        3  7044 1 1  75 TYR C    C  -3.700  -7.900 -12.542 1.00 . A A .  75 TYR C    1 1 
        3  7045 1 1  75 TYR CA   C  -4.194  -8.271 -11.134 1.00 . A A .  75 TYR CA   1 1 
        3  7046 1 1  75 TYR CB   C  -4.923  -7.069 -10.485 1.00 . A A .  75 TYR CB   1 1 
        3  7047 1 1  75 TYR CD1  C  -6.062  -8.594  -8.737 1.00 . A A .  75 TYR CD1  1 1 
        3  7048 1 1  75 TYR CD2  C  -5.701  -6.297  -8.179 1.00 . A A .  75 TYR CD2  1 1 
        3  7049 1 1  75 TYR CE1  C  -6.659  -8.799  -7.498 1.00 . A A .  75 TYR CE1  1 1 
        3  7050 1 1  75 TYR CE2  C  -6.291  -6.500  -6.947 1.00 . A A .  75 TYR CE2  1 1 
        3  7051 1 1  75 TYR CG   C  -5.569  -7.335  -9.106 1.00 . A A .  75 TYR CG   1 1 
        3  7052 1 1  75 TYR CZ   C  -6.769  -7.746  -6.609 1.00 . A A .  75 TYR CZ   1 1 
        3  7053 1 1  75 TYR H    H  -2.845  -8.181  -9.506 1.00 . A A .  75 TYR H    1 1 
        3  7054 1 1  75 TYR HA   H  -4.893  -9.101 -11.213 1.00 . A A .  75 TYR HA   1 1 
        3  7055 1 1  75 TYR HB2  H  -4.213  -6.256 -10.369 1.00 . A A .  75 TYR HB2  1 1 
        3  7056 1 1  75 TYR HB3  H  -5.711  -6.740 -11.150 1.00 . A A .  75 TYR HB3  1 1 
        3  7057 1 1  75 TYR HD1  H  -5.977  -9.422  -9.434 1.00 . A A .  75 TYR HD1  1 1 
        3  7058 1 1  75 TYR HD2  H  -5.331  -5.310  -8.440 1.00 . A A .  75 TYR HD2  1 1 
        3  7059 1 1  75 TYR HE1  H  -7.035  -9.780  -7.234 1.00 . A A .  75 TYR HE1  1 1 
        3  7060 1 1  75 TYR HE2  H  -6.378  -5.676  -6.249 1.00 . A A .  75 TYR HE2  1 1 
        3  7061 1 1  75 TYR HH   H  -7.979  -7.220  -5.198 1.00 . A A .  75 TYR HH   1 1 
        3  7062 1 1  75 TYR N    N  -3.074  -8.712 -10.298 1.00 . A A .  75 TYR N    1 1 
        3  7063 1 1  75 TYR O    O  -4.262  -8.352 -13.538 1.00 . A A .  75 TYR O    1 1 
        3  7064 1 1  75 TYR OH   O  -7.368  -7.941  -5.376 1.00 . A A .  75 TYR OH   1 1 
        3  7065 1 1  76 ALA C    C  -1.444  -7.778 -14.718 1.00 . A A .  76 ALA C    1 1 
        3  7066 1 1  76 ALA CA   C  -2.039  -6.627 -13.878 1.00 . A A .  76 ALA CA   1 1 
        3  7067 1 1  76 ALA CB   C  -0.970  -5.560 -13.620 1.00 . A A .  76 ALA CB   1 1 
        3  7068 1 1  76 ALA H    H  -2.173  -6.819 -11.751 1.00 . A A .  76 ALA H    1 1 
        3  7069 1 1  76 ALA HA   H  -2.841  -6.156 -14.438 1.00 . A A .  76 ALA HA   1 1 
        3  7070 1 1  76 ALA HB1  H  -1.398  -4.737 -13.060 1.00 . A A .  76 ALA HB1  1 1 
        3  7071 1 1  76 ALA HB2  H  -0.591  -5.182 -14.564 1.00 . A A .  76 ALA HB2  1 1 
        3  7072 1 1  76 ALA HB3  H  -0.152  -5.989 -13.052 1.00 . A A .  76 ALA HB3  1 1 
        3  7073 1 1  76 ALA N    N  -2.610  -7.102 -12.599 1.00 . A A .  76 ALA N    1 1 
        3  7074 1 1  76 ALA O    O  -1.726  -7.892 -15.910 1.00 . A A .  76 ALA O    1 1 
        3  7075 1 1  77 ARG C    C  -0.912 -10.875 -15.136 1.00 . A A .  77 ARG C    1 1 
        3  7076 1 1  77 ARG CA   C   0.067  -9.747 -14.742 1.00 . A A .  77 ARG CA   1 1 
        3  7077 1 1  77 ARG CB   C   1.191 -10.285 -13.818 1.00 . A A .  77 ARG CB   1 1 
        3  7078 1 1  77 ARG CD   C   3.299 -11.695 -13.509 1.00 . A A .  77 ARG CD   1 1 
        3  7079 1 1  77 ARG CG   C   2.206 -11.224 -14.488 1.00 . A A .  77 ARG CG   1 1 
        3  7080 1 1  77 ARG CZ   C   5.597 -12.646 -13.751 1.00 . A A .  77 ARG CZ   1 1 
        3  7081 1 1  77 ARG H    H  -0.568  -8.560 -13.098 1.00 . A A .  77 ARG H    1 1 
        3  7082 1 1  77 ARG HA   H   0.520  -9.343 -15.646 1.00 . A A .  77 ARG HA   1 1 
        3  7083 1 1  77 ARG HB2  H   1.738  -9.436 -13.419 1.00 . A A .  77 ARG HB2  1 1 
        3  7084 1 1  77 ARG HB3  H   0.734 -10.812 -12.984 1.00 . A A .  77 ARG HB3  1 1 
        3  7085 1 1  77 ARG HD2  H   3.763 -10.824 -13.054 1.00 . A A .  77 ARG HD2  1 1 
        3  7086 1 1  77 ARG HD3  H   2.842 -12.301 -12.736 1.00 . A A .  77 ARG HD3  1 1 
        3  7087 1 1  77 ARG HE   H   4.072 -12.947 -15.019 1.00 . A A .  77 ARG HE   1 1 
        3  7088 1 1  77 ARG HG2  H   1.683 -12.092 -14.873 1.00 . A A .  77 ARG HG2  1 1 
        3  7089 1 1  77 ARG HG3  H   2.676 -10.699 -15.314 1.00 . A A .  77 ARG HG3  1 1 
        3  7090 1 1  77 ARG HH11 H   5.380 -11.485 -12.097 1.00 . A A .  77 ARG HH11 1 1 
        3  7091 1 1  77 ARG HH12 H   6.955 -12.171 -12.315 1.00 . A A .  77 ARG HH12 1 1 
        3  7092 1 1  77 ARG HH21 H   6.132 -13.845 -15.293 1.00 . A A .  77 ARG HH21 1 1 
        3  7093 1 1  77 ARG HH22 H   7.388 -13.518 -14.138 1.00 . A A .  77 ARG HH22 1 1 
        3  7094 1 1  77 ARG N    N  -0.650  -8.647 -14.068 1.00 . A A .  77 ARG N    1 1 
        3  7095 1 1  77 ARG NE   N   4.338 -12.493 -14.185 1.00 . A A .  77 ARG NE   1 1 
        3  7096 1 1  77 ARG NH1  N   6.013 -12.051 -12.631 1.00 . A A .  77 ARG NH1  1 1 
        3  7097 1 1  77 ARG NH2  N   6.441 -13.393 -14.450 1.00 . A A .  77 ARG NH2  1 1 
        3  7098 1 1  77 ARG O    O  -0.698 -11.564 -16.131 1.00 . A A .  77 ARG O    1 1 
        3  7099 1 1  78 GLN C    C  -3.920 -11.405 -15.794 1.00 . A A .  78 GLN C    1 1 
        3  7100 1 1  78 GLN CA   C  -3.104 -11.953 -14.631 1.00 . A A .  78 GLN CA   1 1 
        3  7101 1 1  78 GLN CB   C  -4.003 -12.155 -13.379 1.00 . A A .  78 GLN CB   1 1 
        3  7102 1 1  78 GLN CD   C  -6.047 -13.271 -12.285 1.00 . A A .  78 GLN CD   1 1 
        3  7103 1 1  78 GLN CG   C  -5.207 -13.102 -13.557 1.00 . A A .  78 GLN CG   1 1 
        3  7104 1 1  78 GLN H    H  -2.038 -10.489 -13.525 1.00 . A A .  78 GLN H    1 1 
        3  7105 1 1  78 GLN HA   H  -2.672 -12.909 -14.917 1.00 . A A .  78 GLN HA   1 1 
        3  7106 1 1  78 GLN HB2  H  -3.382 -12.550 -12.580 1.00 . A A .  78 GLN HB2  1 1 
        3  7107 1 1  78 GLN HB3  H  -4.374 -11.184 -13.060 1.00 . A A .  78 GLN HB3  1 1 
        3  7108 1 1  78 GLN HE21 H  -6.580 -15.105 -12.826 1.00 . A A .  78 GLN HE21 1 1 
        3  7109 1 1  78 GLN HE22 H  -7.224 -14.553 -11.321 1.00 . A A .  78 GLN HE22 1 1 
        3  7110 1 1  78 GLN HG2  H  -5.848 -12.709 -14.338 1.00 . A A .  78 GLN HG2  1 1 
        3  7111 1 1  78 GLN HG3  H  -4.835 -14.074 -13.863 1.00 . A A .  78 GLN HG3  1 1 
        3  7112 1 1  78 GLN N    N  -1.989 -11.028 -14.339 1.00 . A A .  78 GLN N    1 1 
        3  7113 1 1  78 GLN NE2  N  -6.679 -14.427 -12.128 1.00 . A A .  78 GLN NE2  1 1 
        3  7114 1 1  78 GLN O    O  -4.412 -12.168 -16.604 1.00 . A A .  78 GLN O    1 1 
        3  7115 1 1  78 GLN OE1  O  -6.146 -12.363 -11.454 1.00 . A A .  78 GLN OE1  1 1 
        3  7116 1 1  79 ALA C    C  -3.965  -9.701 -18.303 1.00 . A A .  79 ALA C    1 1 
        3  7117 1 1  79 ALA CA   C  -4.715  -9.401 -16.997 1.00 . A A .  79 ALA CA   1 1 
        3  7118 1 1  79 ALA CB   C  -4.815  -7.893 -16.757 1.00 . A A .  79 ALA CB   1 1 
        3  7119 1 1  79 ALA H    H  -3.691  -9.505 -15.143 1.00 . A A .  79 ALA H    1 1 
        3  7120 1 1  79 ALA HA   H  -5.726  -9.797 -17.067 1.00 . A A .  79 ALA HA   1 1 
        3  7121 1 1  79 ALA HB1  H  -5.334  -7.709 -15.826 1.00 . A A .  79 ALA HB1  1 1 
        3  7122 1 1  79 ALA HB2  H  -5.355  -7.425 -17.568 1.00 . A A .  79 ALA HB2  1 1 
        3  7123 1 1  79 ALA HB3  H  -3.820  -7.464 -16.696 1.00 . A A .  79 ALA HB3  1 1 
        3  7124 1 1  79 ALA N    N  -4.048 -10.065 -15.872 1.00 . A A .  79 ALA N    1 1 
        3  7125 1 1  79 ALA O    O  -4.566 -10.141 -19.277 1.00 . A A .  79 ALA O    1 1 
        3  7126 1 1  80 ILE C    C  -1.771 -11.258 -19.858 1.00 . A A .  80 ILE C    1 1 
        3  7127 1 1  80 ILE CA   C  -1.775  -9.756 -19.462 1.00 . A A .  80 ILE CA   1 1 
        3  7128 1 1  80 ILE CB   C  -0.303  -9.256 -19.222 1.00 . A A .  80 ILE CB   1 1 
        3  7129 1 1  80 ILE CD1  C  -0.902  -6.774 -19.729 1.00 . A A .  80 ILE CD1  1 1 
        3  7130 1 1  80 ILE CG1  C  -0.286  -7.763 -18.757 1.00 . A A .  80 ILE CG1  1 1 
        3  7131 1 1  80 ILE CG2  C   0.568  -9.438 -20.490 1.00 . A A .  80 ILE CG2  1 1 
        3  7132 1 1  80 ILE H    H  -2.215  -9.199 -17.448 1.00 . A A .  80 ILE H    1 1 
        3  7133 1 1  80 ILE HA   H  -2.194  -9.181 -20.286 1.00 . A A .  80 ILE HA   1 1 
        3  7134 1 1  80 ILE HB   H   0.133  -9.866 -18.432 1.00 . A A .  80 ILE HB   1 1 
        3  7135 1 1  80 ILE HD11 H  -1.955  -6.991 -19.849 1.00 . A A .  80 ILE HD11 1 1 
        3  7136 1 1  80 ILE HD12 H  -0.405  -6.838 -20.688 1.00 . A A .  80 ILE HD12 1 1 
        3  7137 1 1  80 ILE HD13 H  -0.787  -5.775 -19.336 1.00 . A A .  80 ILE HD13 1 1 
        3  7138 1 1  80 ILE HG12 H  -0.831  -7.675 -17.830 1.00 . A A .  80 ILE HG12 1 1 
        3  7139 1 1  80 ILE HG13 H   0.738  -7.451 -18.581 1.00 . A A .  80 ILE HG13 1 1 
        3  7140 1 1  80 ILE HG21 H   1.574  -9.081 -20.302 1.00 . A A .  80 ILE HG21 1 1 
        3  7141 1 1  80 ILE HG22 H   0.143  -8.880 -21.314 1.00 . A A .  80 ILE HG22 1 1 
        3  7142 1 1  80 ILE HG23 H   0.610 -10.489 -20.759 1.00 . A A .  80 ILE HG23 1 1 
        3  7143 1 1  80 ILE N    N  -2.632  -9.516 -18.281 1.00 . A A .  80 ILE N    1 1 
        3  7144 1 1  80 ILE O    O  -1.906 -11.591 -21.030 1.00 . A A .  80 ILE O    1 1 
        3  7145 1 1  81 ASN C    C  -2.929 -14.162 -19.605 1.00 . A A .  81 ASN C    1 1 
        3  7146 1 1  81 ASN CA   C  -1.591 -13.610 -19.059 1.00 . A A .  81 ASN CA   1 1 
        3  7147 1 1  81 ASN CB   C  -1.209 -14.317 -17.729 1.00 . A A .  81 ASN CB   1 1 
        3  7148 1 1  81 ASN CG   C  -1.246 -15.859 -17.761 1.00 . A A .  81 ASN CG   1 1 
        3  7149 1 1  81 ASN H    H  -1.554 -11.792 -17.942 1.00 . A A .  81 ASN H    1 1 
        3  7150 1 1  81 ASN HA   H  -0.808 -13.806 -19.786 1.00 . A A .  81 ASN HA   1 1 
        3  7151 1 1  81 ASN HB2  H  -0.204 -14.025 -17.452 1.00 . A A .  81 ASN HB2  1 1 
        3  7152 1 1  81 ASN HB3  H  -1.886 -13.980 -16.951 1.00 . A A .  81 ASN HB3  1 1 
        3  7153 1 1  81 ASN HD21 H  -0.755 -15.954 -19.702 1.00 . A A .  81 ASN HD21 1 1 
        3  7154 1 1  81 ASN HD22 H  -1.011 -17.468 -18.914 1.00 . A A .  81 ASN HD22 1 1 
        3  7155 1 1  81 ASN N    N  -1.640 -12.141 -18.853 1.00 . A A .  81 ASN N    1 1 
        3  7156 1 1  81 ASN ND2  N  -0.974 -16.486 -18.908 1.00 . A A .  81 ASN ND2  1 1 
        3  7157 1 1  81 ASN O    O  -2.945 -14.920 -20.579 1.00 . A A .  81 ASN O    1 1 
        3  7158 1 1  81 ASN OD1  O  -1.512 -16.496 -16.739 1.00 . A A .  81 ASN OD1  1 1 
        3  7159 1 1  82 ASP C    C  -5.938 -13.571 -20.571 1.00 . A A .  82 ASP C    1 1 
        3  7160 1 1  82 ASP CA   C  -5.391 -14.246 -19.295 1.00 . A A .  82 ASP CA   1 1 
        3  7161 1 1  82 ASP CB   C  -6.324 -13.994 -18.076 1.00 . A A .  82 ASP CB   1 1 
        3  7162 1 1  82 ASP CG   C  -7.735 -14.570 -18.249 1.00 . A A .  82 ASP CG   1 1 
        3  7163 1 1  82 ASP H    H  -3.933 -13.083 -18.269 1.00 . A A .  82 ASP H    1 1 
        3  7164 1 1  82 ASP HA   H  -5.329 -15.321 -19.471 1.00 . A A .  82 ASP HA   1 1 
        3  7165 1 1  82 ASP HB2  H  -5.874 -14.444 -17.193 1.00 . A A .  82 ASP HB2  1 1 
        3  7166 1 1  82 ASP HB3  H  -6.401 -12.924 -17.897 1.00 . A A .  82 ASP HB3  1 1 
        3  7167 1 1  82 ASP N    N  -4.033 -13.750 -18.977 1.00 . A A .  82 ASP N    1 1 
        3  7168 1 1  82 ASP O    O  -6.757 -14.157 -21.300 1.00 . A A .  82 ASP O    1 1 
        3  7169 1 1  82 ASP OD1  O  -7.956 -15.749 -17.893 1.00 . A A .  82 ASP OD1  1 1 
        3  7170 1 1  82 ASP OD2  O  -8.630 -13.856 -18.734 1.00 . A A .  82 ASP OD2  1 1 
        3  7171 1 1  83 GLY C    C  -6.703 -10.374 -21.780 1.00 . A A .  83 GLY C    1 1 
        3  7172 1 1  83 GLY CA   C  -5.833 -11.597 -22.055 1.00 . A A .  83 GLY CA   1 1 
        3  7173 1 1  83 GLY H    H  -4.839 -11.935 -20.208 1.00 . A A .  83 GLY H    1 1 
        3  7174 1 1  83 GLY HA2  H  -4.925 -11.268 -22.543 1.00 . A A .  83 GLY HA2  1 1 
        3  7175 1 1  83 GLY HA3  H  -6.364 -12.250 -22.745 1.00 . A A .  83 GLY HA3  1 1 
        3  7176 1 1  83 GLY N    N  -5.460 -12.344 -20.845 1.00 . A A .  83 GLY N    1 1 
        3  7177 1 1  83 GLY O    O  -7.091  -9.674 -22.724 1.00 . A A .  83 GLY O    1 1 
        3  7178 1 1  84 VAL C    C  -6.990  -7.668 -20.368 1.00 . A A .  84 VAL C    1 1 
        3  7179 1 1  84 VAL CA   C  -7.798  -8.948 -20.065 1.00 . A A .  84 VAL CA   1 1 
        3  7180 1 1  84 VAL CB   C  -8.167  -8.997 -18.528 1.00 . A A .  84 VAL CB   1 1 
        3  7181 1 1  84 VAL CG1  C  -9.109  -7.833 -18.121 1.00 . A A .  84 VAL CG1  1 1 
        3  7182 1 1  84 VAL CG2  C  -8.771 -10.362 -18.142 1.00 . A A .  84 VAL CG2  1 1 
        3  7183 1 1  84 VAL H    H  -6.755 -10.784 -19.818 1.00 . A A .  84 VAL H    1 1 
        3  7184 1 1  84 VAL HA   H  -8.724  -8.938 -20.640 1.00 . A A .  84 VAL HA   1 1 
        3  7185 1 1  84 VAL HB   H  -7.244  -8.881 -17.964 1.00 . A A .  84 VAL HB   1 1 
        3  7186 1 1  84 VAL HG11 H -10.043  -7.906 -18.667 1.00 . A A .  84 VAL HG11 1 1 
        3  7187 1 1  84 VAL HG12 H  -8.640  -6.885 -18.350 1.00 . A A .  84 VAL HG12 1 1 
        3  7188 1 1  84 VAL HG13 H  -9.310  -7.881 -17.057 1.00 . A A .  84 VAL HG13 1 1 
        3  7189 1 1  84 VAL HG21 H  -8.971 -10.383 -17.079 1.00 . A A .  84 VAL HG21 1 1 
        3  7190 1 1  84 VAL HG22 H  -8.074 -11.155 -18.388 1.00 . A A .  84 VAL HG22 1 1 
        3  7191 1 1  84 VAL HG23 H  -9.697 -10.522 -18.681 1.00 . A A .  84 VAL HG23 1 1 
        3  7192 1 1  84 VAL N    N  -7.031 -10.134 -20.494 1.00 . A A .  84 VAL N    1 1 
        3  7193 1 1  84 VAL O    O  -5.872  -7.491 -19.869 1.00 . A A .  84 VAL O    1 1 
        3  7194 1 1  85 THR C    C  -7.579  -4.319 -20.896 1.00 . A A .  85 THR C    1 1 
        3  7195 1 1  85 THR CA   C  -6.937  -5.527 -21.609 1.00 . A A .  85 THR CA   1 1 
        3  7196 1 1  85 THR CB   C  -7.011  -5.373 -23.168 1.00 . A A .  85 THR CB   1 1 
        3  7197 1 1  85 THR CG2  C  -6.040  -6.333 -23.890 1.00 . A A .  85 THR CG2  1 1 
        3  7198 1 1  85 THR H    H  -8.488  -6.978 -21.457 1.00 . A A .  85 THR H    1 1 
        3  7199 1 1  85 THR HA   H  -5.884  -5.552 -21.327 1.00 . A A .  85 THR HA   1 1 
        3  7200 1 1  85 THR HB   H  -6.746  -4.353 -23.433 1.00 . A A .  85 THR HB   1 1 
        3  7201 1 1  85 THR HG1  H  -8.983  -5.224 -22.995 1.00 . A A .  85 THR HG1  1 1 
        3  7202 1 1  85 THR HG21 H  -6.282  -7.359 -23.642 1.00 . A A .  85 THR HG21 1 1 
