NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
523870 2kpn 16561 cing 4-filtered-FRED STAR entry full 1926


data_FRED_restraints_with_modified_coordinates_PDB_code_2kpn

# This FRED archive file contains, for PDB entry <2kpn>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, WF Vranken, C Schulte, J Lin, JR Wedell, CJ Penkett, GW Vuister, 
# G Vriend, JL Markley, and EL Ulrich (2009). The NMR Restraints Grid at BMRB for 
# 5,266 Protein and Nucleic Acid PDB Entries. J Biomol. NMR 45, 389?396.




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.PDB_coordinate_file_version  .
    _Entry.Sf_category                  entry_information
    _Entry.ID                           1
    _Entry.Title                        "Data for entry 1"
    _Entry.NMR_STAR_version             3.1.0.8
    _Entry.Experimental_method          NMR
    _Entry.Details                      .

save_


save_assembly_2kpn
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2kpn
    _Assembly.Number_of_components  2
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "not present"
    _Assembly.Molecular_mass        10421.63

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $Bacillolysin A . 1 1 
       2 . 2 $CALCIUM_ION  B . 1 1 
    stop_

    loop_
       _PDBX_nonpoly_scheme.Entity_assembly_ID
       _PDBX_nonpoly_scheme.Entity_ID
       _PDBX_nonpoly_scheme.Mon_ID
       _PDBX_nonpoly_scheme.Comp_index_ID
       _PDBX_nonpoly_scheme.Comp_ID
       _PDBX_nonpoly_scheme.Entry_ID
       _PDBX_nonpoly_scheme.Assembly_ID

       2 2 CA 1 CA 1 1 
    stop_

save_


save_Bacillolysin
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         Bacillolysin
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  MGNGETSDLEPKLTVPVGATIHVGDSFVPMAEVLAIDKEDGDLTSKIKVDGEVDTTKAGTYVLTYTVTDSKGHEVTAKQTVTVKVREEVKNDKPILEHHHHHH
    _Entity.Number_of_monomers           103

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

         1 MET . 1 1 
         2 GLY . 1 1 
         3 ASN . 1 1 
         4 GLY . 1 1 
         5 GLU . 1 1 
         6 THR . 1 1 
         7 SER . 1 1 
         8 ASP . 1 1 
         9 LEU . 1 1 
        10 GLU . 1 1 
        11 PRO . 1 1 
        12 LYS . 1 1 
        13 LEU . 1 1 
        14 THR . 1 1 
        15 VAL . 1 1 
        16 PRO . 1 1 
        17 VAL . 1 1 
        18 GLY . 1 1 
        19 ALA . 1 1 
        20 THR . 1 1 
        21 ILE . 1 1 
        22 HIS . 1 1 
        23 VAL . 1 1 
        24 GLY . 1 1 
        25 ASP . 1 1 
        26 SER . 1 1 
        27 PHE . 1 1 
        28 VAL . 1 1 
        29 PRO . 1 1 
        30 MET . 1 1 
        31 ALA . 1 1 
        32 GLU . 1 1 
        33 VAL . 1 1 
        34 LEU . 1 1 
        35 ALA . 1 1 
        36 ILE . 1 1 
        37 ASP . 1 1 
        38 LYS . 1 1 
        39 GLU . 1 1 
        40 ASP . 1 1 
        41 GLY . 1 1 
        42 ASP . 1 1 
        43 LEU . 1 1 
        44 THR . 1 1 
        45 SER . 1 1 
        46 LYS . 1 1 
        47 ILE . 1 1 
        48 LYS . 1 1 
        49 VAL . 1 1 
        50 ASP . 1 1 
        51 GLY . 1 1 
        52 GLU . 1 1 
        53 VAL . 1 1 
        54 ASP . 1 1 
        55 THR . 1 1 
        56 THR . 1 1 
        57 LYS . 1 1 
        58 ALA . 1 1 
        59 GLY . 1 1 
        60 THR . 1 1 
        61 TYR . 1 1 
        62 VAL . 1 1 
        63 LEU . 1 1 
        64 THR . 1 1 
        65 TYR . 1 1 
        66 THR . 1 1 
        67 VAL . 1 1 
        68 THR . 1 1 
        69 ASP . 1 1 
        70 SER . 1 1 
        71 LYS . 1 1 
        72 GLY . 1 1 
        73 HIS . 1 1 
        74 GLU . 1 1 
        75 VAL . 1 1 
        76 THR . 1 1 
        77 ALA . 1 1 
        78 LYS . 1 1 
        79 GLN . 1 1 
        80 THR . 1 1 
        81 VAL . 1 1 
        82 THR . 1 1 
        83 VAL . 1 1 
        84 LYS . 1 1 
        85 VAL . 1 1 
        86 ARG . 1 1 
        87 GLU . 1 1 
        88 GLU . 1 1 
        89 VAL . 1 1 
        90 LYS . 1 1 
        91 ASN . 1 1 
        92 ASP . 1 1 
        93 LYS . 1 1 
        94 PRO . 1 1 
        95 ILE . 1 1 
        96 LEU . 1 1 
        97 GLU . 1 1 
        98 HIS . 1 1 
        99 HIS . 1 1 
       100 HIS . 1 1 
       101 HIS . 1 1 
       102 HIS . 1 1 
       103 HIS . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       MET   1   1 1 1 
       GLY   2   2 1 1 
       ASN   3   3 1 1 
       GLY   4   4 1 1 
       GLU   5   5 1 1 
       THR   6   6 1 1 
       SER   7   7 1 1 
       ASP   8   8 1 1 
       LEU   9   9 1 1 
       GLU  10  10 1 1 
       PRO  11  11 1 1 
       LYS  12  12 1 1 
       LEU  13  13 1 1 
       THR  14  14 1 1 
       VAL  15  15 1 1 
       PRO  16  16 1 1 
       VAL  17  17 1 1 
       GLY  18  18 1 1 
       ALA  19  19 1 1 
       THR  20  20 1 1 
       ILE  21  21 1 1 
       HIS  22  22 1 1 
       VAL  23  23 1 1 
       GLY  24  24 1 1 
       ASP  25  25 1 1 
       SER  26  26 1 1 
       PHE  27  27 1 1 
       VAL  28  28 1 1 
       PRO  29  29 1 1 
       MET  30  30 1 1 
       ALA  31  31 1 1 
       GLU  32  32 1 1 
       VAL  33  33 1 1 
       LEU  34  34 1 1 
       ALA  35  35 1 1 
       ILE  36  36 1 1 
       ASP  37  37 1 1 
       LYS  38  38 1 1 
       GLU  39  39 1 1 
       ASP  40  40 1 1 
       GLY  41  41 1 1 
       ASP  42  42 1 1 
       LEU  43  43 1 1 
       THR  44  44 1 1 
       SER  45  45 1 1 
       LYS  46  46 1 1 
       ILE  47  47 1 1 
       LYS  48  48 1 1 
       VAL  49  49 1 1 
       ASP  50  50 1 1 
       GLY  51  51 1 1 
       GLU  52  52 1 1 
       VAL  53  53 1 1 
       ASP  54  54 1 1 
       THR  55  55 1 1 
       THR  56  56 1 1 
       LYS  57  57 1 1 
       ALA  58  58 1 1 
       GLY  59  59 1 1 
       THR  60  60 1 1 
       TYR  61  61 1 1 
       VAL  62  62 1 1 
       LEU  63  63 1 1 
       THR  64  64 1 1 
       TYR  65  65 1 1 
       THR  66  66 1 1 
       VAL  67  67 1 1 
       THR  68  68 1 1 
       ASP  69  69 1 1 
       SER  70  70 1 1 
       LYS  71  71 1 1 
       GLY  72  72 1 1 
       HIS  73  73 1 1 
       GLU  74  74 1 1 
       VAL  75  75 1 1 
       THR  76  76 1 1 
       ALA  77  77 1 1 
       LYS  78  78 1 1 
       GLN  79  79 1 1 
       THR  80  80 1 1 
       VAL  81  81 1 1 
       THR  82  82 1 1 
       VAL  83  83 1 1 
       LYS  84  84 1 1 
       VAL  85  85 1 1 
       ARG  86  86 1 1 
       GLU  87  87 1 1 
       GLU  88  88 1 1 
       VAL  89  89 1 1 
       LYS  90  90 1 1 
       ASN  91  91 1 1 
       ASP  92  92 1 1 
       LYS  93  93 1 1 
       PRO  94  94 1 1 
       ILE  95  95 1 1 
       LEU  96  96 1 1 
       GLU  97  97 1 1 
       HIS  98  98 1 1 
       HIS  99  99 1 1 
       HIS 100 100 1 1 
       HIS 101 101 1 1 
       HIS 102 102 1 1 
       HIS 103 103 1 1 
    stop_

save_


save_CALCIUM_ION
    _Entity.Sf_category  entity
    _Entity.Entry_ID     1
    _Entity.ID           2
    _Entity.Name         "CALCIUM ION"
    _Entity.Type         non-polymer

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

       1 CA $CA 1 2 
    stop_

save_


save_CA
    _Chem_comp.Sf_category  chem_comp
    _Chem_comp.Entry_ID     1
    _Chem_comp.ID           CA
    _Chem_comp.Type         non-polymer

save_


save_CNS/XPLOR_distance_constraints_3_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

          1 1 . . . 1 1 
          2 1 . . . 1 1 
          3 1 . . . 1 1 
          4 1 . . . 1 1 
          5 1 . . . 1 1 
          6 1 . . . 1 1 
          7 1 . . . 1 1 
          8 1 . . . 1 1 
          9 1 . . . 1 1 
         10 1 . . . 1 1 
         11 1 . . . 1 1 
         12 1 . . . 1 1 
         13 1 . . . 1 1 
         14 1 . . . 1 1 
         15 1 . . . 1 1 
         16 1 . . . 1 1 
         17 1 . . . 1 1 
         18 1 . . . 1 1 
         19 1 . . . 1 1 
         20 1 . . . 1 1 
         21 1 . . . 1 1 
         22 1 . . . 1 1 
         23 1 . . . 1 1 
         24 1 . . . 1 1 
         25 1 . . . 1 1 
         26 1 . . . 1 1 
         27 1 . . . 1 1 
         28 1 . . . 1 1 
         29 1 . . . 1 1 
         30 1 . . . 1 1 
         31 1 . . . 1 1 
         32 1 . . . 1 1 
         33 1 . . . 1 1 
         34 1 . . . 1 1 
         35 1 . . . 1 1 
         36 1 . . . 1 1 
         37 1 . . . 1 1 
         38 1 . . . 1 1 
         39 1 . . . 1 1 
         40 1 . . . 1 1 
         41 1 . . . 1 1 
         42 1 . . . 1 1 
         43 1 . . . 1 1 
         44 1 . . . 1 1 
         45 1 . . . 1 1 
         46 1 . . . 1 1 
         47 1 . . . 1 1 
         48 1 . . . 1 1 
         49 1 . . . 1 1 
         50 1 . . . 1 1 
         51 1 . . . 1 1 
         52 1 . . . 1 1 
         53 1 . . . 1 1 
         54 1 . . . 1 1 
         55 1 . . . 1 1 
         56 1 . . . 1 1 
         57 1 . . . 1 1 
         58 1 . . . 1 1 
         59 1 . . . 1 1 
         60 1 . . . 1 1 
         61 1 . . . 1 1 
         62 1 . . . 1 1 
         63 1 . . . 1 1 
         64 1 . . . 1 1 
         65 1 . . . 1 1 
         66 1 . . . 1 1 
         67 1 . . . 1 1 
         68 1 . . . 1 1 
         69 1 . . . 1 1 
         70 1 . . . 1 1 
         71 1 . . . 1 1 
         72 1 . . . 1 1 
         73 1 . . . 1 1 
         74 1 . . . 1 1 
         75 1 . . . 1 1 
         76 1 . . . 1 1 
         77 1 . . . 1 1 
         78 1 . . . 1 1 
         79 1 . . . 1 1 
         80 1 . . . 1 1 
         81 1 . . . 1 1 
         82 1 . . . 1 1 
         83 1 . . . 1 1 
         84 1 . . . 1 1 
         85 1 . . . 1 1 
         86 1 . . . 1 1 
         87 1 . . . 1 1 
         88 1 . . . 1 1 
         89 1 . . . 1 1 
         90 1 . . . 1 1 
         91 1 . . . 1 1 
         92 1 . . . 1 1 
         93 1 . . . 1 1 
         94 1 . . . 1 1 
         95 1 . . . 1 1 
         96 1 . . . 1 1 
         97 1 . . . 1 1 
         98 1 . . . 1 1 
         99 1 . . . 1 1 
        100 1 . . . 1 1 
        101 1 . . . 1 1 
        102 1 . . . 1 1 
        103 1 . . . 1 1 
        104 1 . . . 1 1 
        105 1 . . . 1 1 
        106 1 . . . 1 1 
        107 1 . . . 1 1 
        108 1 . . . 1 1 
        109 1 . . . 1 1 
        110 1 . . . 1 1 
        111 1 . . . 1 1 
        112 1 . . . 1 1 
        113 1 . . . 1 1 
        114 1 . . . 1 1 
        115 1 . . . 1 1 
        116 1 . . . 1 1 
        117 1 . . . 1 1 
        118 1 . . . 1 1 
        119 1 . . . 1 1 
        120 1 . . . 1 1 
        121 1 . . . 1 1 
        122 1 . . . 1 1 
        123 1 . . . 1 1 
        124 1 . . . 1 1 
        125 1 . . . 1 1 
        126 1 . . . 1 1 
        127 1 . . . 1 1 
        128 1 . . . 1 1 
        129 1 . . . 1 1 
        130 1 . . . 1 1 
        131 1 . . . 1 1 
        132 1 . . . 1 1 
        133 1 . . . 1 1 
        134 1 . . . 1 1 
        135 1 . . . 1 1 
        136 1 . . . 1 1 
        137 1 . . . 1 1 
        138 1 . . . 1 1 
        139 1 . . . 1 1 
        140 1 . . . 1 1 
        141 1 . . . 1 1 
        142 1 . . . 1 1 
        143 1 . . . 1 1 
        144 1 . . . 1 1 
        145 1 . . . 1 1 
        146 1 . . . 1 1 
        147 1 . . . 1 1 
        148 1 . . . 1 1 
        149 1 . . . 1 1 
        150 1 . . . 1 1 
        151 1 . . . 1 1 
        152 1 . . . 1 1 
        153 1 . . . 1 1 
        154 1 . . . 1 1 
        155 1 . . . 1 1 
        156 1 . . . 1 1 
        157 1 . . . 1 1 
        158 1 . . . 1 1 
        159 1 . . . 1 1 
        160 1 . . . 1 1 
        161 1 . . . 1 1 
        162 1 . . . 1 1 
        163 1 . . . 1 1 
        164 1 . . . 1 1 
        165 1 . . . 1 1 
        166 1 . . . 1 1 
        167 1 . . . 1 1 
        168 1 . . . 1 1 
        169 1 . . . 1 1 
        170 1 . . . 1 1 
        171 1 . . . 1 1 
        172 1 . . . 1 1 
        173 1 . . . 1 1 
        174 1 . . . 1 1 
        175 1 . . . 1 1 
        176 1 . . . 1 1 
        177 1 . . . 1 1 
        178 1 . . . 1 1 
        179 1 . . . 1 1 
        180 1 . . . 1 1 
        181 1 . . . 1 1 
        182 1 . . . 1 1 
        183 1 . . . 1 1 
        184 1 . . . 1 1 
        185 1 . . . 1 1 
        186 1 . . . 1 1 
        187 1 . . . 1 1 
        188 1 . . . 1 1 
        189 1 . . . 1 1 
        190 1 . . . 1 1 
        191 1 . . . 1 1 
        192 1 . . . 1 1 
        193 1 . . . 1 1 
        194 1 . . . 1 1 
        195 1 . . . 1 1 
        196 1 . . . 1 1 
        197 1 . . . 1 1 
        198 1 . . . 1 1 
        199 1 . . . 1 1 
        200 1 . . . 1 1 
        201 1 . . . 1 1 
        202 1 . . . 1 1 
        203 1 . . . 1 1 
        204 1 . . . 1 1 
        205 1 . . . 1 1 
        206 1 . . . 1 1 
        207 1 . . . 1 1 
        208 1 . . . 1 1 
        209 1 . . . 1 1 
        210 1 . . . 1 1 
        211 1 . . . 1 1 
        212 1 . . . 1 1 
        213 1 . . . 1 1 
        214 1 . . . 1 1 
        215 1 . . . 1 1 
        216 1 . . . 1 1 
        217 1 . . . 1 1 
        218 1 . . . 1 1 
        219 1 . . . 1 1 
        220 1 . . . 1 1 
        221 1 . . . 1 1 
        222 1 . . . 1 1 
        223 1 . . . 1 1 
        224 1 . . . 1 1 
        225 1 . . . 1 1 
        226 1 . . . 1 1 
        227 1 . . . 1 1 
        228 1 . . . 1 1 
        229 1 . . . 1 1 
        230 1 . . . 1 1 
        231 1 . . . 1 1 
        232 1 . . . 1 1 
        233 1 . . . 1 1 
        234 1 . . . 1 1 
        235 1 . . . 1 1 
        236 1 . . . 1 1 
        237 1 . . . 1 1 
        238 1 . . . 1 1 
        239 1 . . . 1 1 
        240 1 . . . 1 1 
        241 1 . . . 1 1 
        242 1 . . . 1 1 
        243 1 . . . 1 1 
        244 1 . . . 1 1 
        245 1 . . . 1 1 
        246 1 . . . 1 1 
        247 1 . . . 1 1 
        248 1 . . . 1 1 
        249 1 . . . 1 1 
        250 1 . . . 1 1 
        251 1 . . . 1 1 
        252 1 . . . 1 1 
        253 1 . . . 1 1 
        254 1 . . . 1 1 
        255 1 . . . 1 1 
        256 1 . . . 1 1 
        257 1 . . . 1 1 
        258 1 . . . 1 1 
        259 1 . . . 1 1 
        260 1 . . . 1 1 
        261 1 . . . 1 1 
        262 1 . . . 1 1 
        263 1 . . . 1 1 
        264 1 . . . 1 1 
        265 1 . . . 1 1 
        266 1 . . . 1 1 
        267 1 . . . 1 1 
        268 1 . . . 1 1 
        269 1 . . . 1 1 
        270 1 . . . 1 1 
        271 1 . . . 1 1 
        272 1 . . . 1 1 
        273 1 . . . 1 1 
        274 1 . . . 1 1 
        275 1 . . . 1 1 
        276 1 . . . 1 1 
        277 1 . . . 1 1 
        278 1 . . . 1 1 
        279 1 . . . 1 1 
        280 1 . . . 1 1 
        281 1 . . . 1 1 
        282 1 . . . 1 1 
        283 1 . . . 1 1 
        284 1 . . . 1 1 
        285 1 . . . 1 1 
        286 1 . . . 1 1 
        287 1 . . . 1 1 
        288 1 . . . 1 1 
        289 1 . . . 1 1 
        290 1 . . . 1 1 
        291 1 . . . 1 1 
        292 1 . . . 1 1 
        293 1 . . . 1 1 
        294 1 . . . 1 1 
        295 1 . . . 1 1 
        296 1 . . . 1 1 
        297 1 . . . 1 1 
        298 1 . . . 1 1 
        299 1 . . . 1 1 
        300 1 . . . 1 1 
        301 1 . . . 1 1 
        302 1 . . . 1 1 
        303 1 . . . 1 1 
        304 1 . . . 1 1 
        305 1 . . . 1 1 
        306 1 . . . 1 1 
        307 1 . . . 1 1 
        308 1 . . . 1 1 
        309 1 . . . 1 1 
        310 1 . . . 1 1 
        311 1 . . . 1 1 
        312 1 . . . 1 1 
        313 1 . . . 1 1 
        314 1 . . . 1 1 
        315 1 . . . 1 1 
        316 1 . . . 1 1 
        317 1 . . . 1 1 
        318 1 . . . 1 1 
        319 1 . . . 1 1 
        320 1 . . . 1 1 
        321 1 . . . 1 1 
        322 1 . . . 1 1 
        323 1 . . . 1 1 
        324 1 . . . 1 1 
        325 1 . . . 1 1 
        326 1 . . . 1 1 
        327 1 . . . 1 1 
        328 1 . . . 1 1 
        329 1 . . . 1 1 
        330 1 . . . 1 1 
        331 1 . . . 1 1 
        332 1 . . . 1 1 
        333 1 . . . 1 1 
        334 1 . . . 1 1 
        335 1 . . . 1 1 
        336 1 . . . 1 1 
        337 1 . . . 1 1 
        338 1 . . . 1 1 
        339 1 . . . 1 1 
        340 1 . . . 1 1 
        341 1 . . . 1 1 
        342 1 . . . 1 1 
        343 1 . . . 1 1 
        344 1 . . . 1 1 
        345 1 . . . 1 1 
        346 1 . . . 1 1 
        347 1 . . . 1 1 
        348 1 . . . 1 1 
        349 1 . . . 1 1 
        350 1 . . . 1 1 
        351 1 . . . 1 1 
        352 1 . . . 1 1 
        353 1 . . . 1 1 
        354 1 . . . 1 1 
        355 1 . . . 1 1 
        356 1 . . . 1 1 
        357 1 . . . 1 1 
        358 1 . . . 1 1 
        359 1 . . . 1 1 
        360 1 . . . 1 1 
        361 1 . . . 1 1 
        362 1 . . . 1 1 
        363 1 . . . 1 1 
        364 1 . . . 1 1 
        365 1 . . . 1 1 
        366 1 . . . 1 1 
        367 1 . . . 1 1 
        368 1 . . . 1 1 
        369 1 . . . 1 1 
        370 1 . . . 1 1 
        371 1 . . . 1 1 
        372 1 . . . 1 1 
        373 1 . . . 1 1 
        374 1 . . . 1 1 
        375 1 . . . 1 1 
        376 1 . . . 1 1 
        377 1 . . . 1 1 
        378 1 . . . 1 1 
        379 1 . . . 1 1 
        380 1 . . . 1 1 
        381 1 . . . 1 1 
        382 1 . . . 1 1 
        383 1 . . . 1 1 
        384 1 . . . 1 1 
        385 1 . . . 1 1 
        386 1 . . . 1 1 
        387 1 . . . 1 1 
        388 1 . . . 1 1 
        389 1 . . . 1 1 
        390 1 . . . 1 1 
        391 1 . . . 1 1 
        392 1 . . . 1 1 
        393 1 . . . 1 1 
        394 1 . . . 1 1 
        395 1 . . . 1 1 
        396 1 . . . 1 1 
        397 1 . . . 1 1 
        398 1 . . . 1 1 
        399 1 . . . 1 1 
        400 1 . . . 1 1 
        401 1 . . . 1 1 
        402 1 . . . 1 1 
        403 1 . . . 1 1 
        404 1 . . . 1 1 
        405 1 . . . 1 1 
        406 1 . . . 1 1 
        407 1 . . . 1 1 
        408 1 . . . 1 1 
        409 1 . . . 1 1 
        410 1 . . . 1 1 
        411 1 . . . 1 1 
        412 1 . . . 1 1 
        413 1 . . . 1 1 
        414 1 . . . 1 1 
        415 1 . . . 1 1 
        416 1 . . . 1 1 
        417 1 . . . 1 1 
        418 1 . . . 1 1 
        419 1 . . . 1 1 
        420 1 . . . 1 1 
        421 1 . . . 1 1 
        422 1 . . . 1 1 
        423 1 . . . 1 1 
        424 1 . . . 1 1 
        425 1 . . . 1 1 
        426 1 . . . 1 1 
        427 1 . . . 1 1 
        428 1 . . . 1 1 
        429 1 . . . 1 1 
        430 1 . . . 1 1 
        431 1 . . . 1 1 
        432 1 . . . 1 1 
        433 1 . . . 1 1 
        434 1 . . . 1 1 
        435 1 . . . 1 1 
        436 1 . . . 1 1 
        437 1 . . . 1 1 
        438 1 . . . 1 1 
        439 1 . . . 1 1 
        440 1 . . . 1 1 
        441 1 . . . 1 1 
        442 1 . . . 1 1 
        443 1 . . . 1 1 
        444 1 . . . 1 1 
        445 1 . . . 1 1 
        446 1 . . . 1 1 
        447 1 . . . 1 1 
        448 1 . . . 1 1 
        449 1 . . . 1 1 
        450 1 . . . 1 1 
        451 1 . . . 1 1 
        452 1 . . . 1 1 
        453 1 . . . 1 1 
        454 1 . . . 1 1 
        455 1 . . . 1 1 
        456 1 . . . 1 1 
        457 1 . . . 1 1 
        458 1 . . . 1 1 
        459 1 . . . 1 1 
        460 1 . . . 1 1 
        461 1 . . . 1 1 
        462 1 . . . 1 1 
        463 1 . . . 1 1 
        464 1 . . . 1 1 
        465 1 . . . 1 1 
        466 1 . . . 1 1 
        467 1 . . . 1 1 
        468 1 . . . 1 1 
        469 1 . . . 1 1 
        470 1 . . . 1 1 
        471 1 . . . 1 1 
        472 1 . . . 1 1 
        473 1 . . . 1 1 
        474 1 . . . 1 1 
        475 1 . . . 1 1 
        476 1 . . . 1 1 
        477 1 . . . 1 1 
        478 1 . . . 1 1 
        479 1 . . . 1 1 
        480 1 . . . 1 1 
        481 1 . . . 1 1 
        482 1 . . . 1 1 
        483 1 . . . 1 1 
        484 1 . . . 1 1 
        485 1 . . . 1 1 
        486 1 . . . 1 1 
        487 1 . . . 1 1 
        488 1 . . . 1 1 
        489 1 . . . 1 1 
        490 1 . . . 1 1 
        491 1 . . . 1 1 
        492 1 . . . 1 1 
        493 1 . . . 1 1 
        494 1 . . . 1 1 
        495 1 . . . 1 1 
        496 1 . . . 1 1 
        497 1 . . . 1 1 
        498 1 . . . 1 1 
        499 1 . . . 1 1 
        500 1 . . . 1 1 
        501 1 . . . 1 1 
        502 1 . . . 1 1 
        503 1 . . . 1 1 
        504 1 . . . 1 1 
        505 1 . . . 1 1 
        506 1 . . . 1 1 
        507 1 . . . 1 1 
        508 1 . . . 1 1 
        509 1 . . . 1 1 
        510 1 . . . 1 1 
        511 1 . . . 1 1 
        512 1 . . . 1 1 
        513 1 . . . 1 1 
        514 1 . . . 1 1 
        515 1 . . . 1 1 
        516 1 . . . 1 1 
        517 1 . . . 1 1 
        518 1 . . . 1 1 
        519 1 . . . 1 1 
        520 1 . . . 1 1 
        521 1 . . . 1 1 
        522 1 . . . 1 1 
        523 1 . . . 1 1 
        524 1 . . . 1 1 
        525 1 . . . 1 1 
        526 1 . . . 1 1 
        527 1 . . . 1 1 
        528 1 . . . 1 1 
        529 1 . . . 1 1 
        530 1 . . . 1 1 
        531 1 . . . 1 1 
        532 1 . . . 1 1 
        533 1 . . . 1 1 
        534 1 . . . 1 1 
        535 1 . . . 1 1 
        536 1 . . . 1 1 
        537 1 . . . 1 1 
        538 1 . . . 1 1 
        539 1 . . . 1 1 
        540 1 . . . 1 1 
        541 1 . . . 1 1 
        542 1 . . . 1 1 
        543 1 . . . 1 1 
        544 1 . . . 1 1 
        545 1 . . . 1 1 
        546 1 . . . 1 1 
        547 1 . . . 1 1 
        548 1 . . . 1 1 
        549 1 . . . 1 1 
        550 1 . . . 1 1 
        551 1 . . . 1 1 
        552 1 . . . 1 1 
        553 1 . . . 1 1 
        554 1 . . . 1 1 
        555 1 . . . 1 1 
        556 1 . . . 1 1 
        557 1 . . . 1 1 
        558 1 . . . 1 1 
        559 1 . . . 1 1 
        560 1 . . . 1 1 
        561 1 . . . 1 1 
        562 1 . . . 1 1 
        563 1 . . . 1 1 
        564 1 . . . 1 1 
        565 1 . . . 1 1 
        566 1 . . . 1 1 
        567 1 . . . 1 1 
        568 1 . . . 1 1 
        569 1 . . . 1 1 
        570 1 . . . 1 1 
        571 1 . . . 1 1 
        572 1 . . . 1 1 
        573 1 . . . 1 1 
        574 1 . . . 1 1 
        575 1 . . . 1 1 
        576 1 . . . 1 1 
        577 1 . . . 1 1 
        578 1 . . . 1 1 
        579 1 . . . 1 1 
        580 1 . . . 1 1 
        581 1 . . . 1 1 
        582 1 . . . 1 1 
        583 1 . . . 1 1 
        584 1 . . . 1 1 
        585 1 . . . 1 1 
        586 1 . . . 1 1 
        587 1 . . . 1 1 
        588 1 . . . 1 1 
        589 1 . . . 1 1 
        590 1 . . . 1 1 
        591 1 . . . 1 1 
        592 1 . . . 1 1 
        593 1 . . . 1 1 
        594 1 . . . 1 1 
        595 1 . . . 1 1 
        596 1 . . . 1 1 
        597 1 . . . 1 1 
        598 1 . . . 1 1 
        599 1 . . . 1 1 
        600 1 . . . 1 1 
        601 1 . . . 1 1 
        602 1 . . . 1 1 
        603 1 . . . 1 1 
        604 1 . . . 1 1 
        605 1 . . . 1 1 
        606 1 . . . 1 1 
        607 1 . . . 1 1 
        608 1 . . . 1 1 
        609 1 . . . 1 1 
        610 1 . . . 1 1 
        611 1 . . . 1 1 
        612 1 . . . 1 1 
        613 1 . . . 1 1 
        614 1 . . . 1 1 
        615 1 . . . 1 1 
        616 1 . . . 1 1 
        617 1 . . . 1 1 
        618 1 . . . 1 1 
        619 1 . . . 1 1 
        620 1 . . . 1 1 
        621 1 . . . 1 1 
        622 1 . . . 1 1 
        623 1 . . . 1 1 
        624 1 . . . 1 1 
        625 1 . . . 1 1 
        626 1 . . . 1 1 
        627 1 . . . 1 1 
        628 1 . . . 1 1 
        629 1 . . . 1 1 
        630 1 . . . 1 1 
        631 1 . . . 1 1 
        632 1 . . . 1 1 
        633 1 . . . 1 1 
        634 1 . . . 1 1 
        635 1 . . . 1 1 
        636 1 . . . 1 1 
        637 1 . . . 1 1 
        638 1 . . . 1 1 
        639 1 . . . 1 1 
        640 1 . . . 1 1 
        641 1 . . . 1 1 
        642 1 . . . 1 1 
        643 1 . . . 1 1 
        644 1 . . . 1 1 
        645 1 . . . 1 1 
        646 1 . . . 1 1 
        647 1 . . . 1 1 
        648 1 . . . 1 1 
        649 1 . . . 1 1 
        650 1 . . . 1 1 
        651 1 . . . 1 1 
        652 1 . . . 1 1 
        653 1 . . . 1 1 
        654 1 . . . 1 1 
        655 1 . . . 1 1 
        656 1 . . . 1 1 
        657 1 . . . 1 1 
        658 1 . . . 1 1 
        659 1 . . . 1 1 
        660 1 . . . 1 1 
        661 1 . . . 1 1 
        662 1 . . . 1 1 
        663 1 . . . 1 1 
        664 1 . . . 1 1 
        665 1 . . . 1 1 
        666 1 . . . 1 1 
        667 1 . . . 1 1 
        668 1 . . . 1 1 
        669 1 . . . 1 1 
        670 1 . . . 1 1 
        671 1 . . . 1 1 
        672 1 . . . 1 1 
        673 1 . . . 1 1 
        674 1 . . . 1 1 
        675 1 . . . 1 1 
        676 1 . . . 1 1 
        677 1 . . . 1 1 
        678 1 . . . 1 1 
        679 1 . . . 1 1 
        680 1 . . . 1 1 
        681 1 . . . 1 1 
        682 1 . . . 1 1 
        683 1 . . . 1 1 
        684 1 . . . 1 1 
        685 1 . . . 1 1 
        686 1 . . . 1 1 
        687 1 . . . 1 1 
        688 1 . . . 1 1 
        689 1 . . . 1 1 
        690 1 . . . 1 1 
        691 1 . . . 1 1 
        692 1 . . . 1 1 
        693 1 . . . 1 1 
        694 1 . . . 1 1 
        695 1 . . . 1 1 
        696 1 . . . 1 1 
        697 1 . . . 1 1 
        698 1 . . . 1 1 
        699 1 . . . 1 1 
        700 1 . . . 1 1 
        701 1 . . . 1 1 
        702 1 . . . 1 1 
        703 1 . . . 1 1 
        704 1 . . . 1 1 
        705 1 . . . 1 1 
        706 1 . . . 1 1 
        707 1 . . . 1 1 
        708 1 . . . 1 1 
        709 1 . . . 1 1 
        710 1 . . . 1 1 
        711 1 . . . 1 1 
        712 1 . . . 1 1 
        713 1 . . . 1 1 
        714 1 . . . 1 1 
        715 1 . . . 1 1 
        716 1 . . . 1 1 
        717 1 . . . 1 1 
        718 1 . . . 1 1 
        719 1 . . . 1 1 
        720 1 . . . 1 1 
        721 1 . . . 1 1 
        722 1 . . . 1 1 
        723 1 . . . 1 1 
        724 1 . . . 1 1 
        725 1 . . . 1 1 
        726 1 . . . 1 1 
        727 1 . . . 1 1 
        728 1 . . . 1 1 
        729 1 . . . 1 1 
        730 1 . . . 1 1 
        731 1 . . . 1 1 
        732 1 . . . 1 1 
        733 1 . . . 1 1 
        734 1 . . . 1 1 
        735 1 . . . 1 1 
        736 1 . . . 1 1 
        737 1 . . . 1 1 
        738 1 . . . 1 1 
        739 1 . . . 1 1 
        740 1 . . . 1 1 
        741 1 . . . 1 1 
        742 1 . . . 1 1 
        743 1 . . . 1 1 
        744 1 . . . 1 1 
        745 1 . . . 1 1 
        746 1 . . . 1 1 
        747 1 . . . 1 1 
        748 1 . . . 1 1 
        749 1 . . . 1 1 
        750 1 . . . 1 1 
        751 1 . . . 1 1 
        752 1 . . . 1 1 
        753 1 . . . 1 1 
        754 1 . . . 1 1 
        755 1 . . . 1 1 
        756 1 . . . 1 1 
        757 1 . . . 1 1 
        758 1 . . . 1 1 
        759 1 . . . 1 1 
        760 1 . . . 1 1 
        761 1 . . . 1 1 
        762 1 . . . 1 1 
        763 1 . . . 1 1 
        764 1 . . . 1 1 
        765 1 . . . 1 1 
        766 1 . . . 1 1 
        767 1 . . . 1 1 
        768 1 . . . 1 1 
        769 1 . . . 1 1 
        770 1 . . . 1 1 
        771 1 . . . 1 1 
        772 1 . . . 1 1 
        773 1 . . . 1 1 
        774 1 . . . 1 1 
        775 1 . . . 1 1 
        776 1 . . . 1 1 
        777 1 . . . 1 1 
        778 1 . . . 1 1 
        779 1 . . . 1 1 
        780 1 . . . 1 1 
        781 1 . . . 1 1 
        782 1 . . . 1 1 
        783 1 . . . 1 1 
        784 1 . . . 1 1 
        785 1 . . . 1 1 
        786 1 . . . 1 1 
        787 1 . . . 1 1 
        788 1 . . . 1 1 
        789 1 . . . 1 1 
        790 1 . . . 1 1 
        791 1 . . . 1 1 
        792 1 . . . 1 1 
        793 1 . . . 1 1 
        794 1 . . . 1 1 
        795 1 . . . 1 1 
        796 1 . . . 1 1 
        797 1 . . . 1 1 
        798 1 . . . 1 1 
        799 1 . . . 1 1 
        800 1 . . . 1 1 
        801 1 . . . 1 1 
        802 1 . . . 1 1 
        803 1 . . . 1 1 
        804 1 . . . 1 1 
        805 1 . . . 1 1 
        806 1 . . . 1 1 
        807 1 . . . 1 1 
        808 1 . . . 1 1 
        809 1 . . . 1 1 
        810 1 . . . 1 1 
        811 1 . . . 1 1 
        812 1 . . . 1 1 
        813 1 . . . 1 1 
        814 1 . . . 1 1 
        815 1 . . . 1 1 
        816 1 . . . 1 1 
        817 1 . . . 1 1 
        818 1 . . . 1 1 
        819 1 . . . 1 1 
        820 1 . . . 1 1 
        821 1 . . . 1 1 
        822 1 . . . 1 1 
        823 1 . . . 1 1 
        824 1 . . . 1 1 
        825 1 . . . 1 1 
        826 1 . . . 1 1 
        827 1 . . . 1 1 
        828 1 . . . 1 1 
        829 1 . . . 1 1 
        830 1 . . . 1 1 
        831 1 . . . 1 1 
        832 1 . . . 1 1 
        833 1 . . . 1 1 
        834 1 . . . 1 1 
        835 1 . . . 1 1 
        836 1 . . . 1 1 
        837 1 . . . 1 1 
        838 1 . . . 1 1 
        839 1 . . . 1 1 
        840 1 . . . 1 1 
        841 1 . . . 1 1 
        842 1 . . . 1 1 
        843 1 . . . 1 1 
        844 1 . . . 1 1 
        845 1 . . . 1 1 
        846 1 . . . 1 1 
        847 1 . . . 1 1 
        848 1 . . . 1 1 
        849 1 . . . 1 1 
        850 1 . . . 1 1 
        851 1 . . . 1 1 
        852 1 . . . 1 1 
        853 1 . . . 1 1 
        854 1 . . . 1 1 
        855 1 . . . 1 1 
        856 1 . . . 1 1 
        857 1 . . . 1 1 
        858 1 . . . 1 1 
        859 1 . . . 1 1 
        860 1 . . . 1 1 
        861 1 . . . 1 1 
        862 1 . . . 1 1 
        863 1 . . . 1 1 
        864 1 . . . 1 1 
        865 1 . . . 1 1 
        866 1 . . . 1 1 
        867 1 . . . 1 1 
        868 1 . . . 1 1 
        869 1 . . . 1 1 
        870 1 . . . 1 1 
        871 1 . . . 1 1 
        872 1 . . . 1 1 
        873 1 . . . 1 1 
        874 1 . . . 1 1 
        875 1 . . . 1 1 
        876 1 . . . 1 1 
        877 1 . . . 1 1 
        878 1 . . . 1 1 
        879 1 . . . 1 1 
        880 1 . . . 1 1 
        881 1 . . . 1 1 
        882 1 . . . 1 1 
        883 1 . . . 1 1 
        884 1 . . . 1 1 
        885 1 . . . 1 1 
        886 1 . . . 1 1 
        887 1 . . . 1 1 
        888 1 . . . 1 1 
        889 1 . . . 1 1 
        890 1 . . . 1 1 
        891 1 . . . 1 1 
        892 1 . . . 1 1 
        893 1 . . . 1 1 
        894 1 . . . 1 1 
        895 1 . . . 1 1 
        896 1 . . . 1 1 
        897 1 . . . 1 1 
        898 1 . . . 1 1 
        899 1 . . . 1 1 
        900 1 . . . 1 1 
        901 1 . . . 1 1 
        902 1 . . . 1 1 
        903 1 . . . 1 1 
        904 1 . . . 1 1 
        905 1 . . . 1 1 
        906 1 . . . 1 1 
        907 1 . . . 1 1 
        908 1 . . . 1 1 
        909 1 . . . 1 1 
        910 1 . . . 1 1 
        911 1 . . . 1 1 
        912 1 . . . 1 1 
        913 1 . . . 1 1 
        914 1 . . . 1 1 
        915 1 . . . 1 1 
        916 1 . . . 1 1 
        917 1 . . . 1 1 
        918 1 . . . 1 1 
        919 1 . . . 1 1 
        920 1 . . . 1 1 
        921 1 . . . 1 1 
        922 1 . . . 1 1 
        923 1 . . . 1 1 
        924 1 . . . 1 1 
        925 1 . . . 1 1 
        926 1 . . . 1 1 
        927 1 . . . 1 1 
        928 1 . . . 1 1 
        929 1 . . . 1 1 
        930 1 . . . 1 1 
        931 1 . . . 1 1 
        932 1 . . . 1 1 
        933 1 . . . 1 1 
        934 1 . . . 1 1 
        935 1 . . . 1 1 
        936 1 . . . 1 1 
        937 1 . . . 1 1 
        938 1 . . . 1 1 
        939 1 . . . 1 1 
        940 1 . . . 1 1 
        941 1 . . . 1 1 
        942 1 . . . 1 1 
        943 1 . . . 1 1 
        944 1 . . . 1 1 
        945 1 . . . 1 1 
        946 1 . . . 1 1 
        947 1 . . . 1 1 
        948 1 . . . 1 1 
        949 1 . . . 1 1 
        950 1 . . . 1 1 
        951 1 . . . 1 1 
        952 1 . . . 1 1 
        953 1 . . . 1 1 
        954 1 . . . 1 1 
        955 1 . . . 1 1 
        956 1 . . . 1 1 
        957 1 . . . 1 1 
        958 1 . . . 1 1 
        959 1 . . . 1 1 
        960 1 . . . 1 1 
        961 1 . . . 1 1 
        962 1 . . . 1 1 
        963 1 . . . 1 1 
        964 1 . . . 1 1 
        965 1 . . . 1 1 
        966 1 . . . 1 1 
        967 1 . . . 1 1 
        968 1 . . . 1 1 
        969 1 . . . 1 1 
        970 1 . . . 1 1 
        971 1 . . . 1 1 
        972 1 . . . 1 1 
        973 1 . . . 1 1 
        974 1 . . . 1 1 
        975 1 . . . 1 1 
        976 1 . . . 1 1 
        977 1 . . . 1 1 
        978 1 . . . 1 1 
        979 1 . . . 1 1 
        980 1 . . . 1 1 
        981 1 . . . 1 1 
        982 1 . . . 1 1 
        983 1 . . . 1 1 
        984 1 . . . 1 1 
        985 1 . . . 1 1 
        986 1 . . . 1 1 
        987 1 . . . 1 1 
        988 1 . . . 1 1 
        989 1 . . . 1 1 
        990 1 . . . 1 1 
        991 1 . . . 1 1 
        992 1 . . . 1 1 
        993 1 . . . 1 1 
        994 1 . . . 1 1 
        995 1 . . . 1 1 
        996 1 . . . 1 1 
        997 1 . . . 1 1 
        998 1 . . . 1 1 
        999 1 . . . 1 1 
       1000 1 . . . 1 1 
       1001 1 . . . 1 1 
       1002 1 . . . 1 1 
       1003 1 . . . 1 1 
       1004 1 . . . 1 1 
       1005 1 . . . 1 1 
       1006 1 . . . 1 1 
       1007 1 . . . 1 1 
       1008 1 . . . 1 1 
       1009 1 . . . 1 1 
       1010 1 . . . 1 1 
       1011 1 . . . 1 1 
       1012 1 . . . 1 1 
       1013 1 . . . 1 1 
       1014 1 . . . 1 1 
       1015 1 . . . 1 1 
       1016 1 . . . 1 1 
       1017 1 . . . 1 1 
       1018 1 . . . 1 1 
       1019 1 . . . 1 1 
       1020 1 . . . 1 1 
       1021 1 . . . 1 1 
       1022 1 . . . 1 1 
       1023 1 . . . 1 1 
       1024 1 . . . 1 1 
       1025 1 . . . 1 1 
       1026 1 . . . 1 1 
       1027 1 . . . 1 1 
       1028 1 . . . 1 1 
       1029 1 . . . 1 1 
       1030 1 . . . 1 1 
       1031 1 . . . 1 1 
       1032 1 . . . 1 1 
       1033 1 . . . 1 1 
       1034 1 . . . 1 1 
       1035 1 . . . 1 1 
       1036 1 . . . 1 1 
       1037 1 . . . 1 1 
       1038 1 . . . 1 1 
       1039 1 . . . 1 1 
       1040 1 . . . 1 1 
       1041 1 . . . 1 1 
       1042 1 . . . 1 1 
       1043 1 . . . 1 1 
       1044 1 . . . 1 1 
       1045 1 . . . 1 1 
       1046 1 . . . 1 1 
       1047 1 . . . 1 1 
       1048 1 . . . 1 1 
       1049 1 . . . 1 1 
       1050 1 . . . 1 1 
       1051 1 . . . 1 1 
       1052 1 . . . 1 1 
       1053 1 . . . 1 1 
       1054 1 . . . 1 1 
       1055 1 . . . 1 1 
       1056 1 . . . 1 1 
       1057 1 . . . 1 1 
       1058 1 . . . 1 1 
       1059 1 . . . 1 1 
       1060 1 . . . 1 1 
       1061 1 . . . 1 1 
       1062 1 . . . 1 1 
       1063 1 . . . 1 1 
       1064 1 . . . 1 1 
       1065 1 . . . 1 1 
       1066 1 . . . 1 1 
       1067 1 . . . 1 1 
       1068 1 . . . 1 1 
       1069 1 . . . 1 1 
       1070 1 . . . 1 1 
       1071 1 . . . 1 1 
       1072 1 . . . 1 1 
       1073 1 . . . 1 1 
       1074 1 . . . 1 1 
       1075 1 . . . 1 1 
       1076 1 . . . 1 1 
       1077 1 . . . 1 1 
       1078 1 . . . 1 1 
       1079 1 . . . 1 1 
       1080 1 . . . 1 1 
       1081 1 . . . 1 1 
       1082 1 . . . 1 1 
       1083 1 . . . 1 1 
       1084 1 . . . 1 1 
       1085 1 . . . 1 1 
       1086 1 . . . 1 1 
       1087 1 . . . 1 1 
       1088 1 . . . 1 1 
       1089 1 . . . 1 1 
       1090 1 . . . 1 1 
       1091 1 . . . 1 1 
       1092 1 . . . 1 1 
       1093 1 . . . 1 1 
       1094 1 . . . 1 1 
       1095 1 . . . 1 1 
       1096 1 . . . 1 1 
       1097 1 . . . 1 1 
       1098 1 . . . 1 1 
       1099 1 . . . 1 1 
       1100 1 . . . 1 1 
       1101 1 . . . 1 1 
       1102 1 . . . 1 1 
       1103 1 . . . 1 1 
       1104 1 . . . 1 1 
       1105 1 . . . 1 1 
       1106 1 . . . 1 1 
       1107 1 . . . 1 1 
       1108 1 . . . 1 1 
       1109 1 . . . 1 1 
       1110 1 . . . 1 1 
       1111 1 . . . 1 1 
       1112 1 . . . 1 1 
       1113 1 . . . 1 1 
       1114 1 . . . 1 1 
       1115 1 . . . 1 1 
       1116 1 . . . 1 1 
       1117 1 . . . 1 1 
       1118 1 . . . 1 1 
       1119 1 . . . 1 1 
       1120 1 . . . 1 1 
       1121 1 . . . 1 1 
       1122 1 . . . 1 1 
       1123 1 . . . 1 1 
       1124 1 . . . 1 1 
       1125 1 . . . 1 1 
       1126 1 . . . 1 1 
       1127 1 . . . 1 1 
       1128 1 . . . 1 1 
       1129 1 . . . 1 1 
       1130 1 . . . 1 1 
       1131 1 . . . 1 1 
       1132 1 . . . 1 1 
       1133 1 . . . 1 1 
       1134 1 . . . 1 1 
       1135 1 . . . 1 1 
       1136 1 . . . 1 1 
       1137 1 . . . 1 1 
       1138 1 . . . 1 1 
       1139 1 . . . 1 1 
       1140 1 . . . 1 1 
       1141 1 . . . 1 1 
       1142 1 . . . 1 1 
       1143 1 . . . 1 1 
       1144 1 . . . 1 1 
       1145 1 . . . 1 1 
       1146 1 . . . 1 1 
       1147 1 . . . 1 1 
       1148 1 . . . 1 1 
       1149 1 . . . 1 1 
       1150 1 . . . 1 1 
       1151 1 . . . 1 1 
       1152 1 . . . 1 1 
       1153 1 . . . 1 1 
       1154 1 . . . 1 1 
       1155 1 . . . 1 1 
       1156 1 . . . 1 1 
       1157 1 . . . 1 1 
       1158 1 . . . 1 1 
       1159 1 . . . 1 1 
       1160 1 . . . 1 1 
       1161 1 . . . 1 1 
       1162 1 . . . 1 1 
       1163 1 . . . 1 1 
       1164 1 . . . 1 1 
       1165 1 . . . 1 1 
       1166 1 . . . 1 1 
       1167 1 . . . 1 1 
       1168 1 . . . 1 1 
       1169 1 . . . 1 1 
       1170 1 . . . 1 1 
       1171 1 . . . 1 1 
       1172 1 . . . 1 1 
       1173 1 . . . 1 1 
       1174 1 . . . 1 1 
       1175 1 . . . 1 1 
       1176 1 . . . 1 1 
       1177 1 . . . 1 1 
       1178 1 . . . 1 1 
       1179 1 . . . 1 1 
       1180 1 . . . 1 1 
       1181 1 . . . 1 1 
       1182 1 . . . 1 1 
       1183 1 . . . 1 1 
       1184 1 . . . 1 1 
       1185 1 . . . 1 1 
       1186 1 . . . 1 1 
       1187 1 . . . 1 1 
       1188 1 . . . 1 1 
       1189 1 . . . 1 1 
       1190 1 . . . 1 1 
       1191 1 . . . 1 1 
       1192 1 . . . 1 1 
       1193 1 . . . 1 1 
       1194 1 . . . 1 1 
       1195 1 . . . 1 1 
       1196 1 . . . 1 1 
       1197 1 . . . 1 1 
       1198 1 . . . 1 1 
       1199 1 . . . 1 1 
       1200 1 . . . 1 1 
       1201 1 . . . 1 1 
       1202 1 . . . 1 1 
       1203 1 . . . 1 1 
       1204 1 . . . 1 1 
       1205 1 . . . 1 1 
       1206 1 . . . 1 1 
       1207 1 . . . 1 1 
       1208 1 . . . 1 1 
       1209 1 . . . 1 1 
       1210 1 . . . 1 1 
       1211 1 . . . 1 1 
       1212 1 . . . 1 1 
       1213 1 . . . 1 1 
       1214 1 . . . 1 1 
       1215 1 . . . 1 1 
       1216 1 . . . 1 1 
       1217 1 . . . 1 1 
       1218 1 . . . 1 1 
       1219 1 . . . 1 1 
       1220 1 . . . 1 1 
       1221 1 . . . 1 1 
       1222 1 . . . 1 1 
       1223 1 . . . 1 1 
       1224 1 . . . 1 1 
       1225 1 . . . 1 1 
       1226 1 . . . 1 1 
       1227 1 . . . 1 1 
       1228 1 . . . 1 1 
       1229 1 . . . 1 1 
       1230 1 . . . 1 1 
       1231 1 . . . 1 1 
       1232 1 . . . 1 1 
       1233 1 . . . 1 1 
       1234 1 . . . 1 1 
       1235 1 . . . 1 1 
       1236 1 . . . 1 1 
       1237 1 . . . 1 1 
       1238 1 . . . 1 1 
       1239 1 . . . 1 1 
       1240 1 . . . 1 1 
       1241 1 . . . 1 1 
       1242 1 . . . 1 1 
       1243 1 . . . 1 1 
       1244 1 . . . 1 1 
       1245 1 . . . 1 1 
       1246 1 . . . 1 1 
       1247 1 . . . 1 1 
       1248 1 . . . 1 1 
       1249 1 . . . 1 1 
       1250 1 . . . 1 1 
       1251 1 . . . 1 1 
       1252 1 . . . 1 1 
       1253 1 . . . 1 1 
       1254 1 . . . 1 1 
       1255 1 . . . 1 1 
       1256 1 . . . 1 1 
       1257 1 . . . 1 1 
       1258 1 . . . 1 1 
       1259 1 . . . 1 1 
       1260 1 . . . 1 1 
       1261 1 . . . 1 1 
       1262 1 . . . 1 1 
       1263 1 . . . 1 1 
       1264 1 . . . 1 1 
       1265 1 . . . 1 1 
       1266 1 . . . 1 1 
       1267 1 . . . 1 1 
       1268 1 . . . 1 1 
       1269 1 . . . 1 1 
       1270 1 . . . 1 1 
       1271 1 . . . 1 1 
       1272 1 . . . 1 1 
       1273 1 . . . 1 1 
       1274 1 . . . 1 1 
       1275 1 . . . 1 1 
       1276 1 . . . 1 1 
       1277 1 . . . 1 1 
       1278 1 . . . 1 1 
       1279 1 . . . 1 1 
       1280 1 . . . 1 1 
       1281 1 . . . 1 1 
       1282 1 . . . 1 1 
       1283 1 . . . 1 1 
       1284 1 . . . 1 1 
       1285 1 . . . 1 1 
       1286 1 . . . 1 1 
       1287 1 . . . 1 1 
       1288 1 . . . 1 1 
       1289 1 . . . 1 1 
       1290 1 . . . 1 1 
       1291 1 . . . 1 1 
       1292 1 . . . 1 1 
       1293 1 . . . 1 1 
       1294 1 . . . 1 1 
       1295 1 . . . 1 1 
       1296 1 . . . 1 1 
       1297 1 . . . 1 1 
       1298 1 . . . 1 1 
       1299 1 . . . 1 1 
       1300 1 . . . 1 1 
       1301 1 . . . 1 1 
       1302 1 . . . 1 1 
       1303 1 . . . 1 1 
       1304 1 . . . 1 1 
       1305 1 . . . 1 1 
       1306 1 . . . 1 1 
       1307 1 . . . 1 1 
       1308 1 . . . 1 1 
       1309 1 . . . 1 1 
       1310 1 . . . 1 1 
       1311 1 . . . 1 1 
       1312 1 . . . 1 1 
       1313 1 . . . 1 1 
       1314 1 . . . 1 1 
       1315 1 . . . 1 1 
       1316 1 . . . 1 1 
       1317 1 . . . 1 1 
       1318 1 . . . 1 1 
       1319 1 . . . 1 1 
       1320 1 . . . 1 1 
       1321 1 . . . 1 1 
       1322 1 . . . 1 1 
       1323 1 . . . 1 1 
       1324 1 . . . 1 1 
       1325 1 . . . 1 1 
       1326 1 . . . 1 1 
       1327 1 . . . 1 1 
       1328 1 . . . 1 1 
       1329 1 . . . 1 1 
       1330 1 . . . 1 1 
       1331 1 . . . 1 1 
       1332 1 . . . 1 1 
       1333 1 . . . 1 1 
       1334 1 . . . 1 1 
       1335 1 . . . 1 1 
       1336 1 . . . 1 1 
       1337 1 . . . 1 1 
       1338 1 . . . 1 1 
       1339 1 . . . 1 1 
       1340 1 . . . 1 1 
       1341 1 . . . 1 1 
       1342 1 . . . 1 1 
       1343 1 . . . 1 1 
       1344 1 . . . 1 1 
       1345 1 . . . 1 1 
       1346 1 . . . 1 1 
       1347 1 . . . 1 1 
       1348 1 . . . 1 1 
       1349 1 . . . 1 1 
       1350 1 . . . 1 1 
       1351 1 . . . 1 1 
       1352 1 . . . 1 1 
       1353 1 . . . 1 1 
       1354 1 . . . 1 1 
       1355 1 . . . 1 1 
       1356 1 . . . 1 1 
       1357 1 . . . 1 1 
       1358 1 . . . 1 1 
       1359 1 . . . 1 1 
       1360 1 . . . 1 1 
       1361 1 . . . 1 1 
       1362 1 . . . 1 1 
       1363 1 . . . 1 1 
       1364 1 . . . 1 1 
       1365 1 . . . 1 1 
       1366 1 . . . 1 1 
       1367 1 . . . 1 1 
       1368 1 . . . 1 1 
       1369 1 . . . 1 1 
       1370 1 . . . 1 1 
       1371 1 . . . 1 1 
       1372 1 . . . 1 1 
       1373 1 . . . 1 1 
       1374 1 . . . 1 1 
       1375 1 . . . 1 1 
       1376 1 . . . 1 1 
       1377 1 . . . 1 1 
       1378 1 . . . 1 1 
       1379 1 . . . 1 1 
       1380 1 . . . 1 1 
       1381 1 . . . 1 1 
       1382 1 . . . 1 1 
       1383 1 . . . 1 1 
       1384 1 . . . 1 1 
       1385 1 . . . 1 1 
       1386 1 . . . 1 1 
       1387 1 . . . 1 1 
       1388 1 . . . 1 1 
       1389 1 . . . 1 1 
       1390 1 . . . 1 1 
       1391 1 . . . 1 1 
       1392 1 . . . 1 1 
       1393 1 . . . 1 1 
       1394 1 . . . 1 1 
       1395 1 . . . 1 1 
       1396 1 . . . 1 1 
       1397 1 . . . 1 1 
       1398 1 . . . 1 1 
       1399 1 . . . 1 1 
       1400 1 . . . 1 1 
       1401 1 . . . 1 1 
       1402 1 . . . 1 1 
       1403 1 . . . 1 1 
       1404 1 . . . 1 1 
       1405 1 . . . 1 1 
       1406 1 . . . 1 1 
       1407 1 . . . 1 1 
       1408 1 . . . 1 1 
       1409 1 . . . 1 1 
       1410 1 . . . 1 1 
       1411 1 . . . 1 1 
       1412 1 . . . 1 1 
       1413 1 . . . 1 1 
       1414 1 . . . 1 1 
       1415 1 . . . 1 1 
       1416 1 . . . 1 1 
       1417 1 . . . 1 1 
       1418 1 . . . 1 1 
       1419 1 . . . 1 1 
       1420 1 . . . 1 1 
       1421 1 . . . 1 1 
       1422 1 . . . 1 1 
       1423 1 . . . 1 1 
       1424 1 . . . 1 1 
       1425 1 . . . 1 1 
       1426 1 . . . 1 1 
       1427 1 . . . 1 1 
       1428 1 . . . 1 1 
       1429 1 . . . 1 1 
       1430 1 . . . 1 1 
       1431 1 . . . 1 1 
       1432 1 . . . 1 1 
       1433 1 . . . 1 1 
       1434 1 . . . 1 1 
       1435 1 . . . 1 1 
       1436 1 . . . 1 1 
       1437 1 . . . 1 1 
       1438 1 . . . 1 1 
       1439 1 . . . 1 1 
       1440 1 . . . 1 1 
       1441 1 . . . 1 1 
       1442 1 . . . 1 1 
       1443 1 . . . 1 1 
       1444 1 . . . 1 1 
       1445 1 . . . 1 1 
       1446 1 . . . 1 1 
       1447 1 . . . 1 1 
       1448 1 . . . 1 1 
       1449 1 . . . 1 1 
       1450 1 . . . 1 1 
       1451 1 . . . 1 1 
       1452 1 . . . 1 1 
       1453 1 . . . 1 1 
       1454 1 . . . 1 1 
       1455 1 . . . 1 1 
       1456 1 . . . 1 1 
       1457 1 . . . 1 1 
       1458 1 . . . 1 1 
       1459 1 . . . 1 1 
       1460 1 . . . 1 1 
       1461 1 . . . 1 1 
       1462 1 . . . 1 1 
       1463 1 . . . 1 1 
       1464 1 . . . 1 1 
       1465 1 . . . 1 1 
       1466 1 . . . 1 1 
       1467 1 . . . 1 1 
       1468 1 . . . 1 1 
       1469 1 . . . 1 1 
       1470 1 . . . 1 1 
       1471 1 . . . 1 1 
       1472 1 . . . 1 1 
       1473 1 . . . 1 1 
       1474 1 . . . 1 1 
       1475 1 . . . 1 1 
       1476 1 . . . 1 1 
       1477 1 . . . 1 1 
       1478 1 . . . 1 1 
       1479 1 . . . 1 1 
       1480 1 . . . 1 1 
       1481 1 . . . 1 1 
       1482 1 . . . 1 1 
       1483 1 . . . 1 1 
       1484 1 . . . 1 1 
       1485 1 . . . 1 1 
       1486 1 . . . 1 1 
       1487 1 . . . 1 1 
       1488 1 . . . 1 1 
       1489 1 . . . 1 1 
       1490 1 . . . 1 1 
       1491 1 . . . 1 1 
       1492 1 . . . 1 1 
       1493 1 . . . 1 1 
       1494 1 . . . 1 1 
       1495 1 . . . 1 1 
       1496 1 . . . 1 1 
       1497 1 . . . 1 1 
       1498 1 . . . 1 1 
       1499 1 . . . 1 1 
       1500 1 . . . 1 1 
       1501 1 . . . 1 1 
       1502 1 . . . 1 1 
       1503 1 . . . 1 1 
       1504 1 . . . 1 1 
       1505 1 . . . 1 1 
       1506 1 . . . 1 1 
       1507 1 . . . 1 1 
       1508 1 . . . 1 1 
       1509 1 . . . 1 1 
       1510 1 . . . 1 1 
       1511 1 . . . 1 1 
       1512 1 . . . 1 1 
       1513 1 . . . 1 1 
       1514 1 . . . 1 1 
       1515 1 . . . 1 1 
       1516 1 . . . 1 1 
       1517 1 . . . 1 1 
       1518 1 . . . 1 1 
       1519 1 . . . 1 1 
       1520 1 . . . 1 1 
       1521 1 . . . 1 1 
       1522 1 . . . 1 1 
       1523 1 . . . 1 1 
       1524 1 . . . 1 1 
       1525 1 . . . 1 1 
       1526 1 . . . 1 1 
       1527 1 . . . 1 1 
       1528 1 . . . 1 1 
       1529 1 . . . 1 1 
       1530 1 . . . 1 1 
       1531 1 . . . 1 1 
       1532 1 . . . 1 1 
       1533 1 . . . 1 1 
       1534 1 . . . 1 1 
       1535 1 . . . 1 1 
       1536 1 . . . 1 1 
       1537 1 . . . 1 1 
       1538 1 . . . 1 1 
       1539 1 . . . 1 1 
       1540 1 . . . 1 1 
       1541 1 . . . 1 1 
       1542 1 . . . 1 1 
       1543 1 . . . 1 1 
       1544 1 . . . 1 1 
       1545 1 . . . 1 1 
       1546 1 . . . 1 1 
       1547 1 . . . 1 1 
       1548 1 . . . 1 1 
       1549 1 . . . 1 1 
       1550 1 . . . 1 1 
       1551 1 . . . 1 1 
       1552 1 . . . 1 1 
       1553 1 . . . 1 1 
       1554 1 . . . 1 1 
       1555 1 . . . 1 1 
       1556 1 . . . 1 1 
       1557 1 . . . 1 1 
       1558 1 . . . 1 1 
       1559 1 . . . 1 1 
       1560 1 . . . 1 1 
       1561 1 . . . 1 1 
       1562 1 . . . 1 1 
       1563 1 . . . 1 1 
       1564 1 . . . 1 1 
       1565 1 . . . 1 1 
       1566 1 . . . 1 1 
       1567 1 . . . 1 1 
       1568 1 . . . 1 1 
       1569 1 . . . 1 1 
       1570 1 . . . 1 1 
       1571 1 . . . 1 1 
       1572 1 . . . 1 1 
       1573 1 . . . 1 1 
       1574 1 . . . 1 1 
       1575 1 . . . 1 1 
       1576 1 . . . 1 1 
       1577 1 . . . 1 1 
       1578 1 . . . 1 1 
       1579 1 . . . 1 1 
       1580 1 . . . 1 1 
       1581 1 . . . 1 1 
       1582 1 . . . 1 1 
       1583 1 . . . 1 1 
       1584 1 . . . 1 1 
       1585 1 . . . 1 1 
       1586 1 . . . 1 1 
       1587 1 . . . 1 1 
       1588 1 . . . 1 1 
       1589 1 . . . 1 1 
       1590 1 . . . 1 1 
       1591 1 . . . 1 1 
       1592 1 . . . 1 1 
       1593 1 . . . 1 1 
       1594 1 . . . 1 1 
       1595 1 . . . 1 1 
       1596 1 . . . 1 1 
       1597 1 . . . 1 1 
       1598 1 . . . 1 1 
       1599 1 . . . 1 1 
       1600 1 . . . 1 1 
       1601 1 . . . 1 1 
       1602 1 . . . 1 1 
       1603 1 . . . 1 1 
       1604 1 . . . 1 1 
       1605 1 . . . 1 1 
       1606 1 . . . 1 1 
       1607 1 . . . 1 1 
       1608 1 . . . 1 1 
       1609 1 . . . 1 1 
       1610 1 . . . 1 1 
       1611 1 . . . 1 1 
       1612 1 . . . 1 1 
       1613 1 . . . 1 1 
       1614 1 . . . 1 1 
       1615 1 . . . 1 1 
       1616 1 . . . 1 1 
       1617 1 . . . 1 1 
       1618 1 . . . 1 1 
       1619 1 . . . 1 1 
       1620 1 . . . 1 1 
       1621 1 . . . 1 1 
       1622 1 . . . 1 1 
       1623 1 . . . 1 1 
       1624 1 . . . 1 1 
       1625 1 . . . 1 1 
       1626 1 . . . 1 1 
       1627 1 . . . 1 1 
       1628 1 . . . 1 1 
       1629 1 . . . 1 1 
       1630 1 . . . 1 1 
       1631 1 . . . 1 1 
       1632 1 . . . 1 1 
       1633 1 . . . 1 1 
       1634 1 . . . 1 1 
       1635 1 . . . 1 1 
       1636 1 . . . 1 1 
       1637 1 . . . 1 1 
       1638 1 . . . 1 1 
       1639 1 . . . 1 1 
       1640 1 . . . 1 1 
       1641 1 . . . 1 1 
       1642 1 . . . 1 1 
       1643 1 . . . 1 1 
       1644 1 . . . 1 1 
       1645 1 . . . 1 1 
       1646 1 . . . 1 1 
       1647 1 . . . 1 1 
       1648 1 . . . 1 1 
       1649 1 . . . 1 1 
       1650 1 . . . 1 1 
       1651 1 . . . 1 1 
       1652 1 . . . 1 1 
       1653 1 . . . 1 1 
       1654 1 . . . 1 1 
       1655 1 . . . 1 1 
       1656 1 . . . 1 1 
       1657 1 . . . 1 1 
       1658 1 . . . 1 1 
       1659 1 . . . 1 1 
       1660 1 . . . 1 1 
       1661 1 . . . 1 1 
       1662 1 . . . 1 1 
       1663 1 . . . 1 1 
       1664 1 . . . 1 1 
       1665 1 . . . 1 1 
       1666 1 . . . 1 1 
       1667 1 . . . 1 1 
       1668 1 . . . 1 1 
       1669 1 . . . 1 1 
       1670 1 . . . 1 1 
       1671 1 . . . 1 1 
       1672 1 . . . 1 1 
       1673 1 . . . 1 1 
       1674 1 . . . 1 1 
       1675 1 . . . 1 1 
       1676 1 . . . 1 1 
       1677 1 . . . 1 1 
       1678 1 . . . 1 1 
       1679 1 . . . 1 1 
       1680 1 . . . 1 1 
       1681 1 . . . 1 1 
       1682 1 . . . 1 1 
       1683 1 . . . 1 1 
       1684 1 . . . 1 1 
       1685 1 . . . 1 1 
       1686 1 . . . 1 1 
       1687 1 . . . 1 1 
       1688 1 . . . 1 1 
       1689 1 . . . 1 1 
       1690 1 . . . 1 1 
       1691 1 . . . 1 1 
       1692 1 . . . 1 1 
       1693 1 . . . 1 1 
       1694 1 . . . 1 1 
       1695 1 . . . 1 1 
       1696 1 . . . 1 1 
       1697 1 . . . 1 1 
       1698 1 . . . 1 1 
       1699 1 . . . 1 1 
       1700 1 . . . 1 1 
       1701 1 . . . 1 1 
       1702 1 . . . 1 1 
       1703 1 . . . 1 1 
       1704 1 . . . 1 1 
       1705 1 . . . 1 1 
       1706 1 . . . 1 1 
       1707 1 . . . 1 1 
       1708 1 . . . 1 1 
       1709 1 . . . 1 1 
       1710 1 . . . 1 1 
       1711 1 . . . 1 1 
       1712 1 . . . 1 1 
       1713 1 . . . 1 1 
       1714 1 . . . 1 1 
       1715 1 . . . 1 1 
       1716 1 . . . 1 1 
       1717 1 . . . 1 1 
       1718 1 . . . 1 1 
       1719 1 . . . 1 1 
       1720 1 . . . 1 1 
       1721 1 . . . 1 1 
       1722 1 . . . 1 1 
       1723 1 . . . 1 1 
       1724 1 . . . 1 1 
       1725 1 . . . 1 1 
       1726 1 . . . 1 1 
       1727 1 . . . 1 1 
       1728 1 . . . 1 1 
       1729 1 . . . 1 1 
       1730 1 . . . 1 1 
       1731 1 . . . 1 1 
       1732 1 . . . 1 1 
       1733 1 . . . 1 1 
       1734 1 . . . 1 1 
       1735 1 . . . 1 1 
       1736 1 . . . 1 1 
       1737 1 . . . 1 1 
       1738 1 . . . 1 1 
       1739 1 . . . 1 1 
       1740 1 . . . 1 1 
       1741 1 . . . 1 1 
       1742 1 . . . 1 1 
       1743 1 . . . 1 1 
       1744 1 . . . 1 1 
       1745 1 . . . 1 1 
       1746 1 . . . 1 1 
       1747 1 . . . 1 1 
       1748 1 . . . 1 1 
       1749 1 . . . 1 1 
       1750 1 . . . 1 1 
       1751 1 . . . 1 1 
       1752 1 . . . 1 1 
       1753 1 . . . 1 1 
       1754 1 . . . 1 1 
       1755 1 . . . 1 1 
       1756 1 . . . 1 1 
       1757 1 . . . 1 1 
       1758 1 . . . 1 1 
       1759 1 . . . 1 1 
       1760 1 . . . 1 1 
       1761 1 . . . 1 1 
       1762 1 . . . 1 1 
       1763 1 . . . 1 1 
       1764 1 . . . 1 1 
       1765 1 . . . 1 1 
       1766 1 . . . 1 1 
       1767 1 . . . 1 1 
       1768 1 . . . 1 1 
       1769 1 . . . 1 1 
       1770 1 . . . 1 1 
       1771 1 . . . 1 1 
       1772 1 . . . 1 1 
       1773 1 . . . 1 1 
       1774 1 . . . 1 1 
       1775 1 . . . 1 1 
       1776 1 . . . 1 1 
       1777 1 . . . 1 1 
       1778 1 . . . 1 1 
       1779 1 . . . 1 1 
       1780 1 . . . 1 1 
       1781 1 . . . 1 1 
       1782 1 . . . 1 1 
       1783 1 . . . 1 1 
       1784 1 . . . 1 1 
       1785 1 . . . 1 1 
       1786 1 . . . 1 1 
       1787 1 . . . 1 1 
       1788 1 . . . 1 1 
       1789 1 . . . 1 1 
       1790 1 . . . 1 1 
       1791 1 . . . 1 1 
       1792 1 . . . 1 1 
       1793 1 . . . 1 1 
       1794 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

          1 1 1 1 1  5 GLU QG   .  5 . HG*  1 1 
          1 1 2 1 1  6 THR H    .  6 . HN   1 1 
          2 1 1 1 1  6 THR HA   .  6 . HA   1 1 
          2 1 2 1 1  6 THR MG   .  6 . HG2* 1 1 
          3 1 1 1 1  6 THR HB   .  6 . HB   1 1 
          3 1 2 1 1  7 SER H    .  7 . HN   1 1 
          4 1 1 1 1  7 SER HA   .  7 . HA   1 1 
          4 1 2 1 1  8 ASP H    .  8 . HN   1 1 
          5 1 1 1 1  7 SER HA   .  7 . HA   1 1 
          5 1 2 1 1  8 ASP HB2  .  8 . HB2  1 1 
          6 1 1 1 1  7 SER HA   .  7 . HA   1 1 
          6 1 2 1 1  8 ASP HB3  .  8 . HB1  1 1 
          7 1 1 1 1  7 SER QB   .  7 . HB*  1 1 
          7 1 2 1 1  8 ASP H    .  8 . HN   1 1 
          8 1 1 1 1  7 SER QB   .  7 . HB*  1 1 
          8 1 2 1 1  9 LEU MD2  .  9 . HD2* 1 1 
          9 1 1 1 1  8 ASP H    .  8 . HN   1 1 
          9 1 2 1 1  8 ASP HB2  .  8 . HB2  1 1 
         10 1 1 1 1  8 ASP H    .  8 . HN   1 1 
         10 1 2 1 1  8 ASP HB3  .  8 . HB1  1 1 
         11 1 1 1 1  8 ASP H    .  8 . HN   1 1 
         11 1 2 1 1  9 LEU H    .  9 . HN   1 1 
         12 1 1 1 1  8 ASP H    .  8 . HN   1 1 
         12 1 2 1 1  9 LEU MD2  .  9 . HD2* 1 1 
         13 1 1 1 1  8 ASP HA   .  8 . HA   1 1 
         13 1 2 1 1  9 LEU H    .  9 . HN   1 1 
         14 1 1 1 1  8 ASP HA   .  8 . HA   1 1 
         14 1 2 1 1  9 LEU HB2  .  9 . HB2  1 1 
         15 1 1 1 1  8 ASP HA   .  8 . HA   1 1 
         15 1 2 1 1  9 LEU HG   .  9 . HG   1 1 
         16 1 1 1 1  8 ASP HA   .  8 . HA   1 1 
         16 1 2 1 1 73 HIS HE1  . 73 . HE1  1 1 
         17 1 1 1 1  8 ASP HB2  .  8 . HB2  1 1 
         17 1 2 1 1  9 LEU H    .  9 . HN   1 1 
         18 1 1 1 1  8 ASP HB2  .  8 . HB2  1 1 
         18 1 2 1 1 71 LYS QB   . 71 . HB*  1 1 
         19 1 1 1 1  8 ASP HB2  .  8 . HB2  1 1 
         19 1 2 1 1 71 LYS QG   . 71 . HG*  1 1 
         20 1 1 1 1  8 ASP HB2  .  8 . HB2  1 1 
         20 1 2 1 1 73 HIS HE1  . 73 . HE1  1 1 
         21 1 1 1 1  8 ASP HB3  .  8 . HB1  1 1 
         21 1 2 1 1  9 LEU H    .  9 . HN   1 1 
         22 1 1 1 1  8 ASP HB3  .  8 . HB1  1 1 
         22 1 2 1 1 71 LYS QB   . 71 . HB*  1 1 
         23 1 1 1 1  8 ASP HB3  .  8 . HB1  1 1 
         23 1 2 1 1 71 LYS QG   . 71 . HG*  1 1 
         24 1 1 1 1  8 ASP HB3  .  8 . HB1  1 1 
         24 1 2 1 1 73 HIS HE1  . 73 . HE1  1 1 
         25 1 1 1 1  9 LEU H    .  9 . HN   1 1 
         25 1 2 1 1  9 LEU HB2  .  9 . HB2  1 1 
         26 1 1 1 1  9 LEU H    .  9 . HN   1 1 
         26 1 2 1 1  9 LEU HB3  .  9 . HB1  1 1 
         27 1 1 1 1  9 LEU H    .  9 . HN   1 1 
         27 1 2 1 1  9 LEU MD1  .  9 . HD1* 1 1 
         28 1 1 1 1  9 LEU H    .  9 . HN   1 1 
         28 1 2 1 1  9 LEU MD2  .  9 . HD2* 1 1 
         29 1 1 1 1  9 LEU H    .  9 . HN   1 1 
         29 1 2 1 1  9 LEU HG   .  9 . HG   1 1 
         30 1 1 1 1  9 LEU H    .  9 . HN   1 1 
         30 1 2 1 1 10 GLU H    . 10 . HN   1 1 
         31 1 1 1 1  9 LEU HA   .  9 . HA   1 1 
         31 1 2 1 1  9 LEU MD1  .  9 . HD1* 1 1 
         32 1 1 1 1  9 LEU HA   .  9 . HA   1 1 
         32 1 2 1 1  9 LEU MD2  .  9 . HD2* 1 1 
         33 1 1 1 1  9 LEU HA   .  9 . HA   1 1 
         33 1 2 1 1  9 LEU HG   .  9 . HG   1 1 
         34 1 1 1 1  9 LEU HA   .  9 . HA   1 1 
         34 1 2 1 1 10 GLU H    . 10 . HN   1 1 
         35 1 1 1 1  9 LEU HA   .  9 . HA   1 1 
         35 1 2 1 1 10 GLU QG   . 10 . HG*  1 1 
         36 1 1 1 1  9 LEU HB2  .  9 . HB2  1 1 
         36 1 2 1 1  9 LEU MD1  .  9 . HD1* 1 1 
         37 1 1 1 1  9 LEU HB2  .  9 . HB2  1 1 
         37 1 2 1 1  9 LEU MD2  .  9 . HD2* 1 1 
         38 1 1 1 1  9 LEU HB2  .  9 . HB2  1 1 
         38 1 2 1 1 10 GLU H    . 10 . HN   1 1 
         39 1 1 1 1  9 LEU HB3  .  9 . HB1  1 1 
         39 1 2 1 1  9 LEU MD1  .  9 . HD1* 1 1 
         40 1 1 1 1  9 LEU HB3  .  9 . HB1  1 1 
         40 1 2 1 1  9 LEU MD2  .  9 . HD2* 1 1 
         41 1 1 1 1  9 LEU HB3  .  9 . HB1  1 1 
         41 1 2 1 1 10 GLU H    . 10 . HN   1 1 
         42 1 1 1 1  9 LEU MD1  .  9 . HD1* 1 1 
         42 1 2 1 1 10 GLU H    . 10 . HN   1 1 
         43 1 1 1 1  9 LEU MD1  .  9 . HD1* 1 1 
         43 1 2 1 1 38 LYS H    . 38 . HN   1 1 
         44 1 1 1 1  9 LEU MD1  .  9 . HD1* 1 1 
         44 1 2 1 1 38 LYS QB   . 38 . HB*  1 1 
         45 1 1 1 1  9 LEU MD1  .  9 . HD1* 1 1 
         45 1 2 1 1 38 LYS QD   . 38 . HD*  1 1 
         46 1 1 1 1  9 LEU MD1  .  9 . HD1* 1 1 
         46 1 2 1 1 38 LYS QE   . 38 . HE*  1 1 
         47 1 1 1 1  9 LEU MD1  .  9 . HD1* 1 1 
         47 1 2 1 1 39 GLU H    . 39 . HN   1 1 
         48 1 1 1 1  9 LEU MD2  .  9 . HD2* 1 1 
         48 1 2 1 1 10 GLU H    . 10 . HN   1 1 
         49 1 1 1 1  9 LEU HG   .  9 . HG   1 1 
         49 1 2 1 1 10 GLU H    . 10 . HN   1 1 
         50 1 1 1 1 10 GLU H    . 10 . HN   1 1 
         50 1 2 1 1 10 GLU HB2  . 10 . HB2  1 1 
         51 1 1 1 1 10 GLU H    . 10 . HN   1 1 
         51 1 2 1 1 10 GLU HB3  . 10 . HB1  1 1 
         52 1 1 1 1 10 GLU H    . 10 . HN   1 1 
         52 1 2 1 1 10 GLU QG   . 10 . HG*  1 1 
         53 1 1 1 1 10 GLU H    . 10 . HN   1 1 
         53 1 2 1 1 11 PRO HD2  . 11 . HD2  1 1 
         54 1 1 1 1 10 GLU H    . 10 . HN   1 1 
         54 1 2 1 1 73 HIS QB   . 73 . HB*  1 1 
         55 1 1 1 1 10 GLU H    . 10 . HN   1 1 
         55 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
         56 1 1 1 1 10 GLU HA   . 10 . HA   1 1 
         56 1 2 1 1 11 PRO HD2  . 11 . HD2  1 1 
         57 1 1 1 1 10 GLU HA   . 10 . HA   1 1 
         57 1 2 1 1 11 PRO HD3  . 11 . HD1  1 1 
         58 1 1 1 1 10 GLU HA   . 10 . HA   1 1 
         58 1 2 1 1 11 PRO HG3  . 11 . HG1  1 1 
         59 1 1 1 1 10 GLU HA   . 10 . HA   1 1 
         59 1 2 1 1 73 HIS QB   . 73 . HB*  1 1 
         60 1 1 1 1 10 GLU HA   . 10 . HA   1 1 
         60 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
         61 1 1 1 1 10 GLU HB2  . 10 . HB2  1 1 
         61 1 2 1 1 11 PRO HD2  . 11 . HD2  1 1 
         62 1 1 1 1 10 GLU HB2  . 10 . HB2  1 1 
         62 1 2 1 1 11 PRO HD3  . 11 . HD1  1 1 
         63 1 1 1 1 10 GLU HB2  . 10 . HB2  1 1 
         63 1 2 1 1 73 HIS QB   . 73 . HB*  1 1 
         64 1 1 1 1 10 GLU HB2  . 10 . HB2  1 1 
         64 1 2 1 1 75 VAL MG1  . 75 . HG1* 1 1 
         65 1 1 1 1 10 GLU HB2  . 10 . HB2  1 1 
         65 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
         66 1 1 1 1 10 GLU HB2  . 10 . HB2  1 1 
         66 1 2 1 1 75 VAL MG2  . 75 . HG2* 1 1 
         67 1 1 1 1 10 GLU HB3  . 10 . HB1  1 1 
         67 1 2 1 1 73 HIS H    . 73 . HN   1 1 
         68 1 1 1 1 10 GLU HB3  . 10 . HB1  1 1 
         68 1 2 1 1 73 HIS QB   . 73 . HB*  1 1 
         69 1 1 1 1 10 GLU QG   . 10 . HG*  1 1 
         69 1 2 1 1 11 PRO HD2  . 11 . HD2  1 1 
         70 1 1 1 1 10 GLU QG   . 10 . HG*  1 1 
         70 1 2 1 1 73 HIS QB   . 73 . HB*  1 1 
         71 1 1 1 1 10 GLU QG   . 10 . HG*  1 1 
         71 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
         72 1 1 1 1 10 GLU HG2  . 10 . HG2  1 1 
         72 1 2 1 1 11 PRO HD3  . 11 . HD1  1 1 
         73 1 1 1 1 10 GLU HG2  . 10 . HG2  1 1 
         73 1 2 1 1 73 HIS QB   . 73 . HB*  1 1 
         74 1 1 1 1 10 GLU HG2  . 10 . HG2  1 1 
         74 1 2 1 1 73 HIS HD2  . 73 . HD2  1 1 
         75 1 1 1 1 10 GLU HG2  . 10 . HG2  1 1 
         75 1 2 1 1 75 VAL MG1  . 75 . HG1* 1 1 
         76 1 1 1 1 10 GLU HG2  . 10 . HG2  1 1 
         76 1 2 1 1 75 VAL MG2  . 75 . HG2* 1 1 
         77 1 1 1 1 10 GLU HG3  . 10 . HG1  1 1 
         77 1 2 1 1 11 PRO HD3  . 11 . HD1  1 1 
         78 1 1 1 1 10 GLU HG3  . 10 . HG1  1 1 
         78 1 2 1 1 73 HIS QB   . 73 . HB*  1 1 
         79 1 1 1 1 10 GLU HG3  . 10 . HG1  1 1 
         79 1 2 1 1 73 HIS HD2  . 73 . HD2  1 1 
         80 1 1 1 1 10 GLU HG3  . 10 . HG1  1 1 
         80 1 2 1 1 75 VAL MG1  . 75 . HG1* 1 1 
         81 1 1 1 1 10 GLU HG3  . 10 . HG1  1 1 
         81 1 2 1 1 75 VAL MG2  . 75 . HG2* 1 1 
         82 1 1 1 1 11 PRO HA   . 11 . HA   1 1 
         82 1 2 1 1 12 LYS H    . 12 . HN   1 1 
         83 1 1 1 1 11 PRO HA   . 11 . HA   1 1 
         83 1 2 1 1 37 ASP HA   . 37 . HA   1 1 
         84 1 1 1 1 11 PRO HA   . 11 . HA   1 1 
         84 1 2 1 1 39 GLU H    . 39 . HN   1 1 
         85 1 1 1 1 11 PRO HA   . 11 . HA   1 1 
         85 1 2 1 1 73 HIS QB   . 73 . HB*  1 1 
         86 1 1 1 1 11 PRO QB   . 11 . HB*  1 1 
         86 1 2 1 1 37 ASP HA   . 37 . HA   1 1 
         87 1 1 1 1 11 PRO QB   . 11 . HB*  1 1 
         87 1 2 1 1 37 ASP HB2  . 37 . HB2  1 1 
         88 1 1 1 1 11 PRO QB   . 11 . HB*  1 1 
         88 1 2 1 1 37 ASP HB3  . 37 . HB1  1 1 
         89 1 1 1 1 11 PRO QB   . 11 . HB*  1 1 
         89 1 2 1 1 43 LEU MD1  . 43 . HD1* 1 1 
         90 1 1 1 1 11 PRO QB   . 11 . HB*  1 1 
         90 1 2 1 1 67 VAL MG1  . 67 . HG1* 1 1 
         91 1 1 1 1 11 PRO QB   . 11 . HB*  1 1 
         91 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
         92 1 1 1 1 11 PRO HB2  . 11 . HB2  1 1 
         92 1 2 1 1 12 LYS H    . 12 . HN   1 1 
         93 1 1 1 1 11 PRO HB2  . 11 . HB2  1 1 
         93 1 2 1 1 35 ALA MB   . 35 . HB*  1 1 
         94 1 1 1 1 11 PRO HB2  . 11 . HB2  1 1 
         94 1 2 1 1 37 ASP HA   . 37 . HA   1 1 
         95 1 1 1 1 11 PRO HB2  . 11 . HB2  1 1 
         95 1 2 1 1 37 ASP HB2  . 37 . HB2  1 1 
         96 1 1 1 1 11 PRO HB2  . 11 . HB2  1 1 
         96 1 2 1 1 67 VAL MG1  . 67 . HG1* 1 1 
         97 1 1 1 1 11 PRO HB2  . 11 . HB2  1 1 
         97 1 2 1 1 67 VAL MG2  . 67 . HG2* 1 1 
         98 1 1 1 1 11 PRO HB3  . 11 . HB1  1 1 
         98 1 2 1 1 12 LYS H    . 12 . HN   1 1 
         99 1 1 1 1 11 PRO HB3  . 11 . HB1  1 1 
         99 1 2 1 1 35 ALA MB   . 35 . HB*  1 1 
        100 1 1 1 1 11 PRO HB3  . 11 . HB1  1 1 
        100 1 2 1 1 37 ASP HA   . 37 . HA   1 1 
        101 1 1 1 1 11 PRO HB3  . 11 . HB1  1 1 
        101 1 2 1 1 37 ASP HB2  . 37 . HB2  1 1 
        102 1 1 1 1 11 PRO HB3  . 11 . HB1  1 1 
        102 1 2 1 1 67 VAL MG1  . 67 . HG1* 1 1 
        103 1 1 1 1 11 PRO HB3  . 11 . HB1  1 1 
        103 1 2 1 1 67 VAL MG2  . 67 . HG2* 1 1 
        104 1 1 1 1 11 PRO HD2  . 11 . HD2  1 1 
        104 1 2 1 1 69 ASP H    . 69 . HN   1 1 
        105 1 1 1 1 11 PRO HD2  . 11 . HD2  1 1 
        105 1 2 1 1 69 ASP QB   . 69 . HB*  1 1 
        106 1 1 1 1 11 PRO HD2  . 11 . HD2  1 1 
        106 1 2 1 1 73 HIS QB   . 73 . HB*  1 1 
        107 1 1 1 1 11 PRO HD2  . 11 . HD2  1 1 
        107 1 2 1 1 75 VAL MG1  . 75 . HG1* 1 1 
        108 1 1 1 1 11 PRO HD2  . 11 . HD2  1 1 
        108 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
        109 1 1 1 1 11 PRO HD2  . 11 . HD2  1 1 
        109 1 2 1 1 75 VAL MG2  . 75 . HG2* 1 1 
        110 1 1 1 1 11 PRO HD3  . 11 . HD1  1 1 
        110 1 2 1 1 69 ASP H    . 69 . HN   1 1 
        111 1 1 1 1 11 PRO HD3  . 11 . HD1  1 1 
        111 1 2 1 1 69 ASP QB   . 69 . HB*  1 1 
        112 1 1 1 1 11 PRO HD3  . 11 . HD1  1 1 
        112 1 2 1 1 73 HIS QB   . 73 . HB*  1 1 
        113 1 1 1 1 11 PRO HD3  . 11 . HD1  1 1 
        113 1 2 1 1 75 VAL MG1  . 75 . HG1* 1 1 
        114 1 1 1 1 11 PRO HD3  . 11 . HD1  1 1 
        114 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
        115 1 1 1 1 11 PRO HD3  . 11 . HD1  1 1 
        115 1 2 1 1 75 VAL MG2  . 75 . HG2* 1 1 
        116 1 1 1 1 11 PRO HG2  . 11 . HG2  1 1 
        116 1 2 1 1 67 VAL MG1  . 67 . HG1* 1 1 
        117 1 1 1 1 11 PRO HG2  . 11 . HG2  1 1 
        117 1 2 1 1 69 ASP H    . 69 . HN   1 1 
        118 1 1 1 1 11 PRO HG2  . 11 . HG2  1 1 
        118 1 2 1 1 69 ASP QB   . 69 . HB*  1 1 
        119 1 1 1 1 11 PRO HG2  . 11 . HG2  1 1 
        119 1 2 1 1 75 VAL MG1  . 75 . HG1* 1 1 
        120 1 1 1 1 11 PRO HG2  . 11 . HG2  1 1 
        120 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
        121 1 1 1 1 11 PRO HG2  . 11 . HG2  1 1 
        121 1 2 1 1 75 VAL MG2  . 75 . HG2* 1 1 
        122 1 1 1 1 11 PRO HG3  . 11 . HG1  1 1 
        122 1 2 1 1 37 ASP HB2  . 37 . HB2  1 1 
        123 1 1 1 1 11 PRO HG3  . 11 . HG1  1 1 
        123 1 2 1 1 43 LEU MD1  . 43 . HD1* 1 1 
        124 1 1 1 1 11 PRO HG3  . 11 . HG1  1 1 
        124 1 2 1 1 67 VAL MG1  . 67 . HG1* 1 1 
        125 1 1 1 1 11 PRO HG3  . 11 . HG1  1 1 
        125 1 2 1 1 67 VAL MG2  . 67 . HG2* 1 1 
        126 1 1 1 1 11 PRO HG3  . 11 . HG1  1 1 
        126 1 2 1 1 69 ASP H    . 69 . HN   1 1 
        127 1 1 1 1 11 PRO HG3  . 11 . HG1  1 1 
        127 1 2 1 1 69 ASP HB2  . 69 . HB2  1 1 
        128 1 1 1 1 11 PRO HG3  . 11 . HG1  1 1 
        128 1 2 1 1 69 ASP HB3  . 69 . HB1  1 1 
        129 1 1 1 1 11 PRO HG3  . 11 . HG1  1 1 
        129 1 2 1 1 73 HIS H    . 73 . HN   1 1 
        130 1 1 1 1 11 PRO HG3  . 11 . HG1  1 1 
        130 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
        131 1 1 1 1 12 LYS H    . 12 . HN   1 1 
        131 1 2 1 1 12 LYS HB2  . 12 . HB2  1 1 
        132 1 1 1 1 12 LYS H    . 12 . HN   1 1 
        132 1 2 1 1 12 LYS HB3  . 12 . HB1  1 1 
        133 1 1 1 1 12 LYS H    . 12 . HN   1 1 
        133 1 2 1 1 12 LYS HG2  . 12 . HG2  1 1 
        134 1 1 1 1 12 LYS H    . 12 . HN   1 1 
        134 1 2 1 1 12 LYS QG   . 12 . HG*  1 1 
        135 1 1 1 1 12 LYS H    . 12 . HN   1 1 
        135 1 2 1 1 12 LYS HG3  . 12 . HG1  1 1 
        136 1 1 1 1 12 LYS H    . 12 . HN   1 1 
        136 1 2 1 1 13 LEU H    . 13 . HN   1 1 
        137 1 1 1 1 12 LYS H    . 12 . HN   1 1 
        137 1 2 1 1 35 ALA HA   . 35 . HA   1 1 
        138 1 1 1 1 12 LYS H    . 12 . HN   1 1 
        138 1 2 1 1 35 ALA MB   . 35 . HB*  1 1 
        139 1 1 1 1 12 LYS H    . 12 . HN   1 1 
        139 1 2 1 1 37 ASP HA   . 37 . HA   1 1 
        140 1 1 1 1 12 LYS H    . 12 . HN   1 1 
        140 1 2 1 1 38 LYS H    . 38 . HN   1 1 
        141 1 1 1 1 12 LYS H    . 12 . HN   1 1 
        141 1 2 1 1 43 LEU MD1  . 43 . HD1* 1 1 
        142 1 1 1 1 12 LYS HA   . 12 . HA   1 1 
        142 1 2 1 1 12 LYS QD   . 12 . HD*  1 1 
        143 1 1 1 1 12 LYS HA   . 12 . HA   1 1 
        143 1 2 1 1 12 LYS QG   . 12 . HG*  1 1 
        144 1 1 1 1 12 LYS HA   . 12 . HA   1 1 
        144 1 2 1 1 13 LEU H    . 13 . HN   1 1 
        145 1 1 1 1 12 LYS HA   . 12 . HA   1 1 
        145 1 2 1 1 13 LEU HB2  . 13 . HB2  1 1 
        146 1 1 1 1 12 LYS HA   . 12 . HA   1 1 
        146 1 2 1 1 13 LEU HB3  . 13 . HB1  1 1 
        147 1 1 1 1 12 LYS HA   . 12 . HA   1 1 
        147 1 2 1 1 75 VAL MG1  . 75 . HG1* 1 1 
        148 1 1 1 1 12 LYS HA   . 12 . HA   1 1 
        148 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
        149 1 1 1 1 12 LYS HA   . 12 . HA   1 1 
        149 1 2 1 1 75 VAL MG2  . 75 . HG2* 1 1 
        150 1 1 1 1 12 LYS QB   . 12 . HB*  1 1 
        150 1 2 1 1 12 LYS QD   . 12 . HD*  1 1 
        151 1 1 1 1 12 LYS QB   . 12 . HB*  1 1 
        151 1 2 1 1 13 LEU H    . 13 . HN   1 1 
        152 1 1 1 1 12 LYS HB2  . 12 . HB2  1 1 
        152 1 2 1 1 12 LYS QD   . 12 . HD*  1 1 
        153 1 1 1 1 12 LYS HB2  . 12 . HB2  1 1 
        153 1 2 1 1 13 LEU H    . 13 . HN   1 1 
        154 1 1 1 1 12 LYS HB2  . 12 . HB2  1 1 
        154 1 2 1 1 37 ASP HA   . 37 . HA   1 1 
        155 1 1 1 1 12 LYS HB3  . 12 . HB1  1 1 
        155 1 2 1 1 12 LYS QD   . 12 . HD*  1 1 
        156 1 1 1 1 12 LYS HB3  . 12 . HB1  1 1 
        156 1 2 1 1 13 LEU H    . 13 . HN   1 1 
        157 1 1 1 1 12 LYS HB3  . 12 . HB1  1 1 
        157 1 2 1 1 37 ASP HA   . 37 . HA   1 1 
        158 1 1 1 1 12 LYS QE   . 12 . HE*  1 1 
        158 1 2 1 1 12 LYS HG2  . 12 . HG2  1 1 
        159 1 1 1 1 12 LYS QE   . 12 . HE*  1 1 
        159 1 2 1 1 12 LYS QG   . 12 . HG*  1 1 
        160 1 1 1 1 12 LYS QE   . 12 . HE*  1 1 
        160 1 2 1 1 12 LYS HG3  . 12 . HG1  1 1 
        161 1 1 1 1 12 LYS QG   . 12 . HG*  1 1 
        161 1 2 1 1 13 LEU H    . 13 . HN   1 1 
        162 1 1 1 1 13 LEU H    . 13 . HN   1 1 
        162 1 2 1 1 13 LEU HB2  . 13 . HB2  1 1 
        163 1 1 1 1 13 LEU H    . 13 . HN   1 1 
        163 1 2 1 1 13 LEU HB3  . 13 . HB1  1 1 
        164 1 1 1 1 13 LEU H    . 13 . HN   1 1 
        164 1 2 1 1 13 LEU MD1  . 13 . HD1* 1 1 
        165 1 1 1 1 13 LEU H    . 13 . HN   1 1 
        165 1 2 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        166 1 1 1 1 13 LEU H    . 13 . HN   1 1 
        166 1 2 1 1 13 LEU HG   . 13 . HG   1 1 
        167 1 1 1 1 13 LEU H    . 13 . HN   1 1 
        167 1 2 1 1 14 THR H    . 14 . HN   1 1 
        168 1 1 1 1 13 LEU H    . 13 . HN   1 1 
        168 1 2 1 1 75 VAL MG1  . 75 . HG1* 1 1 
        169 1 1 1 1 13 LEU H    . 13 . HN   1 1 
        169 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
        170 1 1 1 1 13 LEU H    . 13 . HN   1 1 
        170 1 2 1 1 75 VAL MG2  . 75 . HG2* 1 1 
        171 1 1 1 1 13 LEU HA   . 13 . HA   1 1 
        171 1 2 1 1 13 LEU MD1  . 13 . HD1* 1 1 
        172 1 1 1 1 13 LEU HA   . 13 . HA   1 1 
        172 1 2 1 1 14 THR H    . 14 . HN   1 1 
        173 1 1 1 1 13 LEU HA   . 13 . HA   1 1 
        173 1 2 1 1 15 VAL MG2  . 15 . HG2* 1 1 
        174 1 1 1 1 13 LEU HA   . 13 . HA   1 1 
        174 1 2 1 1 33 VAL MG1  . 33 . HG1* 1 1 
        175 1 1 1 1 13 LEU HA   . 13 . HA   1 1 
        175 1 2 1 1 34 LEU H    . 34 . HN   1 1 
        176 1 1 1 1 13 LEU HA   . 13 . HA   1 1 
        176 1 2 1 1 35 ALA HA   . 35 . HA   1 1 
        177 1 1 1 1 13 LEU HA   . 13 . HA   1 1 
        177 1 2 1 1 35 ALA MB   . 35 . HB*  1 1 
        178 1 1 1 1 13 LEU HA   . 13 . HA   1 1 
        178 1 2 1 1 36 ILE H    . 36 . HN   1 1 
        179 1 1 1 1 13 LEU HA   . 13 . HA   1 1 
        179 1 2 1 1 67 VAL MG1  . 67 . HG1* 1 1 
        180 1 1 1 1 13 LEU HA   . 13 . HA   1 1 
        180 1 2 1 1 77 ALA MB   . 77 . HB*  1 1 
        181 1 1 1 1 13 LEU HB2  . 13 . HB2  1 1 
        181 1 2 1 1 14 THR H    . 14 . HN   1 1 
        182 1 1 1 1 13 LEU HB2  . 13 . HB2  1 1 
        182 1 2 1 1 15 VAL MG2  . 15 . HG2* 1 1 
        183 1 1 1 1 13 LEU HB2  . 13 . HB2  1 1 
        183 1 2 1 1 67 VAL MG1  . 67 . HG1* 1 1 
        184 1 1 1 1 13 LEU HB2  . 13 . HB2  1 1 
        184 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
        185 1 1 1 1 13 LEU HB2  . 13 . HB2  1 1 
        185 1 2 1 1 77 ALA MB   . 77 . HB*  1 1 
        186 1 1 1 1 13 LEU HB3  . 13 . HB1  1 1 
        186 1 2 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        187 1 1 1 1 13 LEU HB3  . 13 . HB1  1 1 
        187 1 2 1 1 14 THR H    . 14 . HN   1 1 
        188 1 1 1 1 13 LEU HB3  . 13 . HB1  1 1 
        188 1 2 1 1 14 THR HA   . 14 . HA   1 1 
        189 1 1 1 1 13 LEU HB3  . 13 . HB1  1 1 
        189 1 2 1 1 15 VAL MG2  . 15 . HG2* 1 1 
        190 1 1 1 1 13 LEU HB3  . 13 . HB1  1 1 
        190 1 2 1 1 77 ALA MB   . 77 . HB*  1 1 
        191 1 1 1 1 13 LEU MD1  . 13 . HD1* 1 1 
        191 1 2 1 1 14 THR H    . 14 . HN   1 1 
        192 1 1 1 1 13 LEU MD1  . 13 . HD1* 1 1 
        192 1 2 1 1 14 THR HB   . 14 . HB   1 1 
        193 1 1 1 1 13 LEU MD1  . 13 . HD1* 1 1 
        193 1 2 1 1 15 VAL H    . 15 . HN   1 1 
        194 1 1 1 1 13 LEU MD1  . 13 . HD1* 1 1 
        194 1 2 1 1 34 LEU H    . 34 . HN   1 1 
        195 1 1 1 1 13 LEU MD1  . 13 . HD1* 1 1 
        195 1 2 1 1 35 ALA H    . 35 . HN   1 1 
        196 1 1 1 1 13 LEU MD1  . 13 . HD1* 1 1 
        196 1 2 1 1 35 ALA HA   . 35 . HA   1 1 
        197 1 1 1 1 13 LEU MD1  . 13 . HD1* 1 1 
        197 1 2 1 1 35 ALA MB   . 35 . HB*  1 1 
        198 1 1 1 1 13 LEU MD1  . 13 . HD1* 1 1 
        198 1 2 1 1 36 ILE H    . 36 . HN   1 1 
        199 1 1 1 1 13 LEU MD1  . 13 . HD1* 1 1 
        199 1 2 1 1 47 ILE HA   . 47 . HA   1 1 
        200 1 1 1 1 13 LEU MD1  . 13 . HD1* 1 1 
        200 1 2 1 1 47 ILE HB   . 47 . HB   1 1 
        201 1 1 1 1 13 LEU MD1  . 13 . HD1* 1 1 
        201 1 2 1 1 47 ILE MG   . 47 . HG2* 1 1 
        202 1 1 1 1 13 LEU MD1  . 13 . HD1* 1 1 
        202 1 2 1 1 48 LYS H    . 48 . HN   1 1 
        203 1 1 1 1 13 LEU MD1  . 13 . HD1* 1 1 
        203 1 2 1 1 65 TYR HB2  . 65 . HB2  1 1 
        204 1 1 1 1 13 LEU MD1  . 13 . HD1* 1 1 
        204 1 2 1 1 65 TYR HB3  . 65 . HB1  1 1 
        205 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        205 1 2 1 1 14 THR H    . 14 . HN   1 1 
        206 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        206 1 2 1 1 15 VAL H    . 15 . HN   1 1 
        207 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        207 1 2 1 1 15 VAL HA   . 15 . HA   1 1 
        208 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        208 1 2 1 1 15 VAL HB   . 15 . HB   1 1 
        209 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        209 1 2 1 1 15 VAL MG1  . 15 . HG1* 1 1 
        210 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        210 1 2 1 1 15 VAL MG2  . 15 . HG2* 1 1 
        211 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        211 1 2 1 1 47 ILE MD   . 47 . HD1* 1 1 
        212 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        212 1 2 1 1 65 TYR H    . 65 . HN   1 1 
        213 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        213 1 2 1 1 65 TYR HA   . 65 . HA   1 1 
        214 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        214 1 2 1 1 65 TYR HB2  . 65 . HB2  1 1 
        215 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        215 1 2 1 1 65 TYR HB3  . 65 . HB1  1 1 
        216 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        216 1 2 1 1 65 TYR QD   . 65 . HD*  1 1 
        217 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        217 1 2 1 1 66 THR HA   . 66 . HA   1 1 
        218 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        218 1 2 1 1 67 VAL H    . 67 . HN   1 1 
        219 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        219 1 2 1 1 67 VAL HB   . 67 . HB   1 1 
        220 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        220 1 2 1 1 75 VAL HB   . 75 . HB   1 1 
        221 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        221 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
        222 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        222 1 2 1 1 76 THR H    . 76 . HN   1 1 
        223 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        223 1 2 1 1 76 THR HA   . 76 . HA   1 1 
        224 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        224 1 2 1 1 76 THR HB   . 76 . HB   1 1 
        225 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        225 1 2 1 1 77 ALA H    . 77 . HN   1 1 
        226 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        226 1 2 1 1 77 ALA HA   . 77 . HA   1 1 
        227 1 1 1 1 13 LEU MD2  . 13 . HD2* 1 1 
        227 1 2 1 1 77 ALA MB   . 77 . HB*  1 1 
        228 1 1 1 1 13 LEU HG   . 13 . HG   1 1 
        228 1 2 1 1 14 THR H    . 14 . HN   1 1 
        229 1 1 1 1 13 LEU HG   . 13 . HG   1 1 
        229 1 2 1 1 15 VAL MG1  . 15 . HG1* 1 1 
        230 1 1 1 1 13 LEU HG   . 13 . HG   1 1 
        230 1 2 1 1 15 VAL MG2  . 15 . HG2* 1 1 
        231 1 1 1 1 13 LEU HG   . 13 . HG   1 1 
        231 1 2 1 1 33 VAL MG1  . 33 . HG1* 1 1 
        232 1 1 1 1 13 LEU HG   . 13 . HG   1 1 
        232 1 2 1 1 34 LEU H    . 34 . HN   1 1 
        233 1 1 1 1 14 THR H    . 14 . HN   1 1 
        233 1 2 1 1 14 THR HB   . 14 . HB   1 1 
        234 1 1 1 1 14 THR H    . 14 . HN   1 1 
        234 1 2 1 1 14 THR MG   . 14 . HG2* 1 1 
        235 1 1 1 1 14 THR H    . 14 . HN   1 1 
        235 1 2 1 1 15 VAL H    . 15 . HN   1 1 
        236 1 1 1 1 14 THR H    . 14 . HN   1 1 
        236 1 2 1 1 15 VAL MG2  . 15 . HG2* 1 1 
        237 1 1 1 1 14 THR H    . 14 . HN   1 1 
        237 1 2 1 1 33 VAL HA   . 33 . HA   1 1 
        238 1 1 1 1 14 THR H    . 14 . HN   1 1 
        238 1 2 1 1 34 LEU H    . 34 . HN   1 1 
        239 1 1 1 1 14 THR H    . 14 . HN   1 1 
        239 1 2 1 1 34 LEU HA   . 34 . HA   1 1 
        240 1 1 1 1 14 THR H    . 14 . HN   1 1 
        240 1 2 1 1 34 LEU HB2  . 34 . HB2  1 1 
        241 1 1 1 1 14 THR H    . 14 . HN   1 1 
        241 1 2 1 1 34 LEU HB3  . 34 . HB1  1 1 
        242 1 1 1 1 14 THR H    . 14 . HN   1 1 
        242 1 2 1 1 34 LEU QD   . 34 . HD*  1 1 
        243 1 1 1 1 14 THR H    . 14 . HN   1 1 
        243 1 2 1 1 35 ALA HA   . 35 . HA   1 1 
        244 1 1 1 1 14 THR H    . 14 . HN   1 1 
        244 1 2 1 1 35 ALA MB   . 35 . HB*  1 1 
        245 1 1 1 1 14 THR H    . 14 . HN   1 1 
        245 1 2 1 1 36 ILE H    . 36 . HN   1 1 
        246 1 1 1 1 14 THR H    . 14 . HN   1 1 
        246 1 2 1 1 47 ILE MD   . 47 . HD1* 1 1 
        247 1 1 1 1 14 THR HA   . 14 . HA   1 1 
        247 1 2 1 1 14 THR MG   . 14 . HG2* 1 1 
        248 1 1 1 1 14 THR HA   . 14 . HA   1 1 
        248 1 2 1 1 15 VAL H    . 15 . HN   1 1 
        249 1 1 1 1 14 THR HA   . 14 . HA   1 1 
        249 1 2 1 1 15 VAL HB   . 15 . HB   1 1 
        250 1 1 1 1 14 THR HA   . 14 . HA   1 1 
        250 1 2 1 1 34 LEU H    . 34 . HN   1 1 
        251 1 1 1 1 14 THR HB   . 14 . HB   1 1 
        251 1 2 1 1 15 VAL H    . 15 . HN   1 1 
        252 1 1 1 1 14 THR HB   . 14 . HB   1 1 
        252 1 2 1 1 33 VAL HA   . 33 . HA   1 1 
        253 1 1 1 1 14 THR HB   . 14 . HB   1 1 
        253 1 2 1 1 34 LEU H    . 34 . HN   1 1 
        254 1 1 1 1 14 THR HB   . 14 . HB   1 1 
        254 1 2 1 1 34 LEU HA   . 34 . HA   1 1 
        255 1 1 1 1 14 THR HB   . 14 . HB   1 1 
        255 1 2 1 1 34 LEU HB2  . 34 . HB2  1 1 
        256 1 1 1 1 14 THR HB   . 14 . HB   1 1 
        256 1 2 1 1 34 LEU HB3  . 34 . HB1  1 1 
        257 1 1 1 1 14 THR HB   . 14 . HB   1 1 
        257 1 2 1 1 34 LEU MD1  . 34 . HD1* 1 1 
        258 1 1 1 1 14 THR HB   . 14 . HB   1 1 
        258 1 2 1 1 34 LEU QD   . 34 . HD*  1 1 
        259 1 1 1 1 14 THR HB   . 14 . HB   1 1 
        259 1 2 1 1 34 LEU MD2  . 34 . HD2* 1 1 
        260 1 1 1 1 14 THR HB   . 14 . HB   1 1 
        260 1 2 1 1 34 LEU HG   . 34 . HG   1 1 
        261 1 1 1 1 14 THR MG   . 14 . HG2* 1 1 
        261 1 2 1 1 15 VAL H    . 15 . HN   1 1 
        262 1 1 1 1 14 THR MG   . 14 . HG2* 1 1 
        262 1 2 1 1 34 LEU H    . 34 . HN   1 1 
        263 1 1 1 1 15 VAL H    . 15 . HN   1 1 
        263 1 2 1 1 15 VAL HB   . 15 . HB   1 1 
        264 1 1 1 1 15 VAL H    . 15 . HN   1 1 
        264 1 2 1 1 15 VAL MG1  . 15 . HG1* 1 1 
        265 1 1 1 1 15 VAL H    . 15 . HN   1 1 
        265 1 2 1 1 15 VAL MG2  . 15 . HG2* 1 1 
        266 1 1 1 1 15 VAL H    . 15 . HN   1 1 
        266 1 2 1 1 16 PRO HD2  . 16 . HD2  1 1 
        267 1 1 1 1 15 VAL H    . 15 . HN   1 1 
        267 1 2 1 1 16 PRO HD3  . 16 . HD1  1 1 
        268 1 1 1 1 15 VAL H    . 15 . HN   1 1 
        268 1 2 1 1 77 ALA MB   . 77 . HB*  1 1 
        269 1 1 1 1 15 VAL HA   . 15 . HA   1 1 
        269 1 2 1 1 16 PRO HD2  . 16 . HD2  1 1 
        270 1 1 1 1 15 VAL HA   . 15 . HA   1 1 
        270 1 2 1 1 16 PRO HD3  . 16 . HD1  1 1 
        271 1 1 1 1 15 VAL HA   . 15 . HA   1 1 
        271 1 2 1 1 16 PRO HG2  . 16 . HG2  1 1 
        272 1 1 1 1 15 VAL HA   . 15 . HA   1 1 
        272 1 2 1 1 16 PRO HG3  . 16 . HG1  1 1 
        273 1 1 1 1 15 VAL HA   . 15 . HA   1 1 
        273 1 2 1 1 33 VAL MG1  . 33 . HG1* 1 1 
        274 1 1 1 1 15 VAL HA   . 15 . HA   1 1 
        274 1 2 1 1 33 VAL MG2  . 33 . HG2* 1 1 
        275 1 1 1 1 15 VAL HA   . 15 . HA   1 1 
        275 1 2 1 1 34 LEU H    . 34 . HN   1 1 
        276 1 1 1 1 15 VAL HA   . 15 . HA   1 1 
        276 1 2 1 1 77 ALA MB   . 77 . HB*  1 1 
        277 1 1 1 1 15 VAL HA   . 15 . HA   1 1 
        277 1 2 1 1 79 GLN HB2  . 79 . HB2  1 1 
        278 1 1 1 1 15 VAL HB   . 15 . HB   1 1 
        278 1 2 1 1 16 PRO HD2  . 16 . HD2  1 1 
        279 1 1 1 1 15 VAL HB   . 15 . HB   1 1 
        279 1 2 1 1 16 PRO HD3  . 16 . HD1  1 1 
        280 1 1 1 1 15 VAL HB   . 15 . HB   1 1 
        280 1 2 1 1 33 VAL MG1  . 33 . HG1* 1 1 
        281 1 1 1 1 15 VAL HB   . 15 . HB   1 1 
        281 1 2 1 1 33 VAL MG2  . 33 . HG2* 1 1 
        282 1 1 1 1 15 VAL HB   . 15 . HB   1 1 
        282 1 2 1 1 65 TYR QD   . 65 . HD*  1 1 
        283 1 1 1 1 15 VAL MG1  . 15 . HG1* 1 1 
        283 1 2 1 1 16 PRO QB   . 16 . HB*  1 1 
        284 1 1 1 1 15 VAL MG1  . 15 . HG1* 1 1 
        284 1 2 1 1 16 PRO HD2  . 16 . HD2  1 1 
        285 1 1 1 1 15 VAL MG1  . 15 . HG1* 1 1 
        285 1 2 1 1 16 PRO HD3  . 16 . HD1  1 1 
        286 1 1 1 1 15 VAL MG1  . 15 . HG1* 1 1 
        286 1 2 1 1 16 PRO HG2  . 16 . HG2  1 1 
        287 1 1 1 1 15 VAL MG1  . 15 . HG1* 1 1 
        287 1 2 1 1 33 VAL HA   . 33 . HA   1 1 
        288 1 1 1 1 15 VAL MG1  . 15 . HG1* 1 1 
        288 1 2 1 1 33 VAL MG1  . 33 . HG1* 1 1 
        289 1 1 1 1 15 VAL MG1  . 15 . HG1* 1 1 
        289 1 2 1 1 33 VAL MG2  . 33 . HG2* 1 1 
        290 1 1 1 1 15 VAL MG1  . 15 . HG1* 1 1 
        290 1 2 1 1 34 LEU H    . 34 . HN   1 1 
        291 1 1 1 1 15 VAL MG1  . 15 . HG1* 1 1 
        291 1 2 1 1 65 TYR QD   . 65 . HD*  1 1 
        292 1 1 1 1 15 VAL MG1  . 15 . HG1* 1 1 
        292 1 2 1 1 65 TYR QE   . 65 . HE*  1 1 
        293 1 1 1 1 15 VAL MG1  . 15 . HG1* 1 1 
        293 1 2 1 1 77 ALA HA   . 77 . HA   1 1 
        294 1 1 1 1 15 VAL MG1  . 15 . HG1* 1 1 
        294 1 2 1 1 77 ALA MB   . 77 . HB*  1 1 
        295 1 1 1 1 15 VAL MG1  . 15 . HG1* 1 1 
        295 1 2 1 1 79 GLN H    . 79 . HN   1 1 
        296 1 1 1 1 15 VAL MG1  . 15 . HG1* 1 1 
        296 1 2 1 1 79 GLN HA   . 79 . HA   1 1 
        297 1 1 1 1 15 VAL MG1  . 15 . HG1* 1 1 
        297 1 2 1 1 79 GLN HB2  . 79 . HB2  1 1 
        298 1 1 1 1 15 VAL MG1  . 15 . HG1* 1 1 
        298 1 2 1 1 79 GLN HE21 . 79 . HE21 1 1 
        299 1 1 1 1 15 VAL MG1  . 15 . HG1* 1 1 
        299 1 2 1 1 79 GLN HE22 . 79 . HE22 1 1 
        300 1 1 1 1 15 VAL MG2  . 15 . HG2* 1 1 
        300 1 2 1 1 16 PRO HD2  . 16 . HD2  1 1 
        301 1 1 1 1 15 VAL MG2  . 15 . HG2* 1 1 
        301 1 2 1 1 16 PRO HD3  . 16 . HD1  1 1 
        302 1 1 1 1 15 VAL MG2  . 15 . HG2* 1 1 
        302 1 2 1 1 33 VAL HA   . 33 . HA   1 1 
        303 1 1 1 1 15 VAL MG2  . 15 . HG2* 1 1 
        303 1 2 1 1 33 VAL MG1  . 33 . HG1* 1 1 
        304 1 1 1 1 15 VAL MG2  . 15 . HG2* 1 1 
        304 1 2 1 1 33 VAL MG2  . 33 . HG2* 1 1 
        305 1 1 1 1 15 VAL MG2  . 15 . HG2* 1 1 
        305 1 2 1 1 34 LEU H    . 34 . HN   1 1 
        306 1 1 1 1 15 VAL MG2  . 15 . HG2* 1 1 
        306 1 2 1 1 65 TYR HB2  . 65 . HB2  1 1 
        307 1 1 1 1 15 VAL MG2  . 15 . HG2* 1 1 
        307 1 2 1 1 65 TYR HB3  . 65 . HB1  1 1 
        308 1 1 1 1 15 VAL MG2  . 15 . HG2* 1 1 
        308 1 2 1 1 65 TYR QD   . 65 . HD*  1 1 
        309 1 1 1 1 15 VAL MG2  . 15 . HG2* 1 1 
        309 1 2 1 1 77 ALA H    . 77 . HN   1 1 
        310 1 1 1 1 15 VAL MG2  . 15 . HG2* 1 1 
        310 1 2 1 1 77 ALA MB   . 77 . HB*  1 1 
        311 1 1 1 1 15 VAL MG2  . 15 . HG2* 1 1 
        311 1 2 1 1 79 GLN H    . 79 . HN   1 1 
        312 1 1 1 1 15 VAL MG2  . 15 . HG2* 1 1 
        312 1 2 1 1 79 GLN HB2  . 79 . HB2  1 1 
        313 1 1 1 1 16 PRO HA   . 16 . HA   1 1 
        313 1 2 1 1 17 VAL H    . 17 . HN   1 1 
        314 1 1 1 1 16 PRO HA   . 16 . HA   1 1 
        314 1 2 1 1 17 VAL HB   . 17 . HB   1 1 
        315 1 1 1 1 16 PRO HA   . 16 . HA   1 1 
        315 1 2 1 1 17 VAL MG1  . 17 . HG1* 1 1 
        316 1 1 1 1 16 PRO HA   . 16 . HA   1 1 
        316 1 2 1 1 18 GLY H    . 18 . HN   1 1 
        317 1 1 1 1 16 PRO QB   . 16 . HB*  1 1 
        317 1 2 1 1 17 VAL H    . 17 . HN   1 1 
        318 1 1 1 1 16 PRO HB2  . 16 . HB2  1 1 
        318 1 2 1 1 17 VAL H    . 17 . HN   1 1 
        319 1 1 1 1 16 PRO HB2  . 16 . HB2  1 1 
        319 1 2 1 1 18 GLY H    . 18 . HN   1 1 
        320 1 1 1 1 16 PRO HB3  . 16 . HB1  1 1 
        320 1 2 1 1 17 VAL H    . 17 . HN   1 1 
        321 1 1 1 1 16 PRO HB3  . 16 . HB1  1 1 
        321 1 2 1 1 18 GLY H    . 18 . HN   1 1 
        322 1 1 1 1 16 PRO HD2  . 16 . HD2  1 1 
        322 1 2 1 1 33 VAL MG2  . 33 . HG2* 1 1 
        323 1 1 1 1 16 PRO HD2  . 16 . HD2  1 1 
        323 1 2 1 1 65 TYR QE   . 65 . HE*  1 1 
        324 1 1 1 1 16 PRO HD2  . 16 . HD2  1 1 
        324 1 2 1 1 79 GLN HB2  . 79 . HB2  1 1 
        325 1 1 1 1 16 PRO HD2  . 16 . HD2  1 1 
        325 1 2 1 1 79 GLN HE21 . 79 . HE21 1 1 
        326 1 1 1 1 16 PRO HD3  . 16 . HD1  1 1 
        326 1 2 1 1 33 VAL MG2  . 33 . HG2* 1 1 
        327 1 1 1 1 16 PRO HD3  . 16 . HD1  1 1 
        327 1 2 1 1 79 GLN HB2  . 79 . HB2  1 1 
        328 1 1 1 1 16 PRO HD3  . 16 . HD1  1 1 
        328 1 2 1 1 79 GLN HE21 . 79 . HE21 1 1 
        329 1 1 1 1 16 PRO HG2  . 16 . HG2  1 1 
        329 1 2 1 1 17 VAL H    . 17 . HN   1 1 
        330 1 1 1 1 16 PRO HG2  . 16 . HG2  1 1 
        330 1 2 1 1 18 GLY H    . 18 . HN   1 1 
        331 1 1 1 1 16 PRO HG2  . 16 . HG2  1 1 
        331 1 2 1 1 79 GLN HA   . 79 . HA   1 1 
        332 1 1 1 1 16 PRO HG2  . 16 . HG2  1 1 
        332 1 2 1 1 79 GLN HE22 . 79 . HE22 1 1 
        333 1 1 1 1 16 PRO HG3  . 16 . HG1  1 1 
        333 1 2 1 1 79 GLN HE21 . 79 . HE21 1 1 
        334 1 1 1 1 16 PRO HG3  . 16 . HG1  1 1 
        334 1 2 1 1 79 GLN HE22 . 79 . HE22 1 1 
        335 1 1 1 1 17 VAL H    . 17 . HN   1 1 
        335 1 2 1 1 17 VAL HB   . 17 . HB   1 1 
        336 1 1 1 1 17 VAL H    . 17 . HN   1 1 
        336 1 2 1 1 17 VAL MG1  . 17 . HG1* 1 1 
        337 1 1 1 1 17 VAL H    . 17 . HN   1 1 
        337 1 2 1 1 17 VAL MG2  . 17 . HG2* 1 1 
        338 1 1 1 1 17 VAL H    . 17 . HN   1 1 
        338 1 2 1 1 18 GLY H    . 18 . HN   1 1 
        339 1 1 1 1 17 VAL HA   . 17 . HA   1 1 
        339 1 2 1 1 17 VAL MG1  . 17 . HG1* 1 1 
        340 1 1 1 1 17 VAL HA   . 17 . HA   1 1 
        340 1 2 1 1 17 VAL MG2  . 17 . HG2* 1 1 
        341 1 1 1 1 17 VAL HA   . 17 . HA   1 1 
        341 1 2 1 1 79 GLN HA   . 79 . HA   1 1 
        342 1 1 1 1 17 VAL HA   . 17 . HA   1 1 
        342 1 2 1 1 80 THR H    . 80 . HN   1 1 
        343 1 1 1 1 17 VAL HB   . 17 . HB   1 1 
        343 1 2 1 1 18 GLY H    . 18 . HN   1 1 
        344 1 1 1 1 17 VAL MG1  . 17 . HG1* 1 1 
        344 1 2 1 1 18 GLY H    . 18 . HN   1 1 
        345 1 1 1 1 17 VAL MG1  . 17 . HG1* 1 1 
        345 1 2 1 1 18 GLY HA3  . 18 . HA1  1 1 
        346 1 1 1 1 17 VAL MG1  . 17 . HG1* 1 1 
        346 1 2 1 1 19 ALA H    . 19 . HN   1 1 
        347 1 1 1 1 17 VAL MG2  . 17 . HG2* 1 1 
        347 1 2 1 1 18 GLY H    . 18 . HN   1 1 
        348 1 1 1 1 18 GLY H    . 18 . HN   1 1 
        348 1 2 1 1 19 ALA H    . 19 . HN   1 1 
        349 1 1 1 1 18 GLY H    . 18 . HN   1 1 
        349 1 2 1 1 19 ALA MB   . 19 . HB*  1 1 
        350 1 1 1 1 18 GLY H    . 18 . HN   1 1 
        350 1 2 1 1 80 THR H    . 80 . HN   1 1 
        351 1 1 1 1 18 GLY HA2  . 18 . HA2  1 1 
        351 1 2 1 1 19 ALA H    . 19 . HN   1 1 
        352 1 1 1 1 18 GLY HA2  . 18 . HA2  1 1 
        352 1 2 1 1 19 ALA MB   . 19 . HB*  1 1 
        353 1 1 1 1 18 GLY HA2  . 18 . HA2  1 1 
        353 1 2 1 1 79 GLN HG2  . 79 . HG2  1 1 
        354 1 1 1 1 18 GLY HA2  . 18 . HA2  1 1 
        354 1 2 1 1 79 GLN HG3  . 79 . HG1  1 1 
        355 1 1 1 1 18 GLY HA2  . 18 . HA2  1 1 
        355 1 2 1 1 80 THR H    . 80 . HN   1 1 
        356 1 1 1 1 18 GLY HA2  . 18 . HA2  1 1 
        356 1 2 1 1 80 THR MG   . 80 . HG2* 1 1 
        357 1 1 1 1 18 GLY HA3  . 18 . HA1  1 1 
        357 1 2 1 1 19 ALA H    . 19 . HN   1 1 
        358 1 1 1 1 18 GLY HA3  . 18 . HA1  1 1 
        358 1 2 1 1 79 GLN HG3  . 79 . HG1  1 1 
        359 1 1 1 1 18 GLY HA3  . 18 . HA1  1 1 
        359 1 2 1 1 80 THR H    . 80 . HN   1 1 
        360 1 1 1 1 19 ALA H    . 19 . HN   1 1 
        360 1 2 1 1 19 ALA MB   . 19 . HB*  1 1 
        361 1 1 1 1 19 ALA H    . 19 . HN   1 1 
        361 1 2 1 1 20 THR H    . 20 . HN   1 1 
        362 1 1 1 1 19 ALA H    . 19 . HN   1 1 
        362 1 2 1 1 79 GLN HG2  . 79 . HG2  1 1 
        363 1 1 1 1 19 ALA H    . 19 . HN   1 1 
        363 1 2 1 1 79 GLN HG3  . 79 . HG1  1 1 
        364 1 1 1 1 19 ALA H    . 19 . HN   1 1 
        364 1 2 1 1 80 THR H    . 80 . HN   1 1 
        365 1 1 1 1 19 ALA H    . 19 . HN   1 1 
        365 1 2 1 1 80 THR MG   . 80 . HG2* 1 1 
        366 1 1 1 1 19 ALA H    . 19 . HN   1 1 
        366 1 2 1 1 81 VAL HA   . 81 . HA   1 1 
        367 1 1 1 1 19 ALA H    . 19 . HN   1 1 
        367 1 2 1 1 81 VAL MG1  . 81 . HG1* 1 1 
        368 1 1 1 1 19 ALA H    . 19 . HN   1 1 
        368 1 2 1 1 81 VAL MG2  . 81 . HG2* 1 1 
        369 1 1 1 1 19 ALA H    . 19 . HN   1 1 
        369 1 2 1 1 82 THR H    . 82 . HN   1 1 
        370 1 1 1 1 19 ALA HA   . 19 . HA   1 1 
        370 1 2 1 1 20 THR H    . 20 . HN   1 1 
        371 1 1 1 1 19 ALA HA   . 19 . HA   1 1 
        371 1 2 1 1 20 THR HB   . 20 . HB   1 1 
        372 1 1 1 1 19 ALA MB   . 19 . HB*  1 1 
        372 1 2 1 1 20 THR H    . 20 . HN   1 1 
        373 1 1 1 1 19 ALA MB   . 19 . HB*  1 1 
        373 1 2 1 1 20 THR HA   . 20 . HA   1 1 
        374 1 1 1 1 19 ALA MB   . 19 . HB*  1 1 
        374 1 2 1 1 20 THR HB   . 20 . HB   1 1 
        375 1 1 1 1 19 ALA MB   . 19 . HB*  1 1 
        375 1 2 1 1 21 ILE H    . 21 . HN   1 1 
        376 1 1 1 1 19 ALA MB   . 19 . HB*  1 1 
        376 1 2 1 1 21 ILE MD   . 21 . HD1* 1 1 
        377 1 1 1 1 19 ALA MB   . 19 . HB*  1 1 
        377 1 2 1 1 21 ILE MG   . 21 . HG2* 1 1 
        378 1 1 1 1 19 ALA MB   . 19 . HB*  1 1 
        378 1 2 1 1 27 PHE QE   . 27 . HE*  1 1 
        379 1 1 1 1 19 ALA MB   . 19 . HB*  1 1 
        379 1 2 1 1 81 VAL MG1  . 81 . HG1* 1 1 
        380 1 1 1 1 19 ALA MB   . 19 . HB*  1 1 
        380 1 2 1 1 81 VAL MG2  . 81 . HG2* 1 1 
        381 1 1 1 1 19 ALA MB   . 19 . HB*  1 1 
        381 1 2 1 1 82 THR H    . 82 . HN   1 1 
        382 1 1 1 1 20 THR H    . 20 . HN   1 1 
        382 1 2 1 1 20 THR HB   . 20 . HB   1 1 
        383 1 1 1 1 20 THR H    . 20 . HN   1 1 
        383 1 2 1 1 20 THR MG   . 20 . HG2* 1 1 
        384 1 1 1 1 20 THR H    . 20 . HN   1 1 
        384 1 2 1 1 21 ILE H    . 21 . HN   1 1 
        385 1 1 1 1 20 THR H    . 20 . HN   1 1 
        385 1 2 1 1 21 ILE MG   . 21 . HG2* 1 1 
        386 1 1 1 1 20 THR HA   . 20 . HA   1 1 
        386 1 2 1 1 20 THR MG   . 20 . HG2* 1 1 
        387 1 1 1 1 20 THR HA   . 20 . HA   1 1 
        387 1 2 1 1 21 ILE H    . 21 . HN   1 1 
        388 1 1 1 1 20 THR HA   . 20 . HA   1 1 
        388 1 2 1 1 81 VAL MG1  . 81 . HG1* 1 1 
        389 1 1 1 1 20 THR HA   . 20 . HA   1 1 
        389 1 2 1 1 82 THR H    . 82 . HN   1 1 
        390 1 1 1 1 20 THR HA   . 20 . HA   1 1 
        390 1 2 1 1 82 THR HB   . 82 . HB   1 1 
        391 1 1 1 1 20 THR HA   . 20 . HA   1 1 
        391 1 2 1 1 82 THR MG   . 82 . HG2* 1 1 
        392 1 1 1 1 20 THR HB   . 20 . HB   1 1 
        392 1 2 1 1 21 ILE H    . 21 . HN   1 1 
        393 1 1 1 1 20 THR HB   . 20 . HB   1 1 
        393 1 2 1 1 84 LYS QD   . 84 . HD*  1 1 
        394 1 1 1 1 20 THR MG   . 20 . HG2* 1 1 
        394 1 2 1 1 21 ILE H    . 21 . HN   1 1 
        395 1 1 1 1 20 THR MG   . 20 . HG2* 1 1 
        395 1 2 1 1 82 THR H    . 82 . HN   1 1 
        396 1 1 1 1 20 THR MG   . 20 . HG2* 1 1 
        396 1 2 1 1 82 THR HB   . 82 . HB   1 1 
        397 1 1 1 1 20 THR MG   . 20 . HG2* 1 1 
        397 1 2 1 1 84 LYS H    . 84 . HN   1 1 
        398 1 1 1 1 20 THR MG   . 20 . HG2* 1 1 
        398 1 2 1 1 84 LYS HB2  . 84 . HB2  1 1 
        399 1 1 1 1 20 THR MG   . 20 . HG2* 1 1 
        399 1 2 1 1 84 LYS QB   . 84 . HB*  1 1 
        400 1 1 1 1 20 THR MG   . 20 . HG2* 1 1 
        400 1 2 1 1 84 LYS HB3  . 84 . HB1  1 1 
        401 1 1 1 1 20 THR MG   . 20 . HG2* 1 1 
        401 1 2 1 1 84 LYS QD   . 84 . HD*  1 1 
        402 1 1 1 1 20 THR MG   . 20 . HG2* 1 1 
        402 1 2 1 1 84 LYS QE   . 84 . HE*  1 1 
        403 1 1 1 1 21 ILE H    . 21 . HN   1 1 
        403 1 2 1 1 21 ILE MD   . 21 . HD1* 1 1 
        404 1 1 1 1 21 ILE H    . 21 . HN   1 1 
        404 1 2 1 1 21 ILE HG12 . 21 . HG12 1 1 
        405 1 1 1 1 21 ILE H    . 21 . HN   1 1 
        405 1 2 1 1 21 ILE QG   . 21 . HG1* 1 1 
        406 1 1 1 1 21 ILE H    . 21 . HN   1 1 
        406 1 2 1 1 21 ILE HG13 . 21 . HG11 1 1 
        407 1 1 1 1 21 ILE H    . 21 . HN   1 1 
        407 1 2 1 1 81 VAL MG1  . 81 . HG1* 1 1 
        408 1 1 1 1 21 ILE H    . 21 . HN   1 1 
        408 1 2 1 1 82 THR HB   . 82 . HB   1 1 
        409 1 1 1 1 21 ILE H    . 21 . HN   1 1 
        409 1 2 1 1 83 VAL H    . 83 . HN   1 1 
        410 1 1 1 1 21 ILE H    . 21 . HN   1 1 
        410 1 2 1 1 83 VAL HA   . 83 . HA   1 1 
        411 1 1 1 1 21 ILE H    . 21 . HN   1 1 
        411 1 2 1 1 83 VAL MG2  . 83 . HG2* 1 1 
        412 1 1 1 1 21 ILE H    . 21 . HN   1 1 
        412 1 2 1 1 84 LYS H    . 84 . HN   1 1 
        413 1 1 1 1 21 ILE H    . 21 . HN   1 1 
        413 1 2 1 1 84 LYS QD   . 84 . HD*  1 1 
        414 1 1 1 1 21 ILE H    . 21 . HN   1 1 
        414 1 2 1 1 84 LYS QG   . 84 . HG*  1 1 
        415 1 1 1 1 21 ILE HA   . 21 . HA   1 1 
        415 1 2 1 1 21 ILE MD   . 21 . HD1* 1 1 
        416 1 1 1 1 21 ILE HA   . 21 . HA   1 1 
        416 1 2 1 1 21 ILE MG   . 21 . HG2* 1 1 
        417 1 1 1 1 21 ILE HA   . 21 . HA   1 1 
        417 1 2 1 1 22 HIS H    . 22 . HN   1 1 
        418 1 1 1 1 21 ILE HB   . 21 . HB   1 1 
        418 1 2 1 1 22 HIS H    . 22 . HN   1 1 
        419 1 1 1 1 21 ILE HB   . 21 . HB   1 1 
        419 1 2 1 1 25 ASP H    . 25 . HN   1 1 
        420 1 1 1 1 21 ILE HB   . 21 . HB   1 1 
        420 1 2 1 1 25 ASP QB   . 25 . HB*  1 1 
        421 1 1 1 1 21 ILE HB   . 21 . HB   1 1 
        421 1 2 1 1 26 SER H    . 26 . HN   1 1 
        422 1 1 1 1 21 ILE MD   . 21 . HD1* 1 1 
        422 1 2 1 1 21 ILE MG   . 21 . HG2* 1 1 
        423 1 1 1 1 21 ILE MD   . 21 . HD1* 1 1 
        423 1 2 1 1 22 HIS H    . 22 . HN   1 1 
        424 1 1 1 1 21 ILE MD   . 21 . HD1* 1 1 
        424 1 2 1 1 25 ASP H    . 25 . HN   1 1 
        425 1 1 1 1 21 ILE MD   . 21 . HD1* 1 1 
        425 1 2 1 1 25 ASP HB2  . 25 . HB2  1 1 
        426 1 1 1 1 21 ILE MD   . 21 . HD1* 1 1 
        426 1 2 1 1 25 ASP QB   . 25 . HB*  1 1 
        427 1 1 1 1 21 ILE MD   . 21 . HD1* 1 1 
        427 1 2 1 1 25 ASP HB3  . 25 . HB1  1 1 
        428 1 1 1 1 21 ILE MD   . 21 . HD1* 1 1 
        428 1 2 1 1 26 SER H    . 26 . HN   1 1 
        429 1 1 1 1 21 ILE MD   . 21 . HD1* 1 1 
        429 1 2 1 1 27 PHE H    . 27 . HN   1 1 
        430 1 1 1 1 21 ILE MD   . 21 . HD1* 1 1 
        430 1 2 1 1 27 PHE HA   . 27 . HA   1 1 
        431 1 1 1 1 21 ILE MD   . 21 . HD1* 1 1 
        431 1 2 1 1 27 PHE HB2  . 27 . HB2  1 1 
        432 1 1 1 1 21 ILE MD   . 21 . HD1* 1 1 
        432 1 2 1 1 27 PHE QB   . 27 . HB*  1 1 
        433 1 1 1 1 21 ILE MD   . 21 . HD1* 1 1 
        433 1 2 1 1 27 PHE HB3  . 27 . HB1  1 1 
        434 1 1 1 1 21 ILE MD   . 21 . HD1* 1 1 
        434 1 2 1 1 27 PHE QD   . 27 . HD*  1 1 
        435 1 1 1 1 21 ILE MD   . 21 . HD1* 1 1 
        435 1 2 1 1 27 PHE QE   . 27 . HE*  1 1 
        436 1 1 1 1 21 ILE MD   . 21 . HD1* 1 1 
        436 1 2 1 1 53 VAL MG1  . 53 . HG1* 1 1 
        437 1 1 1 1 21 ILE MD   . 21 . HD1* 1 1 
        437 1 2 1 1 55 THR HA   . 55 . HA   1 1 
        438 1 1 1 1 21 ILE MD   . 21 . HD1* 1 1 
        438 1 2 1 1 55 THR MG   . 55 . HG2* 1 1 
        439 1 1 1 1 21 ILE MD   . 21 . HD1* 1 1 
        439 1 2 1 1 81 VAL MG1  . 81 . HG1* 1 1 
        440 1 1 1 1 21 ILE MD   . 21 . HD1* 1 1 
        440 1 2 1 1 83 VAL HA   . 83 . HA   1 1 
        441 1 1 1 1 21 ILE QG   . 21 . HG1* 1 1 
        441 1 2 1 1 81 VAL MG1  . 81 . HG1* 1 1 
        442 1 1 1 1 21 ILE QG   . 21 . HG1* 1 1 
        442 1 2 1 1 83 VAL HA   . 83 . HA   1 1 
        443 1 1 1 1 21 ILE QG   . 21 . HG1* 1 1 
        443 1 2 1 1 83 VAL MG1  . 83 . HG1* 1 1 
        444 1 1 1 1 21 ILE QG   . 21 . HG1* 1 1 
        444 1 2 1 1 83 VAL MG2  . 83 . HG2* 1 1 
        445 1 1 1 1 21 ILE QG   . 21 . HG1* 1 1 
        445 1 2 1 1 84 LYS H    . 84 . HN   1 1 
        446 1 1 1 1 21 ILE HG12 . 21 . HG12 1 1 
        446 1 2 1 1 81 VAL MG1  . 81 . HG1* 1 1 
        447 1 1 1 1 21 ILE HG12 . 21 . HG12 1 1 
        447 1 2 1 1 83 VAL HA   . 83 . HA   1 1 
        448 1 1 1 1 21 ILE HG13 . 21 . HG11 1 1 
        448 1 2 1 1 81 VAL MG1  . 81 . HG1* 1 1 
        449 1 1 1 1 21 ILE HG13 . 21 . HG11 1 1 
        449 1 2 1 1 83 VAL HA   . 83 . HA   1 1 
        450 1 1 1 1 21 ILE MG   . 21 . HG2* 1 1 
        450 1 2 1 1 22 HIS H    . 22 . HN   1 1 
        451 1 1 1 1 21 ILE MG   . 21 . HG2* 1 1 
        451 1 2 1 1 25 ASP HB2  . 25 . HB2  1 1 
        452 1 1 1 1 21 ILE MG   . 21 . HG2* 1 1 
        452 1 2 1 1 25 ASP QB   . 25 . HB*  1 1 
        453 1 1 1 1 21 ILE MG   . 21 . HG2* 1 1 
        453 1 2 1 1 25 ASP HB3  . 25 . HB1  1 1 
        454 1 1 1 1 21 ILE MG   . 21 . HG2* 1 1 
        454 1 2 1 1 27 PHE QD   . 27 . HD*  1 1 
        455 1 1 1 1 21 ILE MG   . 21 . HG2* 1 1 
        455 1 2 1 1 27 PHE QE   . 27 . HE*  1 1 
        456 1 1 1 1 21 ILE MG   . 21 . HG2* 1 1 
        456 1 2 1 1 81 VAL MG1  . 81 . HG1* 1 1 
        457 1 1 1 1 22 HIS H    . 22 . HN   1 1 
        457 1 2 1 1 22 HIS HB2  . 22 . HB2  1 1 
        458 1 1 1 1 22 HIS H    . 22 . HN   1 1 
        458 1 2 1 1 22 HIS QB   . 22 . HB*  1 1 
        459 1 1 1 1 22 HIS H    . 22 . HN   1 1 
        459 1 2 1 1 22 HIS HB3  . 22 . HB1  1 1 
        460 1 1 1 1 22 HIS H    . 22 . HN   1 1 
        460 1 2 1 1 23 VAL H    . 23 . HN   1 1 
        461 1 1 1 1 22 HIS H    . 22 . HN   1 1 
        461 1 2 1 1 25 ASP H    . 25 . HN   1 1 
        462 1 1 1 1 22 HIS H    . 22 . HN   1 1 
        462 1 2 1 1 25 ASP QB   . 25 . HB*  1 1 
        463 1 1 1 1 22 HIS HA   . 22 . HA   1 1 
        463 1 2 1 1 22 HIS HD2  . 22 . HD2  1 1 
        464 1 1 1 1 22 HIS HA   . 22 . HA   1 1 
        464 1 2 1 1 23 VAL H    . 23 . HN   1 1 
        465 1 1 1 1 22 HIS HA   . 22 . HA   1 1 
        465 1 2 1 1 23 VAL HB   . 23 . HB   1 1 
        466 1 1 1 1 22 HIS HA   . 22 . HA   1 1 
        466 1 2 1 1 23 VAL MG2  . 23 . HG2* 1 1 
        467 1 1 1 1 22 HIS HA   . 22 . HA   1 1 
        467 1 2 1 1 83 VAL HA   . 83 . HA   1 1 
        468 1 1 1 1 22 HIS HA   . 22 . HA   1 1 
        468 1 2 1 1 83 VAL MG1  . 83 . HG1* 1 1 
        469 1 1 1 1 22 HIS HA   . 22 . HA   1 1 
        469 1 2 1 1 84 LYS H    . 84 . HN   1 1 
        470 1 1 1 1 22 HIS HA   . 22 . HA   1 1 
        470 1 2 1 1 84 LYS QB   . 84 . HB*  1 1 
        471 1 1 1 1 22 HIS QB   . 22 . HB*  1 1 
        471 1 2 1 1 23 VAL H    . 23 . HN   1 1 
        472 1 1 1 1 22 HIS HB2  . 22 . HB2  1 1 
        472 1 2 1 1 23 VAL H    . 23 . HN   1 1 
        473 1 1 1 1 22 HIS HB3  . 22 . HB1  1 1 
        473 1 2 1 1 23 VAL H    . 23 . HN   1 1 
        474 1 1 1 1 22 HIS HD2  . 22 . HD2  1 1 
        474 1 2 1 1 23 VAL H    . 23 . HN   1 1 
        475 1 1 1 1 22 HIS HD2  . 22 . HD2  1 1 
        475 1 2 1 1 84 LYS HA   . 84 . HA   1 1 
        476 1 1 1 1 22 HIS HD2  . 22 . HD2  1 1 
        476 1 2 1 1 84 LYS QB   . 84 . HB*  1 1 
        477 1 1 1 1 22 HIS HD2  . 22 . HD2  1 1 
        477 1 2 1 1 84 LYS QD   . 84 . HD*  1 1 
        478 1 1 1 1 22 HIS HD2  . 22 . HD2  1 1 
        478 1 2 1 1 85 VAL H    . 85 . HN   1 1 
        479 1 1 1 1 22 HIS HD2  . 22 . HD2  1 1 
        479 1 2 1 1 85 VAL HA   . 85 . HA   1 1 
        480 1 1 1 1 22 HIS HD2  . 22 . HD2  1 1 
        480 1 2 1 1 85 VAL MG2  . 85 . HG2* 1 1 
        481 1 1 1 1 22 HIS HD2  . 22 . HD2  1 1 
        481 1 2 1 1 86 ARG H    . 86 . HN   1 1 
        482 1 1 1 1 22 HIS HD2  . 22 . HD2  1 1 
        482 1 2 1 1 86 ARG HA   . 86 . HA   1 1 
        483 1 1 1 1 23 VAL H    . 23 . HN   1 1 
        483 1 2 1 1 23 VAL HB   . 23 . HB   1 1 
        484 1 1 1 1 23 VAL H    . 23 . HN   1 1 
        484 1 2 1 1 23 VAL MG1  . 23 . HG1* 1 1 
        485 1 1 1 1 23 VAL H    . 23 . HN   1 1 
        485 1 2 1 1 23 VAL MG2  . 23 . HG2* 1 1 
        486 1 1 1 1 23 VAL H    . 23 . HN   1 1 
        486 1 2 1 1 24 GLY H    . 24 . HN   1 1 
        487 1 1 1 1 23 VAL H    . 23 . HN   1 1 
        487 1 2 1 1 83 VAL HA   . 83 . HA   1 1 
        488 1 1 1 1 23 VAL H    . 23 . HN   1 1 
        488 1 2 1 1 83 VAL MG1  . 83 . HG1* 1 1 
        489 1 1 1 1 23 VAL H    . 23 . HN   1 1 
        489 1 2 1 1 84 LYS H    . 84 . HN   1 1 
        490 1 1 1 1 23 VAL H    . 23 . HN   1 1 
        490 1 2 1 1 84 LYS HA   . 84 . HA   1 1 
        491 1 1 1 1 23 VAL H    . 23 . HN   1 1 
        491 1 2 1 1 84 LYS QB   . 84 . HB*  1 1 
        492 1 1 1 1 23 VAL H    . 23 . HN   1 1 
        492 1 2 1 1 85 VAL HA   . 85 . HA   1 1 
        493 1 1 1 1 23 VAL H    . 23 . HN   1 1 
        493 1 2 1 1 85 VAL MG1  . 85 . HG1* 1 1 
        494 1 1 1 1 23 VAL H    . 23 . HN   1 1 
        494 1 2 1 1 85 VAL MG2  . 85 . HG2* 1 1 
        495 1 1 1 1 23 VAL H    . 23 . HN   1 1 
        495 1 2 1 1 86 ARG H    . 86 . HN   1 1 
        496 1 1 1 1 23 VAL HA   . 23 . HA   1 1 
        496 1 2 1 1 23 VAL MG1  . 23 . HG1* 1 1 
        497 1 1 1 1 23 VAL HA   . 23 . HA   1 1 
        497 1 2 1 1 24 GLY H    . 24 . HN   1 1 
        498 1 1 1 1 23 VAL HA   . 23 . HA   1 1 
        498 1 2 1 1 25 ASP H    . 25 . HN   1 1 
        499 1 1 1 1 23 VAL HA   . 23 . HA   1 1 
        499 1 2 1 1 83 VAL MG1  . 83 . HG1* 1 1 
        500 1 1 1 1 23 VAL HB   . 23 . HB   1 1 
        500 1 2 1 1 24 GLY H    . 24 . HN   1 1 
        501 1 1 1 1 23 VAL HB   . 23 . HB   1 1 
        501 1 2 1 1 86 ARG H    . 86 . HN   1 1 
        502 1 1 1 1 23 VAL MG1  . 23 . HG1* 1 1 
        502 1 2 1 1 24 GLY H    . 24 . HN   1 1 
        503 1 1 1 1 23 VAL MG1  . 23 . HG1* 1 1 
        503 1 2 1 1 24 GLY QA   . 24 . HA*  1 1 
        504 1 1 1 1 23 VAL MG1  . 23 . HG1* 1 1 
        504 1 2 1 1 25 ASP H    . 25 . HN   1 1 
        505 1 1 1 1 23 VAL MG1  . 23 . HG1* 1 1 
        505 1 2 1 1 56 THR H    . 56 . HN   1 1 
        506 1 1 1 1 23 VAL MG1  . 23 . HG1* 1 1 
        506 1 2 1 1 56 THR HA   . 56 . HA   1 1 
        507 1 1 1 1 23 VAL MG1  . 23 . HG1* 1 1 
        507 1 2 1 1 57 LYS H    . 57 . HN   1 1 
        508 1 1 1 1 23 VAL MG2  . 23 . HG2* 1 1 
        508 1 2 1 1 24 GLY H    . 24 . HN   1 1 
        509 1 1 1 1 23 VAL MG2  . 23 . HG2* 1 1 
        509 1 2 1 1 25 ASP H    . 25 . HN   1 1 
        510 1 1 1 1 23 VAL MG2  . 23 . HG2* 1 1 
        510 1 2 1 1 56 THR H    . 56 . HN   1 1 
        511 1 1 1 1 23 VAL MG2  . 23 . HG2* 1 1 
        511 1 2 1 1 56 THR HA   . 56 . HA   1 1 
        512 1 1 1 1 23 VAL MG2  . 23 . HG2* 1 1 
        512 1 2 1 1 57 LYS H    . 57 . HN   1 1 
        513 1 1 1 1 23 VAL MG2  . 23 . HG2* 1 1 
        513 1 2 1 1 57 LYS HA   . 57 . HA   1 1 
        514 1 1 1 1 23 VAL MG2  . 23 . HG2* 1 1 
        514 1 2 1 1 58 ALA H    . 58 . HN   1 1 
        515 1 1 1 1 23 VAL MG2  . 23 . HG2* 1 1 
        515 1 2 1 1 58 ALA HA   . 58 . HA   1 1 
        516 1 1 1 1 23 VAL MG2  . 23 . HG2* 1 1 
        516 1 2 1 1 58 ALA MB   . 58 . HB*  1 1 
        517 1 1 1 1 23 VAL MG2  . 23 . HG2* 1 1 
        517 1 2 1 1 59 GLY H    . 59 . HN   1 1 
        518 1 1 1 1 23 VAL MG2  . 23 . HG2* 1 1 
        518 1 2 1 1 83 VAL HB   . 83 . HB   1 1 
        519 1 1 1 1 23 VAL MG2  . 23 . HG2* 1 1 
        519 1 2 1 1 83 VAL MG1  . 83 . HG1* 1 1 
        520 1 1 1 1 23 VAL MG2  . 23 . HG2* 1 1 
        520 1 2 1 1 84 LYS HA   . 84 . HA   1 1 
        521 1 1 1 1 23 VAL MG2  . 23 . HG2* 1 1 
        521 1 2 1 1 85 VAL H    . 85 . HN   1 1 
        522 1 1 1 1 23 VAL MG2  . 23 . HG2* 1 1 
        522 1 2 1 1 85 VAL HA   . 85 . HA   1 1 
        523 1 1 1 1 23 VAL MG2  . 23 . HG2* 1 1 
        523 1 2 1 1 85 VAL HB   . 85 . HB   1 1 
        524 1 1 1 1 23 VAL MG2  . 23 . HG2* 1 1 
        524 1 2 1 1 85 VAL MG1  . 85 . HG1* 1 1 
        525 1 1 1 1 23 VAL MG2  . 23 . HG2* 1 1 
        525 1 2 1 1 86 ARG H    . 86 . HN   1 1 
        526 1 1 1 1 24 GLY H    . 24 . HN   1 1 
        526 1 2 1 1 25 ASP H    . 25 . HN   1 1 
        527 1 1 1 1 24 GLY H    . 24 . HN   1 1 
        527 1 2 1 1 55 THR HA   . 55 . HA   1 1 
        528 1 1 1 1 24 GLY H    . 24 . HN   1 1 
        528 1 2 1 1 55 THR HB   . 55 . HB   1 1 
        529 1 1 1 1 24 GLY H    . 24 . HN   1 1 
        529 1 2 1 1 55 THR MG   . 55 . HG2* 1 1 
        530 1 1 1 1 24 GLY H    . 24 . HN   1 1 
        530 1 2 1 1 56 THR HA   . 56 . HA   1 1 
        531 1 1 1 1 24 GLY H    . 24 . HN   1 1 
        531 1 2 1 1 83 VAL MG1  . 83 . HG1* 1 1 
        532 1 1 1 1 24 GLY QA   . 24 . HA*  1 1 
        532 1 2 1 1 55 THR MG   . 55 . HG2* 1 1 
        533 1 1 1 1 25 ASP H    . 25 . HN   1 1 
        533 1 2 1 1 25 ASP HB2  . 25 . HB2  1 1 
        534 1 1 1 1 25 ASP H    . 25 . HN   1 1 
        534 1 2 1 1 25 ASP QB   . 25 . HB*  1 1 
        535 1 1 1 1 25 ASP H    . 25 . HN   1 1 
        535 1 2 1 1 25 ASP HB3  . 25 . HB1  1 1 
        536 1 1 1 1 25 ASP H    . 25 . HN   1 1 
        536 1 2 1 1 55 THR MG   . 55 . HG2* 1 1 
        537 1 1 1 1 25 ASP HA   . 25 . HA   1 1 
        537 1 2 1 1 26 SER H    . 26 . HN   1 1 
        538 1 1 1 1 25 ASP QB   . 25 . HB*  1 1 
        538 1 2 1 1 26 SER H    . 26 . HN   1 1 
        539 1 1 1 1 25 ASP HB2  . 25 . HB2  1 1 
        539 1 2 1 1 26 SER H    . 26 . HN   1 1 
        540 1 1 1 1 25 ASP HB3  . 25 . HB1  1 1 
        540 1 2 1 1 26 SER H    . 26 . HN   1 1 
        541 1 1 1 1 26 SER H    . 26 . HN   1 1 
        541 1 2 1 1 26 SER QB   . 26 . HB*  1 1 
        542 1 1 1 1 26 SER H    . 26 . HN   1 1 
        542 1 2 1 1 27 PHE H    . 27 . HN   1 1 
        543 1 1 1 1 26 SER HA   . 26 . HA   1 1 
        543 1 2 1 1 27 PHE H    . 27 . HN   1 1 
        544 1 1 1 1 26 SER HA   . 26 . HA   1 1 
        544 1 2 1 1 55 THR MG   . 55 . HG2* 1 1 
        545 1 1 1 1 26 SER QB   . 26 . HB*  1 1 
        545 1 2 1 1 27 PHE H    . 27 . HN   1 1 
        546 1 1 1 1 26 SER QB   . 26 . HB*  1 1 
        546 1 2 1 1 28 VAL MG2  . 28 . HG2* 1 1 
        547 1 1 1 1 27 PHE H    . 27 . HN   1 1 
        547 1 2 1 1 27 PHE HB2  . 27 . HB2  1 1 
        548 1 1 1 1 27 PHE H    . 27 . HN   1 1 
        548 1 2 1 1 27 PHE QB   . 27 . HB*  1 1 
        549 1 1 1 1 27 PHE H    . 27 . HN   1 1 
        549 1 2 1 1 27 PHE HB3  . 27 . HB1  1 1 
        550 1 1 1 1 27 PHE H    . 27 . HN   1 1 
        550 1 2 1 1 27 PHE QD   . 27 . HD*  1 1 
        551 1 1 1 1 27 PHE H    . 27 . HN   1 1 
        551 1 2 1 1 28 VAL H    . 28 . HN   1 1 
        552 1 1 1 1 27 PHE H    . 27 . HN   1 1 
        552 1 2 1 1 28 VAL MG2  . 28 . HG2* 1 1 
        553 1 1 1 1 27 PHE H    . 27 . HN   1 1 
        553 1 2 1 1 55 THR MG   . 55 . HG2* 1 1 
        554 1 1 1 1 27 PHE HA   . 27 . HA   1 1 
        554 1 2 1 1 27 PHE QD   . 27 . HD*  1 1 
        555 1 1 1 1 27 PHE HA   . 27 . HA   1 1 
        555 1 2 1 1 28 VAL H    . 28 . HN   1 1 
        556 1 1 1 1 27 PHE HA   . 27 . HA   1 1 
        556 1 2 1 1 28 VAL HB   . 28 . HB   1 1 
        557 1 1 1 1 27 PHE HA   . 27 . HA   1 1 
        557 1 2 1 1 28 VAL MG2  . 28 . HG2* 1 1 
        558 1 1 1 1 27 PHE QB   . 27 . HB*  1 1 
        558 1 2 1 1 55 THR MG   . 55 . HG2* 1 1 
        559 1 1 1 1 27 PHE QB   . 27 . HB*  1 1 
        559 1 2 1 1 81 VAL MG1  . 81 . HG1* 1 1 
        560 1 1 1 1 27 PHE HB2  . 27 . HB2  1 1 
        560 1 2 1 1 28 VAL H    . 28 . HN   1 1 
        561 1 1 1 1 27 PHE HB2  . 27 . HB2  1 1 
        561 1 2 1 1 55 THR MG   . 55 . HG2* 1 1 
        562 1 1 1 1 27 PHE HB3  . 27 . HB1  1 1 
        562 1 2 1 1 28 VAL H    . 28 . HN   1 1 
        563 1 1 1 1 27 PHE HB3  . 27 . HB1  1 1 
        563 1 2 1 1 55 THR MG   . 55 . HG2* 1 1 
        564 1 1 1 1 27 PHE QD   . 27 . HD*  1 1 
        564 1 2 1 1 28 VAL H    . 28 . HN   1 1 
        565 1 1 1 1 27 PHE QD   . 27 . HD*  1 1 
        565 1 2 1 1 29 PRO HA   . 29 . HA   1 1 
        566 1 1 1 1 27 PHE QD   . 27 . HD*  1 1 
        566 1 2 1 1 29 PRO QB   . 29 . HB*  1 1 
        567 1 1 1 1 27 PHE QD   . 27 . HD*  1 1 
        567 1 2 1 1 29 PRO HD2  . 29 . HD2  1 1 
        568 1 1 1 1 27 PHE QD   . 27 . HD*  1 1 
        568 1 2 1 1 29 PRO HD3  . 29 . HD1  1 1 
        569 1 1 1 1 27 PHE QD   . 27 . HD*  1 1 
        569 1 2 1 1 29 PRO HG2  . 29 . HG2  1 1 
        570 1 1 1 1 27 PHE QD   . 27 . HD*  1 1 
        570 1 2 1 1 29 PRO HG3  . 29 . HG1  1 1 
        571 1 1 1 1 27 PHE QD   . 27 . HD*  1 1 
        571 1 2 1 1 53 VAL HB   . 53 . HB   1 1 
        572 1 1 1 1 27 PHE QD   . 27 . HD*  1 1 
        572 1 2 1 1 53 VAL MG2  . 53 . HG2* 1 1 
        573 1 1 1 1 27 PHE QD   . 27 . HD*  1 1 
        573 1 2 1 1 55 THR MG   . 55 . HG2* 1 1 
        574 1 1 1 1 27 PHE QD   . 27 . HD*  1 1 
        574 1 2 1 1 63 LEU MD1  . 63 . HD1* 1 1 
        575 1 1 1 1 27 PHE QD   . 27 . HD*  1 1 
        575 1 2 1 1 81 VAL MG1  . 81 . HG1* 1 1 
        576 1 1 1 1 27 PHE QD   . 27 . HD*  1 1 
        576 1 2 1 1 81 VAL MG2  . 81 . HG2* 1 1 
        577 1 1 1 1 27 PHE QE   . 27 . HE*  1 1 
        577 1 2 1 1 29 PRO HA   . 29 . HA   1 1 
        578 1 1 1 1 27 PHE QE   . 27 . HE*  1 1 
        578 1 2 1 1 29 PRO QB   . 29 . HB*  1 1 
        579 1 1 1 1 27 PHE QE   . 27 . HE*  1 1 
        579 1 2 1 1 29 PRO HG2  . 29 . HG2  1 1 
        580 1 1 1 1 27 PHE QE   . 27 . HE*  1 1 
        580 1 2 1 1 29 PRO HG3  . 29 . HG1  1 1 
        581 1 1 1 1 27 PHE QE   . 27 . HE*  1 1 
        581 1 2 1 1 53 VAL MG2  . 53 . HG2* 1 1 
        582 1 1 1 1 27 PHE QE   . 27 . HE*  1 1 
        582 1 2 1 1 63 LEU MD1  . 63 . HD1* 1 1 
        583 1 1 1 1 27 PHE QE   . 27 . HE*  1 1 
        583 1 2 1 1 63 LEU MD2  . 63 . HD2* 1 1 
        584 1 1 1 1 27 PHE QE   . 27 . HE*  1 1 
        584 1 2 1 1 79 GLN HE21 . 79 . HE21 1 1 
        585 1 1 1 1 27 PHE QE   . 27 . HE*  1 1 
        585 1 2 1 1 79 GLN HE22 . 79 . HE22 1 1 
        586 1 1 1 1 27 PHE QE   . 27 . HE*  1 1 
        586 1 2 1 1 81 VAL MG1  . 81 . HG1* 1 1 
        587 1 1 1 1 27 PHE QE   . 27 . HE*  1 1 
        587 1 2 1 1 81 VAL MG2  . 81 . HG2* 1 1 
        588 1 1 1 1 27 PHE HZ   . 27 . HZ   1 1 
        588 1 2 1 1 29 PRO HA   . 29 . HA   1 1 
        589 1 1 1 1 27 PHE HZ   . 27 . HZ   1 1 
        589 1 2 1 1 79 GLN HE21 . 79 . HE21 1 1 
        590 1 1 1 1 27 PHE HZ   . 27 . HZ   1 1 
        590 1 2 1 1 79 GLN HE22 . 79 . HE22 1 1 
        591 1 1 1 1 27 PHE HZ   . 27 . HZ   1 1 
        591 1 2 1 1 81 VAL MG2  . 81 . HG2* 1 1 
        592 1 1 1 1 28 VAL H    . 28 . HN   1 1 
        592 1 2 1 1 28 VAL HB   . 28 . HB   1 1 
        593 1 1 1 1 28 VAL H    . 28 . HN   1 1 
        593 1 2 1 1 28 VAL MG1  . 28 . HG1* 1 1 
        594 1 1 1 1 28 VAL H    . 28 . HN   1 1 
        594 1 2 1 1 28 VAL MG2  . 28 . HG2* 1 1 
        595 1 1 1 1 28 VAL H    . 28 . HN   1 1 
        595 1 2 1 1 29 PRO HD2  . 29 . HD2  1 1 
        596 1 1 1 1 28 VAL H    . 28 . HN   1 1 
        596 1 2 1 1 29 PRO HD3  . 29 . HD1  1 1 
        597 1 1 1 1 28 VAL H    . 28 . HN   1 1 
        597 1 2 1 1 31 ALA MB   . 31 . HB*  1 1 
        598 1 1 1 1 28 VAL HA   . 28 . HA   1 1 
        598 1 2 1 1 28 VAL MG1  . 28 . HG1* 1 1 
        599 1 1 1 1 28 VAL HA   . 28 . HA   1 1 
        599 1 2 1 1 28 VAL MG2  . 28 . HG2* 1 1 
        600 1 1 1 1 28 VAL HA   . 28 . HA   1 1 
        600 1 2 1 1 29 PRO HD2  . 29 . HD2  1 1 
        601 1 1 1 1 28 VAL HA   . 28 . HA   1 1 
        601 1 2 1 1 29 PRO HD3  . 29 . HD1  1 1 
        602 1 1 1 1 28 VAL HA   . 28 . HA   1 1 
        602 1 2 1 1 29 PRO HG2  . 29 . HG2  1 1 
        603 1 1 1 1 28 VAL HA   . 28 . HA   1 1 
        603 1 2 1 1 29 PRO HG3  . 29 . HG1  1 1 
        604 1 1 1 1 28 VAL HA   . 28 . HA   1 1 
        604 1 2 1 1 30 MET H    . 30 . HN   1 1 
        605 1 1 1 1 28 VAL HB   . 28 . HB   1 1 
        605 1 2 1 1 31 ALA H    . 31 . HN   1 1 
        606 1 1 1 1 28 VAL HB   . 28 . HB   1 1 
        606 1 2 1 1 31 ALA MB   . 31 . HB*  1 1 
        607 1 1 1 1 28 VAL HB   . 28 . HB   1 1 
        607 1 2 1 1 32 GLU H    . 32 . HN   1 1 
        608 1 1 1 1 28 VAL MG1  . 28 . HG1* 1 1 
        608 1 2 1 1 29 PRO HD2  . 29 . HD2  1 1 
        609 1 1 1 1 28 VAL MG1  . 28 . HG1* 1 1 
        609 1 2 1 1 29 PRO QD   . 29 . HD*  1 1 
        610 1 1 1 1 28 VAL MG1  . 28 . HG1* 1 1 
        610 1 2 1 1 29 PRO HD3  . 29 . HD1  1 1 
        611 1 1 1 1 28 VAL MG1  . 28 . HG1* 1 1 
        611 1 2 1 1 30 MET H    . 30 . HN   1 1 
        612 1 1 1 1 28 VAL MG1  . 28 . HG1* 1 1 
        612 1 2 1 1 30 MET HA   . 30 . HA   1 1 
        613 1 1 1 1 28 VAL MG1  . 28 . HG1* 1 1 
        613 1 2 1 1 30 MET HB2  . 30 . HB2  1 1 
        614 1 1 1 1 28 VAL MG1  . 28 . HG1* 1 1 
        614 1 2 1 1 30 MET QB   . 30 . HB*  1 1 
        615 1 1 1 1 28 VAL MG1  . 28 . HG1* 1 1 
        615 1 2 1 1 30 MET HB3  . 30 . HB1  1 1 
        616 1 1 1 1 28 VAL MG1  . 28 . HG1* 1 1 
        616 1 2 1 1 30 MET QG   . 30 . HG*  1 1 
        617 1 1 1 1 28 VAL MG1  . 28 . HG1* 1 1 
        617 1 2 1 1 31 ALA H    . 31 . HN   1 1 
        618 1 1 1 1 28 VAL MG1  . 28 . HG1* 1 1 
        618 1 2 1 1 31 ALA HA   . 31 . HA   1 1 
        619 1 1 1 1 28 VAL MG1  . 28 . HG1* 1 1 
        619 1 2 1 1 31 ALA MB   . 31 . HB*  1 1 
        620 1 1 1 1 28 VAL MG1  . 28 . HG1* 1 1 
        620 1 2 1 1 32 GLU H    . 32 . HN   1 1 
        621 1 1 1 1 28 VAL MG1  . 28 . HG1* 1 1 
        621 1 2 1 1 32 GLU HA   . 32 . HA   1 1 
        622 1 1 1 1 28 VAL MG2  . 28 . HG2* 1 1 
        622 1 2 1 1 29 PRO QD   . 29 . HD*  1 1 
        623 1 1 1 1 28 VAL MG2  . 28 . HG2* 1 1 
        623 1 2 1 1 31 ALA H    . 31 . HN   1 1 
        624 1 1 1 1 28 VAL MG2  . 28 . HG2* 1 1 
        624 1 2 1 1 31 ALA MB   . 31 . HB*  1 1 
        625 1 1 1 1 29 PRO HA   . 29 . HA   1 1 
        625 1 2 1 1 33 VAL MG2  . 33 . HG2* 1 1 
        626 1 1 1 1 29 PRO HA   . 29 . HA   1 1 
        626 1 2 1 1 49 VAL MG2  . 49 . HG2* 1 1 
        627 1 1 1 1 29 PRO HA   . 29 . HA   1 1 
        627 1 2 1 1 63 LEU MD1  . 63 . HD1* 1 1 
        628 1 1 1 1 29 PRO HA   . 29 . HA   1 1 
        628 1 2 1 1 65 TYR QE   . 65 . HE*  1 1 
        629 1 1 1 1 29 PRO HA   . 29 . HA   1 1 
        629 1 2 1 1 65 TYR HH   . 65 . HH   1 1 
        630 1 1 1 1 29 PRO HA   . 29 . HA   1 1 
        630 1 2 1 1 79 GLN HE21 . 79 . HE21 1 1 
        631 1 1 1 1 29 PRO QB   . 29 . HB*  1 1 
        631 1 2 1 1 30 MET H    . 30 . HN   1 1 
        632 1 1 1 1 29 PRO QB   . 29 . HB*  1 1 
        632 1 2 1 1 49 VAL MG1  . 49 . HG1* 1 1 
        633 1 1 1 1 29 PRO QB   . 29 . HB*  1 1 
        633 1 2 1 1 49 VAL MG2  . 49 . HG2* 1 1 
        634 1 1 1 1 29 PRO QB   . 29 . HB*  1 1 
        634 1 2 1 1 63 LEU MD1  . 63 . HD1* 1 1 
        635 1 1 1 1 29 PRO QB   . 29 . HB*  1 1 
        635 1 2 1 1 65 TYR HH   . 65 . HH   1 1 
        636 1 1 1 1 29 PRO HB2  . 29 . HB2  1 1 
        636 1 2 1 1 49 VAL MG1  . 49 . HG1* 1 1 
        637 1 1 1 1 29 PRO HB2  . 29 . HB2  1 1 
        637 1 2 1 1 63 LEU MD1  . 63 . HD1* 1 1 
        638 1 1 1 1 29 PRO HB2  . 29 . HB2  1 1 
        638 1 2 1 1 65 TYR QE   . 65 . HE*  1 1 
        639 1 1 1 1 29 PRO HB2  . 29 . HB2  1 1 
        639 1 2 1 1 65 TYR HH   . 65 . HH   1 1 
        640 1 1 1 1 29 PRO HB3  . 29 . HB1  1 1 
        640 1 2 1 1 49 VAL MG1  . 49 . HG1* 1 1 
        641 1 1 1 1 29 PRO HB3  . 29 . HB1  1 1 
        641 1 2 1 1 63 LEU MD1  . 63 . HD1* 1 1 
        642 1 1 1 1 29 PRO HB3  . 29 . HB1  1 1 
        642 1 2 1 1 65 TYR QE   . 65 . HE*  1 1 
        643 1 1 1 1 29 PRO HB3  . 29 . HB1  1 1 
        643 1 2 1 1 65 TYR HH   . 65 . HH   1 1 
        644 1 1 1 1 29 PRO QD   . 29 . HD*  1 1 
        644 1 2 1 1 30 MET H    . 30 . HN   1 1 
        645 1 1 1 1 29 PRO QD   . 29 . HD*  1 1 
        645 1 2 1 1 30 MET QB   . 30 . HB*  1 1 
        646 1 1 1 1 29 PRO HD2  . 29 . HD2  1 1 
        646 1 2 1 1 30 MET H    . 30 . HN   1 1 
        647 1 1 1 1 29 PRO HD3  . 29 . HD1  1 1 
        647 1 2 1 1 30 MET H    . 30 . HN   1 1 
        648 1 1 1 1 29 PRO HG2  . 29 . HG2  1 1 
        648 1 2 1 1 30 MET H    . 30 . HN   1 1 
        649 1 1 1 1 29 PRO HG2  . 29 . HG2  1 1 
        649 1 2 1 1 49 VAL MG1  . 49 . HG1* 1 1 
        650 1 1 1 1 29 PRO HG2  . 29 . HG2  1 1 
        650 1 2 1 1 49 VAL MG2  . 49 . HG2* 1 1 
        651 1 1 1 1 29 PRO HG2  . 29 . HG2  1 1 
        651 1 2 1 1 63 LEU MD1  . 63 . HD1* 1 1 
        652 1 1 1 1 29 PRO HG3  . 29 . HG1  1 1 
        652 1 2 1 1 30 MET H    . 30 . HN   1 1 
        653 1 1 1 1 29 PRO HG3  . 29 . HG1  1 1 
        653 1 2 1 1 49 VAL MG1  . 49 . HG1* 1 1 
        654 1 1 1 1 29 PRO HG3  . 29 . HG1  1 1 
        654 1 2 1 1 49 VAL MG2  . 49 . HG2* 1 1 
        655 1 1 1 1 29 PRO HG3  . 29 . HG1  1 1 
        655 1 2 1 1 63 LEU MD1  . 63 . HD1* 1 1 
        656 1 1 1 1 30 MET H    . 30 . HN   1 1 
        656 1 2 1 1 30 MET HB2  . 30 . HB2  1 1 
        657 1 1 1 1 30 MET H    . 30 . HN   1 1 
        657 1 2 1 1 30 MET QB   . 30 . HB*  1 1 
        658 1 1 1 1 30 MET H    . 30 . HN   1 1 
        658 1 2 1 1 30 MET HB3  . 30 . HB1  1 1 
        659 1 1 1 1 30 MET H    . 30 . HN   1 1 
        659 1 2 1 1 30 MET ME   . 30 . HE*  1 1 
        660 1 1 1 1 30 MET H    . 30 . HN   1 1 
        660 1 2 1 1 30 MET HG2  . 30 . HG2  1 1 
        661 1 1 1 1 30 MET H    . 30 . HN   1 1 
        661 1 2 1 1 30 MET QG   . 30 . HG*  1 1 
        662 1 1 1 1 30 MET H    . 30 . HN   1 1 
        662 1 2 1 1 30 MET HG3  . 30 . HG1  1 1 
        663 1 1 1 1 30 MET H    . 30 . HN   1 1 
        663 1 2 1 1 31 ALA H    . 31 . HN   1 1 
        664 1 1 1 1 30 MET H    . 30 . HN   1 1 
        664 1 2 1 1 31 ALA MB   . 31 . HB*  1 1 
        665 1 1 1 1 30 MET H    . 30 . HN   1 1 
        665 1 2 1 1 49 VAL MG2  . 49 . HG2* 1 1 
        666 1 1 1 1 30 MET HA   . 30 . HA   1 1 
        666 1 2 1 1 30 MET ME   . 30 . HE*  1 1 
        667 1 1 1 1 30 MET HA   . 30 . HA   1 1 
        667 1 2 1 1 33 VAL H    . 33 . HN   1 1 
        668 1 1 1 1 30 MET HA   . 30 . HA   1 1 
        668 1 2 1 1 33 VAL HB   . 33 . HB   1 1 
        669 1 1 1 1 30 MET HA   . 30 . HA   1 1 
        669 1 2 1 1 33 VAL MG2  . 33 . HG2* 1 1 
        670 1 1 1 1 30 MET HA   . 30 . HA   1 1 
        670 1 2 1 1 65 TYR QE   . 65 . HE*  1 1 
        671 1 1 1 1 30 MET QB   . 30 . HB*  1 1 
        671 1 2 1 1 30 MET ME   . 30 . HE*  1 1 
        672 1 1 1 1 30 MET QB   . 30 . HB*  1 1 
        672 1 2 1 1 31 ALA H    . 31 . HN   1 1 
        673 1 1 1 1 30 MET HB2  . 30 . HB2  1 1 
        673 1 2 1 1 31 ALA H    . 31 . HN   1 1 
        674 1 1 1 1 30 MET HB3  . 30 . HB1  1 1 
        674 1 2 1 1 31 ALA H    . 31 . HN   1 1 
        675 1 1 1 1 30 MET ME   . 30 . HE*  1 1 
        675 1 2 1 1 30 MET HG2  . 30 . HG2  1 1 
        676 1 1 1 1 30 MET ME   . 30 . HE*  1 1 
        676 1 2 1 1 30 MET HG3  . 30 . HG1  1 1 
        677 1 1 1 1 30 MET ME   . 30 . HE*  1 1 
        677 1 2 1 1 31 ALA H    . 31 . HN   1 1 
        678 1 1 1 1 30 MET ME   . 30 . HE*  1 1 
        678 1 2 1 1 31 ALA HA   . 31 . HA   1 1 
        679 1 1 1 1 30 MET ME   . 30 . HE*  1 1 
        679 1 2 1 1 33 VAL H    . 33 . HN   1 1 
        680 1 1 1 1 30 MET ME   . 30 . HE*  1 1 
        680 1 2 1 1 33 VAL MG1  . 33 . HG1* 1 1 
        681 1 1 1 1 30 MET ME   . 30 . HE*  1 1 
        681 1 2 1 1 33 VAL MG2  . 33 . HG2* 1 1 
        682 1 1 1 1 30 MET ME   . 30 . HE*  1 1 
        682 1 2 1 1 44 THR HA   . 44 . HA   1 1 
        683 1 1 1 1 30 MET ME   . 30 . HE*  1 1 
        683 1 2 1 1 44 THR MG   . 44 . HG2* 1 1 
        684 1 1 1 1 30 MET ME   . 30 . HE*  1 1 
        684 1 2 1 1 45 SER HA   . 45 . HA   1 1 
        685 1 1 1 1 30 MET ME   . 30 . HE*  1 1 
        685 1 2 1 1 47 ILE H    . 47 . HN   1 1 
        686 1 1 1 1 30 MET ME   . 30 . HE*  1 1 
        686 1 2 1 1 47 ILE HB   . 47 . HB   1 1 
        687 1 1 1 1 30 MET ME   . 30 . HE*  1 1 
        687 1 2 1 1 47 ILE MD   . 47 . HD1* 1 1 
        688 1 1 1 1 30 MET ME   . 30 . HE*  1 1 
        688 1 2 1 1 47 ILE MG   . 47 . HG2* 1 1 
        689 1 1 1 1 30 MET ME   . 30 . HE*  1 1 
        689 1 2 1 1 48 LYS H    . 48 . HN   1 1 
        690 1 1 1 1 30 MET ME   . 30 . HE*  1 1 
        690 1 2 1 1 48 LYS HA   . 48 . HA   1 1 
        691 1 1 1 1 30 MET ME   . 30 . HE*  1 1 
        691 1 2 1 1 49 VAL HA   . 49 . HA   1 1 
        692 1 1 1 1 30 MET ME   . 30 . HE*  1 1 
        692 1 2 1 1 49 VAL MG2  . 49 . HG2* 1 1 
        693 1 1 1 1 30 MET ME   . 30 . HE*  1 1 
        693 1 2 1 1 65 TYR QD   . 65 . HD*  1 1 
        694 1 1 1 1 30 MET ME   . 30 . HE*  1 1 
        694 1 2 1 1 65 TYR QE   . 65 . HE*  1 1 
        695 1 1 1 1 30 MET QG   . 30 . HG*  1 1 
        695 1 2 1 1 49 VAL MG2  . 49 . HG2* 1 1 
        696 1 1 1 1 31 ALA H    . 31 . HN   1 1 
        696 1 2 1 1 31 ALA MB   . 31 . HB*  1 1 
        697 1 1 1 1 31 ALA H    . 31 . HN   1 1 
        697 1 2 1 1 32 GLU H    . 32 . HN   1 1 
        698 1 1 1 1 31 ALA H    . 31 . HN   1 1 
        698 1 2 1 1 32 GLU QG   . 32 . HG*  1 1 
        699 1 1 1 1 31 ALA H    . 31 . HN   1 1 
        699 1 2 1 1 33 VAL H    . 33 . HN   1 1 
        700 1 1 1 1 31 ALA HA   . 31 . HA   1 1 
        700 1 2 1 1 32 GLU HA   . 32 . HA   1 1 
        701 1 1 1 1 31 ALA HA   . 31 . HA   1 1 
        701 1 2 1 1 32 GLU QB   . 32 . HB*  1 1 
        702 1 1 1 1 31 ALA HA   . 31 . HA   1 1 
        702 1 2 1 1 33 VAL H    . 33 . HN   1 1 
        703 1 1 1 1 31 ALA MB   . 31 . HB*  1 1 
        703 1 2 1 1 32 GLU H    . 32 . HN   1 1 
        704 1 1 1 1 31 ALA MB   . 31 . HB*  1 1 
        704 1 2 1 1 32 GLU HA   . 32 . HA   1 1 
        705 1 1 1 1 31 ALA MB   . 31 . HB*  1 1 
        705 1 2 1 1 32 GLU QB   . 32 . HB*  1 1 
        706 1 1 1 1 31 ALA MB   . 31 . HB*  1 1 
        706 1 2 1 1 32 GLU HG2  . 32 . HG2  1 1 
        707 1 1 1 1 31 ALA MB   . 31 . HB*  1 1 
        707 1 2 1 1 32 GLU HG3  . 32 . HG1  1 1 
        708 1 1 1 1 31 ALA MB   . 31 . HB*  1 1 
        708 1 2 1 1 33 VAL H    . 33 . HN   1 1 
        709 1 1 1 1 32 GLU H    . 32 . HN   1 1 
        709 1 2 1 1 32 GLU QB   . 32 . HB*  1 1 
        710 1 1 1 1 32 GLU H    . 32 . HN   1 1 
        710 1 2 1 1 32 GLU HG2  . 32 . HG2  1 1 
        711 1 1 1 1 32 GLU H    . 32 . HN   1 1 
        711 1 2 1 1 32 GLU QG   . 32 . HG*  1 1 
        712 1 1 1 1 32 GLU H    . 32 . HN   1 1 
        712 1 2 1 1 32 GLU HG3  . 32 . HG1  1 1 
        713 1 1 1 1 32 GLU H    . 32 . HN   1 1 
        713 1 2 1 1 33 VAL H    . 33 . HN   1 1 
        714 1 1 1 1 32 GLU H    . 32 . HN   1 1 
        714 1 2 1 1 33 VAL HB   . 33 . HB   1 1 
        715 1 1 1 1 32 GLU H    . 32 . HN   1 1 
        715 1 2 1 1 33 VAL MG2  . 33 . HG2* 1 1 
        716 1 1 1 1 32 GLU HA   . 32 . HA   1 1 
        716 1 2 1 1 32 GLU HG2  . 32 . HG2  1 1 
        717 1 1 1 1 32 GLU HA   . 32 . HA   1 1 
        717 1 2 1 1 32 GLU HG3  . 32 . HG1  1 1 
        718 1 1 1 1 32 GLU HA   . 32 . HA   1 1 
        718 1 2 1 1 33 VAL H    . 33 . HN   1 1 
        719 1 1 1 1 32 GLU QB   . 32 . HB*  1 1 
        719 1 2 1 1 33 VAL H    . 33 . HN   1 1 
        720 1 1 1 1 32 GLU QG   . 32 . HG*  1 1 
        720 1 2 1 1 33 VAL H    . 33 . HN   1 1 
        721 1 1 1 1 32 GLU HG2  . 32 . HG2  1 1 
        721 1 2 1 1 33 VAL H    . 33 . HN   1 1 
        722 1 1 1 1 32 GLU HG3  . 32 . HG1  1 1 
        722 1 2 1 1 33 VAL H    . 33 . HN   1 1 
        723 1 1 1 1 33 VAL H    . 33 . HN   1 1 
        723 1 2 1 1 33 VAL HB   . 33 . HB   1 1 
        724 1 1 1 1 33 VAL H    . 33 . HN   1 1 
        724 1 2 1 1 33 VAL MG1  . 33 . HG1* 1 1 
        725 1 1 1 1 33 VAL H    . 33 . HN   1 1 
        725 1 2 1 1 33 VAL MG2  . 33 . HG2* 1 1 
        726 1 1 1 1 33 VAL H    . 33 . HN   1 1 
        726 1 2 1 1 34 LEU H    . 34 . HN   1 1 
        727 1 1 1 1 33 VAL H    . 33 . HN   1 1 
        727 1 2 1 1 47 ILE MD   . 47 . HD1* 1 1 
        728 1 1 1 1 33 VAL HA   . 33 . HA   1 1 
        728 1 2 1 1 34 LEU H    . 34 . HN   1 1 
        729 1 1 1 1 33 VAL HA   . 33 . HA   1 1 
        729 1 2 1 1 47 ILE MD   . 47 . HD1* 1 1 
        730 1 1 1 1 33 VAL HB   . 33 . HB   1 1 
        730 1 2 1 1 34 LEU H    . 34 . HN   1 1 
        731 1 1 1 1 33 VAL HB   . 33 . HB   1 1 
        731 1 2 1 1 65 TYR QD   . 65 . HD*  1 1 
        732 1 1 1 1 33 VAL MG1  . 33 . HG1* 1 1 
        732 1 2 1 1 34 LEU H    . 34 . HN   1 1 
        733 1 1 1 1 33 VAL MG1  . 33 . HG1* 1 1 
        733 1 2 1 1 34 LEU HB2  . 34 . HB2  1 1 
        734 1 1 1 1 33 VAL MG1  . 33 . HG1* 1 1 
        734 1 2 1 1 44 THR MG   . 44 . HG2* 1 1 
        735 1 1 1 1 33 VAL MG1  . 33 . HG1* 1 1 
        735 1 2 1 1 47 ILE MG   . 47 . HG2* 1 1 
        736 1 1 1 1 33 VAL MG1  . 33 . HG1* 1 1 
        736 1 2 1 1 65 TYR QD   . 65 . HD*  1 1 
        737 1 1 1 1 33 VAL MG1  . 33 . HG1* 1 1 
        737 1 2 1 1 77 ALA MB   . 77 . HB*  1 1 
        738 1 1 1 1 33 VAL MG2  . 33 . HG2* 1 1 
        738 1 2 1 1 34 LEU H    . 34 . HN   1 1 
        739 1 1 1 1 33 VAL MG2  . 33 . HG2* 1 1 
        739 1 2 1 1 65 TYR QE   . 65 . HE*  1 1 
        740 1 1 1 1 33 VAL MG2  . 33 . HG2* 1 1 
        740 1 2 1 1 65 TYR HH   . 65 . HH   1 1 
        741 1 1 1 1 33 VAL MG2  . 33 . HG2* 1 1 
        741 1 2 1 1 79 GLN HE21 . 79 . HE21 1 1 
        742 1 1 1 1 33 VAL MG2  . 33 . HG2* 1 1 
        742 1 2 1 1 79 GLN HE22 . 79 . HE22 1 1 
        743 1 1 1 1 34 LEU H    . 34 . HN   1 1 
        743 1 2 1 1 34 LEU HB2  . 34 . HB2  1 1 
        744 1 1 1 1 34 LEU H    . 34 . HN   1 1 
        744 1 2 1 1 34 LEU HB3  . 34 . HB1  1 1 
        745 1 1 1 1 34 LEU H    . 34 . HN   1 1 
        745 1 2 1 1 34 LEU MD1  . 34 . HD1* 1 1 
        746 1 1 1 1 34 LEU H    . 34 . HN   1 1 
        746 1 2 1 1 34 LEU QD   . 34 . HD*  1 1 
        747 1 1 1 1 34 LEU H    . 34 . HN   1 1 
        747 1 2 1 1 34 LEU MD2  . 34 . HD2* 1 1 
        748 1 1 1 1 34 LEU H    . 34 . HN   1 1 
        748 1 2 1 1 34 LEU HG   . 34 . HG   1 1 
        749 1 1 1 1 34 LEU H    . 34 . HN   1 1 
        749 1 2 1 1 44 THR MG   . 44 . HG2* 1 1 
        750 1 1 1 1 34 LEU H    . 34 . HN   1 1 
        750 1 2 1 1 47 ILE MD   . 47 . HD1* 1 1 
        751 1 1 1 1 34 LEU HA   . 34 . HA   1 1 
        751 1 2 1 1 34 LEU MD1  . 34 . HD1* 1 1 
        752 1 1 1 1 34 LEU HA   . 34 . HA   1 1 
        752 1 2 1 1 34 LEU MD2  . 34 . HD2* 1 1 
        753 1 1 1 1 34 LEU HA   . 34 . HA   1 1 
        753 1 2 1 1 35 ALA H    . 35 . HN   1 1 
        754 1 1 1 1 34 LEU HA   . 34 . HA   1 1 
        754 1 2 1 1 35 ALA HA   . 35 . HA   1 1 
        755 1 1 1 1 34 LEU HA   . 34 . HA   1 1 
        755 1 2 1 1 35 ALA MB   . 35 . HB*  1 1 
        756 1 1 1 1 34 LEU HA   . 34 . HA   1 1 
        756 1 2 1 1 44 THR HB   . 44 . HB   1 1 
        757 1 1 1 1 34 LEU HA   . 34 . HA   1 1 
        757 1 2 1 1 44 THR MG   . 44 . HG2* 1 1 
        758 1 1 1 1 34 LEU HA   . 34 . HA   1 1 
        758 1 2 1 1 47 ILE MD   . 47 . HD1* 1 1 
        759 1 1 1 1 34 LEU HB2  . 34 . HB2  1 1 
        759 1 2 1 1 34 LEU MD1  . 34 . HD1* 1 1 
        760 1 1 1 1 34 LEU HB2  . 34 . HB2  1 1 
        760 1 2 1 1 34 LEU MD2  . 34 . HD2* 1 1 
        761 1 1 1 1 34 LEU HB2  . 34 . HB2  1 1 
        761 1 2 1 1 35 ALA H    . 35 . HN   1 1 
        762 1 1 1 1 34 LEU HB3  . 34 . HB1  1 1 
        762 1 2 1 1 35 ALA H    . 35 . HN   1 1 
        763 1 1 1 1 34 LEU HB3  . 34 . HB1  1 1 
        763 1 2 1 1 35 ALA HA   . 35 . HA   1 1 
        764 1 1 1 1 34 LEU QD   . 34 . HD*  1 1 
        764 1 2 1 1 35 ALA H    . 35 . HN   1 1 
        765 1 1 1 1 34 LEU QD   . 34 . HD*  1 1 
        765 1 2 1 1 35 ALA HA   . 35 . HA   1 1 
        766 1 1 1 1 34 LEU QD   . 34 . HD*  1 1 
        766 1 2 1 1 44 THR MG   . 44 . HG2* 1 1 
        767 1 1 1 1 34 LEU MD1  . 34 . HD1* 1 1 
        767 1 2 1 1 35 ALA H    . 35 . HN   1 1 
        768 1 1 1 1 34 LEU MD2  . 34 . HD2* 1 1 
        768 1 2 1 1 35 ALA H    . 35 . HN   1 1 
        769 1 1 1 1 34 LEU HG   . 34 . HG   1 1 
        769 1 2 1 1 35 ALA H    . 35 . HN   1 1 
        770 1 1 1 1 35 ALA H    . 35 . HN   1 1 
        770 1 2 1 1 36 ILE H    . 36 . HN   1 1 
        771 1 1 1 1 35 ALA H    . 35 . HN   1 1 
        771 1 2 1 1 36 ILE HG12 . 36 . HG12 1 1 
        772 1 1 1 1 35 ALA H    . 35 . HN   1 1 
        772 1 2 1 1 43 LEU H    . 43 . HN   1 1 
        773 1 1 1 1 35 ALA H    . 35 . HN   1 1 
        773 1 2 1 1 44 THR H    . 44 . HN   1 1 
        774 1 1 1 1 35 ALA H    . 35 . HN   1 1 
        774 1 2 1 1 44 THR HA   . 44 . HA   1 1 
        775 1 1 1 1 35 ALA H    . 35 . HN   1 1 
        775 1 2 1 1 44 THR HB   . 44 . HB   1 1 
        776 1 1 1 1 35 ALA H    . 35 . HN   1 1 
        776 1 2 1 1 44 THR MG   . 44 . HG2* 1 1 
        777 1 1 1 1 35 ALA H    . 35 . HN   1 1 
        777 1 2 1 1 47 ILE MD   . 47 . HD1* 1 1 
        778 1 1 1 1 35 ALA HA   . 35 . HA   1 1 
        778 1 2 1 1 36 ILE H    . 36 . HN   1 1 
        779 1 1 1 1 35 ALA HA   . 35 . HA   1 1 
        779 1 2 1 1 36 ILE HB   . 36 . HB   1 1 
        780 1 1 1 1 35 ALA HA   . 35 . HA   1 1 
        780 1 2 1 1 36 ILE HG12 . 36 . HG12 1 1 
        781 1 1 1 1 35 ALA HA   . 35 . HA   1 1 
        781 1 2 1 1 43 LEU QB   . 43 . HB*  1 1 
        782 1 1 1 1 35 ALA HA   . 35 . HA   1 1 
        782 1 2 1 1 47 ILE MD   . 47 . HD1* 1 1 
        783 1 1 1 1 35 ALA MB   . 35 . HB*  1 1 
        783 1 2 1 1 36 ILE H    . 36 . HN   1 1 
        784 1 1 1 1 35 ALA MB   . 35 . HB*  1 1 
        784 1 2 1 1 43 LEU H    . 43 . HN   1 1 
        785 1 1 1 1 35 ALA MB   . 35 . HB*  1 1 
        785 1 2 1 1 43 LEU HA   . 43 . HA   1 1 
        786 1 1 1 1 35 ALA MB   . 35 . HB*  1 1 
        786 1 2 1 1 43 LEU QB   . 43 . HB*  1 1 
        787 1 1 1 1 35 ALA MB   . 35 . HB*  1 1 
        787 1 2 1 1 43 LEU MD1  . 43 . HD1* 1 1 
        788 1 1 1 1 35 ALA MB   . 35 . HB*  1 1 
        788 1 2 1 1 43 LEU HG   . 43 . HG   1 1 
        789 1 1 1 1 35 ALA MB   . 35 . HB*  1 1 
        789 1 2 1 1 44 THR H    . 44 . HN   1 1 
        790 1 1 1 1 35 ALA MB   . 35 . HB*  1 1 
        790 1 2 1 1 44 THR HA   . 44 . HA   1 1 
        791 1 1 1 1 35 ALA MB   . 35 . HB*  1 1 
        791 1 2 1 1 46 LYS H    . 46 . HN   1 1 
        792 1 1 1 1 35 ALA MB   . 35 . HB*  1 1 
        792 1 2 1 1 47 ILE H    . 47 . HN   1 1 
        793 1 1 1 1 35 ALA MB   . 35 . HB*  1 1 
        793 1 2 1 1 47 ILE HA   . 47 . HA   1 1 
        794 1 1 1 1 35 ALA MB   . 35 . HB*  1 1 
        794 1 2 1 1 47 ILE MD   . 47 . HD1* 1 1 
        795 1 1 1 1 35 ALA MB   . 35 . HB*  1 1 
        795 1 2 1 1 47 ILE HG12 . 47 . HG12 1 1 
        796 1 1 1 1 35 ALA MB   . 35 . HB*  1 1 
        796 1 2 1 1 47 ILE HG13 . 47 . HG11 1 1 
        797 1 1 1 1 35 ALA MB   . 35 . HB*  1 1 
        797 1 2 1 1 67 VAL MG1  . 67 . HG1* 1 1 
        798 1 1 1 1 36 ILE H    . 36 . HN   1 1 
        798 1 2 1 1 36 ILE HB   . 36 . HB   1 1 
        799 1 1 1 1 36 ILE H    . 36 . HN   1 1 
        799 1 2 1 1 36 ILE MD   . 36 . HD1* 1 1 
        800 1 1 1 1 36 ILE H    . 36 . HN   1 1 
        800 1 2 1 1 36 ILE HG12 . 36 . HG12 1 1 
        801 1 1 1 1 36 ILE H    . 36 . HN   1 1 
        801 1 2 1 1 36 ILE HG13 . 36 . HG11 1 1 
        802 1 1 1 1 36 ILE H    . 36 . HN   1 1 
        802 1 2 1 1 36 ILE MG   . 36 . HG2* 1 1 
        803 1 1 1 1 36 ILE H    . 36 . HN   1 1 
        803 1 2 1 1 37 ASP H    . 37 . HN   1 1 
        804 1 1 1 1 36 ILE HA   . 36 . HA   1 1 
        804 1 2 1 1 36 ILE MD   . 36 . HD1* 1 1 
        805 1 1 1 1 36 ILE HA   . 36 . HA   1 1 
        805 1 2 1 1 37 ASP H    . 37 . HN   1 1 
        806 1 1 1 1 36 ILE HA   . 36 . HA   1 1 
        806 1 2 1 1 41 GLY H    . 41 . HN   1 1 
        807 1 1 1 1 36 ILE HA   . 36 . HA   1 1 
        807 1 2 1 1 43 LEU H    . 43 . HN   1 1 
        808 1 1 1 1 36 ILE HB   . 36 . HB   1 1 
        808 1 2 1 1 37 ASP H    . 37 . HN   1 1 
        809 1 1 1 1 36 ILE MD   . 36 . HD1* 1 1 
        809 1 2 1 1 37 ASP H    . 37 . HN   1 1 
        810 1 1 1 1 36 ILE MD   . 36 . HD1* 1 1 
        810 1 2 1 1 42 ASP H    . 42 . HN   1 1 
        811 1 1 1 1 36 ILE MD   . 36 . HD1* 1 1 
        811 1 2 1 1 42 ASP HA   . 42 . HA   1 1 
        812 1 1 1 1 36 ILE MD   . 36 . HD1* 1 1 
        812 1 2 1 1 42 ASP HB2  . 42 . HB2  1 1 
        813 1 1 1 1 36 ILE MD   . 36 . HD1* 1 1 
        813 1 2 1 1 42 ASP QB   . 42 . HB*  1 1 
        814 1 1 1 1 36 ILE MD   . 36 . HD1* 1 1 
        814 1 2 1 1 42 ASP HB3  . 42 . HB1  1 1 
        815 1 1 1 1 36 ILE MD   . 36 . HD1* 1 1 
        815 1 2 1 1 43 LEU H    . 43 . HN   1 1 
        816 1 1 1 1 36 ILE HG12 . 36 . HG12 1 1 
        816 1 2 1 1 36 ILE MG   . 36 . HG2* 1 1 
        817 1 1 1 1 36 ILE HG12 . 36 . HG12 1 1 
        817 1 2 1 1 43 LEU H    . 43 . HN   1 1 
        818 1 1 1 1 36 ILE HG13 . 36 . HG11 1 1 
        818 1 2 1 1 36 ILE MG   . 36 . HG2* 1 1 
        819 1 1 1 1 36 ILE MG   . 36 . HG2* 1 1 
        819 1 2 1 1 37 ASP H    . 37 . HN   1 1 
        820 1 1 1 1 37 ASP H    . 37 . HN   1 1 
        820 1 2 1 1 37 ASP HB3  . 37 . HB1  1 1 
        821 1 1 1 1 37 ASP H    . 37 . HN   1 1 
        821 1 2 1 1 38 LYS H    . 38 . HN   1 1 
        822 1 1 1 1 37 ASP H    . 37 . HN   1 1 
        822 1 2 1 1 40 ASP H    . 40 . HN   1 1 
        823 1 1 1 1 37 ASP H    . 37 . HN   1 1 
        823 1 2 1 1 41 GLY H    . 41 . HN   1 1 
        824 1 1 1 1 37 ASP H    . 37 . HN   1 1 
        824 1 2 1 1 43 LEU H    . 43 . HN   1 1 
        825 1 1 1 1 37 ASP H    . 37 . HN   1 1 
        825 1 2 1 1 43 LEU MD1  . 43 . HD1* 1 1 
        826 1 1 1 1 37 ASP H    . 37 . HN   1 1 
        826 1 2 1 1 43 LEU HG   . 43 . HG   1 1 
        827 1 1 1 1 37 ASP HA   . 37 . HA   1 1 
        827 1 2 1 1 38 LYS H    . 38 . HN   1 1 
        828 1 1 1 1 37 ASP HA   . 37 . HA   1 1 
        828 1 2 1 1 38 LYS HA   . 38 . HA   1 1 
        829 1 1 1 1 37 ASP HA   . 37 . HA   1 1 
        829 1 2 1 1 38 LYS HB2  . 38 . HB2  1 1 
        830 1 1 1 1 37 ASP HA   . 37 . HA   1 1 
        830 1 2 1 1 38 LYS HB3  . 38 . HB1  1 1 
        831 1 1 1 1 37 ASP HA   . 37 . HA   1 1 
        831 1 2 1 1 39 GLU H    . 39 . HN   1 1 
        832 1 1 1 1 37 ASP HA   . 37 . HA   1 1 
        832 1 2 1 1 43 LEU MD1  . 43 . HD1* 1 1 
        833 1 1 1 1 37 ASP HB2  . 37 . HB2  1 1 
        833 1 2 1 1 38 LYS H    . 38 . HN   1 1 
        834 1 1 1 1 37 ASP HB2  . 37 . HB2  1 1 
        834 1 2 1 1 40 ASP H    . 40 . HN   1 1 
        835 1 1 1 1 37 ASP HB2  . 37 . HB2  1 1 
        835 1 2 1 1 40 ASP HB2  . 40 . HB2  1 1 
        836 1 1 1 1 37 ASP HB2  . 37 . HB2  1 1 
        836 1 2 1 1 40 ASP HB3  . 40 . HB1  1 1 
        837 1 1 1 1 37 ASP HB2  . 37 . HB2  1 1 
        837 1 2 1 1 41 GLY H    . 41 . HN   1 1 
        838 1 1 1 1 37 ASP HB2  . 37 . HB2  1 1 
        838 1 2 1 1 43 LEU MD1  . 43 . HD1* 1 1 
        839 1 1 1 1 37 ASP HB2  . 37 . HB2  1 1 
        839 1 2 1 1 43 LEU HG   . 43 . HG   1 1 
        840 1 1 1 1 37 ASP HB3  . 37 . HB1  1 1 
        840 1 2 1 1 38 LYS H    . 38 . HN   1 1 
        841 1 1 1 1 37 ASP HB3  . 37 . HB1  1 1 
        841 1 2 1 1 39 GLU H    . 39 . HN   1 1 
        842 1 1 1 1 37 ASP HB3  . 37 . HB1  1 1 
        842 1 2 1 1 40 ASP H    . 40 . HN   1 1 
        843 1 1 1 1 37 ASP HB3  . 37 . HB1  1 1 
        843 1 2 1 1 40 ASP QB   . 40 . HB*  1 1 
        844 1 1 1 1 37 ASP HB3  . 37 . HB1  1 1 
        844 1 2 1 1 41 GLY H    . 41 . HN   1 1 
        845 1 1 1 1 37 ASP HB3  . 37 . HB1  1 1 
        845 1 2 1 1 43 LEU MD1  . 43 . HD1* 1 1 
        846 1 1 1 1 37 ASP HB3  . 37 . HB1  1 1 
        846 1 2 1 1 43 LEU HG   . 43 . HG   1 1 
        847 1 1 1 1 38 LYS H    . 38 . HN   1 1 
        847 1 2 1 1 38 LYS HB2  . 38 . HB2  1 1 
        848 1 1 1 1 38 LYS H    . 38 . HN   1 1 
        848 1 2 1 1 38 LYS QB   . 38 . HB*  1 1 
        849 1 1 1 1 38 LYS H    . 38 . HN   1 1 
        849 1 2 1 1 38 LYS HB3  . 38 . HB1  1 1 
        850 1 1 1 1 38 LYS H    . 38 . HN   1 1 
        850 1 2 1 1 38 LYS HG2  . 38 . HG2  1 1 
        851 1 1 1 1 38 LYS H    . 38 . HN   1 1 
        851 1 2 1 1 38 LYS HG3  . 38 . HG1  1 1 
        852 1 1 1 1 38 LYS H    . 38 . HN   1 1 
        852 1 2 1 1 39 GLU H    . 39 . HN   1 1 
        853 1 1 1 1 38 LYS HA   . 38 . HA   1 1 
        853 1 2 1 1 38 LYS HG2  . 38 . HG2  1 1 
        854 1 1 1 1 38 LYS HA   . 38 . HA   1 1 
        854 1 2 1 1 38 LYS QG   . 38 . HG*  1 1 
        855 1 1 1 1 38 LYS HA   . 38 . HA   1 1 
        855 1 2 1 1 38 LYS HG3  . 38 . HG1  1 1 
        856 1 1 1 1 38 LYS QB   . 38 . HB*  1 1 
        856 1 2 1 1 38 LYS QD   . 38 . HD*  1 1 
        857 1 1 1 1 38 LYS QB   . 38 . HB*  1 1 
        857 1 2 1 1 39 GLU H    . 39 . HN   1 1 
        858 1 1 1 1 38 LYS QB   . 38 . HB*  1 1 
        858 1 2 1 1 40 ASP H    . 40 . HN   1 1 
        859 1 1 1 1 38 LYS QE   . 38 . HE*  1 1 
        859 1 2 1 1 38 LYS QG   . 38 . HG*  1 1 
        860 1 1 1 1 38 LYS QG   . 38 . HG*  1 1 
        860 1 2 1 1 39 GLU H    . 39 . HN   1 1 
        861 1 1 1 1 39 GLU H    . 39 . HN   1 1 
        861 1 2 1 1 39 GLU HB2  . 39 . HB2  1 1 
        862 1 1 1 1 39 GLU H    . 39 . HN   1 1 
        862 1 2 1 1 39 GLU QB   . 39 . HB*  1 1 
        863 1 1 1 1 39 GLU H    . 39 . HN   1 1 
        863 1 2 1 1 39 GLU HB3  . 39 . HB1  1 1 
        864 1 1 1 1 39 GLU H    . 39 . HN   1 1 
        864 1 2 1 1 39 GLU HG2  . 39 . HG2  1 1 
        865 1 1 1 1 39 GLU H    . 39 . HN   1 1 
        865 1 2 1 1 39 GLU QG   . 39 . HG*  1 1 
        866 1 1 1 1 39 GLU H    . 39 . HN   1 1 
        866 1 2 1 1 39 GLU HG3  . 39 . HG1  1 1 
        867 1 1 1 1 39 GLU H    . 39 . HN   1 1 
        867 1 2 1 1 40 ASP H    . 40 . HN   1 1 
        868 1 1 1 1 39 GLU HA   . 39 . HA   1 1 
        868 1 2 1 1 39 GLU HG2  . 39 . HG2  1 1 
        869 1 1 1 1 39 GLU HA   . 39 . HA   1 1 
        869 1 2 1 1 39 GLU QG   . 39 . HG*  1 1 
        870 1 1 1 1 39 GLU HA   . 39 . HA   1 1 
        870 1 2 1 1 39 GLU HG3  . 39 . HG1  1 1 
        871 1 1 1 1 39 GLU QB   . 39 . HB*  1 1 
        871 1 2 1 1 40 ASP H    . 40 . HN   1 1 
        872 1 1 1 1 39 GLU HB2  . 39 . HB2  1 1 
        872 1 2 1 1 40 ASP H    . 40 . HN   1 1 
        873 1 1 1 1 39 GLU HB3  . 39 . HB1  1 1 
        873 1 2 1 1 40 ASP H    . 40 . HN   1 1 
        874 1 1 1 1 40 ASP H    . 40 . HN   1 1 
        874 1 2 1 1 40 ASP HB2  . 40 . HB2  1 1 
        875 1 1 1 1 40 ASP H    . 40 . HN   1 1 
        875 1 2 1 1 40 ASP QB   . 40 . HB*  1 1 
        876 1 1 1 1 40 ASP H    . 40 . HN   1 1 
        876 1 2 1 1 40 ASP HB3  . 40 . HB1  1 1 
        877 1 1 1 1 40 ASP H    . 40 . HN   1 1 
        877 1 2 1 1 41 GLY H    . 41 . HN   1 1 
        878 1 1 1 1 40 ASP H    . 40 . HN   1 1 
        878 1 2 1 1 43 LEU MD1  . 43 . HD1* 1 1 
        879 1 1 1 1 40 ASP H    . 40 . HN   1 1 
        879 1 2 1 1 43 LEU HG   . 43 . HG   1 1 
        880 1 1 1 1 40 ASP HA   . 40 . HA   1 1 
        880 1 2 1 1 43 LEU MD2  . 43 . HD2* 1 1 
        881 1 1 1 1 40 ASP QB   . 40 . HB*  1 1 
        881 1 2 1 1 41 GLY H    . 41 . HN   1 1 
        882 1 1 1 1 40 ASP QB   . 40 . HB*  1 1 
        882 1 2 1 1 43 LEU MD1  . 43 . HD1* 1 1 
        883 1 1 1 1 40 ASP QB   . 40 . HB*  1 1 
        883 1 2 1 1 43 LEU MD2  . 43 . HD2* 1 1 
        884 1 1 1 1 40 ASP QB   . 40 . HB*  1 1 
        884 1 2 1 1 43 LEU HG   . 43 . HG   1 1 
        885 1 1 1 1 40 ASP HB2  . 40 . HB2  1 1 
        885 1 2 1 1 43 LEU MD1  . 43 . HD1* 1 1 
        886 1 1 1 1 40 ASP HB2  . 40 . HB2  1 1 
        886 1 2 1 1 43 LEU MD2  . 43 . HD2* 1 1 
        887 1 1 1 1 40 ASP HB2  . 40 . HB2  1 1 
        887 1 2 1 1 43 LEU HG   . 43 . HG   1 1 
        888 1 1 1 1 40 ASP HB3  . 40 . HB1  1 1 
        888 1 2 1 1 43 LEU MD1  . 43 . HD1* 1 1 
        889 1 1 1 1 40 ASP HB3  . 40 . HB1  1 1 
        889 1 2 1 1 43 LEU MD2  . 43 . HD2* 1 1 
        890 1 1 1 1 40 ASP HB3  . 40 . HB1  1 1 
        890 1 2 1 1 43 LEU HG   . 43 . HG   1 1 
        891 1 1 1 1 41 GLY H    . 41 . HN   1 1 
        891 1 2 1 1 42 ASP H    . 42 . HN   1 1 
        892 1 1 1 1 41 GLY H    . 41 . HN   1 1 
        892 1 2 1 1 43 LEU MD1  . 43 . HD1* 1 1 
        893 1 1 1 1 41 GLY H    . 41 . HN   1 1 
        893 1 2 1 1 43 LEU MD2  . 43 . HD2* 1 1 
        894 1 1 1 1 41 GLY H    . 41 . HN   1 1 
        894 1 2 1 1 43 LEU HG   . 43 . HG   1 1 
        895 1 1 1 1 41 GLY HA2  . 41 . HA2  1 1 