        3  7203 1 1  85 THR HG22 H  -5.021  -6.122 -23.585 1.00 . A A .  85 THR HG22 1 1 
        3  7204 1 1  85 THR HG23 H  -6.124  -6.198 -24.961 1.00 . A A .  85 THR HG23 1 1 
        3  7205 1 1  85 THR N    N  -7.569  -6.786 -21.180 1.00 . A A .  85 THR N    1 1 
        3  7206 1 1  85 THR O    O  -7.258  -3.168 -21.203 1.00 . A A .  85 THR O    1 1 
        3  7207 1 1  85 THR OG1  O  -8.356  -5.621 -23.620 1.00 . A A .  85 THR OG1  1 1 
        3  7208 1 1  86 SER C    C  -8.730  -3.642 -17.661 1.00 . A A .  86 SER C    1 1 
        3  7209 1 1  86 SER CA   C  -9.158  -3.569 -19.132 1.00 . A A .  86 SER CA   1 1 
        3  7210 1 1  86 SER CB   C -10.690  -3.759 -19.256 1.00 . A A .  86 SER CB   1 1 
        3  7211 1 1  86 SER H    H  -8.624  -5.531 -19.677 1.00 . A A .  86 SER H    1 1 
        3  7212 1 1  86 SER HA   H  -8.897  -2.587 -19.531 1.00 . A A .  86 SER HA   1 1 
        3  7213 1 1  86 SER HB2  H -10.972  -4.729 -18.869 1.00 . A A .  86 SER HB2  1 1 
        3  7214 1 1  86 SER HB3  H -11.204  -2.984 -18.697 1.00 . A A .  86 SER HB3  1 1 
        3  7215 1 1  86 SER HG   H -10.580  -3.020 -21.071 1.00 . A A .  86 SER HG   1 1 
        3  7216 1 1  86 SER N    N  -8.454  -4.597 -19.908 1.00 . A A .  86 SER N    1 1 
        3  7217 1 1  86 SER O    O  -9.066  -4.604 -16.957 1.00 . A A .  86 SER O    1 1 
        3  7218 1 1  86 SER OG   O -11.112  -3.684 -20.605 1.00 . A A .  86 SER OG   1 1 
        3  7219 1 1  87 THR C    C  -8.807  -2.042 -14.952 1.00 . A A .  87 THR C    1 1 
        3  7220 1 1  87 THR CA   C  -7.593  -2.447 -15.812 1.00 . A A .  87 THR CA   1 1 
        3  7221 1 1  87 THR CB   C  -6.463  -1.390 -15.667 1.00 . A A .  87 THR CB   1 1 
        3  7222 1 1  87 THR CG2  C  -5.101  -1.921 -16.147 1.00 . A A .  87 THR CG2  1 1 
        3  7223 1 1  87 THR H    H  -7.628  -1.995 -17.874 1.00 . A A .  87 THR H    1 1 
        3  7224 1 1  87 THR HA   H  -7.219  -3.394 -15.439 1.00 . A A .  87 THR HA   1 1 
        3  7225 1 1  87 THR HB   H  -6.370  -1.129 -14.615 1.00 . A A .  87 THR HB   1 1 
        3  7226 1 1  87 THR HG1  H  -6.750   0.556 -15.819 1.00 . A A .  87 THR HG1  1 1 
        3  7227 1 1  87 THR HG21 H  -5.162  -2.192 -17.194 1.00 . A A .  87 THR HG21 1 1 
        3  7228 1 1  87 THR HG22 H  -4.820  -2.793 -15.568 1.00 . A A .  87 THR HG22 1 1 
        3  7229 1 1  87 THR HG23 H  -4.343  -1.156 -16.023 1.00 . A A .  87 THR HG23 1 1 
        3  7230 1 1  87 THR N    N  -7.968  -2.635 -17.222 1.00 . A A .  87 THR N    1 1 
        3  7231 1 1  87 THR O    O  -8.806  -2.238 -13.729 1.00 . A A .  87 THR O    1 1 
        3  7232 1 1  87 THR OG1  O  -6.810  -0.208 -16.403 1.00 . A A .  87 THR OG1  1 1 
        3  7233 1 1  88 GLU C    C -11.957  -2.331 -14.468 1.00 . A A .  88 GLU C    1 1 
        3  7234 1 1  88 GLU CA   C -11.144  -1.136 -15.005 1.00 . A A .  88 GLU CA   1 1 
        3  7235 1 1  88 GLU CB   C -11.981  -0.319 -16.013 1.00 . A A .  88 GLU CB   1 1 
        3  7236 1 1  88 GLU CD   C -12.175   1.776 -17.461 1.00 . A A .  88 GLU CD   1 1 
        3  7237 1 1  88 GLU CG   C -11.347   1.022 -16.413 1.00 . A A .  88 GLU CG   1 1 
        3  7238 1 1  88 GLU H    H  -9.771  -1.425 -16.595 1.00 . A A .  88 GLU H    1 1 
        3  7239 1 1  88 GLU HA   H -10.908  -0.493 -14.164 1.00 . A A .  88 GLU HA   1 1 
        3  7240 1 1  88 GLU HB2  H -12.121  -0.914 -16.913 1.00 . A A .  88 GLU HB2  1 1 
        3  7241 1 1  88 GLU HB3  H -12.962  -0.116 -15.580 1.00 . A A .  88 GLU HB3  1 1 
        3  7242 1 1  88 GLU HG2  H -11.247   1.641 -15.524 1.00 . A A .  88 GLU HG2  1 1 
        3  7243 1 1  88 GLU HG3  H -10.356   0.828 -16.811 1.00 . A A .  88 GLU HG3  1 1 
        3  7244 1 1  88 GLU N    N  -9.861  -1.537 -15.627 1.00 . A A .  88 GLU N    1 1 
        3  7245 1 1  88 GLU O    O -13.050  -2.144 -13.931 1.00 . A A .  88 GLU O    1 1 
        3  7246 1 1  88 GLU OE1  O -13.069   2.559 -17.083 1.00 . A A .  88 GLU OE1  1 1 
        3  7247 1 1  88 GLU OE2  O -11.937   1.581 -18.672 1.00 . A A .  88 GLU OE2  1 1 
        3  7248 1 1  89 GLU C    C -11.291  -5.368 -12.946 1.00 . A A .  89 GLU C    1 1 
        3  7249 1 1  89 GLU CA   C -12.062  -4.774 -14.146 1.00 . A A .  89 GLU CA   1 1 
        3  7250 1 1  89 GLU CB   C -12.087  -5.774 -15.331 1.00 . A A .  89 GLU CB   1 1 
        3  7251 1 1  89 GLU CD   C -12.831  -8.053 -16.217 1.00 . A A .  89 GLU CD   1 1 
        3  7252 1 1  89 GLU CG   C -12.977  -7.009 -15.108 1.00 . A A .  89 GLU CG   1 1 
        3  7253 1 1  89 GLU H    H -10.489  -3.625 -14.884 1.00 . A A .  89 GLU H    1 1 
        3  7254 1 1  89 GLU HA   H -13.084  -4.555 -13.837 1.00 . A A .  89 GLU HA   1 1 
        3  7255 1 1  89 GLU HB2  H -12.449  -5.254 -16.214 1.00 . A A .  89 GLU HB2  1 1 
        3  7256 1 1  89 GLU HB3  H -11.070  -6.111 -15.529 1.00 . A A .  89 GLU HB3  1 1 
        3  7257 1 1  89 GLU HG2  H -12.715  -7.463 -14.152 1.00 . A A .  89 GLU HG2  1 1 
        3  7258 1 1  89 GLU HG3  H -14.012  -6.685 -15.061 1.00 . A A .  89 GLU HG3  1 1 
        3  7259 1 1  89 GLU N    N -11.405  -3.543 -14.579 1.00 . A A .  89 GLU N    1 1 
        3  7260 1 1  89 GLU O    O -11.802  -6.228 -12.229 1.00 . A A .  89 GLU O    1 1 
        3  7261 1 1  89 GLU OE1  O -13.466  -7.902 -17.280 1.00 . A A .  89 GLU OE1  1 1 
        3  7262 1 1  89 GLU OE2  O -12.077  -9.027 -16.028 1.00 . A A .  89 GLU OE2  1 1 
        3  7263 1 1  90 LEU C    C  -9.151  -4.748 -10.415 1.00 . A A .  90 LEU C    1 1 
        3  7264 1 1  90 LEU CA   C  -9.096  -5.482 -11.778 1.00 . A A .  90 LEU CA   1 1 
        3  7265 1 1  90 LEU CB   C  -7.641  -5.431 -12.351 1.00 . A A .  90 LEU CB   1 1 
        3  7266 1 1  90 LEU CD1  C  -5.965  -5.468 -14.283 1.00 . A A .  90 LEU CD1  1 1 
        3  7267 1 1  90 LEU CD2  C  -8.103  -6.832 -14.471 1.00 . A A .  90 LEU CD2  1 1 
        3  7268 1 1  90 LEU CG   C  -7.457  -5.563 -13.897 1.00 . A A .  90 LEU CG   1 1 
        3  7269 1 1  90 LEU H    H  -9.761  -4.095 -13.231 1.00 . A A .  90 LEU H    1 1 
        3  7270 1 1  90 LEU HA   H  -9.374  -6.526 -11.627 1.00 . A A .  90 LEU HA   1 1 
        3  7271 1 1  90 LEU HB2  H  -7.192  -4.491 -12.051 1.00 . A A .  90 LEU HB2  1 1 
        3  7272 1 1  90 LEU HB3  H  -7.075  -6.227 -11.880 1.00 . A A .  90 LEU HB3  1 1 
        3  7273 1 1  90 LEU HD11 H  -5.566  -4.524 -13.944 1.00 . A A .  90 LEU HD11 1 1 
        3  7274 1 1  90 LEU HD12 H  -5.860  -5.529 -15.359 1.00 . A A .  90 LEU HD12 1 1 
        3  7275 1 1  90 LEU HD13 H  -5.409  -6.279 -13.824 1.00 . A A .  90 LEU HD13 1 1 
        3  7276 1 1  90 LEU HD21 H  -9.157  -6.832 -14.235 1.00 . A A .  90 LEU HD21 1 1 
        3  7277 1 1  90 LEU HD22 H  -7.637  -7.714 -14.052 1.00 . A A .  90 LEU HD22 1 1 
        3  7278 1 1  90 LEU HD23 H  -7.986  -6.833 -15.549 1.00 . A A .  90 LEU HD23 1 1 
        3  7279 1 1  90 LEU HG   H  -7.950  -4.719 -14.367 1.00 . A A .  90 LEU HG   1 1 
        3  7280 1 1  90 LEU N    N -10.047  -4.881 -12.732 1.00 . A A .  90 LEU N    1 1 
        3  7281 1 1  90 LEU O    O  -9.468  -5.363  -9.389 1.00 . A A .  90 LEU O    1 1 
        3  7282 1 1  91 SER C    C  -8.521  -1.098  -9.493 1.00 . A A .  91 SER C    1 1 
        3  7283 1 1  91 SER CA   C  -8.714  -2.611  -9.200 1.00 . A A .  91 SER CA   1 1 
        3  7284 1 1  91 SER CB   C  -7.531  -3.154  -8.345 1.00 . A A .  91 SER CB   1 1 
        3  7285 1 1  91 SER H    H  -8.901  -2.954 -11.309 1.00 . A A .  91 SER H    1 1 
        3  7286 1 1  91 SER HA   H  -9.627  -2.723  -8.621 1.00 . A A .  91 SER HA   1 1 
        3  7287 1 1  91 SER HB2  H  -7.352  -2.497  -7.501 1.00 . A A .  91 SER HB2  1 1 
        3  7288 1 1  91 SER HB3  H  -7.783  -4.139  -7.973 1.00 . A A .  91 SER HB3  1 1 
        3  7289 1 1  91 SER HG   H  -6.036  -2.377  -9.348 1.00 . A A .  91 SER HG   1 1 
        3  7290 1 1  91 SER N    N  -8.891  -3.414 -10.440 1.00 . A A .  91 SER N    1 1 
        3  7291 1 1  91 SER O    O  -7.393  -0.637  -9.699 1.00 . A A .  91 SER O    1 1 
        3  7292 1 1  91 SER OG   O  -6.330  -3.259  -9.091 1.00 . A A .  91 SER OG   1 1 
        3  7293 1 1  92 ILE C    C -10.445   1.896  -8.681 1.00 . A A .  92 ILE C    1 1 
        3  7294 1 1  92 ILE CA   C  -9.642   1.134  -9.783 1.00 . A A .  92 ILE CA   1 1 
        3  7295 1 1  92 ILE CB   C -10.269   1.408 -11.226 1.00 . A A .  92 ILE CB   1 1 
        3  7296 1 1  92 ILE CD1  C  -8.043   0.911 -12.481 1.00 . A A .  92 ILE CD1  1 1 
        3  7297 1 1  92 ILE CG1  C  -9.519   0.600 -12.335 1.00 . A A .  92 ILE CG1  1 1 
        3  7298 1 1  92 ILE CG2  C -10.303   2.916 -11.590 1.00 . A A .  92 ILE CG2  1 1 
        3  7299 1 1  92 ILE H    H -10.495  -0.760  -9.293 1.00 . A A .  92 ILE H    1 1 
        3  7300 1 1  92 ILE HA   H  -8.617   1.496  -9.779 1.00 . A A .  92 ILE HA   1 1 
        3  7301 1 1  92 ILE HB   H -11.300   1.063 -11.201 1.00 . A A .  92 ILE HB   1 1 
        3  7302 1 1  92 ILE HD11 H  -7.916   1.945 -12.765 1.00 . A A .  92 ILE HD11 1 1 
        3  7303 1 1  92 ILE HD12 H  -7.617   0.276 -13.248 1.00 . A A .  92 ILE HD12 1 1 
        3  7304 1 1  92 ILE HD13 H  -7.535   0.727 -11.539 1.00 . A A .  92 ILE HD13 1 1 
        3  7305 1 1  92 ILE HG12 H  -9.594  -0.460 -12.121 1.00 . A A .  92 ILE HG12 1 1 
        3  7306 1 1  92 ILE HG13 H  -9.986   0.785 -13.298 1.00 . A A .  92 ILE HG13 1 1 
        3  7307 1 1  92 ILE HG21 H  -9.297   3.318 -11.594 1.00 . A A .  92 ILE HG21 1 1 
        3  7308 1 1  92 ILE HG22 H -10.895   3.448 -10.857 1.00 . A A .  92 ILE HG22 1 1 
        3  7309 1 1  92 ILE HG23 H -10.747   3.048 -12.567 1.00 . A A .  92 ILE HG23 1 1 
        3  7310 1 1  92 ILE N    N  -9.638  -0.334  -9.499 1.00 . A A .  92 ILE N    1 1 
        3  7311 1 1  92 ILE O    O -11.241   1.287  -7.953 1.00 . A A .  92 ILE O    1 1 
        3  7312 1 1  93 THR C    C -12.496   4.069  -7.946 1.00 . A A .  93 THR C    1 1 
        3  7313 1 1  93 THR CA   C -10.964   4.153  -7.693 1.00 . A A .  93 THR CA   1 1 
        3  7314 1 1  93 THR CB   C -10.466   5.619  -7.951 1.00 . A A .  93 THR CB   1 1 
        3  7315 1 1  93 THR CG2  C -11.082   6.650  -6.983 1.00 . A A .  93 THR CG2  1 1 
        3  7316 1 1  93 THR H    H  -9.471   3.601  -9.089 1.00 . A A .  93 THR H    1 1 
        3  7317 1 1  93 THR HA   H -10.754   3.897  -6.661 1.00 . A A .  93 THR HA   1 1 
        3  7318 1 1  93 THR HB   H -10.722   5.901  -8.973 1.00 . A A .  93 THR HB   1 1 
        3  7319 1 1  93 THR HG1  H  -8.653   5.911  -8.665 1.00 . A A .  93 THR HG1  1 1 
        3  7320 1 1  93 THR HG21 H -10.696   7.642  -7.206 1.00 . A A .  93 THR HG21 1 1 
        3  7321 1 1  93 THR HG22 H -10.826   6.388  -5.967 1.00 . A A .  93 THR HG22 1 1 
        3  7322 1 1  93 THR HG23 H -12.157   6.658  -7.093 1.00 . A A .  93 THR HG23 1 1 
        3  7323 1 1  93 THR N    N -10.202   3.223  -8.565 1.00 . A A .  93 THR N    1 1 
        3  7324 1 1  93 THR O    O -12.925   3.628  -9.022 1.00 . A A .  93 THR O    1 1 
        3  7325 1 1  93 THR OG1  O  -9.041   5.666  -7.818 1.00 . A A .  93 THR OG1  1 1 
        3  7326 1 1  94 ARG C    C -15.517   3.195  -7.145 1.00 . A A .  94 ARG C    1 1 
        3  7327 1 1  94 ARG CA   C -14.791   4.538  -6.903 1.00 . A A .  94 ARG CA   1 1 
        3  7328 1 1  94 ARG CB   C -15.377   5.728  -7.769 1.00 . A A .  94 ARG CB   1 1 
        3  7329 1 1  94 ARG CD   C -16.268   5.404 -10.217 1.00 . A A .  94 ARG CD   1 1 
        3  7330 1 1  94 ARG CG   C -15.073   5.759  -9.306 1.00 . A A .  94 ARG CG   1 1 
        3  7331 1 1  94 ARG CZ   C -16.301   2.903 -10.429 1.00 . A A .  94 ARG CZ   1 1 
        3  7332 1 1  94 ARG H    H -12.843   4.703  -6.072 1.00 . A A .  94 ARG H    1 1 
        3  7333 1 1  94 ARG HA   H -15.019   4.786  -5.867 1.00 . A A .  94 ARG HA   1 1 
        3  7334 1 1  94 ARG HB2  H -16.458   5.738  -7.642 1.00 . A A .  94 ARG HB2  1 1 
        3  7335 1 1  94 ARG HB3  H -15.002   6.652  -7.338 1.00 . A A .  94 ARG HB3  1 1 
        3  7336 1 1  94 ARG HD2  H -17.051   6.129 -10.052 1.00 . A A .  94 ARG HD2  1 1 
        3  7337 1 1  94 ARG HD3  H -15.944   5.472 -11.252 1.00 . A A .  94 ARG HD3  1 1 
        3  7338 1 1  94 ARG HE   H -17.650   4.019  -9.441 1.00 . A A .  94 ARG HE   1 1 
        3  7339 1 1  94 ARG HG2  H -14.732   6.753  -9.578 1.00 . A A .  94 ARG HG2  1 1 
        3  7340 1 1  94 ARG HG3  H -14.274   5.063  -9.515 1.00 . A A .  94 ARG HG3  1 1 
        3  7341 1 1  94 ARG HH11 H -14.698   3.731 -11.368 1.00 . A A .  94 ARG HH11 1 1 
        3  7342 1 1  94 ARG HH12 H -14.797   2.001 -11.475 1.00 . A A .  94 ARG HH12 1 1 
        3  7343 1 1  94 ARG HH21 H -17.776   1.770  -9.617 1.00 . A A .  94 ARG HH21 1 1 
        3  7344 1 1  94 ARG HH22 H -16.548   0.899 -10.482 1.00 . A A .  94 ARG HH22 1 1 
        3  7345 1 1  94 ARG N    N -13.299   4.458  -6.912 1.00 . A A .  94 ARG N    1 1 
        3  7346 1 1  94 ARG NE   N -16.829   4.060  -9.984 1.00 . A A .  94 ARG NE   1 1 
        3  7347 1 1  94 ARG NH1  N -15.177   2.876 -11.151 1.00 . A A .  94 ARG NH1  1 1 
        3  7348 1 1  94 ARG NH2  N -16.931   1.770 -10.156 1.00 . A A .  94 ARG NH2  1 1 
        3  7349 1 1  94 ARG O    O -16.761   3.160  -7.130 1.00 . A A .  94 ARG O    1 1 
        3  7350 1 1  95 ASP C    C -15.657   0.276  -5.989 1.00 . A A .  95 ASP C    1 1 
        3  7351 1 1  95 ASP CA   C -15.325   0.737  -7.402 1.00 . A A .  95 ASP CA   1 1 
        3  7352 1 1  95 ASP CB   C -14.357  -0.265  -8.088 1.00 . A A .  95 ASP CB   1 1 
        3  7353 1 1  95 ASP CG   C -14.273  -0.093  -9.608 1.00 . A A .  95 ASP CG   1 1 
        3  7354 1 1  95 ASP H    H -13.801   2.193  -7.469 1.00 . A A .  95 ASP H    1 1 
        3  7355 1 1  95 ASP HA   H -16.249   0.780  -7.970 1.00 . A A .  95 ASP HA   1 1 
        3  7356 1 1  95 ASP HB2  H -13.364  -0.134  -7.663 1.00 . A A .  95 ASP HB2  1 1 
        3  7357 1 1  95 ASP HB3  H -14.680  -1.282  -7.879 1.00 . A A .  95 ASP HB3  1 1 
        3  7358 1 1  95 ASP N    N -14.762   2.090  -7.346 1.00 . A A .  95 ASP N    1 1 
        3  7359 1 1  95 ASP O    O -14.793  -0.252  -5.303 1.00 . A A .  95 ASP O    1 1 
        3  7360 1 1  95 ASP OD1  O -15.197  -0.543 -10.311 1.00 . A A .  95 ASP OD1  1 1 
        3  7361 1 1  95 ASP OD2  O -13.303   0.492 -10.113 1.00 . A A .  95 ASP OD2  1 1 