        895 1 2 1 1 42 ASP HB2  . 42 . HB2  1 1 
        896 1 1 1 1 41 GLY HA2  . 41 . HA2  1 1 
        896 1 2 1 1 42 ASP HB3  . 42 . HB1  1 1 
        897 1 1 1 1 41 GLY HA3  . 41 . HA1  1 1 
        897 1 2 1 1 42 ASP H    . 42 . HN   1 1 
        898 1 1 1 1 41 GLY HA3  . 41 . HA1  1 1 
        898 1 2 1 1 42 ASP HB2  . 42 . HB2  1 1 
        899 1 1 1 1 41 GLY HA3  . 41 . HA1  1 1 
        899 1 2 1 1 42 ASP QB   . 42 . HB*  1 1 
        900 1 1 1 1 41 GLY HA3  . 41 . HA1  1 1 
        900 1 2 1 1 42 ASP HB3  . 42 . HB1  1 1 
        901 1 1 1 1 42 ASP H    . 42 . HN   1 1 
        901 1 2 1 1 42 ASP HB2  . 42 . HB2  1 1 
        902 1 1 1 1 42 ASP H    . 42 . HN   1 1 
        902 1 2 1 1 42 ASP HB3  . 42 . HB1  1 1 
        903 1 1 1 1 42 ASP HA   . 42 . HA   1 1 
        903 1 2 1 1 43 LEU H    . 43 . HN   1 1 
        904 1 1 1 1 42 ASP QB   . 42 . HB*  1 1 
        904 1 2 1 1 43 LEU H    . 43 . HN   1 1 
        905 1 1 1 1 42 ASP HB2  . 42 . HB2  1 1 
        905 1 2 1 1 43 LEU H    . 43 . HN   1 1 
        906 1 1 1 1 42 ASP HB3  . 42 . HB1  1 1 
        906 1 2 1 1 43 LEU H    . 43 . HN   1 1 
        907 1 1 1 1 43 LEU H    . 43 . HN   1 1 
        907 1 2 1 1 43 LEU HB2  . 43 . HB2  1 1 
        908 1 1 1 1 43 LEU H    . 43 . HN   1 1 
        908 1 2 1 1 43 LEU QB   . 43 . HB*  1 1 
        909 1 1 1 1 43 LEU H    . 43 . HN   1 1 
        909 1 2 1 1 43 LEU HB3  . 43 . HB1  1 1 
        910 1 1 1 1 43 LEU H    . 43 . HN   1 1 
        910 1 2 1 1 43 LEU MD1  . 43 . HD1* 1 1 
        911 1 1 1 1 43 LEU H    . 43 . HN   1 1 
        911 1 2 1 1 43 LEU MD2  . 43 . HD2* 1 1 
        912 1 1 1 1 43 LEU H    . 43 . HN   1 1 
        912 1 2 1 1 43 LEU HG   . 43 . HG   1 1 
        913 1 1 1 1 43 LEU H    . 43 . HN   1 1 
        913 1 2 1 1 44 THR H    . 44 . HN   1 1 
        914 1 1 1 1 43 LEU H    . 43 . HN   1 1 
        914 1 2 1 1 44 THR HA   . 44 . HA   1 1 
        915 1 1 1 1 43 LEU H    . 43 . HN   1 1 
        915 1 2 1 1 44 THR HB   . 44 . HB   1 1 
        916 1 1 1 1 43 LEU HA   . 43 . HA   1 1 
        916 1 2 1 1 43 LEU MD2  . 43 . HD2* 1 1 
        917 1 1 1 1 43 LEU HA   . 43 . HA   1 1 
        917 1 2 1 1 45 SER H    . 45 . HN   1 1 
        918 1 1 1 1 43 LEU HA   . 43 . HA   1 1 
        918 1 2 1 1 46 LYS H    . 46 . HN   1 1 
        919 1 1 1 1 43 LEU HA   . 43 . HA   1 1 
        919 1 2 1 1 46 LYS HG2  . 46 . HG2  1 1 
        920 1 1 1 1 43 LEU HA   . 43 . HA   1 1 
        920 1 2 1 1 46 LYS QG   . 46 . HG*  1 1 
        921 1 1 1 1 43 LEU HA   . 43 . HA   1 1 
        921 1 2 1 1 46 LYS HG3  . 46 . HG1  1 1 
        922 1 1 1 1 43 LEU HA   . 43 . HA   1 1 
        922 1 2 1 1 47 ILE H    . 47 . HN   1 1 
        923 1 1 1 1 43 LEU QB   . 43 . HB*  1 1 
        923 1 2 1 1 43 LEU MD2  . 43 . HD2* 1 1 
        924 1 1 1 1 43 LEU QB   . 43 . HB*  1 1 
        924 1 2 1 1 44 THR H    . 44 . HN   1 1 
        925 1 1 1 1 43 LEU MD1  . 43 . HD1* 1 1 
        925 1 2 1 1 69 ASP H    . 69 . HN   1 1 
        926 1 1 1 1 43 LEU MD1  . 43 . HD1* 1 1 
        926 1 2 1 1 69 ASP HA   . 69 . HA   1 1 
        927 1 1 1 1 43 LEU MD1  . 43 . HD1* 1 1 
        927 1 2 1 1 69 ASP HB2  . 69 . HB2  1 1 
        928 1 1 1 1 43 LEU MD1  . 43 . HD1* 1 1 
        928 1 2 1 1 69 ASP HB3  . 69 . HB1  1 1 
        929 1 1 1 1 43 LEU MD1  . 43 . HD1* 1 1 
        929 1 2 1 1 70 SER H    . 70 . HN   1 1 
        930 1 1 1 1 43 LEU MD1  . 43 . HD1* 1 1 
        930 1 2 1 1 71 LYS H    . 71 . HN   1 1 
        931 1 1 1 1 43 LEU MD2  . 43 . HD2* 1 1 
        931 1 2 1 1 44 THR H    . 44 . HN   1 1 
        932 1 1 1 1 43 LEU MD2  . 43 . HD2* 1 1 
        932 1 2 1 1 45 SER H    . 45 . HN   1 1 
        933 1 1 1 1 43 LEU MD2  . 43 . HD2* 1 1 
        933 1 2 1 1 46 LYS H    . 46 . HN   1 1 
        934 1 1 1 1 43 LEU MD2  . 43 . HD2* 1 1 
        934 1 2 1 1 46 LYS QD   . 46 . HD*  1 1 
        935 1 1 1 1 43 LEU MD2  . 43 . HD2* 1 1 
        935 1 2 1 1 46 LYS QE   . 46 . HE*  1 1 
        936 1 1 1 1 44 THR H    . 44 . HN   1 1 
        936 1 2 1 1 44 THR HB   . 44 . HB   1 1 
        937 1 1 1 1 44 THR H    . 44 . HN   1 1 
        937 1 2 1 1 44 THR MG   . 44 . HG2* 1 1 
        938 1 1 1 1 44 THR H    . 44 . HN   1 1 
        938 1 2 1 1 45 SER H    . 45 . HN   1 1 
        939 1 1 1 1 44 THR H    . 44 . HN   1 1 
        939 1 2 1 1 47 ILE MD   . 47 . HD1* 1 1 
        940 1 1 1 1 44 THR HA   . 44 . HA   1 1 
        940 1 2 1 1 44 THR MG   . 44 . HG2* 1 1 
        941 1 1 1 1 44 THR HA   . 44 . HA   1 1 
        941 1 2 1 1 46 LYS H    . 46 . HN   1 1 
        942 1 1 1 1 44 THR HA   . 44 . HA   1 1 
        942 1 2 1 1 47 ILE H    . 47 . HN   1 1 
        943 1 1 1 1 44 THR HA   . 44 . HA   1 1 
        943 1 2 1 1 47 ILE HB   . 47 . HB   1 1 
        944 1 1 1 1 44 THR HA   . 44 . HA   1 1 
        944 1 2 1 1 47 ILE MD   . 47 . HD1* 1 1 
        945 1 1 1 1 44 THR HA   . 44 . HA   1 1 
        945 1 2 1 1 47 ILE HG12 . 47 . HG12 1 1 
        946 1 1 1 1 44 THR HA   . 44 . HA   1 1 
        946 1 2 1 1 47 ILE HG13 . 47 . HG11 1 1 
        947 1 1 1 1 44 THR HB   . 44 . HB   1 1 
        947 1 2 1 1 45 SER H    . 45 . HN   1 1 
        948 1 1 1 1 44 THR MG   . 44 . HG2* 1 1 
        948 1 2 1 1 45 SER H    . 45 . HN   1 1 
        949 1 1 1 1 44 THR MG   . 44 . HG2* 1 1 
        949 1 2 1 1 47 ILE H    . 47 . HN   1 1 
        950 1 1 1 1 44 THR MG   . 44 . HG2* 1 1 
        950 1 2 1 1 47 ILE MD   . 47 . HD1* 1 1 
        951 1 1 1 1 45 SER H    . 45 . HN   1 1 
        951 1 2 1 1 45 SER HB2  . 45 . HB2  1 1 
        952 1 1 1 1 45 SER H    . 45 . HN   1 1 
        952 1 2 1 1 45 SER QB   . 45 . HB*  1 1 
        953 1 1 1 1 45 SER H    . 45 . HN   1 1 
        953 1 2 1 1 45 SER HB3  . 45 . HB1  1 1 
        954 1 1 1 1 45 SER H    . 45 . HN   1 1 
        954 1 2 1 1 46 LYS H    . 46 . HN   1 1 
        955 1 1 1 1 45 SER H    . 45 . HN   1 1 
        955 1 2 1 1 46 LYS HB2  . 46 . HB2  1 1 
        956 1 1 1 1 45 SER H    . 45 . HN   1 1 
        956 1 2 1 1 47 ILE H    . 47 . HN   1 1 
        957 1 1 1 1 45 SER H    . 45 . HN   1 1 
        957 1 2 1 1 47 ILE MD   . 47 . HD1* 1 1 
        958 1 1 1 1 45 SER HA   . 45 . HA   1 1 
        958 1 2 1 1 47 ILE H    . 47 . HN   1 1 
        959 1 1 1 1 45 SER QB   . 45 . HB*  1 1 
        959 1 2 1 1 46 LYS H    . 46 . HN   1 1 
        960 1 1 1 1 46 LYS H    . 46 . HN   1 1 
        960 1 2 1 1 46 LYS HB2  . 46 . HB2  1 1 
        961 1 1 1 1 46 LYS H    . 46 . HN   1 1 
        961 1 2 1 1 46 LYS HB3  . 46 . HB1  1 1 
        962 1 1 1 1 46 LYS H    . 46 . HN   1 1 
        962 1 2 1 1 46 LYS QD   . 46 . HD*  1 1 
        963 1 1 1 1 46 LYS H    . 46 . HN   1 1 
        963 1 2 1 1 46 LYS QE   . 46 . HE*  1 1 
        964 1 1 1 1 46 LYS H    . 46 . HN   1 1 
        964 1 2 1 1 46 LYS HG2  . 46 . HG2  1 1 
        965 1 1 1 1 46 LYS H    . 46 . HN   1 1 
        965 1 2 1 1 46 LYS HG3  . 46 . HG1  1 1 
        966 1 1 1 1 46 LYS H    . 46 . HN   1 1 
        966 1 2 1 1 47 ILE H    . 47 . HN   1 1 
        967 1 1 1 1 46 LYS H    . 46 . HN   1 1 
        967 1 2 1 1 47 ILE HB   . 47 . HB   1 1 
        968 1 1 1 1 46 LYS H    . 46 . HN   1 1 
        968 1 2 1 1 47 ILE HG13 . 47 . HG11 1 1 
        969 1 1 1 1 46 LYS H    . 46 . HN   1 1 
        969 1 2 1 1 67 VAL MG2  . 67 . HG2* 1 1 
        970 1 1 1 1 46 LYS HA   . 46 . HA   1 1 
        970 1 2 1 1 46 LYS QD   . 46 . HD*  1 1 
        971 1 1 1 1 46 LYS HA   . 46 . HA   1 1 
        971 1 2 1 1 46 LYS HG2  . 46 . HG2  1 1 
        972 1 1 1 1 46 LYS HA   . 46 . HA   1 1 
        972 1 2 1 1 46 LYS HG3  . 46 . HG1  1 1 
        973 1 1 1 1 46 LYS HB2  . 46 . HB2  1 1 
        973 1 2 1 1 47 ILE H    . 47 . HN   1 1 
        974 1 1 1 1 46 LYS HB2  . 46 . HB2  1 1 
        974 1 2 1 1 67 VAL MG2  . 67 . HG2* 1 1 
        975 1 1 1 1 46 LYS HB3  . 46 . HB1  1 1 
        975 1 2 1 1 46 LYS QD   . 46 . HD*  1 1 
        976 1 1 1 1 46 LYS HB3  . 46 . HB1  1 1 
        976 1 2 1 1 47 ILE H    . 47 . HN   1 1 
        977 1 1 1 1 46 LYS QE   . 46 . HE*  1 1 
        977 1 2 1 1 46 LYS QG   . 46 . HG*  1 1 
        978 1 1 1 1 46 LYS QG   . 46 . HG*  1 1 
        978 1 2 1 1 47 ILE H    . 47 . HN   1 1 
        979 1 1 1 1 46 LYS HG2  . 46 . HG2  1 1 
        979 1 2 1 1 47 ILE H    . 47 . HN   1 1 
        980 1 1 1 1 46 LYS HG3  . 46 . HG1  1 1 
        980 1 2 1 1 47 ILE H    . 47 . HN   1 1 
        981 1 1 1 1 47 ILE H    . 47 . HN   1 1 
        981 1 2 1 1 47 ILE HB   . 47 . HB   1 1 
        982 1 1 1 1 47 ILE H    . 47 . HN   1 1 
        982 1 2 1 1 47 ILE MD   . 47 . HD1* 1 1 
        983 1 1 1 1 47 ILE H    . 47 . HN   1 1 
        983 1 2 1 1 47 ILE HG12 . 47 . HG12 1 1 
        984 1 1 1 1 47 ILE H    . 47 . HN   1 1 
        984 1 2 1 1 47 ILE HG13 . 47 . HG11 1 1 
        985 1 1 1 1 47 ILE H    . 47 . HN   1 1 
        985 1 2 1 1 47 ILE MG   . 47 . HG2* 1 1 
        986 1 1 1 1 47 ILE H    . 47 . HN   1 1 
        986 1 2 1 1 48 LYS H    . 48 . HN   1 1 
        987 1 1 1 1 47 ILE H    . 47 . HN   1 1 
        987 1 2 1 1 48 LYS HA   . 48 . HA   1 1 
        988 1 1 1 1 47 ILE H    . 47 . HN   1 1 
        988 1 2 1 1 67 VAL HA   . 67 . HA   1 1 
        989 1 1 1 1 47 ILE H    . 47 . HN   1 1 
        989 1 2 1 1 67 VAL MG2  . 67 . HG2* 1 1 
        990 1 1 1 1 47 ILE HA   . 47 . HA   1 1 
        990 1 2 1 1 47 ILE HG13 . 47 . HG11 1 1 
        991 1 1 1 1 47 ILE HA   . 47 . HA   1 1 
        991 1 2 1 1 47 ILE MG   . 47 . HG2* 1 1 
        992 1 1 1 1 47 ILE HA   . 47 . HA   1 1 
        992 1 2 1 1 48 LYS H    . 48 . HN   1 1 
        993 1 1 1 1 47 ILE HA   . 47 . HA   1 1 
        993 1 2 1 1 66 THR H    . 66 . HN   1 1 
        994 1 1 1 1 47 ILE HA   . 47 . HA   1 1 
        994 1 2 1 1 67 VAL HA   . 67 . HA   1 1 
        995 1 1 1 1 47 ILE HA   . 47 . HA   1 1 
        995 1 2 1 1 67 VAL HB   . 67 . HB   1 1 
        996 1 1 1 1 47 ILE HA   . 47 . HA   1 1 
        996 1 2 1 1 67 VAL MG1  . 67 . HG1* 1 1 
        997 1 1 1 1 47 ILE HA   . 47 . HA   1 1 
        997 1 2 1 1 67 VAL MG2  . 67 . HG2* 1 1 
        998 1 1 1 1 47 ILE HA   . 47 . HA   1 1 
        998 1 2 1 1 68 THR H    . 68 . HN   1 1 
        999 1 1 1 1 47 ILE HB   . 47 . HB   1 1 
        999 1 2 1 1 47 ILE MD   . 47 . HD1* 1 1 
       1000 1 1 1 1 47 ILE HB   . 47 . HB   1 1 
       1000 1 2 1 1 48 LYS H    . 48 . HN   1 1 
       1001 1 1 1 1 47 ILE HB   . 47 . HB   1 1 
       1001 1 2 1 1 49 VAL MG2  . 49 . HG2* 1 1 
       1002 1 1 1 1 47 ILE MD   . 47 . HD1* 1 1 
       1002 1 2 1 1 47 ILE MG   . 47 . HG2* 1 1 
       1003 1 1 1 1 47 ILE MD   . 47 . HD1* 1 1 
       1003 1 2 1 1 48 LYS H    . 48 . HN   1 1 
       1004 1 1 1 1 47 ILE MD   . 47 . HD1* 1 1 
       1004 1 2 1 1 65 TYR QD   . 65 . HD*  1 1 
       1005 1 1 1 1 47 ILE HG12 . 47 . HG12 1 1 
       1005 1 2 1 1 67 VAL HB   . 67 . HB   1 1 
       1006 1 1 1 1 47 ILE HG13 . 47 . HG11 1 1 
       1006 1 2 1 1 48 LYS H    . 48 . HN   1 1 
       1007 1 1 1 1 47 ILE HG13 . 47 . HG11 1 1 
       1007 1 2 1 1 67 VAL MG1  . 67 . HG1* 1 1 
       1008 1 1 1 1 47 ILE MG   . 47 . HG2* 1 1 
       1008 1 2 1 1 48 LYS H    . 48 . HN   1 1 
       1009 1 1 1 1 47 ILE MG   . 47 . HG2* 1 1 
       1009 1 2 1 1 49 VAL H    . 49 . HN   1 1 
       1010 1 1 1 1 47 ILE MG   . 47 . HG2* 1 1 
       1010 1 2 1 1 65 TYR H    . 65 . HN   1 1 
       1011 1 1 1 1 47 ILE MG   . 47 . HG2* 1 1 
       1011 1 2 1 1 65 TYR HA   . 65 . HA   1 1 
       1012 1 1 1 1 47 ILE MG   . 47 . HG2* 1 1 
       1012 1 2 1 1 65 TYR HB2  . 65 . HB2  1 1 
       1013 1 1 1 1 47 ILE MG   . 47 . HG2* 1 1 
       1013 1 2 1 1 65 TYR HB3  . 65 . HB1  1 1 
       1014 1 1 1 1 47 ILE MG   . 47 . HG2* 1 1 
       1014 1 2 1 1 65 TYR QD   . 65 . HD*  1 1 
       1015 1 1 1 1 47 ILE MG   . 47 . HG2* 1 1 
       1015 1 2 1 1 65 TYR QE   . 65 . HE*  1 1 
       1016 1 1 1 1 47 ILE MG   . 47 . HG2* 1 1 
       1016 1 2 1 1 67 VAL HB   . 67 . HB   1 1 
       1017 1 1 1 1 48 LYS H    . 48 . HN   1 1 
       1017 1 2 1 1 48 LYS HB2  . 48 . HB2  1 1 
       1018 1 1 1 1 48 LYS H    . 48 . HN   1 1 
       1018 1 2 1 1 48 LYS HB3  . 48 . HB1  1 1 
       1019 1 1 1 1 48 LYS H    . 48 . HN   1 1 
       1019 1 2 1 1 48 LYS QD   . 48 . HD*  1 1 
       1020 1 1 1 1 48 LYS H    . 48 . HN   1 1 
       1020 1 2 1 1 48 LYS HG2  . 48 . HG2  1 1 
       1021 1 1 1 1 48 LYS H    . 48 . HN   1 1 
       1021 1 2 1 1 48 LYS QG   . 48 . HG*  1 1 
       1022 1 1 1 1 48 LYS H    . 48 . HN   1 1 
       1022 1 2 1 1 48 LYS HG3  . 48 . HG1  1 1 
       1023 1 1 1 1 48 LYS H    . 48 . HN   1 1 
       1023 1 2 1 1 49 VAL H    . 49 . HN   1 1 
       1024 1 1 1 1 48 LYS H    . 48 . HN   1 1 
       1024 1 2 1 1 49 VAL MG2  . 49 . HG2* 1 1 
       1025 1 1 1 1 48 LYS H    . 48 . HN   1 1 
       1025 1 2 1 1 65 TYR HA   . 65 . HA   1 1 
       1026 1 1 1 1 48 LYS H    . 48 . HN   1 1 
       1026 1 2 1 1 66 THR H    . 66 . HN   1 1 
       1027 1 1 1 1 48 LYS H    . 48 . HN   1 1 
       1027 1 2 1 1 66 THR HB   . 66 . HB   1 1 
       1028 1 1 1 1 48 LYS H    . 48 . HN   1 1 
       1028 1 2 1 1 66 THR MG   . 66 . HG2* 1 1 
       1029 1 1 1 1 48 LYS H    . 48 . HN   1 1 
       1029 1 2 1 1 67 VAL MG1  . 67 . HG1* 1 1 
       1030 1 1 1 1 48 LYS H    . 48 . HN   1 1 
       1030 1 2 1 1 67 VAL MG2  . 67 . HG2* 1 1 
       1031 1 1 1 1 48 LYS H    . 48 . HN   1 1 
       1031 1 2 1 1 68 THR H    . 68 . HN   1 1 
       1032 1 1 1 1 48 LYS HA   . 48 . HA   1 1 
       1032 1 2 1 1 49 VAL H    . 49 . HN   1 1 
       1033 1 1 1 1 48 LYS QB   . 48 . HB*  1 1 
       1033 1 2 1 1 48 LYS QD   . 48 . HD*  1 1 
       1034 1 1 1 1 48 LYS QB   . 48 . HB*  1 1 
       1034 1 2 1 1 49 VAL H    . 49 . HN   1 1 
       1035 1 1 1 1 48 LYS QB   . 48 . HB*  1 1 
       1035 1 2 1 1 66 THR H    . 66 . HN   1 1 
       1036 1 1 1 1 48 LYS QB   . 48 . HB*  1 1 
       1036 1 2 1 1 66 THR HB   . 66 . HB   1 1 
       1037 1 1 1 1 48 LYS HB2  . 48 . HB2  1 1 
       1037 1 2 1 1 48 LYS QD   . 48 . HD*  1 1 
       1038 1 1 1 1 48 LYS HB2  . 48 . HB2  1 1 
       1038 1 2 1 1 49 VAL H    . 49 . HN   1 1 
       1039 1 1 1 1 48 LYS HB2  . 48 . HB2  1 1 
       1039 1 2 1 1 66 THR HB   . 66 . HB   1 1 
       1040 1 1 1 1 48 LYS HB3  . 48 . HB1  1 1 
       1040 1 2 1 1 48 LYS QD   . 48 . HD*  1 1 
       1041 1 1 1 1 48 LYS HB3  . 48 . HB1  1 1 
       1041 1 2 1 1 49 VAL H    . 49 . HN   1 1 
       1042 1 1 1 1 48 LYS HB3  . 48 . HB1  1 1 
       1042 1 2 1 1 66 THR HB   . 66 . HB   1 1 
       1043 1 1 1 1 48 LYS QG   . 48 . HG*  1 1 
       1043 1 2 1 1 49 VAL H    . 49 . HN   1 1 
       1044 1 1 1 1 48 LYS HG2  . 48 . HG2  1 1 
       1044 1 2 1 1 49 VAL H    . 49 . HN   1 1 
       1045 1 1 1 1 48 LYS HG3  . 48 . HG1  1 1 
       1045 1 2 1 1 49 VAL H    . 49 . HN   1 1 
       1046 1 1 1 1 49 VAL H    . 49 . HN   1 1 
       1046 1 2 1 1 49 VAL HB   . 49 . HB   1 1 
       1047 1 1 1 1 49 VAL H    . 49 . HN   1 1 
       1047 1 2 1 1 49 VAL MG1  . 49 . HG1* 1 1 
       1048 1 1 1 1 49 VAL H    . 49 . HN   1 1 
       1048 1 2 1 1 49 VAL MG2  . 49 . HG2* 1 1 
       1049 1 1 1 1 49 VAL H    . 49 . HN   1 1 
       1049 1 2 1 1 50 ASP H    . 50 . HN   1 1 
       1050 1 1 1 1 49 VAL H    . 49 . HN   1 1 
       1050 1 2 1 1 66 THR H    . 66 . HN   1 1 
       1051 1 1 1 1 49 VAL HA   . 49 . HA   1 1 
       1051 1 2 1 1 49 VAL MG1  . 49 . HG1* 1 1 
       1052 1 1 1 1 49 VAL HA   . 49 . HA   1 1 
       1052 1 2 1 1 49 VAL MG2  . 49 . HG2* 1 1 
       1053 1 1 1 1 49 VAL HA   . 49 . HA   1 1 
       1053 1 2 1 1 50 ASP H    . 50 . HN   1 1 
       1054 1 1 1 1 49 VAL HA   . 49 . HA   1 1 
       1054 1 2 1 1 50 ASP HB2  . 50 . HB2  1 1 
       1055 1 1 1 1 49 VAL HA   . 49 . HA   1 1 
       1055 1 2 1 1 50 ASP QB   . 50 . HB*  1 1 
       1056 1 1 1 1 49 VAL HA   . 49 . HA   1 1 
       1056 1 2 1 1 50 ASP HB3  . 50 . HB1  1 1 
       1057 1 1 1 1 49 VAL HA   . 49 . HA   1 1 
       1057 1 2 1 1 65 TYR HA   . 65 . HA   1 1 
       1058 1 1 1 1 49 VAL HA   . 49 . HA   1 1 
       1058 1 2 1 1 65 TYR QD   . 65 . HD*  1 1 
       1059 1 1 1 1 49 VAL HA   . 49 . HA   1 1 
       1059 1 2 1 1 66 THR H    . 66 . HN   1 1 
       1060 1 1 1 1 49 VAL HB   . 49 . HB   1 1 
       1060 1 2 1 1 50 ASP H    . 50 . HN   1 1 
       1061 1 1 1 1 49 VAL MG1  . 49 . HG1* 1 1 
       1061 1 2 1 1 50 ASP H    . 50 . HN   1 1 
       1062 1 1 1 1 49 VAL MG1  . 49 . HG1* 1 1 
       1062 1 2 1 1 50 ASP HA   . 50 . HA   1 1 
       1063 1 1 1 1 49 VAL MG1  . 49 . HG1* 1 1 
       1063 1 2 1 1 51 GLY H    . 51 . HN   1 1 
       1064 1 1 1 1 49 VAL MG1  . 49 . HG1* 1 1 
       1064 1 2 1 1 63 LEU HB3  . 63 . HB1  1 1 
       1065 1 1 1 1 49 VAL MG1  . 49 . HG1* 1 1 
       1065 1 2 1 1 63 LEU MD1  . 63 . HD1* 1 1 
       1066 1 1 1 1 49 VAL MG1  . 49 . HG1* 1 1 
       1066 1 2 1 1 64 THR H    . 64 . HN   1 1 
       1067 1 1 1 1 49 VAL MG1  . 49 . HG1* 1 1 
       1067 1 2 1 1 65 TYR HA   . 65 . HA   1 1 
       1068 1 1 1 1 49 VAL MG1  . 49 . HG1* 1 1 
       1068 1 2 1 1 65 TYR QD   . 65 . HD*  1 1 
       1069 1 1 1 1 49 VAL MG1  . 49 . HG1* 1 1 
       1069 1 2 1 1 65 TYR QE   . 65 . HE*  1 1 
       1070 1 1 1 1 49 VAL MG2  . 49 . HG2* 1 1 
       1070 1 2 1 1 50 ASP H    . 50 . HN   1 1 
       1071 1 1 1 1 49 VAL MG2  . 49 . HG2* 1 1 
       1071 1 2 1 1 65 TYR HA   . 65 . HA   1 1 
       1072 1 1 1 1 49 VAL MG2  . 49 . HG2* 1 1 
       1072 1 2 1 1 65 TYR QD   . 65 . HD*  1 1 
       1073 1 1 1 1 49 VAL MG2  . 49 . HG2* 1 1 
       1073 1 2 1 1 65 TYR QE   . 65 . HE*  1 1 
       1074 1 1 1 1 50 ASP H    . 50 . HN   1 1 
       1074 1 2 1 1 50 ASP HB2  . 50 . HB2  1 1 
       1075 1 1 1 1 50 ASP H    . 50 . HN   1 1 
       1075 1 2 1 1 50 ASP HB3  . 50 . HB1  1 1 
       1076 1 1 1 1 50 ASP H    . 50 . HN   1 1 
       1076 1 2 1 1 51 GLY H    . 51 . HN   1 1 
       1077 1 1 1 1 50 ASP H    . 50 . HN   1 1 
       1077 1 2 1 1 64 THR H    . 64 . HN   1 1 
       1078 1 1 1 1 50 ASP H    . 50 . HN   1 1 
       1078 1 2 1 1 64 THR HB   . 64 . HB   1 1 
       1079 1 1 1 1 50 ASP H    . 50 . HN   1 1 
       1079 1 2 1 1 64 THR MG   . 64 . HG2* 1 1 
       1080 1 1 1 1 50 ASP H    . 50 . HN   1 1 
       1080 1 2 1 1 65 TYR H    . 65 . HN   1 1 
       1081 1 1 1 1 50 ASP H    . 50 . HN   1 1 
       1081 1 2 1 1 65 TYR HA   . 65 . HA   1 1 
       1082 1 1 1 1 50 ASP H    . 50 . HN   1 1 
       1082 1 2 1 1 65 TYR QD   . 65 . HD*  1 1 
       1083 1 1 1 1 50 ASP H    . 50 . HN   1 1 
       1083 1 2 1 1 66 THR H    . 66 . HN   1 1 
       1084 1 1 1 1 50 ASP HA   . 50 . HA   1 1 
       1084 1 2 1 1 51 GLY H    . 51 . HN   1 1 
       1085 1 1 1 1 50 ASP HA   . 50 . HA   1 1 
       1085 1 2 1 1 51 GLY HA2  . 51 . HA2  1 1 
       1086 1 1 1 1 50 ASP QB   . 50 . HB*  1 1 
       1086 1 2 1 1 51 GLY H    . 51 . HN   1 1 
       1087 1 1 1 1 50 ASP QB   . 50 . HB*  1 1 
       1087 1 2 1 1 64 THR H    . 64 . HN   1 1 
       1088 1 1 1 1 50 ASP HB2  . 50 . HB2  1 1 
       1088 1 2 1 1 51 GLY H    . 51 . HN   1 1 
       1089 1 1 1 1 50 ASP HB2  . 50 . HB2  1 1 
       1089 1 2 1 1 64 THR H    . 64 . HN   1 1 
       1090 1 1 1 1 50 ASP HB2  . 50 . HB2  1 1 
       1090 1 2 1 1 64 THR HB   . 64 . HB   1 1 
       1091 1 1 1 1 50 ASP HB2  . 50 . HB2  1 1 
       1091 1 2 1 1 64 THR MG   . 64 . HG2* 1 1 
       1092 1 1 1 1 50 ASP HB3  . 50 . HB1  1 1 
       1092 1 2 1 1 51 GLY H    . 51 . HN   1 1 
       1093 1 1 1 1 50 ASP HB3  . 50 . HB1  1 1 
       1093 1 2 1 1 64 THR H    . 64 . HN   1 1 
       1094 1 1 1 1 50 ASP HB3  . 50 . HB1  1 1 
       1094 1 2 1 1 64 THR HB   . 64 . HB   1 1 
       1095 1 1 1 1 50 ASP HB3  . 50 . HB1  1 1 
       1095 1 2 1 1 64 THR MG   . 64 . HG2* 1 1 
       1096 1 1 1 1 51 GLY H    . 51 . HN   1 1 
       1096 1 2 1 1 52 GLU H    . 52 . HN   1 1 
       1097 1 1 1 1 51 GLY H    . 51 . HN   1 1 
       1097 1 2 1 1 52 GLU QB   . 52 . HB*  1 1 
       1098 1 1 1 1 51 GLY H    . 51 . HN   1 1 
       1098 1 2 1 1 63 LEU MD2  . 63 . HD2* 1 1 
       1099 1 1 1 1 51 GLY HA2  . 51 . HA2  1 1 
       1099 1 2 1 1 52 GLU H    . 52 . HN   1 1 
       1100 1 1 1 1 51 GLY HA2  . 51 . HA2  1 1 
       1100 1 2 1 1 63 LEU HA   . 63 . HA   1 1 
       1101 1 1 1 1 51 GLY HA2  . 51 . HA2  1 1 
       1101 1 2 1 1 63 LEU MD2  . 63 . HD2* 1 1 
       1102 1 1 1 1 51 GLY HA3  . 51 . HA1  1 1 
       1102 1 2 1 1 52 GLU H    . 52 . HN   1 1 
       1103 1 1 1 1 51 GLY HA3  . 51 . HA1  1 1 
       1103 1 2 1 1 63 LEU MD1  . 63 . HD1* 1 1 
       1104 1 1 1 1 51 GLY HA3  . 51 . HA1  1 1 
       1104 1 2 1 1 64 THR H    . 64 . HN   1 1 
       1105 1 1 1 1 52 GLU H    . 52 . HN   1 1 
       1105 1 2 1 1 52 GLU QB   . 52 . HB*  1 1 
       1106 1 1 1 1 52 GLU H    . 52 . HN   1 1 
       1106 1 2 1 1 52 GLU HG2  . 52 . HG2  1 1 
       1107 1 1 1 1 52 GLU H    . 52 . HN   1 1 
       1107 1 2 1 1 52 GLU QG   . 52 . HG*  1 1 
       1108 1 1 1 1 52 GLU H    . 52 . HN   1 1 
       1108 1 2 1 1 52 GLU HG3  . 52 . HG1  1 1 
       1109 1 1 1 1 52 GLU H    . 52 . HN   1 1 
       1109 1 2 1 1 53 VAL H    . 53 . HN   1 1 
       1110 1 1 1 1 52 GLU H    . 52 . HN   1 1 
       1110 1 2 1 1 53 VAL MG2  . 53 . HG2* 1 1 
       1111 1 1 1 1 52 GLU H    . 52 . HN   1 1 
       1111 1 2 1 1 63 LEU HA   . 63 . HA   1 1 
       1112 1 1 1 1 52 GLU H    . 52 . HN   1 1 
       1112 1 2 1 1 63 LEU MD1  . 63 . HD1* 1 1 
       1113 1 1 1 1 52 GLU H    . 52 . HN   1 1 
       1113 1 2 1 1 63 LEU MD2  . 63 . HD2* 1 1 
       1114 1 1 1 1 52 GLU HA   . 52 . HA   1 1 
       1114 1 2 1 1 52 GLU QG   . 52 . HG*  1 1 
       1115 1 1 1 1 52 GLU HA   . 52 . HA   1 1 
       1115 1 2 1 1 53 VAL H    . 53 . HN   1 1 
       1116 1 1 1 1 52 GLU HA   . 52 . HA   1 1 
       1116 1 2 1 1 53 VAL MG2  . 53 . HG2* 1 1 
       1117 1 1 1 1 52 GLU HA   . 52 . HA   1 1 
       1117 1 2 1 1 63 LEU MD1  . 63 . HD1* 1 1 
       1118 1 1 1 1 52 GLU HA   . 52 . HA   1 1 
       1118 1 2 1 1 63 LEU MD2  . 63 . HD2* 1 1 
       1119 1 1 1 1 52 GLU QB   . 52 . HB*  1 1 
       1119 1 2 1 1 53 VAL H    . 53 . HN   1 1 
       1120 1 1 1 1 52 GLU QB   . 52 . HB*  1 1 
       1120 1 2 1 1 54 ASP H    . 54 . HN   1 1 
       1121 1 1 1 1 52 GLU QG   . 52 . HG*  1 1 
       1121 1 2 1 1 53 VAL H    . 53 . HN   1 1 
       1122 1 1 1 1 53 VAL H    . 53 . HN   1 1 
       1122 1 2 1 1 53 VAL HB   . 53 . HB   1 1 
       1123 1 1 1 1 53 VAL H    . 53 . HN   1 1 
       1123 1 2 1 1 53 VAL MG1  . 53 . HG1* 1 1 
       1124 1 1 1 1 53 VAL H    . 53 . HN   1 1 
       1124 1 2 1 1 53 VAL MG2  . 53 . HG2* 1 1 
       1125 1 1 1 1 53 VAL H    . 53 . HN   1 1 
       1125 1 2 1 1 54 ASP H    . 54 . HN   1 1 
       1126 1 1 1 1 53 VAL H    . 53 . HN   1 1 
       1126 1 2 1 1 61 TYR QD   . 61 . HD*  1 1 
       1127 1 1 1 1 53 VAL H    . 53 . HN   1 1 
       1127 1 2 1 1 63 LEU MD1  . 63 . HD1* 1 1 
       1128 1 1 1 1 53 VAL H    . 53 . HN   1 1 
       1128 1 2 1 1 63 LEU MD2  . 63 . HD2* 1 1 
       1129 1 1 1 1 53 VAL HA   . 53 . HA   1 1 
       1129 1 2 1 1 54 ASP H    . 54 . HN   1 1 
       1130 1 1 1 1 53 VAL HA   . 53 . HA   1 1 
       1130 1 2 1 1 54 ASP QB   . 54 . HB*  1 1 
       1131 1 1 1 1 53 VAL HA   . 53 . HA   1 1 
       1131 1 2 1 1 61 TYR QB   . 61 . HB*  1 1 
       1132 1 1 1 1 53 VAL HA   . 53 . HA   1 1 
       1132 1 2 1 1 61 TYR QD   . 61 . HD*  1 1 
       1133 1 1 1 1 53 VAL HA   . 53 . HA   1 1 
       1133 1 2 1 1 61 TYR QE   . 61 . HE*  1 1 
       1134 1 1 1 1 53 VAL HA   . 53 . HA   1 1 
       1134 1 2 1 1 63 LEU MD2  . 63 . HD2* 1 1 
       1135 1 1 1 1 53 VAL HA   . 53 . HA   1 1 
       1135 1 2 1 1 83 VAL MG2  . 83 . HG2* 1 1 
       1136 1 1 1 1 53 VAL HB   . 53 . HB   1 1 
       1136 1 2 1 1 54 ASP H    . 54 . HN   1 1 
       1137 1 1 1 1 53 VAL HB   . 53 . HB   1 1 
       1137 1 2 1 1 63 LEU MD2  . 63 . HD2* 1 1 
       1138 1 1 1 1 53 VAL MG1  . 53 . HG1* 1 1 
       1138 1 2 1 1 54 ASP H    . 54 . HN   1 1 
       1139 1 1 1 1 53 VAL MG1  . 53 . HG1* 1 1 
       1139 1 2 1 1 54 ASP HA   . 54 . HA   1 1 
       1140 1 1 1 1 53 VAL MG1  . 53 . HG1* 1 1 
       1140 1 2 1 1 55 THR H    . 55 . HN   1 1 
       1141 1 1 1 1 53 VAL MG1  . 53 . HG1* 1 1 
       1141 1 2 1 1 55 THR HA   . 55 . HA   1 1 
       1142 1 1 1 1 53 VAL MG1  . 53 . HG1* 1 1 
       1142 1 2 1 1 55 THR MG   . 55 . HG2* 1 1 
       1143 1 1 1 1 53 VAL MG1  . 53 . HG1* 1 1 
       1143 1 2 1 1 61 TYR QB   . 61 . HB*  1 1 
       1144 1 1 1 1 53 VAL MG1  . 53 . HG1* 1 1 
       1144 1 2 1 1 61 TYR QD   . 61 . HD*  1 1 
       1145 1 1 1 1 53 VAL MG1  . 53 . HG1* 1 1 
       1145 1 2 1 1 61 TYR QE   . 61 . HE*  1 1 
       1146 1 1 1 1 53 VAL MG1  . 53 . HG1* 1 1 
       1146 1 2 1 1 63 LEU MD2  . 63 . HD2* 1 1 
       1147 1 1 1 1 53 VAL MG1  . 53 . HG1* 1 1 
       1147 1 2 1 1 81 VAL MG1  . 81 . HG1* 1 1 
       1148 1 1 1 1 53 VAL MG1  . 53 . HG1* 1 1 
       1148 1 2 1 1 81 VAL MG2  . 81 . HG2* 1 1 
       1149 1 1 1 1 53 VAL MG1  . 53 . HG1* 1 1 
       1149 1 2 1 1 83 VAL MG2  . 83 . HG2* 1 1 
       1150 1 1 1 1 53 VAL MG2  . 53 . HG2* 1 1 
       1150 1 2 1 1 54 ASP H    . 54 . HN   1 1 
       1151 1 1 1 1 53 VAL MG2  . 53 . HG2* 1 1 
       1151 1 2 1 1 55 THR MG   . 55 . HG2* 1 1 
       1152 1 1 1 1 53 VAL MG2  . 53 . HG2* 1 1 
       1152 1 2 1 1 61 TYR H    . 61 . HN   1 1 
       1153 1 1 1 1 53 VAL MG2  . 53 . HG2* 1 1 
       1153 1 2 1 1 61 TYR HB2  . 61 . HB2  1 1 
       1154 1 1 1 1 53 VAL MG2  . 53 . HG2* 1 1 
       1154 1 2 1 1 61 TYR QB   . 61 . HB*  1 1 
       1155 1 1 1 1 53 VAL MG2  . 53 . HG2* 1 1 
       1155 1 2 1 1 61 TYR HB3  . 61 . HB1  1 1 
       1156 1 1 1 1 53 VAL MG2  . 53 . HG2* 1 1 
       1156 1 2 1 1 61 TYR QD   . 61 . HD*  1 1 
       1157 1 1 1 1 53 VAL MG2  . 53 . HG2* 1 1 
       1157 1 2 1 1 63 LEU MD1  . 63 . HD1* 1 1 
       1158 1 1 1 1 53 VAL MG2  . 53 . HG2* 1 1 
       1158 1 2 1 1 63 LEU MD2  . 63 . HD2* 1 1 
       1159 1 1 1 1 53 VAL MG2  . 53 . HG2* 1 1 
       1159 1 2 1 1 63 LEU HG   . 63 . HG   1 1 
       1160 1 1 1 1 53 VAL MG2  . 53 . HG2* 1 1 
       1160 1 2 1 1 81 VAL HB   . 81 . HB   1 1 
       1161 1 1 1 1 53 VAL MG2  . 53 . HG2* 1 1 
       1161 1 2 1 1 81 VAL MG1  . 81 . HG1* 1 1 
       1162 1 1 1 1 54 ASP H    . 54 . HN   1 1 
       1162 1 2 1 1 54 ASP HB2  . 54 . HB2  1 1 
       1163 1 1 1 1 54 ASP H    . 54 . HN   1 1 
       1163 1 2 1 1 54 ASP QB   . 54 . HB*  1 1 
       1164 1 1 1 1 54 ASP H    . 54 . HN   1 1 
       1164 1 2 1 1 54 ASP HB3  . 54 . HB1  1 1 
       1165 1 1 1 1 54 ASP H    . 54 . HN   1 1 
       1165 1 2 1 1 55 THR H    . 55 . HN   1 1 
       1166 1 1 1 1 54 ASP H    . 54 . HN   1 1 
       1166 1 2 1 1 55 THR MG   . 55 . HG2* 1 1 
       1167 1 1 1 1 54 ASP H    . 54 . HN   1 1 
       1167 1 2 1 1 61 TYR QB   . 61 . HB*  1 1 
       1168 1 1 1 1 54 ASP H    . 54 . HN   1 1 
       1168 1 2 1 1 61 TYR QD   . 61 . HD*  1 1 
       1169 1 1 1 1 54 ASP H    . 54 . HN   1 1 
       1169 1 2 1 1 61 TYR QE   . 61 . HE*  1 1 
       1170 1 1 1 1 54 ASP H    . 54 . HN   1 1 
       1170 1 2 1 1 83 VAL MG2  . 83 . HG2* 1 1 
       1171 1 1 1 1 54 ASP HA   . 54 . HA   1 1 
       1171 1 2 1 1 55 THR H    . 55 . HN   1 1 
       1172 1 1 1 1 54 ASP HA   . 54 . HA   1 1 
       1172 1 2 1 1 55 THR HA   . 55 . HA   1 1 
       1173 1 1 1 1 54 ASP HA   . 54 . HA   1 1 
       1173 1 2 1 1 55 THR MG   . 55 . HG2* 1 1 
       1174 1 1 1 1 54 ASP HA   . 54 . HA   1 1 
       1174 1 2 1 1 56 THR H    . 56 . HN   1 1 
       1175 1 1 1 1 54 ASP QB   . 54 . HB*  1 1 
       1175 1 2 1 1 55 THR H    . 55 . HN   1 1 
       1176 1 1 1 1 54 ASP QB   . 54 . HB*  1 1 
       1176 1 2 1 1 57 LYS H    . 57 . HN   1 1 
       1177 1 1 1 1 54 ASP QB   . 54 . HB*  1 1 
       1177 1 2 1 1 57 LYS QB   . 57 . HB*  1 1 
       1178 1 1 1 1 54 ASP QB   . 54 . HB*  1 1 
       1178 1 2 1 1 61 TYR QE   . 61 . HE*  1 1 
       1179 1 1 1 1 54 ASP HB2  . 54 . HB2  1 1 
       1179 1 2 1 1 55 THR H    . 55 . HN   1 1 
       1180 1 1 1 1 54 ASP HB2  . 54 . HB2  1 1 
       1180 1 2 1 1 57 LYS H    . 57 . HN   1 1 
       1181 1 1 1 1 54 ASP HB2  . 54 . HB2  1 1 
       1181 1 2 1 1 57 LYS HB2  . 57 . HB2  1 1 
       1182 1 1 1 1 54 ASP HB2  . 54 . HB2  1 1 
       1182 1 2 1 1 57 LYS HB3  . 57 . HB1  1 1 
       1183 1 1 1 1 54 ASP HB2  . 54 . HB2  1 1 
       1183 1 2 1 1 61 TYR QE   . 61 . HE*  1 1 
       1184 1 1 1 1 54 ASP HB3  . 54 . HB1  1 1 
       1184 1 2 1 1 55 THR H    . 55 . HN   1 1 
       1185 1 1 1 1 54 ASP HB3  . 54 . HB1  1 1 
       1185 1 2 1 1 57 LYS H    . 57 . HN   1 1 
       1186 1 1 1 1 54 ASP HB3  . 54 . HB1  1 1 
       1186 1 2 1 1 57 LYS HB2  . 57 . HB2  1 1 
       1187 1 1 1 1 54 ASP HB3  . 54 . HB1  1 1 
       1187 1 2 1 1 57 LYS HB3  . 57 . HB1  1 1 
       1188 1 1 1 1 54 ASP HB3  . 54 . HB1  1 1 
       1188 1 2 1 1 61 TYR QE   . 61 . HE*  1 1 
       1189 1 1 1 1 55 THR H    . 55 . HN   1 1 
       1189 1 2 1 1 55 THR MG   . 55 . HG2* 1 1 
       1190 1 1 1 1 55 THR H    . 55 . HN   1 1 
       1190 1 2 1 1 56 THR H    . 56 . HN   1 1 
       1191 1 1 1 1 55 THR H    . 55 . HN   1 1 
       1191 1 2 1 1 56 THR HA   . 56 . HA   1 1 
       1192 1 1 1 1 55 THR H    . 55 . HN   1 1 
       1192 1 2 1 1 56 THR MG   . 56 . HG2* 1 1 
       1193 1 1 1 1 55 THR H    . 55 . HN   1 1 
       1193 1 2 1 1 57 LYS H    . 57 . HN   1 1 
       1194 1 1 1 1 55 THR H    . 55 . HN   1 1 
       1194 1 2 1 1 83 VAL MG2  . 83 . HG2* 1 1 
       1195 1 1 1 1 55 THR HA   . 55 . HA   1 1 
       1195 1 2 1 1 55 THR MG   . 55 . HG2* 1 1 
       1196 1 1 1 1 55 THR HA   . 55 . HA   1 1 
       1196 1 2 1 1 57 LYS H    . 57 . HN   1 1 
       1197 1 1 1 1 55 THR HA   . 55 . HA   1 1 
       1197 1 2 1 1 83 VAL MG1  . 83 . HG1* 1 1 
       1198 1 1 1 1 55 THR HA   . 55 . HA   1 1 
       1198 1 2 1 1 83 VAL MG2  . 83 . HG2* 1 1 
       1199 1 1 1 1 55 THR HB   . 55 . HB   1 1 
       1199 1 2 1 1 56 THR H    . 56 . HN   1 1 
       1200 1 1 1 1 55 THR MG   . 55 . HG2* 1 1 
       1200 1 2 1 1 83 VAL MG1  . 83 . HG1* 1 1 
       1201 1 1 1 1 55 THR MG   . 55 . HG2* 1 1 
       1201 1 2 1 1 83 VAL MG2  . 83 . HG2* 1 1 
       1202 1 1 1 1 56 THR H    . 56 . HN   1 1 
       1202 1 2 1 1 56 THR MG   . 56 . HG2* 1 1 
       1203 1 1 1 1 56 THR H    . 56 . HN   1 1 
       1203 1 2 1 1 57 LYS H    . 57 . HN   1 1 
       1204 1 1 1 1 56 THR H    . 56 . HN   1 1 
       1204 1 2 1 1 57 LYS HB2  . 57 . HB2  1 1 
       1205 1 1 1 1 56 THR H    . 56 . HN   1 1 
       1205 1 2 1 1 57 LYS HB3  . 57 . HB1  1 1 
       1206 1 1 1 1 56 THR HA   . 56 . HA   1 1 
       1206 1 2 1 1 56 THR MG   . 56 . HG2* 1 1 
       1207 1 1 1 1 56 THR MG   . 56 . HG2* 1 1 
       1207 1 2 1 1 57 LYS H    . 57 . HN   1 1 
       1208 1 1 1 1 57 LYS H    . 57 . HN   1 1 
       1208 1 2 1 1 57 LYS HB2  . 57 . HB2  1 1 
       1209 1 1 1 1 57 LYS H    . 57 . HN   1 1 
       1209 1 2 1 1 57 LYS HB3  . 57 . HB1  1 1 
       1210 1 1 1 1 57 LYS H    . 57 . HN   1 1 
       1210 1 2 1 1 57 LYS HG2  . 57 . HG2  1 1 
       1211 1 1 1 1 57 LYS H    . 57 . HN   1 1 
       1211 1 2 1 1 57 LYS QG   . 57 . HG*  1 1 
       1212 1 1 1 1 57 LYS H    . 57 . HN   1 1 
       1212 1 2 1 1 57 LYS HG3  . 57 . HG1  1 1 
       1213 1 1 1 1 57 LYS H    . 57 . HN   1 1 
       1213 1 2 1 1 58 ALA H    . 58 . HN   1 1 
       1214 1 1 1 1 57 LYS H    . 57 . HN   1 1 
       1214 1 2 1 1 83 VAL MG1  . 83 . HG1* 1 1 
       1215 1 1 1 1 57 LYS HA   . 57 . HA   1 1 
       1215 1 2 1 1 57 LYS QD   . 57 . HD*  1 1 
       1216 1 1 1 1 57 LYS HA   . 57 . HA   1 1 
       1216 1 2 1 1 57 LYS HG2  . 57 . HG2  1 1 
       1217 1 1 1 1 57 LYS HA   . 57 . HA   1 1 
       1217 1 2 1 1 57 LYS QG   . 57 . HG*  1 1 
       1218 1 1 1 1 57 LYS HA   . 57 . HA   1 1 
       1218 1 2 1 1 57 LYS HG3  . 57 . HG1  1 1 
       1219 1 1 1 1 57 LYS HA   . 57 . HA   1 1 
       1219 1 2 1 1 58 ALA H    . 58 . HN   1 1 
       1220 1 1 1 1 57 LYS HA   . 57 . HA   1 1 
       1220 1 2 1 1 58 ALA MB   . 58 . HB*  1 1 
       1221 1 1 1 1 57 LYS QB   . 57 . HB*  1 1 
       1221 1 2 1 1 57 LYS QG   . 57 . HG*  1 1 
       1222 1 1 1 1 57 LYS QB   . 57 . HB*  1 1 
       1222 1 2 1 1 58 ALA H    . 58 . HN   1 1 
       1223 1 1 1 1 57 LYS HB2  . 57 . HB2  1 1 
       1223 1 2 1 1 58 ALA H    . 58 . HN   1 1 
       1224 1 1 1 1 57 LYS HB3  . 57 . HB1  1 1 
       1224 1 2 1 1 58 ALA H    . 58 . HN   1 1 
       1225 1 1 1 1 57 LYS QD   . 57 . HD*  1 1 
       1225 1 2 1 1 58 ALA H    . 58 . HN   1 1 
       1226 1 1 1 1 57 LYS QG   . 57 . HG*  1 1 
       1226 1 2 1 1 58 ALA H    . 58 . HN   1 1 
       1227 1 1 1 1 57 LYS HG2  . 57 . HG2  1 1 
       1227 1 2 1 1 58 ALA H    . 58 . HN   1 1 
       1228 1 1 1 1 57 LYS HG3  . 57 . HG1  1 1 
       1228 1 2 1 1 58 ALA H    . 58 . HN   1 1 
       1229 1 1 1 1 58 ALA H    . 58 . HN   1 1 
       1229 1 2 1 1 58 ALA MB   . 58 . HB*  1 1 
       1230 1 1 1 1 58 ALA H    . 58 . HN   1 1 
       1230 1 2 1 1 83 VAL MG1  . 83 . HG1* 1 1 
       1231 1 1 1 1 58 ALA H    . 58 . HN   1 1 
       1231 1 2 1 1 85 VAL MG1  . 85 . HG1* 1 1 
       1232 1 1 1 1 58 ALA H    . 58 . HN   1 1 
       1232 1 2 1 1 85 VAL MG2  . 85 . HG2* 1 1 
       1233 1 1 1 1 58 ALA HA   . 58 . HA   1 1 
       1233 1 2 1 1 59 GLY H    . 59 . HN   1 1 
       1234 1 1 1 1 58 ALA HA   . 58 . HA   1 1 
       1234 1 2 1 1 61 TYR QE   . 61 . HE*  1 1 
       1235 1 1 1 1 58 ALA HA   . 58 . HA   1 1 
       1235 1 2 1 1 83 VAL H    . 83 . HN   1 1 
       1236 1 1 1 1 58 ALA HA   . 58 . HA   1 1 
       1236 1 2 1 1 83 VAL HB   . 83 . HB   1 1 
       1237 1 1 1 1 58 ALA HA   . 58 . HA   1 1 
       1237 1 2 1 1 83 VAL MG1  . 83 . HG1* 1 1 
       1238 1 1 1 1 58 ALA HA   . 58 . HA   1 1 
       1238 1 2 1 1 83 VAL MG2  . 83 . HG2* 1 1 
       1239 1 1 1 1 58 ALA HA   . 58 . HA   1 1 
       1239 1 2 1 1 85 VAL MG1  . 85 . HG1* 1 1 
       1240 1 1 1 1 58 ALA MB   . 58 . HB*  1 1 
       1240 1 2 1 1 59 GLY H    . 59 . HN   1 1 
       1241 1 1 1 1 58 ALA MB   . 58 . HB*  1 1 
       1241 1 2 1 1 60 THR H    . 60 . HN   1 1 
       1242 1 1 1 1 58 ALA MB   . 58 . HB*  1 1 
       1242 1 2 1 1 83 VAL H    . 83 . HN   1 1 
       1243 1 1 1 1 58 ALA MB   . 58 . HB*  1 1 
       1243 1 2 1 1 83 VAL HA   . 83 . HA   1 1 
       1244 1 1 1 1 58 ALA MB   . 58 . HB*  1 1 
       1244 1 2 1 1 83 VAL HB   . 83 . HB   1 1 
       1245 1 1 1 1 58 ALA MB   . 58 . HB*  1 1 
       1245 1 2 1 1 83 VAL MG1  . 83 . HG1* 1 1 
       1246 1 1 1 1 58 ALA MB   . 58 . HB*  1 1 
       1246 1 2 1 1 84 LYS HA   . 84 . HA   1 1 
       1247 1 1 1 1 58 ALA MB   . 58 . HB*  1 1 
       1247 1 2 1 1 85 VAL H    . 85 . HN   1 1 
       1248 1 1 1 1 58 ALA MB   . 58 . HB*  1 1 
       1248 1 2 1 1 85 VAL HA   . 85 . HA   1 1 
       1249 1 1 1 1 58 ALA MB   . 58 . HB*  1 1 
       1249 1 2 1 1 85 VAL HB   . 85 . HB   1 1 
       1250 1 1 1 1 58 ALA MB   . 58 . HB*  1 1 
       1250 1 2 1 1 85 VAL MG2  . 85 . HG2* 1 1 
       1251 1 1 1 1 59 GLY H    . 59 . HN   1 1 
       1251 1 2 1 1 60 THR H    . 60 . HN   1 1 
       1252 1 1 1 1 59 GLY H    . 59 . HN   1 1 
       1252 1 2 1 1 61 TYR QE   . 61 . HE*  1 1 
       1253 1 1 1 1 59 GLY H    . 59 . HN   1 1 
       1253 1 2 1 1 83 VAL H    . 83 . HN   1 1 
       1254 1 1 1 1 59 GLY H    . 59 . HN   1 1 
       1254 1 2 1 1 83 VAL HB   . 83 . HB   1 1 
       1255 1 1 1 1 59 GLY H    . 59 . HN   1 1 
       1255 1 2 1 1 83 VAL MG1  . 83 . HG1* 1 1 
       1256 1 1 1 1 59 GLY H    . 59 . HN   1 1 
       1256 1 2 1 1 83 VAL MG2  . 83 . HG2* 1 1 
       1257 1 1 1 1 59 GLY H    . 59 . HN   1 1 
       1257 1 2 1 1 84 LYS HA   . 84 . HA   1 1 
       1258 1 1 1 1 59 GLY H    . 59 . HN   1 1 
       1258 1 2 1 1 85 VAL MG2  . 85 . HG2* 1 1 
       1259 1 1 1 1 59 GLY QA   . 59 . HA*  1 1 
       1259 1 2 1 1 60 THR H    . 60 . HN   1 1 
       1260 1 1 1 1 59 GLY QA   . 59 . HA*  1 1 
       1260 1 2 1 1 61 TYR QE   . 61 . HE*  1 1 
       1261 1 1 1 1 59 GLY QA   . 59 . HA*  1 1 
       1261 1 2 1 1 83 VAL H    . 83 . HN   1 1 
       1262 1 1 1 1 59 GLY QA   . 59 . HA*  1 1 
       1262 1 2 1 1 83 VAL MG2  . 83 . HG2* 1 1 
       1263 1 1 1 1 59 GLY HA2  . 59 . HA2  1 1 
       1263 1 2 1 1 60 THR H    . 60 . HN   1 1 
       1264 1 1 1 1 59 GLY HA3  . 59 . HA1  1 1 
       1264 1 2 1 1 60 THR H    . 60 . HN   1 1 
       1265 1 1 1 1 60 THR H    . 60 . HN   1 1 
       1265 1 2 1 1 60 THR HB   . 60 . HB   1 1 
       1266 1 1 1 1 60 THR H    . 60 . HN   1 1 
       1266 1 2 1 1 60 THR MG   . 60 . HG2* 1 1 
       1267 1 1 1 1 60 THR H    . 60 . HN   1 1 
       1267 1 2 1 1 61 TYR H    . 61 . HN   1 1 
       1268 1 1 1 1 60 THR H    . 60 . HN   1 1 
       1268 1 2 1 1 82 THR HA   . 82 . HA   1 1 
       1269 1 1 1 1 60 THR H    . 60 . HN   1 1 
       1269 1 2 1 1 83 VAL H    . 83 . HN   1 1 
       1270 1 1 1 1 60 THR HA   . 60 . HA   1 1 
       1270 1 2 1 1 60 THR MG   . 60 . HG2* 1 1 
       1271 1 1 1 1 60 THR HA   . 60 . HA   1 1 
       1271 1 2 1 1 61 TYR H    . 61 . HN   1 1 
       1272 1 1 1 1 60 THR HB   . 60 . HB   1 1 
       1272 1 2 1 1 61 TYR H    . 61 . HN   1 1 
       1273 1 1 1 1 60 THR HB   . 60 . HB   1 1 
       1273 1 2 1 1 82 THR HA   . 82 . HA   1 1 
       1274 1 1 1 1 60 THR MG   . 60 . HG2* 1 1 
       1274 1 2 1 1 61 TYR H    . 61 . HN   1 1 
       1275 1 1 1 1 60 THR MG   . 60 . HG2* 1 1 
       1275 1 2 1 1 81 VAL H    . 81 . HN   1 1 
       1276 1 1 1 1 60 THR MG   . 60 . HG2* 1 1 
       1276 1 2 1 1 81 VAL HB   . 81 . HB   1 1 
       1277 1 1 1 1 60 THR MG   . 60 . HG2* 1 1 
       1277 1 2 1 1 82 THR H    . 82 . HN   1 1 
       1278 1 1 1 1 60 THR MG   . 60 . HG2* 1 1 
       1278 1 2 1 1 82 THR HA   . 82 . HA   1 1 
       1279 1 1 1 1 61 TYR H    . 61 . HN   1 1 
       1279 1 2 1 1 61 TYR QB   . 61 . HB*  1 1 
       1280 1 1 1 1 61 TYR H    . 61 . HN   1 1 
       1280 1 2 1 1 61 TYR QD   . 61 . HD*  1 1 
       1281 1 1 1 1 61 TYR H    . 61 . HN   1 1 
       1281 1 2 1 1 61 TYR QE   . 61 . HE*  1 1 
       1282 1 1 1 1 61 TYR H    . 61 . HN   1 1 
       1282 1 2 1 1 62 VAL H    . 62 . HN   1 1 
       1283 1 1 1 1 61 TYR H    . 61 . HN   1 1 
       1283 1 2 1 1 81 VAL H    . 81 . HN   1 1 
       1284 1 1 1 1 61 TYR H    . 61 . HN   1 1 
       1284 1 2 1 1 81 VAL HB   . 81 . HB   1 1 
       1285 1 1 1 1 61 TYR H    . 61 . HN   1 1 
       1285 1 2 1 1 82 THR H    . 82 . HN   1 1 
       1286 1 1 1 1 61 TYR H    . 61 . HN   1 1 
       1286 1 2 1 1 82 THR HA   . 82 . HA   1 1 
       1287 1 1 1 1 61 TYR HA   . 61 . HA   1 1 
       1287 1 2 1 1 62 VAL H    . 62 . HN   1 1 
       1288 1 1 1 1 61 TYR QB   . 61 . HB*  1 1 
       1288 1 2 1 1 62 VAL H    . 62 . HN   1 1 
       1289 1 1 1 1 61 TYR QB   . 61 . HB*  1 1 
       1289 1 2 1 1 63 LEU MD2  . 63 . HD2* 1 1 
       1290 1 1 1 1 61 TYR QB   . 61 . HB*  1 1 
       1290 1 2 1 1 81 VAL HB   . 81 . HB   1 1 
       1291 1 1 1 1 61 TYR QB   . 61 . HB*  1 1 
       1291 1 2 1 1 81 VAL MG1  . 81 . HG1* 1 1 
       1292 1 1 1 1 61 TYR QB   . 61 . HB*  1 1 
       1292 1 2 1 1 81 VAL MG2  . 81 . HG2* 1 1 
       1293 1 1 1 1 61 TYR HB2  . 61 . HB2  1 1 
       1293 1 2 1 1 62 VAL H    . 62 . HN   1 1 
       1294 1 1 1 1 61 TYR HB2  . 61 . HB2  1 1 
       1294 1 2 1 1 81 VAL HB   . 81 . HB   1 1 
       1295 1 1 1 1 61 TYR HB3  . 61 . HB1  1 1 
       1295 1 2 1 1 62 VAL H    . 62 . HN   1 1 
       1296 1 1 1 1 61 TYR HB3  . 61 . HB1  1 1 
       1296 1 2 1 1 81 VAL HB   . 81 . HB   1 1 
       1297 1 1 1 1 61 TYR QD   . 61 . HD*  1 1 
       1297 1 2 1 1 62 VAL H    . 62 . HN   1 1 
       1298 1 1 1 1 61 TYR QD   . 61 . HD*  1 1 
       1298 1 2 1 1 63 LEU MD2  . 63 . HD2* 1 1 
       1299 1 1 1 1 61 TYR QD   . 61 . HD*  1 1 
       1299 1 2 1 1 83 VAL MG2  . 83 . HG2* 1 1 
       1300 1 1 1 1 61 TYR QE   . 61 . HE*  1 1 
       1300 1 2 1 1 83 VAL H    . 83 . HN   1 1 
       1301 1 1 1 1 61 TYR QE   . 61 . HE*  1 1 
       1301 1 2 1 1 83 VAL HB   . 83 . HB   1 1 
       1302 1 1 1 1 61 TYR QE   . 61 . HE*  1 1 
       1302 1 2 1 1 83 VAL MG1  . 83 . HG1* 1 1 
       1303 1 1 1 1 61 TYR QE   . 61 . HE*  1 1 
       1303 1 2 1 1 83 VAL MG2  . 83 . HG2* 1 1 
       1304 1 1 1 1 62 VAL H    . 62 . HN   1 1 
       1304 1 2 1 1 62 VAL HB   . 62 . HB   1 1 
       1305 1 1 1 1 62 VAL H    . 62 . HN   1 1 
       1305 1 2 1 1 62 VAL MG1  . 62 . HG1* 1 1 
       1306 1 1 1 1 62 VAL H    . 62 . HN   1 1 
       1306 1 2 1 1 62 VAL MG2  . 62 . HG2* 1 1 
       1307 1 1 1 1 62 VAL H    . 62 . HN   1 1 
       1307 1 2 1 1 63 LEU H    . 63 . HN   1 1 
       1308 1 1 1 1 62 VAL HA   . 62 . HA   1 1 
       1308 1 2 1 1 62 VAL MG1  . 62 . HG1* 1 1 
       1309 1 1 1 1 62 VAL HA   . 62 . HA   1 1 
       1309 1 2 1 1 63 LEU H    . 63 . HN   1 1 
       1310 1 1 1 1 62 VAL HA   . 62 . HA   1 1 
       1310 1 2 1 1 63 LEU HG   . 63 . HG   1 1 
       1311 1 1 1 1 62 VAL HA   . 62 . HA   1 1 
       1311 1 2 1 1 78 LYS HB3  . 78 . HB1  1 1 
       1312 1 1 1 1 62 VAL HA   . 62 . HA   1 1 
       1312 1 2 1 1 79 GLN H    . 79 . HN   1 1 
       1313 1 1 1 1 62 VAL HA   . 62 . HA   1 1 
       1313 1 2 1 1 79 GLN HG2  . 79 . HG2  1 1 
       1314 1 1 1 1 62 VAL HB   . 62 . HB   1 1 
       1314 1 2 1 1 63 LEU H    . 63 . HN   1 1 
       1315 1 1 1 1 62 VAL MG1  . 62 . HG1* 1 1 
       1315 1 2 1 1 63 LEU H    . 63 . HN   1 1 
       1316 1 1 1 1 62 VAL MG1  . 62 . HG1* 1 1 
       1316 1 2 1 1 78 LYS HA   . 78 . HA   1 1 
       1317 1 1 1 1 62 VAL MG1  . 62 . HG1* 1 1 
       1317 1 2 1 1 78 LYS HB2  . 78 . HB2  1 1 
       1318 1 1 1 1 62 VAL MG1  . 62 . HG1* 1 1 
       1318 1 2 1 1 78 LYS HB3  . 78 . HB1  1 1 
       1319 1 1 1 1 62 VAL MG1  . 62 . HG1* 1 1 
       1319 1 2 1 1 78 LYS QD   . 78 . HD*  1 1 
       1320 1 1 1 1 62 VAL MG1  . 62 . HG1* 1 1 
       1320 1 2 1 1 78 LYS QE   . 78 . HE*  1 1 
       1321 1 1 1 1 62 VAL MG1  . 62 . HG1* 1 1 
       1321 1 2 1 1 79 GLN H    . 79 . HN   1 1 
       1322 1 1 1 1 62 VAL MG2  . 62 . HG2* 1 1 
       1322 1 2 1 1 79 GLN H    . 79 . HN   1 1 
       1323 1 1 1 1 63 LEU H    . 63 . HN   1 1 
       1323 1 2 1 1 63 LEU HB2  . 63 . HB2  1 1 
       1324 1 1 1 1 63 LEU H    . 63 . HN   1 1 
       1324 1 2 1 1 63 LEU HB3  . 63 . HB1  1 1 
       1325 1 1 1 1 63 LEU H    . 63 . HN   1 1 
       1325 1 2 1 1 63 LEU MD1  . 63 . HD1* 1 1 
       1326 1 1 1 1 63 LEU H    . 63 . HN   1 1 
       1326 1 2 1 1 63 LEU MD2  . 63 . HD2* 1 1 
       1327 1 1 1 1 63 LEU H    . 63 . HN   1 1 
       1327 1 2 1 1 63 LEU HG   . 63 . HG   1 1 
       1328 1 1 1 1 63 LEU H    . 63 . HN   1 1 
       1328 1 2 1 1 64 THR H    . 64 . HN   1 1 
       1329 1 1 1 1 63 LEU H    . 63 . HN   1 1 
       1329 1 2 1 1 81 VAL H    . 81 . HN   1 1 
       1330 1 1 1 1 63 LEU HA   . 63 . HA   1 1 
       1330 1 2 1 1 63 LEU MD1  . 63 . HD1* 1 1 
       1331 1 1 1 1 63 LEU HA   . 63 . HA   1 1 
       1331 1 2 1 1 63 LEU MD2  . 63 . HD2* 1 1 
       1332 1 1 1 1 63 LEU HA   . 63 . HA   1 1 
       1332 1 2 1 1 64 THR H    . 64 . HN   1 1 
       1333 1 1 1 1 63 LEU HB2  . 63 . HB2  1 1 
       1333 1 2 1 1 63 LEU MD1  . 63 . HD1* 1 1 
       1334 1 1 1 1 63 LEU HB2  . 63 . HB2  1 1 
       1334 1 2 1 1 64 THR H    . 64 . HN   1 1 
       1335 1 1 1 1 63 LEU HB2  . 63 . HB2  1 1 
       1335 1 2 1 1 65 TYR QE   . 65 . HE*  1 1 
       1336 1 1 1 1 63 LEU HB2  . 63 . HB2  1 1 
       1336 1 2 1 1 79 GLN H    . 79 . HN   1 1 
       1337 1 1 1 1 63 LEU HB2  . 63 . HB2  1 1 
       1337 1 2 1 1 79 GLN HB3  . 79 . HB1  1 1 
       1338 1 1 1 1 63 LEU HB2  . 63 . HB2  1 1 
       1338 1 2 1 1 79 GLN HE21 . 79 . HE21 1 1 
       1339 1 1 1 1 63 LEU HB3  . 63 . HB1  1 1 
       1339 1 2 1 1 63 LEU MD1  . 63 . HD1* 1 1 
       1340 1 1 1 1 63 LEU HB3  . 63 . HB1  1 1 
       1340 1 2 1 1 63 LEU MD2  . 63 . HD2* 1 1 
       1341 1 1 1 1 63 LEU HB3  . 63 . HB1  1 1 
       1341 1 2 1 1 64 THR H    . 64 . HN   1 1 
       1342 1 1 1 1 63 LEU HB3  . 63 . HB1  1 1 
       1342 1 2 1 1 65 TYR QE   . 65 . HE*  1 1 
       1343 1 1 1 1 63 LEU HB3  . 63 . HB1  1 1 
       1343 1 2 1 1 79 GLN H    . 79 . HN   1 1 
       1344 1 1 1 1 63 LEU MD1  . 63 . HD1* 1 1 
       1344 1 2 1 1 64 THR H    . 64 . HN   1 1 
       1345 1 1 1 1 63 LEU MD1  . 63 . HD1* 1 1 
       1345 1 2 1 1 65 TYR QE   . 65 . HE*  1 1 
       1346 1 1 1 1 63 LEU MD1  . 63 . HD1* 1 1 
       1346 1 2 1 1 65 TYR HH   . 65 . HH   1 1 
       1347 1 1 1 1 63 LEU MD1  . 63 . HD1* 1 1 
       1347 1 2 1 1 79 GLN H    . 79 . HN   1 1 
       1348 1 1 1 1 63 LEU MD1  . 63 . HD1* 1 1 
       1348 1 2 1 1 79 GLN HB3  . 79 . HB1  1 1 
       1349 1 1 1 1 63 LEU MD1  . 63 . HD1* 1 1 
       1349 1 2 1 1 79 GLN HE21 . 79 . HE21 1 1 
       1350 1 1 1 1 63 LEU MD1  . 63 . HD1* 1 1 
       1350 1 2 1 1 79 GLN HE22 . 79 . HE22 1 1 
       1351 1 1 1 1 63 LEU MD1  . 63 . HD1* 1 1 
       1351 1 2 1 1 81 VAL MG2  . 81 . HG2* 1 1 
       1352 1 1 1 1 63 LEU MD2  . 63 . HD2* 1 1 
       1352 1 2 1 1 64 THR H    . 64 . HN   1 1 
       1353 1 1 1 1 63 LEU MD2  . 63 . HD2* 1 1 
       1353 1 2 1 1 81 VAL MG2  . 81 . HG2* 1 1 
       1354 1 1 1 1 63 LEU HG   . 63 . HG   1 1 
       1354 1 2 1 1 64 THR H    . 64 . HN   1 1 
       1355 1 1 1 1 63 LEU HG   . 63 . HG   1 1 
       1355 1 2 1 1 65 TYR QE   . 65 . HE*  1 1 
       1356 1 1 1 1 64 THR H    . 64 . HN   1 1 
       1356 1 2 1 1 64 THR HB   . 64 . HB   1 1 
       1357 1 1 1 1 64 THR H    . 64 . HN   1 1 
       1357 1 2 1 1 64 THR MG   . 64 . HG2* 1 1 
       1358 1 1 1 1 64 THR H    . 64 . HN   1 1 
       1358 1 2 1 1 78 LYS HG2  . 78 . HG2  1 1 
       1359 1 1 1 1 64 THR HA   . 64 . HA   1 1 
       1359 1 2 1 1 64 THR MG   . 64 . HG2* 1 1 
       1360 1 1 1 1 64 THR HA   . 64 . HA   1 1 
       1360 1 2 1 1 65 TYR H    . 65 . HN   1 1 
       1361 1 1 1 1 64 THR HA   . 64 . HA   1 1 
       1361 1 2 1 1 65 TYR QD   . 65 . HD*  1 1 
       1362 1 1 1 1 64 THR HA   . 64 . HA   1 1 
       1362 1 2 1 1 65 TYR QE   . 65 . HE*  1 1 
       1363 1 1 1 1 64 THR HA   . 64 . HA   1 1 
       1363 1 2 1 1 77 ALA H    . 77 . HN   1 1 
       1364 1 1 1 1 64 THR HA   . 64 . HA   1 1 
       1364 1 2 1 1 77 ALA MB   . 77 . HB*  1 1 
       1365 1 1 1 1 64 THR HA   . 64 . HA   1 1 
       1365 1 2 1 1 78 LYS HA   . 78 . HA   1 1 
       1366 1 1 1 1 64 THR HA   . 64 . HA   1 1 
       1366 1 2 1 1 78 LYS HB2  . 78 . HB2  1 1 
       1367 1 1 1 1 64 THR HA   . 64 . HA   1 1 
       1367 1 2 1 1 78 LYS HB3  . 78 . HB1  1 1 
       1368 1 1 1 1 64 THR HA   . 64 . HA   1 1 
       1368 1 2 1 1 78 LYS HG2  . 78 . HG2  1 1 
       1369 1 1 1 1 64 THR HA   . 64 . HA   1 1 
       1369 1 2 1 1 78 LYS HG3  . 78 . HG1  1 1 
       1370 1 1 1 1 64 THR HB   . 64 . HB   1 1 
       1370 1 2 1 1 65 TYR H    . 65 . HN   1 1 
       1371 1 1 1 1 64 THR MG   . 64 . HG2* 1 1 
       1371 1 2 1 1 65 TYR H    . 65 . HN   1 1 
       1372 1 1 1 1 64 THR MG   . 64 . HG2* 1 1 
       1372 1 2 1 1 65 TYR HA   . 65 . HA   1 1 
       1373 1 1 1 1 64 THR MG   . 64 . HG2* 1 1 
       1373 1 2 1 1 65 TYR QD   . 65 . HD*  1 1 
       1374 1 1 1 1 64 THR MG   . 64 . HG2* 1 1 
       1374 1 2 1 1 66 THR H    . 66 . HN   1 1 
       1375 1 1 1 1 64 THR MG   . 64 . HG2* 1 1 
       1375 1 2 1 1 77 ALA H    . 77 . HN   1 1 
       1376 1 1 1 1 64 THR MG   . 64 . HG2* 1 1 
       1376 1 2 1 1 78 LYS HA   . 78 . HA   1 1 
       1377 1 1 1 1 64 THR MG   . 64 . HG2* 1 1 
       1377 1 2 1 1 78 LYS QE   . 78 . HE*  1 1 
       1378 1 1 1 1 64 THR MG   . 64 . HG2* 1 1 
       1378 1 2 1 1 79 GLN H    . 79 . HN   1 1 
       1379 1 1 1 1 65 TYR H    . 65 . HN   1 1 
       1379 1 2 1 1 65 TYR HB2  . 65 . HB2  1 1 
       1380 1 1 1 1 65 TYR H    . 65 . HN   1 1 
       1380 1 2 1 1 65 TYR HB3  . 65 . HB1  1 1 
       1381 1 1 1 1 65 TYR H    . 65 . HN   1 1 
       1381 1 2 1 1 65 TYR QD   . 65 . HD*  1 1 
       1382 1 1 1 1 65 TYR H    . 65 . HN   1 1 
       1382 1 2 1 1 65 TYR QE   . 65 . HE*  1 1 
       1383 1 1 1 1 65 TYR H    . 65 . HN   1 1 
       1383 1 2 1 1 66 THR H    . 66 . HN   1 1 
       1384 1 1 1 1 65 TYR H    . 65 . HN   1 1 
       1384 1 2 1 1 76 THR HA   . 76 . HA   1 1 
       1385 1 1 1 1 65 TYR H    . 65 . HN   1 1 
       1385 1 2 1 1 77 ALA H    . 77 . HN   1 1 
       1386 1 1 1 1 65 TYR H    . 65 . HN   1 1 
       1386 1 2 1 1 77 ALA HA   . 77 . HA   1 1 
       1387 1 1 1 1 65 TYR H    . 65 . HN   1 1 
       1387 1 2 1 1 77 ALA MB   . 77 . HB*  1 1 
       1388 1 1 1 1 65 TYR H    . 65 . HN   1 1 
       1388 1 2 1 1 78 LYS HA   . 78 . HA   1 1 
       1389 1 1 1 1 65 TYR H    . 65 . HN   1 1 
       1389 1 2 1 1 78 LYS HG3  . 78 . HG1  1 1 
       1390 1 1 1 1 65 TYR H    . 65 . HN   1 1 
       1390 1 2 1 1 79 GLN H    . 79 . HN   1 1 
       1391 1 1 1 1 65 TYR HA   . 65 . HA   1 1 
       1391 1 2 1 1 65 TYR QD   . 65 . HD*  1 1 
       1392 1 1 1 1 65 TYR HA   . 65 . HA   1 1 
       1392 1 2 1 1 66 THR H    . 66 . HN   1 1 
       1393 1 1 1 1 65 TYR HB2  . 65 . HB2  1 1 
       1393 1 2 1 1 66 THR H    . 66 . HN   1 1 
       1394 1 1 1 1 65 TYR HB2  . 65 . HB2  1 1 
       1394 1 2 1 1 77 ALA H    . 77 . HN   1 1 
       1395 1 1 1 1 65 TYR HB2  . 65 . HB2  1 1 
       1395 1 2 1 1 77 ALA MB   . 77 . HB*  1 1 
       1396 1 1 1 1 65 TYR HB3  . 65 . HB1  1 1 
       1396 1 2 1 1 66 THR H    . 66 . HN   1 1 
       1397 1 1 1 1 65 TYR HB3  . 65 . HB1  1 1 
       1397 1 2 1 1 77 ALA H    . 77 . HN   1 1 
       1398 1 1 1 1 65 TYR HB3  . 65 . HB1  1 1 
       1398 1 2 1 1 77 ALA MB   . 77 . HB*  1 1 
       1399 1 1 1 1 65 TYR QD   . 65 . HD*  1 1 
       1399 1 2 1 1 65 TYR HH   . 65 . HH   1 1 
       1400 1 1 1 1 65 TYR QD   . 65 . HD*  1 1 
       1400 1 2 1 1 66 THR H    . 66 . HN   1 1 
       1401 1 1 1 1 65 TYR QD   . 65 . HD*  1 1 
       1401 1 2 1 1 77 ALA H    . 77 . HN   1 1 
       1402 1 1 1 1 65 TYR QD   . 65 . HD*  1 1 
       1402 1 2 1 1 77 ALA MB   . 77 . HB*  1 1 
       1403 1 1 1 1 65 TYR QD   . 65 . HD*  1 1 
       1403 1 2 1 1 78 LYS HA   . 78 . HA   1 1 
       1404 1 1 1 1 65 TYR QD   . 65 . HD*  1 1 
       1404 1 2 1 1 79 GLN H    . 79 . HN   1 1 
       1405 1 1 1 1 65 TYR QD   . 65 . HD*  1 1 
       1405 1 2 1 1 79 GLN HB3  . 79 . HB1  1 1 
       1406 1 1 1 1 65 TYR QE   . 65 . HE*  1 1 
       1406 1 2 1 1 65 TYR HH   . 65 . HH   1 1 
       1407 1 1 1 1 65 TYR QE   . 65 . HE*  1 1 
       1407 1 2 1 1 78 LYS HA   . 78 . HA   1 1 
       1408 1 1 1 1 65 TYR QE   . 65 . HE*  1 1 
       1408 1 2 1 1 79 GLN H    . 79 . HN   1 1 
       1409 1 1 1 1 65 TYR QE   . 65 . HE*  1 1 
       1409 1 2 1 1 79 GLN HB3  . 79 . HB1  1 1 
       1410 1 1 1 1 65 TYR HH   . 65 . HH   1 1 
       1410 1 2 1 1 79 GLN HE21 . 79 . HE21 1 1 
       1411 1 1 1 1 65 TYR HH   . 65 . HH   1 1 
       1411 1 2 1 1 79 GLN HE22 . 79 . HE22 1 1 
       1412 1 1 1 1 66 THR H    . 66 . HN   1 1 
       1412 1 2 1 1 66 THR HB   . 66 . HB   1 1 
       1413 1 1 1 1 66 THR HA   . 66 . HA   1 1 
       1413 1 2 1 1 66 THR MG   . 66 . HG2* 1 1 
       1414 1 1 1 1 66 THR HA   . 66 . HA   1 1 
       1414 1 2 1 1 67 VAL H    . 67 . HN   1 1 
       1415 1 1 1 1 66 THR HA   . 66 . HA   1 1 
       1415 1 2 1 1 67 VAL HB   . 67 . HB   1 1 
       1416 1 1 1 1 66 THR HA   . 66 . HA   1 1 
       1416 1 2 1 1 67 VAL MG1  . 67 . HG1* 1 1 
       1417 1 1 1 1 66 THR HA   . 66 . HA   1 1 
       1417 1 2 1 1 75 VAL H    . 75 . HN   1 1 
       1418 1 1 1 1 66 THR HA   . 66 . HA   1 1 
       1418 1 2 1 1 76 THR HA   . 76 . HA   1 1 
       1419 1 1 1 1 66 THR HA   . 66 . HA   1 1 
       1419 1 2 1 1 76 THR HB   . 76 . HB   1 1 
       1420 1 1 1 1 66 THR HA   . 66 . HA   1 1 
       1420 1 2 1 1 77 ALA H    . 77 . HN   1 1 
       1421 1 1 1 1 66 THR HB   . 66 . HB   1 1 
       1421 1 2 1 1 67 VAL H    . 67 . HN   1 1 
       1422 1 1 1 1 66 THR MG   . 66 . HG2* 1 1 
       1422 1 2 1 1 67 VAL H    . 67 . HN   1 1 
       1423 1 1 1 1 66 THR MG   . 66 . HG2* 1 1 
       1423 1 2 1 1 67 VAL MG1  . 67 . HG1* 1 1 
       1424 1 1 1 1 66 THR MG   . 66 . HG2* 1 1 
       1424 1 2 1 1 74 GLU HA   . 74 . HA   1 1 
       1425 1 1 1 1 66 THR MG   . 66 . HG2* 1 1 
       1425 1 2 1 1 74 GLU HB2  . 74 . HB2  1 1 
       1426 1 1 1 1 66 THR MG   . 66 . HG2* 1 1 
       1426 1 2 1 1 74 GLU HB3  . 74 . HB1  1 1 
       1427 1 1 1 1 66 THR MG   . 66 . HG2* 1 1 
       1427 1 2 1 1 74 GLU HG2  . 74 . HG2  1 1 
       1428 1 1 1 1 66 THR MG   . 66 . HG2* 1 1 
       1428 1 2 1 1 74 GLU HG3  . 74 . HG1  1 1 
       1429 1 1 1 1 66 THR MG   . 66 . HG2* 1 1 
       1429 1 2 1 1 75 VAL H    . 75 . HN   1 1 
       1430 1 1 1 1 66 THR MG   . 66 . HG2* 1 1 
       1430 1 2 1 1 76 THR HA   . 76 . HA   1 1 
       1431 1 1 1 1 66 THR MG   . 66 . HG2* 1 1 
       1431 1 2 1 1 76 THR HB   . 76 . HB   1 1 
       1432 1 1 1 1 67 VAL H    . 67 . HN   1 1 
       1432 1 2 1 1 67 VAL HB   . 67 . HB   1 1 
       1433 1 1 1 1 67 VAL H    . 67 . HN   1 1 
       1433 1 2 1 1 67 VAL MG1  . 67 . HG1* 1 1 
       1434 1 1 1 1 67 VAL H    . 67 . HN   1 1 
       1434 1 2 1 1 67 VAL MG2  . 67 . HG2* 1 1 
       1435 1 1 1 1 67 VAL H    . 67 . HN   1 1 
       1435 1 2 1 1 68 THR H    . 68 . HN   1 1 
       1436 1 1 1 1 67 VAL H    . 67 . HN   1 1 
       1436 1 2 1 1 74 GLU HA   . 74 . HA   1 1 
       1437 1 1 1 1 67 VAL H    . 67 . HN   1 1 
       1437 1 2 1 1 74 GLU QG   . 74 . HG*  1 1 
       1438 1 1 1 1 67 VAL H    . 67 . HN   1 1 
       1438 1 2 1 1 75 VAL H    . 75 . HN   1 1 
       1439 1 1 1 1 67 VAL H    . 67 . HN   1 1 
       1439 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
       1440 1 1 1 1 67 VAL H    . 67 . HN   1 1 
       1440 1 2 1 1 76 THR HA   . 76 . HA   1 1 
       1441 1 1 1 1 67 VAL HA   . 67 . HA   1 1 
       1441 1 2 1 1 67 VAL MG2  . 67 . HG2* 1 1 
       1442 1 1 1 1 67 VAL HA   . 67 . HA   1 1 
       1442 1 2 1 1 68 THR H    . 68 . HN   1 1 
       1443 1 1 1 1 67 VAL HA   . 67 . HA   1 1 
       1443 1 2 1 1 68 THR HA   . 68 . HA   1 1 
       1444 1 1 1 1 67 VAL HB   . 67 . HB   1 1 
       1444 1 2 1 1 68 THR H    . 68 . HN   1 1 
       1445 1 1 1 1 67 VAL MG1  . 67 . HG1* 1 1 
       1445 1 2 1 1 68 THR H    . 68 . HN   1 1 
       1446 1 1 1 1 67 VAL MG1  . 67 . HG1* 1 1 
       1446 1 2 1 1 68 THR HA   . 68 . HA   1 1 
       1447 1 1 1 1 67 VAL MG1  . 67 . HG1* 1 1 
       1447 1 2 1 1 69 ASP H    . 69 . HN   1 1 
       1448 1 1 1 1 67 VAL MG1  . 67 . HG1* 1 1 
       1448 1 2 1 1 74 GLU HA   . 74 . HA   1 1 
       1449 1 1 1 1 67 VAL MG1  . 67 . HG1* 1 1 
       1449 1 2 1 1 75 VAL H    . 75 . HN   1 1 
       1450 1 1 1 1 67 VAL MG1  . 67 . HG1* 1 1 
       1450 1 2 1 1 75 VAL HB   . 75 . HB   1 1 
       1451 1 1 1 1 67 VAL MG1  . 67 . HG1* 1 1 
       1451 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
       1452 1 1 1 1 67 VAL MG2  . 67 . HG2* 1 1 
       1452 1 2 1 1 68 THR H    . 68 . HN   1 1 
       1453 1 1 1 1 67 VAL MG2  . 67 . HG2* 1 1 
       1453 1 2 1 1 68 THR HA   . 68 . HA   1 1 
       1454 1 1 1 1 67 VAL MG2  . 67 . HG2* 1 1 
       1454 1 2 1 1 68 THR HB   . 68 . HB   1 1 
       1455 1 1 1 1 67 VAL MG2  . 67 . HG2* 1 1 
       1455 1 2 1 1 69 ASP H    . 69 . HN   1 1 
       1456 1 1 1 1 68 THR H    . 68 . HN   1 1 
       1456 1 2 1 1 68 THR HB   . 68 . HB   1 1 
       1457 1 1 1 1 68 THR H    . 68 . HN   1 1 
       1457 1 2 1 1 68 THR MG   . 68 . HG2* 1 1 
       1458 1 1 1 1 68 THR H    . 68 . HN   1 1 
       1458 1 2 1 1 69 ASP H    . 69 . HN   1 1 
       1459 1 1 1 1 68 THR HA   . 68 . HA   1 1 
       1459 1 2 1 1 68 THR MG   . 68 . HG2* 1 1 
       1460 1 1 1 1 68 THR HA   . 68 . HA   1 1 
       1460 1 2 1 1 69 ASP H    . 69 . HN   1 1 
       1461 1 1 1 1 68 THR HA   . 68 . HA   1 1 
       1461 1 2 1 1 69 ASP HA   . 69 . HA   1 1 
       1462 1 1 1 1 68 THR HA   . 68 . HA   1 1 
       1462 1 2 1 1 73 HIS H    . 73 . HN   1 1 
       1463 1 1 1 1 68 THR HA   . 68 . HA   1 1 
       1463 1 2 1 1 74 GLU H    . 74 . HN   1 1 
       1464 1 1 1 1 68 THR HA   . 68 . HA   1 1 
       1464 1 2 1 1 74 GLU HA   . 74 . HA   1 1 
       1465 1 1 1 1 68 THR HA   . 68 . HA   1 1 
       1465 1 2 1 1 74 GLU HG2  . 74 . HG2  1 1 
       1466 1 1 1 1 68 THR HA   . 68 . HA   1 1 
       1466 1 2 1 1 74 GLU QG   . 74 . HG*  1 1 
       1467 1 1 1 1 68 THR HA   . 68 . HA   1 1 
       1467 1 2 1 1 74 GLU HG3  . 74 . HG1  1 1 
       1468 1 1 1 1 68 THR HA   . 68 . HA   1 1 
       1468 1 2 1 1 75 VAL H    . 75 . HN   1 1 
       1469 1 1 1 1 68 THR HA   . 68 . HA   1 1 
       1469 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
       1470 1 1 1 1 68 THR HB   . 68 . HB   1 1 
       1470 1 2 1 1 69 ASP H    . 69 . HN   1 1 
       1471 1 1 1 1 68 THR HB   . 68 . HB   1 1 
       1471 1 2 1 1 74 GLU HA   . 74 . HA   1 1 
       1472 1 1 1 1 68 THR MG   . 68 . HG2* 1 1 
       1472 1 2 1 1 69 ASP H    . 69 . HN   1 1 
       1473 1 1 1 1 68 THR MG   . 68 . HG2* 1 1 
       1473 1 2 1 1 69 ASP HA   . 69 . HA   1 1 
       1474 1 1 1 1 68 THR MG   . 68 . HG2* 1 1 
       1474 1 2 1 1 72 GLY H    . 72 . HN   1 1 
       1475 1 1 1 1 68 THR MG   . 68 . HG2* 1 1 
       1475 1 2 1 1 72 GLY HA2  . 72 . HA2  1 1 
       1476 1 1 1 1 68 THR MG   . 68 . HG2* 1 1 
       1476 1 2 1 1 72 GLY HA3  . 72 . HA1  1 1 
       1477 1 1 1 1 68 THR MG   . 68 . HG2* 1 1 
       1477 1 2 1 1 73 HIS H    . 73 . HN   1 1 
       1478 1 1 1 1 68 THR MG   . 68 . HG2* 1 1 
       1478 1 2 1 1 74 GLU H    . 74 . HN   1 1 
       1479 1 1 1 1 68 THR MG   . 68 . HG2* 1 1 
       1479 1 2 1 1 74 GLU HA   . 74 . HA   1 1 
       1480 1 1 1 1 68 THR MG   . 68 . HG2* 1 1 
       1480 1 2 1 1 74 GLU HB2  . 74 . HB2  1 1 
       1481 1 1 1 1 68 THR MG   . 68 . HG2* 1 1 
       1481 1 2 1 1 74 GLU HB3  . 74 . HB1  1 1 
       1482 1 1 1 1 68 THR MG   . 68 . HG2* 1 1 
       1482 1 2 1 1 74 GLU QG   . 74 . HG*  1 1 
       1483 1 1 1 1 69 ASP H    . 69 . HN   1 1 
       1483 1 2 1 1 70 SER H    . 70 . HN   1 1 
       1484 1 1 1 1 69 ASP H    . 69 . HN   1 1 
       1484 1 2 1 1 70 SER HA   . 70 . HA   1 1 
       1485 1 1 1 1 69 ASP H    . 69 . HN   1 1 
       1485 1 2 1 1 71 LYS H    . 71 . HN   1 1 
       1486 1 1 1 1 69 ASP H    . 69 . HN   1 1 
       1486 1 2 1 1 73 HIS H    . 73 . HN   1 1 
       1487 1 1 1 1 69 ASP H    . 69 . HN   1 1 
       1487 1 2 1 1 73 HIS QB   . 73 . HB*  1 1 
       1488 1 1 1 1 69 ASP H    . 69 . HN   1 1 
       1488 1 2 1 1 74 GLU HA   . 74 . HA   1 1 
       1489 1 1 1 1 69 ASP H    . 69 . HN   1 1 
       1489 1 2 1 1 75 VAL H    . 75 . HN   1 1 
       1490 1 1 1 1 69 ASP H    . 69 . HN   1 1 
       1490 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
       1491 1 1 1 1 69 ASP HA   . 69 . HA   1 1 
       1491 1 2 1 1 70 SER H    . 70 . HN   1 1 
       1492 1 1 1 1 69 ASP HA   . 69 . HA   1 1 
       1492 1 2 1 1 70 SER HA   . 70 . HA   1 1 
       1493 1 1 1 1 69 ASP HA   . 69 . HA   1 1 
       1493 1 2 1 1 71 LYS H    . 71 . HN   1 1 
       1494 1 1 1 1 69 ASP QB   . 69 . HB*  1 1 
       1494 1 2 1 1 70 SER H    . 70 . HN   1 1 
       1495 1 1 1 1 69 ASP HB2  . 69 . HB2  1 1 
       1495 1 2 1 1 70 SER H    . 70 . HN   1 1 
       1496 1 1 1 1 69 ASP HB2  . 69 . HB2  1 1 
       1496 1 2 1 1 71 LYS H    . 71 . HN   1 1 
       1497 1 1 1 1 69 ASP HB3  . 69 . HB1  1 1 
       1497 1 2 1 1 70 SER H    . 70 . HN   1 1 
       1498 1 1 1 1 69 ASP HB3  . 69 . HB1  1 1 
       1498 1 2 1 1 71 LYS H    . 71 . HN   1 1 
       1499 1 1 1 1 70 SER H    . 70 . HN   1 1 
       1499 1 2 1 1 71 LYS H    . 71 . HN   1 1 
       1500 1 1 1 1 71 LYS H    . 71 . HN   1 1 
       1500 1 2 1 1 71 LYS HB2  . 71 . HB2  1 1 
       1501 1 1 1 1 71 LYS H    . 71 . HN   1 1 
       1501 1 2 1 1 71 LYS QB   . 71 . HB*  1 1 
       1502 1 1 1 1 71 LYS H    . 71 . HN   1 1 
       1502 1 2 1 1 71 LYS HB3  . 71 . HB1  1 1 
       1503 1 1 1 1 71 LYS H    . 71 . HN   1 1 
       1503 1 2 1 1 71 LYS QD   . 71 . HD*  1 1 
       1504 1 1 1 1 71 LYS H    . 71 . HN   1 1 
       1504 1 2 1 1 71 LYS QE   . 71 . HE*  1 1 
       1505 1 1 1 1 71 LYS H    . 71 . HN   1 1 
       1505 1 2 1 1 71 LYS HG2  . 71 . HG2  1 1 
       1506 1 1 1 1 71 LYS H    . 71 . HN   1 1 
       1506 1 2 1 1 71 LYS QG   . 71 . HG*  1 1 
       1507 1 1 1 1 71 LYS H    . 71 . HN   1 1 
       1507 1 2 1 1 71 LYS HG3  . 71 . HG1  1 1 
       1508 1 1 1 1 71 LYS H    . 71 . HN   1 1 
       1508 1 2 1 1 72 GLY H    . 72 . HN   1 1 
       1509 1 1 1 1 71 LYS H    . 71 . HN   1 1 
       1509 1 2 1 1 72 GLY HA2  . 72 . HA2  1 1 
       1510 1 1 1 1 71 LYS H    . 71 . HN   1 1 
       1510 1 2 1 1 73 HIS H    . 73 . HN   1 1 
       1511 1 1 1 1 71 LYS HA   . 71 . HA   1 1 
       1511 1 2 1 1 71 LYS QD   . 71 . HD*  1 1 
       1512 1 1 1 1 71 LYS HA   . 71 . HA   1 1 
       1512 1 2 1 1 73 HIS H    . 73 . HN   1 1 
       1513 1 1 1 1 71 LYS QB   . 71 . HB*  1 1 
       1513 1 2 1 1 71 LYS QD   . 71 . HD*  1 1 
       1514 1 1 1 1 71 LYS QB   . 71 . HB*  1 1 
       1514 1 2 1 1 73 HIS H    . 73 . HN   1 1 
       1515 1 1 1 1 71 LYS HB2  . 71 . HB2  1 1 
       1515 1 2 1 1 72 GLY H    . 72 . HN   1 1 
       1516 1 1 1 1 71 LYS HB3  . 71 . HB1  1 1 
       1516 1 2 1 1 72 GLY H    . 72 . HN   1 1 
       1517 1 1 1 1 71 LYS QE   . 71 . HE*  1 1 
       1517 1 2 1 1 71 LYS HG2  . 71 . HG2  1 1 
       1518 1 1 1 1 71 LYS QE   . 71 . HE*  1 1 
       1518 1 2 1 1 71 LYS QG   . 71 . HG*  1 1 
       1519 1 1 1 1 71 LYS QE   . 71 . HE*  1 1 
       1519 1 2 1 1 71 LYS HG3  . 71 . HG1  1 1 
       1520 1 1 1 1 72 GLY H    . 72 . HN   1 1 
       1520 1 2 1 1 73 HIS H    . 73 . HN   1 1 
       1521 1 1 1 1 73 HIS H    . 73 . HN   1 1 
       1521 1 2 1 1 73 HIS QB   . 73 . HB*  1 1 
       1522 1 1 1 1 73 HIS H    . 73 . HN   1 1 
       1522 1 2 1 1 73 HIS HD2  . 73 . HD2  1 1 
       1523 1 1 1 1 73 HIS H    . 73 . HN   1 1 
       1523 1 2 1 1 74 GLU HB2  . 74 . HB2  1 1 
       1524 1 1 1 1 73 HIS HA   . 73 . HA   1 1 
       1524 1 2 1 1 73 HIS HD2  . 73 . HD2  1 1 
       1525 1 1 1 1 73 HIS HA   . 73 . HA   1 1 
       1525 1 2 1 1 74 GLU H    . 74 . HN   1 1 
       1526 1 1 1 1 73 HIS QB   . 73 . HB*  1 1 
       1526 1 2 1 1 74 GLU H    . 74 . HN   1 1 
       1527 1 1 1 1 73 HIS QB   . 73 . HB*  1 1 
       1527 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
       1528 1 1 1 1 73 HIS HD2  . 73 . HD2  1 1 
       1528 1 2 1 1 74 GLU H    . 74 . HN   1 1 
       1529 1 1 1 1 74 GLU H    . 74 . HN   1 1 
       1529 1 2 1 1 74 GLU HB2  . 74 . HB2  1 1 
       1530 1 1 1 1 74 GLU H    . 74 . HN   1 1 
       1530 1 2 1 1 74 GLU HB3  . 74 . HB1  1 1 
       1531 1 1 1 1 74 GLU H    . 74 . HN   1 1 
       1531 1 2 1 1 74 GLU HG2  . 74 . HG2  1 1 
       1532 1 1 1 1 74 GLU H    . 74 . HN   1 1 
       1532 1 2 1 1 74 GLU HG3  . 74 . HG1  1 1 
       1533 1 1 1 1 74 GLU H    . 74 . HN   1 1 
       1533 1 2 1 1 75 VAL H    . 75 . HN   1 1 
       1534 1 1 1 1 74 GLU H    . 74 . HN   1 1 
       1534 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
       1535 1 1 1 1 74 GLU HA   . 74 . HA   1 1 
       1535 1 2 1 1 74 GLU HG2  . 74 . HG2  1 1 
       1536 1 1 1 1 74 GLU HA   . 74 . HA   1 1 
       1536 1 2 1 1 74 GLU QG   . 74 . HG*  1 1 
       1537 1 1 1 1 74 GLU HA   . 74 . HA   1 1 
       1537 1 2 1 1 74 GLU HG3  . 74 . HG1  1 1 
       1538 1 1 1 1 74 GLU HA   . 74 . HA   1 1 
       1538 1 2 1 1 75 VAL H    . 75 . HN   1 1 
       1539 1 1 1 1 74 GLU HA   . 74 . HA   1 1 
       1539 1 2 1 1 75 VAL MG1  . 75 . HG1* 1 1 
       1540 1 1 1 1 74 GLU HA   . 74 . HA   1 1 
       1540 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
       1541 1 1 1 1 74 GLU HA   . 74 . HA   1 1 
       1541 1 2 1 1 75 VAL MG2  . 75 . HG2* 1 1 
       1542 1 1 1 1 74 GLU HB2  . 74 . HB2  1 1 
       1542 1 2 1 1 75 VAL H    . 75 . HN   1 1 
       1543 1 1 1 1 74 GLU HB3  . 74 . HB1  1 1 
       1543 1 2 1 1 75 VAL H    . 75 . HN   1 1 
       1544 1 1 1 1 74 GLU QG   . 74 . HG*  1 1 
       1544 1 2 1 1 75 VAL H    . 75 . HN   1 1 
       1545 1 1 1 1 74 GLU HG2  . 74 . HG2  1 1 
       1545 1 2 1 1 75 VAL H    . 75 . HN   1 1 
       1546 1 1 1 1 74 GLU HG3  . 74 . HG1  1 1 
       1546 1 2 1 1 75 VAL H    . 75 . HN   1 1 
       1547 1 1 1 1 75 VAL H    . 75 . HN   1 1 
       1547 1 2 1 1 75 VAL HB   . 75 . HB   1 1 
       1548 1 1 1 1 75 VAL H    . 75 . HN   1 1 
       1548 1 2 1 1 75 VAL MG1  . 75 . HG1* 1 1 
       1549 1 1 1 1 75 VAL H    . 75 . HN   1 1 
       1549 1 2 1 1 75 VAL QG   . 75 . HG*  1 1 
       1550 1 1 1 1 75 VAL H    . 75 . HN   1 1 
       1550 1 2 1 1 75 VAL MG2  . 75 . HG2* 1 1 
       1551 1 1 1 1 75 VAL H    . 75 . HN   1 1 
       1551 1 2 1 1 76 THR H    . 76 . HN   1 1 
       1552 1 1 1 1 75 VAL HA   . 75 . HA   1 1 
       1552 1 2 1 1 75 VAL MG1  . 75 . HG1* 1 1 
       1553 1 1 1 1 75 VAL HA   . 75 . HA   1 1 
       1553 1 2 1 1 75 VAL MG2  . 75 . HG2* 1 1 
       1554 1 1 1 1 75 VAL HA   . 75 . HA   1 1 
       1554 1 2 1 1 76 THR H    . 76 . HN   1 1 
       1555 1 1 1 1 75 VAL HA   . 75 . HA   1 1 
       1555 1 2 1 1 76 THR HA   . 76 . HA   1 1 
       1556 1 1 1 1 75 VAL HA   . 75 . HA   1 1 
       1556 1 2 1 1 76 THR HB   . 76 . HB   1 1 
       1557 1 1 1 1 75 VAL HB   . 75 . HB   1 1 
       1557 1 2 1 1 76 THR H    . 76 . HN   1 1 
       1558 1 1 1 1 75 VAL QG   . 75 . HG*  1 1 
       1558 1 2 1 1 76 THR H    . 76 . HN   1 1 
       1559 1 1 1 1 75 VAL QG   . 75 . HG*  1 1 
       1559 1 2 1 1 76 THR HA   . 76 . HA   1 1 
       1560 1 1 1 1 75 VAL MG1  . 75 . HG1* 1 1 
       1560 1 2 1 1 76 THR H    . 76 . HN   1 1 
       1561 1 1 1 1 75 VAL MG2  . 75 . HG2* 1 1 
       1561 1 2 1 1 76 THR H    . 76 . HN   1 1 
       1562 1 1 1 1 76 THR H    . 76 . HN   1 1 
       1562 1 2 1 1 76 THR HB   . 76 . HB   1 1 
       1563 1 1 1 1 76 THR H    . 76 . HN   1 1 
       1563 1 2 1 1 76 THR MG   . 76 . HG2* 1 1 
       1564 1 1 1 1 76 THR H    . 76 . HN   1 1 
       1564 1 2 1 1 77 ALA H    . 77 . HN   1 1 
       1565 1 1 1 1 76 THR HA   . 76 . HA   1 1 
       1565 1 2 1 1 76 THR MG   . 76 . HG2* 1 1 
       1566 1 1 1 1 76 THR HA   . 76 . HA   1 1 
       1566 1 2 1 1 77 ALA H    . 77 . HN   1 1 
       1567 1 1 1 1 76 THR HA   . 76 . HA   1 1 
       1567 1 2 1 1 77 ALA HA   . 77 . HA   1 1 
       1568 1 1 1 1 76 THR HA   . 76 . HA   1 1 
       1568 1 2 1 1 77 ALA MB   . 77 . HB*  1 1 
       1569 1 1 1 1 76 THR HB   . 76 . HB   1 1 
       1569 1 2 1 1 77 ALA H    . 77 . HN   1 1 
       1570 1 1 1 1 76 THR MG   . 76 . HG2* 1 1 
       1570 1 2 1 1 77 ALA H    . 77 . HN   1 1 
       1571 1 1 1 1 77 ALA H    . 77 . HN   1 1 
       1571 1 2 1 1 78 LYS H    . 78 . HN   1 1 
       1572 1 1 1 1 77 ALA H    . 77 . HN   1 1 
       1572 1 2 1 1 78 LYS HG3  . 78 . HG1  1 1 
       1573 1 1 1 1 77 ALA HA   . 77 . HA   1 1 
       1573 1 2 1 1 78 LYS H    . 78 . HN   1 1 
       1574 1 1 1 1 77 ALA HA   . 77 . HA   1 1 
       1574 1 2 1 1 78 LYS HB2  . 78 . HB2  1 1 
       1575 1 1 1 1 77 ALA HA   . 77 . HA   1 1 
       1575 1 2 1 1 78 LYS HB3  . 78 . HB1  1 1 
       1576 1 1 1 1 77 ALA MB   . 77 . HB*  1 1 
       1576 1 2 1 1 78 LYS H    . 78 . HN   1 1 
       1577 1 1 1 1 77 ALA MB   . 77 . HB*  1 1 
       1577 1 2 1 1 78 LYS HA   . 78 . HA   1 1 
       1578 1 1 1 1 78 LYS H    . 78 . HN   1 1 
       1578 1 2 1 1 78 LYS HB2  . 78 . HB2  1 1 
       1579 1 1 1 1 78 LYS H    . 78 . HN   1 1 
       1579 1 2 1 1 78 LYS HB3  . 78 . HB1  1 1 
       1580 1 1 1 1 78 LYS H    . 78 . HN   1 1 
       1580 1 2 1 1 78 LYS QD   . 78 . HD*  1 1 
       1581 1 1 1 1 78 LYS H    . 78 . HN   1 1 
       1581 1 2 1 1 78 LYS HG2  . 78 . HG2  1 1 
       1582 1 1 1 1 78 LYS H    . 78 . HN   1 1 
       1582 1 2 1 1 78 LYS HG3  . 78 . HG1  1 1 
       1583 1 1 1 1 78 LYS H    . 78 . HN   1 1 
       1583 1 2 1 1 79 GLN H    . 79 . HN   1 1 
       1584 1 1 1 1 78 LYS HA   . 78 . HA   1 1 
       1584 1 2 1 1 78 LYS QD   . 78 . HD*  1 1 
       1585 1 1 1 1 78 LYS HA   . 78 . HA   1 1 
       1585 1 2 1 1 78 LYS HG3  . 78 . HG1  1 1 
       1586 1 1 1 1 78 LYS HA   . 78 . HA   1 1 
       1586 1 2 1 1 79 GLN H    . 79 . HN   1 1 
       1587 1 1 1 1 78 LYS HA   . 78 . HA   1 1 
       1587 1 2 1 1 79 GLN HB2  . 79 . HB2  1 1 
       1588 1 1 1 1 78 LYS HA   . 78 . HA   1 1 
       1588 1 2 1 1 79 GLN HB3  . 79 . HB1  1 1 
       1589 1 1 1 1 78 LYS HB2  . 78 . HB2  1 1 
       1589 1 2 1 1 79 GLN H    . 79 . HN   1 1 
       1590 1 1 1 1 78 LYS HB2  . 78 . HB2  1 1 
       1590 1 2 1 1 79 GLN HA   . 79 . HA   1 1 
       1591 1 1 1 1 78 LYS HB3  . 78 . HB1  1 1 
       1591 1 2 1 1 78 LYS QD   . 78 . HD*  1 1 
       1592 1 1 1 1 78 LYS HB3  . 78 . HB1  1 1 
       1592 1 2 1 1 78 LYS QE   . 78 . HE*  1 1 
       1593 1 1 1 1 78 LYS HB3  . 78 . HB1  1 1 
       1593 1 2 1 1 79 GLN H    . 79 . HN   1 1 
       1594 1 1 1 1 78 LYS HB3  . 78 . HB1  1 1 
       1594 1 2 1 1 79 GLN HA   . 79 . HA   1 1 
       1595 1 1 1 1 78 LYS QD   . 78 . HD*  1 1 
       1595 1 2 1 1 79 GLN H    . 79 . HN   1 1 
       1596 1 1 1 1 78 LYS QE   . 78 . HE*  1 1 
       1596 1 2 1 1 78 LYS HG2  . 78 . HG2  1 1 
       1597 1 1 1 1 78 LYS QE   . 78 . HE*  1 1 
       1597 1 2 1 1 78 LYS HG3  . 78 . HG1  1 1 
       1598 1 1 1 1 78 LYS HG2  . 78 . HG2  1 1 
       1598 1 2 1 1 79 GLN H    . 79 . HN   1 1 
       1599 1 1 1 1 78 LYS HG3  . 78 . HG1  1 1 
       1599 1 2 1 1 79 GLN H    . 79 . HN   1 1 
       1600 1 1 1 1 79 GLN H    . 79 . HN   1 1 
       1600 1 2 1 1 79 GLN HB3  . 79 . HB1  1 1 
       1601 1 1 1 1 79 GLN H    . 79 . HN   1 1 
       1601 1 2 1 1 79 GLN HG2  . 79 . HG2  1 1 
       1602 1 1 1 1 79 GLN H    . 79 . HN   1 1 
       1602 1 2 1 1 80 THR H    . 80 . HN   1 1 
       1603 1 1 1 1 79 GLN H    . 79 . HN   1 1 
       1603 1 2 1 1 81 VAL MG2  . 81 . HG2* 1 1 
       1604 1 1 1 1 79 GLN HA   . 79 . HA   1 1 
       1604 1 2 1 1 80 THR H    . 80 . HN   1 1 
       1605 1 1 1 1 79 GLN HB2  . 79 . HB2  1 1 
       1605 1 2 1 1 79 GLN HE22 . 79 . HE22 1 1 
       1606 1 1 1 1 79 GLN HB2  . 79 . HB2  1 1 
       1606 1 2 1 1 80 THR H    . 80 . HN   1 1 
       1607 1 1 1 1 79 GLN HB3  . 79 . HB1  1 1 
       1607 1 2 1 1 79 GLN HE21 . 79 . HE21 1 1 
       1608 1 1 1 1 79 GLN HB3  . 79 . HB1  1 1 
       1608 1 2 1 1 79 GLN HE22 . 79 . HE22 1 1 
       1609 1 1 1 1 79 GLN HB3  . 79 . HB1  1 1 
       1609 1 2 1 1 80 THR H    . 80 . HN   1 1 
       1610 1 1 1 1 79 GLN HE21 . 79 . HE21 1 1 
       1610 1 2 1 1 81 VAL MG2  . 81 . HG2* 1 1 
       1611 1 1 1 1 79 GLN HE22 . 79 . HE22 1 1 
       1611 1 2 1 1 81 VAL MG2  . 81 . HG2* 1 1 
       1612 1 1 1 1 79 GLN HG2  . 79 . HG2  1 1 
       1612 1 2 1 1 80 THR H    . 80 . HN   1 1 
       1613 1 1 1 1 79 GLN HG2  . 79 . HG2  1 1 
       1613 1 2 1 1 81 VAL MG2  . 81 . HG2* 1 1 
       1614 1 1 1 1 79 GLN HG3  . 79 . HG1  1 1 
       1614 1 2 1 1 80 THR H    . 80 . HN   1 1 
       1615 1 1 1 1 79 GLN HG3  . 79 . HG1  1 1 
       1615 1 2 1 1 81 VAL MG2  . 81 . HG2* 1 1 
       1616 1 1 1 1 80 THR H    . 80 . HN   1 1 
       1616 1 2 1 1 80 THR HB   . 80 . HB   1 1 
       1617 1 1 1 1 80 THR H    . 80 . HN   1 1 
       1617 1 2 1 1 80 THR MG   . 80 . HG2* 1 1 
       1618 1 1 1 1 80 THR H    . 80 . HN   1 1 
       1618 1 2 1 1 81 VAL H    . 81 . HN   1 1 
       1619 1 1 1 1 80 THR H    . 80 . HN   1 1 
       1619 1 2 1 1 81 VAL MG2  . 81 . HG2* 1 1 
       1620 1 1 1 1 80 THR HA   . 80 . HA   1 1 
       1620 1 2 1 1 80 THR MG   . 80 . HG2* 1 1 
       1621 1 1 1 1 80 THR HA   . 80 . HA   1 1 
       1621 1 2 1 1 81 VAL H    . 81 . HN   1 1 
       1622 1 1 1 1 80 THR HB   . 80 . HB   1 1 
       1622 1 2 1 1 81 VAL H    . 81 . HN   1 1 
       1623 1 1 1 1 80 THR MG   . 80 . HG2* 1 1 
       1623 1 2 1 1 81 VAL H    . 81 . HN   1 1 
       1624 1 1 1 1 81 VAL H    . 81 . HN   1 1 
       1624 1 2 1 1 81 VAL HB   . 81 . HB   1 1 
       1625 1 1 1 1 81 VAL H    . 81 . HN   1 1 
       1625 1 2 1 1 81 VAL MG1  . 81 . HG1* 1 1 
       1626 1 1 1 1 81 VAL H    . 81 . HN   1 1 
       1626 1 2 1 1 81 VAL MG2  . 81 . HG2* 1 1 
       1627 1 1 1 1 81 VAL H    . 81 . HN   1 1 
       1627 1 2 1 1 82 THR H    . 82 . HN   1 1 
       1628 1 1 1 1 81 VAL HA   . 81 . HA   1 1 
       1628 1 2 1 1 82 THR H    . 82 . HN   1 1 
       1629 1 1 1 1 81 VAL HB   . 81 . HB   1 1 
       1629 1 2 1 1 82 THR H    . 82 . HN   1 1 
       1630 1 1 1 1 81 VAL HB   . 81 . HB   1 1 
       1630 1 2 1 1 83 VAL MG2  . 83 . HG2* 1 1 
       1631 1 1 1 1 81 VAL MG1  . 81 . HG1* 1 1 
       1631 1 2 1 1 82 THR H    . 82 . HN   1 1 
       1632 1 1 1 1 81 VAL MG1  . 81 . HG1* 1 1 
       1632 1 2 1 1 82 THR HB   . 82 . HB   1 1 
       1633 1 1 1 1 81 VAL MG1  . 81 . HG1* 1 1 
       1633 1 2 1 1 83 VAL HA   . 83 . HA   1 1 
       1634 1 1 1 1 81 VAL MG1  . 81 . HG1* 1 1 
       1634 1 2 1 1 83 VAL MG2  . 83 . HG2* 1 1 
       1635 1 1 1 1 81 VAL MG2  . 81 . HG2* 1 1 
       1635 1 2 1 1 82 THR H    . 82 . HN   1 1 
       1636 1 1 1 1 82 THR H    . 82 . HN   1 1 
       1636 1 2 1 1 82 THR HB   . 82 . HB   1 1 
       1637 1 1 1 1 82 THR H    . 82 . HN   1 1 
       1637 1 2 1 1 82 THR MG   . 82 . HG2* 1 1 
       1638 1 1 1 1 82 THR H    . 82 . HN   1 1 
       1638 1 2 1 1 83 VAL H    . 83 . HN   1 1 
       1639 1 1 1 1 82 THR H    . 82 . HN   1 1 
       1639 1 2 1 1 83 VAL MG2  . 83 . HG2* 1 1 
       1640 1 1 1 1 82 THR HA   . 82 . HA   1 1 
       1640 1 2 1 1 83 VAL H    . 83 . HN   1 1 
       1641 1 1 1 1 82 THR HA   . 82 . HA   1 1 
       1641 1 2 1 1 83 VAL MG2  . 83 . HG2* 1 1 
       1642 1 1 1 1 82 THR HB   . 82 . HB   1 1 
       1642 1 2 1 1 83 VAL H    . 83 . HN   1 1 
       1643 1 1 1 1 82 THR MG   . 82 . HG2* 1 1 
       1643 1 2 1 1 83 VAL H    . 83 . HN   1 1 
       1644 1 1 1 1 82 THR MG   . 82 . HG2* 1 1 
       1644 1 2 1 1 83 VAL HA   . 83 . HA   1 1 
       1645 1 1 1 1 82 THR MG   . 82 . HG2* 1 1 
       1645 1 2 1 1 84 LYS H    . 84 . HN   1 1 
       1646 1 1 1 1 83 VAL H    . 83 . HN   1 1 
       1646 1 2 1 1 83 VAL HB   . 83 . HB   1 1 
       1647 1 1 1 1 83 VAL H    . 83 . HN   1 1 
       1647 1 2 1 1 83 VAL MG1  . 83 . HG1* 1 1 
       1648 1 1 1 1 83 VAL H    . 83 . HN   1 1 
       1648 1 2 1 1 83 VAL MG2  . 83 . HG2* 1 1 
       1649 1 1 1 1 83 VAL H    . 83 . HN   1 1 
       1649 1 2 1 1 84 LYS H    . 84 . HN   1 1 
       1650 1 1 1 1 83 VAL HA   . 83 . HA   1 1 
       1650 1 2 1 1 84 LYS H    . 84 . HN   1 1 
       1651 1 1 1 1 83 VAL MG1  . 83 . HG1* 1 1 
       1651 1 2 1 1 84 LYS H    . 84 . HN   1 1 
       1652 1 1 1 1 83 VAL MG2  . 83 . HG2* 1 1 
       1652 1 2 1 1 84 LYS H    . 84 . HN   1 1 
       1653 1 1 1 1 84 LYS H    . 84 . HN   1 1 
       1653 1 2 1 1 84 LYS HB2  . 84 . HB2  1 1 
       1654 1 1 1 1 84 LYS H    . 84 . HN   1 1 
       1654 1 2 1 1 84 LYS QB   . 84 . HB*  1 1 
       1655 1 1 1 1 84 LYS H    . 84 . HN   1 1 
       1655 1 2 1 1 84 LYS HB3  . 84 . HB1  1 1 
       1656 1 1 1 1 84 LYS H    . 84 . HN   1 1 
       1656 1 2 1 1 84 LYS QD   . 84 . HD*  1 1 
       1657 1 1 1 1 84 LYS H    . 84 . HN   1 1 
       1657 1 2 1 1 84 LYS QG   . 84 . HG*  1 1 
       1658 1 1 1 1 84 LYS H    . 84 . HN   1 1 
       1658 1 2 1 1 85 VAL H    . 85 . HN   1 1 
       1659 1 1 1 1 84 LYS HA   . 84 . HA   1 1 
       1659 1 2 1 1 84 LYS QE   . 84 . HE*  1 1 
       1660 1 1 1 1 84 LYS HA   . 84 . HA   1 1 
       1660 1 2 1 1 85 VAL H    . 85 . HN   1 1 
       1661 1 1 1 1 84 LYS HA   . 84 . HA   1 1 
       1661 1 2 1 1 85 VAL HB   . 85 . HB   1 1 
       1662 1 1 1 1 84 LYS HA   . 84 . HA   1 1 
       1662 1 2 1 1 85 VAL MG2  . 85 . HG2* 1 1 
       1663 1 1 1 1 84 LYS QB   . 84 . HB*  1 1 
       1663 1 2 1 1 84 LYS QD   . 84 . HD*  1 1 
       1664 1 1 1 1 84 LYS QB   . 84 . HB*  1 1 
       1664 1 2 1 1 85 VAL H    . 85 . HN   1 1 
       1665 1 1 1 1 84 LYS QB   . 84 . HB*  1 1 
       1665 1 2 1 1 85 VAL MG1  . 85 . HG1* 1 1 
       1666 1 1 1 1 84 LYS QB   . 84 . HB*  1 1 
       1666 1 2 1 1 85 VAL MG2  . 85 . HG2* 1 1 
       1667 1 1 1 1 84 LYS HB2  . 84 . HB2  1 1 
       1667 1 2 1 1 84 LYS QD   . 84 . HD*  1 1 
       1668 1 1 1 1 84 LYS HB2  . 84 . HB2  1 1 
       1668 1 2 1 1 84 LYS QE   . 84 . HE*  1 1 
       1669 1 1 1 1 84 LYS HB2  . 84 . HB2  1 1 
       1669 1 2 1 1 85 VAL H    . 85 . HN   1 1 
       1670 1 1 1 1 84 LYS HB3  . 84 . HB1  1 1 
       1670 1 2 1 1 84 LYS QD   . 84 . HD*  1 1 
       1671 1 1 1 1 84 LYS HB3  . 84 . HB1  1 1 
       1671 1 2 1 1 84 LYS QE   . 84 . HE*  1 1 
       1672 1 1 1 1 84 LYS HB3  . 84 . HB1  1 1 
       1672 1 2 1 1 85 VAL H    . 85 . HN   1 1 
       1673 1 1 1 1 84 LYS QD   . 84 . HD*  1 1 
       1673 1 2 1 1 85 VAL H    . 85 . HN   1 1 
       1674 1 1 1 1 84 LYS QE   . 84 . HE*  1 1 
       1674 1 2 1 1 84 LYS QG   . 84 . HG*  1 1 
       1675 1 1 1 1 84 LYS QG   . 84 . HG*  1 1 
       1675 1 2 1 1 85 VAL H    . 85 . HN   1 1 
       1676 1 1 1 1 85 VAL H    . 85 . HN   1 1 
       1676 1 2 1 1 85 VAL HB   . 85 . HB   1 1 
       1677 1 1 1 1 85 VAL H    . 85 . HN   1 1 
       1677 1 2 1 1 85 VAL MG1  . 85 . HG1* 1 1 
       1678 1 1 1 1 85 VAL H    . 85 . HN   1 1 
       1678 1 2 1 1 85 VAL MG2  . 85 . HG2* 1 1 
       1679 1 1 1 1 85 VAL H    . 85 . HN   1 1 
       1679 1 2 1 1 86 ARG H    . 86 . HN   1 1 
       1680 1 1 1 1 85 VAL HA   . 85 . HA   1 1 
       1680 1 2 1 1 85 VAL MG1  . 85 . HG1* 1 1 
       1681 1 1 1 1 85 VAL HA   . 85 . HA   1 1 
       1681 1 2 1 1 85 VAL MG2  . 85 . HG2* 1 1 
       1682 1 1 1 1 85 VAL HA   . 85 . HA   1 1 
       1682 1 2 1 1 86 ARG H    . 86 . HN   1 1 
       1683 1 1 1 1 85 VAL HA   . 85 . HA   1 1 
       1683 1 2 1 1 86 ARG QG   . 86 . HG*  1 1 
       1684 1 1 1 1 85 VAL HB   . 85 . HB   1 1 
       1684 1 2 1 1 86 ARG H    . 86 . HN   1 1 
       1685 1 1 1 1 85 VAL MG1  . 85 . HG1* 1 1 
       1685 1 2 1 1 86 ARG H    . 86 . HN   1 1 
       1686 1 1 1 1 85 VAL MG1  . 85 . HG1* 1 1 
       1686 1 2 1 1 87 GLU H    . 87 . HN   1 1 
       1687 1 1 1 1 86 ARG H    . 86 . HN   1 1 
       1687 1 2 1 1 86 ARG HB2  . 86 . HB2  1 1 
       1688 1 1 1 1 86 ARG H    . 86 . HN   1 1 
       1688 1 2 1 1 86 ARG QB   . 86 . HB*  1 1 
       1689 1 1 1 1 86 ARG H    . 86 . HN   1 1 
       1689 1 2 1 1 86 ARG HB3  . 86 . HB1  1 1 
       1690 1 1 1 1 86 ARG H    . 86 . HN   1 1 
       1690 1 2 1 1 86 ARG QD   . 86 . HD*  1 1 
       1691 1 1 1 1 86 ARG H    . 86 . HN   1 1 
       1691 1 2 1 1 86 ARG HG2  . 86 . HG2  1 1 
       1692 1 1 1 1 86 ARG H    . 86 . HN   1 1 
       1692 1 2 1 1 86 ARG QG   . 86 . HG*  1 1 
       1693 1 1 1 1 86 ARG H    . 86 . HN   1 1 
       1693 1 2 1 1 86 ARG HG3  . 86 . HG1  1 1 
       1694 1 1 1 1 86 ARG H    . 86 . HN   1 1 
       1694 1 2 1 1 87 GLU H    . 87 . HN   1 1 
       1695 1 1 1 1 86 ARG HA   . 86 . HA   1 1 
       1695 1 2 1 1 86 ARG QD   . 86 . HD*  1 1 
       1696 1 1 1 1 86 ARG HA   . 86 . HA   1 1 
       1696 1 2 1 1 86 ARG HG2  . 86 . HG2  1 1 
       1697 1 1 1 1 86 ARG HA   . 86 . HA   1 1 
       1697 1 2 1 1 86 ARG HG3  . 86 . HG1  1 1 
       1698 1 1 1 1 86 ARG HA   . 86 . HA   1 1 
       1698 1 2 1 1 87 GLU H    . 87 . HN   1 1 
       1699 1 1 1 1 86 ARG HA   . 86 . HA   1 1 
       1699 1 2 1 1 87 GLU QG   . 87 . HG*  1 1 
       1700 1 1 1 1 86 ARG QB   . 86 . HB*  1 1 
       1700 1 2 1 1 86 ARG QD   . 86 . HD*  1 1 
       1701 1 1 1 1 86 ARG QB   . 86 . HB*  1 1 
       1701 1 2 1 1 87 GLU H    . 87 . HN   1 1 
       1702 1 1 1 1 86 ARG HB2  . 86 . HB2  1 1 
       1702 1 2 1 1 86 ARG QD   . 86 . HD*  1 1 
       1703 1 1 1 1 86 ARG HB2  . 86 . HB2  1 1 
       1703 1 2 1 1 87 GLU H    . 87 . HN   1 1 
       1704 1 1 1 1 86 ARG HB3  . 86 . HB1  1 1 
       1704 1 2 1 1 86 ARG QD   . 86 . HD*  1 1 
       1705 1 1 1 1 86 ARG HB3  . 86 . HB1  1 1 
       1705 1 2 1 1 87 GLU H    . 87 . HN   1 1 
       1706 1 1 1 1 86 ARG QD   . 86 . HD*  1 1 
       1706 1 2 1 1 87 GLU H    . 87 . HN   1 1 
       1707 1 1 1 1 86 ARG QG   . 86 . HG*  1 1 
       1707 1 2 1 1 87 GLU H    . 87 . HN   1 1 
       1708 1 1 1 1 86 ARG HG2  . 86 . HG2  1 1 
       1708 1 2 1 1 87 GLU H    . 87 . HN   1 1 
       1709 1 1 1 1 86 ARG HG3  . 86 . HG1  1 1 
       1709 1 2 1 1 87 GLU H    . 87 . HN   1 1 
       1710 1 1 1 1 87 GLU H    . 87 . HN   1 1 
       1710 1 2 1 1 87 GLU HB2  . 87 . HB2  1 1 
       1711 1 1 1 1 87 GLU H    . 87 . HN   1 1 
       1711 1 2 1 1 87 GLU QB   . 87 . HB*  1 1 
       1712 1 1 1 1 87 GLU H    . 87 . HN   1 1 
       1712 1 2 1 1 87 GLU HB3  . 87 . HB1  1 1 
       1713 1 1 1 1 87 GLU H    . 87 . HN   1 1 
       1713 1 2 1 1 87 GLU QG   . 87 . HG*  1 1 
       1714 1 1 1 1 87 GLU HA   . 87 . HA   1 1 
       1714 1 2 1 1 88 GLU H    . 88 . HN   1 1 
       1715 1 1 1 1 87 GLU HB2  . 87 . HB2  1 1 
       1715 1 2 1 1 88 GLU H    . 88 . HN   1 1 
       1716 1 1 1 1 87 GLU HB3  . 87 . HB1  1 1 
       1716 1 2 1 1 88 GLU H    . 88 . HN   1 1 
       1717 1 1 1 1 88 GLU H    . 88 . HN   1 1 
       1717 1 2 1 1 88 GLU QG   . 88 . HG*  1 1 
       1718 1 1 1 1 88 GLU H    . 88 . HN   1 1 
       1718 1 2 1 1 89 VAL H    . 89 . HN   1 1 
       1719 1 1 1 1 88 GLU HA   . 88 . HA   1 1 
       1719 1 2 1 1 88 GLU QG   . 88 . HG*  1 1 
       1720 1 1 1 1 88 GLU HA   . 88 . HA   1 1 
       1720 1 2 1 1 89 VAL H    . 89 . HN   1 1 
       1721 1 1 1 1 88 GLU HA   . 88 . HA   1 1 
       1721 1 2 1 1 89 VAL MG1  . 89 . HG1* 1 1 
       1722 1 1 1 1 88 GLU HA   . 88 . HA   1 1 
       1722 1 2 1 1 89 VAL QG   . 89 . HG*  1 1 
       1723 1 1 1 1 88 GLU HA   . 88 . HA   1 1 
       1723 1 2 1 1 89 VAL MG2  . 89 . HG2* 1 1 
       1724 1 1 1 1 88 GLU HB2  . 88 . HB2  1 1 
       1724 1 2 1 1 89 VAL H    . 89 . HN   1 1 
       1725 1 1 1 1 88 GLU HB3  . 88 . HB1  1 1 
       1725 1 2 1 1 89 VAL H    . 89 . HN   1 1 
       1726 1 1 1 1 88 GLU QG   . 88 . HG*  1 1 
       1726 1 2 1 1 89 VAL H    . 89 . HN   1 1 
       1727 1 1 1 1 89 VAL H    . 89 . HN   1 1 
       1727 1 2 1 1 89 VAL HB   . 89 . HB   1 1 
       1728 1 1 1 1 89 VAL H    . 89 . HN   1 1 
       1728 1 2 1 1 89 VAL MG1  . 89 . HG1* 1 1 
       1729 1 1 1 1 89 VAL H    . 89 . HN   1 1 
       1729 1 2 1 1 89 VAL QG   . 89 . HG*  1 1 
       1730 1 1 1 1 89 VAL H    . 89 . HN   1 1 
       1730 1 2 1 1 89 VAL MG2  . 89 . HG2* 1 1 
       1731 1 1 1 1 89 VAL H    . 89 . HN   1 1 
       1731 1 2 1 1 90 LYS H    . 90 . HN   1 1 
       1732 1 1 1 1 89 VAL HA   . 89 . HA   1 1 
       1732 1 2 1 1 90 LYS H    . 90 . HN   1 1 
       1733 1 1 1 1 89 VAL HB   . 89 . HB   1 1 
       1733 1 2 1 1 90 LYS H    . 90 . HN   1 1 
       1734 1 1 1 1 89 VAL QG   . 89 . HG*  1 1 
       1734 1 2 1 1 90 LYS H    . 90 . HN   1 1 
       1735 1 1 1 1 89 VAL MG1  . 89 . HG1* 1 1 
       1735 1 2 1 1 90 LYS H    . 90 . HN   1 1 
       1736 1 1 1 1 89 VAL MG2  . 89 . HG2* 1 1 
       1736 1 2 1 1 90 LYS H    . 90 . HN   1 1 
       1737 1 1 1 1 90 LYS H    . 90 . HN   1 1 
       1737 1 2 1 1 90 LYS HB2  . 90 . HB2  1 1 
       1738 1 1 1 1 90 LYS H    . 90 . HN   1 1 
       1738 1 2 1 1 90 LYS QB   . 90 . HB*  1 1 
       1739 1 1 1 1 90 LYS H    . 90 . HN   1 1 
       1739 1 2 1 1 90 LYS HB3  . 90 . HB1  1 1 
       1740 1 1 1 1 90 LYS H    . 90 . HN   1 1 
       1740 1 2 1 1 90 LYS QD   . 90 . HD*  1 1 
       1741 1 1 1 1 90 LYS H    . 90 . HN   1 1 
       1741 1 2 1 1 90 LYS HG2  . 90 . HG2  1 1 
       1742 1 1 1 1 90 LYS H    . 90 . HN   1 1 
       1742 1 2 1 1 90 LYS HG3  . 90 . HG1  1 1 
       1743 1 1 1 1 90 LYS HA   . 90 . HA   1 1 
       1743 1 2 1 1 91 ASN H    . 91 . HN   1 1 
       1744 1 1 1 1 90 LYS QB   . 90 . HB*  1 1 
       1744 1 2 1 1 90 LYS QD   . 90 . HD*  1 1 
       1745 1 1 1 1 90 LYS HB2  . 90 . HB2  1 1 
       1745 1 2 1 1 90 LYS QD   . 90 . HD*  1 1 
       1746 1 1 1 1 90 LYS HB2  . 90 . HB2  1 1 
       1746 1 2 1 1 91 ASN H    . 91 . HN   1 1 
       1747 1 1 1 1 90 LYS HB3  . 90 . HB1  1 1 
       1747 1 2 1 1 90 LYS QD   . 90 . HD*  1 1 
       1748 1 1 1 1 90 LYS HB3  . 90 . HB1  1 1 
       1748 1 2 1 1 91 ASN H    . 91 . HN   1 1 
       1749 1 1 1 1 91 ASN HA   . 91 . HA   1 1 
       1749 1 2 1 1 92 ASP H    . 92 . HN   1 1 
       1750 1 1 1 1 92 ASP H    . 92 . HN   1 1 
       1750 1 2 1 1 92 ASP QB   . 92 . HB*  1 1 
       1751 1 1 1 1 92 ASP H    . 92 . HN   1 1 
       1751 1 2 1 1 93 LYS H    . 93 . HN   1 1 
       1752 1 1 1 1 92 ASP HA   . 92 . HA   1 1 
       1752 1 2 1 1 93 LYS H    . 93 . HN   1 1 
       1753 1 1 1 1 92 ASP QB   . 92 . HB*  1 1 
       1753 1 2 1 1 93 LYS H    . 93 . HN   1 1 
       1754 1 1 1 1 93 LYS H    . 93 . HN   1 1 
       1754 1 2 1 1 93 LYS HB2  . 93 . HB2  1 1 
       1755 1 1 1 1 93 LYS H    . 93 . HN   1 1 
       1755 1 2 1 1 93 LYS QB   . 93 . HB*  1 1 
       1756 1 1 1 1 93 LYS H    . 93 . HN   1 1 
       1756 1 2 1 1 93 LYS HB3  . 93 . HB1  1 1 
       1757 1 1 1 1 93 LYS H    . 93 . HN   1 1 
       1757 1 2 1 1 93 LYS HG2  . 93 . HG2  1 1 
       1758 1 1 1 1 93 LYS H    . 93 . HN   1 1 
       1758 1 2 1 1 93 LYS QG   . 93 . HG*  1 1 
       1759 1 1 1 1 93 LYS H    . 93 . HN   1 1 
       1759 1 2 1 1 93 LYS HG3  . 93 . HG1  1 1 
       1760 1 1 1 1 93 LYS HA   . 93 . HA   1 1 
       1760 1 2 1 1 94 PRO HD2  . 94 . HD2  1 1 
       1761 1 1 1 1 93 LYS HA   . 93 . HA   1 1 
       1761 1 2 1 1 94 PRO QD   . 94 . HD*  1 1 
       1762 1 1 1 1 93 LYS HA   . 93 . HA   1 1 
       1762 1 2 1 1 94 PRO HD3  . 94 . HD1  1 1 
       1763 1 1 1 1 93 LYS QB   . 93 . HB*  1 1 
       1763 1 2 1 1 93 LYS QD   . 93 . HD*  1 1 
       1764 1 1 1 1 93 LYS QB   . 93 . HB*  1 1 
       1764 1 2 1 1 94 PRO QD   . 94 . HD*  1 1 
       1765 1 1 1 1 94 PRO HA   . 94 . HA   1 1 
       1765 1 2 1 1 95 ILE H    . 95 . HN   1 1 
       1766 1 1 1 1 94 PRO HB2  . 94 . HB2  1 1 
       1766 1 2 1 1 95 ILE H    . 95 . HN   1 1 
       1767 1 1 1 1 94 PRO HB3  . 94 . HB1  1 1 
       1767 1 2 1 1 95 ILE H    . 95 . HN   1 1 
       1768 1 1 1 1 95 ILE H    . 95 . HN   1 1 
       1768 1 2 1 1 95 ILE MD   . 95 . HD1* 1 1 
       1769 1 1 1 1 95 ILE H    . 95 . HN   1 1 
       1769 1 2 1 1 95 ILE HG12 . 95 . HG12 1 1 
       1770 1 1 1 1 95 ILE H    . 95 . HN   1 1 
       1770 1 2 1 1 95 ILE HG13 . 95 . HG11 1 1 
       1771 1 1 1 1 95 ILE H    . 95 . HN   1 1 
       1771 1 2 1 1 95 ILE MG   . 95 . HG2* 1 1 
       1772 1 1 1 1 95 ILE HA   . 95 . HA   1 1 
       1772 1 2 1 1 96 LEU H    . 96 . HN   1 1 
       1773 1 1 1 1 95 ILE HB   . 95 . HB   1 1 
       1773 1 2 1 1 96 LEU H    . 96 . HN   1 1 
       1774 1 1 1 1 95 ILE QG   . 95 . HG1* 1 1 
       1774 1 2 1 1 95 ILE MG   . 95 . HG2* 1 1 
       1775 1 1 1 1 95 ILE MG   . 95 . HG2* 1 1 
       1775 1 2 1 1 96 LEU H    . 96 . HN   1 1 
       1776 1 1 1 1 96 LEU H    . 96 . HN   1 1 
       1776 1 2 1 1 96 LEU HB2  . 96 . HB2  1 1 
       1777 1 1 1 1 96 LEU H    . 96 . HN   1 1 
       1777 1 2 1 1 96 LEU QB   . 96 . HB*  1 1 
       1778 1 1 1 1 96 LEU H    . 96 . HN   1 1 
       1778 1 2 1 1 96 LEU HB3  . 96 . HB1  1 1 
       1779 1 1 1 1 96 LEU H    . 96 . HN   1 1 
       1779 1 2 1 1 96 LEU MD1  . 96 . HD1* 1 1 
       1780 1 1 1 1 96 LEU H    . 96 . HN   1 1 
       1780 1 2 1 1 96 LEU QD   . 96 . HD*  1 1 
       1781 1 1 1 1 96 LEU H    . 96 . HN   1 1 
       1781 1 2 1 1 96 LEU MD2  . 96 . HD2* 1 1 
       1782 1 1 1 1 96 LEU H    . 96 . HN   1 1 
       1782 1 2 1 1 96 LEU HG   . 96 . HG   1 1 
       1783 1 1 1 1 96 LEU HA   . 96 . HA   1 1 
       1783 1 2 1 1 96 LEU QD   . 96 . HD*  1 1 
       1784 1 1 1 1 96 LEU HA   . 96 . HA   1 1 
       1784 1 2 1 1 96 LEU HG   . 96 . HG   1 1 
       1785 1 1 1 1 96 LEU HA   . 96 . HA   1 1 
       1785 1 2 1 1 97 GLU H    . 97 . HN   1 1 
       1786 1 1 1 1 96 LEU QB   . 96 . HB*  1 1 
       1786 1 2 1 1 97 GLU H    . 97 . HN   1 1 
       1787 1 1 1 1 96 LEU QD   . 96 . HD*  1 1 
       1787 1 2 1 1 97 GLU H    . 97 . HN   1 1 
       1788 1 1 1 1 96 LEU HG   . 96 . HG   1 1 
       1788 1 2 1 1 97 GLU H    . 97 . HN   1 1 
       1789 1 1 1 1 97 GLU H    . 97 . HN   1 1 
       1789 1 2 1 1 97 GLU HB2  . 97 . HB2  1 1 
       1790 1 1 1 1 97 GLU H    . 97 . HN   1 1 
       1790 1 2 1 1 97 GLU QB   . 97 . HB*  1 1 
       1791 1 1 1 1 97 GLU H    . 97 . HN   1 1 
       1791 1 2 1 1 97 GLU HB3  . 97 . HB1  1 1 
       1792 1 1 1 1 97 GLU H    . 97 . HN   1 1 
       1792 1 2 1 1 97 GLU HG2  . 97 . HG2  1 1 
       1793 1 1 1 1 97 GLU H    . 97 . HN   1 1 
       1793 1 2 1 1 97 GLU QG   . 97 . HG*  1 1 
       1794 1 1 1 1 97 GLU H    . 97 . HN   1 1 
       1794 1 2 1 1 97 GLU HG3  . 97 . HG1  1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

          1 1 . . . . .  5.5 1.8 6.05 1 1 
          2 1 . . . . . 3.31 1.8 3.64 1 1 
          3 1 . . . . .  5.5 1.8 6.05 1 1 
          4 1 . . . . . 2.84 1.8 3.12 1 1 
          5 1 . . . . . 4.86 1.8 5.35 1 1 
          6 1 . . . . . 4.93 1.8 5.42 1 1 
          7 1 . . . . .  3.6 1.8 3.96 1 1 
          8 1 . . . . . 3.76 1.8 4.14 1 1 
          9 1 . . . . . 3.54 1.8 3.89 1 1 
         10 1 . . . . . 3.48 1.8 3.83 1 1 
         11 1 . . . . . 4.76 1.8 5.24 1 1 
         12 1 . . . . . 4.89 1.8 5.38 1 1 
         13 1 . . . . . 3.07 1.8 3.38 1 1 
         14 1 . . . . . 4.67 1.8 5.14 1 1 
         15 1 . . . . . 4.94 1.8 5.43 1 1 
         16 1 . . . . . 4.18 1.8  4.6 1 1 
         17 1 . . . . . 4.34 1.8 4.77 1 1 
         18 1 . . . . . 4.99 1.8 5.49 1 1 
         19 1 . . . . . 4.83 1.8 5.31 1 1 
         20 1 . . . . . 3.89 1.8 4.28 1 1 
         21 1 . . . . . 4.58 1.8 5.04 1 1 
         22 1 . . . . . 4.86 1.8 5.35 1 1 
         23 1 . . . . . 4.89 1.8 5.38 1 1 
         24 1 . . . . . 3.22 1.8 3.54 1 1 
         25 1 . . . . .  3.5 1.8 3.85 1 1 
         26 1 . . . . . 3.86 1.8 4.25 1 1 
         27 1 . . . . . 4.18 1.8  4.6 1 1 
         28 1 . . . . . 4.19 1.8 4.61 1 1 
         29 1 . . . . . 3.58 1.8 3.94 1 1 
         30 1 . . . . . 4.54 1.8 4.99 1 1 
         31 1 . . . . . 4.06 1.8 4.47 1 1 
         32 1 . . . . . 3.23 1.8 3.55 1 1 
         33 1 . . . . . 4.13 1.8 4.54 1 1 
         34 1 . . . . . 2.82 1.8  3.1 1 1 
         35 1 . . . . . 4.28 1.8 4.71 1 1 
         36 1 . . . . . 3.27 1.8  3.6 1 1 
         37 1 . . . . . 3.44 1.8 3.78 1 1 
         38 1 . . . . . 4.49 1.8 4.94 1 1 
         39 1 . . . . . 3.32 1.8 3.65 1 1 
         40 1 . . . . .  3.4 1.8 3.74 1 1 
         41 1 . . . . . 3.54 1.8 3.89 1 1 
         42 1 . . . . .  5.5 1.8 6.05 1 1 
         43 1 . . . . . 5.29 1.8 5.82 1 1 
         44 1 . . . . . 4.55 1.8 5.01 1 1 
         45 1 . . . . . 3.26 1.8 3.59 1 1 
         46 1 . . . . . 4.03 1.8 4.43 1 1 
         47 1 . . . . . 5.49 1.8 6.04 1 1 
         48 1 . . . . . 3.88 1.8 4.27 1 1 
         49 1 . . . . . 5.24 1.8 5.76 1 1 
         50 1 . . . . .  3.7 1.8 4.07 1 1 
         51 1 . . . . . 3.41 1.8 3.75 1 1 
         52 1 . . . . . 3.19 1.8 3.51 1 1 
         53 1 . . . . . 4.85 1.8 5.33 1 1 
         54 1 . . . . . 4.97 1.8 5.47 1 1 
         55 1 . . . . . 5.44 1.8 5.98 1 1 
         56 1 . . . . . 3.69 1.8 4.06 1 1 
         57 1 . . . . . 3.76 1.8 4.14 1 1 
         58 1 . . . . . 4.76 1.8 5.24 1 1 
         59 1 . . . . . 3.89 1.8 4.28 1 1 
         60 1 . . . . . 4.58 1.8 5.04 1 1 
         61 1 . . . . . 4.44 1.8 4.88 1 1 
         62 1 . . . . . 4.85 1.8 5.33 1 1 
         63 1 . . . . . 4.76 1.8 5.24 1 1 
         64 1 . . . . . 4.51 1.8 4.96 1 1 
         65 1 . . . . . 3.14 1.8 3.45 1 1 
         66 1 . . . . . 4.51 1.8 4.96 1 1 
         67 1 . . . . .  5.5 1.8 6.05 1 1 
         68 1 . . . . .  4.3 1.8 4.73 1 1 
         69 1 . . . . . 4.27 1.8  4.7 1 1 
         70 1 . . . . . 4.48 1.8 4.93 1 1 
         71 1 . . . . . 3.57 1.8 3.93 1 1 
         72 1 . . . . .  5.5 1.8 6.05 1 1 
         73 1 . . . . . 5.22 1.8 5.74 1 1 
         74 1 . . . . .  5.5 1.8 6.05 1 1 
         75 1 . . . . . 5.97 1.8 6.57 1 1 
         76 1 . . . . . 5.97 1.8 6.57 1 1 
         77 1 . . . . .  5.5 1.8 6.05 1 1 
         78 1 . . . . . 5.22 1.8 5.74 1 1 
         79 1 . . . . .  5.5 1.8 6.05 1 1 
         80 1 . . . . . 5.97 1.8 6.57 1 1 
         81 1 . . . . . 5.97 1.8 6.57 1 1 
         82 1 . . . . . 3.02 1.8 3.32 1 1 
         83 1 . . . . . 3.69 1.8 4.06 1 1 
         84 1 . . . . .  5.5 1.8 6.05 1 1 
         85 1 . . . . .  5.5 1.8 6.05 1 1 
         86 1 . . . . . 4.28 1.8 4.71 1 1 
         87 1 . . . . . 4.02 1.8 4.42 1 1 
         88 1 . . . . . 4.62 1.8 5.08 1 1 
         89 1 . . . . . 3.98 1.8 4.38 1 1 
         90 1 . . . . . 3.84 1.8 4.22 1 1 
         91 1 . . . . . 4.25 1.8 4.68 1 1 
         92 1 . . . . . 3.96 1.8 4.36 1 1 
         93 1 . . . . . 4.69 1.8 5.16 1 1 
         94 1 . . . . . 5.09 1.8  5.6 1 1 
         95 1 . . . . . 4.78 1.8 5.26 1 1 
         96 1 . . . . . 4.57 1.8 5.03 1 1 
         97 1 . . . . . 4.52 1.8 4.97 1 1 
         98 1 . . . . . 3.96 1.8 4.36 1 1 
         99 1 . . . . . 4.69 1.8 5.16 1 1 
        100 1 . . . . . 5.09 1.8  5.6 1 1 
        101 1 . . . . . 4.78 1.8 5.26 1 1 
        102 1 . . . . . 4.57 1.8 5.03 1 1 
        103 1 . . . . . 4.52 1.8 4.97 1 1 
        104 1 . . . . . 4.74 1.8 5.21 1 1 
        105 1 . . . . . 5.18 1.8  5.7 1 1 
        106 1 . . . . . 4.12 1.8 4.53 1 1 
        107 1 . . . . . 4.35 1.8 4.79 1 1 
        108 1 . . . . . 3.43 1.8 3.77 1 1 
        109 1 . . . . . 4.35 1.8 4.79 1 1 
        110 1 . . . . . 4.88 1.8 5.37 1 1 
        111 1 . . . . . 5.15 1.8 5.67 1 1 
        112 1 . . . . . 4.35 1.8 4.79 1 1 
        113 1 . . . . .  5.5 1.8 6.05 1 1 
        114 1 . . . . . 4.49 1.8 4.94 1 1 
        115 1 . . . . .  5.5 1.8 6.05 1 1 
        116 1 . . . . . 4.03 1.8 4.43 1 1 
        117 1 . . . . . 5.01 1.8 5.51 1 1 
        118 1 . . . . . 4.58 1.8 5.04 1 1 
        119 1 . . . . . 4.13 1.8 4.54 1 1 
        120 1 . . . . .  3.4 1.8 3.74 1 1 
        121 1 . . . . . 4.13 1.8 4.54 1 1 
        122 1 . . . . . 5.14 1.8 5.65 1 1 
        123 1 . . . . . 3.82 1.8  4.2 1 1 
        124 1 . . . . . 4.03 1.8 4.43 1 1 
        125 1 . . . . . 4.21 1.8 4.63 1 1 
        126 1 . . . . . 4.07 1.8 4.48 1 1 
        127 1 . . . . . 4.92 1.8 5.41 1 1 
        128 1 . . . . . 4.92 1.8 5.41 1 1 
        129 1 . . . . .  5.5 1.8 6.05 1 1 
        130 1 . . . . . 4.52 1.8 4.97 1 1 
        131 1 . . . . . 3.42 1.8 3.76 1 1 
        132 1 . . . . . 3.42 1.8 3.76 1 1 
        133 1 . . . . . 5.07 1.8 5.58 1 1 
        134 1 . . . . . 4.41 1.8 4.85 1 1 
        135 1 . . . . . 5.07 1.8 5.58 1 1 
        136 1 . . . . . 4.58 1.8 5.04 1 1 
        137 1 . . . . . 5.17 1.8 5.69 1 1 
        138 1 . . . . . 5.09 1.8  5.6 1 1 
        139 1 . . . . . 3.84 1.8 4.22 1 1 
        140 1 . . . . . 5.04 1.8 5.54 1 1 
        141 1 . . . . . 5.36 1.8  5.9 1 1 
        142 1 . . . . . 3.38 1.8 3.72 1 1 
        143 1 . . . . . 3.51 1.8 3.86 1 1 
        144 1 . . . . . 2.76 1.8 3.04 1 1 
        145 1 . . . . . 4.62 1.8 5.08 1 1 
        146 1 . . . . . 5.11 1.8 5.62 1 1 
        147 1 . . . . .  5.5 1.8 6.05 1 1 
        148 1 . . . . . 4.08 1.8 4.49 1 1 
        149 1 . . . . .  5.5 1.8 6.05 1 1 
        150 1 . . . . . 2.47 1.8 2.72 1 1 
        151 1 . . . . . 4.06 1.8 4.47 1 1 
        152 1 . . . . . 3.26 1.8 3.59 1 1 
        153 1 . . . . . 4.74 1.8 5.21 1 1 
        154 1 . . . . .  5.5 1.8 6.05 1 1 
        155 1 . . . . . 3.26 1.8 3.59 1 1 
        156 1 . . . . . 4.74 1.8 5.21 1 1 
        157 1 . . . . .  5.5 1.8 6.05 1 1 
        158 1 . . . . .  3.7 1.8 4.07 1 1 
        159 1 . . . . . 3.07 1.8 3.38 1 1 
        160 1 . . . . .  3.7 1.8 4.07 1 1 
        161 1 . . . . .  3.9 1.8 4.29 1 1 
        162 1 . . . . .  3.4 1.8 3.74 1 1 
        163 1 . . . . . 3.59 1.8 3.95 1 1 
        164 1 . . . . . 4.44 1.8 4.88 1 1 
        165 1 . . . . . 4.87 1.8 5.36 1 1 
        166 1 . . . . . 5.41 1.8 5.95 1 1 
        167 1 . . . . . 4.75 1.8 5.22 1 1 
        168 1 . . . . . 4.59 1.8 5.05 1 1 
        169 1 . . . . . 3.79 1.8 4.17 1 1 
        170 1 . . . . . 4.59 1.8 5.05 1 1 
        171 1 . . . . . 3.52 1.8 3.87 1 1 
        172 1 . . . . . 2.97 1.8 3.27 1 1 
        173 1 . . . . . 4.51 1.8 4.96 1 1 
        174 1 . . . . .  4.5 1.8 4.95 1 1 
        175 1 . . . . .  4.9 1.8 5.39 1 1 
        176 1 . . . . . 3.78 1.8 4.16 1 1 
        177 1 . . . . . 4.16 1.8 4.58 1 1 
        178 1 . . . . . 4.15 1.8 4.57 1 1 
        179 1 . . . . . 4.96 1.8 5.46 1 1 
        180 1 . . . . .  5.5 1.8 6.05 1 1 
        181 1 . . . . . 4.59 1.8 5.05 1 1 
        182 1 . . . . . 4.62 1.8 5.08 1 1 
        183 1 . . . . . 4.12 1.8 4.53 1 1 
        184 1 . . . . . 3.39 1.8 3.73 1 1 
        185 1 . . . . . 4.46 1.8 4.91 1 1 
        186 1 . . . . . 3.34 1.8 3.67 1 1 
        187 1 . . . . . 4.47 1.8 4.92 1 1 
        188 1 . . . . .  5.5 1.8 6.05 1 1 
        189 1 . . . . . 3.91 1.8  4.3 1 1 
        190 1 . . . . . 3.85 1.8 4.23 1 1 
        191 1 . . . . . 3.38 1.8 3.72 1 1 
        192 1 . . . . . 5.31 1.8 5.84 1 1 
        193 1 . . . . .  5.5 1.8 6.05 1 1 
        194 1 . . . . . 4.67 1.8 5.14 1 1 
        195 1 . . . . . 4.39 1.8 4.83 1 1 
        196 1 . . . . . 4.13 1.8 4.54 1 1 
        197 1 . . . . . 2.99 1.8 3.29 1 1 
        198 1 . . . . . 4.85 1.8 5.33 1 1 
        199 1 . . . . . 4.02 1.8 4.42 1 1 
        200 1 . . . . . 4.84 1.8 5.32 1 1 
        201 1 . . . . . 3.03 1.8 3.33 1 1 
        202 1 . . . . . 5.44 1.8 5.98 1 1 
        203 1 . . . . .  4.6 1.8 5.06 1 1 
        204 1 . . . . .  4.3 1.8 4.73 1 1 
        205 1 . . . . . 5.01 1.8 5.51 1 1 
        206 1 . . . . .  5.5 1.8 6.05 1 1 
        207 1 . . . . .  5.5 1.8 6.05 1 1 
        208 1 . . . . . 4.91 1.8  5.4 1 1 
        209 1 . . . . .  4.5 1.8 4.95 1 1 
        210 1 . . . . . 3.03 1.8 3.33 1 1 
        211 1 . . . . .  4.3 1.8 4.73 1 1 
        212 1 . . . . . 4.16 1.8 4.58 1 1 
        213 1 . . . . . 5.03 1.8 5.53 1 1 
        214 1 . . . . . 3.98 1.8 4.38 1 1 
        215 1 . . . . . 4.23 1.8 4.65 1 1 
        216 1 . . . . . 4.73 1.8  5.2 1 1 
        217 1 . . . . .  4.1 1.8 4.51 1 1 
        218 1 . . . . . 4.58 1.8 5.04 1 1 
        219 1 . . . . .  4.4 1.8 4.84 1 1 
        220 1 . . . . . 4.24 1.8 4.66 1 1 
        221 1 . . . . . 3.54 1.8 3.89 1 1 
        222 1 . . . . . 4.58 1.8 5.04 1 1 
        223 1 . . . . . 3.83 1.8 4.21 1 1 
        224 1 . . . . . 5.16 1.8 5.68 1 1 
        225 1 . . . . . 3.58 1.8 3.94 1 1 
        226 1 . . . . . 4.84 1.8 5.32 1 1 
        227 1 . . . . . 3.06 1.8 3.37 1 1 
        228 1 . . . . . 4.33 1.8 4.76 1 1 
        229 1 . . . . . 4.82 1.8  5.3 1 1 
        230 1 . . . . . 3.55 1.8  3.9 1 1 
        231 1 . . . . . 4.18 1.8  4.6 1 1 
        232 1 . . . . . 5.12 1.8 5.63 1 1 
        233 1 . . . . . 3.63 1.8 3.99 1 1 
        234 1 . . . . . 4.08 1.8 4.49 1 1 
        235 1 . . . . . 4.36 1.8  4.8 1 1 
        236 1 . . . . . 4.66 1.8 5.13 1 1 
        237 1 . . . . . 5.15 1.8 5.67 1 1 
        238 1 . . . . . 3.87 1.8 4.26 1 1 
        239 1 . . . . . 4.89 1.8 5.38 1 1 
        240 1 . . . . . 4.81 1.8 5.29 1 1 
        241 1 . . . . .  4.4 1.8 4.84 1 1 
        242 1 . . . . . 4.98 1.8 5.48 1 1 
        243 1 . . . . . 3.83 1.8 4.21 1 1 
        244 1 . . . . . 4.57 1.8 5.03 1 1 
        245 1 . . . . . 4.77 1.8 5.25 1 1 
        246 1 . . . . . 5.22 1.8 5.74 1 1 
        247 1 . . . . . 3.25 1.8 3.58 1 1 
        248 1 . . . . . 2.64 1.8  2.9 1 1 
        249 1 . . . . . 4.98 1.8 5.48 1 1 
        250 1 . . . . . 4.99 1.8 5.49 1 1 
        251 1 . . . . . 4.36 1.8  4.8 1 1 
        252 1 . . . . . 4.43 1.8 4.87 1 1 
        253 1 . . . . . 4.04 1.8 4.44 1 1 
        254 1 . . . . . 4.56 1.8 5.02 1 1 
        255 1 . . . . . 4.12 1.8 4.53 1 1 
        256 1 . . . . . 3.89 1.8 4.28 1 1 
        257 1 . . . . . 4.91 1.8  5.4 1 1 
        258 1 . . . . .  4.1 1.8 4.51 1 1 
        259 1 . . . . . 4.91 1.8  5.4 1 1 
        260 1 . . . . . 5.28 1.8 5.81 1 1 
        261 1 . . . . . 3.48 1.8 3.83 1 1 
        262 1 . . . . . 4.42 1.8 4.86 1 1 
        263 1 . . . . .  3.7 1.8 4.07 1 1 
        264 1 . . . . . 4.14 1.8 4.55 1 1 
        265 1 . . . . . 3.55 1.8  3.9 1 1 
        266 1 . . . . . 4.89 1.8 5.38 1 1 
        267 1 . . . . .  4.9 1.8 5.39 1 1 
        268 1 . . . . . 4.44 1.8 4.88 1 1 
        269 1 . . . . . 3.69 1.8 4.06 1 1 
        270 1 . . . . . 3.56 1.8 3.92 1 1 
        271 1 . . . . .  4.7 1.8 5.17 1 1 
        272 1 . . . . .  4.5 1.8 4.95 1 1 
        273 1 . . . . . 4.56 1.8 5.02 1 1 
        274 1 . . . . . 3.69 1.8 4.06 1 1 
        275 1 . . . . . 5.28 1.8 5.81 1 1 
        276 1 . . . . . 4.73 1.8  5.2 1 1 
        277 1 . . . . . 4.86 1.8 5.35 1 1 
        278 1 . . . . . 4.26 1.8 4.69 1 1 
        279 1 . . . . . 4.93 1.8 5.42 1 1 
        280 1 . . . . . 5.23 1.8 5.75 1 1 
        281 1 . . . . . 4.91 1.8  5.4 1 1 
        282 1 . . . . .  5.5 1.8 6.05 1 1 
        283 1 . . . . . 4.65 1.8 5.12 1 1 
        284 1 . . . . . 4.02 1.8 4.42 1 1 
        285 1 . . . . . 4.31 1.8 4.74 1 1 
        286 1 . . . . . 4.51 1.8 4.96 1 1 
        287 1 . . . . . 4.95 1.8 5.44 1 1 
        288 1 . . . . . 4.03 1.8 4.43 1 1 
        289 1 . . . . . 3.62 1.8 3.98 1 1 
        290 1 . . . . .  5.5 1.8 6.05 1 1 
        291 1 . . . . . 3.75 1.8 4.13 1 1 
        292 1 . . . . . 3.61 1.8 3.97 1 1 
        293 1 . . . . . 5.38 1.8 5.92 1 1 
        294 1 . . . . . 3.51 1.8 3.86 1 1 
        295 1 . . . . . 4.69 1.8 5.16 1 1 
        296 1 . . . . . 4.51 1.8 4.96 1 1 
        297 1 . . . . . 3.65 1.8 4.02 1 1 
        298 1 . . . . . 4.35 1.8 4.79 1 1 
        299 1 . . . . . 4.52 1.8 4.97 1 1 
        300 1 . . . . . 4.59 1.8 5.05 1 1 
        301 1 . . . . . 4.63 1.8 5.09 1 1 
        302 1 . . . . . 4.38 1.8 4.82 1 1 
        303 1 . . . . . 3.74 1.8 4.11 1 1 
        304 1 . . . . . 3.75 1.8 4.13 1 1 
        305 1 . . . . . 4.78 1.8 5.26 1 1 
        306 1 . . . . . 4.41 1.8 4.85 1 1 
        307 1 . . . . . 4.96 1.8 5.46 1 1 
        308 1 . . . . . 3.76 1.8 4.14 1 1 
        309 1 . . . . . 4.86 1.8 5.35 1 1 
        310 1 . . . . . 3.18 1.8  3.5 1 1 
        311 1 . . . . .  5.5 1.8 6.05 1 1 
        312 1 . . . . . 4.61 1.8 5.07 1 1 
        313 1 . . . . . 2.86 1.8 3.15 1 1 
        314 1 . . . . . 4.52 1.8 4.97 1 1 
        315 1 . . . . . 4.16 1.8 4.58 1 1 
        316 1 . . . . . 4.18 1.8  4.6 1 1 
        317 1 . . . . . 3.36 1.8  3.7 1 1 
        318 1 . . . . .  3.9 1.8 4.29 1 1 
        319 1 . . . . . 4.09 1.8  4.5 1 1 
        320 1 . . . . .  3.9 1.8 4.29 1 1 
        321 1 . . . . . 4.09 1.8  4.5 1 1 
        322 1 . . . . . 3.92 1.8 4.31 1 1 
        323 1 . . . . .  5.5 1.8 6.05 1 1 
        324 1 . . . . .  4.5 1.8 4.95 1 1 
        325 1 . . . . .  5.5 1.8 6.05 1 1 
        326 1 . . . . .  3.9 1.8 4.29 1 1 
        327 1 . . . . . 4.47 1.8 4.92 1 1 
        328 1 . . . . .  5.5 1.8 6.05 1 1 
        329 1 . . . . . 4.54 1.8 4.99 1 1 
        330 1 . . . . .  4.5 1.8 4.95 1 1 
        331 1 . . . . . 4.59 1.8 5.05 1 1 
        332 1 . . . . . 4.68 1.8 5.15 1 1 
        333 1 . . . . . 5.15 1.8 5.67 1 1 
        334 1 . . . . . 4.64 1.8  5.1 1 1 
        335 1 . . . . . 3.11 1.8 3.42 1 1 
        336 1 . . . . . 3.08 1.8 3.39 1 1 
        337 1 . . . . . 3.83 1.8 4.21 1 1 
        338 1 . . . . . 3.08 1.8 3.39 1 1 
        339 1 . . . . . 3.29 1.8 3.62 1 1 
        340 1 . . . . . 3.35 1.8 3.69 1 1 
        341 1 . . . . . 4.57 1.8 5.03 1 1 
        342 1 . . . . . 5.01 1.8 5.51 1 1 
        343 1 . . . . . 4.15 1.8 4.57 1 1 
        344 1 . . . . . 3.34 1.8 3.67 1 1 
        345 1 . . . . . 3.35 1.8 3.69 1 1 
        346 1 . . . . .  5.5 1.8 6.05 1 1 
        347 1 . . . . . 3.99 1.8 4.39 1 1 
        348 1 . . . . . 4.35 1.8 4.79 1 1 
        349 1 . . . . . 4.64 1.8  5.1 1 1 
        350 1 . . . . .  4.7 1.8 5.17 1 1 
        351 1 . . . . . 3.19 1.8 3.51 1 1 
        352 1 . . . . . 4.79 1.8 5.27 1 1 
        353 1 . . . . . 4.92 1.8 5.41 1 1 
        354 1 . . . . . 4.32 1.8 4.75 1 1 
        355 1 . . . . .  3.5 1.8 3.85 1 1 
        356 1 . . . . .  4.0 1.8  4.4 1 1 
        357 1 . . . . . 2.96 1.8 3.26 1 1 
        358 1 . . . . . 5.32 1.8 5.85 1 1 
        359 1 . . . . . 3.75 1.8 4.13 1 1 
        360 1 . . . . . 3.26 1.8 3.59 1 1 
        361 1 . . . . . 4.43 1.8 4.87 1 1 
        362 1 . . . . . 5.09 1.8  5.6 1 1 
        363 1 . . . . . 4.56 1.8 5.02 1 1 
        364 1 . . . . . 4.45 1.8 4.89 1 1 
        365 1 . . . . . 4.52 1.8 4.97 1 1 
        366 1 . . . . . 3.48 1.8 3.83 1 1 
        367 1 . . . . . 4.78 1.8 5.26 1 1 
        368 1 . . . . . 4.15 1.8 4.57 1 1 
        369 1 . . . . . 3.82 1.8  4.2 1 1 
        370 1 . . . . . 2.83 1.8 3.11 1 1 
        371 1 . . . . . 4.75 1.8 5.22 1 1 
        372 1 . . . . .  3.2 1.8 3.52 1 1 
        373 1 . . . . . 4.65 1.8 5.12 1 1 
        374 1 . . . . . 4.95 1.8 5.44 1 1 
        375 1 . . . . .  5.5 1.8 6.05 1 1 
        376 1 . . . . . 4.87 1.8 5.36 1 1 
        377 1 . . . . . 3.49 1.8 3.84 1 1 
        378 1 . . . . . 3.65 1.8 4.02 1 1 
        379 1 . . . . . 3.82 1.8  4.2 1 1 
        380 1 . . . . . 3.61 1.8 3.97 1 1 
        381 1 . . . . . 4.54 1.8 4.99 1 1 
        382 1 . . . . . 3.34 1.8 3.67 1 1 
        383 1 . . . . . 4.28 1.8 4.71 1 1 
        384 1 . . . . . 4.45 1.8 4.89 1 1 
        385 1 . . . . . 4.65 1.8 5.12 1 1 
        386 1 . . . . . 3.37 1.8 3.71 1 1 
        387 1 . . . . . 3.05 1.8 3.36 1 1 
        388 1 . . . . . 5.06 1.8 5.57 1 1 
        389 1 . . . . .  3.8 1.8 4.18 1 1 
        390 1 . . . . . 4.02 1.8 4.42 1 1 
        391 1 . . . . . 4.41 1.8 4.85 1 1 
        392 1 . . . . . 4.62 1.8 5.08 1 1 
        393 1 . . . . .  5.5 1.8 6.05 1 1 
        394 1 . . . . . 3.37 1.8 3.71 1 1 
        395 1 . . . . . 4.68 1.8 5.15 1 1 
        396 1 . . . . .  3.8 1.8 4.18 1 1 
        397 1 . . . . .  4.6 1.8 5.06 1 1 
        398 1 . . . . . 5.12 1.8 5.63 1 1 
        399 1 . . . . . 4.27 1.8  4.7 1 1 
        400 1 . . . . . 5.12 1.8 5.63 1 1 
        401 1 . . . . . 3.31 1.8 3.64 1 1 
        402 1 . . . . . 4.19 1.8 4.61 1 1 
        403 1 . . . . . 4.39 1.8 4.83 1 1 
        404 1 . . . . . 3.85 1.8 4.23 1 1 
        405 1 . . . . . 3.31 1.8 3.64 1 1 
        406 1 . . . . . 3.85 1.8 4.23 1 1 
        407 1 . . . . . 4.48 1.8 4.93 1 1 
        408 1 . . . . . 4.41 1.8 4.85 1 1 
        409 1 . . . . . 5.23 1.8 5.75 1 1 
        410 1 . . . . . 4.01 1.8 4.41 1 1 
        411 1 . . . . . 4.72 1.8 5.19 1 1 
        412 1 . . . . . 4.21 1.8 4.63 1 1 
        413 1 . . . . .  5.5 1.8 6.05 1 1 
        414 1 . . . . . 4.79 1.8 5.27 1 1 
        415 1 . . . . . 4.32 1.8 4.75 1 1 
        416 1 . . . . . 3.23 1.8 3.55 1 1 
        417 1 . . . . . 3.49 1.8 3.84 1 1 
        418 1 . . . . . 3.25 1.8 3.58 1 1 
        419 1 . . . . . 4.93 1.8 5.42 1 1 
        420 1 . . . . . 4.32 1.8 4.75 1 1 
        421 1 . . . . . 5.42 1.8 5.96 1 1 
        422 1 . . . . . 3.09 1.8  3.4 1 1 
        423 1 . . . . . 4.15 1.8 4.57 1 1 
        424 1 . . . . . 4.56 1.8 5.02 1 1 
        425 1 . . . . . 4.14 1.8 4.55 1 1 
        426 1 . . . . .  3.6 1.8 3.96 1 1 
        427 1 . . . . . 4.14 1.8 4.55 1 1 
        428 1 . . . . . 4.87 1.8 5.36 1 1 
        429 1 . . . . . 4.56 1.8 5.02 1 1 
        430 1 . . . . . 4.55 1.8 5.01 1 1 
        431 1 . . . . . 4.16 1.8 4.58 1 1 
        432 1 . . . . . 3.51 1.8 3.86 1 1 
        433 1 . . . . . 4.16 1.8 4.58 1 1 
        434 1 . . . . . 3.76 1.8 4.14 1 1 
        435 1 . . . . . 4.13 1.8 4.54 1 1 
        436 1 . . . . . 3.81 1.8 4.19 1 1 
        437 1 . . . . . 4.48 1.8 4.93 1 1 
        438 1 . . . . .  3.3 1.8 3.63 1 1 
        439 1 . . . . . 3.53 1.8 3.88 1 1 
        440 1 . . . . . 4.53 1.8 4.98 1 1 
        441 1 . . . . . 3.92 1.8 4.31 1 1 
        442 1 . . . . . 3.88 1.8 4.27 1 1 
        443 1 . . . . .  4.7 1.8 5.17 1 1 
        444 1 . . . . . 4.02 1.8 4.42 1 1 
        445 1 . . . . .  4.3 1.8 4.73 1 1 
        446 1 . . . . . 4.68 1.8 5.15 1 1 
        447 1 . . . . .  4.7 1.8 5.17 1 1 
        448 1 . . . . . 4.68 1.8 5.15 1 1 
        449 1 . . . . .  4.7 1.8 5.17 1 1 
        450 1 . . . . . 3.67 1.8 4.04 1 1 
        451 1 . . . . . 4.61 1.8 5.07 1 1 
        452 1 . . . . . 3.95 1.8 4.35 1 1 
        453 1 . . . . . 4.61 1.8 5.07 1 1 
        454 1 . . . . . 3.77 1.8 4.15 1 1 
        455 1 . . . . . 4.36 1.8  4.8 1 1 
        456 1 . . . . .  4.0 1.8  4.4 1 1 
        457 1 . . . . . 3.72 1.8 4.09 1 1 
        458 1 . . . . . 3.19 1.8 3.51 1 1 
        459 1 . . . . . 3.72 1.8 4.09 1 1 
        460 1 . . . . . 4.56 1.8 5.02 1 1 
        461 1 . . . . . 4.73 1.8  5.2 1 1 
        462 1 . . . . . 3.84 1.8 4.22 1 1 
        463 1 . . . . . 3.81 1.8 4.19 1 1 
        464 1 . . . . . 3.11 1.8 3.42 1 1 
        465 1 . . . . . 5.07 1.8 5.58 1 1 
        466 1 . . . . . 4.32 1.8 4.75 1 1 
        467 1 . . . . . 4.53 1.8 4.98 1 1 
        468 1 . . . . . 4.21 1.8 4.63 1 1 
        469 1 . . . . . 3.65 1.8 4.02 1 1 
        470 1 . . . . . 4.37 1.8 4.81 1 1 
        471 1 . . . . . 3.47 1.8 3.82 1 1 
        472 1 . . . . . 4.32 1.8 4.75 1 1 
        473 1 . . . . . 4.32 1.8 4.75 1 1 
        474 1 . . . . . 4.56 1.8 5.02 1 1 
        475 1 . . . . . 4.77 1.8 5.25 1 1 
        476 1 . . . . . 3.45 1.8 3.79 1 1 
        477 1 . . . . . 4.03 1.8 4.43 1 1 
        478 1 . . . . . 4.16 1.8 4.58 1 1 
        479 1 . . . . . 4.11 1.8 4.52 1 1 
        480 1 . . . . . 5.23 1.8 5.75 1 1 
        481 1 . . . . . 4.82 1.8  5.3 1 1 
        482 1 . . . . . 3.83 1.8 4.21 1 1 
        483 1 . . . . . 3.22 1.8 3.54 1 1 
        484 1 . . . . . 3.99 1.8 4.39 1 1 
        485 1 . . . . . 3.05 1.8 3.36 1 1 
        486 1 . . . . . 4.67 1.8 5.14 1 1 
        487 1 . . . . . 5.28 1.8 5.81 1 1 
        488 1 . . . . . 3.53 1.8 3.88 1 1 
        489 1 . . . . .  4.1 1.8 4.51 1 1 
        490 1 . . . . . 5.44 1.8 5.98 1 1 
        491 1 . . . . .  5.2 1.8 5.72 1 1 
        492 1 . . . . .  3.9 1.8 4.29 1 1 
        493 1 . . . . . 5.49 1.8 6.04 1 1 
        494 1 . . . . .  5.5 1.8 6.05 1 1 
        495 1 . . . . .  4.3 1.8 4.73 1 1 
        496 1 . . . . . 3.37 1.8 3.71 1 1 
        497 1 . . . . .  3.1 1.8 3.41 1 1 
        498 1 . . . . . 3.92 1.8 4.31 1 1 
        499 1 . . . . . 3.79 1.8 4.17 1 1 
        500 1 . . . . . 4.27 1.8  4.7 1 1 
        501 1 . . . . . 3.95 1.8 4.35 1 1 
        502 1 . . . . . 3.33 1.8 3.66 1 1 
        503 1 . . . . .  4.4 1.8 4.84 1 1 
        504 1 . . . . . 4.39 1.8 4.83 1 1 
        505 1 . . . . . 4.65 1.8 5.12 1 1 
        506 1 . . . . . 3.29 1.8 3.62 1 1 
        507 1 . . . . . 4.26 1.8 4.69 1 1 
        508 1 . . . . . 4.21 1.8 4.63 1 1 
        509 1 . . . . . 5.21 1.8 5.73 1 1 
        510 1 . . . . . 5.31 1.8 5.84 1 1 
        511 1 . . . . . 4.33 1.8 4.76 1 1 
        512 1 . . . . .  4.2 1.8 4.62 1 1 
        513 1 . . . . . 4.36 1.8  4.8 1 1 
        514 1 . . . . . 3.69 1.8 4.06 1 1 
        515 1 . . . . . 4.15 1.8 4.57 1 1 
        516 1 . . . . . 3.54 1.8 3.89 1 1 
        517 1 . . . . .  5.0 1.8  5.5 1 1 
        518 1 . . . . .  4.5 1.8 4.95 1 1 
        519 1 . . . . . 2.97 1.8 3.27 1 1 
        520 1 . . . . . 4.74 1.8 5.21 1 1 
        521 1 . . . . . 4.54 1.8 4.99 1 1 
        522 1 . . . . . 3.52 1.8 3.87 1 1 
        523 1 . . . . . 4.63 1.8 5.09 1 1 
        524 1 . . . . . 3.88 1.8 4.27 1 1 
        525 1 . . . . .  3.8 1.8 4.18 1 1 
        526 1 . . . . .  3.5 1.8 3.85 1 1 
        527 1 . . . . . 4.16 1.8 4.58 1 1 
        528 1 . . . . . 3.79 1.8 4.17 1 1 
        529 1 . . . . . 4.19 1.8 4.61 1 1 
        530 1 . . . . . 4.64 1.8  5.1 1 1 
        531 1 . . . . . 4.59 1.8 5.05 1 1 
        532 1 . . . . . 5.34 1.8 5.87 1 1 
        533 1 . . . . . 3.69 1.8 4.06 1 1 
        534 1 . . . . . 3.06 1.8 3.37 1 1 
        535 1 . . . . . 3.69 1.8 4.06 1 1 
        536 1 . . . . . 4.56 1.8 5.02 1 1 
        537 1 . . . . . 2.91 1.8  3.2 1 1 
        538 1 . . . . . 3.22 1.8 3.54 1 1 
        539 1 . . . . . 3.83 1.8 4.21 1 1 
        540 1 . . . . . 3.83 1.8 4.21 1 1 
        541 1 . . . . . 3.06 1.8 3.37 1 1 
        542 1 . . . . . 4.65 1.8 5.12 1 1 
        543 1 . . . . . 2.73 1.8  3.0 1 1 
        544 1 . . . . . 4.51 1.8 4.96 1 1 
        545 1 . . . . . 3.28 1.8 3.61 1 1 
        546 1 . . . . . 3.88 1.8 4.27 1 1 
        547 1 . . . . .  3.9 1.8 4.29 1 1 
        548 1 . . . . . 3.37 1.8 3.71 1 1 
        549 1 . . . . .  3.9 1.8 4.29 1 1 
        550 1 . . . . . 4.57 1.8 5.03 1 1 
        551 1 . . . . . 4.31 1.8 4.74 1 1 
        552 1 . . . . . 4.34 1.8 4.77 1 1 
        553 1 . . . . . 3.82 1.8  4.2 1 1 
        554 1 . . . . . 3.86 1.8 4.25 1 1 
        555 1 . . . . . 2.91 1.8  3.2 1 1 
        556 1 . . . . . 4.73 1.8  5.2 1 1 
        557 1 . . . . . 3.96 1.8 4.36 1 1 
        558 1 . . . . .  3.6 1.8 3.96 1 1 
        559 1 . . . . . 5.06 1.8 5.57 1 1 
        560 1 . . . . . 4.55 1.8 5.01 1 1 
        561 1 . . . . . 4.11 1.8 4.52 1 1 
        562 1 . . . . . 4.55 1.8 5.01 1 1 
        563 1 . . . . . 4.11 1.8 4.52 1 1 
        564 1 . . . . . 3.89 1.8 4.28 1 1 
        565 1 . . . . . 4.68 1.8 5.15 1 1 
        566 1 . . . . . 4.32 1.8 4.75 1 1 
        567 1 . . . . . 4.92 1.8 5.41 1 1 
        568 1 . . . . . 4.92 1.8 5.41 1 1 
        569 1 . . . . . 5.01 1.8 5.51 1 1 
        570 1 . . . . . 4.35 1.8 4.79 1 1 
        571 1 . . . . . 4.56 1.8 5.02 1 1 
        572 1 . . . . . 4.36 1.8  4.8 1 1 
        573 1 . . . . . 4.78 1.8 5.26 1 1 
        574 1 . . . . .  4.0 1.8  4.4 1 1 
        575 1 . . . . . 4.74 1.8 5.21 1 1 
        576 1 . . . . . 4.65 1.8 5.12 1 1 
        577 1 . . . . . 3.47 1.8 3.82 1 1 
        578 1 . . . . . 3.83 1.8 4.21 1 1 
        579 1 . . . . . 5.46 1.8 6.01 1 1 
        580 1 . . . . . 4.33 1.8 4.76 1 1 
        581 1 . . . . . 4.13 1.8 4.54 1 1 
        582 1 . . . . . 3.39 1.8 3.73 1 1 
        583 1 . . . . . 5.09 1.8  5.6 1 1 
        584 1 . . . . . 4.86 1.8 5.35 1 1 
        585 1 . . . . . 4.53 1.8 4.98 1 1 
        586 1 . . . . . 5.02 1.8 5.52 1 1 
        587 1 . . . . . 4.24 1.8 4.66 1 1 
        588 1 . . . . . 4.28 1.8 4.71 1 1 
        589 1 . . . . . 4.37 1.8 4.81 1 1 
        590 1 . . . . . 4.35 1.8 4.79 1 1 
        591 1 . . . . . 4.39 1.8 4.83 1 1 
        592 1 . . . . . 3.44 1.8 3.78 1 1 
        593 1 . . . . . 4.04 1.8 4.44 1 1 
        594 1 . . . . .  3.3 1.8 3.63 1 1 
        595 1 . . . . . 4.93 1.8 5.42 1 1 
        596 1 . . . . . 4.93 1.8 5.42 1 1 
        597 1 . . . . . 4.68 1.8 5.15 1 1 
        598 1 . . . . . 3.27 1.8  3.6 1 1 
        599 1 . . . . . 3.39 1.8 3.73 1 1 
        600 1 . . . . . 3.53 1.8 3.88 1 1 
        601 1 . . . . . 3.53 1.8 3.88 1 1 
        602 1 . . . . . 4.54 1.8 4.99 1 1 
        603 1 . . . . . 4.72 1.8 5.19 1 1 
        604 1 . . . . .  4.5 1.8 4.95 1 1 
        605 1 . . . . . 3.98 1.8 4.38 1 1 
        606 1 . . . . . 3.46 1.8 3.81 1 1 
        607 1 . . . . . 4.92 1.8 5.41 1 1 
        608 1 . . . . . 4.45 1.8 4.89 1 1 
        609 1 . . . . . 3.77 1.8 4.15 1 1 
        610 1 . . . . . 4.45 1.8 4.89 1 1 
        611 1 . . . . .  3.2 1.8 3.52 1 1 
        612 1 . . . . . 4.77 1.8 5.25 1 1 
        613 1 . . . . .  4.8 1.8 5.28 1 1 
        614 1 . . . . . 4.18 1.8  4.6 1 1 
        615 1 . . . . .  4.8 1.8 5.28 1 1 
        616 1 . . . . . 5.03 1.8 5.53 1 1 
        617 1 . . . . . 3.07 1.8 3.38 1 1 
        618 1 . . . . . 4.15 1.8 4.57 1 1 
        619 1 . . . . . 3.32 1.8 3.65 1 1 
        620 1 . . . . . 4.44 1.8 4.88 1 1 
        621 1 . . . . .  5.5 1.8 6.05 1 1 
        622 1 . . . . . 4.21 1.8 4.63 1 1 
        623 1 . . . . . 5.01 1.8 5.51 1 1 
        624 1 . . . . . 3.89 1.8 4.28 1 1 
        625 1 . . . . . 5.04 1.8 5.54 1 1 
        626 1 . . . . .  5.5 1.8 6.05 1 1 
        627 1 . . . . . 4.07 1.8 4.48 1 1 
        628 1 . . . . . 5.07 1.8 5.58 1 1 
        629 1 . . . . . 4.02 1.8 4.42 1 1 
        630 1 . . . . . 5.47 1.8 6.02 1 1 
        631 1 . . . . . 4.02 1.8 4.42 1 1 
        632 1 . . . . . 3.62 1.8 3.98 1 1 
        633 1 . . . . . 3.95 1.8 4.35 1 1 
        634 1 . . . . . 3.32 1.8 3.65 1 1 
        635 1 . . . . . 4.35 1.8 4.79 1 1 
        636 1 . . . . . 4.17 1.8 4.59 1 1 
        637 1 . . . . . 3.78 1.8 4.16 1 1 
        638 1 . . . . . 3.76 1.8 4.14 1 1 
        639 1 . . . . . 5.15 1.8 5.67 1 1 
        640 1 . . . . . 4.17 1.8 4.59 1 1 
        641 1 . . . . . 3.78 1.8 4.16 1 1 
        642 1 . . . . . 3.76 1.8 4.14 1 1 
        643 1 . . . . . 5.15 1.8 5.67 1 1 
        644 1 . . . . . 3.94 1.8 4.33 1 1 
        645 1 . . . . .  4.9 1.8 5.39 1 1 
        646 1 . . . . . 4.71 1.8 5.18 1 1 
        647 1 . . . . . 4.71 1.8 5.18 1 1 
        648 1 . . . . . 4.94 1.8 5.43 1 1 
        649 1 . . . . . 4.72 1.8 5.19 1 1 
        650 1 . . . . . 4.72 1.8 5.19 1 1 
        651 1 . . . . . 4.61 1.8 5.07 1 1 
        652 1 . . . . . 4.16 1.8 4.58 1 1 
        653 1 . . . . . 4.34 1.8 4.77 1 1 
        654 1 . . . . . 4.56 1.8 5.02 1 1 
        655 1 . . . . . 3.85 1.8 4.23 1 1 
        656 1 . . . . . 3.55 1.8  3.9 1 1 
        657 1 . . . . . 3.02 1.8 3.32 1 1 
        658 1 . . . . . 3.55 1.8  3.9 1 1 
        659 1 . . . . . 4.54 1.8 4.99 1 1 
        660 1 . . . . . 4.13 1.8 4.54 1 1 
        661 1 . . . . . 3.61 1.8 3.97 1 1 
        662 1 . . . . . 4.13 1.8 4.54 1 1 
        663 1 . . . . . 3.47 1.8 3.82 1 1 
        664 1 . . . . . 4.36 1.8  4.8 1 1 
        665 1 . . . . . 4.81 1.8 5.29 1 1 
        666 1 . . . . . 3.66 1.8 4.03 1 1 
        667 1 . . . . . 4.43 1.8 4.87 1 1 
        668 1 . . . . .  4.2 1.8 4.62 1 1 
        669 1 . . . . . 5.17 1.8 5.69 1 1 
        670 1 . . . . . 4.84 1.8 5.32 1 1 
        671 1 . . . . . 3.84 1.8 4.22 1 1 
        672 1 . . . . . 3.92 1.8 4.31 1 1 
        673 1 . . . . . 4.62 1.8 5.08 1 1 
        674 1 . . . . . 4.62 1.8 5.08 1 1 
        675 1 . . . . . 3.47 1.8 3.82 1 1 
        676 1 . . . . . 3.47 1.8 3.82 1 1 
        677 1 . . . . . 5.02 1.8 5.52 1 1 
        678 1 . . . . . 4.81 1.8 5.29 1 1 
        679 1 . . . . . 4.58 1.8 5.04 1 1 
        680 1 . . . . . 3.86 1.8 4.25 1 1 
        681 1 . . . . . 4.55 1.8 5.01 1 1 
        682 1 . . . . .  4.9 1.8 5.39 1 1 
        683 1 . . . . . 3.18 1.8  3.5 1 1 
        684 1 . . . . . 4.51 1.8 4.96 1 1 
        685 1 . . . . . 4.38 1.8 4.82 1 1 
        686 1 . . . . . 3.18 1.8  3.5 1 1 
        687 1 . . . . . 3.05 1.8 3.36 1 1 
        688 1 . . . . . 3.42 1.8 3.76 1 1 
        689 1 . . . . .  5.5 1.8 6.05 1 1 
        690 1 . . . . .  5.5 1.8 6.05 1 1 
        691 1 . . . . .  5.5 1.8 6.05 1 1 
        692 1 . . . . .  3.6 1.8 3.96 1 1 
        693 1 . . . . . 5.02 1.8 5.52 1 1 
        694 1 . . . . . 4.78 1.8 5.26 1 1 
        695 1 . . . . . 3.62 1.8 3.98 1 1 
        696 1 . . . . . 2.92 1.8 3.21 1 1 
        697 1 . . . . . 4.28 1.8 4.71 1 1 
        698 1 . . . . . 5.21 1.8 5.73 1 1 
        699 1 . . . . .  4.8 1.8 5.28 1 1 
        700 1 . . . . . 4.79 1.8 5.27 1 1 
        701 1 . . . . . 5.48 1.8 6.03 1 1 
        702 1 . . . . . 4.31 1.8 4.74 1 1 
        703 1 . . . . . 3.25 1.8 3.58 1 1 
        704 1 . . . . . 4.75 1.8 5.22 1 1 
        705 1 . . . . . 4.89 1.8 5.38 1 1 
        706 1 . . . . . 4.29 1.8 4.72 1 1 
        707 1 . . . . . 4.29 1.8 4.72 1 1 
        708 1 . . . . . 4.62 1.8 5.08 1 1 
        709 1 . . . . . 3.48 1.8 3.83 1 1 
        710 1 . . . . . 4.28 1.8 4.71 1 1 
        711 1 . . . . . 3.48 1.8 3.83 1 1 
        712 1 . . . . . 4.28 1.8 4.71 1 1 
        713 1 . . . . .  3.3 1.8 3.63 1 1 
        714 1 . . . . . 4.71 1.8 5.18 1 1 
        715 1 . . . . . 5.06 1.8 5.57 1 1 
        716 1 . . . . . 3.62 1.8 3.98 1 1 
        717 1 . . . . . 3.62 1.8 3.98 1 1 
        718 1 . . . . . 3.51 1.8 3.86 1 1 
        719 1 . . . . .  4.0 1.8  4.4 1 1 
        720 1 . . . . . 4.82 1.8  5.3 1 1 
        721 1 . . . . .  5.5 1.8 6.05 1 1 
        722 1 . . . . .  5.5 1.8 6.05 1 1 
        723 1 . . . . . 3.12 1.8 3.43 1 1 
        724 1 . . . . .  4.0 1.8  4.4 1 1 
        725 1 . . . . . 3.21 1.8 3.53 1 1 
        726 1 . . . . .  4.5 1.8 4.95 1 1 
        727 1 . . . . . 5.41 1.8 5.95 1 1 
        728 1 . . . . . 3.02 1.8 3.32 1 1 
        729 1 . . . . . 4.71 1.8 5.18 1 1 
        730 1 . . . . . 4.25 1.8 4.68 1 1 
        731 1 . . . . . 4.16 1.8 4.58 1 1 
        732 1 . . . . .  3.5 1.8 3.85 1 1 
        733 1 . . . . .  5.5 1.8 6.05 1 1 
        734 1 . . . . . 4.63 1.8 5.09 1 1 
        735 1 . . . . . 3.55 1.8  3.9 1 1 
        736 1 . . . . . 4.05 1.8 4.46 1 1 
        737 1 . . . . . 4.69 1.8 5.16 1 1 
        738 1 . . . . . 4.15 1.8 4.57 1 1 
        739 1 . . . . . 3.44 1.8 3.78 1 1 
        740 1 . . . . . 4.21 1.8 4.63 1 1 
        741 1 . . . . . 4.44 1.8 4.88 1 1 
        742 1 . . . . . 4.67 1.8 5.14 1 1 
        743 1 . . . . .  4.1 1.8 4.51 1 1 
        744 1 . . . . .  3.7 1.8 4.07 1 1 
        745 1 . . . . . 4.42 1.8 4.86 1 1 
        746 1 . . . . . 3.83 1.8 4.21 1 1 
        747 1 . . . . . 4.42 1.8 4.86 1 1 
        748 1 . . . . .  5.0 1.8  5.5 1 1 
        749 1 . . . . .  5.5 1.8 6.05 1 1 
        750 1 . . . . . 4.44 1.8 4.88 1 1 
        751 1 . . . . . 3.54 1.8 3.89 1 1 
        752 1 . . . . . 3.54 1.8 3.89 1 1 
        753 1 . . . . . 2.92 1.8 3.21 1 1 
        754 1 . . . . . 4.96 1.8 5.46 1 1 
        755 1 . . . . . 4.24 1.8 4.66 1 1 
        756 1 . . . . . 5.24 1.8 5.76 1 1 
        757 1 . . . . . 3.62 1.8 3.98 1 1 
        758 1 . . . . . 4.59 1.8 5.05 1 1 
        759 1 . . . . . 3.45 1.8 3.79 1 1 
        760 1 . . . . . 3.45 1.8 3.79 1 1 
        761 1 . . . . . 4.01 1.8 4.41 1 1 
        762 1 . . . . .  4.0 1.8  4.4 1 1 
        763 1 . . . . . 4.81 1.8 5.29 1 1 
        764 1 . . . . . 3.53 1.8 3.88 1 1 
        765 1 . . . . . 5.06 1.8 5.57 1 1 
        766 1 . . . . . 3.66 1.8 4.03 1 1 
        767 1 . . . . . 4.25 1.8 4.68 1 1 
        768 1 . . . . . 4.25 1.8 4.68 1 1 
        769 1 . . . . . 4.32 1.8 4.75 1 1 
        770 1 . . . . . 4.22 1.8 4.64 1 1 
        771 1 . . . . . 4.15 1.8 4.57 1 1 
        772 1 . . . . . 4.84 1.8 5.32 1 1 
        773 1 . . . . . 4.64 1.8  5.1 1 1 
        774 1 . . . . . 4.07 1.8 4.48 1 1 
        775 1 . . . . . 4.55 1.8 5.01 1 1 
        776 1 . . . . . 4.22 1.8 4.64 1 1 
        777 1 . . . . . 3.69 1.8 4.06 1 1 
        778 1 . . . . . 2.86 1.8 3.15 1 1 
        779 1 . . . . . 5.21 1.8 5.73 1 1 
        780 1 . . . . . 4.77 1.8 5.25 1 1 
        781 1 . . . . . 5.34 1.8 5.87 1 1 
        782 1 . . . . . 5.27 1.8  5.8 1 1 
        783 1 . . . . . 3.51 1.8 3.86 1 1 
        784 1 . . . . . 4.11 1.8 4.52 1 1 
        785 1 . . . . . 4.62 1.8 5.08 1 1 
        786 1 . . . . . 3.52 1.8 3.87 1 1 
        787 1 . . . . . 3.76 1.8 4.14 1 1 
        788 1 . . . . . 4.92 1.8 5.41 1 1 
        789 1 . . . . . 4.31 1.8 4.74 1 1 
        790 1 . . . . . 3.93 1.8 4.32 1 1 
        791 1 . . . . . 4.56 1.8 5.02 1 1 
        792 1 . . . . .  4.2 1.8 4.62 1 1 
        793 1 . . . . . 4.77 1.8 5.25 1 1 
        794 1 . . . . . 2.92 1.8 3.21 1 1 
        795 1 . . . . . 4.38 1.8 4.82 1 1 
        796 1 . . . . . 3.87 1.8 4.26 1 1 
        797 1 . . . . . 3.32 1.8 3.65 1 1 
        798 1 . . . . . 3.39 1.8 3.73 1 1 
        799 1 . . . . . 4.61 1.8 5.07 1 1 
        800 1 . . . . . 4.05 1.8 4.46 1 1 
        801 1 . . . . . 4.42 1.8 4.86 1 1 
        802 1 . . . . . 4.06 1.8 4.47 1 1 
        803 1 . . . . . 4.59 1.8 5.05 1 1 
        804 1 . . . . . 3.87 1.8 4.26 1 1 
        805 1 . . . . . 3.15 1.8 3.47 1 1 
        806 1 . . . . .  5.2 1.8 5.72 1 1 
        807 1 . . . . . 3.92 1.8 4.31 1 1 
        808 1 . . . . . 4.56 1.8 5.02 1 1 
        809 1 . . . . . 4.44 1.8 4.88 1 1 
        810 1 . . . . . 4.63 1.8 5.09 1 1 
        811 1 . . . . . 3.86 1.8 4.25 1 1 
        812 1 . . . . . 4.67 1.8 5.14 1 1 
        813 1 . . . . . 4.01 1.8 4.41 1 1 
        814 1 . . . . . 4.67 1.8 5.14 1 1 
        815 1 . . . . . 3.66 1.8 4.03 1 1 
        816 1 . . . . .  3.4 1.8 3.74 1 1 
        817 1 . . . . . 4.59 1.8 5.05 1 1 
        818 1 . . . . .  3.1 1.8 3.41 1 1 
        819 1 . . . . . 3.64 1.8  4.0 1 1 
        820 1 . . . . . 3.99 1.8 4.39 1 1 
        821 1 . . . . . 4.74 1.8 5.21 1 1 
        822 1 . . . . . 5.11 1.8 5.62 1 1 
        823 1 . . . . . 3.96 1.8 4.36 1 1 
        824 1 . . . . .  4.5 1.8 4.95 1 1 
        825 1 . . . . .  5.2 1.8 5.72 1 1 
        826 1 . . . . . 4.08 1.8 4.49 1 1 
        827 1 . . . . .  3.2 1.8 3.52 1 1 
        828 1 . . . . . 4.77 1.8 5.25 1 1 
        829 1 . . . . .  5.5 1.8 6.05 1 1 
        830 1 . . . . .  5.5 1.8 6.05 1 1 
        831 1 . . . . . 4.35 1.8 4.79 1 1 
        832 1 . . . . . 4.59 1.8 5.05 1 1 
        833 1 . . . . . 4.68 1.8 5.15 1 1 
        834 1 . . . . . 4.71 1.8 5.18 1 1 
        835 1 . . . . .  4.6 1.8 5.06 1 1 
        836 1 . . . . .  4.6 1.8 5.06 1 1 
        837 1 . . . . . 3.97 1.8 4.37 1 1 
        838 1 . . . . . 3.83 1.8 4.21 1 1 
        839 1 . . . . . 4.83 1.8 5.31 1 1 
        840 1 . . . . .  5.0 1.8  5.5 1 1 
        841 1 . . . . . 4.29 1.8 4.72 1 1 
        842 1 . . . . . 3.72 1.8 4.09 1 1 
        843 1 . . . . . 4.39 1.8 4.83 1 1 
        844 1 . . . . .  3.6 1.8 3.96 1 1 
        845 1 . . . . . 4.22 1.8 4.64 1 1 
        846 1 . . . . . 4.92 1.8 5.41 1 1 
        847 1 . . . . . 3.62 1.8 3.98 1 1 
        848 1 . . . . . 3.04 1.8 3.34 1 1 
        849 1 . . . . . 3.62 1.8 3.98 1 1 
        850 1 . . . . . 4.65 1.8 5.12 1 1 
        851 1 . . . . . 4.65 1.8 5.12 1 1 
        852 1 . . . . . 3.66 1.8 4.03 1 1 
        853 1 . . . . . 3.88 1.8 4.27 1 1 
        854 1 . . . . . 3.32 1.8 3.65 1 1 
        855 1 . . . . . 3.88 1.8 4.27 1 1 
        856 1 . . . . . 2.84 1.8 3.12 1 1 
        857 1 . . . . . 3.37 1.8 3.71 1 1 
        858 1 . . . . . 5.34 1.8 5.87 1 1 
        859 1 . . . . . 3.32 1.8 3.65 1 1 
        860 1 . . . . . 4.02 1.8 4.42 1 1 
        861 1 . . . . . 3.65 1.8 4.02 1 1 
        862 1 . . . . . 3.07 1.8 3.38 1 1 
        863 1 . . . . . 3.65 1.8 4.02 1 1 
        864 1 . . . . . 3.99 1.8 4.39 1 1 
        865 1 . . . . .  3.2 1.8 3.52 1 1 
        866 1 . . . . . 3.99 1.8 4.39 1 1 
        867 1 . . . . . 3.45 1.8 3.79 1 1 
        868 1 . . . . . 4.13 1.8 4.54 1 1 
        869 1 . . . . . 3.39 1.8 3.73 1 1 
        870 1 . . . . . 4.13 1.8 4.54 1 1 
        871 1 . . . . . 3.37 1.8 3.71 1 1 
        872 1 . . . . . 3.99 1.8 4.39 1 1 
        873 1 . . . . . 3.99 1.8 4.39 1 1 
        874 1 . . . . . 4.09 1.8  4.5 1 1 
        875 1 . . . . . 3.44 1.8 3.78 1 1 
        876 1 . . . . . 4.09 1.8  4.5 1 1 
        877 1 . . . . . 3.53 1.8 3.88 1 1 
        878 1 . . . . . 4.22 1.8 4.64 1 1 
        879 1 . . . . .  5.5 1.8 6.05 1 1 
        880 1 . . . . . 4.55 1.8 5.01 1 1 
        881 1 . . . . .  3.8 1.8 4.18 1 1 
        882 1 . . . . . 3.82 1.8  4.2 1 1 
        883 1 . . . . . 3.13 1.8 3.44 1 1 
        884 1 . . . . . 4.44 1.8 4.88 1 1 
        885 1 . . . . . 4.48 1.8 4.93 1 1 
        886 1 . . . . . 3.62 1.8 3.98 1 1 
        887 1 . . . . . 5.15 1.8 5.67 1 1 
        888 1 . . . . . 4.48 1.8 4.93 1 1 
        889 1 . . . . . 3.62 1.8 3.98 1 1 
        890 1 . . . . . 5.15 1.8 5.67 1 1 
        891 1 . . . . . 4.15 1.8 4.57 1 1 
        892 1 . . . . . 4.16 1.8 4.58 1 1 
        893 1 . . . . . 4.96 1.8 5.46 1 1 
        894 1 . . . . . 4.57 1.8 5.03 1 1 
        895 1 . . . . .  5.5 1.8 6.05 1 1 
        896 1 . . . . .  5.5 1.8 6.05 1 1 
        897 1 . . . . . 3.25 1.8 3.58 1 1 
        898 1 . . . . . 4.85 1.8 5.33 1 1 
        899 1 . . . . . 4.24 1.8 4.66 1 1 
        900 1 . . . . . 4.85 1.8 5.33 1 1 
        901 1 . . . . . 3.31 1.8 3.64 1 1 
        902 1 . . . . . 3.31 1.8 3.64 1 1 
        903 1 . . . . . 3.26 1.8 3.59 1 1 
        904 1 . . . . . 4.34 1.8 4.77 1 1 
        905 1 . . . . . 4.94 1.8 5.43 1 1 
        906 1 . . . . . 4.94 1.8 5.43 1 1 
        907 1 . . . . . 4.02 1.8 4.42 1 1 
        908 1 . . . . . 3.45 1.8 3.79 1 1 
        909 1 . . . . . 4.02 1.8 4.42 1 1 
        910 1 . . . . . 4.91 1.8  5.4 1 1 
        911 1 . . . . . 3.77 1.8 4.15 1 1 
        912 1 . . . . . 4.26 1.8 4.69 1 1 
        913 1 . . . . .  3.6 1.8 3.96 1 1 
        914 1 . . . . . 5.04 1.8 5.54 1 1 
        915 1 . . . . . 4.85 1.8 5.33 1 1 
        916 1 . . . . . 2.88 1.8 3.17 1 1 
        917 1 . . . . .  4.1 1.8 4.51 1 1 
        918 1 . . . . . 4.48 1.8 4.93 1 1 
        919 1 . . . . . 4.67 1.8 5.14 1 1 
        920 1 . . . . . 3.83 1.8 4.21 1 1 
        921 1 . . . . . 4.67 1.8 5.14 1 1 
        922 1 . . . . .  5.5 1.8 6.05 1 1 
        923 1 . . . . . 3.08 1.8 3.39 1 1 
        924 1 . . . . . 4.31 1.8 4.74 1 1 
        925 1 . . . . .  5.1 1.8 5.61 1 1 
        926 1 . . . . . 3.64 1.8  4.0 1 1 
        927 1 . . . . . 4.58 1.8 5.04 1 1 
        928 1 . . . . . 4.58 1.8 5.04 1 1 
        929 1 . . . . . 4.09 1.8  4.5 1 1 
        930 1 . . . . .  5.5 1.8 6.05 1 1 
        931 1 . . . . . 4.94 1.8 5.43 1 1 
        932 1 . . . . .  5.5 1.8 6.05 1 1 
        933 1 . . . . . 4.51 1.8 4.96 1 1 
        934 1 . . . . . 3.56 1.8 3.92 1 1 
        935 1 . . . . . 3.95 1.8 4.35 1 1 
        936 1 . . . . . 3.59 1.8 3.95 1 1 
        937 1 . . . . . 3.78 1.8 4.16 1 1 
        938 1 . . . . . 3.97 1.8 4.37 1 1 
        939 1 . . . . . 5.31 1.8 5.84 1 1 
        940 1 . . . . . 3.52 1.8 3.87 1 1 
        941 1 . . . . . 4.76 1.8 5.24 1 1 
        942 1 . . . . . 4.45 1.8 4.89 1 1 
        943 1 . . . . . 4.91 1.8  5.4 1 1 
        944 1 . . . . . 3.57 1.8 3.93 1 1 
        945 1 . . . . . 5.21 1.8 5.73 1 1 
        946 1 . . . . . 4.46 1.8 4.91 1 1 
        947 1 . . . . . 3.61 1.8 3.97 1 1 
        948 1 . . . . .  3.8 1.8 4.18 1 1 
        949 1 . . . . . 4.76 1.8 5.24 1 1 
        950 1 . . . . . 3.56 1.8 3.92 1 1 
        951 1 . . . . . 3.77 1.8 4.15 1 1 
        952 1 . . . . . 3.31 1.8 3.64 1 1 
        953 1 . . . . . 3.77 1.8 4.15 1 1 
        954 1 . . . . . 3.59 1.8 3.95 1 1 
        955 1 . . . . . 4.75 1.8 5.22 1 1 
        956 1 . . . . . 4.65 1.8 5.12 1 1 
        957 1 . . . . .  5.5 1.8 6.05 1 1 
        958 1 . . . . . 4.79 1.8 5.27 1 1 
        959 1 . . . . . 4.45 1.8 4.89 1 1 
        960 1 . . . . . 3.18 1.8  3.5 1 1 
        961 1 . . . . . 3.75 1.8 4.13 1 1 
        962 1 . . . . . 4.42 1.8 4.86 1 1 
        963 1 . . . . . 4.99 1.8 5.49 1 1 
        964 1 . . . . . 3.61 1.8 3.97 1 1 
        965 1 . . . . . 3.61 1.8 3.97 1 1 
        966 1 . . . . . 3.15 1.8 3.47 1 1 
        967 1 . . . . .  5.0 1.8  5.5 1 1 
        968 1 . . . . . 3.94 1.8 4.33 1 1 
        969 1 . . . . . 4.75 1.8 5.22 1 1 
        970 1 . . . . . 3.47 1.8 3.82 1 1 
        971 1 . . . . . 3.86 1.8 4.25 1 1 
        972 1 . . . . . 3.86 1.8 4.25 1 1 
        973 1 . . . . . 4.97 1.8 5.47 1 1 
        974 1 . . . . . 3.15 1.8 3.47 1 1 
        975 1 . . . . . 3.48 1.8 3.83 1 1 
        976 1 . . . . . 4.35 1.8 4.79 1 1 
        977 1 . . . . . 3.25 1.8 3.58 1 1 
        978 1 . . . . . 4.28 1.8 4.71 1 1 
        979 1 . . . . . 5.13 1.8 5.64 1 1 
        980 1 . . . . . 5.13 1.8 5.64 1 1 
        981 1 . . . . . 3.02 1.8 3.32 1 1 
        982 1 . . . . . 3.83 1.8 4.21 1 1 
        983 1 . . . . . 3.83 1.8 4.21 1 1 
        984 1 . . . . . 3.29 1.8 3.62 1 1 
        985 1 . . . . . 4.18 1.8  4.6 1 1 
        986 1 . . . . . 4.57 1.8 5.03 1 1 
        987 1 . . . . .  5.5 1.8 6.05 1 1 
        988 1 . . . . .  5.5 1.8 6.05 1 1 
        989 1 . . . . . 4.14 1.8 4.55 1 1 
        990 1 . . . . . 4.06 1.8 4.47 1 1 
        991 1 . . . . . 3.42 1.8 3.76 1 1 
        992 1 . . . . . 3.09 1.8  3.4 1 1 
        993 1 . . . . .  4.9 1.8 5.39 1 1 
        994 1 . . . . . 4.38 1.8 4.82 1 1 
        995 1 . . . . . 3.77 1.8 4.15 1 1 
        996 1 . . . . . 4.54 1.8 4.99 1 1 
        997 1 . . . . . 3.61 1.8 3.97 1 1 
        998 1 . . . . . 5.45 1.8  6.0 1 1 
        999 1 . . . . . 3.29 1.8 3.62 1 1 
       1000 1 . . . . . 5.48 1.8 6.03 1 1 
       1001 1 . . . . . 5.24 1.8 5.76 1 1 
       1002 1 . . . . . 3.15 1.8 3.47 1 1 
       1003 1 . . . . . 5.25 1.8 5.78 1 1 
       1004 1 . . . . .  5.5 1.8 6.05 1 1 
       1005 1 . . . . . 4.36 1.8  4.8 1 1 
       1006 1 . . . . .  5.5 1.8 6.05 1 1 
       1007 1 . . . . . 4.99 1.8 5.49 1 1 
       1008 1 . . . . . 3.37 1.8 3.71 1 1 
       1009 1 . . . . . 4.86 1.8 5.35 1 1 
       1010 1 . . . . . 5.35 1.8 5.89 1 1 
       1011 1 . . . . . 4.31 1.8 4.74 1 1 
       1012 1 . . . . .  4.2 1.8 4.62 1 1 
       1013 1 . . . . . 3.89 1.8 4.28 1 1 
       1014 1 . . . . . 3.04 1.8 3.34 1 1 
       1015 1 . . . . . 4.39 1.8 4.83 1 1 
       1016 1 . . . . . 4.96 1.8 5.46 1 1 
       1017 1 . . . . . 3.47 1.8 3.82 1 1 
       1018 1 . . . . . 3.47 1.8 3.82 1 1 
       1019 1 . . . . . 4.58 1.8 5.04 1 1 
       1020 1 . . . . . 4.94 1.8 5.43 1 1 
       1021 1 . . . . . 4.23 1.8 4.65 1 1 
       1022 1 . . . . . 4.94 1.8 5.43 1 1 
       1023 1 . . . . . 4.61 1.8 5.07 1 1 
       1024 1 . . . . .  5.5 1.8 6.05 1 1 
       1025 1 . . . . . 4.67 1.8 5.14 1 1 
       1026 1 . . . . . 3.91 1.8  4.3 1 1 
       1027 1 . . . . . 4.84 1.8 5.32 1 1 
       1028 1 . . . . . 5.05 1.8 5.56 1 1 
       1029 1 . . . . .  5.5 1.8 6.05 1 1 
       1030 1 . . . . . 4.45 1.8 4.89 1 1 
       1031 1 . . . . .  5.5 1.8 6.05 1 1 
       1032 1 . . . . . 2.77 1.8 3.05 1 1 
       1033 1 . . . . . 3.07 1.8 3.38 1 1 
       1034 1 . . . . . 3.55 1.8  3.9 1 1 
       1035 1 . . . . . 4.11 1.8 4.52 1 1 
       1036 1 . . . . . 3.93 1.8 4.32 1 1 
       1037 1 . . . . . 3.74 1.8 4.11 1 1 
       1038 1 . . . . . 4.35 1.8 4.79 1 1 
       1039 1 . . . . . 4.77 1.8 5.25 1 1 
       1040 1 . . . . . 3.74 1.8 4.11 1 1 
       1041 1 . . . . . 4.35 1.8 4.79 1 1 
       1042 1 . . . . . 4.77 1.8 5.25 1 1 
       1043 1 . . . . . 3.77 1.8 4.15 1 1 
       1044 1 . . . . . 4.32 1.8 4.75 1 1 
       1045 1 . . . . . 4.32 1.8 4.75 1 1 
       1046 1 . . . . . 2.99 1.8 3.29 1 1 
       1047 1 . . . . .  3.9 1.8 4.29 1 1 
       1048 1 . . . . . 3.43 1.8 3.77 1 1 
       1049 1 . . . . . 4.57 1.8 5.03 1 1 
       1050 1 . . . . .  5.5 1.8 6.05 1 1 
       1051 1 . . . . . 3.25 1.8 3.58 1 1 
       1052 1 . . . . . 3.48 1.8 3.83 1 1 
       1053 1 . . . . .  3.0 1.8  3.3 1 1 
       1054 1 . . . . . 5.22 1.8 5.74 1 1 
       1055 1 . . . . .  4.4 1.8 4.84 1 1 
       1056 1 . . . . . 5.22 1.8 5.74 1 1 
       1057 1 . . . . . 4.01 1.8 4.41 1 1 
       1058 1 . . . . . 4.48 1.8 4.93 1 1 
       1059 1 . . . . .  4.7 1.8 5.17 1 1 
       1060 1 . . . . . 4.43 1.8 4.87 1 1 
       1061 1 . . . . . 3.41 1.8 3.75 1 1 
       1062 1 . . . . . 4.24 1.8 4.66 1 1 
       1063 1 . . . . . 4.69 1.8 5.16 1 1 
       1064 1 . . . . . 4.03 1.8 4.43 1 1 
       1065 1 . . . . . 3.81 1.8 4.19 1 1 
       1066 1 . . . . . 4.68 1.8 5.15 1 1 
       1067 1 . . . . . 4.75 1.8 5.22 1 1 
       1068 1 . . . . . 4.64 1.8  5.1 1 1 
       1069 1 . . . . . 4.49 1.8 4.94 1 1 
       1070 1 . . . . . 4.23 1.8 4.65 1 1 
       1071 1 . . . . . 4.74 1.8 5.21 1 1 
       1072 1 . . . . .  3.1 1.8 3.41 1 1 
       1073 1 . . . . . 3.12 1.8 3.43 1 1 
       1074 1 . . . . . 3.68 1.8 4.05 1 1 
       1075 1 . . . . . 3.68 1.8 4.05 1 1 
       1076 1 . . . . .  4.4 1.8 4.84 1 1 
       1077 1 . . . . . 3.81 1.8 4.19 1 1 
       1078 1 . . . . . 4.34 1.8 4.77 1 1 
       1079 1 . . . . . 5.07 1.8 5.58 1 1 
       1080 1 . . . . .  5.5 1.8 6.05 1 1 
       1081 1 . . . . . 4.22 1.8 4.64 1 1 
       1082 1 . . . . . 4.55 1.8 5.01 1 1 
       1083 1 . . . . . 5.14 1.8 5.65 1 1 
       1084 1 . . . . . 2.79 1.8 3.07 1 1 
       1085 1 . . . . . 4.88 1.8 5.37 1 1 
       1086 1 . . . . . 3.85 1.8 4.23 1 1 
       1087 1 . . . . . 4.09 1.8  4.5 1 1 
       1088 1 . . . . . 4.49 1.8 4.94 1 1 
       1089 1 . . . . . 4.87 1.8 5.36 1 1 
       1090 1 . . . . . 3.85 1.8 4.23 1 1 
       1091 1 . . . . . 4.33 1.8 4.76 1 1 
       1092 1 . . . . . 4.49 1.8 4.94 1 1 
       1093 1 . . . . . 4.87 1.8 5.36 1 1 
       1094 1 . . . . . 3.85 1.8 4.23 1 1 
       1095 1 . . . . . 4.33 1.8 4.76 1 1 
       1096 1 . . . . . 4.57 1.8 5.03 1 1 
       1097 1 . . . . . 4.82 1.8  5.3 1 1 
       1098 1 . . . . .  4.7 1.8 5.17 1 1 
       1099 1 . . . . . 2.89 1.8 3.18 1 1 
       1100 1 . . . . . 5.22 1.8 5.74 1 1 
       1101 1 . . . . .  4.3 1.8 4.73 1 1 
       1102 1 . . . . . 3.04 1.8 3.34 1 1 
       1103 1 . . . . . 4.69 1.8 5.16 1 1 
       1104 1 . . . . . 4.25 1.8 4.68 1 1 
       1105 1 . . . . . 3.29 1.8 3.62 1 1 
       1106 1 . . . . . 4.97 1.8 5.47 1 1 
       1107 1 . . . . . 4.31 1.8 4.74 1 1 
       1108 1 . . . . . 4.97 1.8 5.47 1 1 
       1109 1 . . . . . 4.27 1.8  4.7 1 1 
       1110 1 . . . . . 4.97 1.8 5.47 1 1 
       1111 1 . . . . . 4.34 1.8 4.77 1 1 
       1112 1 . . . . . 4.99 1.8 5.49 1 1 
       1113 1 . . . . .  3.7 1.8 4.07 1 1 
       1114 1 . . . . . 3.46 1.8 3.81 1 1 
       1115 1 . . . . . 2.71 1.8 2.98 1 1 
       1116 1 . . . . . 4.13 1.8 4.54 1 1 
       1117 1 . . . . . 4.88 1.8 5.37 1 1 
       1118 1 . . . . . 3.59 1.8 3.95 1 1 
       1119 1 . . . . . 3.61 1.8 3.97 1 1 
       1120 1 . . . . .  5.5 1.8 6.05 1 1 
       1121 1 . . . . . 3.88 1.8 4.27 1 1 
       1122 1 . . . . . 3.25 1.8 3.58 1 1 
       1123 1 . . . . . 3.98 1.8 4.38 1 1 
       1124 1 . . . . .  3.4 1.8 3.74 1 1 
       1125 1 . . . . . 4.49 1.8 4.94 1 1 
       1126 1 . . . . .  5.5 1.8 6.05 1 1 
       1127 1 . . . . . 4.71 1.8 5.18 1 1 
       1128 1 . . . . . 3.62 1.8 3.98 1 1 
       1129 1 . . . . . 3.01 1.8 3.31 1 1 
       1130 1 . . . . . 4.66 1.8 5.13 1 1 
       1131 1 . . . . .  4.4 1.8 4.84 1 1 
       1132 1 . . . . . 4.91 1.8  5.4 1 1 
       1133 1 . . . . . 4.24 1.8 4.66 1 1 
       1134 1 . . . . . 4.85 1.8 5.33 1 1 
       1135 1 . . . . . 5.49 1.8 6.04 1 1 
       1136 1 . . . . . 4.33 1.8 4.76 1 1 
       1137 1 . . . . . 4.43 1.8 4.87 1 1 
       1138 1 . . . . . 3.75 1.8 4.13 1 1 
       1139 1 . . . . .  4.5 1.8 4.95 1 1 
       1140 1 . . . . .  4.8 1.8 5.28 1 1 
       1141 1 . . . . . 4.28 1.8 4.71 1 1 
       1142 1 . . . . . 3.62 1.8 3.98 1 1 
       1143 1 . . . . . 4.32 1.8 4.75 1 1 
       1144 1 . . . . . 4.16 1.8 4.58 1 1 
       1145 1 . . . . . 4.88 1.8 5.37 1 1 
       1146 1 . . . . . 4.37 1.8 4.81 1 1 
       1147 1 . . . . . 3.53 1.8 3.88 1 1 
       1148 1 . . . . . 3.96 1.8 4.36 1 1 
       1149 1 . . . . . 3.23 1.8 3.55 1 1 
       1150 1 . . . . . 4.11 1.8 4.52 1 1 
       1151 1 . . . . . 5.21 1.8 5.73 1 1 
       1152 1 . . . . . 4.79 1.8 5.27 1 1 
       1153 1 . . . . . 4.36 1.8  4.8 1 1 
       1154 1 . . . . . 3.69 1.8 4.06 1 1 
       1155 1 . . . . . 4.36 1.8  4.8 1 1 
       1156 1 . . . . . 4.33 1.8 4.76 1 1 
       1157 1 . . . . . 3.08 1.8 3.39 1 1 
       1158 1 . . . . . 3.06 1.8 3.37 1 1 
       1159 1 . . . . . 4.02 1.8 4.42 1 1 
       1160 1 . . . . . 3.83 1.8 4.21 1 1 
       1161 1 . . . . . 3.44 1.8 3.78 1 1 
       1162 1 . . . . . 3.82 1.8  4.2 1 1 
       1163 1 . . . . . 3.27 1.8  3.6 1 1 
       1164 1 . . . . . 3.82 1.8  4.2 1 1 
       1165 1 . . . . . 4.69 1.8 5.16 1 1 
       1166 1 . . . . .  5.5 1.8 6.05 1 1 
       1167 1 . . . . . 4.76 1.8 5.24 1 1 
       1168 1 . . . . .  4.9 1.8 5.39 1 1 
       1169 1 . . . . . 4.28 1.8 4.71 1 1 
       1170 1 . . . . . 4.46 1.8 4.91 1 1 
       1171 1 . . . . . 2.89 1.8 3.18 1 1 
       1172 1 . . . . . 5.18 1.8  5.7 1 1 
       1173 1 . . . . . 4.59 1.8 5.05 1 1 
       1174 1 . . . . . 4.06 1.8 4.47 1 1 
       1175 1 . . . . .  4.0 1.8  4.4 1 1 
       1176 1 . . . . . 4.15 1.8 4.57 1 1 
       1177 1 . . . . . 3.95 1.8 4.35 1 1 
       1178 1 . . . . . 4.13 1.8 4.54 1 1 
       1179 1 . . . . . 4.62 1.8 5.08 1 1 
       1180 1 . . . . . 4.84 1.8 5.32 1 1 
       1181 1 . . . . .  5.5 1.8 6.05 1 1 
       1182 1 . . . . .  5.5 1.8 6.05 1 1 
       1183 1 . . . . . 4.88 1.8 5.37 1 1 
       1184 1 . . . . . 4.62 1.8 5.08 1 1 
       1185 1 . . . . . 4.84 1.8 5.32 1 1 
       1186 1 . . . . .  5.5 1.8 6.05 1 1 
       1187 1 . . . . .  5.5 1.8 6.05 1 1 
       1188 1 . . . . . 4.88 1.8 5.37 1 1 
       1189 1 . . . . . 3.25 1.8 3.58 1 1 
       1190 1 . . . . . 3.37 1.8 3.71 1 1 
       1191 1 . . . . . 5.48 1.8 6.03 1 1 
       1192 1 . . . . . 3.89 1.8 4.28 1 1 
       1193 1 . . . . . 4.31 1.8 4.74 1 1 
       1194 1 . . . . . 5.43 1.8 5.97 1 1 
       1195 1 . . . . . 3.39 1.8 3.73 1 1 
       1196 1 . . . . . 4.25 1.8 4.68 1 1 
       1197 1 . . . . . 3.47 1.8 3.82 1 1 
       1198 1 . . . . . 4.09 1.8  4.5 1 1 
       1199 1 . . . . . 4.49 1.8 4.94 1 1 
       1200 1 . . . . .  5.0 1.8  5.5 1 1 
       1201 1 . . . . .  4.6 1.8 5.06 1 1 
       1202 1 . . . . . 3.35 1.8 3.69 1 1 
       1203 1 . . . . . 3.26 1.8 3.59 1 1 
       1204 1 . . . . . 5.18 1.8  5.7 1 1 
       1205 1 . . . . . 5.18 1.8  5.7 1 1 
       1206 1 . . . . . 3.27 1.8  3.6 1 1 
       1207 1 . . . . . 4.14 1.8 4.55 1 1 
       1208 1 . . . . . 3.64 1.8  4.0 1 1 
       1209 1 . . . . . 3.64 1.8  4.0 1 1 
       1210 1 . . . . . 4.93 1.8 5.42 1 1 
       1211 1 . . . . . 4.32 1.8 4.75 1 1 
       1212 1 . . . . . 4.93 1.8 5.42 1 1 
       1213 1 . . . . . 4.64 1.8  5.1 1 1 
       1214 1 . . . . . 4.35 1.8 4.79 1 1 
       1215 1 . . . . . 4.66 1.8 5.13 1 1 
       1216 1 . . . . . 4.23 1.8 4.65 1 1 
       1217 1 . . . . . 3.69 1.8 4.06 1 1 
       1218 1 . . . . . 4.23 1.8 4.65 1 1 
       1219 1 . . . . . 2.92 1.8 3.21 1 1 
       1220 1 . . . . . 4.28 1.8 4.71 1 1 
       1221 1 . . . . . 2.32 1.8 2.55 1 1 
       1222 1 . . . . . 3.81 1.8 4.19 1 1 
       1223 1 . . . . . 4.41 1.8 4.85 1 1 
       1224 1 . . . . . 4.41 1.8 4.85 1 1 
       1225 1 . . . . . 5.06 1.8 5.57 1 1 
       1226 1 . . . . . 4.31 1.8 4.74 1 1 
       1227 1 . . . . . 4.92 1.8 5.41 1 1 
       1228 1 . . . . . 4.92 1.8 5.41 1 1 
       1229 1 . . . . .  3.0 1.8  3.3 1 1 
       1230 1 . . . . . 4.42 1.8 4.86 1 1 
       1231 1 . . . . . 4.87 1.8 5.36 1 1 
       1232 1 . . . . . 3.95 1.8 4.35 1 1 
       1233 1 . . . . .  3.0 1.8  3.3 1 1 
       1234 1 . . . . . 5.24 1.8 5.76 1 1 
       1235 1 . . . . . 4.88 1.8 5.37 1 1 
       1236 1 . . . . .  3.7 1.8 4.07 1 1 
       1237 1 . . . . . 3.73 1.8  4.1 1 1 
       1238 1 . . . . . 4.65 1.8 5.12 1 1 
       1239 1 . . . . .  5.5 1.8 6.05 1 1 
       1240 1 . . . . . 3.18 1.8  3.5 1 1 
       1241 1 . . . . .  5.5 1.8 6.05 1 1 
       1242 1 . . . . .  5.2 1.8 5.72 1 1 
       1243 1 . . . . .  5.5 1.8 6.05 1 1 
       1244 1 . . . . . 4.43 1.8 4.87 1 1 
       1245 1 . . . . .  4.0 1.8  4.4 1 1 
       1246 1 . . . . . 4.03 1.8 4.43 1 1 
       1247 1 . . . . . 3.45 1.8 3.79 1 1 
       1248 1 . . . . . 4.33 1.8 4.76 1 1 
       1249 1 . . . . . 4.28 1.8 4.71 1 1 
       1250 1 . . . . . 3.15 1.8 3.47 1 1 
       1251 1 . . . . . 4.11 1.8 4.52 1 1 
       1252 1 . . . . . 4.32 1.8 4.75 1 1 
       1253 1 . . . . . 3.77 1.8 4.15 1 1 
       1254 1 . . . . . 3.43 1.8 3.77 1 1 
       1255 1 . . . . . 3.68 1.8 4.05 1 1 
       1256 1 . . . . .  4.6 1.8 5.06 1 1 
       1257 1 . . . . . 4.63 1.8 5.09 1 1 
       1258 1 . . . . . 4.95 1.8 5.44 1 1 
       1259 1 . . . . .  2.7 1.8 2.97 1 1 
       1260 1 . . . . . 4.11 1.8 4.52 1 1 
       1261 1 . . . . . 5.34 1.8 5.87 1 1 
       1262 1 . . . . .  5.0 1.8  5.5 1 1 
       1263 1 . . . . . 3.14 1.8 3.45 1 1 
       1264 1 . . . . . 3.14 1.8 3.45 1 1 
       1265 1 . . . . . 3.23 1.8 3.55 1 1 
       1266 1 . . . . . 3.82 1.8  4.2 1 1 
       1267 1 . . . . . 4.79 1.8 5.27 1 1 
       1268 1 . . . . . 4.59 1.8 5.05 1 1 
       1269 1 . . . . . 5.19 1.8 5.71 1 1 
       1270 1 . . . . . 3.54 1.8 3.89 1 1 
       1271 1 . . . . . 3.09 1.8  3.4 1 1 
       1272 1 . . . . . 4.55 1.8 5.01 1 1 
       1273 1 . . . . .  4.4 1.8 4.84 1 1 
       1274 1 . . . . . 3.52 1.8 3.87 1 1 
       1275 1 . . . . . 3.91 1.8  4.3 1 1 
       1276 1 . . . . . 4.79 1.8 5.27 1 1 
       1277 1 . . . . .  4.9 1.8 5.39 1 1 
       1278 1 . . . . . 3.51 1.8 3.86 1 1 
       1279 1 . . . . . 3.66 1.8 4.03 1 1 
       1280 1 . . . . .  4.3 1.8 4.73 1 1 
       1281 1 . . . . . 5.05 1.8 5.56 1 1 
       1282 1 . . . . . 4.71 1.8 5.18 1 1 
       1283 1 . . . . . 4.16 1.8 4.58 1 1 
       1284 1 . . . . . 4.47 1.8 4.92 1 1 
       1285 1 . . . . . 5.33 1.8 5.86 1 1 
       1286 1 . . . . . 4.38 1.8 4.82 1 1 
       1287 1 . . . . .  2.9 1.8 3.19 1 1 
       1288 1 . . . . . 3.68 1.8 4.05 1 1 
       1289 1 . . . . . 5.18 1.8  5.7 1 1 
       1290 1 . . . . . 4.09 1.8  4.5 1 1 
       1291 1 . . . . . 5.31 1.8 5.84 1 1 
       1292 1 . . . . .  4.8 1.8 5.28 1 1 
       1293 1 . . . . . 4.39 1.8 4.83 1 1 
       1294 1 . . . . . 4.76 1.8 5.24 1 1 
       1295 1 . . . . . 4.39 1.8 4.83 1 1 
       1296 1 . . . . . 4.76 1.8 5.24 1 1 
       1297 1 . . . . . 4.83 1.8 5.31 1 1 
       1298 1 . . . . .  5.5 1.8 6.05 1 1 
       1299 1 . . . . . 4.24 1.8 4.66 1 1 
       1300 1 . . . . . 5.32 1.8 5.85 1 1 
       1301 1 . . . . . 3.93 1.8 4.32 1 1 
       1302 1 . . . . . 4.54 1.8 4.99 1 1 
       1303 1 . . . . . 3.41 1.8 3.75 1 1 
       1304 1 . . . . . 3.15 1.8 3.47 1 1 
       1305 1 . . . . . 4.03 1.8 4.43 1 1 
       1306 1 . . . . . 3.32 1.8 3.65 1 1 
       1307 1 . . . . . 4.69 1.8 5.16 1 1 
       1308 1 . . . . . 3.41 1.8 3.75 1 1 
       1309 1 . . . . .  3.1 1.8 3.41 1 1 
       1310 1 . . . . . 5.19 1.8 5.71 1 1 
       1311 1 . . . . .  5.5 1.8 6.05 1 1 
       1312 1 . . . . . 4.57 1.8 5.03 1 1 
       1313 1 . . . . . 5.29 1.8 5.82 1 1 
       1314 1 . . . . . 5.13 1.8 5.64 1 1 
       1315 1 . . . . .  3.4 1.8 3.74 1 1 
       1316 1 . . . . . 4.77 1.8 5.25 1 1 
       1317 1 . . . . . 4.18 1.8  4.6 1 1 
       1318 1 . . . . . 3.58 1.8 3.94 1 1 
       1319 1 . . . . .  3.2 1.8 3.52 1 1 
       1320 1 . . . . . 4.15 1.8 4.57 1 1 
       1321 1 . . . . . 4.32 1.8 4.75 1 1 
       1322 1 . . . . .  5.5 1.8 6.05 1 1 
       1323 1 . . . . . 3.89 1.8 4.28 1 1 
       1324 1 . . . . . 3.98 1.8 4.38 1 1 
       1325 1 . . . . . 3.93 1.8 4.32 1 1 
       1326 1 . . . . . 4.47 1.8 4.92 1 1 
       1327 1 . . . . . 4.04 1.8 4.44 1 1 
       1328 1 . . . . . 4.76 1.8 5.24 1 1 
       1329 1 . . . . . 4.89 1.8 5.38 1 1 
       1330 1 . . . . . 4.29 1.8 4.72 1 1 
       1331 1 . . . . . 3.31 1.8 3.64 1 1 
       1332 1 . . . . .  3.0 1.8  3.3 1 1 
       1333 1 . . . . . 3.11 1.8 3.42 1 1 
       1334 1 . . . . . 4.37 1.8 4.81 1 1 
       1335 1 . . . . . 3.67 1.8 4.04 1 1 
       1336 1 . . . . . 4.52 1.8 4.97 1 1 
       1337 1 . . . . . 4.68 1.8 5.15 1 1 
       1338 1 . . . . . 4.64 1.8  5.1 1 1 
       1339 1 . . . . . 3.17 1.8 3.49 1 1 
       1340 1 . . . . . 3.12 1.8 3.43 1 1 
       1341 1 . . . . . 4.03 1.8 4.43 1 1 
       1342 1 . . . . . 3.63 1.8 3.99 1 1 
       1343 1 . . . . . 5.06 1.8 5.57 1 1 
       1344 1 . . . . . 4.58 1.8 5.04 1 1 
       1345 1 . . . . . 3.69 1.8 4.06 1 1 
       1346 1 . . . . .  4.2 1.8 4.62 1 1 
       1347 1 . . . . .  5.5 1.8 6.05 1 1 
       1348 1 . . . . . 4.87 1.8 5.36 1 1 
       1349 1 . . . . . 4.54 1.8 4.99 1 1 
       1350 1 . . . . .  5.0 1.8  5.5 1 1 
       1351 1 . . . . . 3.64 1.8  4.0 1 1 
       1352 1 . . . . . 3.69 1.8 4.06 1 1 
       1353 1 . . . . . 4.03 1.8 4.43 1 1 
       1354 1 . . . . . 5.29 1.8 5.82 1 1 
       1355 1 . . . . . 4.71 1.8 5.18 1 1 
       1356 1 . . . . . 3.63 1.8 3.99 1 1 
       1357 1 . . . . . 4.05 1.8 4.46 1 1 
       1358 1 . . . . .  5.5 1.8 6.05 1 1 
       1359 1 . . . . . 3.41 1.8 3.75 1 1 
       1360 1 . . . . . 3.24 1.8 3.56 1 1 
       1361 1 . . . . . 3.73 1.8  4.1 1 1 
       1362 1 . . . . . 5.27 1.8  5.8 1 1 
       1363 1 . . . . .  4.4 1.8 4.84 1 1 
       1364 1 . . . . .  5.5 1.8 6.05 1 1 
       1365 1 . . . . . 3.89 1.8 4.28 1 1 
       1366 1 . . . . .  5.5 1.8 6.05 1 1 
       1367 1 . . . . . 5.48 1.8 6.03 1 1 
       1368 1 . . . . . 4.74 1.8 5.21 1 1 
       1369 1 . . . . . 4.26 1.8 4.69 1 1 
       1370 1 . . . . . 4.48 1.8 4.93 1 1 
       1371 1 . . . . . 3.49 1.8 3.84 1 1 
       1372 1 . . . . . 4.71 1.8 5.18 1 1 
       1373 1 . . . . . 4.52 1.8 4.97 1 1 
       1374 1 . . . . . 4.53 1.8 4.98 1 1 
       1375 1 . . . . . 3.44 1.8 3.78 1 1 
       1376 1 . . . . . 4.56 1.8 5.02 1 1 
       1377 1 . . . . . 3.89 1.8 4.28 1 1 
       1378 1 . . . . .  5.5 1.8 6.05 1 1 
       1379 1 . . . . . 3.92 1.8 4.31 1 1 
       1380 1 . . . . . 4.14 1.8 4.55 1 1 
       1381 1 . . . . . 3.49 1.8 3.84 1 1 
       1382 1 . . . . . 4.46 1.8 4.91 1 1 
       1383 1 . . . . . 4.86 1.8 5.35 1 1 
       1384 1 . . . . .  5.0 1.8  5.5 1 1 
       1385 1 . . . . . 3.91 1.8  4.3 1 1 
       1386 1 . . . . . 4.89 1.8 5.38 1 1 
       1387 1 . . . . . 4.46 1.8 4.91 1 1 
       1388 1 . . . . . 3.95 1.8 4.35 1 1 
       1389 1 . . . . . 4.93 1.8 5.42 1 1 
       1390 1 . . . . . 5.33 1.8 5.86 1 1 
       1391 1 . . . . . 3.96 1.8 4.36 1 1 
       1392 1 . . . . . 2.95 1.8 3.25 1 1 
       1393 1 . . . . . 4.43 1.8 4.87 1 1 
       1394 1 . . . . . 4.37 1.8 4.81 1 1 
       1395 1 . . . . . 4.28 1.8 4.71 1 1 
       1396 1 . . . . . 4.36 1.8  4.8 1 1 
       1397 1 . . . . . 5.21 1.8 5.73 1 1 
       1398 1 . . . . . 4.66 1.8 5.13 1 1 
       1399 1 . . . . .  4.5 1.8 4.95 1 1 
       1400 1 . . . . . 4.58 1.8 5.04 1 1 
       1401 1 . . . . . 4.67 1.8 5.14 1 1 
       1402 1 . . . . .  4.0 1.8  4.4 1 1 
       1403 1 . . . . . 3.88 1.8 4.27 1 1 
       1404 1 . . . . .  4.2 1.8 4.62 1 1 
       1405 1 . . . . . 4.12 1.8 4.53 1 1 
       1406 1 . . . . .  3.1 1.8 3.41 1 1 
       1407 1 . . . . . 4.49 1.8 4.94 1 1 
       1408 1 . . . . . 3.86 1.8 4.25 1 1 
       1409 1 . . . . . 3.23 1.8 3.55 1 1 
       1410 1 . . . . . 4.33 1.8 4.76 1 1 
       1411 1 . . . . .  4.4 1.8 4.84 1 1 
       1412 1 . . . . . 3.79 1.8 4.17 1 1 
       1413 1 . . . . . 3.45 1.8 3.79 1 1 
       1414 1 . . . . . 2.94 1.8 3.23 1 1 
       1415 1 . . . . . 4.68 1.8 5.15 1 1 
       1416 1 . . . . . 4.54 1.8 4.99 1 1 
       1417 1 . . . . . 5.11 1.8 5.62 1 1 
       1418 1 . . . . . 3.74 1.8 4.11 1 1 
       1419 1 . . . . . 4.74 1.8 5.21 1 1 
       1420 1 . . . . . 4.08 1.8 4.49 1 1 
       1421 1 . . . . . 4.32 1.8 4.75 1 1 
       1422 1 . . . . . 3.28 1.8 3.61 1 1 
       1423 1 . . . . .  4.1 1.8 4.51 1 1 
       1424 1 . . . . . 4.53 1.8 4.98 1 1 
       1425 1 . . . . . 4.63 1.8 5.09 1 1 
       1426 1 . . . . . 4.89 1.8 5.38 1 1 
       1427 1 . . . . . 3.39 1.8 3.73 1 1 
       1428 1 . . . . . 3.39 1.8 3.73 1 1 
       1429 1 . . . . . 4.13 1.8 4.54 1 1 
       1430 1 . . . . . 3.79 1.8 4.17 1 1 
       1431 1 . . . . . 3.52 1.8 3.87 1 1 
       1432 1 . . . . . 4.02 1.8 4.42 1 1 
       1433 1 . . . . . 3.22 1.8 3.54 1 1 
       1434 1 . . . . . 3.97 1.8 4.37 1 1 
       1435 1 . . . . . 4.48 1.8 4.93 1 1 
       1436 1 . . . . .  4.7 1.8 5.17 1 1 
       1437 1 . . . . . 4.86 1.8 5.35 1 1 
       1438 1 . . . . . 3.58 1.8 3.94 1 1 
       1439 1 . . . . . 4.83 1.8 5.31 1 1 
       1440 1 . . . . . 3.95 1.8 4.35 1 1 
       1441 1 . . . . . 3.01 1.8 3.31 1 1 
       1442 1 . . . . . 2.92 1.8 3.21 1 1 
       1443 1 . . . . . 4.92 1.8 5.41 1 1 
       1444 1 . . . . .  4.3 1.8 4.73 1 1 
       1445 1 . . . . . 4.23 1.8 4.65 1 1 
       1446 1 . . . . .  4.9 1.8 5.39 1 1 
       1447 1 . . . . . 5.05 1.8 5.56 1 1 
       1448 1 . . . . . 4.85 1.8 5.33 1 1 
       1449 1 . . . . . 3.99 1.8 4.39 1 1 
       1450 1 . . . . . 4.12 1.8 4.53 1 1 
       1451 1 . . . . . 3.63 1.8 3.99 1 1 
       1452 1 . . . . . 3.12 1.8 3.43 1 1 
       1453 1 . . . . . 4.84 1.8 5.32 1 1 
       1454 1 . . . . .  4.9 1.8 5.39 1 1 
       1455 1 . . . . . 4.87 1.8 5.36 1 1 
       1456 1 . . . . . 3.49 1.8 3.84 1 1 
       1457 1 . . . . . 3.92 1.8 4.31 1 1 
       1458 1 . . . . . 4.68 1.8 5.15 1 1 
       1459 1 . . . . . 3.56 1.8 3.92 1 1 
       1460 1 . . . . . 2.94 1.8 3.23 1 1 
       1461 1 . . . . . 5.28 1.8 5.81 1 1 
       1462 1 . . . . . 5.28 1.8 5.81 1 1 
       1463 1 . . . . . 4.99 1.8 5.49 1 1 
       1464 1 . . . . . 3.73 1.8  4.1 1 1 
       1465 1 . . . . . 4.89 1.8 5.38 1 1 
       1466 1 . . . . . 4.17 1.8 4.59 1 1 
       1467 1 . . . . . 4.89 1.8 5.38 1 1 
       1468 1 . . . . . 3.95 1.8 4.35 1 1 
       1469 1 . . . . . 5.44 1.8 5.98 1 1 
       1470 1 . . . . . 4.15 1.8 4.57 1 1 
       1471 1 . . . . . 5.05 1.8 5.56 1 1 
       1472 1 . . . . . 3.38 1.8 3.72 1 1 
       1473 1 . . . . . 4.41 1.8 4.85 1 1 
       1474 1 . . . . . 4.11 1.8 4.52 1 1 
       1475 1 . . . . . 3.46 1.8 3.81 1 1 
       1476 1 . . . . .  4.9 1.8 5.39 1 1 
       1477 1 . . . . . 3.94 1.8 4.33 1 1 
       1478 1 . . . . . 4.57 1.8 5.03 1 1 
       1479 1 . . . . . 4.04 1.8 4.44 1 1 
       1480 1 . . . . . 4.13 1.8 4.54 1 1 
       1481 1 . . . . . 4.14 1.8 4.55 1 1 
       1482 1 . . . . . 4.27 1.8  4.7 1 1 
       1483 1 . . . . . 4.93 1.8 5.42 1 1 
       1484 1 . . . . .  5.5 1.8 6.05 1 1 
       1485 1 . . . . . 4.97 1.8 5.47 1 1 
       1486 1 . . . . . 3.73 1.8  4.1 1 1 
       1487 1 . . . . . 4.37 1.8 4.81 1 1 
       1488 1 . . . . . 3.99 1.8 4.39 1 1 
       1489 1 . . . . .  4.9 1.8 5.39 1 1 
       1490 1 . . . . . 5.32 1.8 5.85 1 1 
       1491 1 . . . . . 3.45 1.8 3.79 1 1 
       1492 1 . . . . . 4.69 1.8 5.16 1 1 
       1493 1 . . . . . 4.39 1.8 4.83 1 1 
       1494 1 . . . . . 3.56 1.8 3.92 1 1 
       1495 1 . . . . . 4.24 1.8 4.66 1 1 
       1496 1 . . . . . 4.71 1.8 5.18 1 1 
       1497 1 . . . . . 4.24 1.8 4.66 1 1 
       1498 1 . . . . . 4.71 1.8 5.18 1 1 
       1499 1 . . . . . 4.04 1.8 4.44 1 1 
       1500 1 . . . . . 3.88 1.8 4.27 1 1 
       1501 1 . . . . . 3.27 1.8  3.6 1 1 
       1502 1 . . . . . 3.88 1.8 4.27 1 1 
       1503 1 . . . . . 3.93 1.8 4.32 1 1 
       1504 1 . . . . . 5.09 1.8  5.6 1 1 
       1505 1 . . . . .  4.3 1.8 4.73 1 1 
       1506 1 . . . . . 3.74 1.8 4.11 1 1 
       1507 1 . . . . .  4.3 1.8 4.73 1 1 
       1508 1 . . . . . 3.19 1.8 3.51 1 1 
       1509 1 . . . . . 4.91 1.8  5.4 1 1 
       1510 1 . . . . . 4.05 1.8 4.46 1 1 
       1511 1 . . . . . 3.32 1.8 3.65 1 1 
       1512 1 . . . . . 5.34 1.8 5.87 1 1 
       1513 1 . . . . . 3.17 1.8 3.49 1 1 
       1514 1 . . . . . 4.17 1.8 4.59 1 1 
       1515 1 . . . . . 4.28 1.8 4.71 1 1 
       1516 1 . . . . . 4.28 1.8 4.71 1 1 
       1517 1 . . . . . 3.43 1.8 3.77 1 1 
       1518 1 . . . . . 2.91 1.8  3.2 1 1 
       1519 1 . . . . . 3.43 1.8 3.77 1 1 
       1520 1 . . . . . 3.18 1.8  3.5 1 1 
       1521 1 . . . . .  3.4 1.8 3.74 1 1 
       1522 1 . . . . . 4.79 1.8 5.27 1 1 
       1523 1 . . . . .  5.5 1.8 6.05 1 1 
       1524 1 . . . . . 3.67 1.8 4.04 1 1 
       1525 1 . . . . . 2.91 1.8  3.2 1 1 
       1526 1 . . . . . 3.99 1.8 4.39 1 1 
       1527 1 . . . . . 3.88 1.8 4.27 1 1 
       1528 1 . . . . . 4.03 1.8 4.43 1 1 
       1529 1 . . . . . 3.37 1.8 3.71 1 1 
       1530 1 . . . . . 3.42 1.8 3.76 1 1 
       1531 1 . . . . . 4.86 1.8 5.35 1 1 
       1532 1 . . . . . 4.86 1.8 5.35 1 1 
       1533 1 . . . . . 4.45 1.8 4.89 1 1 
       1534 1 . . . . . 4.34 1.8 4.77 1 1 
       1535 1 . . . . . 4.13 1.8 4.54 1 1 
       1536 1 . . . . . 3.51 1.8 3.86 1 1 
       1537 1 . . . . . 4.13 1.8 4.54 1 1 
       1538 1 . . . . . 3.04 1.8 3.34 1 1 
       1539 1 . . . . .  5.5 1.8 6.05 1 1 
       1540 1 . . . . . 4.08 1.8 4.49 1 1 
       1541 1 . . . . .  5.5 1.8 6.05 1 1 
       1542 1 . . . . . 4.84 1.8 5.32 1 1 
       1543 1 . . . . . 4.74 1.8 5.21 1 1 
       1544 1 . . . . . 3.58 1.8 3.94 1 1 
       1545 1 . . . . . 4.36 1.8  4.8 1 1 
       1546 1 . . . . . 4.36 1.8  4.8 1 1 
       1547 1 . . . . . 4.11 1.8 4.52 1 1 
       1548 1 . . . . . 4.25 1.8 4.68 1 1 
       1549 1 . . . . . 3.49 1.8 3.84 1 1 
       1550 1 . . . . . 4.25 1.8 4.68 1 1 
       1551 1 . . . . . 4.58 1.8 5.04 1 1 
       1552 1 . . . . . 3.56 1.8 3.92 1 1 
       1553 1 . . . . . 3.56 1.8 3.92 1 1 
       1554 1 . . . . . 2.69 1.8 2.96 1 1 
       1555 1 . . . . . 4.89 1.8 5.38 1 1 
       1556 1 . . . . . 4.95 1.8 5.44 1 1 
       1557 1 . . . . . 4.09 1.8  4.5 1 1 
       1558 1 . . . . . 3.66 1.8 4.03 1 1 
       1559 1 . . . . . 4.79 1.8 5.27 1 1 
       1560 1 . . . . . 4.22 1.8 4.64 1 1 
       1561 1 . . . . . 4.22 1.8 4.64 1 1 
       1562 1 . . . . . 3.78 1.8 4.16 1 1 
       1563 1 . . . . . 3.52 1.8 3.87 1 1 
       1564 1 . . . . . 4.75 1.8 5.22 1 1 
       1565 1 . . . . . 3.51 1.8 3.86 1 1 
       1566 1 . . . . . 2.96 1.8 3.26 1 1 
       1567 1 . . . . . 4.61 1.8 5.07 1 1 
       1568 1 . . . . . 4.54 1.8 4.99 1 1 
       1569 1 . . . . . 3.84 1.8 4.22 1 1 
       1570 1 . . . . . 3.93 1.8 4.32 1 1 
       1571 1 . . . . . 4.43 1.8 4.87 1 1 
       1572 1 . . . . . 4.89 1.8 5.38 1 1 
       1573 1 . . . . . 2.82 1.8  3.1 1 1 
       1574 1 . . . . . 4.97 1.8 5.47 1 1 
       1575 1 . . . . .  5.5 1.8 6.05 1 1 
       1576 1 . . . . . 2.99 1.8 3.29 1 1 
       1577 1 . . . . . 4.93 1.8 5.42 1 1 
       1578 1 . . . . . 3.37 1.8 3.71 1 1 
       1579 1 . . . . . 4.16 1.8 4.58 1 1 
       1580 1 . . . . .  5.5 1.8 6.05 1 1 
       1581 1 . . . . . 4.63 1.8 5.09 1 1 
       1582 1 . . . . . 3.68 1.8 4.05 1 1 
       1583 1 . . . . . 4.46 1.8 4.91 1 1 
       1584 1 . . . . . 4.33 1.8 4.76 1 1 
       1585 1 . . . . . 3.93 1.8 4.32 1 1 
       1586 1 . . . . . 3.06 1.8 3.37 1 1 
       1587 1 . . . . .  5.5 1.8 6.05 1 1 
       1588 1 . . . . .  5.5 1.8 6.05 1 1 
       1589 1 . . . . . 4.46 1.8 4.91 1 1 
       1590 1 . . . . .  5.5 1.8 6.05 1 1 
       1591 1 . . . . . 3.27 1.8  3.6 1 1 
       1592 1 . . . . . 4.75 1.8 5.22 1 1 
       1593 1 . . . . . 3.68 1.8 4.05 1 1 
       1594 1 . . . . .  5.5 1.8 6.05 1 1 
       1595 1 . . . . .  5.5 1.8 6.05 1 1 
       1596 1 . . . . . 3.64 1.8  4.0 1 1 
       1597 1 . . . . . 3.37 1.8 3.71 1 1 
       1598 1 . . . . . 4.37 1.8 4.81 1 1 
       1599 1 . . . . . 4.88 1.8 5.37 1 1 
       1600 1 . . . . . 3.91 1.8  4.3 1 1 
       1601 1 . . . . . 5.12 1.8 5.63 1 1 
       1602 1 . . . . . 4.78 1.8 5.26 1 1 
       1603 1 . . . . .  5.5 1.8 6.05 1 1 
       1604 1 . . . . .  3.1 1.8 3.41 1 1 
       1605 1 . . . . . 4.27 1.8  4.7 1 1 
       1606 1 . . . . .  5.5 1.8 6.05 1 1 
       1607 1 . . . . . 3.79 1.8 4.17 1 1 
       1608 1 . . . . . 4.51 1.8 4.96 1 1 
       1609 1 . . . . .  5.5 1.8 6.05 1 1 
       1610 1 . . . . . 4.04 1.8 4.44 1 1 
       1611 1 . . . . . 4.78 1.8 5.26 1 1 
       1612 1 . . . . . 4.18 1.8  4.6 1 1 
       1613 1 . . . . . 3.79 1.8 4.17 1 1 
       1614 1 . . . . . 3.65 1.8 4.02 1 1 
       1615 1 . . . . . 3.64 1.8  4.0 1 1 
       1616 1 . . . . .  3.8 1.8 4.18 1 1 
       1617 1 . . . . . 4.13 1.8 4.54 1 1 
       1618 1 . . . . . 4.82 1.8  5.3 1 1 
       1619 1 . . . . . 4.64 1.8  5.1 1 1 
       1620 1 . . . . . 3.24 1.8 3.56 1 1 
       1621 1 . . . . .  3.2 1.8 3.52 1 1 
       1622 1 . . . . . 5.17 1.8 5.69 1 1 
       1623 1 . . . . . 3.84 1.8 4.22 1 1 
       1624 1 . . . . . 3.39 1.8 3.73 1 1 
       1625 1 . . . . . 4.43 1.8 4.87 1 1 
       1626 1 . . . . . 3.66 1.8 4.03 1 1 
       1627 1 . . . . . 4.78 1.8 5.26 1 1 
       1628 1 . . . . . 3.07 1.8 3.38 1 1 
       1629 1 . . . . . 4.76 1.8 5.24 1 1 
       1630 1 . . . . . 4.24 1.8 4.66 1 1 
       1631 1 . . . . . 3.67 1.8 4.04 1 1 
       1632 1 . . . . . 5.35 1.8 5.89 1 1 
       1633 1 . . . . . 4.99 1.8 5.49 1 1 
       1634 1 . . . . . 3.71 1.8 4.08 1 1 
       1635 1 . . . . . 4.37 1.8 4.81 1 1 
       1636 1 . . . . . 3.58 1.8 3.94 1 1 
       1637 1 . . . . . 4.05 1.8 4.46 1 1 
       1638 1 . . . . . 5.49 1.8 6.04 1 1 
       1639 1 . . . . .  5.5 1.8 6.05 1 1 
       1640 1 . . . . . 3.09 1.8  3.4 1 1 
       1641 1 . . . . . 4.41 1.8 4.85 1 1 
       1642 1 . . . . . 4.74 1.8 5.21 1 1 
       1643 1 . . . . . 3.54 1.8 3.89 1 1 
       1644 1 . . . . . 5.18 1.8  5.7 1 1 
       1645 1 . . . . . 4.37 1.8 4.81 1 1 
       1646 1 . . . . . 3.78 1.8 4.16 1 1 
       1647 1 . . . . .  4.1 1.8 4.51 1 1 
       1648 1 . . . . . 3.67 1.8 4.04 1 1 
       1649 1 . . . . . 4.51 1.8 4.96 1 1 
       1650 1 . . . . . 3.18 1.8  3.5 1 1 
       1651 1 . . . . .  3.7 1.8 4.07 1 1 
       1652 1 . . . . .  4.5 1.8 4.95 1 1 
       1653 1 . . . . . 4.18 1.8  4.6 1 1 
       1654 1 . . . . . 3.53 1.8 3.88 1 1 
       1655 1 . . . . . 4.18 1.8  4.6 1 1 
       1656 1 . . . . . 4.57 1.8 5.03 1 1 
       1657 1 . . . . .  3.9 1.8 4.29 1 1 
       1658 1 . . . . .  4.8 1.8 5.28 1 1 
       1659 1 . . . . .  4.3 1.8 4.73 1 1 
       1660 1 . . . . . 2.87 1.8 3.16 1 1 
       1661 1 . . . . . 5.05 1.8 5.56 1 1 
       1662 1 . . . . . 3.78 1.8 4.16 1 1 
       1663 1 . . . . . 3.18 1.8  3.5 1 1 
       1664 1 . . . . . 3.75 1.8 4.13 1 1 
       1665 1 . . . . . 5.34 1.8 5.87 1 1 
       1666 1 . . . . . 5.27 1.8  5.8 1 1 
       1667 1 . . . . . 3.73 1.8  4.1 1 1 
       1668 1 . . . . . 4.82 1.8  5.3 1 1 
       1669 1 . . . . .  4.6 1.8 5.06 1 1 
       1670 1 . . . . . 3.73 1.8  4.1 1 1 
       1671 1 . . . . . 4.82 1.8  5.3 1 1 
       1672 1 . . . . .  4.6 1.8 5.06 1 1 
       1673 1 . . . . .  5.5 1.8 6.05 1 1 
       1674 1 . . . . . 3.28 1.8 3.61 1 1 
       1675 1 . . . . . 4.73 1.8  5.2 1 1 
       1676 1 . . . . . 3.32 1.8 3.65 1 1 
       1677 1 . . . . . 3.93 1.8 4.32 1 1 
       1678 1 . . . . . 3.13 1.8 3.44 1 1 
       1679 1 . . . . . 4.65 1.8 5.12 1 1 
       1680 1 . . . . . 3.18 1.8  3.5 1 1 
       1681 1 . . . . . 3.55 1.8  3.9 1 1 
       1682 1 . . . . . 2.82 1.8  3.1 1 1 
       1683 1 . . . . . 4.59 1.8 5.05 1 1 
       1684 1 . . . . . 4.12 1.8 4.53 1 1 
       1685 1 . . . . . 3.38 1.8 3.72 1 1 
       1686 1 . . . . . 5.17 1.8 5.69 1 1 
       1687 1 . . . . .  3.7 1.8 4.07 1 1 
       1688 1 . . . . . 3.13 1.8 3.44 1 1 
       1689 1 . . . . .  3.7 1.8 4.07 1 1 
       1690 1 . . . . . 4.33 1.8 4.76 1 1 
       1691 1 . . . . . 4.16 1.8 4.58 1 1 
       1692 1 . . . . . 3.42 1.8 3.76 1 1 
       1693 1 . . . . . 4.16 1.8 4.58 1 1 
       1694 1 . . . . . 4.78 1.8 5.26 1 1 
       1695 1 . . . . . 4.28 1.8 4.71 1 1 
       1696 1 . . . . . 4.12 1.8 4.53 1 1 
       1697 1 . . . . . 4.12 1.8 4.53 1 1 
       1698 1 . . . . . 3.53 1.8 3.88 1 1 
       1699 1 . . . . . 4.97 1.8 5.47 1 1 
       1700 1 . . . . . 3.24 1.8 3.56 1 1 
       1701 1 . . . . . 3.83 1.8 4.21 1 1 
       1702 1 . . . . . 3.71 1.8 4.08 1 1 
       1703 1 . . . . . 4.58 1.8 5.04 1 1 
       1704 1 . . . . . 3.71 1.8 4.08 1 1 
       1705 1 . . . . . 4.58 1.8 5.04 1 1 
       1706 1 . . . . . 4.68 1.8 5.15 1 1 
       1707 1 . . . . . 3.98 1.8 4.38 1 1 
       1708 1 . . . . . 4.68 1.8 5.15 1 1 
       1709 1 . . . . . 4.68 1.8 5.15 1 1 
       1710 1 . . . . . 3.81 1.8 4.19 1 1 
       1711 1 . . . . . 3.09 1.8  3.4 1 1 
       1712 1 . . . . . 3.81 1.8 4.19 1 1 
       1713 1 . . . . . 3.59 1.8 3.95 1 1 
       1714 1 . . . . . 3.17 1.8 3.49 1 1 
       1715 1 . . . . . 4.16 1.8 4.58 1 1 
       1716 1 . . . . . 4.16 1.8 4.58 1 1 
       1717 1 . . . . . 3.65 1.8 4.02 1 1 
       1718 1 . . . . . 4.39 1.8 4.83 1 1 
       1719 1 . . . . . 3.63 1.8 3.99 1 1 
       1720 1 . . . . . 2.73 1.8  3.0 1 1 
       1721 1 . . . . .  5.3 1.8 5.83 1 1 
       1722 1 . . . . . 4.53 1.8 4.98 1 1 
       1723 1 . . . . .  5.3 1.8 5.83 1 1 
       1724 1 . . . . . 4.47 1.8 4.92 1 1 
       1725 1 . . . . . 4.47 1.8 4.92 1 1 
       1726 1 . . . . . 4.56 1.8 5.02 1 1 
       1727 1 . . . . . 3.87 1.8 4.26 1 1 
       1728 1 . . . . . 3.84 1.8 4.22 1 1 
       1729 1 . . . . . 3.34 1.8 3.67 1 1 
       1730 1 . . . . . 3.84 1.8 4.22 1 1 
       1731 1 . . . . . 4.59 1.8 5.05 1 1 
       1732 1 . . . . . 2.79 1.8 3.07 1 1 
       1733 1 . . . . . 4.37 1.8 4.81 1 1 
       1734 1 . . . . . 4.03 1.8 4.43 1 1 
       1735 1 . . . . . 4.65 1.8 5.12 1 1 
       1736 1 . . . . . 4.65 1.8 5.12 1 1 
       1737 1 . . . . . 3.91 1.8  4.3 1 1 
       1738 1 . . . . . 3.26 1.8 3.59 1 1 
       1739 1 . . . . . 3.91 1.8  4.3 1 1 
       1740 1 . . . . . 4.03 1.8 4.43 1 1 
       1741 1 . . . . . 4.32 1.8 4.75 1 1 
       1742 1 . . . . . 4.32 1.8 4.75 1 1 
       1743 1 . . . . . 3.49 1.8 3.84 1 1 
       1744 1 . . . . . 2.39 1.8 2.63 1 1 
       1745 1 . . . . . 2.77 1.8 3.05 1 1 
       1746 1 . . . . . 4.79 1.8 5.27 1 1 
       1747 1 . . . . . 2.77 1.8 3.05 1 1 
       1748 1 . . . . . 4.79 1.8 5.27 1 1 
       1749 1 . . . . . 3.21 1.8 3.53 1 1 
       1750 1 . . . . . 3.68 1.8 4.05 1 1 
       1751 1 . . . . .  4.1 1.8 4.51 1 1 
       1752 1 . . . . . 3.13 1.8 3.44 1 1 
       1753 1 . . . . . 4.09 1.8  4.5 1 1 
       1754 1 . . . . . 4.08 1.8 4.49 1 1 
       1755 1 . . . . . 3.53 1.8 3.88 1 1 
       1756 1 . . . . . 4.08 1.8 4.49 1 1 
       1757 1 . . . . . 5.31 1.8 5.84 1 1 
       1758 1 . . . . . 4.58 1.8 5.04 1 1 
       1759 1 . . . . . 5.31 1.8 5.84 1 1 
       1760 1 . . . . . 3.37 1.8 3.71 1 1 
       1761 1 . . . . . 2.94 1.8 3.23 1 1 
       1762 1 . . . . . 3.37 1.8 3.71 1 1 
       1763 1 . . . . . 2.62 1.8 2.88 1 1 
       1764 1 . . . . . 4.21 1.8 4.63 1 1 
       1765 1 . . . . . 2.86 1.8 3.15 1 1 
       1766 1 . . . . . 4.47 1.8 4.92 1 1 
       1767 1 . . . . . 4.47 1.8 4.92 1 1 
       1768 1 . . . . .  4.7 1.8 5.17 1 1 
       1769 1 . . . . . 3.99 1.8 4.39 1 1 
       1770 1 . . . . . 3.99 1.8 4.39 1 1 
       1771 1 . . . . . 4.17 1.8 4.59 1 1 
       1772 1 . . . . . 2.93 1.8 3.22 1 1 
       1773 1 . . . . . 4.42 1.8 4.86 1 1 
       1774 1 . . . . . 3.18 1.8  3.5 1 1 
       1775 1 . . . . . 4.32 1.8 4.75 1 1 
       1776 1 . . . . . 4.12 1.8 4.53 1 1 
       1777 1 . . . . . 3.61 1.8 3.97 1 1 
       1778 1 . . . . . 4.12 1.8 4.53 1 1 
       1779 1 . . . . .  5.2 1.8 5.72 1 1 
       1780 1 . . . . . 4.39 1.8 4.83 1 1 
       1781 1 . . . . .  5.2 1.8 5.72 1 1 
       1782 1 . . . . . 4.59 1.8 5.05 1 1 
       1783 1 . . . . .  3.7 1.8 4.07 1 1 
       1784 1 . . . . . 4.04 1.8 4.44 1 1 
       1785 1 . . . . . 3.13 1.8 3.44 1 1 
       1786 1 . . . . . 4.12 1.8 4.53 1 1 
       1787 1 . . . . . 4.43 1.8 4.87 1 1 
       1788 1 . . . . .  5.5 1.8 6.05 1 1 
       1789 1 . . . . . 4.15 1.8 4.57 1 1 
       1790 1 . . . . . 3.48 1.8 3.83 1 1 
       1791 1 . . . . . 4.15 1.8 4.57 1 1 
       1792 1 . . . . . 4.84 1.8 5.32 1 1 
       1793 1 . . . . . 4.22 1.8 4.64 1 1 
       1794 1 . . . . . 4.84 1.8 5.32 1 1 
    stop_