        3  7362 1 1  96 CYS C    C -17.192  -1.338  -3.880 1.00 . A A .  96 CYS C    1 1 
        3  7363 1 1  96 CYS CA   C -17.403   0.157  -4.215 1.00 . A A .  96 CYS CA   1 1 
        3  7364 1 1  96 CYS CB   C -18.884   0.554  -4.111 1.00 . A A .  96 CYS CB   1 1 
        3  7365 1 1  96 CYS H    H -17.546   0.898  -6.200 1.00 . A A .  96 CYS H    1 1 
        3  7366 1 1  96 CYS HA   H -16.834   0.757  -3.513 1.00 . A A .  96 CYS HA   1 1 
        3  7367 1 1  96 CYS HB2  H -19.481  -0.065  -4.778 1.00 . A A .  96 CYS HB2  1 1 
        3  7368 1 1  96 CYS HB3  H -19.230   0.414  -3.094 1.00 . A A .  96 CYS HB3  1 1 
        3  7369 1 1  96 CYS HG   H -18.366   2.592  -5.560 1.00 . A A .  96 CYS HG   1 1 
        3  7370 1 1  96 CYS N    N -16.912   0.493  -5.569 1.00 . A A .  96 CYS N    1 1 
        3  7371 1 1  96 CYS O    O -16.994  -1.700  -2.714 1.00 . A A .  96 CYS O    1 1 
        3  7372 1 1  96 CYS SG   S -19.188   2.280  -4.556 1.00 . A A .  96 CYS SG   1 1 
        3  7373 1 1  97 GLU C    C -15.393  -3.790  -4.416 1.00 . A A .  97 GLU C    1 1 
        3  7374 1 1  97 GLU CA   C -16.864  -3.612  -4.845 1.00 . A A .  97 GLU CA   1 1 
        3  7375 1 1  97 GLU CB   C -17.122  -4.307  -6.206 1.00 . A A .  97 GLU CB   1 1 
        3  7376 1 1  97 GLU CD   C -17.738  -6.611  -5.215 1.00 . A A .  97 GLU CD   1 1 
        3  7377 1 1  97 GLU CG   C -16.868  -5.831  -6.224 1.00 . A A .  97 GLU CG   1 1 
        3  7378 1 1  97 GLU H    H -17.431  -1.820  -5.822 1.00 . A A .  97 GLU H    1 1 
        3  7379 1 1  97 GLU HA   H -17.509  -4.054  -4.096 1.00 . A A .  97 GLU HA   1 1 
        3  7380 1 1  97 GLU HB2  H -18.154  -4.132  -6.493 1.00 . A A .  97 GLU HB2  1 1 
        3  7381 1 1  97 GLU HB3  H -16.483  -3.847  -6.959 1.00 . A A .  97 GLU HB3  1 1 
        3  7382 1 1  97 GLU HG2  H -17.075  -6.207  -7.221 1.00 . A A .  97 GLU HG2  1 1 
        3  7383 1 1  97 GLU HG3  H -15.819  -6.009  -6.001 1.00 . A A .  97 GLU HG3  1 1 
        3  7384 1 1  97 GLU N    N -17.199  -2.184  -4.937 1.00 . A A .  97 GLU N    1 1 
        3  7385 1 1  97 GLU O    O -15.094  -4.584  -3.530 1.00 . A A .  97 GLU O    1 1 
        3  7386 1 1  97 GLU OE1  O -18.954  -6.776  -5.466 1.00 . A A .  97 GLU OE1  1 1 
        3  7387 1 1  97 GLU OE2  O -17.222  -7.050  -4.159 1.00 . A A .  97 GLU OE2  1 1 
        3  7388 1 1  98 LEU C    C -12.802  -2.453  -3.305 1.00 . A A .  98 LEU C    1 1 
        3  7389 1 1  98 LEU CA   C -13.049  -3.021  -4.720 1.00 . A A .  98 LEU CA   1 1 
        3  7390 1 1  98 LEU CB   C -12.216  -2.194  -5.733 1.00 . A A .  98 LEU CB   1 1 
        3  7391 1 1  98 LEU CD1  C -10.054  -3.580  -5.796 1.00 . A A .  98 LEU CD1  1 1 
        3  7392 1 1  98 LEU CD2  C  -9.954  -1.045  -6.163 1.00 . A A .  98 LEU CD2  1 1 
        3  7393 1 1  98 LEU CG   C -10.676  -2.208  -5.463 1.00 . A A .  98 LEU CG   1 1 
        3  7394 1 1  98 LEU H    H -14.798  -2.411  -5.764 1.00 . A A .  98 LEU H    1 1 
        3  7395 1 1  98 LEU HA   H -12.714  -4.056  -4.751 1.00 . A A .  98 LEU HA   1 1 
        3  7396 1 1  98 LEU HB2  H -12.407  -2.580  -6.733 1.00 . A A .  98 LEU HB2  1 1 
        3  7397 1 1  98 LEU HB3  H -12.567  -1.166  -5.698 1.00 . A A .  98 LEU HB3  1 1 
        3  7398 1 1  98 LEU HD11 H -10.527  -4.351  -5.198 1.00 . A A .  98 LEU HD11 1 1 
        3  7399 1 1  98 LEU HD12 H  -8.997  -3.560  -5.568 1.00 . A A .  98 LEU HD12 1 1 
        3  7400 1 1  98 LEU HD13 H -10.190  -3.805  -6.846 1.00 . A A .  98 LEU HD13 1 1 
        3  7401 1 1  98 LEU HD21 H -10.092  -1.115  -7.233 1.00 . A A .  98 LEU HD21 1 1 
        3  7402 1 1  98 LEU HD22 H  -8.899  -1.082  -5.932 1.00 . A A .  98 LEU HD22 1 1 
        3  7403 1 1  98 LEU HD23 H -10.359  -0.104  -5.811 1.00 . A A .  98 LEU HD23 1 1 
        3  7404 1 1  98 LEU HG   H -10.522  -2.064  -4.395 1.00 . A A .  98 LEU HG   1 1 
        3  7405 1 1  98 LEU N    N -14.486  -3.011  -5.051 1.00 . A A .  98 LEU N    1 1 
        3  7406 1 1  98 LEU O    O -11.900  -2.902  -2.617 1.00 . A A .  98 LEU O    1 1 
        3  7407 1 1  99 TYR C    C -13.865  -2.013  -0.516 1.00 . A A .  99 TYR C    1 1 
        3  7408 1 1  99 TYR CA   C -13.559  -0.887  -1.531 1.00 . A A .  99 TYR CA   1 1 
        3  7409 1 1  99 TYR CB   C -14.567   0.295  -1.379 1.00 . A A .  99 TYR CB   1 1 
        3  7410 1 1  99 TYR CD1  C -13.847   1.816  -3.332 1.00 . A A .  99 TYR CD1  1 1 
        3  7411 1 1  99 TYR CD2  C -14.019   2.792  -1.161 1.00 . A A .  99 TYR CD2  1 1 
        3  7412 1 1  99 TYR CE1  C -13.488   3.042  -3.852 1.00 . A A .  99 TYR CE1  1 1 
        3  7413 1 1  99 TYR CE2  C -13.654   4.020  -1.682 1.00 . A A .  99 TYR CE2  1 1 
        3  7414 1 1  99 TYR CG   C -14.123   1.655  -1.973 1.00 . A A .  99 TYR CG   1 1 
        3  7415 1 1  99 TYR CZ   C -13.394   4.139  -3.030 1.00 . A A .  99 TYR CZ   1 1 
        3  7416 1 1  99 TYR H    H -14.245  -1.072  -3.540 1.00 . A A .  99 TYR H    1 1 
        3  7417 1 1  99 TYR HA   H -12.552  -0.523  -1.356 1.00 . A A .  99 TYR HA   1 1 
        3  7418 1 1  99 TYR HB2  H -15.502   0.027  -1.860 1.00 . A A .  99 TYR HB2  1 1 
        3  7419 1 1  99 TYR HB3  H -14.770   0.446  -0.321 1.00 . A A .  99 TYR HB3  1 1 
        3  7420 1 1  99 TYR HD1  H -13.920   0.963  -3.994 1.00 . A A .  99 TYR HD1  1 1 
        3  7421 1 1  99 TYR HD2  H -14.220   2.701  -0.098 1.00 . A A .  99 TYR HD2  1 1 
        3  7422 1 1  99 TYR HE1  H -13.275   3.134  -4.909 1.00 . A A .  99 TYR HE1  1 1 
        3  7423 1 1  99 TYR HE2  H -13.579   4.883  -1.032 1.00 . A A .  99 TYR HE2  1 1 
        3  7424 1 1  99 TYR HH   H -12.352   5.761  -3.022 1.00 . A A .  99 TYR HH   1 1 
        3  7425 1 1  99 TYR N    N -13.602  -1.443  -2.903 1.00 . A A .  99 TYR N    1 1 
        3  7426 1 1  99 TYR O    O -13.109  -2.232   0.434 1.00 . A A .  99 TYR O    1 1 
        3  7427 1 1  99 TYR OH   O -13.034   5.357  -3.567 1.00 . A A .  99 TYR OH   1 1 
        3  7428 1 1 100 ARG C    C -14.337  -5.101  -0.107 1.00 . A A . 100 ARG C    1 1 
        3  7429 1 1 100 ARG CA   C -15.360  -3.953  -0.015 1.00 . A A . 100 ARG CA   1 1 
        3  7430 1 1 100 ARG CB   C -16.769  -4.468  -0.450 1.00 . A A . 100 ARG CB   1 1 
        3  7431 1 1 100 ARG CD   C -18.088  -3.652   1.610 1.00 . A A . 100 ARG CD   1 1 
        3  7432 1 1 100 ARG CG   C -17.964  -3.638   0.069 1.00 . A A . 100 ARG CG   1 1 
        3  7433 1 1 100 ARG CZ   C -19.273  -2.037   3.133 1.00 . A A . 100 ARG CZ   1 1 
        3  7434 1 1 100 ARG H    H -15.451  -2.546  -1.624 1.00 . A A . 100 ARG H    1 1 
        3  7435 1 1 100 ARG HA   H -15.417  -3.628   1.022 1.00 . A A . 100 ARG HA   1 1 
        3  7436 1 1 100 ARG HB2  H -16.817  -4.478  -1.536 1.00 . A A . 100 ARG HB2  1 1 
        3  7437 1 1 100 ARG HB3  H -16.900  -5.488  -0.099 1.00 . A A . 100 ARG HB3  1 1 
        3  7438 1 1 100 ARG HD2  H -18.194  -4.676   1.948 1.00 . A A . 100 ARG HD2  1 1 
        3  7439 1 1 100 ARG HD3  H -17.182  -3.229   2.038 1.00 . A A . 100 ARG HD3  1 1 
        3  7440 1 1 100 ARG HE   H -20.088  -2.996   1.574 1.00 . A A . 100 ARG HE   1 1 
        3  7441 1 1 100 ARG HG2  H -17.846  -2.614  -0.262 1.00 . A A . 100 ARG HG2  1 1 
        3  7442 1 1 100 ARG HG3  H -18.877  -4.040  -0.358 1.00 . A A . 100 ARG HG3  1 1 
        3  7443 1 1 100 ARG HH11 H -17.313  -2.287   3.641 1.00 . A A . 100 ARG HH11 1 1 
        3  7444 1 1 100 ARG HH12 H -18.206  -1.188   4.648 1.00 . A A . 100 ARG HH12 1 1 
        3  7445 1 1 100 ARG HH21 H -21.226  -1.571   2.907 1.00 . A A . 100 ARG HH21 1 1 
        3  7446 1 1 100 ARG HH22 H -20.426  -0.785   4.229 1.00 . A A . 100 ARG HH22 1 1 
        3  7447 1 1 100 ARG N    N -14.940  -2.779  -0.815 1.00 . A A . 100 ARG N    1 1 
        3  7448 1 1 100 ARG NE   N -19.255  -2.878   2.078 1.00 . A A . 100 ARG NE   1 1 
        3  7449 1 1 100 ARG NH1  N -18.178  -1.822   3.869 1.00 . A A . 100 ARG NH1  1 1 
        3  7450 1 1 100 ARG NH2  N -20.403  -1.420   3.450 1.00 . A A . 100 ARG NH2  1 1 
        3  7451 1 1 100 ARG O    O -14.153  -5.837   0.861 1.00 . A A . 100 ARG O    1 1 
        3  7452 1 1 101 ALA C    C -11.427  -6.108  -0.732 1.00 . A A . 101 ALA C    1 1 
        3  7453 1 1 101 ALA CA   C -12.718  -6.334  -1.525 1.00 . A A . 101 ALA CA   1 1 
        3  7454 1 1 101 ALA CB   C -12.423  -6.464  -3.032 1.00 . A A . 101 ALA CB   1 1 
        3  7455 1 1 101 ALA H    H -13.753  -4.540  -1.961 1.00 . A A . 101 ALA H    1 1 
        3  7456 1 1 101 ALA HA   H -13.191  -7.259  -1.194 1.00 . A A . 101 ALA HA   1 1 
        3  7457 1 1 101 ALA HB1  H -13.348  -6.627  -3.572 1.00 . A A . 101 ALA HB1  1 1 
        3  7458 1 1 101 ALA HB2  H -11.759  -7.299  -3.201 1.00 . A A . 101 ALA HB2  1 1 
        3  7459 1 1 101 ALA HB3  H -11.957  -5.554  -3.393 1.00 . A A . 101 ALA HB3  1 1 
        3  7460 1 1 101 ALA N    N -13.659  -5.232  -1.268 1.00 . A A . 101 ALA N    1 1 
        3  7461 1 1 101 ALA O    O -11.063  -6.938   0.092 1.00 . A A . 101 ALA O    1 1 
        3  7462 1 1 102 LEU C    C  -9.782  -4.421   1.254 1.00 . A A . 102 LEU C    1 1 
        3  7463 1 1 102 LEU CA   C  -9.549  -4.519  -0.268 1.00 . A A . 102 LEU CA   1 1 
        3  7464 1 1 102 LEU CB   C  -9.032  -3.159  -0.820 1.00 . A A . 102 LEU CB   1 1 
        3  7465 1 1 102 LEU CD1  C  -8.137  -1.715  -2.747 1.00 . A A . 102 LEU CD1  1 1 
        3  7466 1 1 102 LEU CD2  C  -7.453  -4.172  -2.586 1.00 . A A . 102 LEU CD2  1 1 
        3  7467 1 1 102 LEU CG   C  -8.571  -3.136  -2.316 1.00 . A A . 102 LEU CG   1 1 
        3  7468 1 1 102 LEU H    H -11.071  -4.396  -1.722 1.00 . A A . 102 LEU H    1 1 
        3  7469 1 1 102 LEU HA   H  -8.790  -5.275  -0.452 1.00 . A A . 102 LEU HA   1 1 
        3  7470 1 1 102 LEU HB2  H  -9.829  -2.428  -0.702 1.00 . A A . 102 LEU HB2  1 1 
        3  7471 1 1 102 LEU HB3  H  -8.195  -2.840  -0.206 1.00 . A A . 102 LEU HB3  1 1 
        3  7472 1 1 102 LEU HD11 H  -7.296  -1.383  -2.148 1.00 . A A . 102 LEU HD11 1 1 
        3  7473 1 1 102 LEU HD12 H  -8.961  -1.027  -2.615 1.00 . A A . 102 LEU HD12 1 1 
        3  7474 1 1 102 LEU HD13 H  -7.851  -1.723  -3.792 1.00 . A A . 102 LEU HD13 1 1 
        3  7475 1 1 102 LEU HD21 H  -7.167  -4.133  -3.631 1.00 . A A . 102 LEU HD21 1 1 
        3  7476 1 1 102 LEU HD22 H  -7.814  -5.166  -2.355 1.00 . A A . 102 LEU HD22 1 1 
        3  7477 1 1 102 LEU HD23 H  -6.587  -3.955  -1.972 1.00 . A A . 102 LEU HD23 1 1 
        3  7478 1 1 102 LEU HG   H  -9.417  -3.409  -2.939 1.00 . A A . 102 LEU HG   1 1 
        3  7479 1 1 102 LEU N    N -10.763  -4.955  -0.990 1.00 . A A . 102 LEU N    1 1 
        3  7480 1 1 102 LEU O    O  -8.882  -4.751   2.024 1.00 . A A . 102 LEU O    1 1 
        3  7481 1 1 103 ASN C    C -11.295  -5.461   3.613 1.00 . A A . 103 ASN C    1 1 
        3  7482 1 1 103 ASN CA   C -11.375  -4.001   3.114 1.00 . A A . 103 ASN CA   1 1 
        3  7483 1 1 103 ASN CB   C -12.809  -3.444   3.331 1.00 . A A . 103 ASN CB   1 1 
        3  7484 1 1 103 ASN CG   C -13.236  -3.368   4.808 1.00 . A A . 103 ASN CG   1 1 
        3  7485 1 1 103 ASN H    H -11.627  -3.597   1.025 1.00 . A A . 103 ASN H    1 1 
        3  7486 1 1 103 ASN HA   H -10.663  -3.390   3.668 1.00 . A A . 103 ASN HA   1 1 
        3  7487 1 1 103 ASN HB2  H -12.870  -2.448   2.904 1.00 . A A . 103 ASN HB2  1 1 
        3  7488 1 1 103 ASN HB3  H -13.522  -4.076   2.808 1.00 . A A . 103 ASN HB3  1 1 
        3  7489 1 1 103 ASN HD21 H -13.000  -1.401   4.833 1.00 . A A . 103 ASN HD21 1 1 
        3  7490 1 1 103 ASN HD22 H -13.517  -2.108   6.317 1.00 . A A . 103 ASN HD22 1 1 
        3  7491 1 1 103 ASN N    N -10.989  -3.968   1.683 1.00 . A A . 103 ASN N    1 1 
        3  7492 1 1 103 ASN ND2  N -13.248  -2.172   5.376 1.00 . A A . 103 ASN ND2  1 1 
        3  7493 1 1 103 ASN O    O -10.392  -5.825   4.347 1.00 . A A . 103 ASN O    1 1 
        3  7494 1 1 103 ASN OD1  O -13.608  -4.370   5.421 1.00 . A A . 103 ASN OD1  1 1 
        3  7495 1 1 104 MET C    C -11.089  -8.573   3.317 1.00 . A A . 104 MET C    1 1 
        3  7496 1 1 104 MET CA   C -12.361  -7.700   3.494 1.00 . A A . 104 MET CA   1 1 
        3  7497 1 1 104 MET CB   C -13.564  -8.317   2.742 1.00 . A A . 104 MET CB   1 1 
        3  7498 1 1 104 MET CE   C -16.668  -8.932   2.400 1.00 . A A . 104 MET CE   1 1 
        3  7499 1 1 104 MET CG   C -14.116  -9.623   3.331 1.00 . A A . 104 MET CG   1 1 
        3  7500 1 1 104 MET H    H -12.652  -5.997   2.250 1.00 . A A . 104 MET H    1 1 
        3  7501 1 1 104 MET HA   H -12.601  -7.655   4.554 1.00 . A A . 104 MET HA   1 1 
        3  7502 1 1 104 MET HB2  H -14.370  -7.595   2.734 1.00 . A A . 104 MET HB2  1 1 
        3  7503 1 1 104 MET HB3  H -13.270  -8.508   1.716 1.00 . A A . 104 MET HB3  1 1 
        3  7504 1 1 104 MET HE1  H -17.548  -9.213   1.842 1.00 . A A . 104 MET HE1  1 1 
        3  7505 1 1 104 MET HE2  H -16.230  -8.047   1.959 1.00 . A A . 104 MET HE2  1 1 
        3  7506 1 1 104 MET HE3  H -16.942  -8.728   3.424 1.00 . A A . 104 MET HE3  1 1 
        3  7507 1 1 104 MET HG2  H -13.326 -10.362   3.359 1.00 . A A . 104 MET HG2  1 1 
        3  7508 1 1 104 MET HG3  H -14.467  -9.437   4.339 1.00 . A A . 104 MET HG3  1 1 
        3  7509 1 1 104 MET N    N -12.154  -6.312   3.037 1.00 . A A . 104 MET N    1 1 
        3  7510 1 1 104 MET O    O -10.958  -9.623   3.953 1.00 . A A . 104 MET O    1 1 
        3  7511 1 1 104 MET SD   S -15.483 -10.286   2.355 1.00 . A A . 104 MET SD   1 1 
        3  7512 1 1 105 HIS C    C  -7.797  -8.434   3.138 1.00 . A A . 105 HIS C    1 1 
        3  7513 1 1 105 HIS CA   C  -8.912  -8.855   2.159 1.00 . A A . 105 HIS CA   1 1 
        3  7514 1 1 105 HIS CB   C  -8.469  -8.620   0.691 1.00 . A A . 105 HIS CB   1 1 
        3  7515 1 1 105 HIS CD2  C  -6.119  -9.692   0.379 1.00 . A A . 105 HIS CD2  1 1 
        3  7516 1 1 105 HIS CE1  C  -6.698 -11.381  -0.868 1.00 . A A . 105 HIS CE1  1 1 
        3  7517 1 1 105 HIS CG   C  -7.455  -9.616   0.197 1.00 . A A . 105 HIS CG   1 1 
        3  7518 1 1 105 HIS H    H -10.334  -7.286   1.970 1.00 . A A . 105 HIS H    1 1 
        3  7519 1 1 105 HIS HA   H  -9.108  -9.918   2.295 1.00 . A A . 105 HIS HA   1 1 
        3  7520 1 1 105 HIS HB2  H  -9.335  -8.688   0.045 1.00 . A A . 105 HIS HB2  1 1 
        3  7521 1 1 105 HIS HB3  H  -8.043  -7.628   0.593 1.00 . A A . 105 HIS HB3  1 1 
        3  7522 1 1 105 HIS HD1  H  -8.689 -10.932  -0.892 1.00 . A A . 105 HIS HD1  1 1 
        3  7523 1 1 105 HIS HD2  H  -5.510  -9.005   0.949 1.00 . A A . 105 HIS HD2  1 1 
        3  7524 1 1 105 HIS HE1  H  -6.651 -12.274  -1.477 1.00 . A A . 105 HIS HE1  1 1 
        3  7525 1 1 105 HIS HE2  H  -4.746 -10.962  -0.531 1.00 . A A . 105 HIS HE2  1 1 
        3  7526 1 1 105 HIS N    N -10.163  -8.130   2.442 1.00 . A A . 105 HIS N    1 1 
        3  7527 1 1 105 HIS ND1  N  -7.783 -10.693  -0.593 1.00 . A A . 105 HIS ND1  1 1 
        3  7528 1 1 105 HIS NE2  N  -5.675 -10.795  -0.292 1.00 . A A . 105 HIS NE2  1 1 
        3  7529 1 1 105 HIS O    O  -7.071  -9.288   3.658 1.00 . A A . 105 HIS O    1 1 
        3  7530 1 1 106 TYR C    C  -7.071  -6.740   5.753 1.00 . A A . 106 TYR C    1 1 
        3  7531 1 1 106 TYR CA   C  -6.618  -6.574   4.290 1.00 . A A . 106 TYR CA   1 1 
        3  7532 1 1 106 TYR CB   C  -6.283  -5.084   3.965 1.00 . A A . 106 TYR CB   1 1 
        3  7533 1 1 106 TYR CD1  C  -5.915  -5.030   1.423 1.00 . A A . 106 TYR CD1  1 1 
        3  7534 1 1 106 TYR CD2  C  -4.041  -4.562   2.828 1.00 . A A . 106 TYR CD2  1 1 
        3  7535 1 1 106 TYR CE1  C  -5.126  -4.854   0.308 1.00 . A A . 106 TYR CE1  1 1 
        3  7536 1 1 106 TYR CE2  C  -3.251  -4.383   1.707 1.00 . A A . 106 TYR CE2  1 1 
        3  7537 1 1 106 TYR CG   C  -5.396  -4.889   2.714 1.00 . A A . 106 TYR CG   1 1 
        3  7538 1 1 106 TYR CZ   C  -3.801  -4.530   0.452 1.00 . A A . 106 TYR CZ   1 1 
        3  7539 1 1 106 TYR H    H  -8.241  -6.481   2.907 1.00 . A A . 106 TYR H    1 1 
        3  7540 1 1 106 TYR HA   H  -5.710  -7.164   4.147 1.00 . A A . 106 TYR HA   1 1 
        3  7541 1 1 106 TYR HB2  H  -7.209  -4.535   3.803 1.00 . A A . 106 TYR HB2  1 1 
        3  7542 1 1 106 TYR HB3  H  -5.771  -4.636   4.811 1.00 . A A . 106 TYR HB3  1 1 
        3  7543 1 1 106 TYR HD1  H  -6.957  -5.285   1.302 1.00 . A A . 106 TYR HD1  1 1 
        3  7544 1 1 106 TYR HD2  H  -3.602  -4.445   3.813 1.00 . A A . 106 TYR HD2  1 1 
        3  7545 1 1 106 TYR HE1  H  -5.554  -4.969  -0.683 1.00 . A A . 106 TYR HE1  1 1 
        3  7546 1 1 106 TYR HE2  H  -2.201  -4.132   1.818 1.00 . A A . 106 TYR HE2  1 1 
        3  7547 1 1 106 TYR HH   H  -2.169  -4.770  -0.521 1.00 . A A . 106 TYR HH   1 1 
        3  7548 1 1 106 TYR N    N  -7.643  -7.113   3.365 1.00 . A A . 106 TYR N    1 1 
        3  7549 1 1 106 TYR O    O  -6.399  -7.426   6.535 1.00 . A A . 106 TYR O    1 1 
        3  7550 1 1 106 TYR OH   O  -3.020  -4.356  -0.664 1.00 . A A . 106 TYR OH   1 1 
        3  7551 1 1 107 ASN C    C -10.163  -5.431   7.489 1.00 . A A . 107 ASN C    1 1 
        3  7552 1 1 107 ASN CA   C  -8.825  -6.202   7.456 1.00 . A A . 107 ASN CA   1 1 
        3  7553 1 1 107 ASN CB   C  -7.883  -5.665   8.576 1.00 . A A . 107 ASN CB   1 1 
        3  7554 1 1 107 ASN CG   C  -7.671  -4.157   8.516 1.00 . A A . 107 ASN CG   1 1 
        3  7555 1 1 107 ASN H    H  -8.692  -5.586   5.426 1.00 . A A . 107 ASN H    1 1 
        3  7556 1 1 107 ASN HA   H  -9.035  -7.250   7.642 1.00 . A A . 107 ASN HA   1 1 
        3  7557 1 1 107 ASN HB2  H  -8.302  -5.911   9.544 1.00 . A A . 107 ASN HB2  1 1 
        3  7558 1 1 107 ASN HB3  H  -6.916  -6.146   8.486 1.00 . A A . 107 ASN HB3  1 1 
        3  7559 1 1 107 ASN HD21 H  -6.505  -4.358   6.920 1.00 . A A . 107 ASN HD21 1 1 
        3  7560 1 1 107 ASN HD22 H  -6.787  -2.738   7.444 1.00 . A A . 107 ASN HD22 1 1 
        3  7561 1 1 107 ASN N    N  -8.212  -6.110   6.106 1.00 . A A . 107 ASN N    1 1 
        3  7562 1 1 107 ASN ND2  N  -6.900  -3.704   7.536 1.00 . A A . 107 ASN ND2  1 1 
        3  7563 1 1 107 ASN O    O -10.444  -4.596   6.631 1.00 . A A . 107 ASN O    1 1 
        3  7564 1 1 107 ASN OD1  O  -8.227  -3.393   9.316 1.00 . A A . 107 ASN OD1  1 1 
        3  7565 1 1 108 LYS C    C -12.270  -4.041   9.857 1.00 . A A . 108 LYS C    1 1 
        3  7566 1 1 108 LYS CA   C -12.273  -5.072   8.709 1.00 . A A . 108 LYS CA   1 1 
        3  7567 1 1 108 LYS CB   C -13.308  -6.219   8.927 1.00 . A A . 108 LYS CB   1 1 
        3  7568 1 1 108 LYS CD   C -15.766  -7.005   8.830 1.00 . A A . 108 LYS CD   1 1 
        3  7569 1 1 108 LYS CE   C -15.718  -7.699  10.204 1.00 . A A . 108 LYS CE   1 1 
        3  7570 1 1 108 LYS CG   C -14.785  -5.811   8.715 1.00 . A A . 108 LYS CG   1 1 
        3  7571 1 1 108 LYS H    H -10.516  -6.135   9.292 1.00 . A A . 108 LYS H    1 1 
        3  7572 1 1 108 LYS HA   H -12.532  -4.543   7.788 1.00 . A A . 108 LYS HA   1 1 
        3  7573 1 1 108 LYS HB2  H -13.080  -7.022   8.226 1.00 . A A . 108 LYS HB2  1 1 
        3  7574 1 1 108 LYS HB3  H -13.195  -6.607   9.933 1.00 . A A . 108 LYS HB3  1 1 
        3  7575 1 1 108 LYS HD2  H -16.776  -6.646   8.663 1.00 . A A . 108 LYS HD2  1 1 
        3  7576 1 1 108 LYS HD3  H -15.522  -7.732   8.060 1.00 . A A . 108 LYS HD3  1 1 
        3  7577 1 1 108 LYS HE2  H -16.431  -8.511  10.208 1.00 . A A . 108 LYS HE2  1 1 
        3  7578 1 1 108 LYS HE3  H -14.725  -8.098  10.369 1.00 . A A . 108 LYS HE3  1 1 
        3  7579 1 1 108 LYS HG2  H -15.056  -5.067   9.459 1.00 . A A . 108 LYS HG2  1 1 
        3  7580 1 1 108 LYS HG3  H -14.888  -5.371   7.727 1.00 . A A . 108 LYS HG3  1 1 
        3  7581 1 1 108 LYS HZ1  H -17.040  -6.446  11.228 1.00 . A A . 108 LYS HZ1  1 1 
        3  7582 1 1 108 LYS HZ2  H -15.430  -5.943  11.303 1.00 . A A . 108 LYS HZ2  1 1 
        3  7583 1 1 108 LYS HZ3  H -15.949  -7.253  12.234 1.00 . A A . 108 LYS HZ3  1 1 
        3  7584 1 1 108 LYS N    N -10.924  -5.648   8.554 1.00 . A A . 108 LYS N    1 1 
        3  7585 1 1 108 LYS NZ   N -16.056  -6.772  11.319 1.00 . A A . 108 LYS NZ   1 1 
        3  7586 1 1 108 LYS O    O -13.252  -3.321  10.054 1.00 . A A . 108 LYS O    1 1 
        3  7587 1 1 109 ALA C    C -10.837  -1.553  11.183 1.00 . A A . 109 ALA C    1 1 
        3  7588 1 1 109 ALA CA   C -10.936  -2.999  11.694 1.00 . A A . 109 ALA CA   1 1 
        3  7589 1 1 109 ALA CB   C  -9.678  -3.364  12.494 1.00 . A A . 109 ALA CB   1 1 
        3  7590 1 1 109 ALA H    H -10.433  -4.627  10.440 1.00 . A A . 109 ALA H    1 1 
        3  7591 1 1 109 ALA HA   H -11.789  -3.070  12.366 1.00 . A A . 109 ALA HA   1 1 
        3  7592 1 1 109 ALA HB1  H  -8.805  -3.303  11.853 1.00 . A A . 109 ALA HB1  1 1 
        3  7593 1 1 109 ALA HB2  H  -9.770  -4.372  12.877 1.00 . A A . 109 ALA HB2  1 1 
        3  7594 1 1 109 ALA HB3  H  -9.562  -2.676  13.321 1.00 . A A . 109 ALA HB3  1 1 
        3  7595 1 1 109 ALA N    N -11.141  -3.972  10.602 1.00 . A A . 109 ALA N    1 1 
        3  7596 1 1 109 ALA O    O -11.111  -0.610  11.941 1.00 . A A . 109 ALA O    1 1 
        3  7597 1 1 110 ASN C    C -11.831   0.464   9.053 1.00 . A A . 110 ASN C    1 1 
        3  7598 1 1 110 ASN CA   C -10.388  -0.048   9.271 1.00 . A A . 110 ASN CA   1 1 
        3  7599 1 1 110 ASN CB   C  -9.565  -0.026   7.946 1.00 . A A . 110 ASN CB   1 1 
        3  7600 1 1 110 ASN CG   C  -9.900  -1.119   6.931 1.00 . A A . 110 ASN CG   1 1 
        3  7601 1 1 110 ASN H    H -10.117  -2.156   9.389 1.00 . A A . 110 ASN H    1 1 
        3  7602 1 1 110 ASN HA   H  -9.895   0.623   9.979 1.00 . A A . 110 ASN HA   1 1 
        3  7603 1 1 110 ASN HB2  H  -9.696   0.934   7.456 1.00 . A A . 110 ASN HB2  1 1 
        3  7604 1 1 110 ASN HB3  H  -8.511  -0.124   8.194 1.00 . A A . 110 ASN HB3  1 1 
        3  7605 1 1 110 ASN HD21 H -11.409  -0.077   6.191 1.00 . A A . 110 ASN HD21 1 1 
        3  7606 1 1 110 ASN HD22 H -11.119  -1.616   5.465 1.00 . A A . 110 ASN HD22 1 1 
        3  7607 1 1 110 ASN N    N -10.413  -1.376   9.909 1.00 . A A . 110 ASN N    1 1 
        3  7608 1 1 110 ASN ND2  N -10.916  -0.916   6.124 1.00 . A A . 110 ASN ND2  1 1 
        3  7609 1 1 110 ASN O    O -12.631  -0.172   8.352 1.00 . A A . 110 ASN O    1 1 
        3  7610 1 1 110 ASN OD1  O  -9.255  -2.150   6.891 1.00 . A A . 110 ASN OD1  1 1 
        3  7611 1 1 111 ASP C    C -13.746   2.615   8.147 1.00 . A A . 111 ASP C    1 1 
        3  7612 1 1 111 ASP CA   C -13.426   2.316   9.623 1.00 . A A . 111 ASP CA   1 1 
        3  7613 1 1 111 ASP CB   C -13.355   3.633  10.455 1.00 . A A . 111 ASP CB   1 1 
        3  7614 1 1 111 ASP CG   C -14.588   4.545  10.273 1.00 . A A . 111 ASP CG   1 1 
        3  7615 1 1 111 ASP H    H -11.496   1.893  10.413 1.00 . A A . 111 ASP H    1 1 
        3  7616 1 1 111 ASP HA   H -14.209   1.688  10.033 1.00 . A A . 111 ASP HA   1 1 
        3  7617 1 1 111 ASP HB2  H -13.266   3.378  11.509 1.00 . A A . 111 ASP HB2  1 1 
        3  7618 1 1 111 ASP HB3  H -12.464   4.185  10.168 1.00 . A A . 111 ASP HB3  1 1 
        3  7619 1 1 111 ASP N    N -12.148   1.575   9.753 1.00 . A A . 111 ASP N    1 1 
        3  7620 1 1 111 ASP O    O -14.693   2.068   7.588 1.00 . A A . 111 ASP O    1 1 
        3  7621 1 1 111 ASP OD1  O -15.624   4.307  10.929 1.00 . A A . 111 ASP OD1  1 1 
        3  7622 1 1 111 ASP OD2  O -14.527   5.504   9.474 1.00 . A A . 111 ASP OD2  1 1 
        3  7623 1 1 112 PHE C    C -12.322   2.519   5.375 1.00 . A A . 112 PHE C    1 1 
        3  7624 1 1 112 PHE CA   C -12.972   3.721   6.081 1.00 . A A . 112 PHE CA   1 1 
        3  7625 1 1 112 PHE CB   C -12.272   5.060   5.701 1.00 . A A . 112 PHE CB   1 1 
        3  7626 1 1 112 PHE CD1  C -10.609   5.754   7.515 1.00 . A A . 112 PHE CD1  1 1 
        3  7627 1 1 112 PHE CD2  C  -9.726   4.876   5.465 1.00 . A A . 112 PHE CD2  1 1 
        3  7628 1 1 112 PHE CE1  C  -9.328   5.916   7.998 1.00 . A A . 112 PHE CE1  1 1 
        3  7629 1 1 112 PHE CE2  C  -8.448   5.038   5.960 1.00 . A A . 112 PHE CE2  1 1 
        3  7630 1 1 112 PHE CG   C -10.840   5.231   6.234 1.00 . A A . 112 PHE CG   1 1 
        3  7631 1 1 112 PHE CZ   C  -8.249   5.558   7.221 1.00 . A A . 112 PHE CZ   1 1 
        3  7632 1 1 112 PHE H    H -12.273   3.969   8.068 1.00 . A A . 112 PHE H    1 1 
        3  7633 1 1 112 PHE HA   H -14.021   3.778   5.785 1.00 . A A . 112 PHE HA   1 1 
        3  7634 1 1 112 PHE HB2  H -12.239   5.142   4.622 1.00 . A A . 112 PHE HB2  1 1 
        3  7635 1 1 112 PHE HB3  H -12.867   5.885   6.081 1.00 . A A . 112 PHE HB3  1 1 
        3  7636 1 1 112 PHE HD1  H -11.454   6.034   8.132 1.00 . A A . 112 PHE HD1  1 1 
        3  7637 1 1 112 PHE HD2  H  -9.870   4.463   4.474 1.00 . A A . 112 PHE HD2  1 1 
        3  7638 1 1 112 PHE HE1  H  -9.166   6.324   8.992 1.00 . A A . 112 PHE HE1  1 1 
        3  7639 1 1 112 PHE HE2  H  -7.593   4.761   5.355 1.00 . A A . 112 PHE HE2  1 1 
        3  7640 1 1 112 PHE HZ   H  -7.239   5.688   7.602 1.00 . A A . 112 PHE HZ   1 1 
        3  7641 1 1 112 PHE N    N -12.933   3.486   7.532 1.00 . A A . 112 PHE N    1 1 
        3  7642 1 1 112 PHE O    O -11.341   1.969   5.890 1.00 . A A . 112 PHE O    1 1 
        3  7643 1 1 113 GLU C    C -10.987   0.927   3.117 1.00 . A A . 113 GLU C    1 1 
        3  7644 1 1 113 GLU CA   C -12.486   0.914   3.457 1.00 . A A . 113 GLU CA   1 1 
        3  7645 1 1 113 GLU CB   C -13.321   0.810   2.148 1.00 . A A . 113 GLU CB   1 1 
        3  7646 1 1 113 GLU CD   C -15.365  -0.469   3.065 1.00 . A A . 113 GLU CD   1 1 
        3  7647 1 1 113 GLU CG   C -14.849   0.788   2.345 1.00 . A A . 113 GLU CG   1 1 
        3  7648 1 1 113 GLU H    H -13.576   2.705   3.826 1.00 . A A . 113 GLU H    1 1 
        3  7649 1 1 113 GLU HA   H -12.703   0.056   4.083 1.00 . A A . 113 GLU HA   1 1 
        3  7650 1 1 113 GLU HB2  H -13.080   1.664   1.515 1.00 . A A . 113 GLU HB2  1 1 
        3  7651 1 1 113 GLU HB3  H -13.036  -0.093   1.616 1.00 . A A . 113 GLU HB3  1 1 
        3  7652 1 1 113 GLU HG2  H -15.138   1.665   2.918 1.00 . A A . 113 GLU HG2  1 1 
        3  7653 1 1 113 GLU HG3  H -15.327   0.853   1.367 1.00 . A A . 113 GLU HG3  1 1 
        3  7654 1 1 113 GLU N    N -12.878   2.136   4.206 1.00 . A A . 113 GLU N    1 1 
        3  7655 1 1 113 GLU O    O -10.233   0.037   3.512 1.00 . A A . 113 GLU O    1 1 
        3  7656 1 1 113 GLU OE1  O -15.644  -1.475   2.387 1.00 . A A . 113 GLU OE1  1 1 
        3  7657 1 1 113 GLU OE2  O -15.513  -0.445   4.307 1.00 . A A . 113 GLU OE2  1 1 
        3  7658 1 1 114 VAL C    C  -9.064   3.748   1.671 1.00 . A A . 114 VAL C    1 1 
        3  7659 1 1 114 VAL CA   C  -9.220   2.231   1.936 1.00 . A A . 114 VAL CA   1 1 
        3  7660 1 1 114 VAL CB   C  -8.821   1.381   0.640 1.00 . A A . 114 VAL CB   1 1 
        3  7661 1 1 114 VAL CG1  C  -8.204   0.013   1.019 1.00 . A A . 114 VAL CG1  1 1 
        3  7662 1 1 114 VAL CG2  C -10.032   1.191  -0.314 1.00 . A A . 114 VAL CG2  1 1 
        3  7663 1 1 114 VAL H    H -11.275   2.656   2.170 1.00 . A A . 114 VAL H    1 1 
        3  7664 1 1 114 VAL HA   H  -8.556   1.960   2.751 1.00 . A A . 114 VAL HA   1 1 
        3  7665 1 1 114 VAL HB   H  -8.055   1.932   0.092 1.00 . A A . 114 VAL HB   1 1 
        3  7666 1 1 114 VAL HG11 H  -7.915  -0.520   0.120 1.00 . A A . 114 VAL HG11 1 1 
        3  7667 1 1 114 VAL HG12 H  -8.924  -0.582   1.568 1.00 . A A . 114 VAL HG12 1 1 
        3  7668 1 1 114 VAL HG13 H  -7.324   0.166   1.635 1.00 . A A . 114 VAL HG13 1 1 
        3  7669 1 1 114 VAL HG21 H -10.425   2.162  -0.596 1.00 . A A . 114 VAL HG21 1 1 
        3  7670 1 1 114 VAL HG22 H -10.809   0.626   0.188 1.00 . A A . 114 VAL HG22 1 1 
        3  7671 1 1 114 VAL HG23 H  -9.722   0.664  -1.205 1.00 . A A . 114 VAL HG23 1 1 
        3  7672 1 1 114 VAL N    N -10.597   1.980   2.393 1.00 . A A . 114 VAL N    1 1 
        3  7673 1 1 114 VAL O    O -10.009   4.376   1.171 1.00 . A A . 114 VAL O    1 1 
        3  7674 1 1 115 PRO C    C  -7.694   6.206   0.309 1.00 . A A . 115 PRO C    1 1 
        3  7675 1 1 115 PRO CA   C  -7.604   5.811   1.796 1.00 . A A . 115 PRO CA   1 1 
        3  7676 1 1 115 PRO CB   C  -6.141   5.974   2.291 1.00 . A A . 115 PRO CB   1 1 
        3  7677 1 1 115 PRO CD   C  -6.759   3.717   2.770 1.00 . A A . 115 PRO CD   1 1 
        3  7678 1 1 115 PRO CG   C  -5.958   4.891   3.299 1.00 . A A . 115 PRO CG   1 1 
        3  7679 1 1 115 PRO HA   H  -8.263   6.443   2.382 1.00 . A A . 115 PRO HA   1 1 