save_


save_CNS/XPLOR_dihedral_4
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

         1 . 1 1  7 SER C  1 1  8 ASP N  1 1  8 ASP CA 1 1  8 ASP C      -114.32     -74.32 .  7 . C  .  8 . N  .  8 . CA .  8 . C  1 1 
         2 . 1 1  8 ASP N  1 1  8 ASP CA 1 1  8 ASP C  1 1  9 LEU N    114.10999     154.11 .  8 . N  .  8 . CA .  8 . C  .  9 . N  1 1 
         3 . 1 1  8 ASP C  1 1  9 LEU N  1 1  9 LEU CA 1 1  9 LEU C      -120.97     -80.97 .  8 . C  .  9 . N  .  9 . CA .  9 . C  1 1 
         4 . 1 1  9 LEU N  1 1  9 LEU CA 1 1  9 LEU C  1 1 10 GLU N        95.82     135.82 .  9 . N  .  9 . CA .  9 . C  . 10 . N  1 1 
         5 . 1 1  9 LEU C  1 1 10 GLU N  1 1 10 GLU CA 1 1 10 GLU C       -94.49     -54.49 .  9 . C  . 10 . N  . 10 . CA . 10 . C  1 1 
         6 . 1 1 10 GLU N  1 1 10 GLU CA 1 1 10 GLU C  1 1 11 PRO N       117.82     157.82 . 10 . N  . 10 . CA . 10 . C  . 11 . N  1 1 
         7 . 1 1 11 PRO C  1 1 12 LYS N  1 1 12 LYS CA 1 1 12 LYS C  -123.729996     -83.73 . 11 . C  . 12 . N  . 12 . CA . 12 . C  1 1 
         8 . 1 1 12 LYS N  1 1 12 LYS CA 1 1 12 LYS C  1 1 13 LEU N        98.18     138.18 . 12 . N  . 12 . CA . 12 . C  . 13 . N  1 1 
         9 . 1 1 12 LYS C  1 1 13 LEU N  1 1 13 LEU CA 1 1 13 LEU C      -130.27     -90.27 . 12 . C  . 13 . N  . 13 . CA . 13 . C  1 1 
        10 . 1 1 13 LEU N  1 1 13 LEU CA 1 1 13 LEU C  1 1 14 THR N       106.71     146.71 . 13 . N  . 13 . CA . 13 . C  . 14 . N  1 1 
        11 . 1 1 13 LEU C  1 1 14 THR N  1 1 14 THR CA 1 1 14 THR C      -126.68     -86.68 . 13 . C  . 14 . N  . 14 . CA . 14 . C  1 1 
        12 . 1 1 14 THR N  1 1 14 THR CA 1 1 14 THR C  1 1 15 VAL N       111.88     151.88 . 14 . N  . 14 . CA . 14 . C  . 15 . N  1 1 
        13 . 1 1 14 THR C  1 1 15 VAL N  1 1 15 VAL CA 1 1 15 VAL C      -144.81    -104.81 . 14 . C  . 15 . N  . 15 . CA . 15 . C  1 1 
        14 . 1 1 15 VAL N  1 1 15 VAL CA 1 1 15 VAL C  1 1 16 PRO N       112.58     152.58 . 15 . N  . 15 . CA . 15 . C  . 16 . N  1 1 
        15 . 1 1 16 PRO N  1 1 16 PRO CA 1 1 16 PRO C  1 1 17 VAL N    122.22001     162.22 . 16 . N  . 16 . CA . 16 . C  . 17 . N  1 1 
        16 . 1 1 16 PRO C  1 1 17 VAL N  1 1 17 VAL CA 1 1 17 VAL C      -104.73     -64.73 . 16 . C  . 17 . N  . 17 . CA . 17 . C  1 1 
        17 . 1 1 17 VAL N  1 1 17 VAL CA 1 1 17 VAL C  1 1 18 GLY N        -49.6       -9.6 . 17 . N  . 17 . CA . 17 . C  . 18 . N  1 1 
        18 . 1 1 18 GLY C  1 1 19 ALA N  1 1 19 ALA CA 1 1 19 ALA C      -156.18    -116.18 . 18 . C  . 19 . N  . 19 . CA . 19 . C  1 1 
        19 . 1 1 19 ALA N  1 1 19 ALA CA 1 1 19 ALA C  1 1 20 THR N   118.759995     158.76 . 19 . N  . 19 . CA . 19 . C  . 20 . N  1 1 
        20 . 1 1 19 ALA C  1 1 20 THR N  1 1 20 THR CA 1 1 20 THR C      -137.44     -97.44 . 19 . C  . 20 . N  . 20 . CA . 20 . C  1 1 
        21 . 1 1 20 THR N  1 1 20 THR CA 1 1 20 THR C  1 1 21 ILE N       119.58  159.57999 . 20 . N  . 20 . CA . 20 . C  . 21 . N  1 1 
        22 . 1 1 20 THR C  1 1 21 ILE N  1 1 21 ILE CA 1 1 21 ILE C      -144.61    -104.61 . 20 . C  . 21 . N  . 21 . CA . 21 . C  1 1 
        23 . 1 1 21 ILE N  1 1 21 ILE CA 1 1 21 ILE C  1 1 22 HIS N       136.24     176.24 . 21 . N  . 21 . CA . 21 . C  . 22 . N  1 1 
        24 . 1 1 21 ILE C  1 1 22 HIS N  1 1 22 HIS CA 1 1 22 HIS C      -134.27     -94.27 . 21 . C  . 22 . N  . 22 . CA . 22 . C  1 1 
        25 . 1 1 22 HIS N  1 1 22 HIS CA 1 1 22 HIS C  1 1 23 VAL N       138.37     178.37 . 22 . N  . 22 . CA . 22 . C  . 23 . N  1 1 
        26 . 1 1 22 HIS C  1 1 23 VAL N  1 1 23 VAL CA 1 1 23 VAL C       -85.36     -45.36 . 22 . C  . 23 . N  . 23 . CA . 23 . C  1 1 
        27 . 1 1 23 VAL N  1 1 23 VAL CA 1 1 23 VAL C  1 1 24 GLY N       112.54     152.54 . 23 . N  . 23 . CA . 23 . C  . 24 . N  1 1 
        28 . 1 1 26 SER C  1 1 27 PHE N  1 1 27 PHE CA 1 1 27 PHE C      -158.68    -118.68 . 26 . C  . 27 . N  . 27 . CA . 27 . C  1 1 
        29 . 1 1 27 PHE N  1 1 27 PHE CA 1 1 27 PHE C  1 1 28 VAL N       112.39     152.39 . 27 . N  . 27 . CA . 27 . C  . 28 . N  1 1 
        30 . 1 1 27 PHE C  1 1 28 VAL N  1 1 28 VAL CA 1 1 28 VAL C      -124.63     -84.63 . 27 . C  . 28 . N  . 28 . CA . 28 . C  1 1 
        31 . 1 1 28 VAL N  1 1 28 VAL CA 1 1 28 VAL C  1 1 29 PRO N        93.27     133.27 . 28 . N  . 28 . CA . 28 . C  . 29 . N  1 1 
        32 . 1 1 29 PRO N  1 1 29 PRO CA 1 1 29 PRO C  1 1 30 MET N       -49.96  -9.959999 . 29 . N  . 29 . CA . 29 . C  . 30 . N  1 1 
        33 . 1 1 29 PRO C  1 1 30 MET N  1 1 30 MET CA 1 1 30 MET C      -119.55     -79.55 . 29 . C  . 30 . N  . 30 . CA . 30 . C  1 1 
        34 . 1 1 30 MET N  1 1 30 MET CA 1 1 30 MET C  1 1 31 ALA N       -11.65      28.35 . 30 . N  . 30 . CA . 30 . C  . 31 . N  1 1 
        35 . 1 1 32 GLU C  1 1 33 VAL N  1 1 33 VAL CA 1 1 33 VAL C      -124.98     -84.98 . 32 . C  . 33 . N  . 33 . CA . 33 . C  1 1 
        36 . 1 1 33 VAL N  1 1 33 VAL CA 1 1 33 VAL C  1 1 34 LEU N   125.299995      165.3 . 33 . N  . 33 . CA . 33 . C  . 34 . N  1 1 
        37 . 1 1 33 VAL C  1 1 34 LEU N  1 1 34 LEU CA 1 1 34 LEU C      -150.96 -110.95999 . 33 . C  . 34 . N  . 34 . CA . 34 . C  1 1 
        38 . 1 1 34 LEU N  1 1 34 LEU CA 1 1 34 LEU C  1 1 35 ALA N       127.74     167.74 . 34 . N  . 34 . CA . 34 . C  . 35 . N  1 1 
        39 . 1 1 34 LEU C  1 1 35 ALA N  1 1 35 ALA CA 1 1 35 ALA C      -155.72    -115.72 . 34 . C  . 35 . N  . 35 . CA . 35 . C  1 1 
        40 . 1 1 35 ALA N  1 1 35 ALA CA 1 1 35 ALA C  1 1 36 ILE N       123.24     163.24 . 35 . N  . 35 . CA . 35 . C  . 36 . N  1 1 
        41 . 1 1 35 ALA C  1 1 36 ILE N  1 1 36 ILE CA 1 1 36 ILE C      -143.21    -103.21 . 35 . C  . 36 . N  . 36 . CA . 36 . C  1 1 
        42 . 1 1 36 ILE N  1 1 36 ILE CA 1 1 36 ILE C  1 1 37 ASP N       108.78     148.78 . 36 . N  . 36 . CA . 36 . C  . 37 . N  1 1 
        43 . 1 1 36 ILE C  1 1 37 ASP N  1 1 37 ASP CA 1 1 37 ASP C   -135.70999     -95.71 . 36 . C  . 37 . N  . 37 . CA . 37 . C  1 1 
        44 . 1 1 37 ASP N  1 1 37 ASP CA 1 1 37 ASP C  1 1 38 LYS N       109.05     149.05 . 37 . N  . 37 . CA . 37 . C  . 38 . N  1 1 
        45 . 1 1 37 ASP C  1 1 38 LYS N  1 1 38 LYS CA 1 1 38 LYS C    -77.12999     -37.13 . 37 . C  . 38 . N  . 38 . CA . 38 . C  1 1 
        46 . 1 1 38 LYS N  1 1 38 LYS CA 1 1 38 LYS C  1 1 39 GLU N       -59.99     -19.99 . 38 . N  . 38 . CA . 38 . C  . 39 . N  1 1 
        47 . 1 1 38 LYS C  1 1 39 GLU N  1 1 39 GLU CA 1 1 39 GLU C       -82.32     -42.32 . 38 . C  . 39 . N  . 39 . CA . 39 . C  1 1 
        48 . 1 1 39 GLU N  1 1 39 GLU CA 1 1 39 GLU C  1 1 40 ASP N   -53.389996     -13.39 . 39 . N  . 39 . CA . 39 . C  . 40 . N  1 1 
        49 . 1 1 39 GLU C  1 1 40 ASP N  1 1 40 ASP CA 1 1 40 ASP C       -94.81     -54.81 . 39 . C  . 40 . N  . 40 . CA . 40 . C  1 1 
        50 . 1 1 40 ASP N  1 1 40 ASP CA 1 1 40 ASP C  1 1 41 GLY N        -48.5       -8.5 . 40 . N  . 40 . CA . 40 . C  . 41 . N  1 1 
        51 . 1 1 41 GLY C  1 1 42 ASP N  1 1 42 ASP CA 1 1 42 ASP C       -96.35 -56.349995 . 41 . C  . 42 . N  . 42 . CA . 42 . C  1 1 
        52 . 1 1 42 ASP N  1 1 42 ASP CA 1 1 42 ASP C  1 1 43 LEU N        104.9      144.9 . 42 . N  . 42 . CA . 42 . C  . 43 . N  1 1 
        53 . 1 1 43 LEU C  1 1 44 THR N  1 1 44 THR CA 1 1 44 THR C       -79.76 -39.759995 . 43 . C  . 44 . N  . 44 . CA . 44 . C  1 1 
        54 . 1 1 44 THR N  1 1 44 THR CA 1 1 44 THR C  1 1 45 SER N       -53.21     -13.21 . 44 . N  . 44 . CA . 44 . C  . 45 . N  1 1 
        55 . 1 1 44 THR C  1 1 45 SER N  1 1 45 SER CA 1 1 45 SER C       -88.71     -48.71 . 44 . C  . 45 . N  . 45 . CA . 45 . C  1 1 
        56 . 1 1 45 SER N  1 1 45 SER CA 1 1 45 SER C  1 1 46 LYS N       -36.94       3.06 . 45 . N  . 45 . CA . 45 . C  . 46 . N  1 1 
        57 . 1 1 45 SER C  1 1 46 LYS N  1 1 46 LYS CA 1 1 46 LYS C      -117.84     -77.84 . 45 . C  . 46 . N  . 46 . CA . 46 . C  1 1 
        58 . 1 1 46 LYS N  1 1 46 LYS CA 1 1 46 LYS C  1 1 47 ILE N       -20.68      19.32 . 46 . N  . 46 . CA . 46 . C  . 47 . N  1 1 
        59 . 1 1 46 LYS C  1 1 47 ILE N  1 1 47 ILE CA 1 1 47 ILE C      -100.83 -60.829998 . 46 . C  . 47 . N  . 47 . CA . 47 . C  1 1 
        60 . 1 1 47 ILE N  1 1 47 ILE CA 1 1 47 ILE C  1 1 48 LYS N    113.26999     153.27 . 47 . N  . 47 . CA . 47 . C  . 48 . N  1 1 
        61 . 1 1 47 ILE C  1 1 48 LYS N  1 1 48 LYS CA 1 1 48 LYS C   -125.16999     -85.17 . 47 . C  . 48 . N  . 48 . CA . 48 . C  1 1 
        62 . 1 1 48 LYS N  1 1 48 LYS CA 1 1 48 LYS C  1 1 49 VAL N       110.75     150.75 . 48 . N  . 48 . CA . 48 . C  . 49 . N  1 1 
        63 . 1 1 48 LYS C  1 1 49 VAL N  1 1 49 VAL CA 1 1 49 VAL C      -136.55     -96.55 . 48 . C  . 49 . N  . 49 . CA . 49 . C  1 1 
        64 . 1 1 49 VAL N  1 1 49 VAL CA 1 1 49 VAL C  1 1 50 ASP N       106.08     146.08 . 49 . N  . 49 . CA . 49 . C  . 50 . N  1 1 
        65 . 1 1 49 VAL C  1 1 50 ASP N  1 1 50 ASP CA 1 1 50 ASP C      -140.45    -100.45 . 49 . C  . 50 . N  . 50 . CA . 50 . C  1 1 
        66 . 1 1 50 ASP N  1 1 50 ASP CA 1 1 50 ASP C  1 1 51 GLY N   118.509995     158.51 . 50 . N  . 50 . CA . 50 . C  . 51 . N  1 1 
        67 . 1 1 51 GLY C  1 1 52 GLU N  1 1 52 GLU CA 1 1 52 GLU C      -167.76    -127.76 . 51 . C  . 52 . N  . 52 . CA . 52 . C  1 1 
        68 . 1 1 52 GLU N  1 1 52 GLU CA 1 1 52 GLU C  1 1 53 VAL N        131.0      171.0 . 52 . N  . 52 . CA . 52 . C  . 53 . N  1 1 
        69 . 1 1 52 GLU C  1 1 53 VAL N  1 1 53 VAL CA 1 1 53 VAL C      -125.93     -85.93 . 52 . C  . 53 . N  . 53 . CA . 53 . C  1 1 
        70 . 1 1 53 VAL N  1 1 53 VAL CA 1 1 53 VAL C  1 1 54 ASP N        112.0      152.0 . 53 . N  . 53 . CA . 53 . C  . 54 . N  1 1 
        71 . 1 1 53 VAL C  1 1 54 ASP N  1 1 54 ASP CA 1 1 54 ASP C      -109.19     -69.19 . 53 . C  . 54 . N  . 54 . CA . 54 . C  1 1 
        72 . 1 1 54 ASP N  1 1 54 ASP CA 1 1 54 ASP C  1 1 55 THR N       137.58     177.58 . 54 . N  . 54 . CA . 54 . C  . 55 . N  1 1 
        73 . 1 1 55 THR C  1 1 56 THR N  1 1 56 THR CA 1 1 56 THR C      -115.28     -75.28 . 55 . C  . 56 . N  . 56 . CA . 56 . C  1 1 
        74 . 1 1 56 THR N  1 1 56 THR CA 1 1 56 THR C  1 1 57 LYS N       -27.35      12.65 . 56 . N  . 56 . CA . 56 . C  . 57 . N  1 1 
        75 . 1 1 56 THR C  1 1 57 LYS N  1 1 57 LYS CA 1 1 57 LYS C      -143.77    -103.77 . 56 . C  . 57 . N  . 57 . CA . 57 . C  1 1 
        76 . 1 1 57 LYS N  1 1 57 LYS CA 1 1 57 LYS C  1 1 58 ALA N    121.33999     161.34 . 57 . N  . 57 . CA . 57 . C  . 58 . N  1 1 
        77 . 1 1 57 LYS C  1 1 58 ALA N  1 1 58 ALA CA 1 1 58 ALA C   -110.38999     -70.39 . 57 . C  . 58 . N  . 58 . CA . 58 . C  1 1 
        78 . 1 1 58 ALA N  1 1 58 ALA CA 1 1 58 ALA C  1 1 59 GLY N       103.78     143.78 . 58 . N  . 58 . CA . 58 . C  . 59 . N  1 1 
        79 . 1 1 59 GLY C  1 1 60 THR N  1 1 60 THR CA 1 1 60 THR C  -123.299995      -83.3 . 59 . C  . 60 . N  . 60 . CA . 60 . C  1 1 
        80 . 1 1 60 THR N  1 1 60 THR CA 1 1 60 THR C  1 1 61 TYR N       123.43     163.43 . 60 . N  . 60 . CA . 60 . C  . 61 . N  1 1 
        81 . 1 1 60 THR C  1 1 61 TYR N  1 1 61 TYR CA 1 1 61 TYR C      -138.48     -98.48 . 60 . C  . 61 . N  . 61 . CA . 61 . C  1 1 
        82 . 1 1 61 TYR N  1 1 61 TYR CA 1 1 61 TYR C  1 1 62 VAL N       109.98     149.98 . 61 . N  . 61 . CA . 61 . C  . 62 . N  1 1 
        83 . 1 1 61 TYR C  1 1 62 VAL N  1 1 62 VAL CA 1 1 62 VAL C      -129.65     -89.65 . 61 . C  . 62 . N  . 62 . CA . 62 . C  1 1 
        84 . 1 1 62 VAL N  1 1 62 VAL CA 1 1 62 VAL C  1 1 63 LEU N       102.27     142.27 . 62 . N  . 62 . CA . 62 . C  . 63 . N  1 1 
        85 . 1 1 62 VAL C  1 1 63 LEU N  1 1 63 LEU CA 1 1 63 LEU C   -128.89998      -88.9 . 62 . C  . 63 . N  . 63 . CA . 63 . C  1 1 
        86 . 1 1 63 LEU N  1 1 63 LEU CA 1 1 63 LEU C  1 1 64 THR N       113.87     153.87 . 63 . N  . 63 . CA . 63 . C  . 64 . N  1 1 
        87 . 1 1 63 LEU C  1 1 64 THR N  1 1 64 THR CA 1 1 64 THR C      -130.02     -90.02 . 63 . C  . 64 . N  . 64 . CA . 64 . C  1 1 
        88 . 1 1 64 THR N  1 1 64 THR CA 1 1 64 THR C  1 1 65 TYR N       104.95     144.95 . 64 . N  . 64 . CA . 64 . C  . 65 . N  1 1 
        89 . 1 1 64 THR C  1 1 65 TYR N  1 1 65 TYR CA 1 1 65 TYR C      -134.59  -94.58999 . 64 . C  . 65 . N  . 65 . CA . 65 . C  1 1 
        90 . 1 1 65 TYR N  1 1 65 TYR CA 1 1 65 TYR C  1 1 66 THR N       114.04     154.04 . 65 . N  . 65 . CA . 65 . C  . 66 . N  1 1 
        91 . 1 1 65 TYR C  1 1 66 THR N  1 1 66 THR CA 1 1 66 THR C   -146.02998    -106.03 . 65 . C  . 66 . N  . 66 . CA . 66 . C  1 1 
        92 . 1 1 66 THR N  1 1 66 THR CA 1 1 66 THR C  1 1 67 VAL N       123.25     163.25 . 66 . N  . 66 . CA . 66 . C  . 67 . N  1 1 
        93 . 1 1 66 THR C  1 1 67 VAL N  1 1 67 VAL CA 1 1 67 VAL C      -150.03    -110.03 . 66 . C  . 67 . N  . 67 . CA . 67 . C  1 1 
        94 . 1 1 67 VAL N  1 1 67 VAL CA 1 1 67 VAL C  1 1 68 THR N    119.05999     159.06 . 67 . N  . 67 . CA . 67 . C  . 68 . N  1 1 
        95 . 1 1 67 VAL C  1 1 68 THR N  1 1 68 THR CA 1 1 68 THR C       -132.9      -92.9 . 67 . C  . 68 . N  . 68 . CA . 68 . C  1 1 
        96 . 1 1 68 THR N  1 1 68 THR CA 1 1 68 THR C  1 1 69 ASP N       105.38     145.38 . 68 . N  . 68 . CA . 68 . C  . 69 . N  1 1 
        97 . 1 1 68 THR C  1 1 69 ASP N  1 1 69 ASP CA 1 1 69 ASP C      -114.12     -74.12 . 68 . C  . 69 . N  . 69 . CA . 69 . C  1 1 
        98 . 1 1 69 ASP N  1 1 69 ASP CA 1 1 69 ASP C  1 1 70 SER N       151.66     191.66 . 69 . N  . 69 . CA . 69 . C  . 70 . N  1 1 
        99 . 1 1 69 ASP C  1 1 70 SER N  1 1 70 SER CA 1 1 70 SER C       -81.62 -41.619995 . 69 . C  . 70 . N  . 70 . CA . 70 . C  1 1 
       100 . 1 1 70 SER N  1 1 70 SER CA 1 1 70 SER C  1 1 71 LYS N       -39.99       0.01 . 70 . N  . 70 . CA . 70 . C  . 71 . N  1 1 
       101 . 1 1 70 SER C  1 1 71 LYS N  1 1 71 LYS CA 1 1 71 LYS C      -107.77     -67.77 . 70 . C  . 71 . N  . 71 . CA . 71 . C  1 1 
       102 . 1 1 71 LYS N  1 1 71 LYS CA 1 1 71 LYS C  1 1 72 GLY N       -13.14      26.86 . 71 . N  . 71 . CA . 71 . C  . 72 . N  1 1 
       103 . 1 1 71 LYS C  1 1 72 GLY N  1 1 72 GLY CA 1 1 72 GLY C        71.98     111.98 . 71 . C  . 72 . N  . 72 . CA . 72 . C  1 1 
       104 . 1 1 72 GLY N  1 1 72 GLY CA 1 1 72 GLY C  1 1 73 HIS N        -5.31      34.69 . 72 . N  . 72 . CA . 72 . C  . 73 . N  1 1 
       105 . 1 1 72 GLY C  1 1 73 HIS N  1 1 73 HIS CA 1 1 73 HIS C      -108.78     -68.78 . 72 . C  . 73 . N  . 73 . CA . 73 . C  1 1 
       106 . 1 1 73 HIS N  1 1 73 HIS CA 1 1 73 HIS C  1 1 74 GLU N        97.85     137.85 . 73 . N  . 73 . CA . 73 . C  . 74 . N  1 1 
       107 . 1 1 73 HIS C  1 1 74 GLU N  1 1 74 GLU CA 1 1 74 GLU C      -133.55     -93.55 . 73 . C  . 74 . N  . 74 . CA . 74 . C  1 1 
       108 . 1 1 74 GLU N  1 1 74 GLU CA 1 1 74 GLU C  1 1 75 VAL N       106.07     146.07 . 74 . N  . 74 . CA . 74 . C  . 75 . N  1 1 
       109 . 1 1 74 GLU C  1 1 75 VAL N  1 1 75 VAL CA 1 1 75 VAL C      -143.07    -103.07 . 74 . C  . 75 . N  . 75 . CA . 75 . C  1 1 
       110 . 1 1 75 VAL N  1 1 75 VAL CA 1 1 75 VAL C  1 1 76 THR N       129.59     169.59 . 75 . N  . 75 . CA . 75 . C  . 76 . N  1 1 
       111 . 1 1 75 VAL C  1 1 76 THR N  1 1 76 THR CA 1 1 76 THR C      -152.28    -112.28 . 75 . C  . 76 . N  . 76 . CA . 76 . C  1 1 
       112 . 1 1 76 THR N  1 1 76 THR CA 1 1 76 THR C  1 1 77 ALA N       129.64     169.64 . 76 . N  . 76 . CA . 76 . C  . 77 . N  1 1 
       113 . 1 1 76 THR C  1 1 77 ALA N  1 1 77 ALA CA 1 1 77 ALA C       -147.8     -107.8 . 76 . C  . 77 . N  . 77 . CA . 77 . C  1 1 
       114 . 1 1 77 ALA N  1 1 77 ALA CA 1 1 77 ALA C  1 1 78 LYS N       121.21     161.21 . 77 . N  . 77 . CA . 77 . C  . 78 . N  1 1 
       115 . 1 1 77 ALA C  1 1 78 LYS N  1 1 78 LYS CA 1 1 78 LYS C      -145.28    -105.28 . 77 . C  . 78 . N  . 78 . CA . 78 . C  1 1 
       116 . 1 1 78 LYS N  1 1 78 LYS CA 1 1 78 LYS C  1 1 79 GLN N       124.88     164.88 . 78 . N  . 78 . CA . 78 . C  . 79 . N  1 1 
       117 . 1 1 78 LYS C  1 1 79 GLN N  1 1 79 GLN CA 1 1 79 GLN C      -171.03    -131.03 . 78 . C  . 79 . N  . 79 . CA . 79 . C  1 1 
       118 . 1 1 79 GLN N  1 1 79 GLN CA 1 1 79 GLN C  1 1 80 THR N       118.29     158.29 . 79 . N  . 79 . CA . 79 . C  . 80 . N  1 1 
       119 . 1 1 79 GLN C  1 1 80 THR N  1 1 80 THR CA 1 1 80 THR C   -118.99999      -79.0 . 79 . C  . 80 . N  . 80 . CA . 80 . C  1 1 
       120 . 1 1 80 THR N  1 1 80 THR CA 1 1 80 THR C  1 1 81 VAL N       104.67     144.67 . 80 . N  . 80 . CA . 80 . C  . 81 . N  1 1 
       121 . 1 1 80 THR C  1 1 81 VAL N  1 1 81 VAL CA 1 1 81 VAL C      -137.09     -97.09 . 80 . C  . 81 . N  . 81 . CA . 81 . C  1 1 
       122 . 1 1 81 VAL N  1 1 81 VAL CA 1 1 81 VAL C  1 1 82 THR N       100.76     140.76 . 81 . N  . 81 . CA . 81 . C  . 82 . N  1 1 
       123 . 1 1 81 VAL C  1 1 82 THR N  1 1 82 THR CA 1 1 82 THR C      -134.82     -94.82 . 81 . C  . 82 . N  . 82 . CA . 82 . C  1 1 
       124 . 1 1 82 THR N  1 1 82 THR CA 1 1 82 THR C  1 1 83 VAL N       101.23     141.23 . 82 . N  . 82 . CA . 82 . C  . 83 . N  1 1 
       125 . 1 1 82 THR C  1 1 83 VAL N  1 1 83 VAL CA 1 1 83 VAL C      -133.32     -93.32 . 82 . C  . 83 . N  . 83 . CA . 83 . C  1 1 
       126 . 1 1 83 VAL N  1 1 83 VAL CA 1 1 83 VAL C  1 1 84 LYS N       101.59     141.59 . 83 . N  . 83 . CA . 83 . C  . 84 . N  1 1 
       127 . 1 1 83 VAL C  1 1 84 LYS N  1 1 84 LYS CA 1 1 84 LYS C      -143.45    -103.45 . 83 . C  . 84 . N  . 84 . CA . 84 . C  1 1 
       128 . 1 1 84 LYS N  1 1 84 LYS CA 1 1 84 LYS C  1 1 85 VAL N       135.41  175.40999 . 84 . N  . 84 . CA . 84 . C  . 85 . N  1 1 
       129 . 1 1 84 LYS C  1 1 85 VAL N  1 1 85 VAL CA 1 1 85 VAL C      -105.37 -65.369995 . 84 . C  . 85 . N  . 85 . CA . 85 . C  1 1 
       130 . 1 1 85 VAL N  1 1 85 VAL CA 1 1 85 VAL C  1 1 86 ARG N    122.26999     162.27 . 85 . N  . 85 . CA . 85 . C  . 86 . N  1 1 
       131 . 1 1 40 ASP N  1 1 40 ASP CA 1 1 40 ASP CB 1 1 40 ASP CG       160.0      200.0 . 40 . N  . 40 . CA . 40 . CB . 40 . CG 1 1 
       132 . 1 1 38 LYS CA 1 1 38 LYS CB 1 1 38 LYS CG 1 1 38 LYS CD       160.0      200.0 . 38 . CA . 38 . CB . 38 . CG . 38 . CD 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1  1 MET C    C  -34.835   0.702  15.845 1.00 . A A . 657 MET C    1 1 
        1     2 1 1  1 MET CA   C  -35.374   2.128  15.675 1.00 . A A . 657 MET CA   1 1 
        1     3 1 1  1 MET CB   C  -34.337   3.155  16.160 1.00 . A A . 657 MET CB   1 1 
        1     4 1 1  1 MET CE   C  -35.644   4.839  18.633 1.00 . A A . 657 MET CE   1 1 
        1     5 1 1  1 MET CG   C  -34.786   4.602  15.995 1.00 . A A . 657 MET CG   1 1 
        1     6 1 1  1 MET H1   H  -37.376   1.642  16.050 1.00 . A A . 657 MET H1   1 1 
        1     7 1 1  1 MET H2   H  -37.009   3.272  16.324 1.00 . A A . 657 MET H2   1 1 
        1     8 1 1  1 MET H3   H  -36.512   2.091  17.430 1.00 . A A . 657 MET H3   1 1 
        1     9 1 1  1 MET HA   H  -35.574   2.296  14.626 1.00 . A A . 657 MET HA   1 1 
        1    10 1 1  1 MET HB2  H  -34.134   2.981  17.207 1.00 . A A . 657 MET HB2  1 1 
        1    11 1 1  1 MET HB3  H  -33.423   3.019  15.599 1.00 . A A . 657 MET HB3  1 1 
        1    12 1 1  1 MET HE1  H  -36.442   5.045  19.331 1.00 . A A . 657 MET HE1  1 1 
        1    13 1 1  1 MET HE2  H  -34.841   5.543  18.786 1.00 . A A . 657 MET HE2  1 1 
        1    14 1 1  1 MET HE3  H  -35.278   3.836  18.792 1.00 . A A . 657 MET HE3  1 1 
        1    15 1 1  1 MET HG2  H  -33.986   5.253  16.316 1.00 . A A . 657 MET HG2  1 1 
        1    16 1 1  1 MET HG3  H  -34.996   4.782  14.950 1.00 . A A . 657 MET HG3  1 1 
        1    17 1 1  1 MET N    N  -36.655   2.297  16.421 1.00 . A A . 657 MET N    1 1 
        1    18 1 1  1 MET O    O  -35.458  -0.122  16.511 1.00 . A A . 657 MET O    1 1 
        1    19 1 1  1 MET SD   S  -36.264   4.989  16.957 1.00 . A A . 657 MET SD   1 1 
        1    20 1 1  2 GLY C    C  -32.091  -1.257  14.264 1.00 . A A . 658 GLY C    1 1 
        1    21 1 1  2 GLY CA   C  -33.102  -0.930  15.363 1.00 . A A . 658 GLY CA   1 1 
        1    22 1 1  2 GLY H    H  -33.233   1.086  14.699 1.00 . A A . 658 GLY H    1 1 
        1    23 1 1  2 GLY HA2  H  -32.606  -1.001  16.319 1.00 . A A . 658 GLY HA2  1 1 
        1    24 1 1  2 GLY HA3  H  -33.897  -1.662  15.332 1.00 . A A . 658 GLY HA3  1 1 
        1    25 1 1  2 GLY N    N  -33.687   0.403  15.238 1.00 . A A . 658 GLY N    1 1 
        1    26 1 1  2 GLY O    O  -31.853  -0.448  13.361 1.00 . A A . 658 GLY O    1 1 
        1    27 1 1  3 ASN C    C  -30.758  -4.310  12.868 1.00 . A A . 659 ASN C    1 1 
        1    28 1 1  3 ASN CA   C  -30.485  -2.883  13.363 1.00 . A A . 659 ASN CA   1 1 
        1    29 1 1  3 ASN CB   C  -29.086  -2.824  13.991 1.00 . A A . 659 ASN CB   1 1 
        1    30 1 1  3 ASN CG   C  -28.727  -1.437  14.488 1.00 . A A . 659 ASN CG   1 1 
        1    31 1 1  3 ASN H    H  -31.738  -3.054  15.071 1.00 . A A . 659 ASN H    1 1 
        1    32 1 1  3 ASN HA   H  -30.519  -2.209  12.517 1.00 . A A . 659 ASN HA   1 1 
        1    33 1 1  3 ASN HB2  H  -29.042  -3.508  14.828 1.00 . A A . 659 ASN HB2  1 1 
        1    34 1 1  3 ASN HB3  H  -28.354  -3.122  13.254 1.00 . A A . 659 ASN HB3  1 1 
        1    35 1 1  3 ASN HD21 H  -29.408  -1.867  16.297 1.00 . A A . 659 ASN HD21 1 1 
        1    36 1 1  3 ASN HD22 H  -28.756  -0.280  16.091 1.00 . A A . 659 ASN HD22 1 1 
        1    37 1 1  3 ASN N    N  -31.495  -2.448  14.338 1.00 . A A . 659 ASN N    1 1 
        1    38 1 1  3 ASN ND2  N  -28.993  -1.166  15.749 1.00 . A A . 659 ASN ND2  1 1 
        1    39 1 1  3 ASN O    O  -31.403  -5.105  13.552 1.00 . A A . 659 ASN O    1 1 
        1    40 1 1  3 ASN OD1  O  -28.211  -0.613  13.743 1.00 . A A . 659 ASN OD1  1 1 
        1    41 1 1  4 GLY C    C  -28.997  -6.628  10.933 1.00 . A A . 660 GLY C    1 1 
        1    42 1 1  4 GLY CA   C  -30.364  -5.982  11.142 1.00 . A A . 660 GLY CA   1 1 
        1    43 1 1  4 GLY H    H  -29.812  -3.932  11.149 1.00 . A A . 660 GLY H    1 1 
        1    44 1 1  4 GLY HA2  H  -30.941  -6.593  11.823 1.00 . A A . 660 GLY HA2  1 1 
        1    45 1 1  4 GLY HA3  H  -30.878  -5.940  10.193 1.00 . A A . 660 GLY HA3  1 1 
        1    46 1 1  4 GLY N    N  -30.257  -4.627  11.678 1.00 . A A . 660 GLY N    1 1 
        1    47 1 1  4 GLY O    O  -28.080  -5.991  10.405 1.00 . A A . 660 GLY O    1 1 
        1    48 1 1  5 GLU C    C  -27.247  -8.922   9.747 1.00 . A A . 661 GLU C    1 1 
        1    49 1 1  5 GLU CA   C  -27.572  -8.597  11.210 1.00 . A A . 661 GLU CA   1 1 
        1    50 1 1  5 GLU CB   C  -27.568  -9.893  12.036 1.00 . A A . 661 GLU CB   1 1 
        1    51 1 1  5 GLU CD   C  -27.449 -10.971  14.321 1.00 . A A . 661 GLU CD   1 1 
        1    52 1 1  5 GLU CG   C  -27.639  -9.678  13.543 1.00 . A A . 661 GLU CG   1 1 
        1    53 1 1  5 GLU H    H  -29.618  -8.356  11.735 1.00 . A A . 661 GLU H    1 1 
        1    54 1 1  5 GLU HA   H  -26.798  -7.945  11.592 1.00 . A A . 661 GLU HA   1 1 
        1    55 1 1  5 GLU HB2  H  -28.417 -10.493  11.740 1.00 . A A . 661 GLU HB2  1 1 
        1    56 1 1  5 GLU HB3  H  -26.662 -10.441  11.816 1.00 . A A . 661 GLU HB3  1 1 
        1    57 1 1  5 GLU HG2  H  -26.862  -8.984  13.833 1.00 . A A . 661 GLU HG2  1 1 
        1    58 1 1  5 GLU HG3  H  -28.605  -9.259  13.791 1.00 . A A . 661 GLU HG3  1 1 
        1    59 1 1  5 GLU N    N  -28.850  -7.888  11.343 1.00 . A A . 661 GLU N    1 1 
        1    60 1 1  5 GLU O    O  -27.528 -10.017   9.261 1.00 . A A . 661 GLU O    1 1 
        1    61 1 1  5 GLU OE1  O  -26.287 -11.324  14.624 1.00 . A A . 661 GLU OE1  1 1 
        1    62 1 1  5 GLU OE2  O  -28.453 -11.649  14.623 1.00 . A A . 661 GLU OE2  1 1 
        1    63 1 1  6 THR C    C  -24.719  -8.577   7.670 1.00 . A A . 662 THR C    1 1 
        1    64 1 1  6 THR CA   C  -26.197  -8.171   7.673 1.00 . A A . 662 THR CA   1 1 
        1    65 1 1  6 THR CB   C  -26.378  -6.908   6.796 1.00 . A A . 662 THR CB   1 1 
        1    66 1 1  6 THR CG2  C  -27.847  -6.505   6.716 1.00 . A A . 662 THR CG2  1 1 
        1    67 1 1  6 THR H    H  -26.585  -7.064   9.447 1.00 . A A . 662 THR H    1 1 
        1    68 1 1  6 THR HA   H  -26.781  -8.973   7.238 1.00 . A A . 662 THR HA   1 1 
        1    69 1 1  6 THR HB   H  -26.030  -7.131   5.796 1.00 . A A . 662 THR HB   1 1 
        1    70 1 1  6 THR HG1  H  -24.704  -6.099   7.493 1.00 . A A . 662 THR HG1  1 1 
        1    71 1 1  6 THR HG21 H  -28.216  -6.291   7.709 1.00 . A A . 662 THR HG21 1 1 
        1    72 1 1  6 THR HG22 H  -28.423  -7.313   6.285 1.00 . A A . 662 THR HG22 1 1 
        1    73 1 1  6 THR HG23 H  -27.945  -5.623   6.099 1.00 . A A . 662 THR HG23 1 1 
        1    74 1 1  6 THR N    N  -26.675  -7.954   9.043 1.00 . A A . 662 THR N    1 1 
        1    75 1 1  6 THR O    O  -23.895  -7.945   8.333 1.00 . A A . 662 THR O    1 1 
        1    76 1 1  6 THR OG1  O  -25.609  -5.811   7.323 1.00 . A A . 662 THR OG1  1 1 
        1    77 1 1  7 SER C    C  -22.059  -9.142   6.208 1.00 . A A . 663 SER C    1 1 
        1    78 1 1  7 SER CA   C  -23.011 -10.147   6.876 1.00 . A A . 663 SER CA   1 1 
        1    79 1 1  7 SER CB   C  -22.966 -11.485   6.117 1.00 . A A . 663 SER CB   1 1 
        1    80 1 1  7 SER H    H  -25.086 -10.093   6.420 1.00 . A A . 663 SER H    1 1 
        1    81 1 1  7 SER HA   H  -22.680 -10.314   7.891 1.00 . A A . 663 SER HA   1 1 
        1    82 1 1  7 SER HB2  H  -23.315 -11.335   5.105 1.00 . A A . 663 SER HB2  1 1 
        1    83 1 1  7 SER HB3  H  -21.950 -11.853   6.096 1.00 . A A . 663 SER HB3  1 1 
        1    84 1 1  7 SER HG   H  -23.620 -13.326   6.336 1.00 . A A . 663 SER HG   1 1 
        1    85 1 1  7 SER N    N  -24.388  -9.636   6.936 1.00 . A A . 663 SER N    1 1 
        1    86 1 1  7 SER O    O  -21.937  -9.116   4.983 1.00 . A A . 663 SER O    1 1 
        1    87 1 1  7 SER OG   O  -23.790 -12.464   6.739 1.00 . A A . 663 SER OG   1 1 
        1    88 1 1  8 ASP C    C  -19.140  -8.029   6.032 1.00 . A A . 664 ASP C    1 1 
        1    89 1 1  8 ASP CA   C  -20.431  -7.337   6.484 1.00 . A A . 664 ASP CA   1 1 
        1    90 1 1  8 ASP CB   C  -20.096  -6.265   7.533 1.00 . A A . 664 ASP CB   1 1 
        1    91 1 1  8 ASP CG   C  -19.087  -5.243   7.011 1.00 . A A . 664 ASP CG   1 1 
        1    92 1 1  8 ASP H    H  -21.555  -8.347   7.976 1.00 . A A . 664 ASP H    1 1 
        1    93 1 1  8 ASP HA   H  -20.885  -6.859   5.630 1.00 . A A . 664 ASP HA   1 1 
        1    94 1 1  8 ASP HB2  H  -21.003  -5.746   7.809 1.00 . A A . 664 ASP HB2  1 1 
        1    95 1 1  8 ASP HB3  H  -19.681  -6.744   8.408 1.00 . A A . 664 ASP HB3  1 1 
        1    96 1 1  8 ASP N    N  -21.393  -8.311   7.013 1.00 . A A . 664 ASP N    1 1 
        1    97 1 1  8 ASP O    O  -18.496  -8.742   6.804 1.00 . A A . 664 ASP O    1 1 
        1    98 1 1  8 ASP OD1  O  -17.872  -5.516   7.036 1.00 . A A . 664 ASP OD1  1 1 
        1    99 1 1  8 ASP OD2  O  -19.492  -4.163   6.550 1.00 . A A . 664 ASP OD2  1 1 
        1   100 1 1  9 LEU C    C  -16.353  -7.397   4.657 1.00 . A A . 665 LEU C    1 1 
        1   101 1 1  9 LEU CA   C  -17.511  -8.315   4.249 1.00 . A A . 665 LEU CA   1 1 
        1   102 1 1  9 LEU CB   C  -17.587  -8.427   2.722 1.00 . A A . 665 LEU CB   1 1 
        1   103 1 1  9 LEU CD1  C  -18.703  -9.364   0.660 1.00 . A A . 665 LEU CD1  1 1 
        1   104 1 1  9 LEU CD2  C  -18.551 -10.759   2.742 1.00 . A A . 665 LEU CD2  1 1 
        1   105 1 1  9 LEU CG   C  -18.701  -9.344   2.186 1.00 . A A . 665 LEU CG   1 1 
        1   106 1 1  9 LEU H    H  -19.366  -7.299   4.191 1.00 . A A . 665 LEU H    1 1 
        1   107 1 1  9 LEU HA   H  -17.344  -9.298   4.665 1.00 . A A . 665 LEU HA   1 1 
        1   108 1 1  9 LEU HB2  H  -17.741  -7.434   2.319 1.00 . A A . 665 LEU HB2  1 1 
        1   109 1 1  9 LEU HB3  H  -16.639  -8.799   2.362 1.00 . A A . 665 LEU HB3  1 1 
        1   110 1 1  9 LEU HD11 H  -19.520  -9.979   0.308 1.00 . A A . 665 LEU HD11 1 1 
        1   111 1 1  9 LEU HD12 H  -17.768  -9.771   0.302 1.00 . A A . 665 LEU HD12 1 1 
        1   112 1 1  9 LEU HD13 H  -18.825  -8.358   0.286 1.00 . A A . 665 LEU HD13 1 1 
        1   113 1 1  9 LEU HD21 H  -19.332 -11.388   2.343 1.00 . A A . 665 LEU HD21 1 1 
        1   114 1 1  9 LEU HD22 H  -18.627 -10.733   3.820 1.00 . A A . 665 LEU HD22 1 1 
        1   115 1 1  9 LEU HD23 H  -17.587 -11.159   2.459 1.00 . A A . 665 LEU HD23 1 1 
        1   116 1 1  9 LEU HG   H  -19.658  -8.960   2.510 1.00 . A A . 665 LEU HG   1 1 
        1   117 1 1  9 LEU N    N  -18.772  -7.811   4.780 1.00 . A A . 665 LEU N    1 1 
        1   118 1 1  9 LEU O    O  -16.474  -6.168   4.619 1.00 . A A . 665 LEU O    1 1 
        1   119 1 1 10 GLU C    C  -13.403  -6.618   4.184 1.00 . A A . 666 GLU C    1 1 
        1   120 1 1 10 GLU CA   C  -14.050  -7.235   5.435 1.00 . A A . 666 GLU CA   1 1 
        1   121 1 1 10 GLU CB   C  -13.034  -8.101   6.219 1.00 . A A . 666 GLU CB   1 1 
        1   122 1 1 10 GLU CD   C  -14.137 -10.390   6.419 1.00 . A A . 666 GLU CD   1 1 
        1   123 1 1 10 GLU CG   C  -12.985  -9.578   5.828 1.00 . A A . 666 GLU CG   1 1 
        1   124 1 1 10 GLU H    H  -15.227  -8.972   5.120 1.00 . A A . 666 GLU H    1 1 
        1   125 1 1 10 GLU HA   H  -14.375  -6.426   6.076 1.00 . A A . 666 GLU HA   1 1 
        1   126 1 1 10 GLU HB2  H  -12.047  -7.687   6.074 1.00 . A A . 666 GLU HB2  1 1 
        1   127 1 1 10 GLU HB3  H  -13.277  -8.042   7.271 1.00 . A A . 666 GLU HB3  1 1 
        1   128 1 1 10 GLU HG2  H  -13.024  -9.654   4.751 1.00 . A A . 666 GLU HG2  1 1 
        1   129 1 1 10 GLU HG3  H  -12.053  -9.997   6.179 1.00 . A A . 666 GLU HG3  1 1 
        1   130 1 1 10 GLU N    N  -15.245  -7.997   5.073 1.00 . A A . 666 GLU N    1 1 
        1   131 1 1 10 GLU O    O  -13.343  -7.254   3.129 1.00 . A A . 666 GLU O    1 1 
        1   132 1 1 10 GLU OE1  O  -14.163 -10.588   7.651 1.00 . A A . 666 GLU OE1  1 1 
        1   133 1 1 10 GLU OE2  O  -15.034 -10.812   5.655 1.00 . A A . 666 GLU OE2  1 1 
        1   134 1 1 11 PRO C    C  -11.336  -5.308   2.319 1.00 . A A . 667 PRO C    1 1 
        1   135 1 1 11 PRO CA   C  -12.431  -4.595   3.129 1.00 . A A . 667 PRO CA   1 1 
        1   136 1 1 11 PRO CB   C  -11.884  -3.296   3.749 1.00 . A A . 667 PRO CB   1 1 
        1   137 1 1 11 PRO CD   C  -12.733  -4.622   5.551 1.00 . A A . 667 PRO CD   1 1 
        1   138 1 1 11 PRO CG   C  -11.688  -3.601   5.200 1.00 . A A . 667 PRO CG   1 1 
        1   139 1 1 11 PRO HA   H  -13.256  -4.353   2.469 1.00 . A A . 667 PRO HA   1 1 
        1   140 1 1 11 PRO HB2  H  -10.951  -3.026   3.272 1.00 . A A . 667 PRO HB2  1 1 
        1   141 1 1 11 PRO HB3  H  -12.602  -2.499   3.610 1.00 . A A . 667 PRO HB3  1 1 
        1   142 1 1 11 PRO HD2  H  -12.378  -5.270   6.341 1.00 . A A . 667 PRO HD2  1 1 
        1   143 1 1 11 PRO HD3  H  -13.655  -4.141   5.842 1.00 . A A . 667 PRO HD3  1 1 
        1   144 1 1 11 PRO HG2  H  -10.698  -4.006   5.362 1.00 . A A . 667 PRO HG2  1 1 
        1   145 1 1 11 PRO HG3  H  -11.827  -2.704   5.787 1.00 . A A . 667 PRO HG3  1 1 
        1   146 1 1 11 PRO N    N  -12.903  -5.369   4.293 1.00 . A A . 667 PRO N    1 1 
        1   147 1 1 11 PRO O    O  -10.392  -5.867   2.878 1.00 . A A . 667 PRO O    1 1 
        1   148 1 1 12 LYS C    C   -9.320  -4.848  -0.123 1.00 . A A . 668 LYS C    1 1 
        1   149 1 1 12 LYS CA   C  -10.468  -5.839   0.098 1.00 . A A . 668 LYS CA   1 1 
        1   150 1 1 12 LYS CB   C  -11.100  -6.222  -1.250 1.00 . A A . 668 LYS CB   1 1 
        1   151 1 1 12 LYS CD   C   -9.381  -8.002  -1.808 1.00 . A A . 668 LYS CD   1 1 
        1   152 1 1 12 LYS CE   C   -8.300  -8.456  -2.784 1.00 . A A . 668 LYS CE   1 1 
        1   153 1 1 12 LYS CG   C  -10.094  -6.736  -2.284 1.00 . A A . 668 LYS CG   1 1 
        1   154 1 1 12 LYS H    H  -12.263  -4.847   0.610 1.00 . A A . 668 LYS H    1 1 
        1   155 1 1 12 LYS HA   H  -10.072  -6.733   0.565 1.00 . A A . 668 LYS HA   1 1 
        1   156 1 1 12 LYS HB2  H  -11.837  -6.995  -1.081 1.00 . A A . 668 LYS HB2  1 1 
        1   157 1 1 12 LYS HB3  H  -11.594  -5.353  -1.662 1.00 . A A . 668 LYS HB3  1 1 
        1   158 1 1 12 LYS HD2  H   -8.921  -7.805  -0.849 1.00 . A A . 668 LYS HD2  1 1 
        1   159 1 1 12 LYS HD3  H  -10.109  -8.794  -1.700 1.00 . A A . 668 LYS HD3  1 1 
        1   160 1 1 12 LYS HE2  H   -7.914  -9.409  -2.455 1.00 . A A . 668 LYS HE2  1 1 
        1   161 1 1 12 LYS HE3  H   -8.741  -8.568  -3.764 1.00 . A A . 668 LYS HE3  1 1 
        1   162 1 1 12 LYS HG2  H  -10.621  -6.956  -3.202 1.00 . A A . 668 LYS HG2  1 1 
        1   163 1 1 12 LYS HG3  H   -9.358  -5.965  -2.469 1.00 . A A . 668 LYS HG3  1 1 
        1   164 1 1 12 LYS HZ1  H   -6.764  -7.320  -1.926 1.00 . A A . 668 LYS HZ1  1 1 
        1   165 1 1 12 LYS HZ2  H   -7.501  -6.578  -3.260 1.00 . A A . 668 LYS HZ2  1 1 
        1   166 1 1 12 LYS HZ3  H   -6.428  -7.862  -3.492 1.00 . A A . 668 LYS HZ3  1 1 
        1   167 1 1 12 LYS N    N  -11.470  -5.270   0.994 1.00 . A A . 668 LYS N    1 1 
        1   168 1 1 12 LYS NZ   N   -7.171  -7.486  -2.872 1.00 . A A . 668 LYS NZ   1 1 
        1   169 1 1 12 LYS O    O   -9.467  -3.849  -0.830 1.00 . A A . 668 LYS O    1 1 
        1   170 1 1 13 LEU C    C   -6.129  -4.911  -0.806 1.00 . A A . 669 LEU C    1 1 
        1   171 1 1 13 LEU CA   C   -6.984  -4.317   0.320 1.00 . A A . 669 LEU CA   1 1 
        1   172 1 1 13 LEU CB   C   -6.179  -4.256   1.627 1.00 . A A . 669 LEU CB   1 1 
        1   173 1 1 13 LEU CD1  C   -5.208  -1.951   1.239 1.00 . A A . 669 LEU CD1  1 1 
        1   174 1 1 13 LEU CD2  C   -4.143  -3.502   2.904 1.00 . A A . 669 LEU CD2  1 1 
        1   175 1 1 13 LEU CG   C   -4.896  -3.408   1.580 1.00 . A A . 669 LEU CG   1 1 
        1   176 1 1 13 LEU H    H   -8.163  -5.885   1.127 1.00 . A A . 669 LEU H    1 1 
        1   177 1 1 13 LEU HA   H   -7.287  -3.315   0.042 1.00 . A A . 669 LEU HA   1 1 
        1   178 1 1 13 LEU HB2  H   -6.822  -3.861   2.402 1.00 . A A . 669 LEU HB2  1 1 
        1   179 1 1 13 LEU HB3  H   -5.904  -5.266   1.898 1.00 . A A . 669 LEU HB3  1 1 
        1   180 1 1 13 LEU HD11 H   -4.290  -1.381   1.224 1.00 . A A . 669 LEU HD11 1 1 
        1   181 1 1 13 LEU HD12 H   -5.874  -1.538   1.982 1.00 . A A . 669 LEU HD12 1 1 
        1   182 1 1 13 LEU HD13 H   -5.678  -1.899   0.267 1.00 . A A . 669 LEU HD13 1 1 
        1   183 1 1 13 LEU HD21 H   -4.774  -3.146   3.707 1.00 . A A . 669 LEU HD21 1 1 
        1   184 1 1 13 LEU HD22 H   -3.248  -2.897   2.855 1.00 . A A . 669 LEU HD22 1 1 
        1   185 1 1 13 LEU HD23 H   -3.869  -4.531   3.091 1.00 . A A . 669 LEU HD23 1 1 
        1   186 1 1 13 LEU HG   H   -4.249  -3.794   0.805 1.00 . A A . 669 LEU HG   1 1 
        1   187 1 1 13 LEU N    N   -8.190  -5.120   0.510 1.00 . A A . 669 LEU N    1 1 
        1   188 1 1 13 LEU O    O   -5.847  -6.111  -0.816 1.00 . A A . 669 LEU O    1 1 
        1   189 1 1 14 THR C    C   -3.526  -3.882  -2.845 1.00 . A A . 670 THR C    1 1 
        1   190 1 1 14 THR CA   C   -4.907  -4.544  -2.884 1.00 . A A . 670 THR CA   1 1 
        1   191 1 1 14 THR CB   C   -5.586  -4.270  -4.247 1.00 . A A . 670 THR CB   1 1 
        1   192 1 1 14 THR CG2  C   -4.713  -4.734  -5.412 1.00 . A A . 670 THR CG2  1 1 
        1   193 1 1 14 THR H    H   -6.037  -3.149  -1.743 1.00 . A A . 670 THR H    1 1 
        1   194 1 1 14 THR HA   H   -4.777  -5.615  -2.785 1.00 . A A . 670 THR HA   1 1 
        1   195 1 1 14 THR HB   H   -5.753  -3.205  -4.341 1.00 . A A . 670 THR HB   1 1 
        1   196 1 1 14 THR HG1  H   -7.045  -5.204  -5.216 1.00 . A A . 670 THR HG1  1 1 
        1   197 1 1 14 THR HG21 H   -5.214  -4.522  -6.345 1.00 . A A . 670 THR HG21 1 1 
        1   198 1 1 14 THR HG22 H   -4.537  -5.797  -5.331 1.00 . A A . 670 THR HG22 1 1 
        1   199 1 1 14 THR HG23 H   -3.768  -4.211  -5.387 1.00 . A A . 670 THR HG23 1 1 
        1   200 1 1 14 THR N    N   -5.745  -4.086  -1.771 1.00 . A A . 670 THR N    1 1 
        1   201 1 1 14 THR O    O   -3.389  -2.679  -3.079 1.00 . A A . 670 THR O    1 1 
        1   202 1 1 14 THR OG1  O   -6.857  -4.949  -4.302 1.00 . A A . 670 THR OG1  1 1 
        1   203 1 1 15 VAL C    C   -0.149  -5.155  -3.134 1.00 . A A . 671 VAL C    1 1 
        1   204 1 1 15 VAL CA   C   -1.126  -4.212  -2.407 1.00 . A A . 671 VAL CA   1 1 
        1   205 1 1 15 VAL CB   C   -0.709  -4.123  -0.910 1.00 . A A . 671 VAL CB   1 1 
        1   206 1 1 15 VAL CG1  C    0.744  -3.666  -0.766 1.00 . A A . 671 VAL CG1  1 1 
        1   207 1 1 15 VAL CG2  C   -1.640  -3.195  -0.132 1.00 . A A . 671 VAL CG2  1 1 
        1   208 1 1 15 VAL H    H   -2.693  -5.642  -2.415 1.00 . A A . 671 VAL H    1 1 
        1   209 1 1 15 VAL HA   H   -1.061  -3.224  -2.842 1.00 . A A . 671 VAL HA   1 1 
        1   210 1 1 15 VAL HB   H   -0.790  -5.115  -0.481 1.00 . A A . 671 VAL HB   1 1 
        1   211 1 1 15 VAL HG11 H    0.863  -2.690  -1.216 1.00 . A A . 671 VAL HG11 1 1 
        1   212 1 1 15 VAL HG12 H    1.397  -4.371  -1.259 1.00 . A A . 671 VAL HG12 1 1 
        1   213 1 1 15 VAL HG13 H    1.002  -3.611   0.282 1.00 . A A . 671 VAL HG13 1 1 
        1   214 1 1 15 VAL HG21 H   -2.661  -3.531  -0.239 1.00 . A A . 671 VAL HG21 1 1 
        1   215 1 1 15 VAL HG22 H   -1.551  -2.189  -0.516 1.00 . A A . 671 VAL HG22 1 1 
        1   216 1 1 15 VAL HG23 H   -1.369  -3.205   0.915 1.00 . A A . 671 VAL HG23 1 1 
        1   217 1 1 15 VAL N    N   -2.509  -4.688  -2.545 1.00 . A A . 671 VAL N    1 1 
        1   218 1 1 15 VAL O    O   -0.222  -6.376  -2.968 1.00 . A A . 671 VAL O    1 1 
        1   219 1 1 16 PRO C    C    2.896  -5.890  -3.646 1.00 . A A . 672 PRO C    1 1 
        1   220 1 1 16 PRO CA   C    1.803  -5.421  -4.623 1.00 . A A . 672 PRO CA   1 1 
        1   221 1 1 16 PRO CB   C    2.374  -4.459  -5.675 1.00 . A A . 672 PRO CB   1 1 
        1   222 1 1 16 PRO CD   C    0.887  -3.178  -4.292 1.00 . A A . 672 PRO CD   1 1 
        1   223 1 1 16 PRO CG   C    2.157  -3.099  -5.101 1.00 . A A . 672 PRO CG   1 1 
        1   224 1 1 16 PRO HA   H    1.368  -6.282  -5.115 1.00 . A A . 672 PRO HA   1 1 
        1   225 1 1 16 PRO HB2  H    3.426  -4.662  -5.829 1.00 . A A . 672 PRO HB2  1 1 
        1   226 1 1 16 PRO HB3  H    1.841  -4.582  -6.607 1.00 . A A . 672 PRO HB3  1 1 
        1   227 1 1 16 PRO HD2  H    0.970  -2.576  -3.398 1.00 . A A . 672 PRO HD2  1 1 
        1   228 1 1 16 PRO HD3  H    0.044  -2.857  -4.882 1.00 . A A . 672 PRO HD3  1 1 
        1   229 1 1 16 PRO HG2  H    2.991  -2.834  -4.464 1.00 . A A . 672 PRO HG2  1 1 
        1   230 1 1 16 PRO HG3  H    2.051  -2.377  -5.897 1.00 . A A . 672 PRO HG3  1 1 
        1   231 1 1 16 PRO N    N    0.775  -4.611  -3.952 1.00 . A A . 672 PRO N    1 1 
        1   232 1 1 16 PRO O    O    3.563  -5.078  -3.010 1.00 . A A . 672 PRO O    1 1 
        1   233 1 1 17 VAL C    C    5.490  -7.369  -2.877 1.00 . A A . 673 VAL C    1 1 
        1   234 1 1 17 VAL CA   C    4.031  -7.775  -2.574 1.00 . A A . 673 VAL CA   1 1 
        1   235 1 1 17 VAL CB   C    3.914  -9.323  -2.531 1.00 . A A . 673 VAL CB   1 1 
        1   236 1 1 17 VAL CG1  C    4.305  -9.943  -3.871 1.00 . A A . 673 VAL CG1  1 1 
        1   237 1 1 17 VAL CG2  C    4.750  -9.905  -1.392 1.00 . A A . 673 VAL CG2  1 1 
        1   238 1 1 17 VAL H    H    2.562  -7.806  -4.113 1.00 . A A . 673 VAL H    1 1 
        1   239 1 1 17 VAL HA   H    3.767  -7.394  -1.597 1.00 . A A . 673 VAL HA   1 1 
        1   240 1 1 17 VAL HB   H    2.877  -9.572  -2.343 1.00 . A A . 673 VAL HB   1 1 
        1   241 1 1 17 VAL HG11 H    5.329  -9.684  -4.105 1.00 . A A . 673 VAL HG11 1 1 
        1   242 1 1 17 VAL HG12 H    3.653  -9.568  -4.647 1.00 . A A . 673 VAL HG12 1 1 
        1   243 1 1 17 VAL HG13 H    4.212 -11.019  -3.814 1.00 . A A . 673 VAL HG13 1 1 
        1   244 1 1 17 VAL HG21 H    4.624 -10.978  -1.363 1.00 . A A . 673 VAL HG21 1 1 
        1   245 1 1 17 VAL HG22 H    4.427  -9.480  -0.453 1.00 . A A . 673 VAL HG22 1 1 
        1   246 1 1 17 VAL HG23 H    5.793  -9.672  -1.552 1.00 . A A . 673 VAL HG23 1 1 
        1   247 1 1 17 VAL N    N    3.082  -7.204  -3.539 1.00 . A A . 673 VAL N    1 1 
        1   248 1 1 17 VAL O    O    6.330  -7.298  -1.971 1.00 . A A . 673 VAL O    1 1 
        1   249 1 1 18 GLY C    C    7.192  -5.729  -5.711 1.00 . A A . 674 GLY C    1 1 
        1   250 1 1 18 GLY CA   C    7.139  -6.702  -4.533 1.00 . A A . 674 GLY CA   1 1 
        1   251 1 1 18 GLY H    H    5.075  -7.117  -4.820 1.00 . A A . 674 GLY H    1 1 
        1   252 1 1 18 GLY HA2  H    7.629  -6.243  -3.687 1.00 . A A . 674 GLY HA2  1 1 
        1   253 1 1 18 GLY HA3  H    7.680  -7.597  -4.798 1.00 . A A . 674 GLY HA3  1 1 
        1   254 1 1 18 GLY N    N    5.782  -7.078  -4.144 1.00 . A A . 674 GLY N    1 1 
        1   255 1 1 18 GLY O    O    6.445  -5.866  -6.681 1.00 . A A . 674 GLY O    1 1 
        1   256 1 1 19 ALA C    C    9.786  -3.498  -6.930 1.00 . A A . 675 ALA C    1 1 
        1   257 1 1 19 ALA CA   C    8.288  -3.754  -6.683 1.00 . A A . 675 ALA CA   1 1 
        1   258 1 1 19 ALA CB   C    7.582  -2.455  -6.306 1.00 . A A . 675 ALA CB   1 1 
        1   259 1 1 19 ALA H    H    8.648  -4.699  -4.822 1.00 . A A . 675 ALA H    1 1 
        1   260 1 1 19 ALA HA   H    7.842  -4.133  -7.593 1.00 . A A . 675 ALA HA   1 1 
        1   261 1 1 19 ALA HB1  H    7.706  -1.734  -7.101 1.00 . A A . 675 ALA HB1  1 1 
        1   262 1 1 19 ALA HB2  H    8.009  -2.062  -5.394 1.00 . A A . 675 ALA HB2  1 1 
        1   263 1 1 19 ALA HB3  H    6.529  -2.647  -6.156 1.00 . A A . 675 ALA HB3  1 1 
        1   264 1 1 19 ALA N    N    8.094  -4.753  -5.625 1.00 . A A . 675 ALA N    1 1 
        1   265 1 1 19 ALA O    O   10.605  -3.656  -6.022 1.00 . A A . 675 ALA O    1 1 
        1   266 1 1 20 THR C    C   11.689  -1.595  -9.383 1.00 . A A . 676 THR C    1 1 
        1   267 1 1 20 THR CA   C   11.558  -2.839  -8.491 1.00 . A A . 676 THR CA   1 1 
        1   268 1 1 20 THR CB   C   12.227  -4.046  -9.205 1.00 . A A . 676 THR CB   1 1 
        1   269 1 1 20 THR CG2  C   13.695  -3.760  -9.520 1.00 . A A . 676 THR CG2  1 1 
        1   270 1 1 20 THR H    H    9.459  -3.003  -8.844 1.00 . A A . 676 THR H    1 1 
        1   271 1 1 20 THR HA   H   12.093  -2.658  -7.566 1.00 . A A . 676 THR HA   1 1 
        1   272 1 1 20 THR HB   H   11.705  -4.230 -10.135 1.00 . A A . 676 THR HB   1 1 
        1   273 1 1 20 THR HG1  H   11.604  -5.887  -8.831 1.00 . A A . 676 THR HG1  1 1 
        1   274 1 1 20 THR HG21 H   14.133  -4.619 -10.007 1.00 . A A . 676 THR HG21 1 1 
        1   275 1 1 20 THR HG22 H   14.227  -3.555  -8.602 1.00 . A A . 676 THR HG22 1 1 
        1   276 1 1 20 THR HG23 H   13.765  -2.903 -10.174 1.00 . A A . 676 THR HG23 1 1 
        1   277 1 1 20 THR N    N   10.149  -3.116  -8.154 1.00 . A A . 676 THR N    1 1 
        1   278 1 1 20 THR O    O   11.165  -1.565 -10.500 1.00 . A A . 676 THR O    1 1 
        1   279 1 1 20 THR OG1  O   12.141  -5.223  -8.381 1.00 . A A . 676 THR OG1  1 1 
        1   280 1 1 21 ILE C    C   14.072   1.088  -9.684 1.00 . A A . 677 ILE C    1 1 
        1   281 1 1 21 ILE CA   C   12.592   0.676  -9.653 1.00 . A A . 677 ILE CA   1 1 
        1   282 1 1 21 ILE CB   C   11.749   1.840  -9.065 1.00 . A A . 677 ILE CB   1 1 
        1   283 1 1 21 ILE CD1  C   11.370   3.243  -6.963 1.00 . A A . 677 ILE CD1  1 1 
        1   284 1 1 21 ILE CG1  C   12.113   2.082  -7.591 1.00 . A A . 677 ILE CG1  1 1 
        1   285 1 1 21 ILE CG2  C   10.254   1.559  -9.224 1.00 . A A . 677 ILE CG2  1 1 
        1   286 1 1 21 ILE H    H   12.824  -0.666  -8.018 1.00 . A A . 677 ILE H    1 1 
        1   287 1 1 21 ILE HA   H   12.263   0.505 -10.671 1.00 . A A . 677 ILE HA   1 1 
        1   288 1 1 21 ILE HB   H   11.977   2.734  -9.631 1.00 . A A . 677 ILE HB   1 1 
        1   289 1 1 21 ILE HD11 H   11.692   3.366  -5.939 1.00 . A A . 677 ILE HD11 1 1 
        1   290 1 1 21 ILE HD12 H   10.309   3.046  -6.986 1.00 . A A . 677 ILE HD12 1 1 
        1   291 1 1 21 ILE HD13 H   11.580   4.148  -7.517 1.00 . A A . 677 ILE HD13 1 1 
        1   292 1 1 21 ILE HG12 H   11.885   1.196  -7.017 1.00 . A A . 677 ILE HG12 1 1 
        1   293 1 1 21 ILE HG13 H   13.171   2.289  -7.515 1.00 . A A . 677 ILE HG13 1 1 
        1   294 1 1 21 ILE HG21 H   10.024   1.416 -10.271 1.00 . A A . 677 ILE HG21 1 1 
        1   295 1 1 21 ILE HG22 H    9.685   2.395  -8.843 1.00 . A A . 677 ILE HG22 1 1 
        1   296 1 1 21 ILE HG23 H    9.993   0.666  -8.674 1.00 . A A . 677 ILE HG23 1 1 
        1   297 1 1 21 ILE N    N   12.400  -0.576  -8.900 1.00 . A A . 677 ILE N    1 1 
        1   298 1 1 21 ILE O    O   14.923   0.438  -9.074 1.00 . A A . 677 ILE O    1 1 
        1   299 1 1 22 HIS C    C   16.015   3.953  -9.761 1.00 . A A . 678 HIS C    1 1 
        1   300 1 1 22 HIS CA   C   15.767   2.646 -10.529 1.00 . A A . 678 HIS CA   1 1 
        1   301 1 1 22 HIS CB   C   16.127   2.851 -12.006 1.00 . A A . 678 HIS CB   1 1 
        1   302 1 1 22 HIS CD2  C   17.107   0.606 -12.856 1.00 . A A . 678 HIS CD2  1 1 
        1   303 1 1 22 HIS CE1  C   15.498   0.063 -14.235 1.00 . A A . 678 HIS CE1  1 1 
        1   304 1 1 22 HIS CG   C   16.169   1.581 -12.794 1.00 . A A . 678 HIS CG   1 1 
        1   305 1 1 22 HIS H    H   13.658   2.669 -10.837 1.00 . A A . 678 HIS H    1 1 
        1   306 1 1 22 HIS HA   H   16.417   1.883 -10.122 1.00 . A A . 678 HIS HA   1 1 
        1   307 1 1 22 HIS HB2  H   15.394   3.500 -12.464 1.00 . A A . 678 HIS HB2  1 1 
        1   308 1 1 22 HIS HB3  H   17.101   3.316 -12.072 1.00 . A A . 678 HIS HB3  1 1 
        1   309 1 1 22 HIS HD1  H   14.351   1.708 -13.847 1.00 . A A . 678 HIS HD1  1 1 
        1   310 1 1 22 HIS HD2  H   18.024   0.559 -12.279 1.00 . A A . 678 HIS HD2  1 1 
        1   311 1 1 22 HIS HE1  H   14.906  -0.467 -14.965 1.00 . A A . 678 HIS HE1  1 1 
        1   312 1 1 22 HIS HE2  H   17.243  -0.993 -14.200 1.00 . A A . 678 HIS HE2  1 1 
        1   313 1 1 22 HIS N    N   14.380   2.170 -10.398 1.00 . A A . 678 HIS N    1 1 
        1   314 1 1 22 HIS ND1  N   15.180   1.209 -13.671 1.00 . A A . 678 HIS ND1  1 1 
        1   315 1 1 22 HIS NE2  N   16.666  -0.325 -13.762 1.00 . A A . 678 HIS NE2  1 1 
        1   316 1 1 22 HIS O    O   15.080   4.655  -9.372 1.00 . A A . 678 HIS O    1 1 
        1   317 1 1 23 VAL C    C   17.294   6.729  -9.821 1.00 . A A . 679 VAL C    1 1 
        1   318 1 1 23 VAL CA   C   17.696   5.534  -8.935 1.00 . A A . 679 VAL CA   1 1 
        1   319 1 1 23 VAL CB   C   19.228   5.566  -8.674 1.00 . A A . 679 VAL CB   1 1 
        1   320 1 1 23 VAL CG1  C   19.670   6.928  -8.139 1.00 . A A . 679 VAL CG1  1 1 
        1   321 1 1 23 VAL CG2  C   19.627   4.455  -7.702 1.00 . A A . 679 VAL CG2  1 1 
        1   322 1 1 23 VAL H    H   17.984   3.619  -9.798 1.00 . A A . 679 VAL H    1 1 
        1   323 1 1 23 VAL HA   H   17.188   5.617  -7.982 1.00 . A A . 679 VAL HA   1 1 
        1   324 1 1 23 VAL HB   H   19.738   5.392  -9.613 1.00 . A A . 679 VAL HB   1 1 
        1   325 1 1 23 VAL HG11 H   19.437   7.696  -8.864 1.00 . A A . 679 VAL HG11 1 1 
        1   326 1 1 23 VAL HG12 H   20.735   6.918  -7.956 1.00 . A A . 679 VAL HG12 1 1 
        1   327 1 1 23 VAL HG13 H   19.150   7.139  -7.215 1.00 . A A . 679 VAL HG13 1 1 
        1   328 1 1 23 VAL HG21 H   19.338   3.496  -8.111 1.00 . A A . 679 VAL HG21 1 1 
        1   329 1 1 23 VAL HG22 H   19.129   4.606  -6.754 1.00 . A A . 679 VAL HG22 1 1 
        1   330 1 1 23 VAL HG23 H   20.697   4.472  -7.553 1.00 . A A . 679 VAL HG23 1 1 
        1   331 1 1 23 VAL N    N   17.293   4.266  -9.548 1.00 . A A . 679 VAL N    1 1 
        1   332 1 1 23 VAL O    O   17.784   6.875 -10.942 1.00 . A A . 679 VAL O    1 1 
        1   333 1 1 24 GLY C    C   14.526   8.452 -10.703 1.00 . A A . 680 GLY C    1 1 
        1   334 1 1 24 GLY CA   C   15.894   8.713 -10.075 1.00 . A A . 680 GLY CA   1 1 
        1   335 1 1 24 GLY H    H   16.078   7.429  -8.393 1.00 . A A . 680 GLY H    1 1 
        1   336 1 1 24 GLY HA2  H   15.816   9.565  -9.415 1.00 . A A . 680 GLY HA2  1 1 
        1   337 1 1 24 GLY HA3  H   16.598   8.948 -10.861 1.00 . A A . 680 GLY HA3  1 1 
        1   338 1 1 24 GLY N    N   16.396   7.573  -9.308 1.00 . A A . 680 GLY N    1 1 
        1   339 1 1 24 GLY O    O   13.971   9.319 -11.390 1.00 . A A . 680 GLY O    1 1 
        1   340 1 1 25 ASP C    C   11.506   7.279 -10.128 1.00 . A A . 681 ASP C    1 1 
        1   341 1 1 25 ASP CA   C   12.683   6.870 -11.042 1.00 . A A . 681 ASP CA   1 1 
        1   342 1 1 25 ASP CB   C   12.661   5.354 -11.309 1.00 . A A . 681 ASP CB   1 1 
        1   343 1 1 25 ASP CG   C   11.473   4.920 -12.150 1.00 . A A . 681 ASP CG   1 1 
        1   344 1 1 25 ASP H    H   14.455   6.620  -9.900 1.00 . A A . 681 ASP H    1 1 
        1   345 1 1 25 ASP HA   H   12.577   7.387 -11.986 1.00 . A A . 681 ASP HA   1 1 
        1   346 1 1 25 ASP HB2  H   13.565   5.073 -11.831 1.00 . A A . 681 ASP HB2  1 1 
        1   347 1 1 25 ASP HB3  H   12.623   4.828 -10.363 1.00 . A A . 681 ASP HB3  1 1 
        1   348 1 1 25 ASP N    N   13.977   7.258 -10.469 1.00 . A A . 681 ASP N    1 1 
        1   349 1 1 25 ASP O    O   11.672   7.472  -8.922 1.00 . A A . 681 ASP O    1 1 
        1   350 1 1 25 ASP OD1  O   10.996   5.730 -12.977 1.00 . A A . 681 ASP OD1  1 1 
        1   351 1 1 25 ASP OD2  O   11.021   3.768 -12.002 1.00 . A A . 681 ASP OD2  1 1 
        1   352 1 1 26 SER C    C    8.442   6.668  -9.250 1.00 . A A . 682 SER C    1 1 
        1   353 1 1 26 SER CA   C    9.109   7.835  -9.994 1.00 . A A . 682 SER CA   1 1 
        1   354 1 1 26 SER CB   C    8.096   8.448 -10.972 1.00 . A A . 682 SER CB   1 1 
        1   355 1 1 26 SER H    H   10.251   7.209 -11.680 1.00 . A A . 682 SER H    1 1 
        1   356 1 1 26 SER HA   H    9.400   8.589  -9.276 1.00 . A A . 682 SER HA   1 1 
        1   357 1 1 26 SER HB2  H    7.237   8.802 -10.422 1.00 . A A . 682 SER HB2  1 1 
        1   358 1 1 26 SER HB3  H    8.555   9.278 -11.489 1.00 . A A . 682 SER HB3  1 1 
        1   359 1 1 26 SER HG   H    8.235   6.723 -11.919 1.00 . A A . 682 SER HG   1 1 
        1   360 1 1 26 SER N    N   10.319   7.407 -10.722 1.00 . A A . 682 SER N    1 1 
        1   361 1 1 26 SER O    O    8.433   5.537  -9.735 1.00 . A A . 682 SER O    1 1 
        1   362 1 1 26 SER OG   O    7.655   7.496 -11.935 1.00 . A A . 682 SER OG   1 1 
        1   363 1 1 27 PHE C    C    6.000   6.581  -6.492 1.00 . A A . 683 PHE C    1 1 
        1   364 1 1 27 PHE CA   C    7.148   5.941  -7.297 1.00 . A A . 683 PHE CA   1 1 
        1   365 1 1 27 PHE CB   C    8.112   5.208  -6.352 1.00 . A A . 683 PHE CB   1 1 
        1   366 1 1 27 PHE CD1  C    7.335   2.817  -6.202 1.00 . A A . 683 PHE CD1  1 1 
        1   367 1 1 27 PHE CD2  C    7.007   4.230  -4.306 1.00 . A A . 683 PHE CD2  1 1 
        1   368 1 1 27 PHE CE1  C    6.749   1.766  -5.521 1.00 . A A . 683 PHE CE1  1 1 
        1   369 1 1 27 PHE CE2  C    6.420   3.182  -3.624 1.00 . A A . 683 PHE CE2  1 1 
        1   370 1 1 27 PHE CG   C    7.475   4.061  -5.602 1.00 . A A . 683 PHE CG   1 1 
        1   371 1 1 27 PHE CZ   C    6.289   1.950  -4.233 1.00 . A A . 683 PHE CZ   1 1 
        1   372 1 1 27 PHE H    H    7.946   7.864  -7.724 1.00 . A A . 683 PHE H    1 1 
        1   373 1 1 27 PHE HA   H    6.727   5.227  -7.992 1.00 . A A . 683 PHE HA   1 1 
        1   374 1 1 27 PHE HB2  H    8.937   4.812  -6.926 1.00 . A A . 683 PHE HB2  1 1 
        1   375 1 1 27 PHE HB3  H    8.495   5.912  -5.625 1.00 . A A . 683 PHE HB3  1 1 
        1   376 1 1 27 PHE HD1  H    7.693   2.671  -7.211 1.00 . A A . 683 PHE HD1  1 1 
        1   377 1 1 27 PHE HD2  H    7.106   5.194  -3.828 1.00 . A A . 683 PHE HD2  1 1 
        1   378 1 1 27 PHE HE1  H    6.649   0.801  -5.998 1.00 . A A . 683 PHE HE1  1 1 
        1   379 1 1 27 PHE HE2  H    6.061   3.329  -2.616 1.00 . A A . 683 PHE HE2  1 1 
        1   380 1 1 27 PHE HZ   H    5.831   1.129  -3.699 1.00 . A A . 683 PHE HZ   1 1 
        1   381 1 1 27 PHE N    N    7.873   6.954  -8.078 1.00 . A A . 683 PHE N    1 1 
        1   382 1 1 27 PHE O    O    6.239   7.376  -5.579 1.00 . A A . 683 PHE O    1 1 
        1   383 1 1 28 VAL C    C    2.776   5.667  -5.427 1.00 . A A . 684 VAL C    1 1 
        1   384 1 1 28 VAL CA   C    3.570   6.773  -6.157 1.00 . A A . 684 VAL CA   1 1 
        1   385 1 1 28 VAL CB   C    2.632   7.495  -7.160 1.00 . A A . 684 VAL CB   1 1 
        1   386 1 1 28 VAL CG1  C    1.407   8.071  -6.448 1.00 . A A . 684 VAL CG1  1 1 
        1   387 1 1 28 VAL CG2  C    3.384   8.591  -7.914 1.00 . A A . 684 VAL CG2  1 1 
        1   388 1 1 28 VAL H    H    4.633   5.589  -7.570 1.00 . A A . 684 VAL H    1 1 
        1   389 1 1 28 VAL HA   H    3.904   7.503  -5.428 1.00 . A A . 684 VAL HA   1 1 
        1   390 1 1 28 VAL HB   H    2.286   6.767  -7.881 1.00 . A A . 684 VAL HB   1 1 
        1   391 1 1 28 VAL HG11 H    1.725   8.773  -5.691 1.00 . A A . 684 VAL HG11 1 1 
        1   392 1 1 28 VAL HG12 H    0.849   7.271  -5.984 1.00 . A A . 684 VAL HG12 1 1 
        1   393 1 1 28 VAL HG13 H    0.775   8.577  -7.165 1.00 . A A . 684 VAL HG13 1 1 
        1   394 1 1 28 VAL HG21 H    3.753   9.325  -7.212 1.00 . A A . 684 VAL HG21 1 1 
        1   395 1 1 28 VAL HG22 H    2.719   9.069  -8.617 1.00 . A A . 684 VAL HG22 1 1 
        1   396 1 1 28 VAL HG23 H    4.217   8.156  -8.448 1.00 . A A . 684 VAL HG23 1 1 
        1   397 1 1 28 VAL N    N    4.759   6.230  -6.837 1.00 . A A . 684 VAL N    1 1 
        1   398 1 1 28 VAL O    O    1.994   4.940  -6.046 1.00 . A A . 684 VAL O    1 1 
        1   399 1 1 29 PRO C    C    0.753   4.535  -3.350 1.00 . A A . 685 PRO C    1 1 
        1   400 1 1 29 PRO CA   C    2.294   4.479  -3.299 1.00 . A A . 685 PRO CA   1 1 
        1   401 1 1 29 PRO CB   C    2.800   4.736  -1.866 1.00 . A A . 685 PRO CB   1 1 
        1   402 1 1 29 PRO CD   C    3.817   6.388  -3.258 1.00 . A A . 685 PRO CD   1 1 
        1   403 1 1 29 PRO CG   C    3.286   6.147  -1.872 1.00 . A A . 685 PRO CG   1 1 
        1   404 1 1 29 PRO HA   H    2.618   3.497  -3.618 1.00 . A A . 685 PRO HA   1 1 
        1   405 1 1 29 PRO HB2  H    1.993   4.599  -1.159 1.00 . A A . 685 PRO HB2  1 1 
        1   406 1 1 29 PRO HB3  H    3.602   4.047  -1.636 1.00 . A A . 685 PRO HB3  1 1 
        1   407 1 1 29 PRO HD2  H    3.715   7.431  -3.529 1.00 . A A . 685 PRO HD2  1 1 
        1   408 1 1 29 PRO HD3  H    4.850   6.077  -3.330 1.00 . A A . 685 PRO HD3  1 1 
        1   409 1 1 29 PRO HG2  H    2.466   6.820  -1.660 1.00 . A A . 685 PRO HG2  1 1 
        1   410 1 1 29 PRO HG3  H    4.072   6.272  -1.140 1.00 . A A . 685 PRO HG3  1 1 
        1   411 1 1 29 PRO N    N    2.953   5.534  -4.095 1.00 . A A . 685 PRO N    1 1 
        1   412 1 1 29 PRO O    O    0.091   3.498  -3.388 1.00 . A A . 685 PRO O    1 1 
        1   413 1 1 30 MET C    C   -1.916   5.670  -4.742 1.00 . A A . 686 MET C    1 1 
        1   414 1 1 30 MET CA   C   -1.283   5.902  -3.357 1.00 . A A . 686 MET CA   1 1 
        1   415 1 1 30 MET CB   C   -1.664   7.294  -2.826 1.00 . A A . 686 MET CB   1 1 
        1   416 1 1 30 MET CE   C   -2.837   5.223  -0.532 1.00 . A A . 686 MET CE   1 1 
        1   417 1 1 30 MET CG   C   -1.381   7.501  -1.337 1.00 . A A . 686 MET CG   1 1 
        1   418 1 1 30 MET H    H    0.754   6.541  -3.392 1.00 . A A . 686 MET H    1 1 
        1   419 1 1 30 MET HA   H   -1.680   5.159  -2.683 1.00 . A A . 686 MET HA   1 1 
        1   420 1 1 30 MET HB2  H   -1.113   8.041  -3.381 1.00 . A A . 686 MET HB2  1 1 
        1   421 1 1 30 MET HB3  H   -2.721   7.450  -2.989 1.00 . A A . 686 MET HB3  1 1 
        1   422 1 1 30 MET HE1  H   -3.126   5.028  -1.554 1.00 . A A . 686 MET HE1  1 1 
        1   423 1 1 30 MET HE2  H   -3.569   4.795   0.136 1.00 . A A . 686 MET HE2  1 1 
        1   424 1 1 30 MET HE3  H   -1.870   4.779  -0.340 1.00 . A A . 686 MET HE3  1 1 
        1   425 1 1 30 MET HG2  H   -0.505   6.929  -1.069 1.00 . A A . 686 MET HG2  1 1 
        1   426 1 1 30 MET HG3  H   -1.182   8.551  -1.166 1.00 . A A . 686 MET HG3  1 1 
        1   427 1 1 30 MET N    N    0.183   5.742  -3.369 1.00 . A A . 686 MET N    1 1 
        1   428 1 1 30 MET O    O   -3.138   5.711  -4.887 1.00 . A A . 686 MET O    1 1 
        1   429 1 1 30 MET SD   S   -2.749   6.994  -0.261 1.00 . A A . 686 MET SD   1 1 
        1   430 1 1 31 ALA C    C   -1.632   3.608  -7.360 1.00 . A A . 687 ALA C    1 1 
        1   431 1 1 31 ALA CA   C   -1.588   5.120  -7.100 1.00 . A A . 687 ALA CA   1 1 
        1   432 1 1 31 ALA CB   C   -0.723   5.803  -8.151 1.00 . A A . 687 ALA CB   1 1 
        1   433 1 1 31 ALA H    H   -0.121   5.453  -5.598 1.00 . A A . 687 ALA H    1 1 
        1   434 1 1 31 ALA HA   H   -2.591   5.516  -7.184 1.00 . A A . 687 ALA HA   1 1 
        1   435 1 1 31 ALA HB1  H   -0.669   6.861  -7.942 1.00 . A A . 687 ALA HB1  1 1 
        1   436 1 1 31 ALA HB2  H   -1.154   5.651  -9.129 1.00 . A A . 687 ALA HB2  1 1 
        1   437 1 1 31 ALA HB3  H    0.272   5.384  -8.129 1.00 . A A . 687 ALA HB3  1 1 
        1   438 1 1 31 ALA N    N   -1.088   5.424  -5.753 1.00 . A A . 687 ALA N    1 1 
        1   439 1 1 31 ALA O    O   -2.494   3.116  -8.090 1.00 . A A . 687 ALA O    1 1 
        1   440 1 1 32 GLU C    C   -1.234   0.595  -5.882 1.00 . A A . 688 GLU C    1 1 
        1   441 1 1 32 GLU CA   C   -0.562   1.435  -6.988 1.00 . A A . 688 GLU CA   1 1 
        1   442 1 1 32 GLU CB   C    0.925   1.072  -7.105 1.00 . A A . 688 GLU CB   1 1 
        1   443 1 1 32 GLU CD   C    3.119   1.462  -8.336 1.00 . A A . 688 GLU CD   1 1 
        1   444 1 1 32 GLU CG   C    1.656   1.854  -8.196 1.00 . A A . 688 GLU CG   1 1 
        1   445 1 1 32 GLU H    H   -0.071   3.319  -6.144 1.00 . A A . 688 GLU H    1 1 
        1   446 1 1 32 GLU HA   H   -1.044   1.208  -7.928 1.00 . A A . 688 GLU HA   1 1 
        1   447 1 1 32 GLU HB2  H    1.410   1.272  -6.158 1.00 . A A . 688 GLU HB2  1 1 
        1   448 1 1 32 GLU HB3  H    1.011   0.018  -7.327 1.00 . A A . 688 GLU HB3  1 1 
        1   449 1 1 32 GLU HG2  H    1.160   1.676  -9.140 1.00 . A A . 688 GLU HG2  1 1 
        1   450 1 1 32 GLU HG3  H    1.601   2.910  -7.964 1.00 . A A . 688 GLU HG3  1 1 
        1   451 1 1 32 GLU N    N   -0.696   2.878  -6.756 1.00 . A A . 688 GLU N    1 1 
        1   452 1 1 32 GLU O    O   -1.251  -0.634  -5.954 1.00 . A A . 688 GLU O    1 1 
        1   453 1 1 32 GLU OE1  O    3.967   2.027  -7.617 1.00 . A A . 688 GLU OE1  1 1 
        1   454 1 1 32 GLU OE2  O    3.428   0.586  -9.175 1.00 . A A . 688 GLU OE2  1 1 
        1   455 1 1 33 VAL C    C   -3.913   1.059  -3.586 1.00 . A A . 689 VAL C    1 1 
        1   456 1 1 33 VAL CA   C   -2.462   0.574  -3.753 1.00 . A A . 689 VAL CA   1 1 
        1   457 1 1 33 VAL CB   C   -1.701   0.775  -2.417 1.00 . A A . 689 VAL CB   1 1 
        1   458 1 1 33 VAL CG1  C   -2.463   0.144  -1.250 1.00 . A A . 689 VAL CG1  1 1 
        1   459 1 1 33 VAL CG2  C   -0.287   0.203  -2.517 1.00 . A A . 689 VAL CG2  1 1 
        1   460 1 1 33 VAL H    H   -1.736   2.240  -4.857 1.00 . A A . 689 VAL H    1 1 
        1   461 1 1 33 VAL HA   H   -2.475  -0.485  -3.975 1.00 . A A . 689 VAL HA   1 1 
        1   462 1 1 33 VAL HB   H   -1.621   1.839  -2.229 1.00 . A A . 689 VAL HB   1 1 
        1   463 1 1 33 VAL HG11 H   -1.905   0.282  -0.335 1.00 . A A . 689 VAL HG11 1 1 
        1   464 1 1 33 VAL HG12 H   -2.596  -0.913  -1.433 1.00 . A A . 689 VAL HG12 1 1 
        1   465 1 1 33 VAL HG13 H   -3.431   0.616  -1.154 1.00 . A A . 689 VAL HG13 1 1 
        1   466 1 1 33 VAL HG21 H   -0.337  -0.857  -2.724 1.00 . A A . 689 VAL HG21 1 1 
        1   467 1 1 33 VAL HG22 H    0.235   0.362  -1.585 1.00 . A A . 689 VAL HG22 1 1 
        1   468 1 1 33 VAL HG23 H    0.247   0.700  -3.316 1.00 . A A . 689 VAL HG23 1 1 
        1   469 1 1 33 VAL N    N   -1.784   1.262  -4.864 1.00 . A A . 689 VAL N    1 1 
        1   470 1 1 33 VAL O    O   -4.165   2.255  -3.428 1.00 . A A . 689 VAL O    1 1 
        1   471 1 1 34 LEU C    C   -6.938  -0.340  -2.317 1.00 . A A . 690 LEU C    1 1 
        1   472 1 1 34 LEU CA   C   -6.297   0.436  -3.481 1.00 . A A . 690 LEU CA   1 1 
        1   473 1 1 34 LEU CB   C   -7.063   0.109  -4.783 1.00 . A A . 690 LEU CB   1 1 
        1   474 1 1 34 LEU CD1  C   -6.750   2.450  -5.695 1.00 . A A . 690 LEU CD1  1 1 
        1   475 1 1 34 LEU CD2  C   -5.365   0.555  -6.613 1.00 . A A . 690 LEU CD2  1 1 
        1   476 1 1 34 LEU CG   C   -6.716   0.960  -6.024 1.00 . A A . 690 LEU CG   1 1 
        1   477 1 1 34 LEU H    H   -4.591  -0.820  -3.721 1.00 . A A . 690 LEU H    1 1 
        1   478 1 1 34 LEU HA   H   -6.389   1.494  -3.279 1.00 . A A . 690 LEU HA   1 1 
        1   479 1 1 34 LEU HB2  H   -6.879  -0.928  -5.028 1.00 . A A . 690 LEU HB2  1 1 
        1   480 1 1 34 LEU HB3  H   -8.120   0.223  -4.585 1.00 . A A . 690 LEU HB3  1 1 
        1   481 1 1 34 LEU HD11 H   -6.007   2.674  -4.941 1.00 . A A . 690 LEU HD11 1 1 
        1   482 1 1 34 LEU HD12 H   -7.730   2.714  -5.323 1.00 . A A . 690 LEU HD12 1 1 
        1   483 1 1 34 LEU HD13 H   -6.542   3.022  -6.588 1.00 . A A . 690 LEU HD13 1 1 
        1   484 1 1 34 LEU HD21 H   -5.396  -0.486  -6.900 1.00 . A A . 690 LEU HD21 1 1 
        1   485 1 1 34 LEU HD22 H   -4.591   0.702  -5.875 1.00 . A A . 690 LEU HD22 1 1 
        1   486 1 1 34 LEU HD23 H   -5.152   1.161  -7.482 1.00 . A A . 690 LEU HD23 1 1 
        1   487 1 1 34 LEU HG   H   -7.468   0.782  -6.783 1.00 . A A . 690 LEU HG   1 1 
        1   488 1 1 34 LEU N    N   -4.862   0.118  -3.615 1.00 . A A . 690 LEU N    1 1 
        1   489 1 1 34 LEU O    O   -6.388  -1.334  -1.844 1.00 . A A . 690 LEU O    1 1 
        1   490 1 1 35 ALA C    C  -10.384  -0.358  -0.997 1.00 . A A . 691 ALA C    1 1 
        1   491 1 1 35 ALA CA   C   -8.873  -0.577  -0.821 1.00 . A A . 691 ALA CA   1 1 
        1   492 1 1 35 ALA CB   C   -8.433  -0.113   0.560 1.00 . A A . 691 ALA CB   1 1 
        1   493 1 1 35 ALA H    H   -8.466   0.952  -2.247 1.00 . A A . 691 ALA H    1 1 
        1   494 1 1 35 ALA HA   H   -8.663  -1.636  -0.903 1.00 . A A . 691 ALA HA   1 1 
        1   495 1 1 35 ALA HB1  H   -7.366  -0.254   0.666 1.00 . A A . 691 ALA HB1  1 1 
        1   496 1 1 35 ALA HB2  H   -8.948  -0.686   1.317 1.00 . A A . 691 ALA HB2  1 1 
        1   497 1 1 35 ALA HB3  H   -8.668   0.935   0.681 1.00 . A A . 691 ALA HB3  1 1 
        1   498 1 1 35 ALA N    N   -8.107   0.120  -1.867 1.00 . A A . 691 ALA N    1 1 
        1   499 1 1 35 ALA O    O  -10.865   0.779  -0.972 1.00 . A A . 691 ALA O    1 1 
        1   500 1 1 36 ILE C    C  -13.411  -2.213  -0.449 1.00 . A A . 692 ILE C    1 1 
        1   501 1 1 36 ILE CA   C  -12.576  -1.371  -1.432 1.00 . A A . 692 ILE CA   1 1 
        1   502 1 1 36 ILE CB   C  -12.893  -1.853  -2.876 1.00 . A A . 692 ILE CB   1 1 
        1   503 1 1 36 ILE CD1  C  -12.170   0.364  -3.944 1.00 . A A . 692 ILE CD1  1 1 
        1   504 1 1 36 ILE CG1  C  -11.994  -1.139  -3.908 1.00 . A A . 692 ILE CG1  1 1 
        1   505 1 1 36 ILE CG2  C  -14.373  -1.629  -3.202 1.00 . A A . 692 ILE CG2  1 1 
        1   506 1 1 36 ILE H    H  -10.709  -2.334  -1.078 1.00 . A A . 692 ILE H    1 1 
        1   507 1 1 36 ILE HA   H  -12.879  -0.335  -1.348 1.00 . A A . 692 ILE HA   1 1 
        1   508 1 1 36 ILE HB   H  -12.701  -2.917  -2.922 1.00 . A A . 692 ILE HB   1 1 
        1   509 1 1 36 ILE HD11 H  -11.536   0.782  -4.710 1.00 . A A . 692 ILE HD11 1 1 
        1   510 1 1 36 ILE HD12 H  -11.900   0.782  -2.986 1.00 . A A . 692 ILE HD12 1 1 
        1   511 1 1 36 ILE HD13 H  -13.200   0.601  -4.162 1.00 . A A . 692 ILE HD13 1 1 
        1   512 1 1 36 ILE HG12 H  -10.959  -1.343  -3.673 1.00 . A A . 692 ILE HG12 1 1 
        1   513 1 1 36 ILE HG13 H  -12.213  -1.523  -4.895 1.00 . A A . 692 ILE HG13 1 1 
        1   514 1 1 36 ILE HG21 H  -14.985  -2.194  -2.514 1.00 . A A . 692 ILE HG21 1 1 
        1   515 1 1 36 ILE HG22 H  -14.575  -1.956  -4.213 1.00 . A A . 692 ILE HG22 1 1 
        1   516 1 1 36 ILE HG23 H  -14.610  -0.578  -3.111 1.00 . A A . 692 ILE HG23 1 1 
        1   517 1 1 36 ILE N    N  -11.134  -1.451  -1.150 1.00 . A A . 692 ILE N    1 1 
        1   518 1 1 36 ILE O    O  -13.127  -3.391  -0.223 1.00 . A A . 692 ILE O    1 1 
        1   519 1 1 37 ASP C    C  -16.804  -2.294   0.312 1.00 . A A . 693 ASP C    1 1 
        1   520 1 1 37 ASP CA   C  -15.409  -2.328   0.963 1.00 . A A . 693 ASP CA   1 1 
        1   521 1 1 37 ASP CB   C  -15.453  -1.720   2.370 1.00 . A A . 693 ASP CB   1 1 
        1   522 1 1 37 ASP CG   C  -16.251  -2.569   3.347 1.00 . A A . 693 ASP CG   1 1 
        1   523 1 1 37 ASP H    H  -14.563  -0.639  -0.002 1.00 . A A . 693 ASP H    1 1 
        1   524 1 1 37 ASP HA   H  -15.085  -3.358   1.034 1.00 . A A . 693 ASP HA   1 1 
        1   525 1 1 37 ASP HB2  H  -14.442  -1.630   2.745 1.00 . A A . 693 ASP HB2  1 1 
        1   526 1 1 37 ASP HB3  H  -15.899  -0.737   2.319 1.00 . A A . 693 ASP HB3  1 1 
        1   527 1 1 37 ASP N    N  -14.444  -1.603   0.129 1.00 . A A . 693 ASP N    1 1 
        1   528 1 1 37 ASP O    O  -17.179  -1.310  -0.329 1.00 . A A . 693 ASP O    1 1 
        1   529 1 1 37 ASP OD1  O  -15.726  -3.589   3.826 1.00 . A A . 693 ASP OD1  1 1 
        1   530 1 1 37 ASP OD2  O  -17.415  -2.236   3.636 1.00 . A A . 693 ASP OD2  1 1 
        1   531 1 1 38 LYS C    C  -19.924  -2.570   0.575 1.00 . A A . 694 LYS C    1 1 
        1   532 1 1 38 LYS CA   C  -18.899  -3.468  -0.138 1.00 . A A . 694 LYS CA   1 1 
        1   533 1 1 38 LYS CB   C  -19.379  -4.929  -0.120 1.00 . A A . 694 LYS CB   1 1 
        1   534 1 1 38 LYS CD   C  -21.263  -6.582  -0.542 1.00 . A A . 694 LYS CD   1 1 
        1   535 1 1 38 LYS CE   C  -20.962  -7.192  -1.912 1.00 . A A . 694 LYS CE   1 1 
        1   536 1 1 38 LYS CG   C  -20.862  -5.106  -0.455 1.00 . A A . 694 LYS CG   1 1 
        1   537 1 1 38 LYS H    H  -17.222  -4.125   0.995 1.00 . A A . 694 LYS H    1 1 
        1   538 1 1 38 LYS HA   H  -18.816  -3.146  -1.168 1.00 . A A . 694 LYS HA   1 1 
        1   539 1 1 38 LYS HB2  H  -18.802  -5.492  -0.839 1.00 . A A . 694 LYS HB2  1 1 
        1   540 1 1 38 LYS HB3  H  -19.204  -5.339   0.865 1.00 . A A . 694 LYS HB3  1 1 
        1   541 1 1 38 LYS HD2  H  -20.719  -7.137   0.210 1.00 . A A . 694 LYS HD2  1 1 
        1   542 1 1 38 LYS HD3  H  -22.323  -6.666  -0.348 1.00 . A A . 694 LYS HD3  1 1 
        1   543 1 1 38 LYS HE2  H  -21.172  -8.251  -1.872 1.00 . A A . 694 LYS HE2  1 1 
        1   544 1 1 38 LYS HE3  H  -21.609  -6.730  -2.645 1.00 . A A . 694 LYS HE3  1 1 
        1   545 1 1 38 LYS HG2  H  -21.452  -4.632   0.318 1.00 . A A . 694 LYS HG2  1 1 
        1   546 1 1 38 LYS HG3  H  -21.066  -4.628  -1.404 1.00 . A A . 694 LYS HG3  1 1 
        1   547 1 1 38 LYS HZ1  H  -19.352  -5.996  -2.496 1.00 . A A . 694 LYS HZ1  1 1 
        1   548 1 1 38 LYS HZ2  H  -19.363  -7.523  -3.211 1.00 . A A . 694 LYS HZ2  1 1 
        1   549 1 1 38 LYS HZ3  H  -18.900  -7.352  -1.596 1.00 . A A . 694 LYS HZ3  1 1 
        1   550 1 1 38 LYS N    N  -17.564  -3.372   0.467 1.00 . A A . 694 LYS N    1 1 
        1   551 1 1 38 LYS NZ   N  -19.546  -7.004  -2.331 1.00 . A A . 694 LYS NZ   1 1 
        1   552 1 1 38 LYS O    O  -20.700  -1.859  -0.068 1.00 . A A . 694 LYS O    1 1 
        1   553 1 1 39 GLU C    C  -20.611  -0.444   2.927 1.00 . A A . 695 GLU C    1 1 
        1   554 1 1 39 GLU CA   C  -20.935  -1.932   2.712 1.00 . A A . 695 GLU CA   1 1 
        1   555 1 1 39 GLU CB   C  -21.082  -2.631   4.075 1.00 . A A . 695 GLU CB   1 1 
        1   556 1 1 39 GLU CD   C  -20.203  -4.984   3.552 1.00 . A A . 695 GLU CD   1 1 
        1   557 1 1 39 GLU CG   C  -21.392  -4.130   3.992 1.00 . A A . 695 GLU CG   1 1 
        1   558 1 1 39 GLU H    H  -19.194  -3.099   2.357 1.00 . A A . 695 GLU H    1 1 
        1   559 1 1 39 GLU HA   H  -21.876  -2.006   2.185 1.00 . A A . 695 GLU HA   1 1 
        1   560 1 1 39 GLU HB2  H  -20.161  -2.509   4.629 1.00 . A A . 695 GLU HB2  1 1 
        1   561 1 1 39 GLU HB3  H  -21.881  -2.152   4.625 1.00 . A A . 695 GLU HB3  1 1 
        1   562 1 1 39 GLU HG2  H  -21.708  -4.470   4.968 1.00 . A A . 695 GLU HG2  1 1 
        1   563 1 1 39 GLU HG3  H  -22.201  -4.276   3.288 1.00 . A A . 695 GLU HG3  1 1 
        1   564 1 1 39 GLU N    N  -19.916  -2.609   1.902 1.00 . A A . 695 GLU N    1 1 
        1   565 1 1 39 GLU O    O  -21.465   0.423   2.728 1.00 . A A . 695 GLU O    1 1 
        1   566 1 1 39 GLU OE1  O  -19.047  -4.533   3.678 1.00 . A A . 695 GLU OE1  1 1 
        1   567 1 1 39 GLU OE2  O  -20.416  -6.119   3.103 1.00 . A A . 695 GLU OE2  1 1 
        1   568 1 1 40 ASP C    C  -18.566   1.994   2.401 1.00 . A A . 696 ASP C    1 1 
        1   569 1 1 40 ASP CA   C  -18.971   1.217   3.669 1.00 . A A . 696 ASP CA   1 1 
        1   570 1 1 40 ASP CB   C  -17.816   1.185   4.680 1.00 . A A . 696 ASP CB   1 1 
        1   571 1 1 40 ASP CG   C  -17.670   2.492   5.441 1.00 . A A . 696 ASP CG   1 1 
        1   572 1 1 40 ASP H    H  -18.728  -0.880   3.440 1.00 . A A . 696 ASP H    1 1 
        1   573 1 1 40 ASP HA   H  -19.819   1.713   4.123 1.00 . A A . 696 ASP HA   1 1 
        1   574 1 1 40 ASP HB2  H  -17.995   0.395   5.396 1.00 . A A . 696 ASP HB2  1 1 
        1   575 1 1 40 ASP HB3  H  -16.890   0.983   4.157 1.00 . A A . 696 ASP HB3  1 1 
        1   576 1 1 40 ASP N    N  -19.380  -0.154   3.344 1.00 . A A . 696 ASP N    1 1 
        1   577 1 1 40 ASP O    O  -18.781   3.205   2.305 1.00 . A A . 696 ASP O    1 1 
        1   578 1 1 40 ASP OD1  O  -18.580   2.812   6.239 1.00 . A A . 696 ASP OD1  1 1 
        1   579 1 1 40 ASP OD2  O  -16.657   3.197   5.255 1.00 . A A . 696 ASP OD2  1 1 
        1   580 1 1 41 GLY C    C  -16.121   1.928  -0.108 1.00 . A A . 697 GLY C    1 1 
        1   581 1 1 41 GLY CA   C  -17.623   1.910   0.155 1.00 . A A . 697 GLY CA   1 1 
        1   582 1 1 41 GLY H    H  -17.789   0.340   1.576 1.00 . A A . 697 GLY H    1 1 
        1   583 1 1 41 GLY HA2  H  -18.101   1.362  -0.643 1.00 . A A . 697 GLY HA2  1 1 
        1   584 1 1 41 GLY HA3  H  -17.990   2.928   0.141 1.00 . A A . 697 GLY HA3  1 1 
        1   585 1 1 41 GLY N    N  -17.982   1.289   1.428 1.00 . A A . 697 GLY N    1 1 
        1   586 1 1 41 GLY O    O  -15.387   1.045   0.342 1.00 . A A . 697 GLY O    1 1 
        1   587 1 1 42 ASP C    C  -13.434   3.483   0.069 1.00 . A A . 698 ASP C    1 1 
        1   588 1 1 42 ASP CA   C  -14.242   3.074  -1.175 1.00 . A A . 698 ASP CA   1 1 
        1   589 1 1 42 ASP CB   C  -14.059   4.118  -2.285 1.00 . A A . 698 ASP CB   1 1 
        1   590 1 1 42 ASP CG   C  -12.645   4.139  -2.834 1.00 . A A . 698 ASP CG   1 1 
        1   591 1 1 42 ASP H    H  -16.297   3.591  -1.198 1.00 . A A . 698 ASP H    1 1 
        1   592 1 1 42 ASP HA   H  -13.885   2.118  -1.528 1.00 . A A . 698 ASP HA   1 1 
        1   593 1 1 42 ASP HB2  H  -14.742   3.895  -3.094 1.00 . A A . 698 ASP HB2  1 1 
        1   594 1 1 42 ASP HB3  H  -14.289   5.098  -1.891 1.00 . A A . 698 ASP HB3  1 1 