        3  7680 1 1 115 PRO HB2  H  -5.437   5.853   1.463 1.00 . A A . 115 PRO HB2  1 1 
        3  7681 1 1 115 PRO HB3  H  -6.001   6.945   2.748 1.00 . A A . 115 PRO HB3  1 1 
        3  7682 1 1 115 PRO HD2  H  -6.156   3.119   2.088 1.00 . A A . 115 PRO HD2  1 1 
        3  7683 1 1 115 PRO HD3  H  -7.118   3.101   3.586 1.00 . A A . 115 PRO HD3  1 1 
        3  7684 1 1 115 PRO HG2  H  -4.900   4.638   3.384 1.00 . A A . 115 PRO HG2  1 1 
        3  7685 1 1 115 PRO HG3  H  -6.340   5.200   4.268 1.00 . A A . 115 PRO HG3  1 1 
        3  7686 1 1 115 PRO N    N  -7.891   4.367   2.045 1.00 . A A . 115 PRO N    1 1 
        3  7687 1 1 115 PRO O    O  -7.424   5.380  -0.560 1.00 . A A . 115 PRO O    1 1 
        3  7688 1 1 116 GLU C    C  -6.762   7.840  -2.069 1.00 . A A . 116 GLU C    1 1 
        3  7689 1 1 116 GLU CA   C  -8.090   8.056  -1.327 1.00 . A A . 116 GLU CA   1 1 
        3  7690 1 1 116 GLU CB   C  -8.410   9.574  -1.290 1.00 . A A . 116 GLU CB   1 1 
        3  7691 1 1 116 GLU CD   C  -8.528  11.758  -2.649 1.00 . A A . 116 GLU CD   1 1 
        3  7692 1 1 116 GLU CG   C  -8.526  10.227  -2.689 1.00 . A A . 116 GLU CG   1 1 
        3  7693 1 1 116 GLU H    H  -8.231   8.079   0.799 1.00 . A A . 116 GLU H    1 1 
        3  7694 1 1 116 GLU HA   H  -8.882   7.539  -1.857 1.00 . A A . 116 GLU HA   1 1 
        3  7695 1 1 116 GLU HB2  H  -9.347   9.723  -0.763 1.00 . A A . 116 GLU HB2  1 1 
        3  7696 1 1 116 GLU HB3  H  -7.622  10.086  -0.737 1.00 . A A . 116 GLU HB3  1 1 
        3  7697 1 1 116 GLU HG2  H  -7.690   9.898  -3.306 1.00 . A A . 116 GLU HG2  1 1 
        3  7698 1 1 116 GLU HG3  H  -9.444   9.884  -3.159 1.00 . A A . 116 GLU HG3  1 1 
        3  7699 1 1 116 GLU N    N  -8.027   7.489   0.043 1.00 . A A . 116 GLU N    1 1 
        3  7700 1 1 116 GLU O    O  -6.759   7.503  -3.258 1.00 . A A . 116 GLU O    1 1 
        3  7701 1 1 116 GLU OE1  O  -9.609  12.366  -2.496 1.00 . A A . 116 GLU OE1  1 1 
        3  7702 1 1 116 GLU OE2  O  -7.443  12.361  -2.778 1.00 . A A . 116 GLU OE2  1 1 
        3  7703 1 1 117 ARG C    C  -4.193   6.299  -2.307 1.00 . A A . 117 ARG C    1 1 
        3  7704 1 1 117 ARG CA   C  -4.297   7.753  -1.840 1.00 . A A . 117 ARG CA   1 1 
        3  7705 1 1 117 ARG CB   C  -3.217   8.036  -0.763 1.00 . A A . 117 ARG CB   1 1 
        3  7706 1 1 117 ARG CD   C  -2.734  10.493  -1.458 1.00 . A A . 117 ARG CD   1 1 
        3  7707 1 1 117 ARG CG   C  -3.073   9.510  -0.315 1.00 . A A . 117 ARG CG   1 1 
        3  7708 1 1 117 ARG CZ   C  -3.916  11.083  -3.597 1.00 . A A . 117 ARG CZ   1 1 
        3  7709 1 1 117 ARG H    H  -5.722   8.441  -0.447 1.00 . A A . 117 ARG H    1 1 
        3  7710 1 1 117 ARG HA   H  -4.128   8.410  -2.686 1.00 . A A . 117 ARG HA   1 1 
        3  7711 1 1 117 ARG HB2  H  -3.448   7.446   0.121 1.00 . A A . 117 ARG HB2  1 1 
        3  7712 1 1 117 ARG HB3  H  -2.256   7.712  -1.145 1.00 . A A . 117 ARG HB3  1 1 
        3  7713 1 1 117 ARG HD2  H  -2.334  11.400  -1.024 1.00 . A A . 117 ARG HD2  1 1 
        3  7714 1 1 117 ARG HD3  H  -1.975  10.044  -2.096 1.00 . A A . 117 ARG HD3  1 1 
        3  7715 1 1 117 ARG HE   H  -4.775  10.925  -1.795 1.00 . A A . 117 ARG HE   1 1 
        3  7716 1 1 117 ARG HG2  H  -4.005   9.825   0.140 1.00 . A A . 117 ARG HG2  1 1 
        3  7717 1 1 117 ARG HG3  H  -2.290   9.560   0.435 1.00 . A A . 117 ARG HG3  1 1 
        3  7718 1 1 117 ARG HH11 H  -1.925  10.761  -3.850 1.00 . A A . 117 ARG HH11 1 1 
        3  7719 1 1 117 ARG HH12 H  -2.795  11.167  -5.295 1.00 . A A . 117 ARG HH12 1 1 
        3  7720 1 1 117 ARG HH21 H  -5.894  11.487  -3.694 1.00 . A A . 117 ARG HH21 1 1 
        3  7721 1 1 117 ARG HH22 H  -5.038  11.579  -5.202 1.00 . A A . 117 ARG HH22 1 1 
        3  7722 1 1 117 ARG N    N  -5.643   8.047  -1.342 1.00 . A A . 117 ARG N    1 1 
        3  7723 1 1 117 ARG NE   N  -3.917  10.845  -2.276 1.00 . A A . 117 ARG NE   1 1 
        3  7724 1 1 117 ARG NH1  N  -2.784  10.995  -4.301 1.00 . A A . 117 ARG NH1  1 1 
        3  7725 1 1 117 ARG NH2  N  -5.039  11.401  -4.215 1.00 . A A . 117 ARG NH2  1 1 
        3  7726 1 1 117 ARG O    O  -3.704   6.059  -3.378 1.00 . A A . 117 ARG O    1 1 
        3  7727 1 1 118 PHE C    C  -5.407   3.583  -3.119 1.00 . A A . 118 PHE C    1 1 
        3  7728 1 1 118 PHE CA   C  -4.642   3.914  -1.812 1.00 . A A . 118 PHE CA   1 1 
        3  7729 1 1 118 PHE CB   C  -5.171   3.071  -0.611 1.00 . A A . 118 PHE CB   1 1 
        3  7730 1 1 118 PHE CD1  C  -5.343   0.619  -1.299 1.00 . A A . 118 PHE CD1  1 1 
        3  7731 1 1 118 PHE CD2  C  -3.549   1.265   0.147 1.00 . A A . 118 PHE CD2  1 1 
        3  7732 1 1 118 PHE CE1  C  -4.880  -0.684  -1.281 1.00 . A A . 118 PHE CE1  1 1 
        3  7733 1 1 118 PHE CE2  C  -3.089  -0.037   0.163 1.00 . A A . 118 PHE CE2  1 1 
        3  7734 1 1 118 PHE CG   C  -4.684   1.622  -0.590 1.00 . A A . 118 PHE CG   1 1 
        3  7735 1 1 118 PHE CZ   C  -3.757  -1.012  -0.548 1.00 . A A . 118 PHE CZ   1 1 
        3  7736 1 1 118 PHE H    H  -5.179   5.635  -0.683 1.00 . A A . 118 PHE H    1 1 
        3  7737 1 1 118 PHE HA   H  -3.589   3.686  -1.963 1.00 . A A . 118 PHE HA   1 1 
        3  7738 1 1 118 PHE HB2  H  -4.850   3.540   0.315 1.00 . A A . 118 PHE HB2  1 1 
        3  7739 1 1 118 PHE HB3  H  -6.257   3.062  -0.622 1.00 . A A . 118 PHE HB3  1 1 
        3  7740 1 1 118 PHE HD1  H  -6.224   0.864  -1.874 1.00 . A A . 118 PHE HD1  1 1 
        3  7741 1 1 118 PHE HD2  H  -3.019   2.022   0.711 1.00 . A A . 118 PHE HD2  1 1 
        3  7742 1 1 118 PHE HE1  H  -5.403  -1.454  -1.841 1.00 . A A . 118 PHE HE1  1 1 
        3  7743 1 1 118 PHE HE2  H  -2.208  -0.293   0.739 1.00 . A A . 118 PHE HE2  1 1 
        3  7744 1 1 118 PHE HZ   H  -3.395  -2.033  -0.538 1.00 . A A . 118 PHE HZ   1 1 
        3  7745 1 1 118 PHE N    N  -4.722   5.353  -1.507 1.00 . A A . 118 PHE N    1 1 
        3  7746 1 1 118 PHE O    O  -4.971   2.723  -3.871 1.00 . A A . 118 PHE O    1 1 
        3  7747 1 1 119 LEU C    C  -6.640   4.712  -5.874 1.00 . A A . 119 LEU C    1 1 
        3  7748 1 1 119 LEU CA   C  -7.334   4.109  -4.639 1.00 . A A . 119 LEU CA   1 1 
        3  7749 1 1 119 LEU CB   C  -8.770   4.706  -4.538 1.00 . A A . 119 LEU CB   1 1 
        3  7750 1 1 119 LEU CD1  C  -9.770   2.378  -4.008 1.00 . A A . 119 LEU CD1  1 1 
        3  7751 1 1 119 LEU CD2  C  -9.726   4.206  -2.204 1.00 . A A . 119 LEU CD2  1 1 
        3  7752 1 1 119 LEU CG   C  -9.822   3.902  -3.709 1.00 . A A . 119 LEU CG   1 1 
        3  7753 1 1 119 LEU H    H  -6.857   4.946  -2.723 1.00 . A A . 119 LEU H    1 1 
        3  7754 1 1 119 LEU HA   H  -7.427   3.039  -4.796 1.00 . A A . 119 LEU HA   1 1 
        3  7755 1 1 119 LEU HB2  H  -8.693   5.711  -4.125 1.00 . A A . 119 LEU HB2  1 1 
        3  7756 1 1 119 LEU HB3  H  -9.165   4.807  -5.548 1.00 . A A . 119 LEU HB3  1 1 
        3  7757 1 1 119 LEU HD11 H -10.551   1.874  -3.452 1.00 . A A . 119 LEU HD11 1 1 
        3  7758 1 1 119 LEU HD12 H  -8.810   1.971  -3.716 1.00 . A A . 119 LEU HD12 1 1 
        3  7759 1 1 119 LEU HD13 H  -9.924   2.207  -5.067 1.00 . A A . 119 LEU HD13 1 1 
        3  7760 1 1 119 LEU HD21 H -10.522   3.694  -1.680 1.00 . A A . 119 LEU HD21 1 1 
        3  7761 1 1 119 LEU HD22 H  -9.831   5.273  -2.042 1.00 . A A . 119 LEU HD22 1 1 
        3  7762 1 1 119 LEU HD23 H  -8.770   3.878  -1.816 1.00 . A A . 119 LEU HD23 1 1 
        3  7763 1 1 119 LEU HG   H -10.809   4.230  -4.027 1.00 . A A . 119 LEU HG   1 1 
        3  7764 1 1 119 LEU N    N  -6.540   4.294  -3.389 1.00 . A A . 119 LEU N    1 1 
        3  7765 1 1 119 LEU O    O  -6.572   4.064  -6.921 1.00 . A A . 119 LEU O    1 1 
        3  7766 1 1 120 GLU C    C  -4.198   5.957  -7.241 1.00 . A A . 120 GLU C    1 1 
        3  7767 1 1 120 GLU CA   C  -5.504   6.678  -6.878 1.00 . A A . 120 GLU CA   1 1 
        3  7768 1 1 120 GLU CB   C  -5.210   8.159  -6.525 1.00 . A A . 120 GLU CB   1 1 
        3  7769 1 1 120 GLU CD   C  -4.246  10.396  -7.347 1.00 . A A . 120 GLU CD   1 1 
        3  7770 1 1 120 GLU CG   C  -4.665   8.973  -7.720 1.00 . A A . 120 GLU CG   1 1 
        3  7771 1 1 120 GLU H    H  -6.266   6.438  -4.903 1.00 . A A . 120 GLU H    1 1 
        3  7772 1 1 120 GLU HA   H  -6.178   6.646  -7.728 1.00 . A A . 120 GLU HA   1 1 
        3  7773 1 1 120 GLU HB2  H  -6.127   8.629  -6.178 1.00 . A A . 120 GLU HB2  1 1 
        3  7774 1 1 120 GLU HB3  H  -4.481   8.197  -5.719 1.00 . A A . 120 GLU HB3  1 1 
        3  7775 1 1 120 GLU HG2  H  -3.806   8.450  -8.132 1.00 . A A . 120 GLU HG2  1 1 
        3  7776 1 1 120 GLU HG3  H  -5.436   9.023  -8.486 1.00 . A A . 120 GLU HG3  1 1 
        3  7777 1 1 120 GLU N    N  -6.168   5.973  -5.759 1.00 . A A . 120 GLU N    1 1 
        3  7778 1 1 120 GLU O    O  -3.884   5.725  -8.417 1.00 . A A . 120 GLU O    1 1 
        3  7779 1 1 120 GLU OE1  O  -5.126  11.266  -7.181 1.00 . A A . 120 GLU OE1  1 1 
        3  7780 1 1 120 GLU OE2  O  -3.031  10.657  -7.203 1.00 . A A . 120 GLU OE2  1 1 
        3  7781 1 1 121 VAL C    C  -2.631   3.380  -6.889 1.00 . A A . 121 VAL C    1 1 
        3  7782 1 1 121 VAL CA   C  -2.276   4.761  -6.314 1.00 . A A . 121 VAL CA   1 1 
        3  7783 1 1 121 VAL CB   C  -1.506   4.646  -4.947 1.00 . A A . 121 VAL CB   1 1 
        3  7784 1 1 121 VAL CG1  C  -0.434   3.553  -4.983 1.00 . A A . 121 VAL CG1  1 1 
        3  7785 1 1 121 VAL CG2  C  -0.873   6.008  -4.555 1.00 . A A . 121 VAL CG2  1 1 
        3  7786 1 1 121 VAL H    H  -3.759   5.856  -5.307 1.00 . A A . 121 VAL H    1 1 
        3  7787 1 1 121 VAL HA   H  -1.619   5.263  -7.023 1.00 . A A . 121 VAL HA   1 1 
        3  7788 1 1 121 VAL HB   H  -2.224   4.382  -4.176 1.00 . A A . 121 VAL HB   1 1 
        3  7789 1 1 121 VAL HG11 H   0.265   3.759  -5.781 1.00 . A A . 121 VAL HG11 1 1 
        3  7790 1 1 121 VAL HG12 H  -0.897   2.589  -5.155 1.00 . A A . 121 VAL HG12 1 1 
        3  7791 1 1 121 VAL HG13 H   0.098   3.525  -4.042 1.00 . A A . 121 VAL HG13 1 1 
        3  7792 1 1 121 VAL HG21 H  -0.373   5.923  -3.595 1.00 . A A . 121 VAL HG21 1 1 
        3  7793 1 1 121 VAL HG22 H  -1.644   6.766  -4.485 1.00 . A A . 121 VAL HG22 1 1 
        3  7794 1 1 121 VAL HG23 H  -0.150   6.306  -5.306 1.00 . A A . 121 VAL HG23 1 1 
        3  7795 1 1 121 VAL N    N  -3.470   5.578  -6.194 1.00 . A A . 121 VAL N    1 1 
        3  7796 1 1 121 VAL O    O  -1.907   2.909  -7.725 1.00 . A A . 121 VAL O    1 1 
        3  7797 1 1 122 ALA C    C  -4.365   1.520  -8.533 1.00 . A A . 122 ALA C    1 1 
        3  7798 1 1 122 ALA CA   C  -4.222   1.458  -7.011 1.00 . A A . 122 ALA CA   1 1 
        3  7799 1 1 122 ALA CB   C  -5.557   0.994  -6.395 1.00 . A A . 122 ALA CB   1 1 
        3  7800 1 1 122 ALA H    H  -4.307   3.182  -5.757 1.00 . A A . 122 ALA H    1 1 
        3  7801 1 1 122 ALA HA   H  -3.465   0.719  -6.756 1.00 . A A . 122 ALA HA   1 1 
        3  7802 1 1 122 ALA HB1  H  -5.815   0.013  -6.777 1.00 . A A . 122 ALA HB1  1 1 
        3  7803 1 1 122 ALA HB2  H  -6.346   1.698  -6.660 1.00 . A A . 122 ALA HB2  1 1 
        3  7804 1 1 122 ALA HB3  H  -5.473   0.950  -5.321 1.00 . A A . 122 ALA HB3  1 1 
        3  7805 1 1 122 ALA N    N  -3.769   2.765  -6.464 1.00 . A A . 122 ALA N    1 1 
        3  7806 1 1 122 ALA O    O  -3.732   0.747  -9.243 1.00 . A A . 122 ALA O    1 1 
        3  7807 1 1 123 GLN C    C  -4.219   2.948 -11.276 1.00 . A A . 123 GLN C    1 1 
        3  7808 1 1 123 GLN CA   C  -5.472   2.630 -10.441 1.00 . A A . 123 GLN CA   1 1 
        3  7809 1 1 123 GLN CB   C  -6.586   3.691 -10.701 1.00 . A A . 123 GLN CB   1 1 
        3  7810 1 1 123 GLN CD   C  -7.276   6.186 -10.708 1.00 . A A . 123 GLN CD   1 1 
        3  7811 1 1 123 GLN CG   C  -6.245   5.139 -10.296 1.00 . A A . 123 GLN CG   1 1 
        3  7812 1 1 123 GLN H    H  -5.521   3.161  -8.388 1.00 . A A . 123 GLN H    1 1 
        3  7813 1 1 123 GLN HA   H  -5.851   1.661 -10.758 1.00 . A A . 123 GLN HA   1 1 
        3  7814 1 1 123 GLN HB2  H  -6.825   3.684 -11.759 1.00 . A A . 123 GLN HB2  1 1 
        3  7815 1 1 123 GLN HB3  H  -7.479   3.390 -10.156 1.00 . A A . 123 GLN HB3  1 1 
        3  7816 1 1 123 GLN HE21 H  -5.879   7.601 -10.751 1.00 . A A . 123 GLN HE21 1 1 
        3  7817 1 1 123 GLN HE22 H  -7.481   8.114 -11.157 1.00 . A A . 123 GLN HE22 1 1 
        3  7818 1 1 123 GLN HG2  H  -6.141   5.182  -9.218 1.00 . A A . 123 GLN HG2  1 1 
        3  7819 1 1 123 GLN HG3  H  -5.291   5.401 -10.746 1.00 . A A . 123 GLN HG3  1 1 
        3  7820 1 1 123 GLN N    N  -5.149   2.504  -9.015 1.00 . A A . 123 GLN N    1 1 
        3  7821 1 1 123 GLN NE2  N  -6.834   7.425 -10.890 1.00 . A A . 123 GLN NE2  1 1 
        3  7822 1 1 123 GLN O    O  -4.009   2.347 -12.329 1.00 . A A . 123 GLN O    1 1 
        3  7823 1 1 123 GLN OE1  O  -8.466   5.897 -10.827 1.00 . A A . 123 GLN OE1  1 1 
        3  7824 1 1 124 ILE C    C  -1.062   3.230 -11.473 1.00 . A A . 124 ILE C    1 1 
        3  7825 1 1 124 ILE CA   C  -2.172   4.297 -11.526 1.00 . A A . 124 ILE CA   1 1 
        3  7826 1 1 124 ILE CB   C  -1.664   5.703 -11.041 1.00 . A A . 124 ILE CB   1 1 
        3  7827 1 1 124 ILE CD1  C  -2.481   8.167 -10.741 1.00 . A A . 124 ILE CD1  1 1 
        3  7828 1 1 124 ILE CG1  C  -2.782   6.777 -11.271 1.00 . A A . 124 ILE CG1  1 1 
        3  7829 1 1 124 ILE CG2  C  -0.331   6.112 -11.731 1.00 . A A . 124 ILE CG2  1 1 
        3  7830 1 1 124 ILE H    H  -3.542   4.258  -9.891 1.00 . A A . 124 ILE H    1 1 
        3  7831 1 1 124 ILE HA   H  -2.476   4.407 -12.573 1.00 . A A . 124 ILE HA   1 1 
        3  7832 1 1 124 ILE HB   H  -1.469   5.632  -9.974 1.00 . A A . 124 ILE HB   1 1 
        3  7833 1 1 124 ILE HD11 H  -3.310   8.824 -10.968 1.00 . A A . 124 ILE HD11 1 1 
        3  7834 1 1 124 ILE HD12 H  -1.582   8.555 -11.206 1.00 . A A . 124 ILE HD12 1 1 
        3  7835 1 1 124 ILE HD13 H  -2.344   8.122  -9.671 1.00 . A A . 124 ILE HD13 1 1 
        3  7836 1 1 124 ILE HG12 H  -2.972   6.877 -12.332 1.00 . A A . 124 ILE HG12 1 1 
        3  7837 1 1 124 ILE HG13 H  -3.694   6.446 -10.790 1.00 . A A . 124 ILE HG13 1 1 
        3  7838 1 1 124 ILE HG21 H  -0.008   7.084 -11.371 1.00 . A A . 124 ILE HG21 1 1 
        3  7839 1 1 124 ILE HG22 H  -0.470   6.160 -12.802 1.00 . A A . 124 ILE HG22 1 1 
        3  7840 1 1 124 ILE HG23 H   0.439   5.379 -11.508 1.00 . A A . 124 ILE HG23 1 1 
        3  7841 1 1 124 ILE N    N  -3.363   3.865 -10.780 1.00 . A A . 124 ILE N    1 1 
        3  7842 1 1 124 ILE O    O  -0.483   2.937 -12.496 1.00 . A A . 124 ILE O    1 1 
        3  7843 1 1 125 THR C    C  -0.165   0.327 -11.009 1.00 . A A . 125 THR C    1 1 
        3  7844 1 1 125 THR CA   C   0.227   1.556 -10.172 1.00 . A A . 125 THR CA   1 1 
        3  7845 1 1 125 THR CB   C   0.515   1.115  -8.686 1.00 . A A . 125 THR CB   1 1 
        3  7846 1 1 125 THR CG2  C  -0.567   0.208  -8.074 1.00 . A A . 125 THR CG2  1 1 
        3  7847 1 1 125 THR H    H  -1.306   2.877  -9.517 1.00 . A A . 125 THR H    1 1 
        3  7848 1 1 125 THR HA   H   1.150   1.969 -10.574 1.00 . A A . 125 THR HA   1 1 
        3  7849 1 1 125 THR HB   H   0.597   2.010  -8.075 1.00 . A A . 125 THR HB   1 1 
        3  7850 1 1 125 THR HG1  H   1.922  -0.065  -9.436 1.00 . A A . 125 THR HG1  1 1 
        3  7851 1 1 125 THR HG21 H  -1.523   0.708  -8.114 1.00 . A A . 125 THR HG21 1 1 
        3  7852 1 1 125 THR HG22 H  -0.321  -0.012  -7.040 1.00 . A A . 125 THR HG22 1 1 
        3  7853 1 1 125 THR HG23 H  -0.625  -0.720  -8.629 1.00 . A A . 125 THR HG23 1 1 
        3  7854 1 1 125 THR N    N  -0.803   2.615 -10.299 1.00 . A A . 125 THR N    1 1 
        3  7855 1 1 125 THR O    O   0.696  -0.308 -11.594 1.00 . A A . 125 THR O    1 1 
        3  7856 1 1 125 THR OG1  O   1.764   0.412  -8.614 1.00 . A A . 125 THR OG1  1 1 
        3  7857 1 1 126 LEU C    C  -1.826  -0.708 -13.360 1.00 . A A . 126 LEU C    1 1 
        3  7858 1 1 126 LEU CA   C  -2.050  -1.039 -11.879 1.00 . A A . 126 LEU CA   1 1 
        3  7859 1 1 126 LEU CB   C  -3.562  -1.188 -11.584 1.00 . A A . 126 LEU CB   1 1 
        3  7860 1 1 126 LEU CD1  C  -3.769  -3.736 -11.647 1.00 . A A . 126 LEU CD1  1 1 
        3  7861 1 1 126 LEU CD2  C  -5.799  -2.266 -12.113 1.00 . A A . 126 LEU CD2  1 1 
        3  7862 1 1 126 LEU CG   C  -4.274  -2.403 -12.237 1.00 . A A . 126 LEU CG   1 1 
        3  7863 1 1 126 LEU H    H  -2.090   0.507 -10.438 1.00 . A A . 126 LEU H    1 1 
        3  7864 1 1 126 LEU HA   H  -1.543  -1.965 -11.633 1.00 . A A . 126 LEU HA   1 1 
        3  7865 1 1 126 LEU HB2  H  -3.691  -1.256 -10.505 1.00 . A A . 126 LEU HB2  1 1 
        3  7866 1 1 126 LEU HB3  H  -4.060  -0.279 -11.915 1.00 . A A . 126 LEU HB3  1 1 
        3  7867 1 1 126 LEU HD11 H  -2.705  -3.833 -11.818 1.00 . A A . 126 LEU HD11 1 1 
        3  7868 1 1 126 LEU HD12 H  -4.278  -4.560 -12.129 1.00 . A A . 126 LEU HD12 1 1 
        3  7869 1 1 126 LEU HD13 H  -3.964  -3.773 -10.580 1.00 . A A . 126 LEU HD13 1 1 
        3  7870 1 1 126 LEU HD21 H  -6.093  -2.307 -11.070 1.00 . A A . 126 LEU HD21 1 1 
        3  7871 1 1 126 LEU HD22 H  -6.275  -3.074 -12.648 1.00 . A A . 126 LEU HD22 1 1 
        3  7872 1 1 126 LEU HD23 H  -6.118  -1.325 -12.540 1.00 . A A . 126 LEU HD23 1 1 
        3  7873 1 1 126 LEU HG   H  -4.039  -2.419 -13.294 1.00 . A A . 126 LEU HG   1 1 
        3  7874 1 1 126 LEU N    N  -1.481   0.020 -11.040 1.00 . A A . 126 LEU N    1 1 
        3  7875 1 1 126 LEU O    O  -1.440  -1.570 -14.134 1.00 . A A . 126 LEU O    1 1 
        3  7876 1 1 127 ARG C    C  -0.327   0.985 -15.444 1.00 . A A . 127 ARG C    1 1 
        3  7877 1 1 127 ARG CA   C  -1.812   1.133 -15.052 1.00 . A A . 127 ARG CA   1 1 
        3  7878 1 1 127 ARG CB   C  -2.238   2.631 -15.082 1.00 . A A . 127 ARG CB   1 1 
        3  7879 1 1 127 ARG CD   C  -2.300   4.898 -16.269 1.00 . A A . 127 ARG CD   1 1 
        3  7880 1 1 127 ARG CG   C  -1.913   3.410 -16.377 1.00 . A A . 127 ARG CG   1 1 
        3  7881 1 1 127 ARG CZ   C  -2.717   6.557 -18.104 1.00 . A A . 127 ARG CZ   1 1 
        3  7882 1 1 127 ARG H    H  -2.501   1.151 -13.039 1.00 . A A . 127 ARG H    1 1 
        3  7883 1 1 127 ARG HA   H  -2.421   0.584 -15.761 1.00 . A A . 127 ARG HA   1 1 
        3  7884 1 1 127 ARG HB2  H  -3.310   2.684 -14.918 1.00 . A A . 127 ARG HB2  1 1 
        3  7885 1 1 127 ARG HB3  H  -1.750   3.138 -14.254 1.00 . A A . 127 ARG HB3  1 1 
        3  7886 1 1 127 ARG HD2  H  -3.371   4.971 -16.105 1.00 . A A . 127 ARG HD2  1 1 
        3  7887 1 1 127 ARG HD3  H  -1.782   5.331 -15.422 1.00 . A A . 127 ARG HD3  1 1 
        3  7888 1 1 127 ARG HE   H  -1.040   5.489 -17.848 1.00 . A A . 127 ARG HE   1 1 
        3  7889 1 1 127 ARG HG2  H  -0.849   3.339 -16.574 1.00 . A A . 127 ARG HG2  1 1 
        3  7890 1 1 127 ARG HG3  H  -2.456   2.961 -17.204 1.00 . A A . 127 ARG HG3  1 1 
        3  7891 1 1 127 ARG HH11 H  -4.299   6.368 -16.838 1.00 . A A . 127 ARG HH11 1 1 
        3  7892 1 1 127 ARG HH12 H  -4.525   7.503 -18.128 1.00 . A A . 127 ARG HH12 1 1 
        3  7893 1 1 127 ARG HH21 H  -1.344   6.988 -19.535 1.00 . A A . 127 ARG HH21 1 1 
        3  7894 1 1 127 ARG HH22 H  -2.847   7.850 -19.654 1.00 . A A . 127 ARG HH22 1 1 
        3  7895 1 1 127 ARG N    N  -2.080   0.571 -13.712 1.00 . A A . 127 ARG N    1 1 
        3  7896 1 1 127 ARG NE   N  -1.937   5.655 -17.484 1.00 . A A . 127 ARG NE   1 1 
        3  7897 1 1 127 ARG NH1  N  -3.948   6.827 -17.657 1.00 . A A . 127 ARG NH1  1 1 
        3  7898 1 1 127 ARG NH2  N  -2.269   7.180 -19.185 1.00 . A A . 127 ARG NH2  1 1 
        3  7899 1 1 127 ARG O    O  -0.042   0.630 -16.575 1.00 . A A . 127 ARG O    1 1 
        3  7900 1 1 128 GLU C    C   2.540  -0.266 -14.939 1.00 . A A . 128 GLU C    1 1 
        3  7901 1 1 128 GLU CA   C   2.060   1.190 -14.776 1.00 . A A . 128 GLU CA   1 1 
        3  7902 1 1 128 GLU CB   C   2.879   1.903 -13.664 1.00 . A A . 128 GLU CB   1 1 
        3  7903 1 1 128 GLU CD   C   2.369   4.259 -14.607 1.00 . A A . 128 GLU CD   1 1 
        3  7904 1 1 128 GLU CG   C   2.449   3.354 -13.366 1.00 . A A . 128 GLU CG   1 1 
        3  7905 1 1 128 GLU H    H   0.306   1.448 -13.589 1.00 . A A . 128 GLU H    1 1 
        3  7906 1 1 128 GLU HA   H   2.220   1.722 -15.714 1.00 . A A . 128 GLU HA   1 1 
        3  7907 1 1 128 GLU HB2  H   2.793   1.330 -12.743 1.00 . A A . 128 GLU HB2  1 1 
        3  7908 1 1 128 GLU HB3  H   3.923   1.916 -13.957 1.00 . A A . 128 GLU HB3  1 1 
        3  7909 1 1 128 GLU HG2  H   1.483   3.328 -12.880 1.00 . A A . 128 GLU HG2  1 1 
        3  7910 1 1 128 GLU HG3  H   3.163   3.782 -12.667 1.00 . A A . 128 GLU HG3  1 1 
        3  7911 1 1 128 GLU N    N   0.605   1.232 -14.495 1.00 . A A . 128 GLU N    1 1 
        3  7912 1 1 128 GLU O    O   3.223  -0.580 -15.917 1.00 . A A . 128 GLU O    1 1 
        3  7913 1 1 128 GLU OE1  O   3.425   4.727 -15.081 1.00 . A A . 128 GLU OE1  1 1 
        3  7914 1 1 128 GLU OE2  O   1.257   4.504 -15.120 1.00 . A A . 128 GLU OE2  1 1 
        3  7915 1 1 129 PHE C    C   1.961  -3.149 -15.369 1.00 . A A . 129 PHE C    1 1 
        3  7916 1 1 129 PHE CA   C   2.416  -2.592 -14.004 1.00 . A A . 129 PHE CA   1 1 
        3  7917 1 1 129 PHE CB   C   1.663  -3.341 -12.851 1.00 . A A . 129 PHE CB   1 1 
        3  7918 1 1 129 PHE CD1  C   3.605  -4.083 -11.391 1.00 . A A . 129 PHE CD1  1 1 
        3  7919 1 1 129 PHE CD2  C   1.834  -2.861 -10.345 1.00 . A A . 129 PHE CD2  1 1 
        3  7920 1 1 129 PHE CE1  C   4.247  -4.191 -10.172 1.00 . A A . 129 PHE CE1  1 1 
        3  7921 1 1 129 PHE CE2  C   2.474  -2.977  -9.127 1.00 . A A . 129 PHE CE2  1 1 
        3  7922 1 1 129 PHE CG   C   2.387  -3.414 -11.502 1.00 . A A . 129 PHE CG   1 1 
        3  7923 1 1 129 PHE CZ   C   3.679  -3.641  -9.041 1.00 . A A . 129 PHE CZ   1 1 
        3  7924 1 1 129 PHE H    H   1.728  -0.764 -13.178 1.00 . A A . 129 PHE H    1 1 
        3  7925 1 1 129 PHE HA   H   3.487  -2.743 -13.882 1.00 . A A . 129 PHE HA   1 1 
        3  7926 1 1 129 PHE HB2  H   0.706  -2.860 -12.689 1.00 . A A . 129 PHE HB2  1 1 
        3  7927 1 1 129 PHE HB3  H   1.470  -4.365 -13.159 1.00 . A A . 129 PHE HB3  1 1 
        3  7928 1 1 129 PHE HD1  H   4.060  -4.517 -12.273 1.00 . A A . 129 PHE HD1  1 1 
        3  7929 1 1 129 PHE HD2  H   0.888  -2.335 -10.405 1.00 . A A . 129 PHE HD2  1 1 
        3  7930 1 1 129 PHE HE1  H   5.196  -4.711 -10.101 1.00 . A A . 129 PHE HE1  1 1 
        3  7931 1 1 129 PHE HE2  H   2.030  -2.540  -8.239 1.00 . A A . 129 PHE HE2  1 1 
        3  7932 1 1 129 PHE HZ   H   4.178  -3.730  -8.084 1.00 . A A . 129 PHE HZ   1 1 
        3  7933 1 1 129 PHE N    N   2.170  -1.130 -13.958 1.00 . A A . 129 PHE N    1 1 
        3  7934 1 1 129 PHE O    O   2.779  -3.629 -16.153 1.00 . A A . 129 PHE O    1 1 
        3  7935 1 1 130 PHE C    C   0.721  -2.927 -18.137 1.00 . A A . 130 PHE C    1 1 
        3  7936 1 1 130 PHE CA   C  -0.024  -3.414 -16.883 1.00 . A A . 130 PHE CA   1 1 
        3  7937 1 1 130 PHE CB   C  -1.496  -2.895 -16.887 1.00 . A A . 130 PHE CB   1 1 
        3  7938 1 1 130 PHE CD1  C  -2.368  -2.416 -19.239 1.00 . A A . 130 PHE CD1  1 1 
        3  7939 1 1 130 PHE CD2  C  -3.091  -4.426 -18.151 1.00 . A A . 130 PHE CD2  1 1 
        3  7940 1 1 130 PHE CE1  C  -3.126  -2.741 -20.346 1.00 . A A . 130 PHE CE1  1 1 
        3  7941 1 1 130 PHE CE2  C  -3.851  -4.746 -19.263 1.00 . A A . 130 PHE CE2  1 1 
        3  7942 1 1 130 PHE CG   C  -2.334  -3.253 -18.116 1.00 . A A . 130 PHE CG   1 1 
        3  7943 1 1 130 PHE CZ   C  -3.863  -3.905 -20.358 1.00 . A A . 130 PHE CZ   1 1 
        3  7944 1 1 130 PHE H    H   0.110  -2.502 -14.982 1.00 . A A . 130 PHE H    1 1 
        3  7945 1 1 130 PHE HA   H  -0.037  -4.500 -16.871 1.00 . A A . 130 PHE HA   1 1 
        3  7946 1 1 130 PHE HB2  H  -2.008  -3.294 -16.017 1.00 . A A . 130 PHE HB2  1 1 
        3  7947 1 1 130 PHE HB3  H  -1.485  -1.811 -16.797 1.00 . A A . 130 PHE HB3  1 1 
        3  7948 1 1 130 PHE HD1  H  -1.792  -1.501 -19.242 1.00 . A A . 130 PHE HD1  1 1 
        3  7949 1 1 130 PHE HD2  H  -3.087  -5.090 -17.296 1.00 . A A . 130 PHE HD2  1 1 
        3  7950 1 1 130 PHE HE1  H  -3.143  -2.081 -21.209 1.00 . A A . 130 PHE HE1  1 1 
        3  7951 1 1 130 PHE HE2  H  -4.433  -5.662 -19.277 1.00 . A A . 130 PHE HE2  1 1 
        3  7952 1 1 130 PHE HZ   H  -4.454  -4.162 -21.230 1.00 . A A . 130 PHE HZ   1 1 
        3  7953 1 1 130 PHE N    N   0.651  -2.969 -15.648 1.00 . A A . 130 PHE N    1 1 
        3  7954 1 1 130 PHE O    O   1.161  -3.750 -18.937 1.00 . A A . 130 PHE O    1 1 
        3  7955 1 1 131 ASN C    C   2.891  -1.398 -19.719 1.00 . A A . 131 ASN C    1 1 
        3  7956 1 1 131 ASN CA   C   1.471  -0.901 -19.425 1.00 . A A . 131 ASN CA   1 1 
        3  7957 1 1 131 ASN CB   C   1.482   0.638 -19.212 1.00 . A A . 131 ASN CB   1 1 
        3  7958 1 1 131 ASN CG   C   1.938   1.445 -20.439 1.00 . A A . 131 ASN CG   1 1 
        3  7959 1 1 131 ASN H    H   0.618  -1.028 -17.481 1.00 . A A . 131 ASN H    1 1 
        3  7960 1 1 131 ASN HA   H   0.831  -1.130 -20.274 1.00 . A A . 131 ASN HA   1 1 
        3  7961 1 1 131 ASN HB2  H   0.484   0.960 -18.941 1.00 . A A . 131 ASN HB2  1 1 
        3  7962 1 1 131 ASN HB3  H   2.146   0.872 -18.384 1.00 . A A . 131 ASN HB3  1 1 
        3  7963 1 1 131 ASN HD21 H   0.074   1.592 -21.097 1.00 . A A . 131 ASN HD21 1 1 
        3  7964 1 1 131 ASN HD22 H   1.282   2.336 -22.080 1.00 . A A . 131 ASN HD22 1 1 
        3  7965 1 1 131 ASN N    N   0.892  -1.584 -18.242 1.00 . A A . 131 ASN N    1 1 
        3  7966 1 1 131 ASN ND2  N   1.004   1.829 -21.291 1.00 . A A . 131 ASN ND2  1 1 
        3  7967 1 1 131 ASN O    O   3.257  -1.592 -20.873 1.00 . A A . 131 ASN O    1 1 
        3  7968 1 1 131 ASN OD1  O   3.122   1.730 -20.617 1.00 . A A . 131 ASN OD1  1 1 
        3  7969 1 1 132 ALA C    C   5.165  -3.524 -19.182 1.00 . A A . 132 ALA C    1 1 
        3  7970 1 1 132 ALA CA   C   5.060  -2.056 -18.738 1.00 . A A . 132 ALA CA   1 1 
        3  7971 1 1 132 ALA CB   C   5.761  -1.830 -17.399 1.00 . A A . 132 ALA CB   1 1 
        3  7972 1 1 132 ALA H    H   3.262  -1.504 -17.768 1.00 . A A . 132 ALA H    1 1 
        3  7973 1 1 132 ALA HA   H   5.555  -1.431 -19.475 1.00 . A A . 132 ALA HA   1 1 
        3  7974 1 1 132 ALA HB1  H   6.798  -2.132 -17.471 1.00 . A A . 132 ALA HB1  1 1 
        3  7975 1 1 132 ALA HB2  H   5.267  -2.411 -16.625 1.00 . A A . 132 ALA HB2  1 1 
        3  7976 1 1 132 ALA HB3  H   5.716  -0.784 -17.133 1.00 . A A . 132 ALA HB3  1 1 
        3  7977 1 1 132 ALA N    N   3.658  -1.628 -18.650 1.00 . A A . 132 ALA N    1 1 
        3  7978 1 1 132 ALA O    O   5.986  -3.855 -20.044 1.00 . A A . 132 ALA O    1 1 
        3  7979 1 1 133 ILE C    C   3.853  -6.056 -20.390 1.00 . A A . 133 ILE C    1 1 
        3  7980 1 1 133 ILE CA   C   4.279  -5.836 -18.920 1.00 . A A . 133 ILE CA   1 1 
        3  7981 1 1 133 ILE CB   C   3.363  -6.663 -17.927 1.00 . A A . 133 ILE CB   1 1 
        3  7982 1 1 133 ILE CD1  C   2.934  -7.000 -15.368 1.00 . A A . 133 ILE CD1  1 1 
        3  7983 1 1 133 ILE CG1  C   3.863  -6.493 -16.459 1.00 . A A . 133 ILE CG1  1 1 
        3  7984 1 1 133 ILE CG2  C   3.335  -8.166 -18.311 1.00 . A A . 133 ILE CG2  1 1 
        3  7985 1 1 133 ILE H    H   3.639  -4.021 -17.981 1.00 . A A . 133 ILE H    1 1 
        3  7986 1 1 133 ILE HA   H   5.301  -6.197 -18.804 1.00 . A A . 133 ILE HA   1 1 
        3  7987 1 1 133 ILE HB   H   2.351  -6.280 -18.004 1.00 . A A . 133 ILE HB   1 1 
        3  7988 1 1 133 ILE HD11 H   2.803  -8.070 -15.458 1.00 . A A . 133 ILE HD11 1 1 
        3  7989 1 1 133 ILE HD12 H   1.977  -6.507 -15.450 1.00 . A A . 133 ILE HD12 1 1 
        3  7990 1 1 133 ILE HD13 H   3.372  -6.770 -14.400 1.00 . A A . 133 ILE HD13 1 1 
        3  7991 1 1 133 ILE HG12 H   4.805  -7.009 -16.336 1.00 . A A . 133 ILE HG12 1 1 
        3  7992 1 1 133 ILE HG13 H   4.022  -5.441 -16.267 1.00 . A A . 133 ILE HG13 1 1 
        3  7993 1 1 133 ILE HG21 H   4.335  -8.581 -18.255 1.00 . A A . 133 ILE HG21 1 1 
        3  7994 1 1 133 ILE HG22 H   2.959  -8.282 -19.320 1.00 . A A . 133 ILE HG22 1 1 
        3  7995 1 1 133 ILE HG23 H   2.688  -8.706 -17.629 1.00 . A A . 133 ILE HG23 1 1 
        3  7996 1 1 133 ILE N    N   4.297  -4.389 -18.610 1.00 . A A . 133 ILE N    1 1 
        3  7997 1 1 133 ILE O    O   4.524  -6.781 -21.123 1.00 . A A . 133 ILE O    1 1 