        1   595 1 1 42 ASP N    N  -15.663   2.930  -0.853 1.00 . A A . 698 ASP N    1 1 
        1   596 1 1 42 ASP O    O  -13.663   4.546   0.651 1.00 . A A . 698 ASP O    1 1 
        1   597 1 1 42 ASP OD1  O  -11.755   4.729  -2.188 1.00 . A A . 698 ASP OD1  1 1 
        1   598 1 1 42 ASP OD2  O  -12.412   3.561  -3.914 1.00 . A A . 698 ASP OD2  1 1 
        1   599 1 1 43 LEU C    C  -10.219   3.271   1.295 1.00 . A A . 699 LEU C    1 1 
        1   600 1 1 43 LEU CA   C  -11.669   2.913   1.664 1.00 . A A . 699 LEU CA   1 1 
        1   601 1 1 43 LEU CB   C  -11.681   1.701   2.610 1.00 . A A . 699 LEU CB   1 1 
        1   602 1 1 43 LEU CD1  C  -12.958   0.140   4.126 1.00 . A A . 699 LEU CD1  1 1 
        1   603 1 1 43 LEU CD2  C  -14.006   2.308   3.410 1.00 . A A . 699 LEU CD2  1 1 
        1   604 1 1 43 LEU CG   C  -13.072   1.171   3.006 1.00 . A A . 699 LEU CG   1 1 
        1   605 1 1 43 LEU H    H  -12.321   1.820  -0.041 1.00 . A A . 699 LEU H    1 1 
        1   606 1 1 43 LEU HA   H  -12.108   3.758   2.180 1.00 . A A . 699 LEU HA   1 1 
        1   607 1 1 43 LEU HB2  H  -11.139   0.895   2.134 1.00 . A A . 699 LEU HB2  1 1 
        1   608 1 1 43 LEU HB3  H  -11.156   1.976   3.515 1.00 . A A . 699 LEU HB3  1 1 
        1   609 1 1 43 LEU HD11 H  -13.942  -0.233   4.376 1.00 . A A . 699 LEU HD11 1 1 
        1   610 1 1 43 LEU HD12 H  -12.516   0.599   4.999 1.00 . A A . 699 LEU HD12 1 1 
        1   611 1 1 43 LEU HD13 H  -12.336  -0.680   3.799 1.00 . A A . 699 LEU HD13 1 1 
        1   612 1 1 43 LEU HD21 H  -14.143   2.977   2.572 1.00 . A A . 699 LEU HD21 1 1 
        1   613 1 1 43 LEU HD22 H  -13.578   2.852   4.239 1.00 . A A . 699 LEU HD22 1 1 
        1   614 1 1 43 LEU HD23 H  -14.963   1.901   3.702 1.00 . A A . 699 LEU HD23 1 1 
        1   615 1 1 43 LEU HG   H  -13.509   0.674   2.152 1.00 . A A . 699 LEU HG   1 1 
        1   616 1 1 43 LEU N    N  -12.482   2.641   0.471 1.00 . A A . 699 LEU N    1 1 
        1   617 1 1 43 LEU O    O   -9.345   3.313   2.161 1.00 . A A . 699 LEU O    1 1 
        1   618 1 1 44 THR C    C   -8.037   5.100   0.287 1.00 . A A . 700 THR C    1 1 
        1   619 1 1 44 THR CA   C   -8.621   3.889  -0.463 1.00 . A A . 700 THR CA   1 1 
        1   620 1 1 44 THR CB   C   -8.617   4.193  -1.982 1.00 . A A . 700 THR CB   1 1 
        1   621 1 1 44 THR CG2  C   -7.195   4.369  -2.512 1.00 . A A . 700 THR CG2  1 1 
        1   622 1 1 44 THR H    H  -10.717   3.535  -0.627 1.00 . A A . 700 THR H    1 1 
        1   623 1 1 44 THR HA   H   -7.987   3.028  -0.289 1.00 . A A . 700 THR HA   1 1 
        1   624 1 1 44 THR HB   H   -9.164   5.110  -2.150 1.00 . A A . 700 THR HB   1 1 
        1   625 1 1 44 THR HG1  H  -10.220   3.305  -2.728 1.00 . A A . 700 THR HG1  1 1 
        1   626 1 1 44 THR HG21 H   -7.229   4.597  -3.568 1.00 . A A . 700 THR HG21 1 1 
        1   627 1 1 44 THR HG22 H   -6.635   3.457  -2.358 1.00 . A A . 700 THR HG22 1 1 
        1   628 1 1 44 THR HG23 H   -6.711   5.179  -1.988 1.00 . A A . 700 THR HG23 1 1 
        1   629 1 1 44 THR N    N   -9.974   3.554   0.016 1.00 . A A . 700 THR N    1 1 
        1   630 1 1 44 THR O    O   -6.851   5.133   0.614 1.00 . A A . 700 THR O    1 1 
        1   631 1 1 44 THR OG1  O   -9.267   3.132  -2.701 1.00 . A A . 700 THR OG1  1 1 
        1   632 1 1 45 SER C    C   -8.088   6.960   2.755 1.00 . A A . 701 SER C    1 1 
        1   633 1 1 45 SER CA   C   -8.465   7.289   1.303 1.00 . A A . 701 SER CA   1 1 
        1   634 1 1 45 SER CB   C   -9.587   8.335   1.297 1.00 . A A . 701 SER CB   1 1 
        1   635 1 1 45 SER H    H   -9.814   6.016   0.262 1.00 . A A . 701 SER H    1 1 
        1   636 1 1 45 SER HA   H   -7.600   7.701   0.803 1.00 . A A . 701 SER HA   1 1 
        1   637 1 1 45 SER HB2  H  -10.445   7.942   1.822 1.00 . A A . 701 SER HB2  1 1 
        1   638 1 1 45 SER HB3  H   -9.245   9.234   1.791 1.00 . A A . 701 SER HB3  1 1 
        1   639 1 1 45 SER HG   H  -10.804   8.199  -0.241 1.00 . A A . 701 SER HG   1 1 
        1   640 1 1 45 SER N    N   -8.884   6.088   0.566 1.00 . A A . 701 SER N    1 1 
        1   641 1 1 45 SER O    O   -7.317   7.682   3.390 1.00 . A A . 701 SER O    1 1 
        1   642 1 1 45 SER OG   O   -9.982   8.665  -0.024 1.00 . A A . 701 SER OG   1 1 
        1   643 1 1 46 LYS C    C   -7.106   4.655   4.840 1.00 . A A . 702 LYS C    1 1 
        1   644 1 1 46 LYS CA   C   -8.410   5.458   4.665 1.00 . A A . 702 LYS CA   1 1 
        1   645 1 1 46 LYS CB   C   -9.603   4.636   5.163 1.00 . A A . 702 LYS CB   1 1 
        1   646 1 1 46 LYS CD   C  -12.075   4.552   5.640 1.00 . A A . 702 LYS CD   1 1 
        1   647 1 1 46 LYS CE   C  -13.421   5.250   5.469 1.00 . A A . 702 LYS CE   1 1 
        1   648 1 1 46 LYS CG   C  -10.935   5.370   5.052 1.00 . A A . 702 LYS CG   1 1 
        1   649 1 1 46 LYS H    H   -9.190   5.294   2.698 1.00 . A A . 702 LYS H    1 1 
        1   650 1 1 46 LYS HA   H   -8.345   6.356   5.262 1.00 . A A . 702 LYS HA   1 1 
        1   651 1 1 46 LYS HB2  H   -9.668   3.725   4.584 1.00 . A A . 702 LYS HB2  1 1 
        1   652 1 1 46 LYS HB3  H   -9.443   4.381   6.202 1.00 . A A . 702 LYS HB3  1 1 
        1   653 1 1 46 LYS HD2  H  -12.112   3.593   5.144 1.00 . A A . 702 LYS HD2  1 1 
        1   654 1 1 46 LYS HD3  H  -11.885   4.407   6.693 1.00 . A A . 702 LYS HD3  1 1 
        1   655 1 1 46 LYS HE2  H  -13.391   6.196   5.990 1.00 . A A . 702 LYS HE2  1 1 
        1   656 1 1 46 LYS HE3  H  -13.590   5.427   4.416 1.00 . A A . 702 LYS HE3  1 1 
        1   657 1 1 46 LYS HG2  H  -10.865   6.308   5.586 1.00 . A A . 702 LYS HG2  1 1 
        1   658 1 1 46 LYS HG3  H  -11.142   5.565   4.008 1.00 . A A . 702 LYS HG3  1 1 
        1   659 1 1 46 LYS HZ1  H  -15.429   4.985   5.976 1.00 . A A . 702 LYS HZ1  1 1 
        1   660 1 1 46 LYS HZ2  H  -14.357   4.176   6.998 1.00 . A A . 702 LYS HZ2  1 1 
        1   661 1 1 46 LYS HZ3  H  -14.675   3.572   5.449 1.00 . A A . 702 LYS HZ3  1 1 
        1   662 1 1 46 LYS N    N   -8.630   5.859   3.271 1.00 . A A . 702 LYS N    1 1 
        1   663 1 1 46 LYS NZ   N  -14.545   4.439   6.010 1.00 . A A . 702 LYS NZ   1 1 
        1   664 1 1 46 LYS O    O   -6.707   4.351   5.965 1.00 . A A . 702 LYS O    1 1 
        1   665 1 1 47 ILE C    C   -4.071   4.255   4.517 1.00 . A A . 703 ILE C    1 1 
        1   666 1 1 47 ILE CA   C   -5.206   3.526   3.776 1.00 . A A . 703 ILE CA   1 1 
        1   667 1 1 47 ILE CB   C   -4.720   3.154   2.351 1.00 . A A . 703 ILE CB   1 1 
        1   668 1 1 47 ILE CD1  C   -5.405   1.939   0.207 1.00 . A A . 703 ILE CD1  1 1 
        1   669 1 1 47 ILE CG1  C   -5.784   2.316   1.625 1.00 . A A . 703 ILE CG1  1 1 
        1   670 1 1 47 ILE CG2  C   -3.386   2.403   2.410 1.00 . A A . 703 ILE CG2  1 1 
        1   671 1 1 47 ILE H    H   -6.787   4.620   2.862 1.00 . A A . 703 ILE H    1 1 
        1   672 1 1 47 ILE HA   H   -5.428   2.606   4.303 1.00 . A A . 703 ILE HA   1 1 
        1   673 1 1 47 ILE HB   H   -4.560   4.071   1.802 1.00 . A A . 703 ILE HB   1 1 
        1   674 1 1 47 ILE HD11 H   -4.522   1.316   0.222 1.00 . A A . 703 ILE HD11 1 1 
        1   675 1 1 47 ILE HD12 H   -5.206   2.835  -0.364 1.00 . A A . 703 ILE HD12 1 1 
        1   676 1 1 47 ILE HD13 H   -6.220   1.396  -0.249 1.00 . A A . 703 ILE HD13 1 1 
        1   677 1 1 47 ILE HG12 H   -5.951   1.400   2.176 1.00 . A A . 703 ILE HG12 1 1 
        1   678 1 1 47 ILE HG13 H   -6.708   2.875   1.584 1.00 . A A . 703 ILE HG13 1 1 
        1   679 1 1 47 ILE HG21 H   -3.503   1.499   2.990 1.00 . A A . 703 ILE HG21 1 1 
        1   680 1 1 47 ILE HG22 H   -2.637   3.032   2.873 1.00 . A A . 703 ILE HG22 1 1 
        1   681 1 1 47 ILE HG23 H   -3.069   2.148   1.409 1.00 . A A . 703 ILE HG23 1 1 
        1   682 1 1 47 ILE N    N   -6.442   4.323   3.732 1.00 . A A . 703 ILE N    1 1 
        1   683 1 1 47 ILE O    O   -3.693   5.373   4.164 1.00 . A A . 703 ILE O    1 1 
        1   684 1 1 48 LYS C    C   -1.083   3.668   5.671 1.00 . A A . 704 LYS C    1 1 
        1   685 1 1 48 LYS CA   C   -2.401   4.136   6.306 1.00 . A A . 704 LYS CA   1 1 
        1   686 1 1 48 LYS CB   C   -2.488   3.658   7.764 1.00 . A A . 704 LYS CB   1 1 
        1   687 1 1 48 LYS CD   C   -1.520   5.728   8.871 1.00 . A A . 704 LYS CD   1 1 
        1   688 1 1 48 LYS CE   C   -2.875   6.142   9.447 1.00 . A A . 704 LYS CE   1 1 
        1   689 1 1 48 LYS CG   C   -1.404   4.215   8.685 1.00 . A A . 704 LYS CG   1 1 
        1   690 1 1 48 LYS H    H   -3.927   2.754   5.818 1.00 . A A . 704 LYS H    1 1 
        1   691 1 1 48 LYS HA   H   -2.444   5.218   6.280 1.00 . A A . 704 LYS HA   1 1 
        1   692 1 1 48 LYS HB2  H   -3.450   3.947   8.164 1.00 . A A . 704 LYS HB2  1 1 
        1   693 1 1 48 LYS HB3  H   -2.420   2.579   7.778 1.00 . A A . 704 LYS HB3  1 1 
        1   694 1 1 48 LYS HD2  H   -0.741   6.056   9.545 1.00 . A A . 704 LYS HD2  1 1 
        1   695 1 1 48 LYS HD3  H   -1.386   6.207   7.911 1.00 . A A . 704 LYS HD3  1 1 
        1   696 1 1 48 LYS HE2  H   -2.884   7.214   9.576 1.00 . A A . 704 LYS HE2  1 1 
        1   697 1 1 48 LYS HE3  H   -3.651   5.863   8.748 1.00 . A A . 704 LYS HE3  1 1 
        1   698 1 1 48 LYS HG2  H   -1.489   3.740   9.651 1.00 . A A . 704 LYS HG2  1 1 
        1   699 1 1 48 LYS HG3  H   -0.436   3.988   8.259 1.00 . A A . 704 LYS HG3  1 1 
        1   700 1 1 48 LYS HZ1  H   -2.408   5.726  11.442 1.00 . A A . 704 LYS HZ1  1 1 
        1   701 1 1 48 LYS HZ2  H   -3.218   4.469  10.655 1.00 . A A . 704 LYS HZ2  1 1 
        1   702 1 1 48 LYS HZ3  H   -4.063   5.847  11.140 1.00 . A A . 704 LYS HZ3  1 1 
        1   703 1 1 48 LYS N    N   -3.541   3.610   5.551 1.00 . A A . 704 LYS N    1 1 
        1   704 1 1 48 LYS NZ   N   -3.159   5.502  10.760 1.00 . A A . 704 LYS NZ   1 1 
        1   705 1 1 48 LYS O    O   -0.816   2.469   5.603 1.00 . A A . 704 LYS O    1 1 
        1   706 1 1 49 VAL C    C    2.199   4.512   5.426 1.00 . A A . 705 VAL C    1 1 
        1   707 1 1 49 VAL CA   C    0.983   4.294   4.513 1.00 . A A . 705 VAL CA   1 1 
        1   708 1 1 49 VAL CB   C    1.147   5.154   3.232 1.00 . A A . 705 VAL CB   1 1 
        1   709 1 1 49 VAL CG1  C    2.429   4.786   2.483 1.00 . A A . 705 VAL CG1  1 1 
        1   710 1 1 49 VAL CG2  C   -0.076   5.014   2.324 1.00 . A A . 705 VAL CG2  1 1 
        1   711 1 1 49 VAL H    H   -0.523   5.554   5.328 1.00 . A A . 705 VAL H    1 1 
        1   712 1 1 49 VAL HA   H    0.951   3.252   4.219 1.00 . A A . 705 VAL HA   1 1 
        1   713 1 1 49 VAL HB   H    1.223   6.191   3.533 1.00 . A A . 705 VAL HB   1 1 
        1   714 1 1 49 VAL HG11 H    2.391   3.746   2.188 1.00 . A A . 705 VAL HG11 1 1 
        1   715 1 1 49 VAL HG12 H    3.284   4.947   3.125 1.00 . A A . 705 VAL HG12 1 1 
        1   716 1 1 49 VAL HG13 H    2.522   5.406   1.602 1.00 . A A . 705 VAL HG13 1 1 
        1   717 1 1 49 VAL HG21 H   -0.179   3.985   2.011 1.00 . A A . 705 VAL HG21 1 1 
        1   718 1 1 49 VAL HG22 H    0.046   5.644   1.454 1.00 . A A . 705 VAL HG22 1 1 
        1   719 1 1 49 VAL HG23 H   -0.964   5.315   2.864 1.00 . A A . 705 VAL HG23 1 1 
        1   720 1 1 49 VAL N    N   -0.274   4.614   5.204 1.00 . A A . 705 VAL N    1 1 
        1   721 1 1 49 VAL O    O    2.598   5.648   5.689 1.00 . A A . 705 VAL O    1 1 
        1   722 1 1 50 ASP C    C    5.245   3.069   6.104 1.00 . A A . 706 ASP C    1 1 
        1   723 1 1 50 ASP CA   C    3.940   3.494   6.809 1.00 . A A . 706 ASP CA   1 1 
        1   724 1 1 50 ASP CB   C    3.685   2.623   8.048 1.00 . A A . 706 ASP CB   1 1 
        1   725 1 1 50 ASP CG   C    4.673   2.913   9.163 1.00 . A A . 706 ASP CG   1 1 
        1   726 1 1 50 ASP H    H    2.450   2.542   5.634 1.00 . A A . 706 ASP H    1 1 
        1   727 1 1 50 ASP HA   H    4.045   4.524   7.125 1.00 . A A . 706 ASP HA   1 1 
        1   728 1 1 50 ASP HB2  H    2.686   2.814   8.418 1.00 . A A . 706 ASP HB2  1 1 
        1   729 1 1 50 ASP HB3  H    3.765   1.580   7.775 1.00 . A A . 706 ASP HB3  1 1 
        1   730 1 1 50 ASP N    N    2.792   3.420   5.900 1.00 . A A . 706 ASP N    1 1 
        1   731 1 1 50 ASP O    O    5.234   2.220   5.210 1.00 . A A . 706 ASP O    1 1 
        1   732 1 1 50 ASP OD1  O    4.565   3.991   9.783 1.00 . A A . 706 ASP OD1  1 1 
        1   733 1 1 50 ASP OD2  O    5.556   2.070   9.428 1.00 . A A . 706 ASP OD2  1 1 
        1   734 1 1 51 GLY C    C    8.061   4.448   4.861 1.00 . A A . 707 GLY C    1 1 
        1   735 1 1 51 GLY CA   C    7.651   3.380   5.875 1.00 . A A . 707 GLY CA   1 1 
        1   736 1 1 51 GLY H    H    6.322   4.310   7.251 1.00 . A A . 707 GLY H    1 1 
        1   737 1 1 51 GLY HA2  H    8.409   3.319   6.642 1.00 . A A . 707 GLY HA2  1 1 
        1   738 1 1 51 GLY HA3  H    7.590   2.426   5.371 1.00 . A A . 707 GLY HA3  1 1 
        1   739 1 1 51 GLY N    N    6.365   3.667   6.511 1.00 . A A . 707 GLY N    1 1 
        1   740 1 1 51 GLY O    O    7.323   5.412   4.628 1.00 . A A . 707 GLY O    1 1 
        1   741 1 1 52 GLU C    C   10.629   4.612   2.198 1.00 . A A . 708 GLU C    1 1 
        1   742 1 1 52 GLU CA   C    9.741   5.262   3.277 1.00 . A A . 708 GLU CA   1 1 
        1   743 1 1 52 GLU CB   C   10.535   6.357   4.006 1.00 . A A . 708 GLU CB   1 1 
        1   744 1 1 52 GLU CD   C    9.867   8.275   2.481 1.00 . A A . 708 GLU CD   1 1 
        1   745 1 1 52 GLU CG   C   11.015   7.487   3.096 1.00 . A A . 708 GLU CG   1 1 
        1   746 1 1 52 GLU H    H    9.766   3.481   4.438 1.00 . A A . 708 GLU H    1 1 
        1   747 1 1 52 GLU HA   H    8.888   5.717   2.792 1.00 . A A . 708 GLU HA   1 1 
        1   748 1 1 52 GLU HB2  H    9.910   6.785   4.777 1.00 . A A . 708 GLU HB2  1 1 
        1   749 1 1 52 GLU HB3  H   11.402   5.908   4.472 1.00 . A A . 708 GLU HB3  1 1 
        1   750 1 1 52 GLU HG2  H   11.628   8.162   3.677 1.00 . A A . 708 GLU HG2  1 1 
        1   751 1 1 52 GLU HG3  H   11.609   7.061   2.301 1.00 . A A . 708 GLU HG3  1 1 
        1   752 1 1 52 GLU N    N    9.232   4.278   4.243 1.00 . A A . 708 GLU N    1 1 
        1   753 1 1 52 GLU O    O   11.514   3.810   2.504 1.00 . A A . 708 GLU O    1 1 
        1   754 1 1 52 GLU OE1  O    9.268   7.796   1.494 1.00 . A A . 708 GLU OE1  1 1 
        1   755 1 1 52 GLU OE2  O    9.559   9.377   2.980 1.00 . A A . 708 GLU OE2  1 1 
        1   756 1 1 53 VAL C    C   12.022   5.652  -0.802 1.00 . A A . 709 VAL C    1 1 
        1   757 1 1 53 VAL CA   C   11.199   4.506  -0.196 1.00 . A A . 709 VAL CA   1 1 
        1   758 1 1 53 VAL CB   C   10.319   3.881  -1.311 1.00 . A A . 709 VAL CB   1 1 
        1   759 1 1 53 VAL CG1  C   11.170   3.464  -2.514 1.00 . A A . 709 VAL CG1  1 1 
        1   760 1 1 53 VAL CG2  C    9.532   2.693  -0.771 1.00 . A A . 709 VAL CG2  1 1 
        1   761 1 1 53 VAL H    H    9.640   5.590   0.758 1.00 . A A . 709 VAL H    1 1 
        1   762 1 1 53 VAL HA   H   11.875   3.742   0.170 1.00 . A A . 709 VAL HA   1 1 
        1   763 1 1 53 VAL HB   H    9.611   4.629  -1.644 1.00 . A A . 709 VAL HB   1 1 
        1   764 1 1 53 VAL HG11 H   11.918   2.749  -2.200 1.00 . A A . 709 VAL HG11 1 1 
        1   765 1 1 53 VAL HG12 H   11.658   4.333  -2.931 1.00 . A A . 709 VAL HG12 1 1 
        1   766 1 1 53 VAL HG13 H   10.536   3.013  -3.266 1.00 . A A . 709 VAL HG13 1 1 
        1   767 1 1 53 VAL HG21 H    8.908   2.288  -1.553 1.00 . A A . 709 VAL HG21 1 1 
        1   768 1 1 53 VAL HG22 H    8.910   3.019   0.051 1.00 . A A . 709 VAL HG22 1 1 
        1   769 1 1 53 VAL HG23 H   10.216   1.931  -0.426 1.00 . A A . 709 VAL HG23 1 1 
        1   770 1 1 53 VAL N    N   10.386   4.979   0.936 1.00 . A A . 709 VAL N    1 1 
        1   771 1 1 53 VAL O    O   11.469   6.657  -1.252 1.00 . A A . 709 VAL O    1 1 
        1   772 1 1 54 ASP C    C   14.677   6.084  -2.813 1.00 . A A . 710 ASP C    1 1 
        1   773 1 1 54 ASP CA   C   14.236   6.501  -1.397 1.00 . A A . 710 ASP CA   1 1 
        1   774 1 1 54 ASP CB   C   15.463   6.703  -0.503 1.00 . A A . 710 ASP CB   1 1 
        1   775 1 1 54 ASP CG   C   16.432   7.704  -1.093 1.00 . A A . 710 ASP CG   1 1 
        1   776 1 1 54 ASP H    H   13.729   4.696  -0.407 1.00 . A A . 710 ASP H    1 1 
        1   777 1 1 54 ASP HA   H   13.693   7.435  -1.462 1.00 . A A . 710 ASP HA   1 1 
        1   778 1 1 54 ASP HB2  H   15.149   7.058   0.466 1.00 . A A . 710 ASP HB2  1 1 
        1   779 1 1 54 ASP HB3  H   15.974   5.756  -0.385 1.00 . A A . 710 ASP HB3  1 1 
        1   780 1 1 54 ASP N    N   13.343   5.499  -0.807 1.00 . A A . 710 ASP N    1 1 
        1   781 1 1 54 ASP O    O   14.974   4.915  -3.062 1.00 . A A . 710 ASP O    1 1 
        1   782 1 1 54 ASP OD1  O   16.132   8.914  -1.091 1.00 . A A . 710 ASP OD1  1 1 
        1   783 1 1 54 ASP OD2  O   17.490   7.285  -1.584 1.00 . A A . 710 ASP OD2  1 1 
        1   784 1 1 55 THR C    C   16.477   7.396  -5.488 1.00 . A A . 711 THR C    1 1 
        1   785 1 1 55 THR CA   C   15.117   6.773  -5.125 1.00 . A A . 711 THR CA   1 1 
        1   786 1 1 55 THR CB   C   14.046   7.278  -6.129 1.00 . A A . 711 THR CB   1 1 
        1   787 1 1 55 THR CG2  C   12.713   6.570  -5.907 1.00 . A A . 711 THR CG2  1 1 
        1   788 1 1 55 THR H    H   14.488   7.964  -3.479 1.00 . A A . 711 THR H    1 1 
        1   789 1 1 55 THR HA   H   15.196   5.700  -5.240 1.00 . A A . 711 THR HA   1 1 
        1   790 1 1 55 THR HB   H   14.385   7.061  -7.134 1.00 . A A . 711 THR HB   1 1 
        1   791 1 1 55 THR HG1  H   13.377   9.027  -6.774 1.00 . A A . 711 THR HG1  1 1 
        1   792 1 1 55 THR HG21 H   12.839   5.507  -6.053 1.00 . A A . 711 THR HG21 1 1 
        1   793 1 1 55 THR HG22 H   11.983   6.945  -6.612 1.00 . A A . 711 THR HG22 1 1 
        1   794 1 1 55 THR HG23 H   12.368   6.758  -4.900 1.00 . A A . 711 THR HG23 1 1 
        1   795 1 1 55 THR N    N   14.726   7.048  -3.735 1.00 . A A . 711 THR N    1 1 
        1   796 1 1 55 THR O    O   16.836   7.466  -6.661 1.00 . A A . 711 THR O    1 1 
        1   797 1 1 55 THR OG1  O   13.858   8.697  -6.000 1.00 . A A . 711 THR OG1  1 1 
        1   798 1 1 56 THR C    C   19.675   7.349  -4.348 1.00 . A A . 712 THR C    1 1 
        1   799 1 1 56 THR CA   C   18.598   8.376  -4.729 1.00 . A A . 712 THR CA   1 1 
        1   800 1 1 56 THR CB   C   18.862   9.685  -3.940 1.00 . A A . 712 THR CB   1 1 
        1   801 1 1 56 THR CG2  C   17.869  10.773  -4.339 1.00 . A A . 712 THR CG2  1 1 
        1   802 1 1 56 THR H    H   16.890   7.817  -3.570 1.00 . A A . 712 THR H    1 1 
        1   803 1 1 56 THR HA   H   18.688   8.595  -5.786 1.00 . A A . 712 THR HA   1 1 
        1   804 1 1 56 THR HB   H   19.861  10.031  -4.173 1.00 . A A . 712 THR HB   1 1 
        1   805 1 1 56 THR HG1  H   17.848   9.478  -2.249 1.00 . A A . 712 THR HG1  1 1 
        1   806 1 1 56 THR HG21 H   18.083  11.678  -3.787 1.00 . A A . 712 THR HG21 1 1 
        1   807 1 1 56 THR HG22 H   16.865  10.444  -4.114 1.00 . A A . 712 THR HG22 1 1 
        1   808 1 1 56 THR HG23 H   17.955  10.970  -5.399 1.00 . A A . 712 THR HG23 1 1 
        1   809 1 1 56 THR N    N   17.240   7.843  -4.488 1.00 . A A . 712 THR N    1 1 
        1   810 1 1 56 THR O    O   20.788   7.361  -4.878 1.00 . A A . 712 THR O    1 1 
        1   811 1 1 56 THR OG1  O   18.774   9.445  -2.526 1.00 . A A . 712 THR OG1  1 1 
        1   812 1 1 57 LYS C    C   19.626   4.016  -3.293 1.00 . A A . 713 LYS C    1 1 
        1   813 1 1 57 LYS CA   C   20.220   5.394  -2.961 1.00 . A A . 713 LYS CA   1 1 
        1   814 1 1 57 LYS CB   C   20.473   5.517  -1.440 1.00 . A A . 713 LYS CB   1 1 
        1   815 1 1 57 LYS CD   C   21.690   7.768  -1.409 1.00 . A A . 713 LYS CD   1 1 
        1   816 1 1 57 LYS CE   C   20.940   8.583  -0.353 1.00 . A A . 713 LYS CE   1 1 
        1   817 1 1 57 LYS CG   C   21.754   6.275  -1.069 1.00 . A A . 713 LYS CG   1 1 
        1   818 1 1 57 LYS H    H   18.438   6.534  -3.019 1.00 . A A . 713 LYS H    1 1 
        1   819 1 1 57 LYS HA   H   21.161   5.497  -3.484 1.00 . A A . 713 LYS HA   1 1 
        1   820 1 1 57 LYS HB2  H   19.636   6.038  -0.994 1.00 . A A . 713 LYS HB2  1 1 
        1   821 1 1 57 LYS HB3  H   20.528   4.528  -1.009 1.00 . A A . 713 LYS HB3  1 1 
        1   822 1 1 57 LYS HD2  H   22.699   8.148  -1.486 1.00 . A A . 713 LYS HD2  1 1 
        1   823 1 1 57 LYS HD3  H   21.192   7.887  -2.362 1.00 . A A . 713 LYS HD3  1 1 
        1   824 1 1 57 LYS HE2  H   21.427   8.443   0.603 1.00 . A A . 713 LYS HE2  1 1 
        1   825 1 1 57 LYS HE3  H   20.988   9.628  -0.625 1.00 . A A . 713 LYS HE3  1 1 
        1   826 1 1 57 LYS HG2  H   21.924   6.171  -0.007 1.00 . A A . 713 LYS HG2  1 1 
        1   827 1 1 57 LYS HG3  H   22.584   5.831  -1.604 1.00 . A A . 713 LYS HG3  1 1 
        1   828 1 1 57 LYS HZ1  H   19.438   7.215   0.137 1.00 . A A . 713 LYS HZ1  1 1 
        1   829 1 1 57 LYS HZ2  H   19.038   8.237  -1.150 1.00 . A A . 713 LYS HZ2  1 1 
        1   830 1 1 57 LYS HZ3  H   19.022   8.825   0.428 1.00 . A A . 713 LYS HZ3  1 1 
        1   831 1 1 57 LYS N    N   19.331   6.467  -3.416 1.00 . A A . 713 LYS N    1 1 
        1   832 1 1 57 LYS NZ   N   19.513   8.186  -0.226 1.00 . A A . 713 LYS NZ   1 1 
        1   833 1 1 57 LYS O    O   18.433   3.778  -3.104 1.00 . A A . 713 LYS O    1 1 
        1   834 1 1 58 ALA C    C   19.827   0.896  -2.885 1.00 . A A . 714 ALA C    1 1 
        1   835 1 1 58 ALA CA   C   20.025   1.759  -4.141 1.00 . A A . 714 ALA CA   1 1 
        1   836 1 1 58 ALA CB   C   21.030   1.101  -5.081 1.00 . A A . 714 ALA CB   1 1 
        1   837 1 1 58 ALA H    H   21.398   3.365  -3.948 1.00 . A A . 714 ALA H    1 1 
        1   838 1 1 58 ALA HA   H   19.081   1.838  -4.664 1.00 . A A . 714 ALA HA   1 1 
        1   839 1 1 58 ALA HB1  H   20.665   0.128  -5.377 1.00 . A A . 714 ALA HB1  1 1 
        1   840 1 1 58 ALA HB2  H   21.979   0.993  -4.577 1.00 . A A . 714 ALA HB2  1 1 
        1   841 1 1 58 ALA HB3  H   21.159   1.718  -5.959 1.00 . A A . 714 ALA HB3  1 1 
        1   842 1 1 58 ALA N    N   20.464   3.115  -3.800 1.00 . A A . 714 ALA N    1 1 
        1   843 1 1 58 ALA O    O   20.644   0.928  -1.963 1.00 . A A . 714 ALA O    1 1 
        1   844 1 1 59 GLY C    C   17.019  -1.184  -1.622 1.00 . A A . 715 GLY C    1 1 
        1   845 1 1 59 GLY CA   C   18.473  -0.738  -1.704 1.00 . A A . 715 GLY CA   1 1 
        1   846 1 1 59 GLY H    H   18.134   0.121  -3.619 1.00 . A A . 715 GLY H    1 1 
        1   847 1 1 59 GLY HA2  H   19.099  -1.615  -1.770 1.00 . A A . 715 GLY HA2  1 1 
        1   848 1 1 59 GLY HA3  H   18.723  -0.201  -0.800 1.00 . A A . 715 GLY HA3  1 1 
        1   849 1 1 59 GLY N    N   18.749   0.119  -2.854 1.00 . A A . 715 GLY N    1 1 
        1   850 1 1 59 GLY O    O   16.204  -0.824  -2.472 1.00 . A A . 715 GLY O    1 1 
        1   851 1 1 60 THR C    C   14.583  -1.681   0.703 1.00 . A A . 716 THR C    1 1 
        1   852 1 1 60 THR CA   C   15.315  -2.458  -0.403 1.00 . A A . 716 THR CA   1 1 
        1   853 1 1 60 THR CB   C   15.293  -3.971  -0.071 1.00 . A A . 716 THR CB   1 1 
        1   854 1 1 60 THR CG2  C   13.875  -4.460   0.219 1.00 . A A . 716 THR CG2  1 1 
        1   855 1 1 60 THR H    H   17.379  -2.212   0.056 1.00 . A A . 716 THR H    1 1 
        1   856 1 1 60 THR HA   H   14.782  -2.314  -1.334 1.00 . A A . 716 THR HA   1 1 
        1   857 1 1 60 THR HB   H   15.904  -4.143   0.806 1.00 . A A . 716 THR HB   1 1 
        1   858 1 1 60 THR HG1  H   16.547  -5.286  -0.846 1.00 . A A . 716 THR HG1  1 1 
        1   859 1 1 60 THR HG21 H   13.894  -5.519   0.428 1.00 . A A . 716 THR HG21 1 1 
        1   860 1 1 60 THR HG22 H   13.246  -4.276  -0.640 1.00 . A A . 716 THR HG22 1 1 
        1   861 1 1 60 THR HG23 H   13.478  -3.933   1.074 1.00 . A A . 716 THR HG23 1 1 
        1   862 1 1 60 THR N    N   16.688  -1.965  -0.594 1.00 . A A . 716 THR N    1 1 
        1   863 1 1 60 THR O    O   15.109  -1.489   1.801 1.00 . A A . 716 THR O    1 1 
        1   864 1 1 60 THR OG1  O   15.836  -4.720  -1.168 1.00 . A A . 716 THR OG1  1 1 
        1   865 1 1 61 TYR C    C   11.127  -1.101   1.419 1.00 . A A . 717 TYR C    1 1 
        1   866 1 1 61 TYR CA   C   12.535  -0.479   1.343 1.00 . A A . 717 TYR CA   1 1 
        1   867 1 1 61 TYR CB   C   12.437   0.993   0.904 1.00 . A A . 717 TYR CB   1 1 
        1   868 1 1 61 TYR CD1  C   14.633   2.156   1.434 1.00 . A A . 717 TYR CD1  1 1 
        1   869 1 1 61 TYR CD2  C   14.170   1.602  -0.840 1.00 . A A . 717 TYR CD2  1 1 
        1   870 1 1 61 TYR CE1  C   15.850   2.694   1.057 1.00 . A A . 717 TYR CE1  1 1 
        1   871 1 1 61 TYR CE2  C   15.384   2.141  -1.222 1.00 . A A . 717 TYR CE2  1 1 
        1   872 1 1 61 TYR CG   C   13.770   1.599   0.493 1.00 . A A . 717 TYR CG   1 1 
        1   873 1 1 61 TYR CZ   C   16.221   2.686  -0.271 1.00 . A A . 717 TYR CZ   1 1 
        1   874 1 1 61 TYR H    H   13.020  -1.399  -0.502 1.00 . A A . 717 TYR H    1 1 
        1   875 1 1 61 TYR HA   H   12.997  -0.530   2.320 1.00 . A A . 717 TYR HA   1 1 
        1   876 1 1 61 TYR HB2  H   11.765   1.067   0.061 1.00 . A A . 717 TYR HB2  1 1 
        1   877 1 1 61 TYR HB3  H   12.042   1.580   1.722 1.00 . A A . 717 TYR HB3  1 1 
        1   878 1 1 61 TYR HD1  H   14.342   2.165   2.475 1.00 . A A . 717 TYR HD1  1 1 
        1   879 1 1 61 TYR HD2  H   13.512   1.175  -1.586 1.00 . A A . 717 TYR HD2  1 1 
        1   880 1 1 61 TYR HE1  H   16.505   3.117   1.802 1.00 . A A . 717 TYR HE1  1 1 
        1   881 1 1 61 TYR HE2  H   15.673   2.132  -2.263 1.00 . A A . 717 TYR HE2  1 1 
        1   882 1 1 61 TYR HH   H   17.325   3.719  -1.465 1.00 . A A . 717 TYR HH   1 1 
        1   883 1 1 61 TYR N    N   13.369  -1.229   0.395 1.00 . A A . 717 TYR N    1 1 
        1   884 1 1 61 TYR O    O   10.458  -1.262   0.397 1.00 . A A . 717 TYR O    1 1 
        1   885 1 1 61 TYR OH   O   17.435   3.215  -0.649 1.00 . A A . 717 TYR OH   1 1 
        1   886 1 1 62 VAL C    C    8.293  -1.154   3.305 1.00 . A A . 718 VAL C    1 1 
        1   887 1 1 62 VAL CA   C    9.379  -2.122   2.796 1.00 . A A . 718 VAL CA   1 1 
        1   888 1 1 62 VAL CB   C    9.487  -3.323   3.772 1.00 . A A . 718 VAL CB   1 1 
        1   889 1 1 62 VAL CG1  C    8.141  -4.033   3.919 1.00 . A A . 718 VAL CG1  1 1 
        1   890 1 1 62 VAL CG2  C   10.567  -4.302   3.309 1.00 . A A . 718 VAL CG2  1 1 
        1   891 1 1 62 VAL H    H   11.231  -1.268   3.413 1.00 . A A . 718 VAL H    1 1 
        1   892 1 1 62 VAL HA   H    9.071  -2.505   1.830 1.00 . A A . 718 VAL HA   1 1 
        1   893 1 1 62 VAL HB   H    9.772  -2.943   4.744 1.00 . A A . 718 VAL HB   1 1 
        1   894 1 1 62 VAL HG11 H    7.401  -3.336   4.286 1.00 . A A . 718 VAL HG11 1 1 
        1   895 1 1 62 VAL HG12 H    8.238  -4.851   4.618 1.00 . A A . 718 VAL HG12 1 1 
        1   896 1 1 62 VAL HG13 H    7.827  -4.417   2.959 1.00 . A A . 718 VAL HG13 1 1 
        1   897 1 1 62 VAL HG21 H   11.518  -3.792   3.253 1.00 . A A . 718 VAL HG21 1 1 
        1   898 1 1 62 VAL HG22 H   10.309  -4.691   2.334 1.00 . A A . 718 VAL HG22 1 1 
        1   899 1 1 62 VAL HG23 H   10.641  -5.120   4.013 1.00 . A A . 718 VAL HG23 1 1 
        1   900 1 1 62 VAL N    N   10.680  -1.456   2.622 1.00 . A A . 718 VAL N    1 1 
        1   901 1 1 62 VAL O    O    8.426  -0.551   4.373 1.00 . A A . 718 VAL O    1 1 
        1   902 1 1 63 LEU C    C    4.933  -0.952   3.525 1.00 . A A . 719 LEU C    1 1 
        1   903 1 1 63 LEU CA   C    6.090  -0.150   2.914 1.00 . A A . 719 LEU CA   1 1 
        1   904 1 1 63 LEU CB   C    5.589   0.612   1.683 1.00 . A A . 719 LEU CB   1 1 
        1   905 1 1 63 LEU CD1  C    6.043   2.188  -0.228 1.00 . A A . 719 LEU CD1  1 1 
        1   906 1 1 63 LEU CD2  C    7.098   2.597   2.012 1.00 . A A . 719 LEU CD2  1 1 
        1   907 1 1 63 LEU CG   C    6.622   1.536   1.024 1.00 . A A . 719 LEU CG   1 1 
        1   908 1 1 63 LEU H    H    7.162  -1.524   1.698 1.00 . A A . 719 LEU H    1 1 
        1   909 1 1 63 LEU HA   H    6.447   0.563   3.646 1.00 . A A . 719 LEU HA   1 1 
        1   910 1 1 63 LEU HB2  H    5.261  -0.112   0.949 1.00 . A A . 719 LEU HB2  1 1 
        1   911 1 1 63 LEU HB3  H    4.738   1.211   1.977 1.00 . A A . 719 LEU HB3  1 1 
        1   912 1 1 63 LEU HD11 H    5.194   2.798   0.042 1.00 . A A . 719 LEU HD11 1 1 
        1   913 1 1 63 LEU HD12 H    5.730   1.422  -0.921 1.00 . A A . 719 LEU HD12 1 1 
        1   914 1 1 63 LEU HD13 H    6.797   2.806  -0.695 1.00 . A A . 719 LEU HD13 1 1 
        1   915 1 1 63 LEU HD21 H    6.258   3.202   2.328 1.00 . A A . 719 LEU HD21 1 1 
        1   916 1 1 63 LEU HD22 H    7.835   3.226   1.535 1.00 . A A . 719 LEU HD22 1 1 
        1   917 1 1 63 LEU HD23 H    7.541   2.117   2.874 1.00 . A A . 719 LEU HD23 1 1 
        1   918 1 1 63 LEU HG   H    7.480   0.950   0.725 1.00 . A A . 719 LEU HG   1 1 
        1   919 1 1 63 LEU N    N    7.211  -1.021   2.540 1.00 . A A . 719 LEU N    1 1 
        1   920 1 1 63 LEU O    O    4.662  -2.076   3.110 1.00 . A A . 719 LEU O    1 1 
        1   921 1 1 64 THR C    C    1.797  -0.250   4.850 1.00 . A A . 720 THR C    1 1 
        1   922 1 1 64 THR CA   C    3.097  -1.008   5.153 1.00 . A A . 720 THR CA   1 1 
        1   923 1 1 64 THR CB   C    3.278  -1.091   6.689 1.00 . A A . 720 THR CB   1 1 
        1   924 1 1 64 THR CG2  C    2.100  -1.808   7.351 1.00 . A A . 720 THR CG2  1 1 
        1   925 1 1 64 THR H    H    4.530   0.526   4.808 1.00 . A A . 720 THR H    1 1 
        1   926 1 1 64 THR HA   H    3.013  -2.017   4.766 1.00 . A A . 720 THR HA   1 1 
        1   927 1 1 64 THR HB   H    3.338  -0.087   7.085 1.00 . A A . 720 THR HB   1 1 
        1   928 1 1 64 THR HG1  H    4.616  -1.794   7.960 1.00 . A A . 720 THR HG1  1 1 
        1   929 1 1 64 THR HG21 H    1.193  -1.245   7.183 1.00 . A A . 720 THR HG21 1 1 
        1   930 1 1 64 THR HG22 H    2.280  -1.891   8.414 1.00 . A A . 720 THR HG22 1 1 
        1   931 1 1 64 THR HG23 H    1.992  -2.797   6.927 1.00 . A A . 720 THR HG23 1 1 
        1   932 1 1 64 THR N    N    4.251  -0.364   4.505 1.00 . A A . 720 THR N    1 1 
        1   933 1 1 64 THR O    O    1.748   0.975   4.934 1.00 . A A . 720 THR O    1 1 
        1   934 1 1 64 THR OG1  O    4.494  -1.786   7.004 1.00 . A A . 720 THR OG1  1 1 
        1   935 1 1 65 TYR C    C   -1.667  -1.017   5.042 1.00 . A A . 721 TYR C    1 1 
        1   936 1 1 65 TYR CA   C   -0.558  -0.391   4.183 1.00 . A A . 721 TYR CA   1 1 
        1   937 1 1 65 TYR CB   C   -0.881  -0.579   2.693 1.00 . A A . 721 TYR CB   1 1 
        1   938 1 1 65 TYR CD1  C    0.125   1.335   1.371 1.00 . A A . 721 TYR CD1  1 1 
        1   939 1 1 65 TYR CD2  C    1.211  -0.789   1.283 1.00 . A A . 721 TYR CD2  1 1 
        1   940 1 1 65 TYR CE1  C    1.083   1.864   0.526 1.00 . A A . 721 TYR CE1  1 1 
        1   941 1 1 65 TYR CE2  C    2.172  -0.268   0.440 1.00 . A A . 721 TYR CE2  1 1 
        1   942 1 1 65 TYR CG   C    0.171   0.000   1.763 1.00 . A A . 721 TYR CG   1 1 
        1   943 1 1 65 TYR CZ   C    2.105   1.058   0.064 1.00 . A A . 721 TYR CZ   1 1 
        1   944 1 1 65 TYR H    H    0.848  -1.960   4.444 1.00 . A A . 721 TYR H    1 1 
        1   945 1 1 65 TYR HA   H   -0.504   0.667   4.401 1.00 . A A . 721 TYR HA   1 1 
        1   946 1 1 65 TYR HB2  H   -0.967  -1.634   2.479 1.00 . A A . 721 TYR HB2  1 1 
        1   947 1 1 65 TYR HB3  H   -1.823  -0.096   2.471 1.00 . A A . 721 TYR HB3  1 1 
        1   948 1 1 65 TYR HD1  H   -0.677   1.964   1.736 1.00 . A A . 721 TYR HD1  1 1 
        1   949 1 1 65 TYR HD2  H    1.262  -1.827   1.577 1.00 . A A . 721 TYR HD2  1 1 
        1   950 1 1 65 TYR HE1  H    1.029   2.902   0.230 1.00 . A A . 721 TYR HE1  1 1 
        1   951 1 1 65 TYR HE2  H    2.972  -0.898   0.080 1.00 . A A . 721 TYR HE2  1 1 
        1   952 1 1 65 TYR HH   H    3.382   2.414  -0.419 1.00 . A A . 721 TYR HH   1 1 
        1   953 1 1 65 TYR N    N    0.747  -0.987   4.497 1.00 . A A . 721 TYR N    1 1 
        1   954 1 1 65 TYR O    O   -1.967  -2.205   4.913 1.00 . A A . 721 TYR O    1 1 
        1   955 1 1 65 TYR OH   O    3.063   1.578  -0.775 1.00 . A A . 721 TYR OH   1 1 
        1   956 1 1 66 THR C    C   -4.637   0.087   6.611 1.00 . A A . 722 THR C    1 1 
        1   957 1 1 66 THR CA   C   -3.337  -0.703   6.812 1.00 . A A . 722 THR CA   1 1 
        1   958 1 1 66 THR CB   C   -2.915  -0.598   8.298 1.00 . A A . 722 THR CB   1 1 
        1   959 1 1 66 THR CG2  C   -3.992  -1.158   9.224 1.00 . A A . 722 THR CG2  1 1 
        1   960 1 1 66 THR H    H   -1.985   0.721   5.980 1.00 . A A . 722 THR H    1 1 
        1   961 1 1 66 THR HA   H   -3.520  -1.745   6.584 1.00 . A A . 722 THR HA   1 1 
        1   962 1 1 66 THR HB   H   -2.759   0.446   8.540 1.00 . A A . 722 THR HB   1 1 
        1   963 1 1 66 THR HG1  H   -1.088  -0.767   9.038 1.00 . A A . 722 THR HG1  1 1 
        1   964 1 1 66 THR HG21 H   -3.658  -1.086  10.250 1.00 . A A . 722 THR HG21 1 1 
        1   965 1 1 66 THR HG22 H   -4.178  -2.193   8.979 1.00 . A A . 722 THR HG22 1 1 
        1   966 1 1 66 THR HG23 H   -4.904  -0.590   9.105 1.00 . A A . 722 THR HG23 1 1 
        1   967 1 1 66 THR N    N   -2.269  -0.216   5.920 1.00 . A A . 722 THR N    1 1 
        1   968 1 1 66 THR O    O   -4.642   1.313   6.684 1.00 . A A . 722 THR O    1 1 
        1   969 1 1 66 THR OG1  O   -1.688  -1.311   8.511 1.00 . A A . 722 THR OG1  1 1 
        1   970 1 1 67 VAL C    C   -8.141  -0.570   7.040 1.00 . A A . 723 VAL C    1 1 
        1   971 1 1 67 VAL CA   C   -7.041   0.038   6.149 1.00 . A A . 723 VAL CA   1 1 
        1   972 1 1 67 VAL CB   C   -7.462  -0.042   4.658 1.00 . A A . 723 VAL CB   1 1 
        1   973 1 1 67 VAL CG1  C   -7.623  -1.490   4.203 1.00 . A A . 723 VAL CG1  1 1 
        1   974 1 1 67 VAL CG2  C   -8.739   0.762   4.406 1.00 . A A . 723 VAL CG2  1 1 
        1   975 1 1 67 VAL H    H   -5.690  -1.595   6.345 1.00 . A A . 723 VAL H    1 1 
        1   976 1 1 67 VAL HA   H   -6.934   1.084   6.409 1.00 . A A . 723 VAL HA   1 1 
        1   977 1 1 67 VAL HB   H   -6.670   0.401   4.068 1.00 . A A . 723 VAL HB   1 1 
        1   978 1 1 67 VAL HG11 H   -6.703  -2.029   4.379 1.00 . A A . 723 VAL HG11 1 1 
        1   979 1 1 67 VAL HG12 H   -7.855  -1.513   3.147 1.00 . A A . 723 VAL HG12 1 1 
        1   980 1 1 67 VAL HG13 H   -8.424  -1.959   4.758 1.00 . A A . 723 VAL HG13 1 1 
        1   981 1 1 67 VAL HG21 H   -8.568   1.799   4.656 1.00 . A A . 723 VAL HG21 1 1 
        1   982 1 1 67 VAL HG22 H   -9.540   0.373   5.019 1.00 . A A . 723 VAL HG22 1 1 
        1   983 1 1 67 VAL HG23 H   -9.015   0.686   3.364 1.00 . A A . 723 VAL HG23 1 1 
        1   984 1 1 67 VAL N    N   -5.742  -0.615   6.370 1.00 . A A . 723 VAL N    1 1 
        1   985 1 1 67 VAL O    O   -8.223  -1.791   7.207 1.00 . A A . 723 VAL O    1 1 
        1   986 1 1 68 THR C    C  -11.439   0.217   8.038 1.00 . A A . 724 THR C    1 1 
        1   987 1 1 68 THR CA   C  -10.036  -0.155   8.540 1.00 . A A . 724 THR CA   1 1 
        1   988 1 1 68 THR CB   C   -9.846   0.461   9.952 1.00 . A A . 724 THR CB   1 1 
        1   989 1 1 68 THR CG2  C  -10.818  -0.150  10.960 1.00 . A A . 724 THR CG2  1 1 
        1   990 1 1 68 THR H    H   -8.888   1.247   7.429 1.00 . A A . 724 THR H    1 1 
        1   991 1 1 68 THR HA   H   -9.971  -1.231   8.631 1.00 . A A . 724 THR HA   1 1 
        1   992 1 1 68 THR HB   H  -10.033   1.526   9.893 1.00 . A A . 724 THR HB   1 1 
        1   993 1 1 68 THR HG1  H   -8.490  -0.416  11.101 1.00 . A A . 724 THR HG1  1 1 
        1   994 1 1 68 THR HG21 H  -10.631  -1.211  11.044 1.00 . A A . 724 THR HG21 1 1 
        1   995 1 1 68 THR HG22 H  -11.835   0.012  10.627 1.00 . A A . 724 THR HG22 1 1 
        1   996 1 1 68 THR HG23 H  -10.678   0.317  11.925 1.00 . A A . 724 THR HG23 1 1 
        1   997 1 1 68 THR N    N   -8.983   0.291   7.617 1.00 . A A . 724 THR N    1 1 
        1   998 1 1 68 THR O    O  -11.677   1.340   7.592 1.00 . A A . 724 THR O    1 1 
        1   999 1 1 68 THR OG1  O   -8.500   0.252  10.404 1.00 . A A . 724 THR OG1  1 1 
        1  1000 1 1 69 ASP C    C  -14.487   0.103   9.026 1.00 . A A . 725 ASP C    1 1 
        1  1001 1 1 69 ASP CA   C  -13.769  -0.507   7.806 1.00 . A A . 725 ASP CA   1 1 
        1  1002 1 1 69 ASP CB   C  -14.401  -1.855   7.403 1.00 . A A . 725 ASP CB   1 1 
        1  1003 1 1 69 ASP CG   C  -15.878  -1.793   7.028 1.00 . A A . 725 ASP CG   1 1 
        1  1004 1 1 69 ASP H    H  -12.079  -1.634   8.393 1.00 . A A . 725 ASP H    1 1 
        1  1005 1 1 69 ASP HA   H  -13.827   0.181   6.975 1.00 . A A . 725 ASP HA   1 1 
        1  1006 1 1 69 ASP HB2  H  -13.864  -2.246   6.552 1.00 . A A . 725 ASP HB2  1 1 
        1  1007 1 1 69 ASP HB3  H  -14.292  -2.548   8.227 1.00 . A A . 725 ASP HB3  1 1 
        1  1008 1 1 69 ASP N    N  -12.358  -0.739   8.119 1.00 . A A . 725 ASP N    1 1 
        1  1009 1 1 69 ASP O    O  -14.150  -0.199  10.173 1.00 . A A . 725 ASP O    1 1 
        1  1010 1 1 69 ASP OD1  O  -16.450  -0.691   6.964 1.00 . A A . 725 ASP OD1  1 1 
        1  1011 1 1 69 ASP OD2  O  -16.475  -2.871   6.808 1.00 . A A . 725 ASP OD2  1 1 
        1  1012 1 1 70 SER C    C  -17.058   0.542  10.659 1.00 . A A . 726 SER C    1 1 
        1  1013 1 1 70 SER CA   C  -16.267   1.575   9.850 1.00 . A A . 726 SER CA   1 1 
        1  1014 1 1 70 SER CB   C  -17.227   2.628   9.274 1.00 . A A . 726 SER CB   1 1 
        1  1015 1 1 70 SER H    H  -15.762   1.085   7.838 1.00 . A A . 726 SER H    1 1 
        1  1016 1 1 70 SER HA   H  -15.561   2.066  10.507 1.00 . A A . 726 SER HA   1 1 
        1  1017 1 1 70 SER HB2  H  -16.655   3.413   8.801 1.00 . A A . 726 SER HB2  1 1 
        1  1018 1 1 70 SER HB3  H  -17.870   2.163   8.540 1.00 . A A . 726 SER HB3  1 1 
        1  1019 1 1 70 SER HG   H  -17.479   3.481  11.028 1.00 . A A . 726 SER HG   1 1 
        1  1020 1 1 70 SER N    N  -15.504   0.926   8.773 1.00 . A A . 726 SER N    1 1 
        1  1021 1 1 70 SER O    O  -17.455   0.795  11.798 1.00 . A A . 726 SER O    1 1 
        1  1022 1 1 70 SER OG   O  -18.038   3.208  10.290 1.00 . A A . 726 SER OG   1 1 
        1  1023 1 1 71 LYS C    C  -17.083  -2.544  11.637 1.00 . A A . 727 LYS C    1 1 
        1  1024 1 1 71 LYS CA   C  -18.001  -1.724  10.704 1.00 . A A . 727 LYS CA   1 1 
        1  1025 1 1 71 LYS CB   C  -18.644  -2.636   9.642 1.00 . A A . 727 LYS CB   1 1 
        1  1026 1 1 71 LYS CD   C  -19.588  -0.709   8.253 1.00 . A A . 727 LYS CD   1 1 
        1  1027 1 1 71 LYS CE   C  -20.814  -0.157   7.533 1.00 . A A . 727 LYS CE   1 1 
        1  1028 1 1 71 LYS CG   C  -19.882  -2.040   8.953 1.00 . A A . 727 LYS CG   1 1 
        1  1029 1 1 71 LYS H    H  -16.964  -0.743   9.132 1.00 . A A . 727 LYS H    1 1 
        1  1030 1 1 71 LYS HA   H  -18.787  -1.288  11.305 1.00 . A A . 727 LYS HA   1 1 
        1  1031 1 1 71 LYS HB2  H  -17.908  -2.853   8.882 1.00 . A A . 727 LYS HB2  1 1 
        1  1032 1 1 71 LYS HB3  H  -18.938  -3.563  10.115 1.00 . A A . 727 LYS HB3  1 1 
        1  1033 1 1 71 LYS HD2  H  -19.265   0.011   8.991 1.00 . A A . 727 LYS HD2  1 1 
        1  1034 1 1 71 LYS HD3  H  -18.797  -0.860   7.531 1.00 . A A . 727 LYS HD3  1 1 
        1  1035 1 1 71 LYS HE2  H  -20.997  -0.750   6.650 1.00 . A A . 727 LYS HE2  1 1 
        1  1036 1 1 71 LYS HE3  H  -21.667  -0.223   8.194 1.00 . A A . 727 LYS HE3  1 1 
        1  1037 1 1 71 LYS HG2  H  -20.242  -2.746   8.216 1.00 . A A . 727 LYS HG2  1 1 
        1  1038 1 1 71 LYS HG3  H  -20.651  -1.881   9.698 1.00 . A A . 727 LYS HG3  1 1 
        1  1039 1 1 71 LYS HZ1  H  -21.470   1.605   6.619 1.00 . A A . 727 LYS HZ1  1 1 
        1  1040 1 1 71 LYS HZ2  H  -19.798   1.359   6.507 1.00 . A A . 727 LYS HZ2  1 1 
        1  1041 1 1 71 LYS HZ3  H  -20.483   1.858   7.968 1.00 . A A . 727 LYS HZ3  1 1 
        1  1042 1 1 71 LYS N    N  -17.281  -0.624  10.054 1.00 . A A . 727 LYS N    1 1 
        1  1043 1 1 71 LYS NZ   N  -20.628   1.263   7.128 1.00 . A A . 727 LYS NZ   1 1 
        1  1044 1 1 71 LYS O    O  -17.541  -3.464  12.318 1.00 . A A . 727 LYS O    1 1 
        1  1045 1 1 72 GLY C    C  -13.875  -3.823  12.021 1.00 . A A . 728 GLY C    1 1 
        1  1046 1 1 72 GLY CA   C  -14.869  -2.830  12.624 1.00 . A A . 728 GLY CA   1 1 
        1  1047 1 1 72 GLY H    H  -15.458  -1.529  11.043 1.00 . A A . 728 GLY H    1 1 
        1  1048 1 1 72 GLY HA2  H  -14.308  -2.043  13.102 1.00 . A A . 728 GLY HA2  1 1 
        1  1049 1 1 72 GLY HA3  H  -15.450  -3.339  13.381 1.00 . A A . 728 GLY HA3  1 1 
        1  1050 1 1 72 GLY N    N  -15.789  -2.212  11.663 1.00 . A A . 728 GLY N    1 1 
        1  1051 1 1 72 GLY O    O  -12.993  -4.317  12.723 1.00 . A A . 728 GLY O    1 1 
        1  1052 1 1 73 HIS C    C  -11.797  -4.327   9.593 1.00 . A A . 729 HIS C    1 1 
        1  1053 1 1 73 HIS CA   C  -13.074  -5.051  10.064 1.00 . A A . 729 HIS CA   1 1 
        1  1054 1 1 73 HIS CB   C  -13.761  -5.736   8.874 1.00 . A A . 729 HIS CB   1 1 
        1  1055 1 1 73 HIS CD2  C  -14.795  -7.842   9.996 1.00 . A A . 729 HIS CD2  1 1 
        1  1056 1 1 73 HIS CE1  C  -16.856  -7.598   9.293 1.00 . A A . 729 HIS CE1  1 1 
        1  1057 1 1 73 HIS CG   C  -14.842  -6.705   9.258 1.00 . A A . 729 HIS CG   1 1 
        1  1058 1 1 73 HIS H    H  -14.727  -3.715  10.214 1.00 . A A . 729 HIS H    1 1 
        1  1059 1 1 73 HIS HA   H  -12.792  -5.809  10.784 1.00 . A A . 729 HIS HA   1 1 
        1  1060 1 1 73 HIS HB2  H  -14.207  -4.982   8.243 1.00 . A A . 729 HIS HB2  1 1 
        1  1061 1 1 73 HIS HB3  H  -13.019  -6.277   8.303 1.00 . A A . 729 HIS HB3  1 1 
        1  1062 1 1 73 HIS HD1  H  -16.509  -5.864   8.279 1.00 . A A . 729 HIS HD1  1 1 
        1  1063 1 1 73 HIS HD2  H  -13.926  -8.252  10.489 1.00 . A A . 729 HIS HD2  1 1 
        1  1064 1 1 73 HIS HE1  H  -17.911  -7.765   9.110 1.00 . A A . 729 HIS HE1  1 1 
        1  1065 1 1 73 HIS HE2  H  -16.328  -9.212  10.435 1.00 . A A . 729 HIS HE2  1 1 
        1  1066 1 1 73 HIS N    N  -14.002  -4.124  10.730 1.00 . A A . 729 HIS N    1 1 
        1  1067 1 1 73 HIS ND1  N  -16.148  -6.587   8.836 1.00 . A A . 729 HIS ND1  1 1 
        1  1068 1 1 73 HIS NE2  N  -16.061  -8.374   9.999 1.00 . A A . 729 HIS NE2  1 1 
        1  1069 1 1 73 HIS O    O  -11.866  -3.376   8.817 1.00 . A A . 729 HIS O    1 1 
        1  1070 1 1 74 GLU C    C   -8.401  -5.152   9.010 1.00 . A A . 730 GLU C    1 1 
        1  1071 1 1 74 GLU CA   C   -9.351  -4.160   9.701 1.00 . A A . 730 GLU CA   1 1 
        1  1072 1 1 74 GLU CB   C   -8.677  -3.592  10.959 1.00 . A A . 730 GLU CB   1 1 
        1  1073 1 1 74 GLU CD   C   -6.667  -2.399  11.958 1.00 . A A . 730 GLU CD   1 1 
        1  1074 1 1 74 GLU CG   C   -7.337  -2.908  10.690 1.00 . A A . 730 GLU CG   1 1 
        1  1075 1 1 74 GLU H    H  -10.632  -5.579  10.639 1.00 . A A . 730 GLU H    1 1 
        1  1076 1 1 74 GLU HA   H   -9.557  -3.345   9.020 1.00 . A A . 730 GLU HA   1 1 
        1  1077 1 1 74 GLU HB2  H   -9.340  -2.866  11.411 1.00 . A A . 730 GLU HB2  1 1 
        1  1078 1 1 74 GLU HB3  H   -8.514  -4.399  11.659 1.00 . A A . 730 GLU HB3  1 1 
        1  1079 1 1 74 GLU HG2  H   -6.675  -3.615  10.208 1.00 . A A . 730 GLU HG2  1 1 
        1  1080 1 1 74 GLU HG3  H   -7.503  -2.070  10.027 1.00 . A A . 730 GLU HG3  1 1 
        1  1081 1 1 74 GLU N    N  -10.634  -4.790  10.053 1.00 . A A . 730 GLU N    1 1 
        1  1082 1 1 74 GLU O    O   -8.208  -6.274   9.480 1.00 . A A . 730 GLU O    1 1 
        1  1083 1 1 74 GLU OE1  O   -5.915  -3.167  12.589 1.00 . A A . 730 GLU OE1  1 1 
        1  1084 1 1 74 GLU OE2  O   -6.893  -1.228  12.329 1.00 . A A . 730 GLU OE2  1 1 
        1  1085 1 1 75 VAL C    C   -5.553  -4.767   6.827 1.00 . A A . 731 VAL C    1 1 
        1  1086 1 1 75 VAL CA   C   -6.836  -5.557   7.154 1.00 . A A . 731 VAL CA   1 1 
        1  1087 1 1 75 VAL CB   C   -7.446  -6.115   5.837 1.00 . A A . 731 VAL CB   1 1 
        1  1088 1 1 75 VAL CG1  C   -8.607  -7.064   6.132 1.00 . A A . 731 VAL CG1  1 1 
        1  1089 1 1 75 VAL CG2  C   -7.898  -4.977   4.922 1.00 . A A . 731 VAL CG2  1 1 
        1  1090 1 1 75 VAL H    H   -8.012  -3.829   7.557 1.00 . A A . 731 VAL H    1 1 
        1  1091 1 1 75 VAL HA   H   -6.568  -6.397   7.784 1.00 . A A . 731 VAL HA   1 1 
        1  1092 1 1 75 VAL HB   H   -6.678  -6.677   5.320 1.00 . A A . 731 VAL HB   1 1 
        1  1093 1 1 75 VAL HG11 H   -9.008  -7.445   5.204 1.00 . A A . 731 VAL HG11 1 1 
        1  1094 1 1 75 VAL HG12 H   -9.383  -6.533   6.666 1.00 . A A . 731 VAL HG12 1 1 
        1  1095 1 1 75 VAL HG13 H   -8.256  -7.888   6.736 1.00 . A A . 731 VAL HG13 1 1 
        1  1096 1 1 75 VAL HG21 H   -8.654  -4.390   5.422 1.00 . A A . 731 VAL HG21 1 1 
        1  1097 1 1 75 VAL HG22 H   -8.308  -5.386   4.009 1.00 . A A . 731 VAL HG22 1 1 
        1  1098 1 1 75 VAL HG23 H   -7.054  -4.344   4.683 1.00 . A A . 731 VAL HG23 1 1 
        1  1099 1 1 75 VAL N    N   -7.803  -4.728   7.894 1.00 . A A . 731 VAL N    1 1 
        1  1100 1 1 75 VAL O    O   -5.589  -3.546   6.656 1.00 . A A . 731 VAL O    1 1 
        1  1101 1 1 76 THR C    C   -2.206  -5.692   5.594 1.00 . A A . 732 THR C    1 1 
        1  1102 1 1 76 THR CA   C   -3.123  -4.817   6.467 1.00 . A A . 732 THR CA   1 1 
        1  1103 1 1 76 THR CB   C   -2.382  -4.451   7.779 1.00 . A A . 732 THR CB   1 1 
        1  1104 1 1 76 THR CG2  C   -2.177  -5.679   8.664 1.00 . A A . 732 THR CG2  1 1 
        1  1105 1 1 76 THR H    H   -4.446  -6.442   6.876 1.00 . A A . 732 THR H    1 1 
        1  1106 1 1 76 THR HA   H   -3.327  -3.899   5.933 1.00 . A A . 732 THR HA   1 1 
        1  1107 1 1 76 THR HB   H   -2.987  -3.737   8.322 1.00 . A A . 732 THR HB   1 1 
        1  1108 1 1 76 THR HG1  H   -1.185  -2.886   7.584 1.00 . A A . 732 THR HG1  1 1 
        1  1109 1 1 76 THR HG21 H   -1.654  -5.392   9.565 1.00 . A A . 732 THR HG21 1 1 
        1  1110 1 1 76 THR HG22 H   -1.593  -6.415   8.130 1.00 . A A . 732 THR HG22 1 1 
        1  1111 1 1 76 THR HG23 H   -3.136  -6.102   8.925 1.00 . A A . 732 THR HG23 1 1 
        1  1112 1 1 76 THR N    N   -4.418  -5.468   6.745 1.00 . A A . 732 THR N    1 1 
        1  1113 1 1 76 THR O    O   -2.245  -6.924   5.664 1.00 . A A . 732 THR O    1 1 
        1  1114 1 1 76 THR OG1  O   -1.110  -3.847   7.489 1.00 . A A . 732 THR OG1  1 1 
        1  1115 1 1 77 ALA C    C    0.804  -4.894   3.619 1.00 . A A . 733 ALA C    1 1 
        1  1116 1 1 77 ALA CA   C   -0.460  -5.736   3.860 1.00 . A A . 733 ALA CA   1 1 
        1  1117 1 1 77 ALA CB   C   -1.148  -6.059   2.534 1.00 . A A . 733 ALA CB   1 1 
        1  1118 1 1 77 ALA H    H   -1.398  -4.056   4.767 1.00 . A A . 733 ALA H    1 1 
        1  1119 1 1 77 ALA HA   H   -0.174  -6.670   4.329 1.00 . A A . 733 ALA HA   1 1 
        1  1120 1 1 77 ALA HB1  H   -2.028  -6.659   2.720 1.00 . A A . 733 ALA HB1  1 1 
        1  1121 1 1 77 ALA HB2  H   -0.468  -6.608   1.896 1.00 . A A . 733 ALA HB2  1 1 
        1  1122 1 1 77 ALA HB3  H   -1.438  -5.141   2.044 1.00 . A A . 733 ALA HB3  1 1 
        1  1123 1 1 77 ALA N    N   -1.391  -5.040   4.762 1.00 . A A . 733 ALA N    1 1 
        1  1124 1 1 77 ALA O    O    0.804  -3.685   3.851 1.00 . A A . 733 ALA O    1 1 
        1  1125 1 1 78 LYS C    C    3.622  -4.927   1.452 1.00 . A A . 734 LYS C    1 1 
        1  1126 1 1 78 LYS CA   C    3.147  -4.812   2.912 1.00 . A A . 734 LYS CA   1 1 
        1  1127 1 1 78 LYS CB   C    4.235  -5.338   3.860 1.00 . A A . 734 LYS CB   1 1 
        1  1128 1 1 78 LYS CD   C    5.109  -5.513   6.232 1.00 . A A . 734 LYS CD   1 1 
        1  1129 1 1 78 LYS CE   C    4.925  -5.056   7.676 1.00 . A A . 734 LYS CE   1 1 
        1  1130 1 1 78 LYS CG   C    4.000  -4.979   5.326 1.00 . A A . 734 LYS CG   1 1 
        1  1131 1 1 78 LYS H    H    1.829  -6.485   2.963 1.00 . A A . 734 LYS H    1 1 
        1  1132 1 1 78 LYS HA   H    2.980  -3.766   3.129 1.00 . A A . 734 LYS HA   1 1 
        1  1133 1 1 78 LYS HB2  H    4.277  -6.415   3.778 1.00 . A A . 734 LYS HB2  1 1 
        1  1134 1 1 78 LYS HB3  H    5.189  -4.927   3.558 1.00 . A A . 734 LYS HB3  1 1 
        1  1135 1 1 78 LYS HD2  H    5.098  -6.593   6.203 1.00 . A A . 734 LYS HD2  1 1 
        1  1136 1 1 78 LYS HD3  H    6.063  -5.153   5.869 1.00 . A A . 734 LYS HD3  1 1 
        1  1137 1 1 78 LYS HE2  H    5.751  -5.428   8.265 1.00 . A A . 734 LYS HE2  1 1 
        1  1138 1 1 78 LYS HE3  H    4.926  -3.976   7.702 1.00 . A A . 734 LYS HE3  1 1 
        1  1139 1 1 78 LYS HG2  H    3.959  -3.904   5.420 1.00 . A A . 734 LYS HG2  1 1 
        1  1140 1 1 78 LYS HG3  H    3.055  -5.402   5.641 1.00 . A A . 734 LYS HG3  1 1 
        1  1141 1 1 78 LYS HZ1  H    2.847  -5.317   7.653 1.00 . A A . 734 LYS HZ1  1 1 
        1  1142 1 1 78 LYS HZ2  H    3.502  -5.113   9.199 1.00 . A A . 734 LYS HZ2  1 1 
        1  1143 1 1 78 LYS HZ3  H    3.690  -6.581   8.391 1.00 . A A . 734 LYS HZ3  1 1 
        1  1144 1 1 78 LYS N    N    1.880  -5.524   3.152 1.00 . A A . 734 LYS N    1 1 
        1  1145 1 1 78 LYS NZ   N    3.654  -5.550   8.268 1.00 . A A . 734 LYS NZ   1 1 
        1  1146 1 1 78 LYS O    O    3.219  -5.831   0.717 1.00 . A A . 734 LYS O    1 1 
        1  1147 1 1 79 GLN C    C    6.612  -3.871  -0.221 1.00 . A A . 735 GLN C    1 1 
        1  1148 1 1 79 GLN CA   C    5.080  -3.970  -0.293 1.00 . A A . 735 GLN CA   1 1 
        1  1149 1 1 79 GLN CB   C    4.521  -2.769  -1.085 1.00 . A A . 735 GLN CB   1 1 
        1  1150 1 1 79 GLN CD   C    4.706  -1.302  -3.169 1.00 . A A . 735 GLN CD   1 1 
        1  1151 1 1 79 GLN CG   C    5.219  -2.529  -2.425 1.00 . A A . 735 GLN CG   1 1 
        1  1152 1 1 79 GLN H    H    4.773  -3.316   1.700 1.00 . A A . 735 GLN H    1 1 
        1  1153 1 1 79 GLN HA   H    4.809  -4.886  -0.801 1.00 . A A . 735 GLN HA   1 1 
        1  1154 1 1 79 GLN HB2  H    3.469  -2.940  -1.280 1.00 . A A . 735 GLN HB2  1 1 
        1  1155 1 1 79 GLN HB3  H    4.625  -1.876  -0.484 1.00 . A A . 735 GLN HB3  1 1 
        1  1156 1 1 79 GLN HE21 H    4.290  -0.368  -1.469 1.00 . A A . 735 GLN HE21 1 1 
        1  1157 1 1 79 GLN HE22 H    3.940   0.502  -2.911 1.00 . A A . 735 GLN HE22 1 1 
        1  1158 1 1 79 GLN HG2  H    6.277  -2.401  -2.248 1.00 . A A . 735 GLN HG2  1 1 
        1  1159 1 1 79 GLN HG3  H    5.067  -3.399  -3.050 1.00 . A A . 735 GLN HG3  1 1 
        1  1160 1 1 79 GLN N    N    4.503  -4.005   1.059 1.00 . A A . 735 GLN N    1 1 
        1  1161 1 1 79 GLN NE2  N    4.268  -0.290  -2.441 1.00 . A A . 735 GLN NE2  1 1 
        1  1162 1 1 79 GLN O    O    7.153  -2.936   0.370 1.00 . A A . 735 GLN O    1 1 
        1  1163 1 1 79 GLN OE1  O    4.715  -1.260  -4.394 1.00 . A A . 735 GLN OE1  1 1 
        1  1164 1 1 80 THR C    C    9.357  -4.169  -2.051 1.00 . A A . 736 THR C    1 1 
        1  1165 1 1 80 THR CA   C    8.778  -4.845  -0.801 1.00 . A A . 736 THR CA   1 1 
        1  1166 1 1 80 THR CB   C    9.332  -6.289  -0.725 1.00 . A A . 736 THR CB   1 1 
        1  1167 1 1 80 THR CG2  C   10.839  -6.291  -0.486 1.00 . A A . 736 THR CG2  1 1 
        1  1168 1 1 80 THR H    H    6.828  -5.551  -1.291 1.00 . A A . 736 THR H    1 1 
        1  1169 1 1 80 THR HA   H    9.108  -4.307   0.080 1.00 . A A . 736 THR HA   1 1 
        1  1170 1 1 80 THR HB   H    9.131  -6.787  -1.665 1.00 . A A . 736 THR HB   1 1 
        1  1171 1 1 80 THR HG1  H    7.779  -7.225   0.065 1.00 . A A . 736 THR HG1  1 1 
        1  1172 1 1 80 THR HG21 H   11.334  -5.754  -1.282 1.00 . A A . 736 THR HG21 1 1 
        1  1173 1 1 80 THR HG22 H   11.198  -7.310  -0.462 1.00 . A A . 736 THR HG22 1 1 
        1  1174 1 1 80 THR HG23 H   11.056  -5.812   0.458 1.00 . A A . 736 THR HG23 1 1 
        1  1175 1 1 80 THR N    N    7.309  -4.835  -0.822 1.00 . A A . 736 THR N    1 1 
        1  1176 1 1 80 THR O    O    9.379  -4.760  -3.130 1.00 . A A . 736 THR O    1 1 
        1  1177 1 1 80 THR OG1  O    8.685  -7.017   0.331 1.00 . A A . 736 THR OG1  1 1 
        1  1178 1 1 81 VAL C    C   11.932  -2.316  -3.084 1.00 . A A . 737 VAL C    1 1 
        1  1179 1 1 81 VAL CA   C   10.400  -2.195  -3.040 1.00 . A A . 737 VAL CA   1 1 
        1  1180 1 1 81 VAL CB   C   10.009  -0.696  -2.974 1.00 . A A . 737 VAL CB   1 1 
        1  1181 1 1 81 VAL CG1  C   10.510   0.057  -4.209 1.00 . A A . 737 VAL CG1  1 1 
        1  1182 1 1 81 VAL CG2  C    8.496  -0.539  -2.810 1.00 . A A . 737 VAL CG2  1 1 
        1  1183 1 1 81 VAL H    H    9.814  -2.516  -1.019 1.00 . A A . 737 VAL H    1 1 
        1  1184 1 1 81 VAL HA   H    9.990  -2.611  -3.952 1.00 . A A . 737 VAL HA   1 1 
        1  1185 1 1 81 VAL HB   H   10.486  -0.265  -2.104 1.00 . A A . 737 VAL HB   1 1 
        1  1186 1 1 81 VAL HG11 H   10.195   1.089  -4.156 1.00 . A A . 737 VAL HG11 1 1 
        1  1187 1 1 81 VAL HG12 H   10.104  -0.397  -5.101 1.00 . A A . 737 VAL HG12 1 1 
        1  1188 1 1 81 VAL HG13 H   11.591   0.013  -4.244 1.00 . A A . 737 VAL HG13 1 1 
        1  1189 1 1 81 VAL HG21 H    8.180  -1.018  -1.893 1.00 . A A . 737 VAL HG21 1 1 
        1  1190 1 1 81 VAL HG22 H    7.991  -0.997  -3.647 1.00 . A A . 737 VAL HG22 1 1 
        1  1191 1 1 81 VAL HG23 H    8.243   0.513  -2.771 1.00 . A A . 737 VAL HG23 1 1 
        1  1192 1 1 81 VAL N    N    9.838  -2.940  -1.906 1.00 . A A . 737 VAL N    1 1 
        1  1193 1 1 81 VAL O    O   12.602  -2.164  -2.068 1.00 . A A . 737 VAL O    1 1 
        1  1194 1 1 82 THR C    C   14.418  -1.667  -5.488 1.00 . A A . 738 THR C    1 1 
        1  1195 1 1 82 THR CA   C   13.936  -2.675  -4.435 1.00 . A A . 738 THR CA   1 1 
        1  1196 1 1 82 THR CB   C   14.388  -4.104  -4.841 1.00 . A A . 738 THR CB   1 1 
        1  1197 1 1 82 THR CG2  C   15.891  -4.157  -5.100 1.00 . A A . 738 THR CG2  1 1 
        1  1198 1 1 82 THR H    H   11.900  -2.750  -5.033 1.00 . A A . 738 THR H    1 1 
        1  1199 1 1 82 THR HA   H   14.400  -2.433  -3.485 1.00 . A A . 738 THR HA   1 1 
        1  1200 1 1 82 THR HB   H   13.872  -4.384  -5.750 1.00 . A A . 738 THR HB   1 1 
        1  1201 1 1 82 THR HG1  H   14.543  -4.833  -3.000 1.00 . A A . 738 THR HG1  1 1 
        1  1202 1 1 82 THR HG21 H   16.142  -3.493  -5.916 1.00 . A A . 738 THR HG21 1 1 
        1  1203 1 1 82 THR HG22 H   16.176  -5.167  -5.358 1.00 . A A . 738 THR HG22 1 1 
        1  1204 1 1 82 THR HG23 H   16.421  -3.850  -4.211 1.00 . A A . 738 THR HG23 1 1 
        1  1205 1 1 82 THR N    N   12.481  -2.594  -4.261 1.00 . A A . 738 THR N    1 1 
        1  1206 1 1 82 THR O    O   14.098  -1.783  -6.672 1.00 . A A . 738 THR O    1 1 
        1  1207 1 1 82 THR OG1  O   14.051  -5.049  -3.808 1.00 . A A . 738 THR OG1  1 1 
        1  1208 1 1 83 VAL C    C   17.158  -0.033  -6.366 1.00 . A A . 739 VAL C    1 1 
        1  1209 1 1 83 VAL CA   C   15.735   0.353  -5.929 1.00 . A A . 739 VAL CA   1 1 
        1  1210 1 1 83 VAL CB   C   15.774   1.740  -5.235 1.00 . A A . 739 VAL CB   1 1 
        1  1211 1 1 83 VAL CG1  C   16.320   2.812  -6.181 1.00 . A A . 739 VAL CG1  1 1 
        1  1212 1 1 83 VAL CG2  C   14.388   2.121  -4.719 1.00 . A A . 739 VAL CG2  1 1 
        1  1213 1 1 83 VAL H    H   15.340  -0.599  -4.079 1.00 . A A . 739 VAL H    1 1 
        1  1214 1 1 83 VAL HA   H   15.104   0.429  -6.806 1.00 . A A . 739 VAL HA   1 1 
        1  1215 1 1 83 VAL HB   H   16.442   1.673  -4.385 1.00 . A A . 739 VAL HB   1 1 
        1  1216 1 1 83 VAL HG11 H   16.323   3.770  -5.680 1.00 . A A . 739 VAL HG11 1 1 
        1  1217 1 1 83 VAL HG12 H   15.696   2.870  -7.061 1.00 . A A . 739 VAL HG12 1 1 
        1  1218 1 1 83 VAL HG13 H   17.329   2.558  -6.473 1.00 . A A . 739 VAL HG13 1 1 
        1  1219 1 1 83 VAL HG21 H   14.054   1.385  -4.002 1.00 . A A . 739 VAL HG21 1 1 
        1  1220 1 1 83 VAL HG22 H   13.693   2.160  -5.544 1.00 . A A . 739 VAL HG22 1 1 
        1  1221 1 1 83 VAL HG23 H   14.432   3.089  -4.242 1.00 . A A . 739 VAL HG23 1 1 
        1  1222 1 1 83 VAL N    N   15.166  -0.664  -5.040 1.00 . A A . 739 VAL N    1 1 
        1  1223 1 1 83 VAL O    O   17.980  -0.439  -5.542 1.00 . A A . 739 VAL O    1 1 
        1  1224 1 1 84 LYS C    C   19.349   0.914  -9.031 1.00 . A A . 740 LYS C    1 1 
        1  1225 1 1 84 LYS CA   C   18.774  -0.241  -8.193 1.00 . A A . 740 LYS CA   1 1 
        1  1226 1 1 84 LYS CB   C   18.705  -1.519  -9.038 1.00 . A A . 740 LYS CB   1 1 
        1  1227 1 1 84 LYS CD   C   17.762  -2.708 -11.058 1.00 . A A . 740 LYS CD   1 1 
        1  1228 1 1 84 LYS CE   C   19.165  -3.070 -11.535 1.00 . A A . 740 LYS CE   1 1 
        1  1229 1 1 84 LYS CG   C   17.754  -1.427 -10.227 1.00 . A A . 740 LYS CG   1 1 
        1  1230 1 1 84 LYS H    H   16.743   0.398  -8.274 1.00 . A A . 740 LYS H    1 1 
        1  1231 1 1 84 LYS HA   H   19.434  -0.417  -7.355 1.00 . A A . 740 LYS HA   1 1 
        1  1232 1 1 84 LYS HB2  H   19.694  -1.739  -9.414 1.00 . A A . 740 LYS HB2  1 1 
        1  1233 1 1 84 LYS HB3  H   18.380  -2.335  -8.407 1.00 . A A . 740 LYS HB3  1 1 
        1  1234 1 1 84 LYS HD2  H   17.381  -3.519 -10.454 1.00 . A A . 740 LYS HD2  1 1 
        1  1235 1 1 84 LYS HD3  H   17.122  -2.568 -11.919 1.00 . A A . 740 LYS HD3  1 1 
        1  1236 1 1 84 LYS HE2  H   19.570  -2.239 -12.093 1.00 . A A . 740 LYS HE2  1 1 
        1  1237 1 1 84 LYS HE3  H   19.789  -3.260 -10.673 1.00 . A A . 740 LYS HE3  1 1 
        1  1238 1 1 84 LYS HG2  H   16.752  -1.253  -9.861 1.00 . A A . 740 LYS HG2  1 1 
        1  1239 1 1 84 LYS HG3  H   18.056  -0.599 -10.855 1.00 . A A . 740 LYS HG3  1 1 
        1  1240 1 1 84 LYS HZ1  H   20.131  -4.644 -12.509 1.00 . A A . 740 LYS HZ1  1 1 
        1  1241 1 1 84 LYS HZ2  H   18.788  -4.043 -13.343 1.00 . A A . 740 LYS HZ2  1 1 
        1  1242 1 1 84 LYS HZ3  H   18.568  -5.018 -11.985 1.00 . A A . 740 LYS HZ3  1 1 
        1  1243 1 1 84 LYS N    N   17.444   0.087  -7.659 1.00 . A A . 740 LYS N    1 1 
        1  1244 1 1 84 LYS NZ   N   19.163  -4.275 -12.402 1.00 . A A . 740 LYS NZ   1 1 
        1  1245 1 1 84 LYS O    O   18.614   1.797  -9.479 1.00 . A A . 740 LYS O    1 1 
        1  1246 1 1 85 VAL C    C   21.196   1.812 -11.498 1.00 . A A . 741 VAL C    1 1 
        1  1247 1 1 85 VAL CA   C   21.341   1.976  -9.973 1.00 . A A . 741 VAL CA   1 1 
        1  1248 1 1 85 VAL CB   C   22.846   2.037  -9.596 1.00 . A A . 741 VAL CB   1 1 
        1  1249 1 1 85 VAL CG1  C   23.470   3.353 -10.057 1.00 . A A . 741 VAL CG1  1 1 
        1  1250 1 1 85 VAL CG2  C   23.039   1.846  -8.091 1.00 . A A . 741 VAL CG2  1 1 
        1  1251 1 1 85 VAL H    H   21.184   0.127  -8.944 1.00 . A A . 741 VAL H    1 1 
        1  1252 1 1 85 VAL HA   H   20.880   2.911  -9.678 1.00 . A A . 741 VAL HA   1 1 
        1  1253 1 1 85 VAL HB   H   23.354   1.227 -10.105 1.00 . A A . 741 VAL HB   1 1 
        1  1254 1 1 85 VAL HG11 H   23.003   4.175  -9.534 1.00 . A A . 741 VAL HG11 1 1 
        1  1255 1 1 85 VAL HG12 H   23.319   3.473 -11.118 1.00 . A A . 741 VAL HG12 1 1 
        1  1256 1 1 85 VAL HG13 H   24.528   3.347  -9.844 1.00 . A A . 741 VAL HG13 1 1 
        1  1257 1 1 85 VAL HG21 H   22.535   2.639  -7.558 1.00 . A A . 741 VAL HG21 1 1 
        1  1258 1 1 85 VAL HG22 H   24.095   1.871  -7.855 1.00 . A A . 741 VAL HG22 1 1 
        1  1259 1 1 85 VAL HG23 H   22.627   0.893  -7.790 1.00 . A A . 741 VAL HG23 1 1 
        1  1260 1 1 85 VAL N    N   20.661   0.893  -9.255 1.00 . A A . 741 VAL N    1 1 
        1  1261 1 1 85 VAL O    O   21.148   0.698 -12.012 1.00 . A A . 741 VAL O    1 1 
        1  1262 1 1 86 ARG C    C   22.269   2.937 -14.441 1.00 . A A . 742 ARG C    1 1 
        1  1263 1 1 86 ARG CA   C   20.931   2.927 -13.673 1.00 . A A . 742 ARG CA   1 1 
        1  1264 1 1 86 ARG CB   C   20.077   4.136 -14.083 1.00 . A A . 742 ARG CB   1 1 
        1  1265 1 1 86 ARG CD   C   19.772   6.644 -14.084 1.00 . A A . 742 ARG CD   1 1 
        1  1266 1 1 86 ARG CG   C   20.649   5.480 -13.637 1.00 . A A . 742 ARG CG   1 1 
        1  1267 1 1 86 ARG CZ   C   19.716   9.085 -13.857 1.00 . A A . 742 ARG CZ   1 1 
        1  1268 1 1 86 ARG H    H   21.191   3.793 -11.747 1.00 . A A . 742 ARG H    1 1 
        1  1269 1 1 86 ARG HA   H   20.395   2.024 -13.932 1.00 . A A . 742 ARG HA   1 1 
        1  1270 1 1 86 ARG HB2  H   19.981   4.149 -15.159 1.00 . A A . 742 ARG HB2  1 1 
        1  1271 1 1 86 ARG HB3  H   19.092   4.028 -13.649 1.00 . A A . 742 ARG HB3  1 1 
        1  1272 1 1 86 ARG HD2  H   19.771   6.680 -15.164 1.00 . A A . 742 ARG HD2  1 1 
        1  1273 1 1 86 ARG HD3  H   18.764   6.474 -13.731 1.00 . A A . 742 ARG HD3  1 1 
        1  1274 1 1 86 ARG HE   H   21.011   7.911 -12.952 1.00 . A A . 742 ARG HE   1 1 
        1  1275 1 1 86 ARG HG2  H   20.719   5.490 -12.558 1.00 . A A . 742 ARG HG2  1 1 
        1  1276 1 1 86 ARG HG3  H   21.637   5.599 -14.061 1.00 . A A . 742 ARG HG3  1 1 
        1  1277 1 1 86 ARG HH11 H   18.383   8.341 -15.133 1.00 . A A . 742 ARG HH11 1 1 
        1  1278 1 1 86 ARG HH12 H   18.329  10.052 -14.909 1.00 . A A . 742 ARG HH12 1 1 
        1  1279 1 1 86 ARG HH21 H   20.946  10.120 -12.680 1.00 . A A . 742 ARG HH21 1 1 
        1  1280 1 1 86 ARG HH22 H   19.765  11.051 -13.535 1.00 . A A . 742 ARG HH22 1 1 
        1  1281 1 1 86 ARG N    N   21.121   2.935 -12.211 1.00 . A A . 742 ARG N    1 1 
        1  1282 1 1 86 ARG NE   N   20.250   7.927 -13.567 1.00 . A A . 742 ARG NE   1 1 
        1  1283 1 1 86 ARG NH1  N   18.734   9.163 -14.701 1.00 . A A . 742 ARG NH1  1 1 
        1  1284 1 1 86 ARG NH2  N   20.178  10.168 -13.318 1.00 . A A . 742 ARG NH2  1 1 
        1  1285 1 1 86 ARG O    O   22.291   3.000 -15.673 1.00 . A A . 742 ARG O    1 1 
        1  1286 1 1 87 GLU C    C   25.676   1.986 -13.467 1.00 . A A . 743 GLU C    1 1 
        1  1287 1 1 87 GLU CA   C   24.725   2.860 -14.301 1.00 . A A . 743 GLU CA   1 1 
        1  1288 1 1 87 GLU CB   C   25.308   4.282 -14.400 1.00 . A A . 743 GLU CB   1 1 
        1  1289 1 1 87 GLU CD   C   25.244   6.566 -15.477 1.00 . A A . 743 GLU CD   1 1 
        1  1290 1 1 87 GLU CG   C   24.540   5.229 -15.318 1.00 . A A . 743 GLU CG   1 1 
        1  1291 1 1 87 GLU H    H   23.293   2.830 -12.738 1.00 . A A . 743 GLU H    1 1 
        1  1292 1 1 87 GLU HA   H   24.647   2.439 -15.295 1.00 . A A . 743 GLU HA   1 1 
        1  1293 1 1 87 GLU HB2  H   25.324   4.718 -13.411 1.00 . A A . 743 GLU HB2  1 1 
        1  1294 1 1 87 GLU HB3  H   26.324   4.213 -14.764 1.00 . A A . 743 GLU HB3  1 1 
        1  1295 1 1 87 GLU HG2  H   24.441   4.766 -16.290 1.00 . A A . 743 GLU HG2  1 1 
        1  1296 1 1 87 GLU HG3  H   23.557   5.401 -14.902 1.00 . A A . 743 GLU HG3  1 1 
        1  1297 1 1 87 GLU N    N   23.378   2.879 -13.707 1.00 . A A . 743 GLU N    1 1 
        1  1298 1 1 87 GLU O    O   25.309   1.494 -12.394 1.00 . A A . 743 GLU O    1 1 
        1  1299 1 1 87 GLU OE1  O   25.370   7.298 -14.476 1.00 . A A . 743 GLU OE1  1 1 
        1  1300 1 1 87 GLU OE2  O   25.702   6.881 -16.596 1.00 . A A . 743 GLU OE2  1 1 
        1  1301 1 1 88 GLU C    C   28.725   1.918 -12.270 1.00 . A A . 744 GLU C    1 1 
        1  1302 1 1 88 GLU CA   C   27.915   1.033 -13.226 1.00 . A A . 744 GLU CA   1 1 
        1  1303 1 1 88 GLU CB   C   28.863   0.310 -14.201 1.00 . A A . 744 GLU CB   1 1 
        1  1304 1 1 88 GLU CD   C   27.092  -0.834 -15.641 1.00 . A A . 744 GLU CD   1 1 
        1  1305 1 1 88 GLU CG   C   28.312  -1.007 -14.749 1.00 . A A . 744 GLU CG   1 1 
        1  1306 1 1 88 GLU H    H   27.139   2.211 -14.813 1.00 . A A . 744 GLU H    1 1 
        1  1307 1 1 88 GLU HA   H   27.395   0.286 -12.639 1.00 . A A . 744 GLU HA   1 1 
        1  1308 1 1 88 GLU HB2  H   29.069   0.964 -15.035 1.00 . A A . 744 GLU HB2  1 1 
        1  1309 1 1 88 GLU HB3  H   29.794   0.097 -13.690 1.00 . A A . 744 GLU HB3  1 1 
        1  1310 1 1 88 GLU HG2  H   29.089  -1.494 -15.321 1.00 . A A . 744 GLU HG2  1 1 
        1  1311 1 1 88 GLU HG3  H   28.042  -1.638 -13.914 1.00 . A A . 744 GLU HG3  1 1 
        1  1312 1 1 88 GLU N    N   26.902   1.807 -13.951 1.00 . A A . 744 GLU N    1 1 
        1  1313 1 1 88 GLU O    O   29.625   2.651 -12.689 1.00 . A A . 744 GLU O    1 1 
        1  1314 1 1 88 GLU OE1  O   27.270  -0.630 -16.862 1.00 . A A . 744 GLU OE1  1 1 
        1  1315 1 1 88 GLU OE2  O   25.956  -0.914 -15.131 1.00 . A A . 744 GLU OE2  1 1 
        1  1316 1 1 89 VAL C    C   29.724   1.445  -8.975 1.00 . A A . 745 VAL C    1 1 
        1  1317 1 1 89 VAL CA   C   29.174   2.509  -9.938 1.00 . A A . 745 VAL CA   1 1 
        1  1318 1 1 89 VAL CB   C   28.363   3.588  -9.165 1.00 . A A . 745 VAL CB   1 1 
        1  1319 1 1 89 VAL CG1  C   28.131   4.811 -10.050 1.00 . A A . 745 VAL CG1  1 1 
        1  1320 1 1 89 VAL CG2  C   27.029   3.030  -8.664 1.00 . A A . 745 VAL CG2  1 1 
        1  1321 1 1 89 VAL H    H   27.560   1.390 -10.739 1.00 . A A . 745 VAL H    1 1 
        1  1322 1 1 89 VAL HA   H   30.014   3.001 -10.415 1.00 . A A . 745 VAL HA   1 1 
        1  1323 1 1 89 VAL HB   H   28.944   3.901  -8.306 1.00 . A A . 745 VAL HB   1 1 
        1  1324 1 1 89 VAL HG11 H   27.582   5.560  -9.498 1.00 . A A . 745 VAL HG11 1 1 
        1  1325 1 1 89 VAL HG12 H   27.565   4.523 -10.924 1.00 . A A . 745 VAL HG12 1 1 
        1  1326 1 1 89 VAL HG13 H   29.083   5.220 -10.358 1.00 . A A . 745 VAL HG13 1 1 
        1  1327 1 1 89 VAL HG21 H   26.441   2.688  -9.504 1.00 . A A . 745 VAL HG21 1 1 
        1  1328 1 1 89 VAL HG22 H   26.488   3.803  -8.136 1.00 . A A . 745 VAL HG22 1 1 
        1  1329 1 1 89 VAL HG23 H   27.213   2.202  -7.996 1.00 . A A . 745 VAL HG23 1 1 
        1  1330 1 1 89 VAL N    N   28.378   1.870 -10.989 1.00 . A A . 745 VAL N    1 1 
        1  1331 1 1 89 VAL O    O   29.032   0.987  -8.064 1.00 . A A . 745 VAL O    1 1 
        1  1332 1 1 90 LYS C    C   31.925   0.382  -7.012 1.00 . A A . 746 LYS C    1 1 
        1  1333 1 1 90 LYS CA   C   31.580  -0.056  -8.443 1.00 . A A . 746 LYS CA   1 1 
        1  1334 1 1 90 LYS CB   C   32.851  -0.559  -9.140 1.00 . A A . 746 LYS CB   1 1 
        1  1335 1 1 90 LYS CD   C   35.306  -0.080  -9.516 1.00 . A A . 746 LYS CD   1 1 
        1  1336 1 1 90 LYS CE   C   36.361   1.009  -9.666 1.00 . A A . 746 LYS CE   1 1 
        1  1337 1 1 90 LYS CG   C   33.914   0.517  -9.331 1.00 . A A . 746 LYS CG   1 1 
        1  1338 1 1 90 LYS H    H   31.478   1.450  -9.934 1.00 . A A . 746 LYS H    1 1 
        1  1339 1 1 90 LYS HA   H   30.869  -0.869  -8.391 1.00 . A A . 746 LYS HA   1 1 
        1  1340 1 1 90 LYS HB2  H   33.278  -1.358  -8.550 1.00 . A A . 746 LYS HB2  1 1 
        1  1341 1 1 90 LYS HB3  H   32.582  -0.948 -10.113 1.00 . A A . 746 LYS HB3  1 1 
        1  1342 1 1 90 LYS HD2  H   35.547  -0.685  -8.652 1.00 . A A . 746 LYS HD2  1 1 
        1  1343 1 1 90 LYS HD3  H   35.308  -0.700 -10.402 1.00 . A A . 746 LYS HD3  1 1 
        1  1344 1 1 90 LYS HE2  H   36.268   1.451 -10.648 1.00 . A A . 746 LYS HE2  1 1 
        1  1345 1 1 90 LYS HE3  H   36.188   1.767  -8.915 1.00 . A A . 746 LYS HE3  1 1 
        1  1346 1 1 90 LYS HG2  H   33.667   1.101 -10.206 1.00 . A A . 746 LYS HG2  1 1 
        1  1347 1 1 90 LYS HG3  H   33.922   1.160  -8.462 1.00 . A A . 746 LYS HG3  1 1 
        1  1348 1 1 90 LYS HZ1  H   37.857   0.067  -8.555 1.00 . A A . 746 LYS HZ1  1 1 
        1  1349 1 1 90 LYS HZ2  H   38.432   1.249  -9.623 1.00 . A A . 746 LYS HZ2  1 1 
        1  1350 1 1 90 LYS HZ3  H   37.933  -0.253 -10.219 1.00 . A A . 746 LYS HZ3  1 1 
        1  1351 1 1 90 LYS N    N   30.963   1.024  -9.217 1.00 . A A . 746 LYS N    1 1 
        1  1352 1 1 90 LYS NZ   N   37.742   0.480  -9.507 1.00 . A A . 746 LYS NZ   1 1 
        1  1353 1 1 90 LYS O    O   31.955   1.574  -6.693 1.00 . A A . 746 LYS O    1 1 
        1  1354 1 1 91 ASN C    C   33.989  -0.884  -4.483 1.00 . A A . 747 ASN C    1 1 
        1  1355 1 1 91 ASN CA   C   32.575  -0.348  -4.771 1.00 . A A . 747 ASN CA   1 1 
        1  1356 1 1 91 ASN CB   C   31.539  -0.987  -3.826 1.00 . A A . 747 ASN CB   1 1 
        1  1357 1 1 91 ASN CG   C   31.277  -2.459  -4.129 1.00 . A A . 747 ASN CG   1 1 
        1  1358 1 1 91 ASN H    H   32.152  -1.524  -6.480 1.00 . A A . 747 ASN H    1 1 
        1  1359 1 1 91 ASN HA   H   32.574   0.722  -4.613 1.00 . A A . 747 ASN HA   1 1 
        1  1360 1 1 91 ASN HB2  H   31.893  -0.908  -2.808 1.00 . A A . 747 ASN HB2  1 1 
        1  1361 1 1 91 ASN HB3  H   30.605  -0.451  -3.917 1.00 . A A . 747 ASN HB3  1 1 
        1  1362 1 1 91 ASN HD21 H   30.752  -2.785  -2.251 1.00 . A A . 747 ASN HD21 1 1 
        1  1363 1 1 91 ASN HD22 H   30.694  -4.152  -3.303 1.00 . A A . 747 ASN HD22 1 1 
        1  1364 1 1 91 ASN N    N   32.201  -0.596  -6.163 1.00 . A A . 747 ASN N    1 1 
        1  1365 1 1 91 ASN ND2  N   30.868  -3.207  -3.128 1.00 . A A . 747 ASN ND2  1 1 
        1  1366 1 1 91 ASN O    O   34.258  -2.077  -4.633 1.00 . A A . 747 ASN O    1 1 
        1  1367 1 1 91 ASN OD1  O   31.423  -2.917  -5.258 1.00 . A A . 747 ASN OD1  1 1 
        1  1368 1 1 92 ASP C    C   36.541  -0.452  -2.288 1.00 . A A . 748 ASP C    1 1 
        1  1369 1 1 92 ASP CA   C   36.289  -0.365  -3.805 1.00 . A A . 748 ASP CA   1 1 
        1  1370 1 1 92 ASP CB   C   37.236   0.661  -4.440 1.00 . A A . 748 ASP CB   1 1 
        1  1371 1 1 92 ASP CG   C   37.014   0.808  -5.935 1.00 . A A . 748 ASP CG   1 1 
        1  1372 1 1 92 ASP H    H   34.626   0.948  -3.991 1.00 . A A . 748 ASP H    1 1 
        1  1373 1 1 92 ASP HA   H   36.476  -1.336  -4.246 1.00 . A A . 748 ASP HA   1 1 
        1  1374 1 1 92 ASP HB2  H   37.078   1.625  -3.972 1.00 . A A . 748 ASP HB2  1 1 
        1  1375 1 1 92 ASP HB3  H   38.259   0.352  -4.271 1.00 . A A . 748 ASP HB3  1 1 
        1  1376 1 1 92 ASP N    N   34.895   0.009  -4.090 1.00 . A A . 748 ASP N    1 1 
        1  1377 1 1 92 ASP O    O   37.556   0.039  -1.787 1.00 . A A . 748 ASP O    1 1 
        1  1378 1 1 92 ASP OD1  O   37.588   0.013  -6.713 1.00 . A A . 748 ASP OD1  1 1 
        1  1379 1 1 92 ASP OD2  O   36.271   1.720  -6.344 1.00 . A A . 748 ASP OD2  1 1 
        1  1380 1 1 93 LYS C    C   35.569   0.162   0.572 1.00 . A A . 749 LYS C    1 1 
        1  1381 1 1 93 LYS CA   C   35.662  -1.213  -0.112 1.00 . A A . 749 LYS CA   1 1 
        1  1382 1 1 93 LYS CB   C   36.927  -1.952   0.369 1.00 . A A . 749 LYS CB   1 1 
        1  1383 1 1 93 LYS CD   C   35.748  -4.187   0.591 1.00 . A A . 749 LYS CD   1 1 
        1  1384 1 1 93 LYS CE   C   35.621  -4.023   2.104 1.00 . A A . 749 LYS CE   1 1 
        1  1385 1 1 93 LYS CG   C   36.954  -3.438   0.021 1.00 . A A . 749 LYS CG   1 1 
        1  1386 1 1 93 LYS H    H   34.887  -1.552  -2.059 1.00 . A A . 749 LYS H    1 1 
        1  1387 1 1 93 LYS HA   H   34.800  -1.793   0.185 1.00 . A A . 749 LYS HA   1 1 
        1  1388 1 1 93 LYS HB2  H   37.792  -1.486  -0.080 1.00 . A A . 749 LYS HB2  1 1 
        1  1389 1 1 93 LYS HB3  H   37.000  -1.856   1.444 1.00 . A A . 749 LYS HB3  1 1 