        3  7998 1 1 134 ILE C    C   3.324  -4.737 -23.169 1.00 . A A . 134 ILE C    1 1 
        3  7999 1 1 134 ILE CA   C   2.298  -5.423 -22.231 1.00 . A A . 134 ILE CA   1 1 
        3  8000 1 1 134 ILE CB   C   0.827  -4.826 -22.390 1.00 . A A . 134 ILE CB   1 1 
        3  8001 1 1 134 ILE CD1  C   0.501  -3.936 -24.841 1.00 . A A . 134 ILE CD1  1 1 
        3  8002 1 1 134 ILE CG1  C   0.207  -5.036 -23.825 1.00 . A A . 134 ILE CG1  1 1 
        3  8003 1 1 134 ILE CG2  C   0.760  -3.342 -21.995 1.00 . A A . 134 ILE CG2  1 1 
        3  8004 1 1 134 ILE H    H   2.268  -4.835 -20.177 1.00 . A A . 134 ILE H    1 1 
        3  8005 1 1 134 ILE HA   H   2.252  -6.476 -22.503 1.00 . A A . 134 ILE HA   1 1 
        3  8006 1 1 134 ILE HB   H   0.202  -5.363 -21.675 1.00 . A A . 134 ILE HB   1 1 
        3  8007 1 1 134 ILE HD11 H   0.067  -3.003 -24.501 1.00 . A A . 134 ILE HD11 1 1 
        3  8008 1 1 134 ILE HD12 H   0.077  -4.206 -25.793 1.00 . A A . 134 ILE HD12 1 1 
        3  8009 1 1 134 ILE HD13 H   1.570  -3.813 -24.941 1.00 . A A . 134 ILE HD13 1 1 
        3  8010 1 1 134 ILE HG12 H   0.573  -5.963 -24.245 1.00 . A A . 134 ILE HG12 1 1 
        3  8011 1 1 134 ILE HG13 H  -0.874  -5.108 -23.734 1.00 . A A . 134 ILE HG13 1 1 
        3  8012 1 1 134 ILE HG21 H   1.080  -3.221 -20.973 1.00 . A A . 134 ILE HG21 1 1 
        3  8013 1 1 134 ILE HG22 H  -0.256  -2.976 -22.092 1.00 . A A . 134 ILE HG22 1 1 
        3  8014 1 1 134 ILE HG23 H   1.409  -2.762 -22.640 1.00 . A A . 134 ILE HG23 1 1 
        3  8015 1 1 134 ILE N    N   2.768  -5.374 -20.821 1.00 . A A . 134 ILE N    1 1 
        3  8016 1 1 134 ILE O    O   3.469  -5.144 -24.329 1.00 . A A . 134 ILE O    1 1 
        3  8017 1 1 135 ALA C    C   6.278  -4.110 -23.691 1.00 . A A . 135 ALA C    1 1 
        3  8018 1 1 135 ALA CA   C   5.168  -3.082 -23.416 1.00 . A A . 135 ALA CA   1 1 
        3  8019 1 1 135 ALA CB   C   5.748  -1.868 -22.671 1.00 . A A . 135 ALA CB   1 1 
        3  8020 1 1 135 ALA H    H   3.826  -3.341 -21.777 1.00 . A A . 135 ALA H    1 1 
        3  8021 1 1 135 ALA HA   H   4.765  -2.732 -24.368 1.00 . A A . 135 ALA HA   1 1 
        3  8022 1 1 135 ALA HB1  H   6.162  -2.183 -21.720 1.00 . A A . 135 ALA HB1  1 1 
        3  8023 1 1 135 ALA HB2  H   4.965  -1.139 -22.493 1.00 . A A . 135 ALA HB2  1 1 
        3  8024 1 1 135 ALA HB3  H   6.527  -1.410 -23.267 1.00 . A A . 135 ALA HB3  1 1 
        3  8025 1 1 135 ALA N    N   4.050  -3.705 -22.663 1.00 . A A . 135 ALA N    1 1 
        3  8026 1 1 135 ALA O    O   6.928  -4.053 -24.739 1.00 . A A . 135 ALA O    1 1 
        3  8027 1 1 136 GLY C    C   7.947  -6.790 -21.668 1.00 . A A . 136 GLY C    1 1 
        3  8028 1 1 136 GLY CA   C   7.396  -6.175 -22.947 1.00 . A A . 136 GLY CA   1 1 
        3  8029 1 1 136 GLY H    H   6.053  -4.910 -21.863 1.00 . A A . 136 GLY H    1 1 
        3  8030 1 1 136 GLY HA2  H   6.834  -6.931 -23.483 1.00 . A A . 136 GLY HA2  1 1 
        3  8031 1 1 136 GLY HA3  H   8.234  -5.867 -23.572 1.00 . A A . 136 GLY HA3  1 1 
        3  8032 1 1 136 GLY N    N   6.502  -5.023 -22.733 1.00 . A A . 136 GLY N    1 1 
        3  8033 1 1 136 GLY O    O   8.691  -7.777 -21.741 1.00 . A A . 136 GLY O    1 1 
        3  8034 1 1 137 LYS C    C   9.541  -6.205 -18.882 1.00 . A A . 137 LYS C    1 1 
        3  8035 1 1 137 LYS CA   C   8.068  -6.595 -19.148 1.00 . A A . 137 LYS CA   1 1 
        3  8036 1 1 137 LYS CB   C   7.742  -8.127 -18.924 1.00 . A A . 137 LYS CB   1 1 
        3  8037 1 1 137 LYS CD   C   9.763  -9.333 -17.723 1.00 . A A . 137 LYS CD   1 1 
        3  8038 1 1 137 LYS CE   C  10.044 -10.339 -18.861 1.00 . A A . 137 LYS CE   1 1 
        3  8039 1 1 137 LYS CG   C   8.284  -8.833 -17.639 1.00 . A A . 137 LYS CG   1 1 
        3  8040 1 1 137 LYS H    H   7.091  -5.362 -20.559 1.00 . A A . 137 LYS H    1 1 
        3  8041 1 1 137 LYS HA   H   7.462  -6.026 -18.455 1.00 . A A . 137 LYS HA   1 1 
        3  8042 1 1 137 LYS HB2  H   6.663  -8.239 -18.920 1.00 . A A . 137 LYS HB2  1 1 
        3  8043 1 1 137 LYS HB3  H   8.119  -8.676 -19.783 1.00 . A A . 137 LYS HB3  1 1 
        3  8044 1 1 137 LYS HD2  H  10.409  -8.473 -17.858 1.00 . A A . 137 LYS HD2  1 1 
        3  8045 1 1 137 LYS HD3  H  10.016  -9.800 -16.773 1.00 . A A . 137 LYS HD3  1 1 
        3  8046 1 1 137 LYS HE2  H  10.976 -10.852 -18.653 1.00 . A A . 137 LYS HE2  1 1 
        3  8047 1 1 137 LYS HE3  H   9.245 -11.070 -18.893 1.00 . A A . 137 LYS HE3  1 1 
        3  8048 1 1 137 LYS HG2  H   8.214  -8.132 -16.813 1.00 . A A . 137 LYS HG2  1 1 
        3  8049 1 1 137 LYS HG3  H   7.652  -9.685 -17.415 1.00 . A A . 137 LYS HG3  1 1 
        3  8050 1 1 137 LYS HZ1  H  10.861  -8.929 -20.187 1.00 . A A . 137 LYS HZ1  1 1 
        3  8051 1 1 137 LYS HZ2  H   9.248  -9.313 -20.518 1.00 . A A . 137 LYS HZ2  1 1 
        3  8052 1 1 137 LYS HZ3  H  10.476 -10.400 -20.918 1.00 . A A . 137 LYS HZ3  1 1 
        3  8053 1 1 137 LYS N    N   7.634  -6.160 -20.503 1.00 . A A . 137 LYS N    1 1 
        3  8054 1 1 137 LYS NZ   N  10.164  -9.699 -20.215 1.00 . A A . 137 LYS NZ   1 1 
        3  8055 1 1 137 LYS O    O  10.004  -6.212 -17.739 1.00 . A A . 137 LYS O    1 1 
        3  8056 1 1 138 ASP C    C  11.811  -4.043 -19.308 1.00 . A A . 138 ASP C    1 1 
        3  8057 1 1 138 ASP CA   C  11.673  -5.457 -19.884 1.00 . A A . 138 ASP CA   1 1 
        3  8058 1 1 138 ASP CB   C  12.339  -5.619 -21.275 1.00 . A A . 138 ASP CB   1 1 
        3  8059 1 1 138 ASP CG   C  12.222  -7.062 -21.814 1.00 . A A . 138 ASP CG   1 1 
        3  8060 1 1 138 ASP H    H   9.792  -5.748 -20.794 1.00 . A A . 138 ASP H    1 1 
        3  8061 1 1 138 ASP HA   H  12.153  -6.148 -19.197 1.00 . A A . 138 ASP HA   1 1 
        3  8062 1 1 138 ASP HB2  H  11.863  -4.934 -21.973 1.00 . A A . 138 ASP HB2  1 1 
        3  8063 1 1 138 ASP HB3  H  13.390  -5.365 -21.199 1.00 . A A . 138 ASP HB3  1 1 
        3  8064 1 1 138 ASP N    N  10.259  -5.817 -19.947 1.00 . A A . 138 ASP N    1 1 
        3  8065 1 1 138 ASP O    O  11.787  -3.039 -20.024 1.00 . A A . 138 ASP O    1 1 
        3  8066 1 1 138 ASP OD1  O  12.497  -8.019 -21.052 1.00 . A A . 138 ASP OD1  1 1 
        3  8067 1 1 138 ASP OD2  O  11.834  -7.251 -22.982 1.00 . A A . 138 ASP OD2  1 1 
        3  8068 1 1 139 VAL C    C  13.248  -3.062 -16.199 1.00 . A A . 139 VAL C    1 1 
        3  8069 1 1 139 VAL CA   C  12.029  -2.808 -17.137 1.00 . A A . 139 VAL CA   1 1 
        3  8070 1 1 139 VAL CB   C  10.712  -2.466 -16.307 1.00 . A A . 139 VAL CB   1 1 
        3  8071 1 1 139 VAL CG1  C  10.816  -1.149 -15.488 1.00 . A A . 139 VAL CG1  1 1 
        3  8072 1 1 139 VAL CG2  C   9.481  -2.410 -17.239 1.00 . A A . 139 VAL CG2  1 1 
        3  8073 1 1 139 VAL H    H  11.740  -4.880 -17.530 1.00 . A A . 139 VAL H    1 1 
        3  8074 1 1 139 VAL HA   H  12.261  -1.963 -17.790 1.00 . A A . 139 VAL HA   1 1 
        3  8075 1 1 139 VAL HB   H  10.545  -3.274 -15.602 1.00 . A A . 139 VAL HB   1 1 
        3  8076 1 1 139 VAL HG11 H  10.994  -0.312 -16.157 1.00 . A A . 139 VAL HG11 1 1 
        3  8077 1 1 139 VAL HG12 H  11.638  -1.217 -14.787 1.00 . A A . 139 VAL HG12 1 1 
        3  8078 1 1 139 VAL HG13 H   9.898  -0.980 -14.940 1.00 . A A . 139 VAL HG13 1 1 
        3  8079 1 1 139 VAL HG21 H   9.370  -3.354 -17.755 1.00 . A A . 139 VAL HG21 1 1 
        3  8080 1 1 139 VAL HG22 H   9.609  -1.619 -17.971 1.00 . A A . 139 VAL HG22 1 1 
        3  8081 1 1 139 VAL HG23 H   8.585  -2.215 -16.658 1.00 . A A . 139 VAL HG23 1 1 
        3  8082 1 1 139 VAL N    N  11.827  -4.017 -17.977 1.00 . A A . 139 VAL N    1 1 
        3  8083 1 1 139 VAL O    O  13.692  -2.154 -15.489 1.00 . A A . 139 VAL O    1 1 
        3  8084 1 1 140 ASP C    C  14.468  -5.049 -13.952 1.00 . A A . 140 ASP C    1 1 
        3  8085 1 1 140 ASP CA   C  14.928  -4.824 -15.425 1.00 . A A . 140 ASP CA   1 1 
        3  8086 1 1 140 ASP CB   C  16.173  -3.867 -15.522 1.00 . A A . 140 ASP CB   1 1 
        3  8087 1 1 140 ASP CG   C  16.707  -3.713 -16.957 1.00 . A A . 140 ASP CG   1 1 
        3  8088 1 1 140 ASP H    H  13.394  -4.954 -16.883 1.00 . A A . 140 ASP H    1 1 
        3  8089 1 1 140 ASP HA   H  15.201  -5.789 -15.832 1.00 . A A . 140 ASP HA   1 1 
        3  8090 1 1 140 ASP HB2  H  15.891  -2.893 -15.138 1.00 . A A . 140 ASP HB2  1 1 
        3  8091 1 1 140 ASP HB3  H  16.972  -4.262 -14.897 1.00 . A A . 140 ASP HB3  1 1 
        3  8092 1 1 140 ASP N    N  13.791  -4.324 -16.256 1.00 . A A . 140 ASP N    1 1 
        3  8093 1 1 140 ASP O    O  13.315  -4.747 -13.639 1.00 . A A . 140 ASP O    1 1 
        3  8094 1 1 140 ASP OD1  O  17.216  -4.705 -17.518 1.00 . A A . 140 ASP OD1  1 1 
        3  8095 1 1 140 ASP OD2  O  16.630  -2.602 -17.525 1.00 . A A . 140 ASP OD2  1 1 
        3  8096 1 1 141 PRO C    C  14.745  -4.183 -10.950 1.00 . A A . 141 PRO C    1 1 
        3  8097 1 1 141 PRO CA   C  15.040  -5.596 -11.533 1.00 . A A . 141 PRO CA   1 1 
        3  8098 1 1 141 PRO CB   C  16.311  -6.239 -10.899 1.00 . A A . 141 PRO CB   1 1 
        3  8099 1 1 141 PRO CD   C  16.564  -6.393 -13.292 1.00 . A A . 141 PRO CD   1 1 
        3  8100 1 1 141 PRO CG   C  17.338  -6.273 -12.001 1.00 . A A . 141 PRO CG   1 1 
        3  8101 1 1 141 PRO HA   H  14.175  -6.222 -11.316 1.00 . A A . 141 PRO HA   1 1 
        3  8102 1 1 141 PRO HB2  H  16.664  -5.652 -10.048 1.00 . A A . 141 PRO HB2  1 1 
        3  8103 1 1 141 PRO HB3  H  16.090  -7.247 -10.569 1.00 . A A . 141 PRO HB3  1 1 
        3  8104 1 1 141 PRO HD2  H  17.128  -5.969 -14.115 1.00 . A A . 141 PRO HD2  1 1 
        3  8105 1 1 141 PRO HD3  H  16.316  -7.426 -13.502 1.00 . A A . 141 PRO HD3  1 1 
        3  8106 1 1 141 PRO HG2  H  17.926  -5.356 -11.990 1.00 . A A . 141 PRO HG2  1 1 
        3  8107 1 1 141 PRO HG3  H  17.993  -7.130 -11.880 1.00 . A A . 141 PRO HG3  1 1 
        3  8108 1 1 141 PRO N    N  15.332  -5.603 -13.010 1.00 . A A . 141 PRO N    1 1 
        3  8109 1 1 141 PRO O    O  14.378  -4.052  -9.771 1.00 . A A . 141 PRO O    1 1 
        3  8110 1 1 142 SER C    C  12.886  -1.698 -11.319 1.00 . A A . 142 SER C    1 1 
        3  8111 1 1 142 SER CA   C  14.420  -1.784 -11.544 1.00 . A A . 142 SER CA   1 1 
        3  8112 1 1 142 SER CB   C  14.795  -0.869 -12.740 1.00 . A A . 142 SER CB   1 1 
        3  8113 1 1 142 SER H    H  15.369  -3.311 -12.635 1.00 . A A . 142 SER H    1 1 
        3  8114 1 1 142 SER HA   H  14.935  -1.422 -10.663 1.00 . A A . 142 SER HA   1 1 
        3  8115 1 1 142 SER HB2  H  14.182  -1.118 -13.600 1.00 . A A . 142 SER HB2  1 1 
        3  8116 1 1 142 SER HB3  H  14.623   0.167 -12.473 1.00 . A A . 142 SER HB3  1 1 
        3  8117 1 1 142 SER HG   H  16.206  -1.334 -14.027 1.00 . A A . 142 SER HG   1 1 
        3  8118 1 1 142 SER N    N  14.888  -3.152 -11.801 1.00 . A A . 142 SER N    1 1 
        3  8119 1 1 142 SER O    O  12.424  -0.642 -10.921 1.00 . A A . 142 SER O    1 1 
        3  8120 1 1 142 SER OG   O  16.158  -1.012 -13.111 1.00 . A A . 142 SER OG   1 1 
        3  8121 1 1 143 TRP C    C  10.179  -2.260 -10.152 1.00 . A A . 143 TRP C    1 1 
        3  8122 1 1 143 TRP CA   C  10.629  -2.851 -11.483 1.00 . A A . 143 TRP CA   1 1 
        3  8123 1 1 143 TRP CB   C  10.093  -4.325 -11.579 1.00 . A A . 143 TRP CB   1 1 
        3  8124 1 1 143 TRP CD1  C  10.360  -5.429 -13.868 1.00 . A A . 143 TRP CD1  1 1 
        3  8125 1 1 143 TRP CD2  C   8.357  -4.513 -13.531 1.00 . A A . 143 TRP CD2  1 1 
        3  8126 1 1 143 TRP CE2  C   8.381  -5.084 -14.808 1.00 . A A . 143 TRP CE2  1 1 
        3  8127 1 1 143 TRP CE3  C   7.185  -3.884 -13.090 1.00 . A A . 143 TRP CE3  1 1 
        3  8128 1 1 143 TRP CG   C   9.642  -4.748 -12.947 1.00 . A A . 143 TRP CG   1 1 
        3  8129 1 1 143 TRP CH2  C   6.165  -4.407 -15.201 1.00 . A A . 143 TRP CH2  1 1 
        3  8130 1 1 143 TRP CZ2  C   7.292  -5.031 -15.658 1.00 . A A . 143 TRP CZ2  1 1 
        3  8131 1 1 143 TRP CZ3  C   6.107  -3.834 -13.935 1.00 . A A . 143 TRP CZ3  1 1 
        3  8132 1 1 143 TRP H    H  12.562  -3.605 -11.960 1.00 . A A . 143 TRP H    1 1 
        3  8133 1 1 143 TRP HA   H  10.207  -2.264 -12.288 1.00 . A A . 143 TRP HA   1 1 
        3  8134 1 1 143 TRP HB2  H  10.879  -5.009 -11.269 1.00 . A A . 143 TRP HB2  1 1 
        3  8135 1 1 143 TRP HB3  H   9.249  -4.466 -10.908 1.00 . A A . 143 TRP HB3  1 1 
        3  8136 1 1 143 TRP HD1  H  11.371  -5.750 -13.720 1.00 . A A . 143 TRP HD1  1 1 
        3  8137 1 1 143 TRP HE1  H   9.919  -6.102 -15.795 1.00 . A A . 143 TRP HE1  1 1 
        3  8138 1 1 143 TRP HE3  H   7.119  -3.446 -12.109 1.00 . A A . 143 TRP HE3  1 1 
        3  8139 1 1 143 TRP HH2  H   5.292  -4.345 -15.832 1.00 . A A . 143 TRP HH2  1 1 
        3  8140 1 1 143 TRP HZ2  H   7.316  -5.471 -16.647 1.00 . A A . 143 TRP HZ2  1 1 
        3  8141 1 1 143 TRP HZ3  H   5.191  -3.350 -13.614 1.00 . A A . 143 TRP HZ3  1 1 
        3  8142 1 1 143 TRP N    N  12.115  -2.801 -11.625 1.00 . A A . 143 TRP N    1 1 
        3  8143 1 1 143 TRP NE1  N   9.618  -5.634 -14.991 1.00 . A A . 143 TRP NE1  1 1 
        3  8144 1 1 143 TRP O    O   9.461  -1.272 -10.133 1.00 . A A . 143 TRP O    1 1 
        3  8145 1 1 144 LYS C    C  10.558  -0.920  -7.476 1.00 . A A . 144 LYS C    1 1 
        3  8146 1 1 144 LYS CA   C  10.346  -2.440  -7.680 1.00 . A A . 144 LYS CA   1 1 
        3  8147 1 1 144 LYS CB   C  11.178  -3.277  -6.661 1.00 . A A . 144 LYS CB   1 1 
        3  8148 1 1 144 LYS CD   C  13.498  -4.160  -5.938 1.00 . A A . 144 LYS CD   1 1 
        3  8149 1 1 144 LYS CE   C  13.210  -5.648  -6.201 1.00 . A A . 144 LYS CE   1 1 
        3  8150 1 1 144 LYS CG   C  12.714  -3.216  -6.874 1.00 . A A . 144 LYS CG   1 1 
        3  8151 1 1 144 LYS H    H  11.344  -3.571  -9.167 1.00 . A A . 144 LYS H    1 1 
        3  8152 1 1 144 LYS HA   H   9.296  -2.675  -7.542 1.00 . A A . 144 LYS HA   1 1 
        3  8153 1 1 144 LYS HB2  H  10.959  -2.928  -5.655 1.00 . A A . 144 LYS HB2  1 1 
        3  8154 1 1 144 LYS HB3  H  10.869  -4.316  -6.732 1.00 . A A . 144 LYS HB3  1 1 
        3  8155 1 1 144 LYS HD2  H  14.556  -3.987  -6.077 1.00 . A A . 144 LYS HD2  1 1 
        3  8156 1 1 144 LYS HD3  H  13.235  -3.930  -4.912 1.00 . A A . 144 LYS HD3  1 1 
        3  8157 1 1 144 LYS HE2  H  12.151  -5.832  -6.088 1.00 . A A . 144 LYS HE2  1 1 
        3  8158 1 1 144 LYS HE3  H  13.511  -5.894  -7.213 1.00 . A A . 144 LYS HE3  1 1 
        3  8159 1 1 144 LYS HG2  H  12.936  -3.480  -7.904 1.00 . A A . 144 LYS HG2  1 1 
        3  8160 1 1 144 LYS HG3  H  13.043  -2.196  -6.697 1.00 . A A . 144 LYS HG3  1 1 
        3  8161 1 1 144 LYS HZ1  H  14.965  -6.303  -5.277 1.00 . A A . 144 LYS HZ1  1 1 
        3  8162 1 1 144 LYS HZ2  H  13.828  -7.520  -5.519 1.00 . A A . 144 LYS HZ2  1 1 
        3  8163 1 1 144 LYS HZ3  H  13.602  -6.392  -4.287 1.00 . A A . 144 LYS HZ3  1 1 
        3  8164 1 1 144 LYS N    N  10.697  -2.841  -9.050 1.00 . A A . 144 LYS N    1 1 
        3  8165 1 1 144 LYS NZ   N  13.952  -6.527  -5.255 1.00 . A A . 144 LYS NZ   1 1 
        3  8166 1 1 144 LYS O    O   9.635  -0.224  -7.085 1.00 . A A . 144 LYS O    1 1 
        3  8167 1 1 145 LYS C    C  11.331   1.931  -8.530 1.00 . A A . 145 LYS C    1 1 
        3  8168 1 1 145 LYS CA   C  12.192   0.956  -7.694 1.00 . A A . 145 LYS CA   1 1 
        3  8169 1 1 145 LYS CB   C  13.696   1.055  -8.088 1.00 . A A . 145 LYS CB   1 1 
        3  8170 1 1 145 LYS CD   C  14.524   2.364  -6.031 1.00 . A A . 145 LYS CD   1 1 
        3  8171 1 1 145 LYS CE   C  15.293   3.601  -5.535 1.00 . A A . 145 LYS CE   1 1 
        3  8172 1 1 145 LYS CG   C  14.420   2.317  -7.577 1.00 . A A . 145 LYS CG   1 1 
        3  8173 1 1 145 LYS H    H  12.373  -1.069  -8.287 1.00 . A A . 145 LYS H    1 1 
        3  8174 1 1 145 LYS HA   H  12.084   1.204  -6.643 1.00 . A A . 145 LYS HA   1 1 
        3  8175 1 1 145 LYS HB2  H  14.219   0.186  -7.690 1.00 . A A . 145 LYS HB2  1 1 
        3  8176 1 1 145 LYS HB3  H  13.779   1.027  -9.173 1.00 . A A . 145 LYS HB3  1 1 
        3  8177 1 1 145 LYS HD2  H  13.522   2.393  -5.613 1.00 . A A . 145 LYS HD2  1 1 
        3  8178 1 1 145 LYS HD3  H  15.029   1.469  -5.677 1.00 . A A . 145 LYS HD3  1 1 
        3  8179 1 1 145 LYS HE2  H  15.354   3.570  -4.456 1.00 . A A . 145 LYS HE2  1 1 
        3  8180 1 1 145 LYS HE3  H  16.295   3.589  -5.947 1.00 . A A . 145 LYS HE3  1 1 
        3  8181 1 1 145 LYS HG2  H  15.419   2.339  -7.995 1.00 . A A . 145 LYS HG2  1 1 
        3  8182 1 1 145 LYS HG3  H  13.874   3.192  -7.919 1.00 . A A . 145 LYS HG3  1 1 
        3  8183 1 1 145 LYS HZ1  H  15.177   5.682  -5.590 1.00 . A A . 145 LYS HZ1  1 1 
        3  8184 1 1 145 LYS HZ2  H  13.679   4.917  -5.519 1.00 . A A . 145 LYS HZ2  1 1 
        3  8185 1 1 145 LYS HZ3  H  14.548   4.927  -6.965 1.00 . A A . 145 LYS HZ3  1 1 
        3  8186 1 1 145 LYS N    N  11.751  -0.439  -7.875 1.00 . A A . 145 LYS N    1 1 
        3  8187 1 1 145 LYS NZ   N  14.628   4.870  -5.932 1.00 . A A . 145 LYS NZ   1 1 
        3  8188 1 1 145 LYS O    O  10.965   3.015  -8.062 1.00 . A A . 145 LYS O    1 1 
        3  8189 1 1 146 ALA C    C   8.763   2.447 -10.251 1.00 . A A . 146 ALA C    1 1 
        3  8190 1 1 146 ALA CA   C  10.208   2.278 -10.720 1.00 . A A . 146 ALA CA   1 1 
        3  8191 1 1 146 ALA CB   C  10.252   1.604 -12.101 1.00 . A A . 146 ALA CB   1 1 
        3  8192 1 1 146 ALA H    H  11.220   0.577  -9.995 1.00 . A A . 146 ALA H    1 1 
        3  8193 1 1 146 ALA HA   H  10.677   3.258 -10.801 1.00 . A A . 146 ALA HA   1 1 
        3  8194 1 1 146 ALA HB1  H  11.281   1.499 -12.420 1.00 . A A . 146 ALA HB1  1 1 
        3  8195 1 1 146 ALA HB2  H   9.717   2.210 -12.819 1.00 . A A . 146 ALA HB2  1 1 
        3  8196 1 1 146 ALA HB3  H   9.796   0.624 -12.044 1.00 . A A . 146 ALA HB3  1 1 
        3  8197 1 1 146 ALA N    N  10.974   1.487  -9.747 1.00 . A A . 146 ALA N    1 1 
        3  8198 1 1 146 ALA O    O   8.210   3.547 -10.312 1.00 . A A . 146 ALA O    1 1 
        3  8199 1 1 147 ILE C    C   6.760   2.218  -7.940 1.00 . A A . 147 ILE C    1 1 
        3  8200 1 1 147 ILE CA   C   6.804   1.345  -9.216 1.00 . A A . 147 ILE CA   1 1 
        3  8201 1 1 147 ILE CB   C   6.283  -0.117  -8.922 1.00 . A A . 147 ILE CB   1 1 
        3  8202 1 1 147 ILE CD1  C   5.687  -0.577 -11.452 1.00 . A A . 147 ILE CD1  1 1 
        3  8203 1 1 147 ILE CG1  C   6.402  -1.046 -10.185 1.00 . A A . 147 ILE CG1  1 1 
        3  8204 1 1 147 ILE CG2  C   4.829  -0.104  -8.400 1.00 . A A . 147 ILE CG2  1 1 
        3  8205 1 1 147 ILE H    H   8.669   0.511  -9.747 1.00 . A A . 147 ILE H    1 1 
        3  8206 1 1 147 ILE HA   H   6.158   1.792  -9.976 1.00 . A A . 147 ILE HA   1 1 
        3  8207 1 1 147 ILE HB   H   6.909  -0.532  -8.133 1.00 . A A . 147 ILE HB   1 1 
        3  8208 1 1 147 ILE HD11 H   4.622  -0.513 -11.276 1.00 . A A . 147 ILE HD11 1 1 
        3  8209 1 1 147 ILE HD12 H   5.876  -1.293 -12.244 1.00 . A A . 147 ILE HD12 1 1 
        3  8210 1 1 147 ILE HD13 H   6.066   0.391 -11.751 1.00 . A A . 147 ILE HD13 1 1 
        3  8211 1 1 147 ILE HG12 H   7.440  -1.153 -10.441 1.00 . A A . 147 ILE HG12 1 1 
        3  8212 1 1 147 ILE HG13 H   6.010  -2.029  -9.940 1.00 . A A . 147 ILE HG13 1 1 
        3  8213 1 1 147 ILE HG21 H   4.176   0.319  -9.153 1.00 . A A . 147 ILE HG21 1 1 
        3  8214 1 1 147 ILE HG22 H   4.766   0.490  -7.495 1.00 . A A . 147 ILE HG22 1 1 
        3  8215 1 1 147 ILE HG23 H   4.512  -1.115  -8.184 1.00 . A A . 147 ILE HG23 1 1 
        3  8216 1 1 147 ILE N    N   8.170   1.345  -9.752 1.00 . A A . 147 ILE N    1 1 
        3  8217 1 1 147 ILE O    O   5.866   3.055  -7.794 1.00 . A A . 147 ILE O    1 1 
        3  8218 1 1 148 TYR C    C   7.992   4.372  -6.181 1.00 . A A . 148 TYR C    1 1 
        3  8219 1 1 148 TYR CA   C   7.925   2.881  -5.831 1.00 . A A . 148 TYR CA   1 1 
        3  8220 1 1 148 TYR CB   C   9.154   2.464  -4.978 1.00 . A A . 148 TYR CB   1 1 
        3  8221 1 1 148 TYR CD1  C   7.839   0.446  -4.061 1.00 . A A . 148 TYR CD1  1 1 
        3  8222 1 1 148 TYR CD2  C  10.232   0.309  -4.091 1.00 . A A . 148 TYR CD2  1 1 
        3  8223 1 1 148 TYR CE1  C   7.773  -0.830  -3.524 1.00 . A A . 148 TYR CE1  1 1 
        3  8224 1 1 148 TYR CE2  C  10.164  -0.966  -3.560 1.00 . A A . 148 TYR CE2  1 1 
        3  8225 1 1 148 TYR CG   C   9.071   1.049  -4.361 1.00 . A A . 148 TYR CG   1 1 
        3  8226 1 1 148 TYR CZ   C   8.936  -1.529  -3.279 1.00 . A A . 148 TYR CZ   1 1 
        3  8227 1 1 148 TYR H    H   8.446   1.366  -7.231 1.00 . A A . 148 TYR H    1 1 
        3  8228 1 1 148 TYR HA   H   7.028   2.712  -5.240 1.00 . A A . 148 TYR HA   1 1 
        3  8229 1 1 148 TYR HB2  H  10.043   2.504  -5.604 1.00 . A A . 148 TYR HB2  1 1 
        3  8230 1 1 148 TYR HB3  H   9.277   3.166  -4.160 1.00 . A A . 148 TYR HB3  1 1 
        3  8231 1 1 148 TYR HD1  H   6.922   0.990  -4.254 1.00 . A A . 148 TYR HD1  1 1 
        3  8232 1 1 148 TYR HD2  H  11.196   0.746  -4.309 1.00 . A A . 148 TYR HD2  1 1 
        3  8233 1 1 148 TYR HE1  H   6.811  -1.279  -3.305 1.00 . A A . 148 TYR HE1  1 1 
        3  8234 1 1 148 TYR HE2  H  11.077  -1.519  -3.363 1.00 . A A . 148 TYR HE2  1 1 
        3  8235 1 1 148 TYR HH   H   8.146  -3.289  -3.161 1.00 . A A . 148 TYR HH   1 1 
        3  8236 1 1 148 TYR N    N   7.783   2.062  -7.057 1.00 . A A . 148 TYR N    1 1 
        3  8237 1 1 148 TYR O    O   7.413   5.190  -5.482 1.00 . A A . 148 TYR O    1 1 
        3  8238 1 1 148 TYR OH   O   8.871  -2.806  -2.746 1.00 . A A . 148 TYR OH   1 1 
        3  8239 1 1 149 LYS C    C   7.267   6.536  -8.215 1.00 . A A . 149 LYS C    1 1 
        3  8240 1 1 149 LYS CA   C   8.688   6.061  -7.850 1.00 . A A . 149 LYS CA   1 1 
        3  8241 1 1 149 LYS CB   C   9.631   6.151  -9.084 1.00 . A A . 149 LYS CB   1 1 
        3  8242 1 1 149 LYS CD   C  11.436   7.638  -8.057 1.00 . A A . 149 LYS CD   1 1 
        3  8243 1 1 149 LYS CE   C  12.918   7.811  -7.718 1.00 . A A . 149 LYS CE   1 1 
        3  8244 1 1 149 LYS CG   C  11.126   6.287  -8.736 1.00 . A A . 149 LYS CG   1 1 
        3  8245 1 1 149 LYS H    H   9.169   3.987  -7.767 1.00 . A A . 149 LYS H    1 1 
        3  8246 1 1 149 LYS HA   H   9.076   6.710  -7.069 1.00 . A A . 149 LYS HA   1 1 
        3  8247 1 1 149 LYS HB2  H   9.506   5.255  -9.686 1.00 . A A . 149 LYS HB2  1 1 
        3  8248 1 1 149 LYS HB3  H   9.350   7.007  -9.694 1.00 . A A . 149 LYS HB3  1 1 
        3  8249 1 1 149 LYS HD2  H  11.140   8.445  -8.722 1.00 . A A . 149 LYS HD2  1 1 
        3  8250 1 1 149 LYS HD3  H  10.858   7.713  -7.139 1.00 . A A . 149 LYS HD3  1 1 
        3  8251 1 1 149 LYS HE2  H  13.198   7.084  -6.963 1.00 . A A . 149 LYS HE2  1 1 
        3  8252 1 1 149 LYS HE3  H  13.511   7.648  -8.610 1.00 . A A . 149 LYS HE3  1 1 
        3  8253 1 1 149 LYS HG2  H  11.400   5.479  -8.064 1.00 . A A . 149 LYS HG2  1 1 
        3  8254 1 1 149 LYS HG3  H  11.708   6.203  -9.649 1.00 . A A . 149 LYS HG3  1 1 
        3  8255 1 1 149 LYS HZ1  H  12.887   9.886  -7.897 1.00 . A A . 149 LYS HZ1  1 1 
        3  8256 1 1 149 LYS HZ2  H  14.201   9.294  -7.021 1.00 . A A . 149 LYS HZ2  1 1 
        3  8257 1 1 149 LYS HZ3  H  12.673   9.330  -6.319 1.00 . A A . 149 LYS HZ3  1 1 
        3  8258 1 1 149 LYS N    N   8.667   4.697  -7.298 1.00 . A A . 149 LYS N    1 1 
        3  8259 1 1 149 LYS NZ   N  13.190   9.173  -7.202 1.00 . A A . 149 LYS NZ   1 1 
        3  8260 1 1 149 LYS O    O   6.786   7.526  -7.644 1.00 . A A . 149 LYS O    1 1 
        3  8261 1 1 150 VAL C    C   4.240   6.450  -8.574 1.00 . A A . 150 VAL C    1 1 
        3  8262 1 1 150 VAL CA   C   5.274   6.201  -9.685 1.00 . A A . 150 VAL CA   1 1 
        3  8263 1 1 150 VAL CB   C   4.675   5.195 -10.769 1.00 . A A . 150 VAL CB   1 1 
        3  8264 1 1 150 VAL CG1  C   5.732   4.800 -11.810 1.00 . A A . 150 VAL CG1  1 1 
        3  8265 1 1 150 VAL CG2  C   4.031   3.928 -10.157 1.00 . A A . 150 VAL CG2  1 1 
        3  8266 1 1 150 VAL H    H   6.956   4.902  -9.367 1.00 . A A . 150 VAL H    1 1 
        3  8267 1 1 150 VAL HA   H   5.459   7.150 -10.189 1.00 . A A . 150 VAL HA   1 1 
        3  8268 1 1 150 VAL HB   H   3.889   5.730 -11.306 1.00 . A A . 150 VAL HB   1 1 
        3  8269 1 1 150 VAL HG11 H   6.520   4.240 -11.323 1.00 . A A . 150 VAL HG11 1 1 
        3  8270 1 1 150 VAL HG12 H   6.151   5.689 -12.261 1.00 . A A . 150 VAL HG12 1 1 
        3  8271 1 1 150 VAL HG13 H   5.280   4.187 -12.579 1.00 . A A . 150 VAL HG13 1 1 
        3  8272 1 1 150 VAL HG21 H   3.631   3.296 -10.943 1.00 . A A . 150 VAL HG21 1 1 
        3  8273 1 1 150 VAL HG22 H   3.230   4.217  -9.490 1.00 . A A . 150 VAL HG22 1 1 
        3  8274 1 1 150 VAL HG23 H   4.769   3.373  -9.601 1.00 . A A . 150 VAL HG23 1 1 
        3  8275 1 1 150 VAL N    N   6.578   5.773  -9.107 1.00 . A A . 150 VAL N    1 1 
        3  8276 1 1 150 VAL O    O   3.452   7.381  -8.660 1.00 . A A . 150 VAL O    1 1 
        3  8277 1 1 151 ILE C    C   3.762   6.678  -5.278 1.00 . A A . 151 ILE C    1 1 
        3  8278 1 1 151 ILE CA   C   3.344   5.687  -6.384 1.00 . A A . 151 ILE CA   1 1 
        3  8279 1 1 151 ILE CB   C   3.116   4.252  -5.799 1.00 . A A . 151 ILE CB   1 1 
        3  8280 1 1 151 ILE CD1  C   4.416   2.197  -4.834 1.00 . A A . 151 ILE CD1  1 1 
        3  8281 1 1 151 ILE CG1  C   4.402   3.697  -5.097 1.00 . A A . 151 ILE CG1  1 1 
        3  8282 1 1 151 ILE CG2  C   2.641   3.305  -6.920 1.00 . A A . 151 ILE CG2  1 1 
        3  8283 1 1 151 ILE H    H   5.023   4.950  -7.476 1.00 . A A . 151 ILE H    1 1 
        3  8284 1 1 151 ILE HA   H   2.396   6.025  -6.790 1.00 . A A . 151 ILE HA   1 1 
        3  8285 1 1 151 ILE HB   H   2.315   4.313  -5.059 1.00 . A A . 151 ILE HB   1 1 
        3  8286 1 1 151 ILE HD11 H   3.524   1.903  -4.298 1.00 . A A . 151 ILE HD11 1 1 
        3  8287 1 1 151 ILE HD12 H   5.291   1.947  -4.257 1.00 . A A . 151 ILE HD12 1 1 
        3  8288 1 1 151 ILE HD13 H   4.457   1.670  -5.785 1.00 . A A . 151 ILE HD13 1 1 
        3  8289 1 1 151 ILE HG12 H   5.261   3.916  -5.714 1.00 . A A . 151 ILE HG12 1 1 
        3  8290 1 1 151 ILE HG13 H   4.524   4.194  -4.144 1.00 . A A . 151 ILE HG13 1 1 
        3  8291 1 1 151 ILE HG21 H   1.750   3.703  -7.382 1.00 . A A . 151 ILE HG21 1 1 
        3  8292 1 1 151 ILE HG22 H   2.414   2.331  -6.503 1.00 . A A . 151 ILE HG22 1 1 
        3  8293 1 1 151 ILE HG23 H   3.419   3.198  -7.661 1.00 . A A . 151 ILE HG23 1 1 
        3  8294 1 1 151 ILE N    N   4.310   5.635  -7.500 1.00 . A A . 151 ILE N    1 1 
        3  8295 1 1 151 ILE O    O   2.893   7.221  -4.590 1.00 . A A . 151 ILE O    1 1 
        3  8296 1 1 152 CYS C    C   5.364   9.336  -4.631 1.00 . A A . 152 CYS C    1 1 
        3  8297 1 1 152 CYS CA   C   5.586   7.903  -4.120 1.00 . A A . 152 CYS CA   1 1 
        3  8298 1 1 152 CYS CB   C   7.078   7.682  -3.796 1.00 . A A . 152 CYS CB   1 1 
        3  8299 1 1 152 CYS H    H   5.741   6.410  -5.648 1.00 . A A . 152 CYS H    1 1 
        3  8300 1 1 152 CYS HA   H   5.010   7.771  -3.207 1.00 . A A . 152 CYS HA   1 1 
        3  8301 1 1 152 CYS HB2  H   7.349   8.257  -2.923 1.00 . A A . 152 CYS HB2  1 1 
        3  8302 1 1 152 CYS HB3  H   7.241   6.630  -3.591 1.00 . A A . 152 CYS HB3  1 1 
        3  8303 1 1 152 CYS HG   H   7.524   8.800  -6.044 1.00 . A A . 152 CYS HG   1 1 
        3  8304 1 1 152 CYS N    N   5.087   6.916  -5.109 1.00 . A A . 152 CYS N    1 1 
        3  8305 1 1 152 CYS O    O   5.307  10.279  -3.840 1.00 . A A . 152 CYS O    1 1 
        3  8306 1 1 152 CYS SG   S   8.216   8.144  -5.118 1.00 . A A . 152 CYS SG   1 1 
        3  8307 1 1 153 LYS C    C   3.429  11.136  -6.323 1.00 . A A . 153 LYS C    1 1 
        3  8308 1 1 153 LYS CA   C   4.897  10.760  -6.612 1.00 . A A . 153 LYS CA   1 1 
        3  8309 1 1 153 LYS CB   C   5.155  10.673  -8.141 1.00 . A A . 153 LYS CB   1 1 
        3  8310 1 1 153 LYS CD   C   6.868  10.172 -10.010 1.00 . A A . 153 LYS CD   1 1 
        3  8311 1 1 153 LYS CE   C   6.395  11.260 -10.987 1.00 . A A . 153 LYS CE   1 1 
        3  8312 1 1 153 LYS CG   C   6.651  10.535  -8.520 1.00 . A A . 153 LYS CG   1 1 
        3  8313 1 1 153 LYS H    H   5.366   8.678  -6.549 1.00 . A A . 153 LYS H    1 1 
        3  8314 1 1 153 LYS HA   H   5.543  11.526  -6.192 1.00 . A A . 153 LYS HA   1 1 
        3  8315 1 1 153 LYS HB2