        1  1390 1 1 93 LYS HD2  H   34.848  -3.812   0.125 1.00 . A A . 749 LYS HD2  1 1 
        1  1391 1 1 93 LYS HD3  H   35.855  -5.239   0.363 1.00 . A A . 749 LYS HD3  1 1 
        1  1392 1 1 93 LYS HE2  H   35.517  -2.973   2.331 1.00 . A A . 749 LYS HE2  1 1 
        1  1393 1 1 93 LYS HE3  H   34.737  -4.549   2.435 1.00 . A A . 749 LYS HE3  1 1 
        1  1394 1 1 93 LYS HG2  H   36.952  -3.543  -1.054 1.00 . A A . 749 LYS HG2  1 1 
        1  1395 1 1 93 LYS HG3  H   37.859  -3.876   0.422 1.00 . A A . 749 LYS HG3  1 1 
        1  1396 1 1 93 LYS HZ1  H   36.947  -5.558   2.596 1.00 . A A . 749 LYS HZ1  1 1 
        1  1397 1 1 93 LYS HZ2  H   36.657  -4.473   3.862 1.00 . A A . 749 LYS HZ2  1 1 
        1  1398 1 1 93 LYS HZ3  H   37.655  -4.025   2.576 1.00 . A A . 749 LYS HZ3  1 1 
        1  1399 1 1 93 LYS N    N   35.620  -1.110  -1.579 1.00 . A A . 749 LYS N    1 1 
        1  1400 1 1 93 LYS NZ   N   36.801  -4.558   2.834 1.00 . A A . 749 LYS NZ   1 1 
        1  1401 1 1 93 LYS O    O   36.572   0.864   0.716 1.00 . A A . 749 LYS O    1 1 
        1  1402 1 1 94 PRO C    C   35.008   1.803   3.061 1.00 . A A . 750 PRO C    1 1 
        1  1403 1 1 94 PRO CA   C   34.163   1.805   1.774 1.00 . A A . 750 PRO CA   1 1 
        1  1404 1 1 94 PRO CB   C   32.660   1.793   2.100 1.00 . A A . 750 PRO CB   1 1 
        1  1405 1 1 94 PRO CD   C   33.072  -0.102   0.702 1.00 . A A . 750 PRO CD   1 1 
        1  1406 1 1 94 PRO CG   C   32.049   0.954   1.026 1.00 . A A . 750 PRO CG   1 1 
        1  1407 1 1 94 PRO HA   H   34.401   2.685   1.191 1.00 . A A . 750 PRO HA   1 1 
        1  1408 1 1 94 PRO HB2  H   32.502   1.359   3.080 1.00 . A A . 750 PRO HB2  1 1 
        1  1409 1 1 94 PRO HB3  H   32.274   2.802   2.083 1.00 . A A . 750 PRO HB3  1 1 
        1  1410 1 1 94 PRO HD2  H   32.942  -0.965   1.340 1.00 . A A . 750 PRO HD2  1 1 
        1  1411 1 1 94 PRO HD3  H   33.008  -0.389  -0.339 1.00 . A A . 750 PRO HD3  1 1 
        1  1412 1 1 94 PRO HG2  H   31.136   0.501   1.384 1.00 . A A . 750 PRO HG2  1 1 
        1  1413 1 1 94 PRO HG3  H   31.849   1.562   0.153 1.00 . A A . 750 PRO HG3  1 1 
        1  1414 1 1 94 PRO N    N   34.353   0.575   0.985 1.00 . A A . 750 PRO N    1 1 
        1  1415 1 1 94 PRO O    O   34.655   1.161   4.055 1.00 . A A . 750 PRO O    1 1 
        1  1416 1 1 95 ILE C    C   36.603   3.522   5.268 1.00 . A A . 751 ILE C    1 1 
        1  1417 1 1 95 ILE CA   C   37.066   2.550   4.170 1.00 . A A . 751 ILE CA   1 1 
        1  1418 1 1 95 ILE CB   C   38.497   2.936   3.715 1.00 . A A . 751 ILE CB   1 1 
        1  1419 1 1 95 ILE CD1  C   39.870   4.790   2.604 1.00 . A A . 751 ILE CD1  1 1 
        1  1420 1 1 95 ILE CG1  C   38.497   4.321   3.037 1.00 . A A . 751 ILE CG1  1 1 
        1  1421 1 1 95 ILE CG2  C   39.066   1.867   2.776 1.00 . A A . 751 ILE CG2  1 1 
        1  1422 1 1 95 ILE H    H   36.366   3.003   2.211 1.00 . A A . 751 ILE H    1 1 
        1  1423 1 1 95 ILE HA   H   37.107   1.557   4.595 1.00 . A A . 751 ILE HA   1 1 
        1  1424 1 1 95 ILE HB   H   39.128   2.974   4.592 1.00 . A A . 751 ILE HB   1 1 
        1  1425 1 1 95 ILE HD11 H   40.513   4.866   3.468 1.00 . A A . 751 ILE HD11 1 1 
        1  1426 1 1 95 ILE HD12 H   39.788   5.758   2.132 1.00 . A A . 751 ILE HD12 1 1 
        1  1427 1 1 95 ILE HD13 H   40.289   4.084   1.904 1.00 . A A . 751 ILE HD13 1 1 
        1  1428 1 1 95 ILE HG12 H   37.869   4.286   2.158 1.00 . A A . 751 ILE HG12 1 1 
        1  1429 1 1 95 ILE HG13 H   38.097   5.053   3.726 1.00 . A A . 751 ILE HG13 1 1 
        1  1430 1 1 95 ILE HG21 H   39.084   0.912   3.283 1.00 . A A . 751 ILE HG21 1 1 
        1  1431 1 1 95 ILE HG22 H   40.072   2.135   2.489 1.00 . A A . 751 ILE HG22 1 1 
        1  1432 1 1 95 ILE HG23 H   38.448   1.792   1.893 1.00 . A A . 751 ILE HG23 1 1 
        1  1433 1 1 95 ILE N    N   36.139   2.509   3.030 1.00 . A A . 751 ILE N    1 1 
        1  1434 1 1 95 ILE O    O   37.282   3.696   6.285 1.00 . A A . 751 ILE O    1 1 
        1  1435 1 1 96 LEU C    C   34.252   4.288   7.219 1.00 . A A . 752 LEU C    1 1 
        1  1436 1 1 96 LEU CA   C   34.870   5.067   6.046 1.00 . A A . 752 LEU CA   1 1 
        1  1437 1 1 96 LEU CB   C   33.805   5.960   5.389 1.00 . A A . 752 LEU CB   1 1 
        1  1438 1 1 96 LEU CD1  C   34.116   7.970   6.897 1.00 . A A . 752 LEU CD1  1 1 
        1  1439 1 1 96 LEU CD2  C   31.977   7.689   5.602 1.00 . A A . 752 LEU CD2  1 1 
        1  1440 1 1 96 LEU CG   C   33.112   6.967   6.328 1.00 . A A . 752 LEU CG   1 1 
        1  1441 1 1 96 LEU H    H   34.973   3.991   4.222 1.00 . A A . 752 LEU H    1 1 
        1  1442 1 1 96 LEU HA   H   35.666   5.694   6.426 1.00 . A A . 752 LEU HA   1 1 
        1  1443 1 1 96 LEU HB2  H   34.275   6.512   4.586 1.00 . A A . 752 LEU HB2  1 1 
        1  1444 1 1 96 LEU HB3  H   33.046   5.320   4.962 1.00 . A A . 752 LEU HB3  1 1 
        1  1445 1 1 96 LEU HD11 H   34.572   8.525   6.090 1.00 . A A . 752 LEU HD11 1 1 
        1  1446 1 1 96 LEU HD12 H   34.882   7.443   7.447 1.00 . A A . 752 LEU HD12 1 1 
        1  1447 1 1 96 LEU HD13 H   33.607   8.654   7.560 1.00 . A A . 752 LEU HD13 1 1 
        1  1448 1 1 96 LEU HD21 H   31.503   8.387   6.278 1.00 . A A . 752 LEU HD21 1 1 
        1  1449 1 1 96 LEU HD22 H   31.247   6.967   5.263 1.00 . A A . 752 LEU HD22 1 1 
        1  1450 1 1 96 LEU HD23 H   32.373   8.226   4.751 1.00 . A A . 752 LEU HD23 1 1 
        1  1451 1 1 96 LEU HG   H   32.681   6.427   7.159 1.00 . A A . 752 LEU HG   1 1 
        1  1452 1 1 96 LEU N    N   35.450   4.151   5.059 1.00 . A A . 752 LEU N    1 1 
        1  1453 1 1 96 LEU O    O   33.176   3.698   7.093 1.00 . A A . 752 LEU O    1 1 
        1  1454 1 1 97 GLU C    C   33.687   4.495  10.471 1.00 . A A . 753 GLU C    1 1 
        1  1455 1 1 97 GLU CA   C   34.482   3.567   9.543 1.00 . A A . 753 GLU CA   1 1 
        1  1456 1 1 97 GLU CB   C   35.678   2.963  10.295 1.00 . A A . 753 GLU CB   1 1 
        1  1457 1 1 97 GLU CD   C   34.465   0.845  10.986 1.00 . A A . 753 GLU CD   1 1 
        1  1458 1 1 97 GLU CG   C   35.282   2.044  11.447 1.00 . A A . 753 GLU CG   1 1 
        1  1459 1 1 97 GLU H    H   35.798   4.769   8.391 1.00 . A A . 753 GLU H    1 1 
        1  1460 1 1 97 GLU HA   H   33.834   2.762   9.217 1.00 . A A . 753 GLU HA   1 1 
        1  1461 1 1 97 GLU HB2  H   36.276   2.390   9.598 1.00 . A A . 753 GLU HB2  1 1 
        1  1462 1 1 97 GLU HB3  H   36.283   3.765  10.694 1.00 . A A . 753 GLU HB3  1 1 
        1  1463 1 1 97 GLU HG2  H   36.180   1.686  11.933 1.00 . A A . 753 GLU HG2  1 1 
        1  1464 1 1 97 GLU HG3  H   34.696   2.612  12.157 1.00 . A A . 753 GLU HG3  1 1 
        1  1465 1 1 97 GLU N    N   34.947   4.283   8.353 1.00 . A A . 753 GLU N    1 1 
        1  1466 1 1 97 GLU O    O   32.587   4.155  10.923 1.00 . A A . 753 GLU O    1 1 
        1  1467 1 1 97 GLU OE1  O   35.066  -0.174  10.584 1.00 . A A . 753 GLU OE1  1 1 
        1  1468 1 1 97 GLU OE2  O   33.217   0.912  11.026 1.00 . A A . 753 GLU OE2  1 1 
        1  1469 2 2  1 CA  CA   CA -17.557  -4.059   5.180 1.00 . B A . 762 CA  CA   1 1 
        2  1470 1 1  1 MET C    C  -36.451 -12.105  17.634 1.00 . A A . 657 MET C    1 1 
        2  1471 1 1  1 MET CA   C  -37.503 -11.208  18.306 1.00 . A A . 657 MET CA   1 1 
        2  1472 1 1  1 MET CB   C  -38.763 -12.019  18.639 1.00 . A A . 657 MET CB   1 1 
        2  1473 1 1  1 MET CE   C  -39.500 -15.079  21.383 1.00 . A A . 657 MET CE   1 1 
        2  1474 1 1  1 MET CG   C  -38.548 -13.094  19.695 1.00 . A A . 657 MET CG   1 1 
        2  1475 1 1  1 MET H1   H  -37.004  -9.470  17.259 1.00 . A A . 657 MET H1   1 1 
        2  1476 1 1  1 MET H2   H  -38.574  -9.461  17.878 1.00 . A A . 657 MET H2   1 1 
        2  1477 1 1  1 MET H3   H  -38.210 -10.388  16.513 1.00 . A A . 657 MET H3   1 1 
        2  1478 1 1  1 MET HA   H  -37.086 -10.817  19.223 1.00 . A A . 657 MET HA   1 1 
        2  1479 1 1  1 MET HB2  H  -39.523 -11.343  19.001 1.00 . A A . 657 MET HB2  1 1 
        2  1480 1 1  1 MET HB3  H  -39.122 -12.498  17.738 1.00 . A A . 657 MET HB3  1 1 
        2  1481 1 1  1 MET HE1  H  -40.322 -15.691  21.724 1.00 . A A . 657 MET HE1  1 1 
        2  1482 1 1  1 MET HE2  H  -39.132 -14.481  22.203 1.00 . A A . 657 MET HE2  1 1 
        2  1483 1 1  1 MET HE3  H  -38.707 -15.715  21.016 1.00 . A A . 657 MET HE3  1 1 
        2  1484 1 1  1 MET HG2  H  -37.803 -13.791  19.340 1.00 . A A . 657 MET HG2  1 1 
        2  1485 1 1  1 MET HG3  H  -38.196 -12.626  20.604 1.00 . A A . 657 MET HG3  1 1 
        2  1486 1 1  1 MET N    N  -37.847 -10.053  17.429 1.00 . A A . 657 MET N    1 1 
        2  1487 1 1  1 MET O    O  -35.390 -12.363  18.200 1.00 . A A . 657 MET O    1 1 
        2  1488 1 1  1 MET SD   S  -40.062 -14.003  20.063 1.00 . A A . 657 MET SD   1 1 
        2  1489 1 1  2 GLY C    C  -34.807 -12.434  14.915 1.00 . A A . 658 GLY C    1 1 
        2  1490 1 1  2 GLY CA   C  -35.789 -13.347  15.647 1.00 . A A . 658 GLY CA   1 1 
        2  1491 1 1  2 GLY H    H  -37.664 -12.449  16.071 1.00 . A A . 658 GLY H    1 1 
        2  1492 1 1  2 GLY HA2  H  -35.239 -14.007  16.302 1.00 . A A . 658 GLY HA2  1 1 
        2  1493 1 1  2 GLY HA3  H  -36.317 -13.943  14.918 1.00 . A A . 658 GLY HA3  1 1 
        2  1494 1 1  2 GLY N    N  -36.763 -12.592  16.432 1.00 . A A . 658 GLY N    1 1 
        2  1495 1 1  2 GLY O    O  -35.069 -11.997  13.791 1.00 . A A . 658 GLY O    1 1 
        2  1496 1 1  3 ASN C    C  -32.080 -11.641  13.698 1.00 . A A . 659 ASN C    1 1 
        2  1497 1 1  3 ASN CA   C  -32.699 -11.188  15.030 1.00 . A A . 659 ASN CA   1 1 
        2  1498 1 1  3 ASN CB   C  -31.589 -10.949  16.061 1.00 . A A . 659 ASN CB   1 1 
        2  1499 1 1  3 ASN CG   C  -32.115 -10.331  17.344 1.00 . A A . 659 ASN CG   1 1 
        2  1500 1 1  3 ASN H    H  -33.490 -12.597  16.408 1.00 . A A . 659 ASN H    1 1 
        2  1501 1 1  3 ASN HA   H  -33.221 -10.255  14.866 1.00 . A A . 659 ASN HA   1 1 
        2  1502 1 1  3 ASN HB2  H  -31.123 -11.893  16.302 1.00 . A A . 659 ASN HB2  1 1 
        2  1503 1 1  3 ASN HB3  H  -30.849 -10.283  15.638 1.00 . A A . 659 ASN HB3  1 1 
        2  1504 1 1  3 ASN HD21 H  -30.695 -11.217  18.406 1.00 . A A . 659 ASN HD21 1 1 
        2  1505 1 1  3 ASN HD22 H  -31.806 -10.234  19.294 1.00 . A A . 659 ASN HD22 1 1 
        2  1506 1 1  3 ASN N    N  -33.676 -12.148  15.556 1.00 . A A . 659 ASN N    1 1 
        2  1507 1 1  3 ASN ND2  N  -31.474 -10.624  18.458 1.00 . A A . 659 ASN ND2  1 1 
        2  1508 1 1  3 ASN O    O  -31.453 -12.700  13.613 1.00 . A A . 659 ASN O    1 1 
        2  1509 1 1  3 ASN OD1  O  -33.091  -9.588  17.335 1.00 . A A . 659 ASN OD1  1 1 
        2  1510 1 1  4 GLY C    C  -30.427 -10.095  11.189 1.00 . A A . 660 GLY C    1 1 
        2  1511 1 1  4 GLY CA   C  -31.605 -11.046  11.383 1.00 . A A . 660 GLY CA   1 1 
        2  1512 1 1  4 GLY H    H  -32.878 -10.060  12.765 1.00 . A A . 660 GLY H    1 1 
        2  1513 1 1  4 GLY HA2  H  -31.247 -12.067  11.335 1.00 . A A . 660 GLY HA2  1 1 
        2  1514 1 1  4 GLY HA3  H  -32.317 -10.887  10.585 1.00 . A A . 660 GLY HA3  1 1 
        2  1515 1 1  4 GLY N    N  -32.270 -10.825  12.663 1.00 . A A . 660 GLY N    1 1 
        2  1516 1 1  4 GLY O    O  -30.586  -8.996  10.646 1.00 . A A . 660 GLY O    1 1 
        2  1517 1 1  5 GLU C    C  -27.440  -9.601  10.200 1.00 . A A . 661 GLU C    1 1 
        2  1518 1 1  5 GLU CA   C  -28.051  -9.662  11.610 1.00 . A A . 661 GLU CA   1 1 
        2  1519 1 1  5 GLU CB   C  -27.002 -10.180  12.606 1.00 . A A . 661 GLU CB   1 1 
        2  1520 1 1  5 GLU CD   C  -24.679  -9.903  13.600 1.00 . A A . 661 GLU CD   1 1 
        2  1521 1 1  5 GLU CG   C  -25.668  -9.439  12.541 1.00 . A A . 661 GLU CG   1 1 
        2  1522 1 1  5 GLU H    H  -29.182 -11.409  12.041 1.00 . A A . 661 GLU H    1 1 
        2  1523 1 1  5 GLU HA   H  -28.341  -8.662  11.905 1.00 . A A . 661 GLU HA   1 1 
        2  1524 1 1  5 GLU HB2  H  -27.397 -10.079  13.608 1.00 . A A . 661 GLU HB2  1 1 
        2  1525 1 1  5 GLU HB3  H  -26.820 -11.226  12.406 1.00 . A A . 661 GLU HB3  1 1 
        2  1526 1 1  5 GLU HG2  H  -25.230  -9.598  11.566 1.00 . A A . 661 GLU HG2  1 1 
        2  1527 1 1  5 GLU HG3  H  -25.852  -8.382  12.678 1.00 . A A . 661 GLU HG3  1 1 
        2  1528 1 1  5 GLU N    N  -29.251 -10.506  11.657 1.00 . A A . 661 GLU N    1 1 
        2  1529 1 1  5 GLU O    O  -27.099 -10.630   9.611 1.00 . A A . 661 GLU O    1 1 
        2  1530 1 1  5 GLU OE1  O  -23.934 -10.874  13.348 1.00 . A A . 661 GLU OE1  1 1 
        2  1531 1 1  5 GLU OE2  O  -24.644  -9.301  14.693 1.00 . A A . 661 GLU OE2  1 1 
        2  1532 1 1  6 THR C    C  -25.122  -8.231   8.507 1.00 . A A . 662 THR C    1 1 
        2  1533 1 1  6 THR CA   C  -26.649  -8.176   8.369 1.00 . A A . 662 THR CA   1 1 
        2  1534 1 1  6 THR CB   C  -27.053  -6.821   7.734 1.00 . A A . 662 THR CB   1 1 
        2  1535 1 1  6 THR CG2  C  -28.550  -6.784   7.434 1.00 . A A . 662 THR CG2  1 1 
        2  1536 1 1  6 THR H    H  -27.636  -7.609  10.163 1.00 . A A . 662 THR H    1 1 
        2  1537 1 1  6 THR HA   H  -26.969  -8.969   7.705 1.00 . A A . 662 THR HA   1 1 
        2  1538 1 1  6 THR HB   H  -26.514  -6.703   6.804 1.00 . A A . 662 THR HB   1 1 
        2  1539 1 1  6 THR HG1  H  -25.765  -5.772   8.813 1.00 . A A . 662 THR HG1  1 1 
        2  1540 1 1  6 THR HG21 H  -28.807  -7.597   6.770 1.00 . A A . 662 THR HG21 1 1 
        2  1541 1 1  6 THR HG22 H  -28.803  -5.844   6.963 1.00 . A A . 662 THR HG22 1 1 
        2  1542 1 1  6 THR HG23 H  -29.107  -6.884   8.355 1.00 . A A . 662 THR HG23 1 1 
        2  1543 1 1  6 THR N    N  -27.298  -8.386   9.669 1.00 . A A . 662 THR N    1 1 
        2  1544 1 1  6 THR O    O  -24.500  -7.316   9.051 1.00 . A A . 662 THR O    1 1 
        2  1545 1 1  6 THR OG1  O  -26.710  -5.733   8.610 1.00 . A A . 662 THR OG1  1 1 
        2  1546 1 1  7 SER C    C  -22.242  -8.615   7.289 1.00 . A A . 663 SER C    1 1 
        2  1547 1 1  7 SER CA   C  -23.081  -9.548   8.174 1.00 . A A . 663 SER CA   1 1 
        2  1548 1 1  7 SER CB   C  -22.745 -11.008   7.835 1.00 . A A . 663 SER CB   1 1 
        2  1549 1 1  7 SER H    H  -25.065  -9.976   7.534 1.00 . A A . 663 SER H    1 1 
        2  1550 1 1  7 SER HA   H  -22.829  -9.367   9.209 1.00 . A A . 663 SER HA   1 1 
        2  1551 1 1  7 SER HB2  H  -22.949 -11.189   6.790 1.00 . A A . 663 SER HB2  1 1 
        2  1552 1 1  7 SER HB3  H  -21.699 -11.189   8.032 1.00 . A A . 663 SER HB3  1 1 
        2  1553 1 1  7 SER HG   H  -23.667 -11.547   9.492 1.00 . A A . 663 SER HG   1 1 
        2  1554 1 1  7 SER N    N  -24.525  -9.313   8.018 1.00 . A A . 663 SER N    1 1 
        2  1555 1 1  7 SER O    O  -22.397  -8.594   6.066 1.00 . A A . 663 SER O    1 1 
        2  1556 1 1  7 SER OG   O  -23.518 -11.915   8.611 1.00 . A A . 663 SER OG   1 1 
        2  1557 1 1  8 ASP C    C  -19.161  -7.805   6.789 1.00 . A A . 664 ASP C    1 1 
        2  1558 1 1  8 ASP CA   C  -20.408  -6.998   7.178 1.00 . A A . 664 ASP CA   1 1 
        2  1559 1 1  8 ASP CB   C  -19.993  -5.778   8.017 1.00 . A A . 664 ASP CB   1 1 
        2  1560 1 1  8 ASP CG   C  -18.938  -4.921   7.320 1.00 . A A . 664 ASP CG   1 1 
        2  1561 1 1  8 ASP H    H  -21.354  -7.817   8.892 1.00 . A A . 664 ASP H    1 1 
        2  1562 1 1  8 ASP HA   H  -20.896  -6.652   6.276 1.00 . A A . 664 ASP HA   1 1 
        2  1563 1 1  8 ASP HB2  H  -20.863  -5.164   8.205 1.00 . A A . 664 ASP HB2  1 1 
        2  1564 1 1  8 ASP HB3  H  -19.590  -6.119   8.962 1.00 . A A . 664 ASP HB3  1 1 
        2  1565 1 1  8 ASP N    N  -21.362  -7.836   7.915 1.00 . A A . 664 ASP N    1 1 
        2  1566 1 1  8 ASP O    O  -18.589  -8.523   7.614 1.00 . A A . 664 ASP O    1 1 
        2  1567 1 1  8 ASP OD1  O  -17.757  -5.307   7.306 1.00 . A A . 664 ASP OD1  1 1 
        2  1568 1 1  8 ASP OD2  O  -19.272  -3.859   6.774 1.00 . A A . 664 ASP OD2  1 1 
        2  1569 1 1  9 LEU C    C  -16.338  -7.301   5.135 1.00 . A A . 665 LEU C    1 1 
        2  1570 1 1  9 LEU CA   C  -17.504  -8.299   5.069 1.00 . A A . 665 LEU CA   1 1 
        2  1571 1 1  9 LEU CB   C  -17.682  -8.845   3.647 1.00 . A A . 665 LEU CB   1 1 
        2  1572 1 1  9 LEU CD1  C  -18.791 -10.488   2.085 1.00 . A A . 665 LEU CD1  1 1 
        2  1573 1 1  9 LEU CD2  C  -18.454 -11.100   4.497 1.00 . A A . 665 LEU CD2  1 1 
        2  1574 1 1  9 LEU CG   C  -18.735  -9.962   3.513 1.00 . A A . 665 LEU CG   1 1 
        2  1575 1 1  9 LEU H    H  -19.279  -7.150   4.905 1.00 . A A . 665 LEU H    1 1 
        2  1576 1 1  9 LEU HA   H  -17.282  -9.125   5.732 1.00 . A A . 665 LEU HA   1 1 
        2  1577 1 1  9 LEU HB2  H  -17.971  -8.026   3.002 1.00 . A A . 665 LEU HB2  1 1 
        2  1578 1 1  9 LEU HB3  H  -16.732  -9.233   3.305 1.00 . A A . 665 LEU HB3  1 1 
        2  1579 1 1  9 LEU HD11 H  -19.504 -11.297   2.026 1.00 . A A . 665 LEU HD11 1 1 
        2  1580 1 1  9 LEU HD12 H  -17.815 -10.845   1.790 1.00 . A A . 665 LEU HD12 1 1 
        2  1581 1 1  9 LEU HD13 H  -19.097  -9.693   1.421 1.00 . A A . 665 LEU HD13 1 1 
        2  1582 1 1  9 LEU HD21 H  -18.487 -10.720   5.507 1.00 . A A . 665 LEU HD21 1 1 
        2  1583 1 1  9 LEU HD22 H  -17.477 -11.517   4.300 1.00 . A A . 665 LEU HD22 1 1 
        2  1584 1 1  9 LEU HD23 H  -19.203 -11.870   4.381 1.00 . A A . 665 LEU HD23 1 1 
        2  1585 1 1  9 LEU HG   H  -19.708  -9.555   3.749 1.00 . A A . 665 LEU HG   1 1 
        2  1586 1 1  9 LEU N    N  -18.742  -7.678   5.537 1.00 . A A . 665 LEU N    1 1 
        2  1587 1 1  9 LEU O    O  -16.494  -6.115   4.822 1.00 . A A . 665 LEU O    1 1 
        2  1588 1 1 10 GLU C    C  -13.393  -6.528   4.399 1.00 . A A . 666 GLU C    1 1 
        2  1589 1 1 10 GLU CA   C  -13.994  -6.941   5.757 1.00 . A A . 666 GLU CA   1 1 
        2  1590 1 1 10 GLU CB   C  -12.963  -7.665   6.638 1.00 . A A . 666 GLU CB   1 1 
        2  1591 1 1 10 GLU CD   C  -11.814  -9.843   7.199 1.00 . A A . 666 GLU CD   1 1 
        2  1592 1 1 10 GLU CG   C  -12.551  -9.044   6.137 1.00 . A A . 666 GLU CG   1 1 
        2  1593 1 1 10 GLU H    H  -15.127  -8.731   5.824 1.00 . A A . 666 GLU H    1 1 
        2  1594 1 1 10 GLU HA   H  -14.307  -6.043   6.272 1.00 . A A . 666 GLU HA   1 1 
        2  1595 1 1 10 GLU HB2  H  -12.074  -7.053   6.704 1.00 . A A . 666 GLU HB2  1 1 
        2  1596 1 1 10 GLU HB3  H  -13.378  -7.777   7.630 1.00 . A A . 666 GLU HB3  1 1 
        2  1597 1 1 10 GLU HG2  H  -13.439  -9.589   5.845 1.00 . A A . 666 GLU HG2  1 1 
        2  1598 1 1 10 GLU HG3  H  -11.905  -8.925   5.278 1.00 . A A . 666 GLU HG3  1 1 
        2  1599 1 1 10 GLU N    N  -15.183  -7.783   5.595 1.00 . A A . 666 GLU N    1 1 
        2  1600 1 1 10 GLU O    O  -13.541  -7.238   3.399 1.00 . A A . 666 GLU O    1 1 
        2  1601 1 1 10 GLU OE1  O  -10.616  -9.576   7.437 1.00 . A A . 666 GLU OE1  1 1 
        2  1602 1 1 10 GLU OE2  O  -12.436 -10.732   7.822 1.00 . A A . 666 GLU OE2  1 1 
        2  1603 1 1 11 PRO C    C  -11.172  -5.561   2.341 1.00 . A A . 667 PRO C    1 1 
        2  1604 1 1 11 PRO CA   C  -12.249  -4.758   3.088 1.00 . A A . 667 PRO CA   1 1 
        2  1605 1 1 11 PRO CB   C  -11.689  -3.401   3.531 1.00 . A A . 667 PRO CB   1 1 
        2  1606 1 1 11 PRO CD   C  -12.291  -4.565   5.524 1.00 . A A . 667 PRO CD   1 1 
        2  1607 1 1 11 PRO CG   C  -11.290  -3.600   4.956 1.00 . A A . 667 PRO CG   1 1 
        2  1608 1 1 11 PRO HA   H  -13.087  -4.594   2.422 1.00 . A A . 667 PRO HA   1 1 
        2  1609 1 1 11 PRO HB2  H  -10.842  -3.131   2.914 1.00 . A A . 667 PRO HB2  1 1 
        2  1610 1 1 11 PRO HB3  H  -12.458  -2.646   3.442 1.00 . A A . 667 PRO HB3  1 1 
        2  1611 1 1 11 PRO HD2  H  -11.829  -5.184   6.281 1.00 . A A . 667 PRO HD2  1 1 
        2  1612 1 1 11 PRO HD3  H  -13.137  -4.033   5.936 1.00 . A A . 667 PRO HD3  1 1 
        2  1613 1 1 11 PRO HG2  H  -10.292  -4.017   5.008 1.00 . A A . 667 PRO HG2  1 1 
        2  1614 1 1 11 PRO HG3  H  -11.331  -2.659   5.487 1.00 . A A . 667 PRO HG3  1 1 
        2  1615 1 1 11 PRO N    N  -12.699  -5.370   4.352 1.00 . A A . 667 PRO N    1 1 
        2  1616 1 1 11 PRO O    O  -10.227  -6.083   2.938 1.00 . A A . 667 PRO O    1 1 
        2  1617 1 1 12 LYS C    C   -9.185  -5.295  -0.159 1.00 . A A . 668 LYS C    1 1 
        2  1618 1 1 12 LYS CA   C  -10.327  -6.271   0.159 1.00 . A A . 668 LYS CA   1 1 
        2  1619 1 1 12 LYS CB   C  -10.998  -6.754  -1.138 1.00 . A A . 668 LYS CB   1 1 
        2  1620 1 1 12 LYS CD   C   -9.749  -8.940  -1.325 1.00 . A A . 668 LYS CD   1 1 
        2  1621 1 1 12 LYS CE   C   -8.994  -9.886  -2.250 1.00 . A A . 668 LYS CE   1 1 
        2  1622 1 1 12 LYS CG   C  -10.112  -7.630  -2.019 1.00 . A A . 668 LYS CG   1 1 
        2  1623 1 1 12 LYS H    H  -12.115  -5.235   0.611 1.00 . A A . 668 LYS H    1 1 
        2  1624 1 1 12 LYS HA   H   -9.923  -7.125   0.687 1.00 . A A . 668 LYS HA   1 1 
        2  1625 1 1 12 LYS HB2  H  -11.878  -7.325  -0.877 1.00 . A A . 668 LYS HB2  1 1 
        2  1626 1 1 12 LYS HB3  H  -11.302  -5.889  -1.714 1.00 . A A . 668 LYS HB3  1 1 
        2  1627 1 1 12 LYS HD2  H   -9.126  -8.723  -0.469 1.00 . A A . 668 LYS HD2  1 1 
        2  1628 1 1 12 LYS HD3  H  -10.659  -9.424  -0.995 1.00 . A A . 668 LYS HD3  1 1 
        2  1629 1 1 12 LYS HE2  H   -8.820 -10.816  -1.727 1.00 . A A . 668 LYS HE2  1 1 
        2  1630 1 1 12 LYS HE3  H   -9.601 -10.077  -3.124 1.00 . A A . 668 LYS HE3  1 1 
        2  1631 1 1 12 LYS HG2  H  -10.643  -7.855  -2.934 1.00 . A A . 668 LYS HG2  1 1 
        2  1632 1 1 12 LYS HG3  H   -9.205  -7.091  -2.253 1.00 . A A . 668 LYS HG3  1 1 
        2  1633 1 1 12 LYS HZ1  H   -7.180 -10.019  -3.277 1.00 . A A . 668 LYS HZ1  1 1 
        2  1634 1 1 12 LYS HZ2  H   -7.098  -9.121  -1.850 1.00 . A A . 668 LYS HZ2  1 1 
        2  1635 1 1 12 LYS HZ3  H   -7.823  -8.456  -3.222 1.00 . A A . 668 LYS HZ3  1 1 
        2  1636 1 1 12 LYS N    N  -11.316  -5.629   1.021 1.00 . A A . 668 LYS N    1 1 
        2  1637 1 1 12 LYS NZ   N   -7.685  -9.330  -2.679 1.00 . A A . 668 LYS NZ   1 1 
        2  1638 1 1 12 LYS O    O   -9.330  -4.391  -0.987 1.00 . A A . 668 LYS O    1 1 
        2  1639 1 1 13 LEU C    C   -5.981  -5.075  -0.776 1.00 . A A . 669 LEU C    1 1 
        2  1640 1 1 13 LEU CA   C   -6.903  -4.576   0.348 1.00 . A A . 669 LEU CA   1 1 
        2  1641 1 1 13 LEU CB   C   -6.127  -4.474   1.673 1.00 . A A . 669 LEU CB   1 1 
        2  1642 1 1 13 LEU CD1  C   -5.213  -2.142   1.313 1.00 . A A . 669 LEU CD1  1 1 
        2  1643 1 1 13 LEU CD2  C   -4.124  -3.674   2.980 1.00 . A A . 669 LEU CD2  1 1 
        2  1644 1 1 13 LEU CG   C   -4.865  -3.591   1.648 1.00 . A A . 669 LEU CG   1 1 
        2  1645 1 1 13 LEU H    H   -7.998  -6.206   1.160 1.00 . A A . 669 LEU H    1 1 
        2  1646 1 1 13 LEU HA   H   -7.276  -3.596   0.085 1.00 . A A . 669 LEU HA   1 1 
        2  1647 1 1 13 LEU HB2  H   -6.799  -4.084   2.425 1.00 . A A . 669 LEU HB2  1 1 
        2  1648 1 1 13 LEU HB3  H   -5.833  -5.474   1.968 1.00 . A A . 669 LEU HB3  1 1 
        2  1649 1 1 13 LEU HD11 H   -4.309  -1.549   1.293 1.00 . A A . 669 LEU HD11 1 1 
        2  1650 1 1 13 LEU HD12 H   -5.884  -1.748   2.061 1.00 . A A . 669 LEU HD12 1 1 
        2  1651 1 1 13 LEU HD13 H   -5.689  -2.100   0.344 1.00 . A A . 669 LEU HD13 1 1 
        2  1652 1 1 13 LEU HD21 H   -4.772  -3.336   3.777 1.00 . A A . 669 LEU HD21 1 1 
        2  1653 1 1 13 LEU HD22 H   -3.243  -3.047   2.943 1.00 . A A . 669 LEU HD22 1 1 
        2  1654 1 1 13 LEU HD23 H   -3.827  -4.696   3.166 1.00 . A A . 669 LEU HD23 1 1 
        2  1655 1 1 13 LEU HG   H   -4.201  -3.955   0.877 1.00 . A A . 669 LEU HG   1 1 
        2  1656 1 1 13 LEU N    N   -8.056  -5.467   0.519 1.00 . A A . 669 LEU N    1 1 
        2  1657 1 1 13 LEU O    O   -5.372  -6.138  -0.665 1.00 . A A . 669 LEU O    1 1 
        2  1658 1 1 14 THR C    C   -3.626  -4.138  -2.850 1.00 . A A . 670 THR C    1 1 
        2  1659 1 1 14 THR CA   C   -5.055  -4.676  -3.010 1.00 . A A . 670 THR CA   1 1 
        2  1660 1 1 14 THR CB   C   -5.651  -4.132  -4.335 1.00 . A A . 670 THR CB   1 1 
        2  1661 1 1 14 THR CG2  C   -4.841  -4.603  -5.538 1.00 . A A . 670 THR CG2  1 1 
        2  1662 1 1 14 THR H    H   -6.373  -3.456  -1.882 1.00 . A A . 670 THR H    1 1 
        2  1663 1 1 14 THR HA   H   -5.022  -5.757  -3.068 1.00 . A A . 670 THR HA   1 1 
        2  1664 1 1 14 THR HB   H   -5.629  -3.051  -4.303 1.00 . A A . 670 THR HB   1 1 
        2  1665 1 1 14 THR HG1  H   -7.482  -4.448  -3.642 1.00 . A A . 670 THR HG1  1 1 
        2  1666 1 1 14 THR HG21 H   -5.275  -4.205  -6.444 1.00 . A A . 670 THR HG21 1 1 
        2  1667 1 1 14 THR HG22 H   -4.849  -5.682  -5.580 1.00 . A A . 670 THR HG22 1 1 
        2  1668 1 1 14 THR HG23 H   -3.820  -4.254  -5.445 1.00 . A A . 670 THR HG23 1 1 
        2  1669 1 1 14 THR N    N   -5.887  -4.304  -1.860 1.00 . A A . 670 THR N    1 1 
        2  1670 1 1 14 THR O    O   -3.393  -2.929  -2.925 1.00 . A A . 670 THR O    1 1 
        2  1671 1 1 14 THR OG1  O   -7.020  -4.562  -4.482 1.00 . A A . 670 THR OG1  1 1 
        2  1672 1 1 15 VAL C    C   -0.339  -5.597  -3.240 1.00 . A A . 671 VAL C    1 1 
        2  1673 1 1 15 VAL CA   C   -1.267  -4.672  -2.440 1.00 . A A . 671 VAL CA   1 1 
        2  1674 1 1 15 VAL CB   C   -0.863  -4.732  -0.940 1.00 . A A . 671 VAL CB   1 1 
        2  1675 1 1 15 VAL CG1  C    0.626  -4.439  -0.755 1.00 . A A . 671 VAL CG1  1 1 
        2  1676 1 1 15 VAL CG2  C   -1.701  -3.763  -0.111 1.00 . A A . 671 VAL CG2  1 1 
        2  1677 1 1 15 VAL H    H   -2.921  -5.993  -2.613 1.00 . A A . 671 VAL H    1 1 
        2  1678 1 1 15 VAL HA   H   -1.134  -3.656  -2.788 1.00 . A A . 671 VAL HA   1 1 
        2  1679 1 1 15 VAL HB   H   -1.055  -5.734  -0.582 1.00 . A A . 671 VAL HB   1 1 
        2  1680 1 1 15 VAL HG11 H    0.854  -3.457  -1.145 1.00 . A A . 671 VAL HG11 1 1 
        2  1681 1 1 15 VAL HG12 H    1.209  -5.179  -1.283 1.00 . A A . 671 VAL HG12 1 1 
        2  1682 1 1 15 VAL HG13 H    0.871  -4.475   0.297 1.00 . A A . 671 VAL HG13 1 1 
        2  1683 1 1 15 VAL HG21 H   -2.749  -4.001  -0.230 1.00 . A A . 671 VAL HG21 1 1 
        2  1684 1 1 15 VAL HG22 H   -1.522  -2.751  -0.448 1.00 . A A . 671 VAL HG22 1 1 
        2  1685 1 1 15 VAL HG23 H   -1.428  -3.850   0.930 1.00 . A A . 671 VAL HG23 1 1 
        2  1686 1 1 15 VAL N    N   -2.674  -5.043  -2.635 1.00 . A A . 671 VAL N    1 1 
        2  1687 1 1 15 VAL O    O   -0.380  -6.818  -3.075 1.00 . A A . 671 VAL O    1 1 
        2  1688 1 1 16 PRO C    C    2.599  -6.405  -4.038 1.00 . A A . 672 PRO C    1 1 
        2  1689 1 1 16 PRO CA   C    1.468  -5.823  -4.903 1.00 . A A . 672 PRO CA   1 1 
        2  1690 1 1 16 PRO CB   C    2.012  -4.815  -5.925 1.00 . A A . 672 PRO CB   1 1 
        2  1691 1 1 16 PRO CD   C    0.626  -3.582  -4.395 1.00 . A A . 672 PRO CD   1 1 
        2  1692 1 1 16 PRO CG   C    1.843  -3.480  -5.279 1.00 . A A . 672 PRO CG   1 1 
        2  1693 1 1 16 PRO HA   H    0.966  -6.631  -5.422 1.00 . A A . 672 PRO HA   1 1 
        2  1694 1 1 16 PRO HB2  H    3.052  -5.027  -6.132 1.00 . A A . 672 PRO HB2  1 1 
        2  1695 1 1 16 PRO HB3  H    1.439  -4.882  -6.839 1.00 . A A . 672 PRO HB3  1 1 
        2  1696 1 1 16 PRO HD2  H    0.775  -3.023  -3.482 1.00 . A A . 672 PRO HD2  1 1 
        2  1697 1 1 16 PRO HD3  H   -0.249  -3.226  -4.915 1.00 . A A . 672 PRO HD3  1 1 
        2  1698 1 1 16 PRO HG2  H    2.718  -3.248  -4.686 1.00 . A A . 672 PRO HG2  1 1 
        2  1699 1 1 16 PRO HG3  H    1.696  -2.720  -6.035 1.00 . A A . 672 PRO HG3  1 1 
        2  1700 1 1 16 PRO N    N    0.516  -5.030  -4.113 1.00 . A A . 672 PRO N    1 1 
        2  1701 1 1 16 PRO O    O    3.146  -5.725  -3.170 1.00 . A A . 672 PRO O    1 1 
        2  1702 1 1 17 VAL C    C    5.360  -7.706  -3.639 1.00 . A A . 673 VAL C    1 1 
        2  1703 1 1 17 VAL CA   C    3.968  -8.355  -3.482 1.00 . A A . 673 VAL CA   1 1 
        2  1704 1 1 17 VAL CB   C    4.042  -9.862  -3.855 1.00 . A A . 673 VAL CB   1 1 
        2  1705 1 1 17 VAL CG1  C    4.449 -10.052  -5.316 1.00 . A A . 673 VAL CG1  1 1 
        2  1706 1 1 17 VAL CG2  C    4.985 -10.609  -2.916 1.00 . A A . 673 VAL CG2  1 1 
        2  1707 1 1 17 VAL H    H    2.500  -8.152  -5.006 1.00 . A A . 673 VAL H    1 1 
        2  1708 1 1 17 VAL HA   H    3.672  -8.285  -2.442 1.00 . A A . 673 VAL HA   1 1 
        2  1709 1 1 17 VAL HB   H    3.052 -10.282  -3.735 1.00 . A A . 673 VAL HB   1 1 
        2  1710 1 1 17 VAL HG11 H    5.431  -9.630  -5.476 1.00 . A A . 673 VAL HG11 1 1 
        2  1711 1 1 17 VAL HG12 H    3.736  -9.553  -5.957 1.00 . A A . 673 VAL HG12 1 1 
        2  1712 1 1 17 VAL HG13 H    4.469 -11.106  -5.551 1.00 . A A . 673 VAL HG13 1 1 
        2  1713 1 1 17 VAL HG21 H    5.030 -11.651  -3.200 1.00 . A A . 673 VAL HG21 1 1 
        2  1714 1 1 17 VAL HG22 H    4.622 -10.530  -1.901 1.00 . A A . 673 VAL HG22 1 1 
        2  1715 1 1 17 VAL HG23 H    5.974 -10.178  -2.977 1.00 . A A . 673 VAL HG23 1 1 
        2  1716 1 1 17 VAL N    N    2.947  -7.667  -4.281 1.00 . A A . 673 VAL N    1 1 
        2  1717 1 1 17 VAL O    O    6.127  -7.610  -2.675 1.00 . A A . 673 VAL O    1 1 
        2  1718 1 1 18 GLY C    C    6.955  -5.645  -6.278 1.00 . A A . 674 GLY C    1 1 
        2  1719 1 1 18 GLY CA   C    6.970  -6.630  -5.110 1.00 . A A . 674 GLY CA   1 1 
        2  1720 1 1 18 GLY H    H    5.013  -7.312  -5.571 1.00 . A A . 674 GLY H    1 1 
        2  1721 1 1 18 GLY HA2  H    7.296  -6.108  -4.222 1.00 . A A . 674 GLY HA2  1 1 
        2  1722 1 1 18 GLY HA3  H    7.680  -7.414  -5.330 1.00 . A A . 674 GLY HA3  1 1 
        2  1723 1 1 18 GLY N    N    5.670  -7.241  -4.849 1.00 . A A . 674 GLY N    1 1 
        2  1724 1 1 18 GLY O    O    6.117  -5.745  -7.177 1.00 . A A . 674 GLY O    1 1 
        2  1725 1 1 19 ALA C    C    9.485  -3.245  -7.472 1.00 . A A . 675 ALA C    1 1 
        2  1726 1 1 19 ALA CA   C    8.025  -3.702  -7.333 1.00 . A A . 675 ALA CA   1 1 
        2  1727 1 1 19 ALA CB   C    7.117  -2.506  -7.060 1.00 . A A . 675 ALA CB   1 1 
        2  1728 1 1 19 ALA H    H    8.507  -4.656  -5.500 1.00 . A A . 675 ALA H    1 1 
        2  1729 1 1 19 ALA HA   H    7.712  -4.161  -8.263 1.00 . A A . 675 ALA HA   1 1 
        2  1730 1 1 19 ALA HB1  H    7.419  -2.025  -6.141 1.00 . A A . 675 ALA HB1  1 1 
        2  1731 1 1 19 ALA HB2  H    6.096  -2.845  -6.969 1.00 . A A . 675 ALA HB2  1 1 
        2  1732 1 1 19 ALA HB3  H    7.190  -1.801  -7.875 1.00 . A A . 675 ALA HB3  1 1 
        2  1733 1 1 19 ALA N    N    7.889  -4.696  -6.263 1.00 . A A . 675 ALA N    1 1 
        2  1734 1 1 19 ALA O    O   10.202  -3.119  -6.478 1.00 . A A . 675 ALA O    1 1 
        2  1735 1 1 20 THR C    C   11.395  -1.206  -9.623 1.00 . A A . 676 THR C    1 1 
        2  1736 1 1 20 THR CA   C   11.317  -2.590  -8.960 1.00 . A A . 676 THR CA   1 1 
        2  1737 1 1 20 THR CB   C   12.058  -3.615  -9.858 1.00 . A A . 676 THR CB   1 1 
        2  1738 1 1 20 THR CG2  C   13.508  -3.197 -10.100 1.00 . A A . 676 THR CG2  1 1 
        2  1739 1 1 20 THR H    H    9.306  -3.087  -9.459 1.00 . A A . 676 THR H    1 1 
        2  1740 1 1 20 THR HA   H   11.831  -2.547  -8.009 1.00 . A A . 676 THR HA   1 1 
        2  1741 1 1 20 THR HB   H   11.552  -3.667 -10.813 1.00 . A A . 676 THR HB   1 1 
        2  1742 1 1 20 THR HG1  H   11.177  -5.328  -9.406 1.00 . A A . 676 THR HG1  1 1 
        2  1743 1 1 20 THR HG21 H   13.990  -3.921 -10.739 1.00 . A A . 676 THR HG21 1 1 
        2  1744 1 1 20 THR HG22 H   14.030  -3.147  -9.156 1.00 . A A . 676 THR HG22 1 1 
        2  1745 1 1 20 THR HG23 H   13.531  -2.227 -10.575 1.00 . A A . 676 THR HG23 1 1 
        2  1746 1 1 20 THR N    N    9.925  -2.997  -8.704 1.00 . A A . 676 THR N    1 1 
        2  1747 1 1 20 THR O    O   10.846  -0.990 -10.705 1.00 . A A . 676 THR O    1 1 
        2  1748 1 1 20 THR OG1  O   12.038  -4.918  -9.250 1.00 . A A . 676 THR OG1  1 1 
        2  1749 1 1 21 ILE C    C   13.827   1.391  -9.498 1.00 . A A . 677 ILE C    1 1 
        2  1750 1 1 21 ILE CA   C   12.326   1.066  -9.514 1.00 . A A . 677 ILE CA   1 1 
        2  1751 1 1 21 ILE CB   C   11.546   2.161  -8.736 1.00 . A A . 677 ILE CB   1 1 
        2  1752 1 1 21 ILE CD1  C   11.255   3.232  -6.432 1.00 . A A . 677 ILE CD1  1 1 
        2  1753 1 1 21 ILE CG1  C   11.931   2.149  -7.247 1.00 . A A . 677 ILE CG1  1 1 
        2  1754 1 1 21 ILE CG2  C   10.038   1.972  -8.908 1.00 . A A . 677 ILE CG2  1 1 
        2  1755 1 1 21 ILE H    H   12.457  -0.503  -8.084 1.00 . A A . 677 ILE H    1 1 
        2  1756 1 1 21 ILE HA   H   11.986   1.074 -10.543 1.00 . A A . 677 ILE HA   1 1 
        2  1757 1 1 21 ILE HB   H   11.808   3.123  -9.158 1.00 . A A . 677 ILE HB   1 1 
        2  1758 1 1 21 ILE HD11 H   11.522   4.201  -6.829 1.00 . A A . 677 ILE HD11 1 1 
        2  1759 1 1 21 ILE HD12 H   11.580   3.162  -5.403 1.00 . A A . 677 ILE HD12 1 1 
        2  1760 1 1 21 ILE HD13 H   10.183   3.105  -6.480 1.00 . A A . 677 ILE HD13 1 1 
        2  1761 1 1 21 ILE HG12 H   11.660   1.195  -6.817 1.00 . A A . 677 ILE HG12 1 1 
        2  1762 1 1 21 ILE HG13 H   13.000   2.286  -7.157 1.00 . A A . 677 ILE HG13 1 1 
        2  1763 1 1 21 ILE HG21 H    9.747   1.007  -8.515 1.00 . A A . 677 ILE HG21 1 1 
        2  1764 1 1 21 ILE HG22 H    9.785   2.024  -9.958 1.00 . A A . 677 ILE HG22 1 1 
        2  1765 1 1 21 ILE HG23 H    9.511   2.751  -8.374 1.00 . A A . 677 ILE HG23 1 1 
        2  1766 1 1 21 ILE N    N   12.085  -0.278  -8.966 1.00 . A A . 677 ILE N    1 1 
        2  1767 1 1 21 ILE O    O   14.635   0.586  -9.036 1.00 . A A . 677 ILE O    1 1 
        2  1768 1 1 22 HIS C    C   15.918   4.270  -9.391 1.00 . A A . 678 HIS C    1 1 
        2  1769 1 1 22 HIS CA   C   15.626   2.936 -10.099 1.00 . A A . 678 HIS CA   1 1 
        2  1770 1 1 22 HIS CB   C   16.066   3.042 -11.562 1.00 . A A . 678 HIS CB   1 1 
        2  1771 1 1 22 HIS CD2  C   16.414   0.669 -12.544 1.00 . A A . 678 HIS CD2  1 1 
        2  1772 1 1 22 HIS CE1  C   14.610   0.575 -13.781 1.00 . A A . 678 HIS CE1  1 1 
        2  1773 1 1 22 HIS CG   C   15.746   1.833 -12.381 1.00 . A A . 678 HIS CG   1 1 
        2  1774 1 1 22 HIS H    H   13.527   3.168 -10.376 1.00 . A A . 678 HIS H    1 1 
        2  1775 1 1 22 HIS HA   H   16.205   2.162  -9.621 1.00 . A A . 678 HIS HA   1 1 
        2  1776 1 1 22 HIS HB2  H   15.576   3.888 -12.022 1.00 . A A . 678 HIS HB2  1 1 
        2  1777 1 1 22 HIS HB3  H   17.137   3.194 -11.599 1.00 . A A . 678 HIS HB3  1 1 
        2  1778 1 1 22 HIS HD1  H   13.931   2.437 -13.264 1.00 . A A . 678 HIS HD1  1 1 
        2  1779 1 1 22 HIS HD2  H   17.345   0.393 -12.069 1.00 . A A . 678 HIS HD2  1 1 
        2  1780 1 1 22 HIS HE1  H   13.848   0.229 -14.463 1.00 . A A . 678 HIS HE1  1 1 
        2  1781 1 1 22 HIS HE2  H   16.022  -0.897 -13.881 1.00 . A A . 678 HIS HE2  1 1 
        2  1782 1 1 22 HIS N    N   14.208   2.555 -10.023 1.00 . A A . 678 HIS N    1 1 
        2  1783 1 1 22 HIS ND1  N   14.623   1.743 -13.171 1.00 . A A . 678 HIS ND1  1 1 
        2  1784 1 1 22 HIS NE2  N   15.686  -0.096 -13.421 1.00 . A A . 678 HIS NE2  1 1 
        2  1785 1 1 22 HIS O    O   15.023   5.084  -9.168 1.00 . A A . 678 HIS O    1 1 
        2  1786 1 1 23 VAL C    C   17.407   6.883  -9.529 1.00 . A A . 679 VAL C    1 1 
        2  1787 1 1 23 VAL CA   C   17.654   5.759  -8.512 1.00 . A A . 679 VAL CA   1 1 
        2  1788 1 1 23 VAL CB   C   19.165   5.704  -8.157 1.00 . A A . 679 VAL CB   1 1 
        2  1789 1 1 23 VAL CG1  C   19.664   7.062  -7.662 1.00 . A A . 679 VAL CG1  1 1 
        2  1790 1 1 23 VAL CG2  C   19.433   4.613  -7.119 1.00 . A A . 679 VAL CG2  1 1 
        2  1791 1 1 23 VAL H    H   17.826   3.740  -9.124 1.00 . A A . 679 VAL H    1 1 
        2  1792 1 1 23 VAL HA   H   17.099   5.971  -7.607 1.00 . A A . 679 VAL HA   1 1 
        2  1793 1 1 23 VAL HB   H   19.714   5.453  -9.057 1.00 . A A . 679 VAL HB   1 1 
        2  1794 1 1 23 VAL HG11 H   19.518   7.804  -8.435 1.00 . A A . 679 VAL HG11 1 1 
        2  1795 1 1 23 VAL HG12 H   20.716   6.997  -7.421 1.00 . A A . 679 VAL HG12 1 1 
        2  1796 1 1 23 VAL HG13 H   19.110   7.351  -6.779 1.00 . A A . 679 VAL HG13 1 1 
        2  1797 1 1 23 VAL HG21 H   19.121   3.656  -7.515 1.00 . A A . 679 VAL HG21 1 1 
        2  1798 1 1 23 VAL HG22 H   18.878   4.826  -6.217 1.00 . A A . 679 VAL HG22 1 1 
        2  1799 1 1 23 VAL HG23 H   20.488   4.578  -6.892 1.00 . A A . 679 VAL HG23 1 1 
        2  1800 1 1 23 VAL N    N   17.189   4.476  -9.041 1.00 . A A . 679 VAL N    1 1 
        2  1801 1 1 23 VAL O    O   18.029   6.918 -10.592 1.00 . A A . 679 VAL O    1 1 
        2  1802 1 1 24 GLY C    C   14.631   8.731 -10.554 1.00 . A A . 680 GLY C    1 1 
        2  1803 1 1 24 GLY CA   C   16.096   8.845 -10.128 1.00 . A A . 680 GLY CA   1 1 
        2  1804 1 1 24 GLY H    H   16.098   7.759  -8.301 1.00 . A A . 680 GLY H    1 1 
        2  1805 1 1 24 GLY HA2  H   16.247   9.803  -9.654 1.00 . A A . 680 GLY HA2  1 1 
        2  1806 1 1 24 GLY HA3  H   16.718   8.793 -11.011 1.00 . A A . 680 GLY HA3  1 1 
        2  1807 1 1 24 GLY N    N   16.496   7.793  -9.197 1.00 . A A . 680 GLY N    1 1 
        2  1808 1 1 24 GLY O    O   14.036   9.706 -11.025 1.00 . A A . 680 GLY O    1 1 
        2  1809 1 1 25 ASP C    C   11.703   7.833  -9.629 1.00 . A A . 681 ASP C    1 1 
        2  1810 1 1 25 ASP CA   C   12.642   7.290 -10.725 1.00 . A A . 681 ASP CA   1 1 
        2  1811 1 1 25 ASP CB   C   12.397   5.782 -10.913 1.00 . A A . 681 ASP CB   1 1 
        2  1812 1 1 25 ASP CG   C   13.160   5.173 -12.082 1.00 . A A . 681 ASP CG   1 1 
        2  1813 1 1 25 ASP H    H   14.591   6.799 -10.040 1.00 . A A . 681 ASP H    1 1 
        2  1814 1 1 25 ASP HA   H   12.423   7.798 -11.652 1.00 . A A . 681 ASP HA   1 1 
        2  1815 1 1 25 ASP HB2  H   12.693   5.264 -10.011 1.00 . A A . 681 ASP HB2  1 1 
        2  1816 1 1 25 ASP HB3  H   11.341   5.617 -11.078 1.00 . A A . 681 ASP HB3  1 1 
        2  1817 1 1 25 ASP N    N   14.054   7.537 -10.394 1.00 . A A . 681 ASP N    1 1 
        2  1818 1 1 25 ASP O    O   12.107   8.623  -8.777 1.00 . A A . 681 ASP O    1 1 
        2  1819 1 1 25 ASP OD1  O   13.870   5.904 -12.801 1.00 . A A . 681 ASP OD1  1 1 
        2  1820 1 1 25 ASP OD2  O   13.046   3.945 -12.286 1.00 . A A . 681 ASP OD2  1 1 
        2  1821 1 1 26 SER C    C    8.490   6.677  -8.307 1.00 . A A . 682 SER C    1 1 
        2  1822 1 1 26 SER CA   C    9.443   7.824  -8.670 1.00 . A A . 682 SER CA   1 1 
        2  1823 1 1 26 SER CB   C    8.640   9.027  -9.193 1.00 . A A . 682 SER CB   1 1 
        2  1824 1 1 26 SER H    H   10.169   6.792 -10.378 1.00 . A A . 682 SER H    1 1 
        2  1825 1 1 26 SER HA   H    9.973   8.124  -7.777 1.00 . A A . 682 SER HA   1 1 
        2  1826 1 1 26 SER HB2  H    7.809   9.219  -8.532 1.00 . A A . 682 SER HB2  1 1 
        2  1827 1 1 26 SER HB3  H    9.279   9.898  -9.225 1.00 . A A . 682 SER HB3  1 1 
        2  1828 1 1 26 SER HG   H    7.216   8.483 -10.440 1.00 . A A . 682 SER HG   1 1 
        2  1829 1 1 26 SER N    N   10.441   7.403  -9.664 1.00 . A A . 682 SER N    1 1 
        2  1830 1 1 26 SER O    O    8.287   5.747  -9.093 1.00 . A A . 682 SER O    1 1 
        2  1831 1 1 26 SER OG   O    8.134   8.784 -10.500 1.00 . A A . 682 SER OG   1 1 
        2  1832 1 1 27 PHE C    C    5.828   6.365  -5.821 1.00 . A A . 683 PHE C    1 1 
        2  1833 1 1 27 PHE CA   C    6.967   5.723  -6.632 1.00 . A A . 683 PHE CA   1 1 
        2  1834 1 1 27 PHE CB   C    7.715   4.690  -5.772 1.00 . A A . 683 PHE CB   1 1 
        2  1835 1 1 27 PHE CD1  C    6.813   2.378  -6.222 1.00 . A A . 683 PHE CD1  1 1 
        2  1836 1 1 27 PHE CD2  C    6.142   3.476  -4.209 1.00 . A A . 683 PHE CD2  1 1 
        2  1837 1 1 27 PHE CE1  C    6.043   1.282  -5.882 1.00 . A A . 683 PHE CE1  1 1 
        2  1838 1 1 27 PHE CE2  C    5.370   2.382  -3.869 1.00 . A A . 683 PHE CE2  1 1 
        2  1839 1 1 27 PHE CG   C    6.874   3.490  -5.391 1.00 . A A . 683 PHE CG   1 1 
        2  1840 1 1 27 PHE CZ   C    5.321   1.285  -4.705 1.00 . A A . 683 PHE CZ   1 1 
        2  1841 1 1 27 PHE H    H    8.087   7.530  -6.545 1.00 . A A . 683 PHE H    1 1 
        2  1842 1 1 27 PHE HA   H    6.544   5.226  -7.495 1.00 . A A . 683 PHE HA   1 1 
        2  1843 1 1 27 PHE HB2  H    8.576   4.332  -6.320 1.00 . A A . 683 PHE HB2  1 1 
        2  1844 1 1 27 PHE HB3  H    8.052   5.164  -4.860 1.00 . A A . 683 PHE HB3  1 1 
        2  1845 1 1 27 PHE HD1  H    7.377   2.372  -7.144 1.00 . A A . 683 PHE HD1  1 1 
        2  1846 1 1 27 PHE HD2  H    6.180   4.332  -3.552 1.00 . A A . 683 PHE HD2  1 1 
        2  1847 1 1 27 PHE HE1  H    6.005   0.424  -6.537 1.00 . A A . 683 PHE HE1  1 1 
        2  1848 1 1 27 PHE HE2  H    4.806   2.383  -2.947 1.00 . A A . 683 PHE HE2  1 1 
        2  1849 1 1 27 PHE HZ   H    4.717   0.428  -4.441 1.00 . A A . 683 PHE HZ   1 1 
        2  1850 1 1 27 PHE N    N    7.901   6.752  -7.116 1.00 . A A . 683 PHE N    1 1 
        2  1851 1 1 27 PHE O    O    6.068   7.244  -4.993 1.00 . A A . 683 PHE O    1 1 
        2  1852 1 1 28 VAL C    C    2.572   5.493  -4.654 1.00 . A A . 684 VAL C    1 1 
        2  1853 1 1 28 VAL CA   C    3.423   6.540  -5.405 1.00 . A A . 684 VAL CA   1 1 
        2  1854 1 1 28 VAL CB   C    2.533   7.290  -6.433 1.00 . A A . 684 VAL CB   1 1 
        2  1855 1 1 28 VAL CG1  C    1.418   8.062  -5.730 1.00 . A A . 684 VAL CG1  1 1 
        2  1856 1 1 28 VAL CG2  C    3.376   8.225  -7.301 1.00 . A A . 684 VAL CG2  1 1 
        2  1857 1 1 28 VAL H    H    4.453   5.180  -6.685 1.00 . A A . 684 VAL H    1 1 
        2  1858 1 1 28 VAL HA   H    3.787   7.264  -4.688 1.00 . A A . 684 VAL HA   1 1 
        2  1859 1 1 28 VAL HB   H    2.073   6.554  -7.080 1.00 . A A . 684 VAL HB   1 1 
        2  1860 1 1 28 VAL HG11 H    0.812   8.571  -6.467 1.00 . A A . 684 VAL HG11 1 1 
        2  1861 1 1 28 VAL HG12 H    1.848   8.789  -5.056 1.00 . A A . 684 VAL HG12 1 1 
        2  1862 1 1 28 VAL HG13 H    0.799   7.375  -5.171 1.00 . A A . 684 VAL HG13 1 1 
        2  1863 1 1 28 VAL HG21 H    3.841   8.975  -6.678 1.00 . A A . 684 VAL HG21 1 1 
        2  1864 1 1 28 VAL HG22 H    2.743   8.707  -8.033 1.00 . A A . 684 VAL HG22 1 1 
        2  1865 1 1 28 VAL HG23 H    4.142   7.655  -7.808 1.00 . A A . 684 VAL HG23 1 1 
        2  1866 1 1 28 VAL N    N    4.589   5.929  -6.061 1.00 . A A . 684 VAL N    1 1 
        2  1867 1 1 28 VAL O    O    1.708   4.837  -5.243 1.00 . A A . 684 VAL O    1 1 
        2  1868 1 1 29 PRO C    C    0.556   4.561  -2.445 1.00 . A A . 685 PRO C    1 1 
        2  1869 1 1 29 PRO CA   C    2.079   4.325  -2.521 1.00 . A A . 685 PRO CA   1 1 
        2  1870 1 1 29 PRO CB   C    2.720   4.463  -1.130 1.00 . A A . 685 PRO CB   1 1 
        2  1871 1 1 29 PRO CD   C    3.766   6.099  -2.526 1.00 . A A . 685 PRO CD   1 1 
        2  1872 1 1 29 PRO CG   C    3.321   5.830  -1.113 1.00 . A A . 685 PRO CG   1 1 
        2  1873 1 1 29 PRO HA   H    2.258   3.327  -2.898 1.00 . A A . 685 PRO HA   1 1 
        2  1874 1 1 29 PRO HB2  H    1.963   4.354  -0.364 1.00 . A A . 685 PRO HB2  1 1 
        2  1875 1 1 29 PRO HB3  H    3.476   3.700  -1.002 1.00 . A A . 685 PRO HB3  1 1 
        2  1876 1 1 29 PRO HD2  H    3.705   7.157  -2.749 1.00 . A A . 685 PRO HD2  1 1 
        2  1877 1 1 29 PRO HD3  H    4.773   5.737  -2.684 1.00 . A A . 685 PRO HD3  1 1 
        2  1878 1 1 29 PRO HG2  H    2.579   6.555  -0.808 1.00 . A A . 685 PRO HG2  1 1 
        2  1879 1 1 29 PRO HG3  H    4.166   5.853  -0.440 1.00 . A A . 685 PRO HG3  1 1 
        2  1880 1 1 29 PRO N    N    2.796   5.329  -3.333 1.00 . A A . 685 PRO N    1 1 
        2  1881 1 1 29 PRO O    O   -0.219   3.614  -2.333 1.00 . A A . 685 PRO O    1 1 
        2  1882 1 1 30 MET C    C   -2.003   5.989  -3.806 1.00 . A A . 686 MET C    1 1 
        2  1883 1 1 30 MET CA   C   -1.306   6.155  -2.443 1.00 . A A . 686 MET CA   1 1 
        2  1884 1 1 30 MET CB   C   -1.506   7.588  -1.923 1.00 . A A . 686 MET CB   1 1 
        2  1885 1 1 30 MET CE   C   -2.730   5.707   0.522 1.00 . A A . 686 MET CE   1 1 
        2  1886 1 1 30 MET CG   C   -1.118   7.790  -0.456 1.00 . A A . 686 MET CG   1 1 
        2  1887 1 1 30 MET H    H    0.787   6.549  -2.584 1.00 . A A . 686 MET H    1 1 
        2  1888 1 1 30 MET HA   H   -1.767   5.470  -1.747 1.00 . A A . 686 MET HA   1 1 
        2  1889 1 1 30 MET HB2  H   -0.908   8.258  -2.524 1.00 . A A . 686 MET HB2  1 1 
        2  1890 1 1 30 MET HB3  H   -2.547   7.856  -2.035 1.00 . A A . 686 MET HB3  1 1 
        2  1891 1 1 30 MET HE1  H   -3.464   5.374   1.241 1.00 . A A . 686 MET HE1  1 1 
        2  1892 1 1 30 MET HE2  H   -1.797   5.190   0.696 1.00 . A A . 686 MET HE2  1 1 
        2  1893 1 1 30 MET HE3  H   -3.083   5.493  -0.475 1.00 . A A . 686 MET HE3  1 1 
        2  1894 1 1 30 MET HG2  H   -0.303   7.122  -0.217 1.00 . A A . 686 MET HG2  1 1 
        2  1895 1 1 30 MET HG3  H   -0.789   8.811  -0.323 1.00 . A A . 686 MET HG3  1 1 
        2  1896 1 1 30 MET N    N    0.128   5.824  -2.504 1.00 . A A . 686 MET N    1 1 
        2  1897 1 1 30 MET O    O   -3.204   6.233  -3.925 1.00 . A A . 686 MET O    1 1 
        2  1898 1 1 30 MET SD   S   -2.475   7.471   0.701 1.00 . A A . 686 MET SD   1 1 
        2  1899 1 1 31 ALA C    C   -1.643   3.924  -6.657 1.00 . A A . 687 ALA C    1 1 
        2  1900 1 1 31 ALA CA   C   -1.818   5.373  -6.172 1.00 . A A . 687 ALA CA   1 1 
        2  1901 1 1 31 ALA CB   C   -1.180   6.335  -7.163 1.00 . A A . 687 ALA CB   1 1 
        2  1902 1 1 31 ALA H    H   -0.299   5.416  -4.681 1.00 . A A . 687 ALA H    1 1 
        2  1903 1 1 31 ALA HA   H   -2.877   5.595  -6.127 1.00 . A A . 687 ALA HA   1 1 
        2  1904 1 1 31 ALA HB1  H   -1.320   7.352  -6.820 1.00 . A A . 687 ALA HB1  1 1 
        2  1905 1 1 31 ALA HB2  H   -1.644   6.217  -8.132 1.00 . A A . 687 ALA HB2  1 1 
        2  1906 1 1 31 ALA HB3  H   -0.123   6.125  -7.242 1.00 . A A . 687 ALA HB3  1 1 
        2  1907 1 1 31 ALA N    N   -1.253   5.576  -4.827 1.00 . A A . 687 ALA N    1 1 
        2  1908 1 1 31 ALA O    O   -2.560   3.335  -7.235 1.00 . A A . 687 ALA O    1 1 
        2  1909 1 1 32 GLU C    C   -0.757   0.935  -5.870 1.00 . A A . 688 GLU C    1 1 
        2  1910 1 1 32 GLU CA   C   -0.164   1.977  -6.844 1.00 . A A . 688 GLU CA   1 1 
        2  1911 1 1 32 GLU CB   C    1.360   1.802  -6.984 1.00 . A A . 688 GLU CB   1 1 
        2  1912 1 1 32 GLU CD   C    3.485   2.585  -8.175 1.00 . A A . 688 GLU CD   1 1 
        2  1913 1 1 32 GLU CG   C    1.973   2.725  -8.042 1.00 . A A . 688 GLU CG   1 1 
        2  1914 1 1 32 GLU H    H    0.233   3.871  -5.968 1.00 . A A . 688 GLU H    1 1 
        2  1915 1 1 32 GLU HA   H   -0.617   1.826  -7.816 1.00 . A A . 688 GLU HA   1 1 
        2  1916 1 1 32 GLU HB2  H    1.826   2.016  -6.031 1.00 . A A . 688 GLU HB2  1 1 
        2  1917 1 1 32 GLU HB3  H    1.574   0.780  -7.261 1.00 . A A . 688 GLU HB3  1 1 
        2  1918 1 1 32 GLU HG2  H    1.524   2.498  -8.999 1.00 . A A . 688 GLU HG2  1 1 
        2  1919 1 1 32 GLU HG3  H    1.740   3.748  -7.777 1.00 . A A . 688 GLU HG3  1 1 
        2  1920 1 1 32 GLU N    N   -0.464   3.353  -6.423 1.00 . A A . 688 GLU N    1 1 
        2  1921 1 1 32 GLU O    O   -0.571  -0.272  -6.042 1.00 . A A . 688 GLU O    1 1 
        2  1922 1 1 32 GLU OE1  O    3.949   1.511  -8.622 1.00 . A A . 688 GLU OE1  1 1 
        2  1923 1 1 32 GLU OE2  O    4.211   3.556  -7.862 1.00 . A A . 688 GLU OE2  1 1 
        2  1924 1 1 33 VAL C    C   -3.679   0.920  -3.841 1.00 . A A . 689 VAL C    1 1 
        2  1925 1 1 33 VAL CA   C   -2.183   0.557  -3.892 1.00 . A A . 689 VAL CA   1 1 
        2  1926 1 1 33 VAL CB   C   -1.555   0.680  -2.478 1.00 . A A . 689 VAL CB   1 1 
        2  1927 1 1 33 VAL CG1  C   -2.279  -0.205  -1.462 1.00 . A A . 689 VAL CG1  1 1 
        2  1928 1 1 33 VAL CG2  C   -0.068   0.338  -2.529 1.00 . A A . 689 VAL CG2  1 1 
        2  1929 1 1 33 VAL H    H   -1.541   2.389  -4.748 1.00 . A A . 689 VAL H    1 1 
        2  1930 1 1 33 VAL HA   H   -2.088  -0.472  -4.221 1.00 . A A . 689 VAL HA   1 1 
        2  1931 1 1 33 VAL HB   H   -1.650   1.708  -2.154 1.00 . A A . 689 VAL HB   1 1 
        2  1932 1 1 33 VAL HG11 H   -3.319   0.083  -1.402 1.00 . A A . 689 VAL HG11 1 1 
        2  1933 1 1 33 VAL HG12 H   -1.821  -0.088  -0.491 1.00 . A A . 689 VAL HG12 1 1 
        2  1934 1 1 33 VAL HG13 H   -2.210  -1.239  -1.769 1.00 . A A . 689 VAL HG13 1 1 
        2  1935 1 1 33 VAL HG21 H    0.434   1.008  -3.212 1.00 . A A . 689 VAL HG21 1 1 
        2  1936 1 1 33 VAL HG22 H    0.055  -0.681  -2.871 1.00 . A A . 689 VAL HG22 1 1 
        2  1937 1 1 33 VAL HG23 H    0.361   0.440  -1.544 1.00 . A A . 689 VAL HG23 1 1 
        2  1938 1 1 33 VAL N    N   -1.478   1.418  -4.857 1.00 . A A . 689 VAL N    1 1 
        2  1939 1 1 33 VAL O    O   -4.057   2.065  -4.104 1.00 . A A . 689 VAL O    1 1 
        2  1940 1 1 34 LEU C    C   -6.680  -0.648  -2.408 1.00 . A A . 690 LEU C    1 1 
        2  1941 1 1 34 LEU CA   C   -5.986   0.133  -3.540 1.00 . A A . 690 LEU CA   1 1 
        2  1942 1 1 34 LEU CB   C   -6.508  -0.309  -4.924 1.00 . A A . 690 LEU CB   1 1 
        2  1943 1 1 34 LEU CD1  C   -8.342   0.107  -6.621 1.00 . A A . 690 LEU CD1  1 1 
        2  1944 1 1 34 LEU CD2  C   -8.719  -1.533  -4.767 1.00 . A A . 690 LEU CD2  1 1 
        2  1945 1 1 34 LEU CG   C   -8.034  -0.223  -5.158 1.00 . A A . 690 LEU CG   1 1 
        2  1946 1 1 34 LEU H    H   -4.164  -0.922  -3.226 1.00 . A A . 690 LEU H    1 1 
        2  1947 1 1 34 LEU HA   H   -6.190   1.187  -3.410 1.00 . A A . 690 LEU HA   1 1 
        2  1948 1 1 34 LEU HB2  H   -6.018   0.300  -5.667 1.00 . A A . 690 LEU HB2  1 1 
        2  1949 1 1 34 LEU HB3  H   -6.202  -1.335  -5.080 1.00 . A A . 690 LEU HB3  1 1 
        2  1950 1 1 34 LEU HD11 H   -9.413   0.186  -6.755 1.00 . A A . 690 LEU HD11 1 1 
        2  1951 1 1 34 LEU HD12 H   -7.958  -0.676  -7.259 1.00 . A A . 690 LEU HD12 1 1 
        2  1952 1 1 34 LEU HD13 H   -7.878   1.046  -6.884 1.00 . A A . 690 LEU HD13 1 1 
        2  1953 1 1 34 LEU HD21 H   -8.576  -1.714  -3.713 1.00 . A A . 690 LEU HD21 1 1 
        2  1954 1 1 34 LEU HD22 H   -8.292  -2.349  -5.333 1.00 . A A . 690 LEU HD22 1 1 
        2  1955 1 1 34 LEU HD23 H   -9.775  -1.464  -4.978 1.00 . A A . 690 LEU HD23 1 1 
        2  1956 1 1 34 LEU HG   H   -8.445   0.568  -4.545 1.00 . A A . 690 LEU HG   1 1 
        2  1957 1 1 34 LEU N    N   -4.527  -0.054  -3.506 1.00 . A A . 690 LEU N    1 1 
        2  1958 1 1 34 LEU O    O   -6.171  -1.666  -1.949 1.00 . A A . 690 LEU O    1 1 
        2  1959 1 1 35 ALA C    C  -10.133  -0.664  -1.131 1.00 . A A . 691 ALA C    1 1 
        2  1960 1 1 35 ALA CA   C   -8.625  -0.852  -0.917 1.00 . A A . 691 ALA CA   1 1 
        2  1961 1 1 35 ALA CB   C   -8.223  -0.350   0.465 1.00 . A A . 691 ALA CB   1 1 
        2  1962 1 1 35 ALA H    H   -8.184   0.680  -2.332 1.00 . A A . 691 ALA H    1 1 
        2  1963 1 1 35 ALA HA   H   -8.396  -1.910  -0.970 1.00 . A A . 691 ALA HA   1 1 
        2  1964 1 1 35 ALA HB1  H   -8.767  -0.898   1.222 1.00 . A A . 691 ALA HB1  1 1 
        2  1965 1 1 35 ALA HB2  H   -8.453   0.703   0.549 1.00 . A A . 691 ALA HB2  1 1 
        2  1966 1 1 35 ALA HB3  H   -7.163  -0.498   0.608 1.00 . A A . 691 ALA HB3  1 1 
        2  1967 1 1 35 ALA N    N   -7.842  -0.164  -1.958 1.00 . A A . 691 ALA N    1 1 
        2  1968 1 1 35 ALA O    O  -10.613   0.464  -1.247 1.00 . A A . 691 ALA O    1 1 
        2  1969 1 1 36 ILE C    C  -13.127  -2.523  -0.377 1.00 . A A . 692 ILE C    1 1 
        2  1970 1 1 36 ILE CA   C  -12.334  -1.716  -1.416 1.00 . A A . 692 ILE CA   1 1 
        2  1971 1 1 36 ILE CB   C  -12.693  -2.242  -2.835 1.00 . A A . 692 ILE CB   1 1 
        2  1972 1 1 36 ILE CD1  C  -12.542   0.102  -3.841 1.00 . A A . 692 ILE CD1  1 1 
        2  1973 1 1 36 ILE CG1  C  -12.085  -1.340  -3.917 1.00 . A A . 692 ILE CG1  1 1 
        2  1974 1 1 36 ILE CG2  C  -14.211  -2.351  -3.020 1.00 . A A . 692 ILE CG2  1 1 
        2  1975 1 1 36 ILE H    H  -10.452  -2.641  -1.044 1.00 . A A . 692 ILE H    1 1 
        2  1976 1 1 36 ILE HA   H  -12.642  -0.681  -1.355 1.00 . A A . 692 ILE HA   1 1 
        2  1977 1 1 36 ILE HB   H  -12.278  -3.235  -2.936 1.00 . A A . 692 ILE HB   1 1 
        2  1978 1 1 36 ILE HD11 H  -12.063   0.671  -4.623 1.00 . A A . 692 ILE HD11 1 1 
        2  1979 1 1 36 ILE HD12 H  -12.274   0.516  -2.880 1.00 . A A . 692 ILE HD12 1 1 
        2  1980 1 1 36 ILE HD13 H  -13.614   0.149  -3.969 1.00 . A A . 692 ILE HD13 1 1 
        2  1981 1 1 36 ILE HG12 H  -11.010  -1.348  -3.822 1.00 . A A . 692 ILE HG12 1 1 
        2  1982 1 1 36 ILE HG13 H  -12.358  -1.723  -4.891 1.00 . A A . 692 ILE HG13 1 1 
        2  1983 1 1 36 ILE HG21 H  -14.615  -3.049  -2.300 1.00 . A A . 692 ILE HG21 1 1 
        2  1984 1 1 36 ILE HG22 H  -14.430  -2.702  -4.019 1.00 . A A . 692 ILE HG22 1 1 
        2  1985 1 1 36 ILE HG23 H  -14.664  -1.382  -2.873 1.00 . A A . 692 ILE HG23 1 1 
        2  1986 1 1 36 ILE N    N  -10.882  -1.768  -1.175 1.00 . A A . 692 ILE N    1 1 
        2  1987 1 1 36 ILE O    O  -12.796  -3.667  -0.071 1.00 . A A . 692 ILE O    1 1 
        2  1988 1 1 37 ASP C    C  -16.508  -2.666   0.377 1.00 . A A . 693 ASP C    1 1 
        2  1989 1 1 37 ASP CA   C  -15.125  -2.592   1.046 1.00 . A A . 693 ASP CA   1 1 
        2  1990 1 1 37 ASP CB   C  -15.216  -1.851   2.383 1.00 . A A . 693 ASP CB   1 1 
        2  1991 1 1 37 ASP CG   C  -16.046  -2.596   3.412 1.00 . A A . 693 ASP CG   1 1 
        2  1992 1 1 37 ASP H    H  -14.323  -0.964  -0.048 1.00 . A A . 693 ASP H    1 1 
        2  1993 1 1 37 ASP HA   H  -14.765  -3.599   1.219 1.00 . A A . 693 ASP HA   1 1 
        2  1994 1 1 37 ASP HB2  H  -14.220  -1.719   2.780 1.00 . A A . 693 ASP HB2  1 1 
        2  1995 1 1 37 ASP HB3  H  -15.659  -0.877   2.218 1.00 . A A . 693 ASP HB3  1 1 
        2  1996 1 1 37 ASP N    N  -14.179  -1.911   0.158 1.00 . A A . 693 ASP N    1 1 
        2  1997 1 1 37 ASP O    O  -16.902  -1.750  -0.349 1.00 . A A . 693 ASP O    1 1 
        2  1998 1 1 37 ASP OD1  O  -15.536  -3.556   4.015 1.00 . A A . 693 ASP OD1  1 1 
        2  1999 1 1 37 ASP OD2  O  -17.221  -2.240   3.620 1.00 . A A . 693 ASP OD2  1 1 
        2  2000 1 1 38 LYS C    C  -19.606  -2.990   0.545 1.00 . A A . 694 LYS C    1 1 
        2  2001 1 1 38 LYS CA   C  -18.548  -3.944  -0.022 1.00 . A A . 694 LYS CA   1 1 
        2  2002 1 1 38 LYS CB   C  -19.022  -5.391   0.154 1.00 . A A . 694 LYS CB   1 1 
        2  2003 1 1 38 LYS CD   C  -18.660  -7.842  -0.317 1.00 . A A . 694 LYS CD   1 1 
        2  2004 1 1 38 LYS CE   C  -20.068  -8.027  -0.879 1.00 . A A . 694 LYS CE   1 1 
        2  2005 1 1 38 LYS CG   C  -18.139  -6.426  -0.539 1.00 . A A . 694 LYS CG   1 1 
        2  2006 1 1 38 LYS H    H  -16.895  -4.429   1.229 1.00 . A A . 694 LYS H    1 1 
        2  2007 1 1 38 LYS HA   H  -18.435  -3.742  -1.077 1.00 . A A . 694 LYS HA   1 1 
        2  2008 1 1 38 LYS HB2  H  -19.049  -5.621   1.210 1.00 . A A . 694 LYS HB2  1 1 
        2  2009 1 1 38 LYS HB3  H  -20.023  -5.480  -0.246 1.00 . A A . 694 LYS HB3  1 1 
        2  2010 1 1 38 LYS HD2  H  -17.995  -8.540  -0.804 1.00 . A A . 694 LYS HD2  1 1 
        2  2011 1 1 38 LYS HD3  H  -18.678  -8.044   0.746 1.00 . A A . 694 LYS HD3  1 1 
        2  2012 1 1 38 LYS HE2  H  -20.699  -7.229  -0.517 1.00 . A A . 694 LYS HE2  1 1 
        2  2013 1 1 38 LYS HE3  H  -20.020  -7.984  -1.959 1.00 . A A . 694 LYS HE3  1 1 
        2  2014 1 1 38 LYS HG2  H  -18.122  -6.220  -1.600 1.00 . A A . 694 LYS HG2  1 1 
        2  2015 1 1 38 LYS HG3  H  -17.136  -6.353  -0.141 1.00 . A A . 694 LYS HG3  1 1 
        2  2016 1 1 38 LYS HZ1  H  -20.047 -10.113  -0.769 1.00 . A A . 694 LYS HZ1  1 1 
        2  2017 1 1 38 LYS HZ2  H  -21.593  -9.449  -0.920 1.00 . A A . 694 LYS HZ2  1 1 
        2  2018 1 1 38 LYS HZ3  H  -20.784  -9.363   0.558 1.00 . A A . 694 LYS HZ3  1 1 
        2  2019 1 1 38 LYS N    N  -17.239  -3.748   0.613 1.00 . A A . 694 LYS N    1 1 
        2  2020 1 1 38 LYS NZ   N  -20.663  -9.328  -0.476 1.00 . A A . 694 LYS NZ   1 1 
        2  2021 1 1 38 LYS O    O  -20.451  -2.474  -0.191 1.00 . A A . 694 LYS O    1 1 
        2  2022 1 1 39 GLU C    C  -20.257  -0.450   2.434 1.00 . A A . 695 GLU C    1 1 
        2  2023 1 1 39 GLU CA   C  -20.566  -1.955   2.535 1.00 . A A . 695 GLU CA   1 1 
        2  2024 1 1 39 GLU CB   C  -20.678  -2.381   4.009 1.00 . A A . 695 GLU CB   1 1 
        2  2025 1 1 39 GLU CD   C  -19.981  -4.854   3.881 1.00 . A A . 695 GLU CD   1 1 
        2  2026 1 1 39 GLU CG   C  -21.083  -3.848   4.218 1.00 . A A . 695 GLU CG   1 1 
        2  2027 1 1 39 GLU H    H  -18.834  -3.169   2.379 1.00 . A A . 695 GLU H    1 1 
        2  2028 1 1 39 GLU HA   H  -21.517  -2.140   2.054 1.00 . A A . 695 GLU HA   1 1 
        2  2029 1 1 39 GLU HB2  H  -19.722  -2.226   4.488 1.00 . A A . 695 GLU HB2  1 1 
        2  2030 1 1 39 GLU HB3  H  -21.417  -1.755   4.493 1.00 . A A . 695 GLU HB3  1 1 
        2  2031 1 1 39 GLU HG2  H  -21.356  -3.986   5.256 1.00 . A A . 695 GLU HG2  1 1 
        2  2032 1 1 39 GLU HG3  H  -21.944  -4.058   3.598 1.00 . A A . 695 GLU HG3  1 1 
        2  2033 1 1 39 GLU N    N  -19.561  -2.769   1.852 1.00 . A A . 695 GLU N    1 1 
        2  2034 1 1 39 GLU O    O  -21.103   0.333   1.995 1.00 . A A . 695 GLU O    1 1 
        2  2035 1 1 39 GLU OE1  O  -18.792  -4.487   3.926 1.00 . A A . 695 GLU OE1  1 1 
        2  2036 1 1 39 GLU OE2  O  -20.296  -6.020   3.598 1.00 . A A . 695 GLU OE2  1 1 
        2  2037 1 1 40 ASP C    C  -18.370   1.878   1.404 1.00 . A A . 696 ASP C    1 1 
        2  2038 1 1 40 ASP CA   C  -18.682   1.383   2.826 1.00 . A A . 696 ASP CA   1 1 
        2  2039 1 1 40 ASP CB   C  -17.481   1.624   3.748 1.00 . A A . 696 ASP CB   1 1 
        2  2040 1 1 40 ASP CG   C  -17.185   3.105   3.943 1.00 . A A . 696 ASP CG   1 1 
        2  2041 1 1 40 ASP H    H  -18.394  -0.706   3.150 1.00 . A A . 696 ASP H    1 1 
        2  2042 1 1 40 ASP HA   H  -19.527   1.941   3.206 1.00 . A A . 696 ASP HA   1 1 
        2  2043 1 1 40 ASP HB2  H  -17.685   1.186   4.715 1.00 . A A . 696 ASP HB2  1 1 
        2  2044 1 1 40 ASP HB3  H  -16.607   1.150   3.322 1.00 . A A . 696 ASP HB3  1 1 
        2  2045 1 1 40 ASP N    N  -19.050  -0.041   2.835 1.00 . A A . 696 ASP N    1 1 
        2  2046 1 1 40 ASP O    O  -18.880   2.917   0.969 1.00 . A A . 696 ASP O    1 1 
        2  2047 1 1 40 ASP OD1  O  -17.926   3.771   4.691 1.00 . A A . 696 ASP OD1  1 1 
        2  2048 1 1 40 ASP OD2  O  -16.215   3.615   3.348 1.00 . A A . 696 ASP OD2  1 1 
        2  2049 1 1 41 GLY C    C  -15.652   1.628  -0.871 1.00 . A A . 697 GLY C    1 1 
        2  2050 1 1 41 GLY CA   C  -17.162   1.514  -0.678 1.00 . A A . 697 GLY CA   1 1 
        2  2051 1 1 41 GLY H    H  -17.175   0.311   1.072 1.00 . A A . 697 GLY H    1 1 
        2  2052 1 1 41 GLY HA2  H  -17.541   0.766  -1.360 1.00 . A A . 697 GLY HA2  1 1 
        2  2053 1 1 41 GLY HA3  H  -17.619   2.466  -0.918 1.00 . A A . 697 GLY HA3  1 1 
        2  2054 1 1 41 GLY N    N  -17.538   1.132   0.682 1.00 . A A . 697 GLY N    1 1 
        2  2055 1 1 41 GLY O    O  -14.904   0.732  -0.486 1.00 . A A . 697 GLY O    1 1 
        2  2056 1 1 42 ASP C    C  -13.022   3.324  -0.436 1.00 . A A . 698 ASP C    1 1 
        2  2057 1 1 42 ASP CA   C  -13.769   2.939  -1.726 1.00 . A A . 698 ASP CA   1 1 
        2  2058 1 1 42 ASP CB   C  -13.575   4.026  -2.790 1.00 . A A . 698 ASP CB   1 1 
        2  2059 1 1 42 ASP CG   C  -12.128   4.143  -3.236 1.00 . A A . 698 ASP CG   1 1 
        2  2060 1 1 42 ASP H    H  -15.837   3.421  -1.748 1.00 . A A . 698 ASP H    1 1 
        2  2061 1 1 42 ASP HA   H  -13.361   2.008  -2.101 1.00 . A A . 698 ASP HA   1 1 
        2  2062 1 1 42 ASP HB2  H  -14.184   3.789  -3.652 1.00 . A A . 698 ASP HB2  1 1 
        2  2063 1 1 42 ASP HB3  H  -13.890   4.978  -2.386 1.00 . A A . 698 ASP HB3  1 1 
        2  2064 1 1 42 ASP N    N  -15.199   2.730  -1.471 1.00 . A A . 698 ASP N    1 1 
        2  2065 1 1 42 ASP O    O  -13.325   4.342   0.195 1.00 . A A . 698 ASP O    1 1 
        2  2066 1 1 42 ASP OD1  O  -11.321   4.778  -2.522 1.00 . A A . 698 ASP OD1  1 1 
        2  2067 1 1 42 ASP OD2  O  -11.787   3.591  -4.302 1.00 . A A . 698 ASP OD2  1 1 
        2  2068 1 1 43 LEU C    C   -9.784   3.111   0.761 1.00 . A A . 699 LEU C    1 1 
        2  2069 1 1 43 LEU CA   C  -11.233   2.771   1.142 1.00 . A A . 699 LEU CA   1 1 
        2  2070 1 1 43 LEU CB   C  -11.251   1.562   2.090 1.00 . A A . 699 LEU CB   1 1 
        2  2071 1 1 43 LEU CD1  C  -12.519  -0.021   3.581 1.00 . A A . 699 LEU CD1  1 1 
        2  2072 1 1 43 LEU CD2  C  -13.517   2.197   3.005 1.00 . A A . 699 LEU CD2  1 1 
        2  2073 1 1 43 LEU CG   C  -12.642   1.056   2.510 1.00 . A A . 699 LEU CG   1 1 
        2  2074 1 1 43 LEU H    H  -11.871   1.697  -0.576 1.00 . A A . 699 LEU H    1 1 
        2  2075 1 1 43 LEU HA   H  -11.661   3.624   1.656 1.00 . A A . 699 LEU HA   1 1 
        2  2076 1 1 43 LEU HB2  H  -10.729   0.746   1.606 1.00 . A A . 699 LEU HB2  1 1 
        2  2077 1 1 43 LEU HB3  H  -10.707   1.828   2.986 1.00 . A A . 699 LEU HB3  1 1 
        2  2078 1 1 43 LEU HD11 H  -13.505  -0.385   3.843 1.00 . A A . 699 LEU HD11 1 1 
        2  2079 1 1 43 LEU HD12 H  -12.043   0.393   4.459 1.00 . A A . 699 LEU HD12 1 1 
        2  2080 1 1 43 LEU HD13 H  -11.924  -0.840   3.203 1.00 . A A . 699 LEU HD13 1 1 
        2  2081 1 1 43 LEU HD21 H  -13.595   2.955   2.237 1.00 . A A . 699 LEU HD21 1 1 
        2  2082 1 1 43 LEU HD22 H  -13.079   2.628   3.892 1.00 . A A . 699 LEU HD22 1 1 
        2  2083 1 1 43 LEU HD23 H  -14.503   1.820   3.238 1.00 . A A . 699 LEU HD23 1 1 
        2  2084 1 1 43 LEU HG   H  -13.127   0.613   1.651 1.00 . A A . 699 LEU HG   1 1 
        2  2085 1 1 43 LEU N    N  -12.049   2.504  -0.049 1.00 . A A . 699 LEU N    1 1 
        2  2086 1 1 43 LEU O    O   -8.906   3.184   1.621 1.00 . A A . 699 LEU O    1 1 
        2  2087 1 1 44 THR C    C   -7.606   4.893  -0.390 1.00 . A A . 700 THR C    1 1 
        2  2088 1 1 44 THR CA   C   -8.196   3.631  -1.040 1.00 . A A . 700 THR CA   1 1 
        2  2089 1 1 44 THR CB   C   -8.206   3.806  -2.580 1.00 . A A . 700 THR CB   1 1 
        2  2090 1 1 44 THR CG2  C   -6.793   3.986  -3.130 1.00 . A A . 700 THR CG2  1 1 
        2  2091 1 1 44 THR H    H  -10.296   3.316  -1.160 1.00 . A A . 700 THR H    1 1 
        2  2092 1 1 44 THR HA   H   -7.563   2.786  -0.800 1.00 . A A . 700 THR HA   1 1 
        2  2093 1 1 44 THR HB   H   -8.786   4.686  -2.824 1.00 . A A . 700 THR HB   1 1 
        2  2094 1 1 44 THR HG1  H   -9.632   2.935  -3.649 1.00 . A A . 700 THR HG1  1 1 
        2  2095 1 1 44 THR HG21 H   -6.195   3.120  -2.884 1.00 . A A . 700 THR HG21 1 1 
        2  2096 1 1 44 THR HG22 H   -6.345   4.867  -2.694 1.00 . A A . 700 THR HG22 1 1 
        2  2097 1 1 44 THR HG23 H   -6.836   4.099  -4.204 1.00 . A A . 700 THR HG23 1 1 
        2  2098 1 1 44 THR N    N   -9.545   3.340  -0.529 1.00 . A A . 700 THR N    1 1 
        2  2099 1 1 44 THR O    O   -6.406   4.973  -0.120 1.00 . A A . 700 THR O    1 1 
        2  2100 1 1 44 THR OG1  O   -8.818   2.661  -3.201 1.00 . A A . 700 THR OG1  1 1 
        2  2101 1 1 45 SER C    C   -7.848   6.912   2.054 1.00 . A A . 701 SER C    1 1 
        2  2102 1 1 45 SER CA   C   -8.045   7.118   0.541 1.00 . A A . 701 SER CA   1 1 
        2  2103 1 1 45 SER CB   C   -9.083   8.223   0.300 1.00 . A A . 701 SER CB   1 1 
        2  2104 1 1 45 SER H    H   -9.397   5.779  -0.414 1.00 . A A . 701 SER H    1 1 
        2  2105 1 1 45 SER HA   H   -7.101   7.426   0.108 1.00 . A A . 701 SER HA   1 1 
        2  2106 1 1 45 SER HB2  H  -10.037   7.914   0.702 1.00 . A A . 701 SER HB2  1 1 
        2  2107 1 1 45 SER HB3  H   -8.764   9.130   0.792 1.00 . A A . 701 SER HB3  1 1 
        2  2108 1 1 45 SER HG   H   -8.631   9.193  -1.347 1.00 . A A . 701 SER HG   1 1 
        2  2109 1 1 45 SER N    N   -8.462   5.877  -0.131 1.00 . A A . 701 SER N    1 1 
        2  2110 1 1 45 SER O    O   -7.242   7.744   2.730 1.00 . A A . 701 SER O    1 1 
        2  2111 1 1 45 SER OG   O   -9.239   8.490  -1.086 1.00 . A A . 701 SER OG   1 1 
        2  2112 1 1 46 LYS C    C   -7.108   4.569   4.369 1.00 . A A . 702 LYS C    1 1 
        2  2113 1 1 46 LYS CA   C   -8.287   5.496   4.017 1.00 . A A . 702 LYS CA   1 1 
        2  2114 1 1 46 LYS CB   C   -9.602   4.860   4.478 1.00 . A A . 702 LYS CB   1 1 
        2  2115 1 1 46 LYS CD   C  -12.094   5.086   4.750 1.00 . A A . 702 LYS CD   1 1 
        2  2116 1 1 46 LYS CE   C  -13.338   5.912   4.435 1.00 . A A . 702 LYS CE   1 1 
        2  2117 1 1 46 LYS CG   C  -10.820   5.744   4.239 1.00 . A A . 702 LYS CG   1 1 
        2  2118 1 1 46 LYS H    H   -8.773   5.140   1.979 1.00 . A A . 702 LYS H    1 1 
        2  2119 1 1 46 LYS HA   H   -8.161   6.428   4.543 1.00 . A A . 702 LYS HA   1 1 
        2  2120 1 1 46 LYS HB2  H   -9.748   3.929   3.946 1.00 . A A . 702 LYS HB2  1 1 
        2  2121 1 1 46 LYS HB3  H   -9.538   4.650   5.538 1.00 . A A . 702 LYS HB3  1 1 
        2  2122 1 1 46 LYS HD2  H  -12.190   4.120   4.288 1.00 . A A . 702 LYS HD2  1 1 
        2  2123 1 1 46 LYS HD3  H  -12.012   4.965   5.821 1.00 . A A . 702 LYS HD3  1 1 
        2  2124 1 1 46 LYS HE2  H  -13.275   6.852   4.963 1.00 . A A . 702 LYS HE2  1 1 
        2  2125 1 1 46 LYS HE3  H  -13.370   6.102   3.372 1.00 . A A . 702 LYS HE3  1 1 
        2  2126 1 1 46 LYS HG2  H  -10.678   6.683   4.755 1.00 . A A . 702 LYS HG2  1 1 
        2  2127 1 1 46 LYS HG3  H  -10.917   5.926   3.178 1.00 . A A . 702 LYS HG3  1 1 
        2  2128 1 1 46 LYS HZ1  H  -15.405   5.867   4.747 1.00 . A A . 702 LYS HZ1  1 1 
        2  2129 1 1 46 LYS HZ2  H  -14.534   4.908   5.829 1.00 . A A . 702 LYS HZ2  1 1 
        2  2130 1 1 46 LYS HZ3  H  -14.765   4.389   4.235 1.00 . A A . 702 LYS HZ3  1 1 
        2  2131 1 1 46 LYS N    N   -8.351   5.791   2.576 1.00 . A A . 702 LYS N    1 1 
        2  2132 1 1 46 LYS NZ   N  -14.595   5.221   4.840 1.00 . A A . 702 LYS NZ   1 1 
        2  2133 1 1 46 LYS O    O   -7.021   4.051   5.487 1.00 . A A . 702 LYS O    1 1 
        2  2134 1 1 47 ILE C    C   -3.883   4.255   4.324 1.00 . A A . 703 ILE C    1 1 
        2  2135 1 1 47 ILE CA   C   -5.031   3.501   3.629 1.00 . A A . 703 ILE CA   1 1 
        2  2136 1 1 47 ILE CB   C   -4.505   2.919   2.290 1.00 . A A . 703 ILE CB   1 1 
        2  2137 1 1 47 ILE CD1  C   -5.186   1.584   0.222 1.00 . A A . 703 ILE CD1  1 1 
        2  2138 1 1 47 ILE CG1  C   -5.607   2.126   1.573 1.00 . A A . 703 ILE CG1  1 1 
        2  2139 1 1 47 ILE CG2  C   -3.274   2.039   2.528 1.00 . A A . 703 ILE CG2  1 1 
        2  2140 1 1 47 ILE H    H   -6.318   4.800   2.547 1.00 . A A . 703 ILE H    1 1 
        2  2141 1 1 47 ILE HA   H   -5.338   2.672   4.258 1.00 . A A . 703 ILE HA   1 1 
        2  2142 1 1 47 ILE HB   H   -4.205   3.747   1.662 1.00 . A A . 703 ILE HB   1 1 
        2  2143 1 1 47 ILE HD11 H   -4.898   2.403  -0.422 1.00 . A A . 703 ILE HD11 1 1 
        2  2144 1 1 47 ILE HD12 H   -6.012   1.049  -0.225 1.00 . A A . 703 ILE HD12 1 1 
        2  2145 1 1 47 ILE HD13 H   -4.348   0.912   0.346 1.00 . A A . 703 ILE HD13 1 1 
        2  2146 1 1 47 ILE HG12 H   -5.898   1.286   2.188 1.00 . A A . 703 ILE HG12 1 1 
        2  2147 1 1 47 ILE HG13 H   -6.462   2.767   1.419 1.00 . A A . 703 ILE HG13 1 1 
        2  2148 1 1 47 ILE HG21 H   -3.531   1.228   3.193 1.00 . A A . 703 ILE HG21 1 1 
        2  2149 1 1 47 ILE HG22 H   -2.486   2.630   2.971 1.00 . A A . 703 ILE HG22 1 1 
        2  2150 1 1 47 ILE HG23 H   -2.929   1.634   1.586 1.00 . A A . 703 ILE HG23 1 1 
        2  2151 1 1 47 ILE N    N   -6.200   4.365   3.416 1.00 . A A . 703 ILE N    1 1 
        2  2152 1 1 47 ILE O    O   -3.362   5.241   3.796 1.00 . A A . 703 ILE O    1 1 
        2  2153 1 1 48 LYS C    C   -1.046   3.655   5.731 1.00 . A A . 704 LYS C    1 1 
        2  2154 1 1 48 LYS CA   C   -2.338   4.335   6.221 1.00 . A A . 704 LYS CA   1 1 
        2  2155 1 1 48 LYS CB   C   -2.500   4.128   7.738 1.00 . A A . 704 LYS CB   1 1 
        2  2156 1 1 48 LYS CD   C   -1.276   6.233   8.458 1.00 . A A . 704 LYS CD   1 1 
        2  2157 1 1 48 LYS CE   C   -2.505   6.919   9.046 1.00 . A A . 704 LYS CE   1 1 
        2  2158 1 1 48 LYS CG   C   -1.361   4.711   8.576 1.00 . A A . 704 LYS CG   1 1 
        2  2159 1 1 48 LYS H    H   -4.008   3.061   5.917 1.00 . A A . 704 LYS H    1 1 
        2  2160 1 1 48 LYS HA   H   -2.281   5.395   6.009 1.00 . A A . 704 LYS HA   1 1 
        2  2161 1 1 48 LYS HB2  H   -3.424   4.593   8.054 1.00 . A A . 704 LYS HB2  1 1 
        2  2162 1 1 48 LYS HB3  H   -2.562   3.067   7.939 1.00 . A A . 704 LYS HB3  1 1 
        2  2163 1 1 48 LYS HD2  H   -0.398   6.577   8.988 1.00 . A A . 704 LYS HD2  1 1 
        2  2164 1 1 48 LYS HD3  H   -1.191   6.499   7.413 1.00 . A A . 704 LYS HD3  1 1 
        2  2165 1 1 48 LYS HE2  H   -2.429   7.982   8.868 1.00 . A A . 704 LYS HE2  1 1 
        2  2166 1 1 48 LYS HE3  H   -3.388   6.537   8.553 1.00 . A A . 704 LYS HE3  1 1 
        2  2167 1 1 48 LYS HG2  H   -1.524   4.452   9.614 1.00 . A A . 704 LYS HG2  1 1 
        2  2168 1 1 48 LYS HG3  H   -0.426   4.280   8.243 1.00 . A A . 704 LYS HG3  1 1 
        2  2169 1 1 48 LYS HZ1  H   -2.631   5.667  10.717 1.00 . A A . 704 LYS HZ1  1 1 
        2  2170 1 1 48 LYS HZ2  H   -3.512   7.101  10.866 1.00 . A A . 704 LYS HZ2  1 1 
        2  2171 1 1 48 LYS HZ3  H   -1.831   7.121  11.012 1.00 . A A . 704 LYS HZ3  1 1 
        2  2172 1 1 48 LYS N    N   -3.498   3.790   5.508 1.00 . A A . 704 LYS N    1 1 
        2  2173 1 1 48 LYS NZ   N   -2.629   6.685  10.511 1.00 . A A . 704 LYS NZ   1 1 
        2  2174 1 1 48 LYS O    O   -0.943   2.428   5.739 1.00 . A A . 704 LYS O    1 1 
        2  2175 1 1 49 VAL C    C    2.361   4.057   5.716 1.00 . A A . 705 VAL C    1 1 
        2  2176 1 1 49 VAL CA   C    1.180   3.918   4.739 1.00 . A A . 705 VAL CA   1 1 
        2  2177 1 1 49 VAL CB   C    1.544   4.628   3.409 1.00 . A A . 705 VAL CB   1 1 
        2  2178 1 1 49 VAL CG1  C    2.809   4.026   2.792 1.00 . A A . 705 VAL CG1  1 1 
        2  2179 1 1 49 VAL CG2  C    0.379   4.562   2.423 1.00 . A A . 705 VAL CG2  1 1 
        2  2180 1 1 49 VAL H    H   -0.184   5.428   5.367 1.00 . A A . 705 VAL H    1 1 
        2  2181 1 1 49 VAL HA   H    1.026   2.868   4.527 1.00 . A A . 705 VAL HA   1 1 
        2  2182 1 1 49 VAL HB   H    1.742   5.671   3.625 1.00 . A A . 705 VAL HB   1 1 
        2  2183 1 1 49 VAL HG11 H    3.031   4.526   1.861 1.00 . A A . 705 VAL HG11 1 1 
        2  2184 1 1 49 VAL HG12 H    2.653   2.972   2.606 1.00 . A A . 705 VAL HG12 1 1 
        2  2185 1 1 49 VAL HG13 H    3.638   4.151   3.474 1.00 . A A . 705 VAL HG13 1 1 
        2  2186 1 1 49 VAL HG21 H    0.655   5.060   1.504 1.00 . A A . 705 VAL HG21 1 1 
        2  2187 1 1 49 VAL HG22 H   -0.485   5.051   2.850 1.00 . A A . 705 VAL HG22 1 1 
        2  2188 1 1 49 VAL HG23 H    0.140   3.530   2.214 1.00 . A A . 705 VAL HG23 1 1 
        2  2189 1 1 49 VAL N    N   -0.068   4.454   5.303 1.00 . A A . 705 VAL N    1 1 
        2  2190 1 1 49 VAL O    O    2.756   5.165   6.080 1.00 . A A . 705 VAL O    1 1 
        2  2191 1 1 50 ASP C    C    5.378   2.618   6.144 1.00 . A A . 706 ASP C    1 1 
        2  2192 1 1 50 ASP CA   C    4.116   2.901   6.977 1.00 . A A . 706 ASP CA   1 1 
        2  2193 1 1 50 ASP CB   C    3.964   1.840   8.072 1.00 . A A . 706 ASP CB   1 1 
        2  2194 1 1 50 ASP CG   C    5.244   1.635   8.866 1.00 . A A . 706 ASP CG   1 1 
        2  2195 1 1 50 ASP H    H    2.515   2.074   5.860 1.00 . A A . 706 ASP H    1 1 
        2  2196 1 1 50 ASP HA   H    4.214   3.875   7.442 1.00 . A A . 706 ASP HA   1 1 
        2  2197 1 1 50 ASP HB2  H    3.182   2.144   8.753 1.00 . A A . 706 ASP HB2  1 1 
        2  2198 1 1 50 ASP HB3  H    3.687   0.900   7.616 1.00 . A A . 706 ASP HB3  1 1 
        2  2199 1 1 50 ASP N    N    2.920   2.924   6.129 1.00 . A A . 706 ASP N    1 1 
        2  2200 1 1 50 ASP O    O    5.358   1.794   5.224 1.00 . A A . 706 ASP O    1 1 
        2  2201 1 1 50 ASP OD1  O    5.477   2.390   9.834 1.00 . A A . 706 ASP OD1  1 1 
        2  2202 1 1 50 ASP OD2  O    6.026   0.716   8.525 1.00 . A A . 706 ASP OD2  1 1 
        2  2203 1 1 51 GLY C    C    8.016   4.247   4.785 1.00 . A A . 707 GLY C    1 1 
        2  2204 1 1 51 GLY CA   C    7.726   3.114   5.760 1.00 . A A . 707 GLY CA   1 1 
        2  2205 1 1 51 GLY H    H    6.433   3.923   7.234 1.00 . A A . 707 GLY H    1 1 
        2  2206 1 1 51 GLY HA2  H    8.533   3.056   6.477 1.00 . A A . 707 GLY HA2  1 1 
        2  2207 1 1 51 GLY HA3  H    7.687   2.183   5.209 1.00 . A A . 707 GLY HA3  1 1 
        2  2208 1 1 51 GLY N    N    6.473   3.293   6.484 1.00 . A A . 707 GLY N    1 1 
        2  2209 1 1 51 GLY O    O    7.212   5.169   4.630 1.00 . A A . 707 GLY O    1 1 
        2  2210 1 1 52 GLU C    C   10.498   4.682   2.088 1.00 . A A . 708 GLU C    1 1 
        2  2211 1 1 52 GLU CA   C    9.576   5.232   3.188 1.00 . A A . 708 GLU CA   1 1 
        2  2212 1 1 52 GLU CB   C   10.283   6.347   3.973 1.00 . A A . 708 GLU CB   1 1 
        2  2213 1 1 52 GLU CD   C   11.481   8.573   3.956 1.00 . A A . 708 GLU CD   1 1 
        2  2214 1 1 52 GLU CG   C   10.761   7.520   3.126 1.00 . A A . 708 GLU CG   1 1 
        2  2215 1 1 52 GLU H    H    9.759   3.411   4.267 1.00 . A A . 708 GLU H    1 1 
        2  2216 1 1 52 GLU HA   H    8.686   5.638   2.729 1.00 . A A . 708 GLU HA   1 1 
        2  2217 1 1 52 GLU HB2  H    9.600   6.731   4.718 1.00 . A A . 708 GLU HB2  1 1 
        2  2218 1 1 52 GLU HB3  H   11.141   5.922   4.477 1.00 . A A . 708 GLU HB3  1 1 
        2  2219 1 1 52 GLU HG2  H   11.437   7.150   2.367 1.00 . A A . 708 GLU HG2  1 1 
        2  2220 1 1 52 GLU HG3  H    9.905   7.978   2.650 1.00 . A A . 708 GLU HG3  1 1 
        2  2221 1 1 52 GLU N    N    9.165   4.179   4.120 1.00 . A A . 708 GLU N    1 1 
        2  2222 1 1 52 GLU O    O   11.472   3.982   2.371 1.00 . A A . 708 GLU O    1 1 
        2  2223 1 1 52 GLU OE1  O   12.696   8.411   4.202 1.00 . A A . 708 GLU OE1  1 1 
        2  2224 1 1 52 GLU OE2  O   10.833   9.554   4.380 1.00 . A A . 708 GLU OE2  1 1 
        2  2225 1 1 53 VAL C    C   11.752   5.820  -0.886 1.00 . A A . 709 VAL C    1 1 
        2  2226 1 1 53 VAL CA   C   11.019   4.605  -0.307 1.00 . A A . 709 VAL CA   1 1 
        2  2227 1 1 53 VAL CB   C   10.188   3.939  -1.434 1.00 . A A . 709 VAL CB   1 1 
        2  2228 1 1 53 VAL CG1  C   11.075   3.577  -2.625 1.00 . A A . 709 VAL CG1  1 1 
        2  2229 1 1 53 VAL CG2  C    9.460   2.706  -0.914 1.00 . A A . 709 VAL CG2  1 1 
        2  2230 1 1 53 VAL H    H    9.368   5.520   0.666 1.00 . A A . 709 VAL H    1 1 
        2  2231 1 1 53 VAL HA   H   11.752   3.888   0.043 1.00 . A A . 709 VAL HA   1 1 
        2  2232 1 1 53 VAL HB   H    9.446   4.651  -1.772 1.00 . A A . 709 VAL HB   1 1 
        2  2233 1 1 53 VAL HG11 H   11.844   2.890  -2.306 1.00 . A A . 709 VAL HG11 1 1 
        2  2234 1 1 53 VAL HG12 H   11.535   4.471  -3.021 1.00 . A A . 709 VAL HG12 1 1 
        2  2235 1 1 53 VAL HG13 H   10.475   3.112  -3.395 1.00 . A A . 709 VAL HG13 1 1 
        2  2236 1 1 53 VAL HG21 H    8.791   2.989  -0.115 1.00 . A A . 709 VAL HG21 1 1 
        2  2237 1 1 53 VAL HG22 H   10.181   1.993  -0.542 1.00 . A A . 709 VAL HG22 1 1 
        2  2238 1 1 53 VAL HG23 H    8.892   2.256  -1.716 1.00 . A A . 709 VAL HG23 1 1 
        2  2239 1 1 53 VAL N    N   10.182   5.000   0.834 1.00 . A A . 709 VAL N    1 1 
        2  2240 1 1 53 VAL O    O   11.124   6.743  -1.410 1.00 . A A . 709 VAL O    1 1 
        2  2241 1 1 54 ASP C    C   14.412   6.522  -2.738 1.00 . A A . 710 ASP C    1 1 
        2  2242 1 1 54 ASP CA   C   13.893   6.894  -1.339 1.00 . A A . 710 ASP CA   1 1 
        2  2243 1 1 54 ASP CB   C   15.063   7.208  -0.402 1.00 . A A . 710 ASP CB   1 1 
        2  2244 1 1 54 ASP CG   C   16.036   8.197  -1.014 1.00 . A A . 710 ASP CG   1 1 
        2  2245 1 1 54 ASP H    H   13.512   5.076  -0.319 1.00 . A A . 710 ASP H    1 1 
        2  2246 1 1 54 ASP HA   H   13.270   7.775  -1.424 1.00 . A A . 710 ASP HA   1 1 
        2  2247 1 1 54 ASP HB2  H   14.678   7.630   0.516 1.00 . A A . 710 ASP HB2  1 1 
        2  2248 1 1 54 ASP HB3  H   15.593   6.291  -0.177 1.00 . A A . 710 ASP HB3  1 1 
        2  2249 1 1 54 ASP N    N   13.073   5.819  -0.780 1.00 . A A . 710 ASP N    1 1 
        2  2250 1 1 54 ASP O    O   14.743   5.366  -3.003 1.00 . A A . 710 ASP O    1 1 
        2  2251 1 1 54 ASP OD1  O   15.617   9.317  -1.366 1.00 . A A . 710 ASP OD1  1 1 
        2  2252 1 1 54 ASP OD2  O   17.218   7.857  -1.165 1.00 . A A . 710 ASP OD2  1 1 
        2  2253 1 1 55 THR C    C   16.307   7.832  -5.317 1.00 . A A . 711 THR C    1 1 
        2  2254 1 1 55 THR CA   C   14.902   7.283  -5.018 1.00 . A A . 711 THR CA   1 1 
        2  2255 1 1 55 THR CB   C   13.900   7.914  -6.011 1.00 . A A . 711 THR CB   1 1 
        2  2256 1 1 55 THR CG2  C   12.513   7.291  -5.862 1.00 . A A . 711 THR CG2  1 1 
        2  2257 1 1 55 THR H    H   14.253   8.422  -3.342 1.00 . A A . 711 THR H    1 1 
        2  2258 1 1 55 THR HA   H   14.911   6.214  -5.189 1.00 . A A . 711 THR HA   1 1 
        2  2259 1 1 55 THR HB   H   14.250   7.733  -7.020 1.00 . A A . 711 THR HB   1 1 
        2  2260 1 1 55 THR HG1  H   13.188   9.713  -6.420 1.00 . A A . 711 THR HG1  1 1 
        2  2261 1 1 55 THR HG21 H   12.574   6.226  -6.031 1.00 . A A . 711 THR HG21 1 1 
        2  2262 1 1 55 THR HG22 H   11.840   7.730  -6.583 1.00 . A A . 711 THR HG22 1 1 
        2  2263 1 1 55 THR HG23 H   12.140   7.477  -4.865 1.00 . A A . 711 THR HG23 1 1 
        2  2264 1 1 55 THR N    N   14.488   7.513  -3.625 1.00 . A A . 711 THR N    1 1 
        2  2265 1 1 55 THR O    O   16.744   7.827  -6.466 1.00 . A A . 711 THR O    1 1 
        2  2266 1 1 55 THR OG1  O   13.818   9.329  -5.796 1.00 . A A . 711 THR OG1  1 1 
        2  2267 1 1 56 THR C    C   19.400   7.700  -3.965 1.00 . A A . 712 THR C    1 1 
        2  2268 1 1 56 THR CA   C   18.408   8.761  -4.462 1.00 . A A . 712 THR CA   1 1 
        2  2269 1 1 56 THR CB   C   18.691  10.099  -3.728 1.00 . A A . 712 THR CB   1 1 
        2  2270 1 1 56 THR CG2  C   17.737  11.194  -4.200 1.00 . A A . 712 THR CG2  1 1 
        2  2271 1 1 56 THR H    H   16.595   8.361  -3.406 1.00 . A A . 712 THR H    1 1 
        2  2272 1 1 56 THR HA   H   18.581   8.916  -5.520 1.00 . A A . 712 THR HA   1 1 
        2  2273 1 1 56 THR HB   H   19.704  10.407  -3.953 1.00 . A A . 712 THR HB   1 1 
        2  2274 1 1 56 THR HG1  H   17.693   9.570  -2.098 1.00 . A A . 712 THR HG1  1 1 
        2  2275 1 1 56 THR HG21 H   17.967  12.119  -3.691 1.00 . A A . 712 THR HG21 1 1 
        2  2276 1 1 56 THR HG22 H   16.719  10.905  -3.981 1.00 . A A . 712 THR HG22 1 1 
        2  2277 1 1 56 THR HG23 H   17.846  11.336  -5.267 1.00 . A A . 712 THR HG23 1 1 
        2  2278 1 1 56 THR N    N   17.014   8.308  -4.291 1.00 . A A . 712 THR N    1 1 
        2  2279 1 1 56 THR O    O   20.553   7.654  -4.396 1.00 . A A . 712 THR O    1 1 
        2  2280 1 1 56 THR OG1  O   18.564   9.937  -2.306 1.00 . A A . 712 THR OG1  1 1 
        2  2281 1 1 57 LYS C    C   19.176   4.386  -2.888 1.00 . A A . 713 LYS C    1 1 
        2  2282 1 1 57 LYS CA   C   19.762   5.759  -2.514 1.00 . A A . 713 LYS CA   1 1 
        2  2283 1 1 57 LYS CB   C   19.856   5.898  -0.986 1.00 . A A . 713 LYS CB   1 1 
        2  2284 1 1 57 LYS CD   C   22.147   4.833  -0.786 1.00 . A A . 713 LYS CD   1 1 
        2  2285 1 1 57 LYS CE   C   23.002   3.833  -0.017 1.00 . A A . 713 LYS CE   1 1 
        2  2286 1 1 57 LYS CG   C   20.697   4.823  -0.304 1.00 . A A . 713 LYS CG   1 1 
        2  2287 1 1 57 LYS H    H   18.024   6.949  -2.729 1.00 . A A . 713 LYS H    1 1 
        2  2288 1 1 57 LYS HA   H   20.753   5.844  -2.936 1.00 . A A . 713 LYS HA   1 1 
        2  2289 1 1 57 LYS HB2  H   20.289   6.860  -0.752 1.00 . A A . 713 LYS HB2  1 1 
        2  2290 1 1 57 LYS HB3  H   18.858   5.858  -0.572 1.00 . A A . 713 LYS HB3  1 1 
        2  2291 1 1 57 LYS HD2  H   22.168   4.578  -1.837 1.00 . A A . 713 LYS HD2  1 1 
        2  2292 1 1 57 LYS HD3  H   22.556   5.824  -0.648 1.00 . A A . 713 LYS HD3  1 1 
        2  2293 1 1 57 LYS HE2  H   22.576   2.847  -0.131 1.00 . A A . 713 LYS HE2  1 1 
        2  2294 1 1 57 LYS HE3  H   24.001   3.841  -0.429 1.00 . A A . 713 LYS HE3  1 1 
        2  2295 1 1 57 LYS HG2  H   20.685   4.997   0.762 1.00 . A A . 713 LYS HG2  1 1 
        2  2296 1 1 57 LYS HG3  H   20.263   3.855  -0.514 1.00 . A A . 713 LYS HG3  1 1 
        2  2297 1 1 57 LYS HZ1  H   23.650   3.461   1.933 1.00 . A A . 713 LYS HZ1  1 1 
        2  2298 1 1 57 LYS HZ2  H   22.119   4.174   1.846 1.00 . A A . 713 LYS HZ2  1 1 
        2  2299 1 1 57 LYS HZ3  H   23.502   5.103   1.561 1.00 . A A . 713 LYS HZ3  1 1 
        2  2300 1 1 57 LYS N    N   18.941   6.844  -3.056 1.00 . A A . 713 LYS N    1 1 
        2  2301 1 1 57 LYS NZ   N   23.072   4.165   1.431 1.00 . A A . 713 LYS NZ   1 1 
        2  2302 1 1 57 LYS O    O   18.026   4.084  -2.565 1.00 . A A . 713 LYS O    1 1 
        2  2303 1 1 58 ALA C    C   19.358   1.277  -2.779 1.00 . A A . 714 ALA C    1 1 
        2  2304 1 1 58 ALA CA   C   19.530   2.221  -3.980 1.00 . A A . 714 ALA CA   1 1 
        2  2305 1 1 58 ALA CB   C   20.519   1.628  -4.977 1.00 . A A . 714 ALA CB   1 1 
        2  2306 1 1 58 ALA H    H   20.879   3.856  -3.798 1.00 . A A . 714 ALA H    1 1 
        2  2307 1 1 58 ALA HA   H   18.576   2.328  -4.481 1.00 . A A . 714 ALA HA   1 1 
        2  2308 1 1 58 ALA HB1  H   20.637   2.302  -5.813 1.00 . A A . 714 ALA HB1  1 1 
        2  2309 1 1 58 ALA HB2  H   20.148   0.675  -5.334 1.00 . A A . 714 ALA HB2  1 1 
        2  2310 1 1 58 ALA HB3  H   21.475   1.484  -4.495 1.00 . A A . 714 ALA HB3  1 1 
        2  2311 1 1 58 ALA N    N   19.974   3.557  -3.564 1.00 . A A . 714 ALA N    1 1 
        2  2312 1 1 58 ALA O    O   20.120   1.337  -1.809 1.00 . A A . 714 ALA O    1 1 
        2  2313 1 1 59 GLY C    C   16.626  -1.008  -1.750 1.00 . A A . 715 GLY C    1 1 
        2  2314 1 1 59 GLY CA   C   18.079  -0.537  -1.773 1.00 . A A . 715 GLY CA   1 1 
        2  2315 1 1 59 GLY H    H   17.782   0.406  -3.653 1.00 . A A . 715 GLY H    1 1 
        2  2316 1 1 59 GLY HA2  H   18.722  -1.398  -1.892 1.00 . A A . 715 GLY HA2  1 1 
        2  2317 1 1 59 GLY HA3  H   18.305  -0.064  -0.827 1.00 . A A . 715 GLY HA3  1 1 
        2  2318 1 1 59 GLY N    N   18.351   0.408  -2.852 1.00 . A A . 715 GLY N    1 1 
        2  2319 1 1 59 GLY O    O   15.779  -0.455  -2.447 1.00 . A A . 715 GLY O    1 1 
        2  2320 1 1 60 THR C    C   14.235  -2.008   0.382 1.00 . A A . 716 THR C    1 1 
        2  2321 1 1 60 THR CA   C   14.972  -2.568  -0.845 1.00 . A A . 716 THR CA   1 1 
        2  2322 1 1 60 THR CB   C   14.975  -4.115  -0.770 1.00 . A A . 716 THR CB   1 1 
        2  2323 1 1 60 THR CG2  C   13.563  -4.663  -0.592 1.00 . A A . 716 THR CG2  1 1 
        2  2324 1 1 60 THR H    H   17.055  -2.441  -0.425 1.00 . A A . 716 THR H    1 1 
        2  2325 1 1 60 THR HA   H   14.430  -2.279  -1.736 1.00 . A A . 716 THR HA   1 1 
        2  2326 1 1 60 THR HB   H   15.574  -4.419   0.080 1.00 . A A . 716 THR HB   1 1 
        2  2327 1 1 60 THR HG1  H   16.487  -4.849  -1.817 1.00 . A A . 716 THR HG1  1 1 
        2  2328 1 1 60 THR HG21 H   13.597  -5.742  -0.561 1.00 . A A . 716 THR HG21 1 1 
        2  2329 1 1 60 THR HG22 H   12.947  -4.348  -1.421 1.00 . A A . 716 THR HG22 1 1 
        2  2330 1 1 60 THR HG23 H   13.142  -4.291   0.331 1.00 . A A . 716 THR HG23 1 1 
        2  2331 1 1 60 THR N    N   16.338  -2.032  -0.954 1.00 . A A . 716 THR N    1 1 
        2  2332 1 1 60 THR O    O   14.693  -2.154   1.515 1.00 . A A . 716 THR O    1 1 
        2  2333 1 1 60 THR OG1  O   15.552  -4.664  -1.965 1.00 . A A . 716 THR OG1  1 1 
        2  2334 1 1 61 TYR C    C   10.909  -1.504   1.321 1.00 . A A . 717 TYR C    1 1 
        2  2335 1 1 61 TYR CA   C   12.270  -0.791   1.211 1.00 . A A . 717 TYR CA   1 1 
        2  2336 1 1 61 TYR CB   C   12.054   0.707   0.935 1.00 . A A . 717 TYR CB   1 1 
        2  2337 1 1 61 TYR CD1  C   13.871   1.537  -0.627 1.00 . A A . 717 TYR CD1  1 1 
        2  2338 1 1 61 TYR CD2  C   14.026   2.123   1.682 1.00 . A A . 717 TYR CD2  1 1 
        2  2339 1 1 61 TYR CE1  C   15.043   2.225  -0.883 1.00 . A A . 717 TYR CE1  1 1 
        2  2340 1 1 61 TYR CE2  C   15.198   2.812   1.430 1.00 . A A . 717 TYR CE2  1 1 
        2  2341 1 1 61 TYR CG   C   13.341   1.473   0.660 1.00 . A A . 717 TYR CG   1 1 
        2  2342 1 1 61 TYR CZ   C   15.701   2.861   0.145 1.00 . A A . 717 TYR CZ   1 1 
        2  2343 1 1 61 TYR H    H   12.772  -1.312  -0.783 1.00 . A A . 717 TYR H    1 1 
        2  2344 1 1 61 TYR HA   H   12.804  -0.904   2.147 1.00 . A A . 717 TYR HA   1 1 
        2  2345 1 1 61 TYR HB2  H   11.413   0.819   0.072 1.00 . A A . 717 TYR HB2  1 1 
        2  2346 1 1 61 TYR HB3  H   11.574   1.159   1.791 1.00 . A A . 717 TYR HB3  1 1 
        2  2347 1 1 61 TYR HD1  H   13.352   1.040  -1.433 1.00 . A A . 717 TYR HD1  1 1 
        2  2348 1 1 61 TYR HD2  H   13.631   2.083   2.690 1.00 . A A . 717 TYR HD2  1 1 
        2  2349 1 1 61 TYR HE1  H   15.438   2.260  -1.889 1.00 . A A . 717 TYR HE1  1 1 
        2  2350 1 1 61 TYR HE2  H   15.713   3.311   2.239 1.00 . A A . 717 TYR HE2  1 1 
        2  2351 1 1 61 TYR HH   H   16.794   4.023  -0.947 1.00 . A A . 717 TYR HH   1 1 
        2  2352 1 1 61 TYR N    N   13.084  -1.384   0.142 1.00 . A A . 717 TYR N    1 1 
        2  2353 1 1 61 TYR O    O   10.182  -1.625   0.333 1.00 . A A . 717 TYR O    1 1 
        2  2354 1 1 61 TYR OH   O   16.872   3.544  -0.108 1.00 . A A . 717 TYR OH   1 1 
        2  2355 1 1 62 VAL C    C    8.231  -1.718   3.306 1.00 . A A . 718 VAL C    1 1 
        2  2356 1 1 62 VAL CA   C    9.299  -2.674   2.747 1.00 . A A . 718 VAL CA   1 1 
        2  2357 1 1 62 VAL CB   C    9.473  -3.869   3.716 1.00 . A A . 718 VAL CB   1 1 
        2  2358 1 1 62 VAL CG1  C    8.150  -4.611   3.908 1.00 . A A . 718 VAL CG1  1 1 
        2  2359 1 1 62 VAL CG2  C   10.565  -4.815   3.213 1.00 . A A . 718 VAL CG2  1 1 
        2  2360 1 1 62 VAL H    H   11.196  -1.868   3.267 1.00 . A A . 718 VAL H    1 1 
        2  2361 1 1 62 VAL HA   H    8.954  -3.060   1.795 1.00 . A A . 718 VAL HA   1 1 
        2  2362 1 1 62 VAL HB   H    9.782  -3.481   4.679 1.00 . A A . 718 VAL HB   1 1 
        2  2363 1 1 62 VAL HG11 H    7.414  -3.940   4.331 1.00 . A A . 718 VAL HG11 1 1 
        2  2364 1 1 62 VAL HG12 H    8.296  -5.446   4.579 1.00 . A A . 718 VAL HG12 1 1 
        2  2365 1 1 62 VAL HG13 H    7.796  -4.976   2.954 1.00 . A A . 718 VAL HG13 1 1 
        2  2366 1 1 62 VAL HG21 H   10.663  -5.648   3.895 1.00 . A A . 718 VAL HG21 1 1 
        2  2367 1 1 62 VAL HG22 H   11.505  -4.285   3.157 1.00 . A A . 718 VAL HG22 1 1 
        2  2368 1 1 62 VAL HG23 H   10.301  -5.184   2.231 1.00 . A A . 718 VAL HG23 1 1 
        2  2369 1 1 62 VAL N    N   10.573  -1.981   2.518 1.00 . A A . 718 VAL N    1 1 
        2  2370 1 1 62 VAL O    O    8.391  -1.154   4.394 1.00 . A A . 718 VAL O    1 1 
        2  2371 1 1 63 LEU C    C    4.854  -1.424   3.531 1.00 . A A . 719 LEU C    1 1 
        2  2372 1 1 63 LEU CA   C    6.057  -0.643   2.979 1.00 . A A . 719 LEU CA   1 1 
        2  2373 1 1 63 LEU CB   C    5.606   0.224   1.795 1.00 . A A . 719 LEU CB   1 1 
        2  2374 1 1 63 LEU CD1  C    6.125   1.948   0.028 1.00 . A A . 719 LEU CD1  1 1 
        2  2375 1 1 63 LEU CD2  C    7.404   1.952   2.193 1.00 . A A . 719 LEU CD2  1 1 
        2  2376 1 1 63 LEU CG   C    6.704   1.087   1.147 1.00 . A A . 719 LEU CG   1 1 
        2  2377 1 1 63 LEU H    H    7.061  -2.028   1.713 1.00 . A A . 719 LEU H    1 1 
        2  2378 1 1 63 LEU HA   H    6.440   0.004   3.759 1.00 . A A . 719 LEU HA   1 1 
        2  2379 1 1 63 LEU HB2  H    5.198  -0.428   1.037 1.00 . A A . 719 LEU HB2  1 1 
        2  2380 1 1 63 LEU HB3  H    4.821   0.882   2.140 1.00 . A A . 719 LEU HB3  1 1 
        2  2381 1 1 63 LEU HD11 H    5.363   2.601   0.430 1.00 . A A . 719 LEU HD11 1 1 
        2  2382 1 1 63 LEU HD12 H    5.690   1.313  -0.729 1.00 . A A . 719 LEU HD12 1 1 
        2  2383 1 1 63 LEU HD13 H    6.910   2.545  -0.414 1.00 . A A . 719 LEU HD13 1 1 
        2  2384 1 1 63 LEU HD21 H    6.676   2.575   2.695 1.00 . A A . 719 LEU HD21 1 1 
        2  2385 1 1 63 LEU HD22 H    8.141   2.577   1.710 1.00 . A A . 719 LEU HD22 1 1 
        2  2386 1 1 63 LEU HD23 H    7.894   1.316   2.918 1.00 . A A . 719 LEU HD23 1 1 
        2  2387 1 1 63 LEU HG   H    7.446   0.435   0.707 1.00 . A A . 719 LEU HG   1 1 
        2  2388 1 1 63 LEU N    N    7.141  -1.542   2.564 1.00 . A A . 719 LEU N    1 1 
        2  2389 1 1 63 LEU O    O    4.433  -2.426   2.951 1.00 . A A . 719 LEU O    1 1 
        2  2390 1 1 64 THR C    C    1.862  -0.707   4.965 1.00 . A A . 720 THR C    1 1 
        2  2391 1 1 64 THR CA   C    3.105  -1.562   5.250 1.00 . A A . 720 THR CA   1 1 
        2  2392 1 1 64 THR CB   C    3.250  -1.747   6.786 1.00 . A A . 720 THR CB   1 1 
        2  2393 1 1 64 THR CG2  C    1.927  -2.161   7.427 1.00 . A A . 720 THR CG2  1 1 
        2  2394 1 1 64 THR H    H    4.716  -0.178   5.089 1.00 . A A . 720 THR H    1 1 
        2  2395 1 1 64 THR HA   H    2.964  -2.541   4.805 1.00 . A A . 720 THR HA   1 1 
        2  2396 1 1 64 THR HB   H    3.559  -0.805   7.215 1.00 . A A . 720 THR HB   1 1 
        2  2397 1 1 64 THR HG1  H    5.128  -2.344   6.990 1.00 . A A . 720 THR HG1  1 1 
        2  2398 1 1 64 THR HG21 H    1.194  -1.380   7.280 1.00 . A A . 720 THR HG21 1 1 
        2  2399 1 1 64 THR HG22 H    2.074  -2.321   8.484 1.00 . A A . 720 THR HG22 1 1 
        2  2400 1 1 64 THR HG23 H    1.575  -3.075   6.968 1.00 . A A . 720 THR HG23 1 1 
        2  2401 1 1 64 THR N    N    4.307  -0.957   4.652 1.00 . A A . 720 THR N    1 1 
        2  2402 1 1 64 THR O    O    1.876   0.508   5.146 1.00 . A A . 720 THR O    1 1 
        2  2403 1 1 64 THR OG1  O    4.251  -2.737   7.079 1.00 . A A . 720 THR OG1  1 1 
        2  2404 1 1 65 TYR C    C   -1.604  -1.179   5.094 1.00 . A A . 721 TYR C    1 1 
        2  2405 1 1 65 TYR CA   C   -0.465  -0.660   4.208 1.00 . A A . 721 TYR CA   1 1 
        2  2406 1 1 65 TYR CB   C   -0.825  -0.851   2.729 1.00 . A A . 721 TYR CB   1 1 
        2  2407 1 1 65 TYR CD1  C    0.427   0.933   1.438 1.00 . A A . 721 TYR CD1  1 1 
        2  2408 1 1 65 TYR CD2  C    1.158  -1.330   1.232 1.00 . A A . 721 TYR CD2  1 1 
        2  2409 1 1 65 TYR CE1  C    1.430   1.335   0.579 1.00 . A A . 721 TYR CE1  1 1 
        2  2410 1 1 65 TYR CE2  C    2.162  -0.932   0.378 1.00 . A A . 721 TYR CE2  1 1 
        2  2411 1 1 65 TYR CG   C    0.271  -0.408   1.780 1.00 . A A . 721 TYR CG   1 1 
        2  2412 1 1 65 TYR CZ   C    2.294   0.398   0.053 1.00 . A A . 721 TYR CZ   1 1 
        2  2413 1 1 65 TYR H    H    0.843  -2.318   4.375 1.00 . A A . 721 TYR H    1 1 
        2  2414 1 1 65 TYR HA   H   -0.325   0.395   4.401 1.00 . A A . 721 TYR HA   1 1 
        2  2415 1 1 65 TYR HB2  H   -1.023  -1.899   2.543 1.00 . A A . 721 TYR HB2  1 1 
        2  2416 1 1 65 TYR HB3  H   -1.715  -0.279   2.505 1.00 . A A . 721 TYR HB3  1 1 
        2  2417 1 1 65 TYR HD1  H   -0.251   1.667   1.854 1.00 . A A . 721 TYR HD1  1 1 
        2  2418 1 1 65 TYR HD2  H    1.053  -2.375   1.485 1.00 . A A . 721 TYR HD2  1 1 
        2  2419 1 1 65 TYR HE1  H    1.537   2.379   0.322 1.00 . A A . 721 TYR HE1  1 1 
        2  2420 1 1 65 TYR HE2  H    2.840  -1.664  -0.036 1.00 . A A . 721 TYR HE2  1 1 
        2  2421 1 1 65 TYR HH   H    3.716   1.582  -0.450 1.00 . A A . 721 TYR HH   1 1 
        2  2422 1 1 65 TYR N    N    0.791  -1.351   4.512 1.00 . A A . 721 TYR N    1 1 
        2  2423 1 1 65 TYR O    O   -1.956  -2.357   5.036 1.00 . A A . 721 TYR O    1 1 
        2  2424 1 1 65 TYR OH   O    3.293   0.795  -0.801 1.00 . A A . 721 TYR OH   1 1 
        2  2425 1 1 66 THR C    C   -4.526   0.170   6.532 1.00 . A A . 722 THR C    1 1 
        2  2426 1 1 66 THR CA   C   -3.271  -0.669   6.814 1.00 . A A . 722 THR CA   1 1 
        2  2427 1 1 66 THR CB   C   -2.863  -0.490   8.298 1.00 . A A . 722 THR CB   1 1 
        2  2428 1 1 66 THR CG2  C   -4.005  -0.863   9.240 1.00 . A A . 722 THR CG2  1 1 
        2  2429 1 1 66 THR H    H   -1.834   0.624   5.921 1.00 . A A . 722 THR H    1 1 
        2  2430 1 1 66 THR HA   H   -3.504  -1.714   6.651 1.00 . A A . 722 THR HA   1 1 
        2  2431 1 1 66 THR HB   H   -2.607   0.548   8.462 1.00 . A A . 722 THR HB   1 1 
        2  2432 1 1 66 THR HG1  H   -1.699  -1.500   9.541 1.00 . A A . 722 THR HG1  1 1 
        2  2433 1 1 66 THR HG21 H   -4.847  -0.209   9.062 1.00 . A A . 722 THR HG21 1 1 
        2  2434 1 1 66 THR HG22 H   -3.678  -0.755  10.264 1.00 . A A . 722 THR HG22 1 1 
        2  2435 1 1 66 THR HG23 H   -4.301  -1.886   9.063 1.00 . A A . 722 THR HG23 1 1 
        2  2436 1 1 66 THR N    N   -2.169  -0.299   5.914 1.00 . A A . 722 THR N    1 1 
        2  2437 1 1 66 THR O    O   -4.468   1.399   6.519 1.00 . A A . 722 THR O    1 1 
        2  2438 1 1 66 THR OG1  O   -1.715  -1.302   8.597 1.00 . A A . 722 THR OG1  1 1 
        2  2439 1 1 67 VAL C    C   -8.051  -0.180   6.950 1.00 . A A . 723 VAL C    1 1 
        2  2440 1 1 67 VAL CA   C   -6.911   0.206   5.987 1.00 . A A . 723 VAL CA   1 1 
        2  2441 1 1 67 VAL CB   C   -7.341  -0.075   4.524 1.00 . A A . 723 VAL CB   1 1 
        2  2442 1 1 67 VAL CG1  C   -7.630  -1.560   4.306 1.00 . A A . 723 VAL CG1  1 1 
        2  2443 1 1 67 VAL CG2  C   -8.546   0.781   4.138 1.00 . A A . 723 VAL CG2  1 1 
        2  2444 1 1 67 VAL H    H   -5.661  -1.473   6.373 1.00 . A A . 723 VAL H    1 1 
        2  2445 1 1 67 VAL HA   H   -6.730   1.270   6.083 1.00 . A A . 723 VAL HA   1 1 
        2  2446 1 1 67 VAL HB   H   -6.518   0.200   3.877 1.00 . A A . 723 VAL HB   1 1 
        2  2447 1 1 67 VAL HG11 H   -6.743  -2.137   4.526 1.00 . A A . 723 VAL HG11 1 1 
        2  2448 1 1 67 VAL HG12 H   -7.920  -1.725   3.278 1.00 . A A . 723 VAL HG12 1 1 
        2  2449 1 1 67 VAL HG13 H   -8.433  -1.872   4.958 1.00 . A A . 723 VAL HG13 1 1 
        2  2450 1 1 67 VAL HG21 H   -8.301   1.826   4.261 1.00 . A A . 723 VAL HG21 1 1 
        2  2451 1 1 67 VAL HG22 H   -9.387   0.531   4.772 1.00 . A A . 723 VAL HG22 1 1 
        2  2452 1 1 67 VAL HG23 H   -8.808   0.594   3.107 1.00 . A A . 723 VAL HG23 1 1 
        2  2453 1 1 67 VAL N    N   -5.660  -0.492   6.312 1.00 . A A . 723 VAL N    1 1 
        2  2454 1 1 67 VAL O    O   -8.170  -1.338   7.358 1.00 . A A . 723 VAL O    1 1 
        2  2455 1 1 68 THR C    C  -11.363   0.639   7.605 1.00 . A A . 724 THR C    1 1 
        2  2456 1 1 68 THR CA   C   -9.975   0.589   8.272 1.00 . A A . 724 THR CA   1 1 
        2  2457 1 1 68 THR CB   C   -9.926   1.648   9.405 1.00 . A A . 724 THR CB   1 1 
        2  2458 1 1 68 THR CG2  C  -10.944   1.337  10.501 1.00 . A A . 724 THR CG2  1 1 
        2  2459 1 1 68 THR H    H   -8.763   1.691   6.916 1.00 . A A . 724 THR H    1 1 
        2  2460 1 1 68 THR HA   H   -9.839  -0.389   8.720 1.00 . A A . 724 THR HA   1 1 
        2  2461 1 1 68 THR HB   H  -10.158   2.616   8.984 1.00 . A A . 724 THR HB   1 1 
        2  2462 1 1 68 THR HG1  H   -8.560   1.081  10.725 1.00 . A A . 724 THR HG1  1 1 
        2  2463 1 1 68 THR HG21 H  -10.741   0.359  10.918 1.00 . A A . 724 THR HG21 1 1 
        2  2464 1 1 68 THR HG22 H  -11.941   1.349  10.086 1.00 . A A . 724 THR HG22 1 1 
        2  2465 1 1 68 THR HG23 H  -10.870   2.080  11.281 1.00 . A A . 724 THR HG23 1 1 
        2  2466 1 1 68 THR N    N   -8.886   0.800   7.305 1.00 . A A . 724 THR N    1 1 
        2  2467 1 1 68 THR O    O  -11.659   1.538   6.817 1.00 . A A . 724 THR O    1 1 
        2  2468 1 1 68 THR OG1  O   -8.609   1.693   9.979 1.00 . A A . 724 THR OG1  1 1 
        2  2469 1 1 69 ASP C    C  -14.568   0.296   8.377 1.00 . A A . 725 ASP C    1 1 
        2  2470 1 1 69 ASP CA   C  -13.585  -0.421   7.433 1.00 . A A . 725 ASP CA   1 1 
        2  2471 1 1 69 ASP CB   C  -13.961  -1.905   7.265 1.00 . A A . 725 ASP CB   1 1 
        2  2472 1 1 69 ASP CG   C  -15.419  -2.160   6.908 1.00 . A A . 725 ASP CG   1 1 
        2  2473 1 1 69 ASP H    H  -11.893  -1.032   8.551 1.00 . A A . 725 ASP H    1 1 
        2  2474 1 1 69 ASP HA   H  -13.615   0.060   6.465 1.00 . A A . 725 ASP HA   1 1 
        2  2475 1 1 69 ASP HB2  H  -13.351  -2.326   6.482 1.00 . A A . 725 ASP HB2  1 1 
        2  2476 1 1 69 ASP HB3  H  -13.743  -2.422   8.192 1.00 . A A . 725 ASP HB3  1 1 
        2  2477 1 1 69 ASP N    N  -12.207  -0.337   7.942 1.00 . A A . 725 ASP N    1 1 
        2  2478 1 1 69 ASP O    O  -14.346   0.361   9.588 1.00 . A A . 725 ASP O    1 1 
        2  2479 1 1 69 ASP OD1  O  -16.041  -1.321   6.239 1.00 . A A . 725 ASP OD1  1 1 
        2  2480 1 1 69 ASP OD2  O  -15.950  -3.220   7.297 1.00 . A A . 725 ASP OD2  1 1 
        2  2481 1 1 70 SER C    C  -17.261   0.801   9.742 1.00 . A A . 726 SER C    1 1 
        2  2482 1 1 70 SER CA   C  -16.652   1.592   8.573 1.00 . A A . 726 SER CA   1 1 
        2  2483 1 1 70 SER CB   C  -17.775   2.077   7.647 1.00 . A A . 726 SER CB   1 1 
        2  2484 1 1 70 SER H    H  -15.823   0.633   6.858 1.00 . A A . 726 SER H    1 1 
        2  2485 1 1 70 SER HA   H  -16.140   2.455   8.974 1.00 . A A . 726 SER HA   1 1 
        2  2486 1 1 70 SER HB2  H  -17.351   2.668   6.848 1.00 . A A . 726 SER HB2  1 1 
        2  2487 1 1 70 SER HB3  H  -18.286   1.224   7.227 1.00 . A A . 726 SER HB3  1 1 
        2  2488 1 1 70 SER HG   H  -18.508   3.811   8.213 1.00 . A A . 726 SER HG   1 1 
        2  2489 1 1 70 SER N    N  -15.664   0.803   7.815 1.00 . A A . 726 SER N    1 1 
        2  2490 1 1 70 SER O    O  -17.645   1.378  10.763 1.00 . A A . 726 SER O    1 1 
        2  2491 1 1 70 SER OG   O  -18.715   2.874   8.351 1.00 . A A . 726 SER OG   1 1 
        2  2492 1 1 71 LYS C    C  -16.826  -1.898  11.617 1.00 . A A . 727 LYS C    1 1 
        2  2493 1 1 71 LYS CA   C  -17.908  -1.376  10.652 1.00 . A A . 727 LYS CA   1 1 
        2  2494 1 1 71 LYS CB   C  -18.678  -2.545  10.026 1.00 . A A . 727 LYS CB   1 1 
        2  2495 1 1 71 LYS CD   C  -21.034  -1.593  10.141 1.00 . A A . 727 LYS CD   1 1 
        2  2496 1 1 71 LYS CE   C  -22.290  -1.252   9.342 1.00 . A A . 727 LYS CE   1 1 
        2  2497 1 1 71 LYS CG   C  -19.918  -2.119   9.239 1.00 . A A . 727 LYS CG   1 1 
        2  2498 1 1 71 LYS H    H  -17.041  -0.927   8.757 1.00 . A A . 727 LYS H    1 1 
        2  2499 1 1 71 LYS HA   H  -18.605  -0.776  11.224 1.00 . A A . 727 LYS HA   1 1 
        2  2500 1 1 71 LYS HB2  H  -18.017  -3.074   9.352 1.00 . A A . 727 LYS HB2  1 1 
        2  2501 1 1 71 LYS HB3  H  -18.990  -3.221  10.810 1.00 . A A . 727 LYS HB3  1 1 
        2  2502 1 1 71 LYS HD2  H  -21.280  -2.349  10.873 1.00 . A A . 727 LYS HD2  1 1 
        2  2503 1 1 71 LYS HD3  H  -20.686  -0.703  10.646 1.00 . A A . 727 LYS HD3  1 1 
        2  2504 1 1 71 LYS HE2  H  -22.066  -0.433   8.673 1.00 . A A . 727 LYS HE2  1 1 
        2  2505 1 1 71 LYS HE3  H  -22.581  -2.117   8.763 1.00 . A A . 727 LYS HE3  1 1 
        2  2506 1 1 71 LYS HG2  H  -19.637  -1.339   8.544 1.00 . A A . 727 LYS HG2  1 1 
        2  2507 1 1 71 LYS HG3  H  -20.287  -2.972   8.685 1.00 . A A . 727 LYS HG3  1 1 
        2  2508 1 1 71 LYS HZ1  H  -23.639  -1.616  10.895 1.00 . A A . 727 LYS HZ1  1 1 
        2  2509 1 1 71 LYS HZ2  H  -24.271  -0.668   9.648 1.00 . A A . 727 LYS HZ2  1 1 
        2  2510 1 1 71 LYS HZ3  H  -23.184   0.004  10.750 1.00 . A A . 727 LYS HZ3  1 1 
        2  2511 1 1 71 LYS N    N  -17.348  -0.519   9.596 1.00 . A A . 727 LYS N    1 1 
        2  2512 1 1 71 LYS NZ   N  -23.423  -0.856  10.220 1.00 . A A . 727 LYS NZ   1 1 
        2  2513 1 1 71 LYS O    O  -17.104  -2.736  12.476 1.00 . A A . 727 LYS O    1 1 
        2  2514 1 1 72 GLY C    C  -13.555  -2.825  11.977 1.00 . A A . 728 GLY C    1 1 
        2  2515 1 1 72 GLY CA   C  -14.533  -1.735  12.433 1.00 . A A . 728 GLY CA   1 1 
        2  2516 1 1 72 GLY H    H  -15.405  -0.794  10.731 1.00 . A A . 728 GLY H    1 1 
        2  2517 1 1 72 GLY HA2  H  -13.967  -0.839  12.630 1.00 . A A . 728 GLY HA2  1 1 
        2  2518 1 1 72 GLY HA3  H  -14.993  -2.053  13.360 1.00 . A A . 728 GLY HA3  1 1 
        2  2519 1 1 72 GLY N    N  -15.594  -1.404  11.475 1.00 . A A . 728 GLY N    1 1 
        2  2520 1 1 72 GLY O    O  -12.725  -3.284  12.767 1.00 . A A . 728 GLY O    1 1 
        2  2521 1 1 73 HIS C    C  -11.422  -3.582   9.642 1.00 . A A . 729 HIS C    1 1 
        2  2522 1 1 73 HIS CA   C  -12.700  -4.251  10.181 1.00 . A A . 729 HIS CA   1 1 
        2  2523 1 1 73 HIS CB   C  -13.362  -5.065   9.062 1.00 . A A . 729 HIS CB   1 1 
        2  2524 1 1 73 HIS CD2  C  -14.445  -7.030  10.365 1.00 . A A . 729 HIS CD2  1 1 
        2  2525 1 1 73 HIS CE1  C  -16.488  -6.827   9.610 1.00 . A A . 729 HIS CE1  1 1 
        2  2526 1 1 73 HIS CG   C  -14.463  -5.971   9.521 1.00 . A A . 729 HIS CG   1 1 
        2  2527 1 1 73 HIS H    H  -14.338  -2.885  10.138 1.00 . A A . 729 HIS H    1 1 
        2  2528 1 1 73 HIS HA   H  -12.428  -4.920  10.987 1.00 . A A . 729 HIS HA   1 1 
        2  2529 1 1 73 HIS HB2  H  -13.780  -4.386   8.334 1.00 . A A . 729 HIS HB2  1 1 
        2  2530 1 1 73 HIS HB3  H  -12.610  -5.677   8.582 1.00 . A A . 729 HIS HB3  1 1 
        2  2531 1 1 73 HIS HD1  H  -16.099  -5.208   8.422 1.00 . A A . 729 HIS HD1  1 1 
        2  2532 1 1 73 HIS HD2  H  -13.586  -7.405  10.905 1.00 . A A . 729 HIS HD2  1 1 
        2  2533 1 1 73 HIS HE1  H  -17.539  -6.995   9.431 1.00 . A A . 729 HIS HE1  1 1 
        2  2534 1 1 73 HIS HE2  H  -15.953  -8.428  10.756 1.00 . A A . 729 HIS HE2  1 1 
        2  2535 1 1 73 HIS N    N  -13.638  -3.248  10.718 1.00 . A A . 729 HIS N    1 1 
        2  2536 1 1 73 HIS ND1  N  -15.759  -5.874   9.066 1.00 . A A . 729 HIS ND1  1 1 
        2  2537 1 1 73 HIS NE2  N  -15.716  -7.543  10.400 1.00 . A A . 729 HIS NE2  1 1 
        2  2538 1 1 73 HIS O    O  -11.471  -2.836   8.671 1.00 . A A . 729 HIS O    1 1 
        2  2539 1 1 74 GLU C    C   -7.969  -4.294   9.435 1.00 . A A . 730 GLU C    1 1 
        2  2540 1 1 74 GLU CA   C   -9.009  -3.238   9.859 1.00 . A A . 730 GLU CA   1 1 
        2  2541 1 1 74 GLU CB   C   -8.458  -2.380  11.009 1.00 . A A . 730 GLU CB   1 1 
        2  2542 1 1 74 GLU CD   C   -6.712  -0.712  11.786 1.00 . A A . 730 GLU CD   1 1 
        2  2543 1 1 74 GLU CG   C   -7.210  -1.586  10.644 1.00 . A A . 730 GLU CG   1 1 
        2  2544 1 1 74 GLU H    H  -10.285  -4.494  11.011 1.00 . A A . 730 GLU H    1 1 
        2  2545 1 1 74 GLU HA   H   -9.208  -2.592   9.011 1.00 . A A . 730 GLU HA   1 1 
        2  2546 1 1 74 GLU HB2  H   -9.224  -1.684  11.320 1.00 . A A . 730 GLU HB2  1 1 
        2  2547 1 1 74 GLU HB3  H   -8.217  -3.028  11.841 1.00 . A A . 730 GLU HB3  1 1 
        2  2548 1 1 74 GLU HG2  H   -6.427  -2.278  10.368 1.00 . A A . 730 GLU HG2  1 1 
        2  2549 1 1 74 GLU HG3  H   -7.438  -0.952   9.798 1.00 . A A . 730 GLU HG3  1 1 
        2  2550 1 1 74 GLU N    N  -10.280  -3.858  10.265 1.00 . A A . 730 GLU N    1 1 
        2  2551 1 1 74 GLU O    O   -7.547  -5.124  10.244 1.00 . A A . 730 GLU O    1 1 
        2  2552 1 1 74 GLU OE1  O   -7.383   0.286  12.111 1.00 . A A . 730 GLU OE1  1 1 
        2  2553 1 1 74 GLU OE2  O   -5.648  -1.021  12.365 1.00 . A A . 730 GLU OE2  1 1 
        2  2554 1 1 75 VAL C    C   -5.293  -4.565   7.157 1.00 . A A . 731 VAL C    1 1 
        2  2555 1 1 75 VAL CA   C   -6.600  -5.235   7.622 1.00 . A A . 731 VAL CA   1 1 
        2  2556 1 1 75 VAL CB   C   -7.222  -6.027   6.441 1.00 . A A . 731 VAL CB   1 1 
        2  2557 1 1 75 VAL CG1  C   -8.438  -6.831   6.906 1.00 . A A . 731 VAL CG1  1 1 
        2  2558 1 1 75 VAL CG2  C   -7.599  -5.088   5.294 1.00 . A A . 731 VAL CG2  1 1 
        2  2559 1 1 75 VAL H    H   -7.885  -3.536   7.585 1.00 . A A . 731 VAL H    1 1 
        2  2560 1 1 75 VAL HA   H   -6.360  -5.940   8.407 1.00 . A A . 731 VAL HA   1 1 
        2  2561 1 1 75 VAL HB   H   -6.480  -6.726   6.074 1.00 . A A . 731 VAL HB   1 1 
        2  2562 1 1 75 VAL HG11 H   -8.849  -7.383   6.072 1.00 . A A . 731 VAL HG11 1 1 
        2  2563 1 1 75 VAL HG12 H   -9.190  -6.160   7.294 1.00 . A A . 731 VAL HG12 1 1 
        2  2564 1 1 75 VAL HG13 H   -8.140  -7.522   7.682 1.00 . A A . 731 VAL HG13 1 1 
        2  2565 1 1 75 VAL HG21 H   -8.042  -5.659   4.490 1.00 . A A . 731 VAL HG21 1 1 
        2  2566 1 1 75 VAL HG22 H   -6.713  -4.587   4.931 1.00 . A A . 731 VAL HG22 1 1 
        2  2567 1 1 75 VAL HG23 H   -8.308  -4.353   5.646 1.00 . A A . 731 VAL HG23 1 1 
        2  2568 1 1 75 VAL N    N   -7.553  -4.253   8.168 1.00 . A A . 731 VAL N    1 1 
        2  2569 1 1 75 VAL O    O   -5.267  -3.365   6.870 1.00 . A A . 731 VAL O    1 1 
        2  2570 1 1 76 THR C    C   -2.082  -5.778   5.828 1.00 . A A . 732 THR C    1 1 
        2  2571 1 1 76 THR CA   C   -2.890  -4.810   6.710 1.00 . A A . 732 THR CA   1 1 
        2  2572 1 1 76 THR CB   C   -2.050  -4.462   7.966 1.00 . A A . 732 THR CB   1 1 
        2  2573 1 1 76 THR CG2  C   -1.861  -5.679   8.868 1.00 . A A . 732 THR CG2  1 1 
        2  2574 1 1 76 THR H    H   -4.302  -6.305   7.276 1.00 . A A . 732 THR H    1 1 
        2  2575 1 1 76 THR HA   H   -3.050  -3.895   6.154 1.00 . A A . 732 THR HA   1 1 
        2  2576 1 1 76 THR HB   H   -2.574  -3.699   8.527 1.00 . A A . 732 THR HB   1 1 
        2  2577 1 1 76 THR HG1  H   -0.778  -2.980   7.654 1.00 . A A . 732 THR HG1  1 1 
        2  2578 1 1 76 THR HG21 H   -1.278  -5.398   9.733 1.00 . A A . 732 THR HG21 1 1 
        2  2579 1 1 76 THR HG22 H   -1.345  -6.456   8.323 1.00 . A A . 732 THR HG22 1 1 
        2  2580 1 1 76 THR HG23 H   -2.825  -6.045   9.188 1.00 . A A . 732 THR HG23 1 1 
        2  2581 1 1 76 THR N    N   -4.212  -5.347   7.080 1.00 . A A . 732 THR N    1 1 
        2  2582 1 1 76 THR O    O   -2.137  -6.999   5.999 1.00 . A A . 732 THR O    1 1 
        2  2583 1 1 76 THR OG1  O   -0.766  -3.946   7.578 1.00 . A A . 732 THR OG1  1 1 
        2  2584 1 1 77 ALA C    C    0.821  -5.227   3.634 1.00 . A A . 733 ALA C    1 1 
        2  2585 1 1 77 ALA CA   C   -0.461  -6.000   3.988 1.00 . A A . 733 ALA CA   1 1 
        2  2586 1 1 77 ALA CB   C   -1.225  -6.372   2.720 1.00 . A A . 733 ALA CB   1 1 
        2  2587 1 1 77 ALA H    H   -1.331  -4.238   4.797 1.00 . A A . 733 ALA H    1 1 
        2  2588 1 1 77 ALA HA   H   -0.186  -6.915   4.497 1.00 . A A . 733 ALA HA   1 1 
        2  2589 1 1 77 ALA HB1  H   -2.114  -6.925   2.984 1.00 . A A . 733 ALA HB1  1 1 
        2  2590 1 1 77 ALA HB2  H   -0.597  -6.984   2.087 1.00 . A A . 733 ALA HB2  1 1 
        2  2591 1 1 77 ALA HB3  H   -1.504  -5.475   2.188 1.00 . A A . 733 ALA HB3  1 1 
        2  2592 1 1 77 ALA N    N   -1.319  -5.216   4.889 1.00 . A A . 733 ALA N    1 1 
        2  2593 1 1 77 ALA O    O    0.866  -4.006   3.751 1.00 . A A . 733 ALA O    1 1 
        2  2594 1 1 78 LYS C    C    3.566  -5.457   1.407 1.00 . A A . 734 LYS C    1 1 
        2  2595 1 1 78 LYS CA   C    3.159  -5.310   2.886 1.00 . A A . 734 LYS CA   1 1 
        2  2596 1 1 78 LYS CB   C    4.264  -5.908   3.769 1.00 . A A . 734 LYS CB   1 1 
        2  2597 1 1 78 LYS CD   C    5.266  -6.178   6.067 1.00 . A A . 734 LYS CD   1 1 
        2  2598 1 1 78 LYS CE   C    5.177  -5.795   7.540 1.00 . A A . 734 LYS CE   1 1 
        2  2599 1 1 78 LYS CG   C    4.112  -5.599   5.253 1.00 . A A . 734 LYS CG   1 1 
        2  2600 1 1 78 LYS H    H    1.754  -6.906   3.071 1.00 . A A . 734 LYS H    1 1 
        2  2601 1 1 78 LYS HA   H    3.074  -4.256   3.113 1.00 . A A . 734 LYS HA   1 1 
        2  2602 1 1 78 LYS HB2  H    4.264  -6.982   3.645 1.00 . A A . 734 LYS HB2  1 1 
        2  2603 1 1 78 LYS HB3  H    5.219  -5.520   3.440 1.00 . A A . 734 LYS HB3  1 1 
        2  2604 1 1 78 LYS HD2  H    5.245  -7.255   5.986 1.00 . A A . 734 LYS HD2  1 1 
        2  2605 1 1 78 LYS HD3  H    6.200  -5.806   5.665 1.00 . A A . 734 LYS HD3  1 1 
        2  2606 1 1 78 LYS HE2  H    6.022  -6.217   8.062 1.00 . A A . 734 LYS HE2  1 1 
        2  2607 1 1 78 LYS HE3  H    5.209  -4.717   7.622 1.00 . A A . 734 LYS HE3  1 1 
        2  2608 1 1 78 LYS HG2  H    4.090  -4.527   5.389 1.00 . A A . 734 LYS HG2  1 1 
        2  2609 1 1 78 LYS HG3  H    3.183  -6.026   5.607 1.00 . A A . 734 LYS HG3  1 1 
        2  2610 1 1 78 LYS HZ1  H    3.096  -5.856   7.732 1.00 . A A . 734 LYS HZ1  1 1 
        2  2611 1 1 78 LYS HZ2  H    3.927  -6.040   9.195 1.00 . A A . 734 LYS HZ2  1 1 
        2  2612 1 1 78 LYS HZ3  H    3.857  -7.319   8.089 1.00 . A A . 734 LYS HZ3  1 1 
        2  2613 1 1 78 LYS N    N    1.859  -5.939   3.192 1.00 . A A . 734 LYS N    1 1 
        2  2614 1 1 78 LYS NZ   N    3.928  -6.287   8.180 1.00 . A A . 734 LYS NZ   1 1 
        2  2615 1 1 78 LYS O    O    3.157  -6.397   0.720 1.00 . A A . 734 LYS O    1 1 
        2  2616 1 1 79 GLN C    C    6.476  -4.401  -0.414 1.00 . A A . 735 GLN C    1 1 
        2  2617 1 1 79 GLN CA   C    4.945  -4.548  -0.427 1.00 . A A . 735 GLN CA   1 1 
        2  2618 1 1 79 GLN CB   C    4.327  -3.409  -1.260 1.00 . A A . 735 GLN CB   1 1 
        2  2619 1 1 79 GLN CD   C    4.476  -1.984  -3.376 1.00 . A A . 735 GLN CD   1 1 
        2  2620 1 1 79 GLN CG   C    5.021  -3.178  -2.606 1.00 . A A . 735 GLN CG   1 1 
        2  2621 1 1 79 GLN H    H    4.692  -3.811   1.548 1.00 . A A . 735 GLN H    1 1 
        2  2622 1 1 79 GLN HA   H    4.688  -5.498  -0.879 1.00 . A A . 735 GLN HA   1 1 
        2  2623 1 1 79 GLN HB2  H    3.287  -3.638  -1.452 1.00 . A A . 735 GLN HB2  1 1 
        2  2624 1 1 79 GLN HB3  H    4.383  -2.491  -0.690 1.00 . A A . 735 GLN HB3  1 1 
        2  2625 1 1 79 GLN HE21 H    4.027  -1.039  -1.693 1.00 . A A . 735 GLN HE21 1 1 
        2  2626 1 1 79 GLN HE22 H    3.647  -0.209  -3.152 1.00 . A A . 735 GLN HE22 1 1 
        2  2627 1 1 79 GLN HG2  H    6.073  -3.010  -2.428 1.00 . A A . 735 GLN HG2  1 1 
        2  2628 1 1 79 GLN HG3  H    4.901  -4.064  -3.214 1.00 . A A . 735 GLN HG3  1 1 
        2  2629 1 1 79 GLN N    N    4.413  -4.532   0.944 1.00 . A A . 735 GLN N    1 1 
        2  2630 1 1 79 GLN NE2  N    4.004  -0.977  -2.668 1.00 . A A . 735 GLN NE2  1 1 
        2  2631 1 1 79 GLN O    O    7.021  -3.564   0.310 1.00 . A A . 735 GLN O    1 1 
        2  2632 1 1 79 GLN OE1  O    4.488  -1.960  -4.602 1.00 . A A . 735 GLN OE1  1 1 
        2  2633 1 1 80 THR C    C    9.077  -4.285  -2.499 1.00 . A A . 736 THR C    1 1 
        2  2634 1 1 80 THR CA   C    8.630  -5.160  -1.319 1.00 . A A . 736 THR CA   1 1 
        2  2635 1 1 80 THR CB   C    9.235  -6.577  -1.495 1.00 . A A . 736 THR CB   1 1 
        2  2636 1 1 80 THR CG2  C   10.758  -6.531  -1.574 1.00 . A A . 736 THR CG2  1 1 
        2  2637 1 1 80 THR H    H    6.672  -5.881  -1.750 1.00 . A A . 736 THR H    1 1 
        2  2638 1 1 80 THR HA   H    9.018  -4.739  -0.399 1.00 . A A . 736 THR HA   1 1 
        2  2639 1 1 80 THR HB   H    8.856  -7.002  -2.417 1.00 . A A . 736 THR HB   1 1 
        2  2640 1 1 80 THR HG1  H    8.377  -8.192  -0.748 1.00 . A A . 736 THR HG1  1 1 
        2  2641 1 1 80 THR HG21 H   11.060  -5.924  -2.416 1.00 . A A . 736 THR HG21 1 1 
        2  2642 1 1 80 THR HG22 H   11.144  -7.532  -1.699 1.00 . A A . 736 THR HG22 1 1 
        2  2643 1 1 80 THR HG23 H   11.154  -6.104  -0.665 1.00 . A A . 736 THR HG23 1 1 
        2  2644 1 1 80 THR N    N    7.162  -5.215  -1.217 1.00 . A A . 736 THR N    1 1 
        2  2645 1 1 80 THR O    O    8.995  -4.700  -3.655 1.00 . A A . 736 THR O    1 1 
        2  2646 1 1 80 THR OG1  O    8.844  -7.420  -0.401 1.00 . A A . 736 THR OG1  1 1 
        2  2647 1 1 81 VAL C    C   11.559  -2.177  -3.358 1.00 . A A . 737 VAL C    1 1 
        2  2648 1 1 81 VAL CA   C   10.020  -2.162  -3.255 1.00 . A A . 737 VAL CA   1 1 
        2  2649 1 1 81 VAL CB   C    9.537  -0.709  -3.000 1.00 . A A . 737 VAL CB   1 1 
        2  2650 1 1 81 VAL CG1  C    9.965   0.216  -4.139 1.00 . A A . 737 VAL CG1  1 1 
        2  2651 1 1 81 VAL CG2  C    8.021  -0.665  -2.807 1.00 . A A . 737 VAL CG2  1 1 
        2  2652 1 1 81 VAL H    H    9.571  -2.781  -1.270 1.00 . A A . 737 VAL H    1 1 
        2  2653 1 1 81 VAL HA   H    9.605  -2.493  -4.199 1.00 . A A . 737 VAL HA   1 1 
        2  2654 1 1 81 VAL HB   H   10.002  -0.354  -2.088 1.00 . A A . 737 VAL HB   1 1 
        2  2655 1 1 81 VAL HG11 H    9.544  -0.139  -5.069 1.00 . A A . 737 VAL HG11 1 1 
        2  2656 1 1 81 VAL HG12 H   11.043   0.224  -4.213 1.00 . A A . 737 VAL HG12 1 1 
        2  2657 1 1 81 VAL HG13 H    9.611   1.218  -3.943 1.00 . A A . 737 VAL HG13 1 1 
        2  2658 1 1 81 VAL HG21 H    7.745  -1.268  -1.953 1.00 . A A . 737 VAL HG21 1 1 
        2  2659 1 1 81 VAL HG22 H    7.531  -1.050  -3.691 1.00 . A A . 737 VAL HG22 1 1 
        2  2660 1 1 81 VAL HG23 H    7.706   0.356  -2.640 1.00 . A A . 737 VAL HG23 1 1 
        2  2661 1 1 81 VAL N    N    9.547  -3.075  -2.208 1.00 . A A . 737 VAL N    1 1 
        2  2662 1 1 81 VAL O    O   12.252  -1.610  -2.514 1.00 . A A . 737 VAL O    1 1 
        2  2663 1 1 82 THR C    C   14.024  -1.804  -5.561 1.00 . A A . 738 THR C    1 1 
        2  2664 1 1 82 THR CA   C   13.544  -2.902  -4.599 1.00 . A A . 738 THR CA   1 1 
        2  2665 1 1 82 THR CB   C   13.983  -4.291  -5.140 1.00 . A A . 738 THR CB   1 1 
        2  2666 1 1 82 THR CG2  C   15.456  -4.295  -5.549 1.00 . A A . 738 THR CG2  1 1 
        2  2667 1 1 82 THR H    H   11.492  -3.285  -5.024 1.00 . A A . 738 THR H    1 1 
        2  2668 1 1 82 THR HA   H   14.022  -2.753  -3.637 1.00 . A A . 738 THR HA   1 1 
        2  2669 1 1 82 THR HB   H   13.383  -4.524  -6.009 1.00 . A A . 738 THR HB   1 1 
        2  2670 1 1 82 THR HG1  H   14.297  -5.108  -3.359 1.00 . A A . 738 THR HG1  1 1 
        2  2671 1 1 82 THR HG21 H   15.616  -3.565  -6.330 1.00 . A A . 738 THR HG21 1 1 
        2  2672 1 1 82 THR HG22 H   15.724  -5.276  -5.915 1.00 . A A . 738 THR HG22 1 1 
        2  2673 1 1 82 THR HG23 H   16.071  -4.050  -4.694 1.00 . A A . 738 THR HG23 1 1 
        2  2674 1 1 82 THR N    N   12.089  -2.835  -4.388 1.00 . A A . 738 THR N    1 1 
        2  2675 1 1 82 THR O    O   13.630  -1.763  -6.729 1.00 . A A . 738 THR O    1 1 
        2  2676 1 1 82 THR OG1  O   13.761  -5.306  -4.142 1.00 . A A . 738 THR OG1  1 1 
        2  2677 1 1 83 VAL C    C   16.830  -0.144  -6.382 1.00 . A A . 739 VAL C    1 1 
        2  2678 1 1 83 VAL CA   C   15.422   0.187  -5.856 1.00 . A A . 739 VAL CA   1 1 
        2  2679 1 1 83 VAL CB   C   15.488   1.501  -5.031 1.00 . A A . 739 VAL CB   1 1 
        2  2680 1 1 83 VAL CG1  C   15.967   2.667  -5.896 1.00 . A A . 739 VAL CG1  1 1 
        2  2681 1 1 83 VAL CG2  C   14.135   1.813  -4.393 1.00 . A A . 739 VAL CG2  1 1 
        2  2682 1 1 83 VAL H    H   15.130  -0.985  -4.114 1.00 . A A . 739 VAL H    1 1 
        2  2683 1 1 83 VAL HA   H   14.762   0.351  -6.698 1.00 . A A . 739 VAL HA   1 1 
        2  2684 1 1 83 VAL HB   H   16.208   1.359  -4.236 1.00 . A A . 739 VAL HB   1 1 
        2  2685 1 1 83 VAL HG11 H   16.012   3.567  -5.298 1.00 . A A . 739 VAL HG11 1 1 
        2  2686 1 1 83 VAL HG12 H   15.282   2.815  -6.718 1.00 . A A . 739 VAL HG12 1 1 
        2  2687 1 1 83 VAL HG13 H   16.951   2.446  -6.286 1.00 . A A . 739 VAL HG13 1 1 
        2  2688 1 1 83 VAL HG21 H   14.210   2.722  -3.811 1.00 . A A . 739 VAL HG21 1 1 
        2  2689 1 1 83 VAL HG22 H   13.843   0.998  -3.747 1.00 . A A . 739 VAL HG22 1 1 
        2  2690 1 1 83 VAL HG23 H   13.391   1.942  -5.167 1.00 . A A . 739 VAL HG23 1 1 
        2  2691 1 1 83 VAL N    N   14.873  -0.912  -5.056 1.00 . A A . 739 VAL N    1 1 
        2  2692 1 1 83 VAL O    O   17.767  -0.355  -5.607 1.00 . A A . 739 VAL O    1 1 
        2  2693 1 1 84 LYS C    C   18.799   0.940  -8.913 1.00 . A A . 740 LYS C    1 1 
        2  2694 1 1 84 LYS CA   C   18.270  -0.390  -8.355 1.00 . A A . 740 LYS CA   1 1 
        2  2695 1 1 84 LYS CB   C   18.155  -1.424  -9.482 1.00 . A A . 740 LYS CB   1 1 
        2  2696 1 1 84 LYS CD   C   17.726  -3.813 -10.155 1.00 . A A . 740 LYS CD   1 1 
        2  2697 1 1 84 LYS CE   C   17.320  -5.207  -9.696 1.00 . A A . 740 LYS CE   1 1 
        2  2698 1 1 84 LYS CG   C   17.702  -2.804  -9.014 1.00 . A A . 740 LYS CG   1 1 
        2  2699 1 1 84 LYS H    H   16.169  -0.100  -8.261 1.00 . A A . 740 LYS H    1 1 
        2  2700 1 1 84 LYS HA   H   18.966  -0.754  -7.611 1.00 . A A . 740 LYS HA   1 1 
        2  2701 1 1 84 LYS HB2  H   17.443  -1.066 -10.214 1.00 . A A . 740 LYS HB2  1 1 
        2  2702 1 1 84 LYS HB3  H   19.121  -1.529  -9.957 1.00 . A A . 740 LYS HB3  1 1 
        2  2703 1 1 84 LYS HD2  H   17.044  -3.489 -10.927 1.00 . A A . 740 LYS HD2  1 1 
        2  2704 1 1 84 LYS HD3  H   18.729  -3.858 -10.559 1.00 . A A . 740 LYS HD3  1 1 
        2  2705 1 1 84 LYS HE2  H   17.943  -5.496  -8.861 1.00 . A A . 740 LYS HE2  1 1 
        2  2706 1 1 84 LYS HE3  H   16.285  -5.185  -9.383 1.00 . A A . 740 LYS HE3  1 1 
        2  2707 1 1 84 LYS HG2  H   18.365  -3.143  -8.230 1.00 . A A . 740 LYS HG2  1 1 
        2  2708 1 1 84 LYS HG3  H   16.694  -2.732  -8.627 1.00 . A A . 740 LYS HG3  1 1 
        2  2709 1 1 84 LYS HZ1  H   16.867  -5.964 -11.589 1.00 . A A . 740 LYS HZ1  1 1 
        2  2710 1 1 84 LYS HZ2  H   17.219  -7.153 -10.442 1.00 . A A . 740 LYS HZ2  1 1 
        2  2711 1 1 84 LYS HZ3  H   18.467  -6.228 -11.110 1.00 . A A . 740 LYS HZ3  1 1 
        2  2712 1 1 84 LYS N    N   16.968  -0.193  -7.704 1.00 . A A . 740 LYS N    1 1 
        2  2713 1 1 84 LYS NZ   N   17.478  -6.207 -10.784 1.00 . A A . 740 LYS NZ   1 1 
        2  2714 1 1 84 LYS O    O   18.118   1.958  -8.852 1.00 . A A . 740 LYS O    1 1 
        2  2715 1 1 85 VAL C    C   20.485   2.255 -11.521 1.00 . A A . 741 VAL C    1 1 
        2  2716 1 1 85 VAL CA   C   20.610   2.170  -9.989 1.00 . A A . 741 VAL CA   1 1 
        2  2717 1 1 85 VAL CB   C   22.107   2.280  -9.600 1.00 . A A . 741 VAL CB   1 1 
        2  2718 1 1 85 VAL CG1  C   22.684   3.628 -10.034 1.00 . A A . 741 VAL CG1  1 1 
        2  2719 1 1 85 VAL CG2  C   22.295   2.057  -8.097 1.00 . A A . 741 VAL CG2  1 1 
        2  2720 1 1 85 VAL H    H   20.509   0.093  -9.518 1.00 . A A . 741 VAL H    1 1 
        2  2721 1 1 85 VAL HA   H   20.087   3.010  -9.553 1.00 . A A . 741 VAL HA   1 1 
        2  2722 1 1 85 VAL HB   H   22.648   1.503 -10.124 1.00 . A A . 741 VAL HB   1 1 
        2  2723 1 1 85 VAL HG11 H   23.733   3.672  -9.783 1.00 . A A . 741 VAL HG11 1 1 
        2  2724 1 1 85 VAL HG12 H   22.160   4.424  -9.527 1.00 . A A . 741 VAL HG12 1 1 
        2  2725 1 1 85 VAL HG13 H   22.565   3.745 -11.102 1.00 . A A . 741 VAL HG13 1 1 
        2  2726 1 1 85 VAL HG21 H   23.346   2.110  -7.852 1.00 . A A . 741 VAL HG21 1 1 
        2  2727 1 1 85 VAL HG22 H   21.912   1.084  -7.826 1.00 . A A . 741 VAL HG22 1 1 
        2  2728 1 1 85 VAL HG23 H   21.760   2.817  -7.547 1.00 . A A . 741 VAL HG23 1 1 
        2  2729 1 1 85 VAL N    N   20.007   0.937  -9.461 1.00 . A A . 741 VAL N    1 1 
        2  2730 1 1 85 VAL O    O   20.952   1.374 -12.239 1.00 . A A . 741 VAL O    1 1 
        2  2731 1 1 86 ARG C    C   20.920   4.428 -13.959 1.00 . A A . 742 ARG C    1 1 
        2  2732 1 1 86 ARG CA   C   19.755   3.552 -13.468 1.00 . A A . 742 ARG CA   1 1 
        2  2733 1 1 86 ARG CB   C   18.411   4.209 -13.840 1.00 . A A . 742 ARG CB   1 1 
        2  2734 1 1 86 ARG CD   C   16.988   6.317 -13.841 1.00 . A A . 742 ARG CD   1 1 
        2  2735 1 1 86 ARG CG   C   18.252   5.636 -13.324 1.00 . A A . 742 ARG CG   1 1 
        2  2736 1 1 86 ARG CZ   C   16.117   8.608 -13.850 1.00 . A A . 742 ARG CZ   1 1 
        2  2737 1 1 86 ARG H    H   19.437   3.959 -11.401 1.00 . A A . 742 ARG H    1 1 
        2  2738 1 1 86 ARG HA   H   19.819   2.589 -13.958 1.00 . A A . 742 ARG HA   1 1 
        2  2739 1 1 86 ARG HB2  H   18.320   4.228 -14.918 1.00 . A A . 742 ARG HB2  1 1 
        2  2740 1 1 86 ARG HB3  H   17.608   3.610 -13.436 1.00 . A A . 742 ARG HB3  1 1 
        2  2741 1 1 86 ARG HD2  H   16.820   6.015 -14.866 1.00 . A A . 742 ARG HD2  1 1 
        2  2742 1 1 86 ARG HD3  H   16.149   6.011 -13.231 1.00 . A A . 742 ARG HD3  1 1 
        2  2743 1 1 86 ARG HE   H   18.015   8.144 -13.737 1.00 . A A . 742 ARG HE   1 1 
        2  2744 1 1 86 ARG HG2  H   18.215   5.614 -12.244 1.00 . A A . 742 ARG HG2  1 1 
        2  2745 1 1 86 ARG HG3  H   19.110   6.214 -13.637 1.00 . A A . 742 ARG HG3  1 1 
        2  2746 1 1 86 ARG HH11 H   14.694   7.213 -13.767 1.00 . A A . 742 ARG HH11 1 1 
        2  2747 1 1 86 ARG HH12 H   14.142   8.848 -13.891 1.00 . A A . 742 ARG HH12 1 1 
        2  2748 1 1 86 ARG HH21 H   17.304  10.198 -13.859 1.00 . A A . 742 ARG HH21 1 1 
        2  2749 1 1 86 ARG HH22 H   15.606  10.525 -13.935 1.00 . A A . 742 ARG HH22 1 1 
        2  2750 1 1 86 ARG N    N   19.851   3.321 -12.017 1.00 . A A . 742 ARG N    1 1 
        2  2751 1 1 86 ARG NE   N   17.112   7.770 -13.791 1.00 . A A . 742 ARG NE   1 1 
        2  2752 1 1 86 ARG NH1  N   14.891   8.190 -13.837 1.00 . A A . 742 ARG NH1  1 1 
        2  2753 1 1 86 ARG NH2  N   16.359   9.873 -13.884 1.00 . A A . 742 ARG NH2  1 1 
        2  2754 1 1 86 ARG O    O   21.556   4.131 -14.968 1.00 . A A . 742 ARG O    1 1 
        2  2755 1 1 87 GLU C    C   23.227   6.619 -12.410 1.00 . A A . 743 GLU C    1 1 
        2  2756 1 1 87 GLU CA   C   22.245   6.463 -13.579 1.00 . A A . 743 GLU CA   1 1 
        2  2757 1 1 87 GLU CB   C   21.626   7.821 -13.958 1.00 . A A . 743 GLU CB   1 1 
        2  2758 1 1 87 GLU CD   C   19.853   9.026 -15.342 1.00 . A A . 743 GLU CD   1 1 
        2  2759 1 1 87 GLU CG   C   20.594   7.724 -15.085 1.00 . A A . 743 GLU CG   1 1 
        2  2760 1 1 87 GLU H    H   20.653   5.679 -12.423 1.00 . A A . 743 GLU H    1 1 
        2  2761 1 1 87 GLU HA   H   22.781   6.071 -14.432 1.00 . A A . 743 GLU HA   1 1 
        2  2762 1 1 87 GLU HB2  H   21.141   8.239 -13.086 1.00 . A A . 743 GLU HB2  1 1 
        2  2763 1 1 87 GLU HB3  H   22.414   8.489 -14.275 1.00 . A A . 743 GLU HB3  1 1 
        2  2764 1 1 87 GLU HG2  H   21.101   7.431 -15.993 1.00 . A A . 743 GLU HG2  1 1 
        2  2765 1 1 87 GLU HG3  H   19.870   6.964 -14.826 1.00 . A A . 743 GLU HG3  1 1 
        2  2766 1 1 87 GLU N    N   21.185   5.512 -13.227 1.00 . A A . 743 GLU N    1 1 
        2  2767 1 1 87 GLU O    O   22.983   7.377 -11.467 1.00 . A A . 743 GLU O    1 1 
        2  2768 1 1 87 GLU OE1  O   19.252   9.574 -14.391 1.00 . A A . 743 GLU OE1  1 1 
        2  2769 1 1 87 GLU OE2  O   19.857   9.504 -16.495 1.00 . A A . 743 GLU OE2  1 1 
        2  2770 1 1 88 GLU C    C   25.937   7.203 -11.109 1.00 . A A . 744 GLU C    1 1 
        2  2771 1 1 88 GLU CA   C   25.318   5.824 -11.396 1.00 . A A . 744 GLU CA   1 1 
        2  2772 1 1 88 GLU CB   C   26.425   4.795 -11.715 1.00 . A A . 744 GLU CB   1 1 
        2  2773 1 1 88 GLU CD   C   26.347   4.828 -14.272 1.00 . A A . 744 GLU CD   1 1 
        2  2774 1 1 88 GLU CG   C   27.192   5.037 -13.019 1.00 . A A . 744 GLU CG   1 1 
        2  2775 1 1 88 GLU H    H   24.463   5.320 -13.271 1.00 . A A . 744 GLU H    1 1 
        2  2776 1 1 88 GLU HA   H   24.804   5.498 -10.503 1.00 . A A . 744 GLU HA   1 1 
        2  2777 1 1 88 GLU HB2  H   27.139   4.798 -10.904 1.00 . A A . 744 GLU HB2  1 1 
        2  2778 1 1 88 GLU HB3  H   25.974   3.814 -11.770 1.00 . A A . 744 GLU HB3  1 1 
        2  2779 1 1 88 GLU HG2  H   27.563   6.052 -13.018 1.00 . A A . 744 GLU HG2  1 1 
        2  2780 1 1 88 GLU HG3  H   28.033   4.356 -13.056 1.00 . A A . 744 GLU HG3  1 1 
        2  2781 1 1 88 GLU N    N   24.321   5.867 -12.473 1.00 . A A . 744 GLU N    1 1 
        2  2782 1 1 88 GLU O    O   26.304   7.946 -12.023 1.00 . A A . 744 GLU O    1 1 
        2  2783 1 1 88 GLU OE1  O   25.916   3.683 -14.527 1.00 . A A . 744 GLU OE1  1 1 
        2  2784 1 1 88 GLU OE2  O   26.087   5.811 -14.997 1.00 . A A . 744 GLU OE2  1 1 
        2  2785 1 1 89 VAL C    C   28.143   8.770  -9.376 1.00 . A A . 745 VAL C    1 1 
        2  2786 1 1 89 VAL CA   C   26.605   8.825  -9.402 1.00 . A A . 745 VAL CA   1 1 
        2  2787 1 1 89 VAL CB   C   26.077   9.243  -8.005 1.00 . A A . 745 VAL CB   1 1 
        2  2788 1 1 89 VAL CG1  C   26.614  10.617  -7.605 1.00 . A A . 745 VAL CG1  1 1 
        2  2789 1 1 89 VAL CG2  C   24.549   9.234  -7.986 1.00 . A A . 745 VAL CG2  1 1 
        2  2790 1 1 89 VAL H    H   25.719   6.914  -9.144 1.00 . A A . 745 VAL H    1 1 
        2  2791 1 1 89 VAL HA   H   26.296   9.576 -10.118 1.00 . A A . 745 VAL HA   1 1 
        2  2792 1 1 89 VAL HB   H   26.428   8.520  -7.280 1.00 . A A . 745 VAL HB   1 1 
        2  2793 1 1 89 VAL HG11 H   26.270  11.360  -8.312 1.00 . A A . 745 VAL HG11 1 1 
        2  2794 1 1 89 VAL HG12 H   27.694  10.598  -7.605 1.00 . A A . 745 VAL HG12 1 1 
        2  2795 1 1 89 VAL HG13 H   26.261  10.873  -6.615 1.00 . A A . 745 VAL HG13 1 1 
        2  2796 1 1 89 VAL HG21 H   24.190   8.239  -8.204 1.00 . A A . 745 VAL HG21 1 1 
        2  2797 1 1 89 VAL HG22 H   24.176   9.924  -8.730 1.00 . A A . 745 VAL HG22 1 1 
        2  2798 1 1 89 VAL HG23 H   24.197   9.536  -7.010 1.00 . A A . 745 VAL HG23 1 1 
        2  2799 1 1 89 VAL N    N   26.036   7.541  -9.825 1.00 . A A . 745 VAL N    1 1 
        2  2800 1 1 89 VAL O    O   28.733   7.845  -8.820 1.00 . A A . 745 VAL O    1 1 
        2  2801 1 1 90 LYS C    C   30.902  10.399  -8.808 1.00 . A A . 746 LYS C    1 1 
        2  2802 1 1 90 LYS CA   C   30.248   9.823 -10.078 1.00 . A A . 746 LYS CA   1 1 
        2  2803 1 1 90 LYS CB   C   30.638  10.678 -11.290 1.00 . A A . 746 LYS CB   1 1 
        2  2804 1 1 90 LYS CD   C   30.436  12.916 -12.464 1.00 . A A . 746 LYS CD   1 1 
        2  2805 1 1 90 LYS CE   C   29.598  12.388 -13.622 1.00 . A A . 746 LYS CE   1 1 
        2  2806 1 1 90 LYS CG   C   30.187  12.135 -11.179 1.00 . A A . 746 LYS CG   1 1 
        2  2807 1 1 90 LYS H    H   28.251  10.490 -10.383 1.00 . A A . 746 LYS H    1 1 
        2  2808 1 1 90 LYS HA   H   30.612   8.816 -10.230 1.00 . A A . 746 LYS HA   1 1 
        2  2809 1 1 90 LYS HB2  H   31.715  10.661 -11.398 1.00 . A A . 746 LYS HB2  1 1 
        2  2810 1 1 90 LYS HB3  H   30.191  10.249 -12.175 1.00 . A A . 746 LYS HB3  1 1 
        2  2811 1 1 90 LYS HD2  H   30.183  13.954 -12.297 1.00 . A A . 746 LYS HD2  1 1 
        2  2812 1 1 90 LYS HD3  H   31.483  12.839 -12.724 1.00 . A A . 746 LYS HD3  1 1 
        2  2813 1 1 90 LYS HE2  H   29.900  11.371 -13.835 1.00 . A A . 746 LYS HE2  1 1 
        2  2814 1 1 90 LYS HE3  H   28.554  12.398 -13.334 1.00 . A A . 746 LYS HE3  1 1 
        2  2815 1 1 90 LYS HG2  H   29.129  12.159 -10.958 1.00 . A A . 746 LYS HG2  1 1 
        2  2816 1 1 90 LYS HG3  H   30.730  12.608 -10.373 1.00 . A A . 746 LYS HG3  1 1 
        2  2817 1 1 90 LYS HZ1  H   30.773  13.270 -15.100 1.00 . A A . 746 LYS HZ1  1 1 
        2  2818 1 1 90 LYS HZ2  H   29.399  14.166 -14.696 1.00 . A A . 746 LYS HZ2  1 1 
        2  2819 1 1 90 LYS HZ3  H   29.253  12.776 -15.643 1.00 . A A . 746 LYS HZ3  1 1 
        2  2820 1 1 90 LYS N    N   28.780   9.768  -9.978 1.00 . A A . 746 LYS N    1 1 
        2  2821 1 1 90 LYS NZ   N   29.770  13.206 -14.850 1.00 . A A . 746 LYS NZ   1 1 
        2  2822 1 1 90 LYS O    O   32.094  10.711  -8.798 1.00 . A A . 746 LYS O    1 1 
        2  2823 1 1 91 ASN C    C   30.483  10.212  -5.289 1.00 . A A . 747 ASN C    1 1 
        2  2824 1 1 91 ASN CA   C   30.608  11.156  -6.498 1.00 . A A . 747 ASN CA   1 1 
        2  2825 1 1 91 ASN CB   C   29.831  12.448  -6.234 1.00 . A A . 747 ASN CB   1 1 
        2  2826 1 1 91 ASN CG   C   29.787  13.362  -7.447 1.00 . A A . 747 ASN CG   1 1 
        2  2827 1 1 91 ASN H    H   29.209  10.197  -7.774 1.00 . A A . 747 ASN H    1 1 
        2  2828 1 1 91 ASN HA   H   31.653  11.403  -6.636 1.00 . A A . 747 ASN HA   1 1 
        2  2829 1 1 91 ASN HB2  H   28.813  12.201  -5.957 1.00 . A A . 747 ASN HB2  1 1 
        2  2830 1 1 91 ASN HB3  H   30.296  12.984  -5.417 1.00 . A A . 747 ASN HB3  1 1 
        2  2831 1 1 91 ASN HD21 H   31.451  14.279  -6.882 1.00 . A A . 747 ASN HD21 1 1 
        2  2832 1 1 91 ASN HD22 H   30.733  14.846  -8.345 1.00 . A A . 747 ASN HD22 1 1 
        2  2833 1 1 91 ASN N    N   30.126  10.528  -7.735 1.00 . A A . 747 ASN N    1 1 
        2  2834 1 1 91 ASN ND2  N   30.756  14.246  -7.572 1.00 . A A . 747 ASN ND2  1 1 
        2  2835 1 1 91 ASN O    O   29.409  10.071  -4.705 1.00 . A A . 747 ASN O    1 1 
        2  2836 1 1 91 ASN OD1  O   28.885  13.272  -8.273 1.00 . A A . 747 ASN OD1  1 1 
        2  2837 1 1 92 ASP C    C   32.038   9.452  -2.477 1.00 . A A . 748 ASP C    1 1 
        2  2838 1 1 92 ASP CA   C   31.610   8.682  -3.746 1.00 . A A . 748 ASP CA   1 1 
        2  2839 1 1 92 ASP CB   C   32.549   7.498  -4.013 1.00 . A A . 748 ASP CB   1 1 
        2  2840 1 1 92 ASP CG   C   32.543   6.471  -2.893 1.00 . A A . 748 ASP CG   1 1 
        2  2841 1 1 92 ASP H    H   32.404   9.668  -5.457 1.00 . A A . 748 ASP H    1 1 
        2  2842 1 1 92 ASP HA   H   30.606   8.305  -3.596 1.00 . A A . 748 ASP HA   1 1 
        2  2843 1 1 92 ASP HB2  H   32.243   7.006  -4.926 1.00 . A A . 748 ASP HB2  1 1 
        2  2844 1 1 92 ASP HB3  H   33.557   7.871  -4.135 1.00 . A A . 748 ASP HB3  1 1 
        2  2845 1 1 92 ASP N    N   31.586   9.565  -4.921 1.00 . A A . 748 ASP N    1 1 
        2  2846 1 1 92 ASP O    O   32.035   8.913  -1.367 1.00 . A A . 748 ASP O    1 1 
        2  2847 1 1 92 ASP OD1  O   31.468   5.906  -2.602 1.00 . A A . 748 ASP OD1  1 1 
        2  2848 1 1 92 ASP OD2  O   33.614   6.223  -2.301 1.00 . A A . 748 ASP OD2  1 1 
        2  2849 1 1 93 LYS C    C   31.562  11.904  -0.636 1.00 . A A . 749 LYS C    1 1 
        2  2850 1 1 93 LYS CA   C   32.780  11.585  -1.523 1.00 . A A . 749 LYS CA   1 1 
        2  2851 1 1 93 LYS CB   C   33.424  12.889  -2.039 1.00 . A A . 749 LYS CB   1 1 
        2  2852 1 1 93 LYS CD   C   34.828  11.941  -3.937 1.00 . A A . 749 LYS CD   1 1 
        2  2853 1 1 93 LYS CE   C   36.238  11.762  -4.487 1.00 . A A . 749 LYS CE   1 1 
        2  2854 1 1 93 LYS CG   C   34.829  12.716  -2.619 1.00 . A A . 749 LYS CG   1 1 
        2  2855 1 1 93 LYS H    H   32.409  11.091  -3.557 1.00 . A A . 749 LYS H    1 1 
        2  2856 1 1 93 LYS HA   H   33.507  11.049  -0.930 1.00 . A A . 749 LYS HA   1 1 
        2  2857 1 1 93 LYS HB2  H   32.791  13.307  -2.808 1.00 . A A . 749 LYS HB2  1 1 
        2  2858 1 1 93 LYS HB3  H   33.484  13.592  -1.219 1.00 . A A . 749 LYS HB3  1 1 
        2  2859 1 1 93 LYS HD2  H   34.391  10.966  -3.769 1.00 . A A . 749 LYS HD2  1 1 
        2  2860 1 1 93 LYS HD3  H   34.233  12.481  -4.661 1.00 . A A . 749 LYS HD3  1 1 
        2  2861 1 1 93 LYS HE2  H   36.697  12.734  -4.593 1.00 . A A . 749 LYS HE2  1 1 
        2  2862 1 1 93 LYS HE3  H   36.813  11.167  -3.791 1.00 . A A . 749 LYS HE3  1 1 
        2  2863 1 1 93 LYS HG2  H   35.254  13.694  -2.795 1.00 . A A . 749 LYS HG2  1 1 
        2  2864 1 1 93 LYS HG3  H   35.439  12.185  -1.902 1.00 . A A . 749 LYS HG3  1 1 
        2  2865 1 1 93 LYS HZ1  H   35.723  11.665  -6.506 1.00 . A A . 749 LYS HZ1  1 1 
        2  2866 1 1 93 LYS HZ2  H   35.768  10.159  -5.741 1.00 . A A . 749 LYS HZ2  1 1 
        2  2867 1 1 93 LYS HZ3  H   37.207  10.946  -6.148 1.00 . A A . 749 LYS HZ3  1 1 
        2  2868 1 1 93 LYS N    N   32.401  10.721  -2.651 1.00 . A A . 749 LYS N    1 1 
        2  2869 1 1 93 LYS NZ   N   36.235  11.086  -5.812 1.00 . A A . 749 LYS NZ   1 1 
        2  2870 1 1 93 LYS O    O   30.417  11.780  -1.077 1.00 . A A . 749 LYS O    1 1 
        2  2871 1 1 94 PRO C    C   29.934  13.935   1.139 1.00 . A A . 750 PRO C    1 1 
        2  2872 1 1 94 PRO CA   C   30.689  12.657   1.556 1.00 . A A . 750 PRO CA   1 1 
        2  2873 1 1 94 PRO CB   C   31.401  12.847   2.905 1.00 . A A . 750 PRO CB   1 1 
        2  2874 1 1 94 PRO CD   C   33.112  12.471   1.274 1.00 . A A . 750 PRO CD   1 1 
        2  2875 1 1 94 PRO CG   C   32.801  13.219   2.544 1.00 . A A . 750 PRO CG   1 1 
        2  2876 1 1 94 PRO HA   H   29.980  11.843   1.634 1.00 . A A . 750 PRO HA   1 1 
        2  2877 1 1 94 PRO HB2  H   30.915  13.629   3.472 1.00 . A A . 750 PRO HB2  1 1 
        2  2878 1 1 94 PRO HB3  H   31.372  11.922   3.463 1.00 . A A . 750 PRO HB3  1 1 
        2  2879 1 1 94 PRO HD2  H   33.778  13.048   0.648 1.00 . A A . 750 PRO HD2  1 1 
        2  2880 1 1 94 PRO HD3  H   33.544  11.507   1.500 1.00 . A A . 750 PRO HD3  1 1 
        2  2881 1 1 94 PRO HG2  H   32.870  14.287   2.381 1.00 . A A . 750 PRO HG2  1 1 
        2  2882 1 1 94 PRO HG3  H   33.476  12.918   3.332 1.00 . A A . 750 PRO HG3  1 1 
        2  2883 1 1 94 PRO N    N   31.786  12.314   0.633 1.00 . A A . 750 PRO N    1 1 
        2  2884 1 1 94 PRO O    O   30.094  14.997   1.743 1.00 . A A . 750 PRO O    1 1 
        2  2885 1 1 95 ILE C    C   26.880  14.841   0.164 1.00 . A A . 751 ILE C    1 1 
        2  2886 1 1 95 ILE CA   C   28.308  14.946  -0.388 1.00 . A A . 751 ILE CA   1 1 
        2  2887 1 1 95 ILE CB   C   28.270  15.003  -1.937 1.00 . A A . 751 ILE CB   1 1 
        2  2888 1 1 95 ILE CD1  C   29.757  15.288  -4.007 1.00 . A A . 751 ILE CD1  1 1 
        2  2889 1 1 95 ILE CG1  C   29.694  15.185  -2.496 1.00 . A A . 751 ILE CG1  1 1 
        2  2890 1 1 95 ILE CG2  C   27.344  16.122  -2.421 1.00 . A A . 751 ILE CG2  1 1 
        2  2891 1 1 95 ILE H    H   29.079  12.970  -0.390 1.00 . A A . 751 ILE H    1 1 
        2  2892 1 1 95 ILE HA   H   28.755  15.865  -0.026 1.00 . A A . 751 ILE HA   1 1 
        2  2893 1 1 95 ILE HB   H   27.870  14.063  -2.294 1.00 . A A . 751 ILE HB   1 1 
        2  2894 1 1 95 ILE HD11 H   29.196  16.151  -4.335 1.00 . A A . 751 ILE HD11 1 1 
        2  2895 1 1 95 ILE HD12 H   29.336  14.395  -4.447 1.00 . A A . 751 ILE HD12 1 1 
        2  2896 1 1 95 ILE HD13 H   30.786  15.389  -4.317 1.00 . A A . 751 ILE HD13 1 1 
        2  2897 1 1 95 ILE HG12 H   30.122  16.088  -2.088 1.00 . A A . 751 ILE HG12 1 1 
        2  2898 1 1 95 ILE HG13 H   30.298  14.340  -2.197 1.00 . A A . 751 ILE HG13 1 1 
        2  2899 1 1 95 ILE HG21 H   27.715  17.076  -2.075 1.00 . A A . 751 ILE HG21 1 1 
        2  2900 1 1 95 ILE HG22 H   26.347  15.962  -2.033 1.00 . A A . 751 ILE HG22 1 1 
        2  2901 1 1 95 ILE HG23 H   27.309  16.121  -3.501 1.00 . A A . 751 ILE HG23 1 1 
        2  2902 1 1 95 ILE N    N   29.126  13.827   0.085 1.00 . A A . 751 ILE N    1 1 
        2  2903 1 1 95 ILE O    O   26.109  13.962  -0.226 1.00 . A A . 751 ILE O    1 1 
        2  2904 1 1 96 LEU C    C   24.337  16.856   1.243 1.00 . A A . 752 LEU C    1 1 
        2  2905 1 1 96 LEU CA   C   25.238  15.719   1.752 1.00 . A A . 752 LEU CA   1 1 
        2  2906 1 1 96 LEU CB   C   25.438  15.841   3.270 1.00 . A A . 752 LEU CB   1 1 
        2  2907 1 1 96 LEU CD1  C   23.493  14.379   3.940 1.00 . A A . 752 LEU CD1  1 1 
        2  2908 1 1 96 LEU CD2  C   24.475  15.997   5.597 1.00 . A A . 752 LEU CD2  1 1 
        2  2909 1 1 96 LEU CG   C   24.161  15.739   4.123 1.00 . A A . 752 LEU CG   1 1 
        2  2910 1 1 96 LEU H    H   27.193  16.426   1.331 1.00 . A A . 752 LEU H    1 1 
        2  2911 1 1 96 LEU HA   H   24.761  14.773   1.536 1.00 . A A . 752 LEU HA   1 1 
        2  2912 1 1 96 LEU HB2  H   26.119  15.059   3.583 1.00 . A A . 752 LEU HB2  1 1 
        2  2913 1 1 96 LEU HB3  H   25.904  16.795   3.472 1.00 . A A . 752 LEU HB3  1 1 
        2  2914 1 1 96 LEU HD11 H   23.204  14.260   2.907 1.00 . A A . 752 LEU HD11 1 1 
        2  2915 1 1 96 LEU HD12 H   22.614  14.322   4.565 1.00 . A A . 752 LEU HD12 1 1 
        2  2916 1 1 96 LEU HD13 H   24.182  13.594   4.216 1.00 . A A . 752 LEU HD13 1 1 
        2  2917 1 1 96 LEU HD21 H   25.200  15.277   5.948 1.00 . A A . 752 LEU HD21 1 1 
        2  2918 1 1 96 LEU HD22 H   23.570  15.910   6.180 1.00 . A A . 752 LEU HD22 1 1 
        2  2919 1 1 96 LEU HD23 H   24.876  16.994   5.708 1.00 . A A . 752 LEU HD23 1 1 
        2  2920 1 1 96 LEU HG   H   23.459  16.494   3.797 1.00 . A A . 752 LEU HG   1 1 
        2  2921 1 1 96 LEU N    N   26.543  15.734   1.087 1.00 . A A . 752 LEU N    1 1 
        2  2922 1 1 96 LEU O    O   24.803  17.973   0.999 1.00 . A A . 752 LEU O    1 1 
        2  2923 1 1 97 GLU C    C   21.021  17.832   1.724 1.00 . A A . 753 GLU C    1 1 
        2  2924 1 1 97 GLU CA   C   22.062  17.557   0.634 1.00 . A A . 753 GLU CA   1 1 
        2  2925 1 1 97 GLU CB   C   21.361  17.074  -0.645 1.00 . A A . 753 GLU CB   1 1 
        2  2926 1 1 97 GLU CD   C   19.661  17.565  -2.468 1.00 . A A . 753 GLU CD   1 1 
        2  2927 1 1 97 GLU CG   C   20.384  18.089  -1.235 1.00 . A A . 753 GLU CG   1 1 
        2  2928 1 1 97 GLU H    H   22.743  15.649   1.271 1.00 . A A . 753 GLU H    1 1 
        2  2929 1 1 97 GLU HA   H   22.589  18.479   0.418 1.00 . A A . 753 GLU HA   1 1 
        2  2930 1 1 97 GLU HB2  H   22.113  16.856  -1.392 1.00 . A A . 753 GLU HB2  1 1 
        2  2931 1 1 97 GLU HB3  H   20.816  16.168  -0.423 1.00 . A A . 753 GLU HB3  1 1 
        2  2932 1 1 97 GLU HG2  H   19.650  18.342  -0.482 1.00 . A A . 753 GLU HG2  1 1 
        2  2933 1 1 97 GLU HG3  H   20.934  18.980  -1.507 1.00 . A A . 753 GLU HG3  1 1 
        2  2934 1 1 97 GLU N    N   23.046  16.560   1.083 1.00 . A A . 753 GLU N    1 1 
        2  2935 1 1 97 GLU O    O   20.618  16.924   2.461 1.00 . A A . 753 GLU O    1 1 
        2  2936 1 1 97 GLU OE1  O   20.237  17.625  -3.575 1.00 . A A . 753 GLU OE1  1 1 
        2  2937 1 1 97 GLU OE2  O   18.514  17.095  -2.339 1.00 . A A . 753 GLU OE2  1 1 
        2  2938 2 2  1 CA  CA   CA -17.327  -3.866   5.436 1.00 . B A . 762 CA  CA   1 1 
        3  2939 1 1  1 MET C    C  -34.581  -9.119  14.949 1.00 . A A . 657 MET C    1 1 
        3  2940 1 1  1 MET CA   C  -34.079  -7.679  14.788 1.00 . A A . 657 MET CA   1 1 
        3  2941 1 1  1 MET CB   C  -35.114  -6.695  15.359 1.00 . A A . 657 MET CB   1 1 
        3  2942 1 1  1 MET CE   C  -39.136  -5.972  14.443 1.00 . A A . 657 MET CE   1 1 
        3  2943 1 1  1 MET CG   C  -36.483  -6.762  14.685 1.00 . A A . 657 MET CG   1 1 
        3  2944 1 1  1 MET H1   H  -33.463  -6.395  13.255 1.00 . A A . 657 MET H1   1 1 
        3  2945 1 1  1 MET H2   H  -34.653  -7.498  12.782 1.00 . A A . 657 MET H2   1 1 
        3  2946 1 1  1 MET H3   H  -33.058  -8.013  12.993 1.00 . A A . 657 MET H3   1 1 
        3  2947 1 1  1 MET HA   H  -33.153  -7.577  15.338 1.00 . A A . 657 MET HA   1 1 
        3  2948 1 1  1 MET HB2  H  -35.247  -6.905  16.411 1.00 . A A . 657 MET HB2  1 1 
        3  2949 1 1  1 MET HB3  H  -34.733  -5.690  15.249 1.00 . A A . 657 MET HB3  1 1 
        3  2950 1 1  1 MET HE1  H  -39.400  -7.019  14.485 1.00 . A A . 657 MET HE1  1 1 
        3  2951 1 1  1 MET HE2  H  -38.915  -5.698  13.422 1.00 . A A . 657 MET HE2  1 1 
        3  2952 1 1  1 MET HE3  H  -39.962  -5.378  14.802 1.00 . A A . 657 MET HE3  1 1 
        3  2953 1 1  1 MET HG2  H  -36.375  -6.469  13.651 1.00 . A A . 657 MET HG2  1 1 
        3  2954 1 1  1 MET HG3  H  -36.847  -7.780  14.734 1.00 . A A . 657 MET HG3  1 1 
        3  2955 1 1  1 MET N    N  -33.794  -7.373  13.357 1.00 . A A . 657 MET N    1 1 
        3  2956 1 1  1 MET O    O  -34.761  -9.830  13.963 1.00 . A A . 657 MET O    1 1 
        3  2957 1 1  1 MET SD   S  -37.695  -5.677  15.471 1.00 . A A . 657 MET SD   1 1 
        3  2958 1 1  2 GLY C    C  -34.252 -11.978  16.178 1.00 . A A . 658 GLY C    1 1 
        3  2959 1 1  2 GLY CA   C  -35.303 -10.900  16.437 1.00 . A A . 658 GLY CA   1 1 
        3  2960 1 1  2 GLY H    H  -34.645  -8.944  16.950 1.00 . A A . 658 GLY H    1 1 
        3  2961 1 1  2 GLY HA2  H  -35.622 -10.968  17.468 1.00 . A A . 658 GLY HA2  1 1 
        3  2962 1 1  2 GLY HA3  H  -36.156 -11.082  15.799 1.00 . A A . 658 GLY HA3  1 1 
        3  2963 1 1  2 GLY N    N  -34.808  -9.548  16.191 1.00 . A A . 658 GLY N    1 1 
        3  2964 1 1  2 GLY O    O  -33.645 -12.503  17.115 1.00 . A A . 658 GLY O    1 1 
        3  2965 1 1  3 ASN C    C  -32.387 -12.958  13.179 1.00 . A A . 659 ASN C    1 1 
        3  2966 1 1  3 ASN CA   C  -33.067 -13.331  14.511 1.00 . A A . 659 ASN CA   1 1 
        3  2967 1 1  3 ASN CB   C  -33.764 -14.694  14.390 1.00 . A A . 659 ASN CB   1 1 
        3  2968 1 1  3 ASN CG   C  -32.791 -15.835  14.158 1.00 . A A . 659 ASN CG   1 1 
        3  2969 1 1  3 ASN H    H  -34.560 -11.852  14.207 1.00 . A A . 659 ASN H    1 1 
        3  2970 1 1  3 ASN HA   H  -32.307 -13.387  15.281 1.00 . A A . 659 ASN HA   1 1 
        3  2971 1 1  3 ASN HB2  H  -34.309 -14.892  15.303 1.00 . A A . 659 ASN HB2  1 1 
        3  2972 1 1  3 ASN HB3  H  -34.461 -14.662  13.563 1.00 . A A . 659 ASN HB3  1 1 
        3  2973 1 1  3 ASN HD21 H  -34.155 -16.846  13.146 1.00 . A A . 659 ASN HD21 1 1 
        3  2974 1 1  3 ASN HD22 H  -32.614 -17.609  13.309 1.00 . A A . 659 ASN HD22 1 1 
        3  2975 1 1  3 ASN N    N  -34.042 -12.309  14.906 1.00 . A A . 659 ASN N    1 1 
        3  2976 1 1  3 ASN ND2  N  -33.231 -16.866  13.470 1.00 . A A . 659 ASN ND2  1 1 
        3  2977 1 1  3 ASN O    O  -32.933 -12.189  12.385 1.00 . A A . 659 ASN O    1 1 
        3  2978 1 1  3 ASN OD1  O  -31.648 -15.792  14.604 1.00 . A A . 659 ASN OD1  1 1 
        3  2979 1 1  4 GLY C    C  -29.191 -12.419  11.911 1.00 . A A . 660 GLY C    1 1 
        3  2980 1 1  4 GLY CA   C  -30.464 -13.235  11.706 1.00 . A A . 660 GLY CA   1 1 
        3  2981 1 1  4 GLY H    H  -30.781 -14.061  13.636 1.00 . A A . 660 GLY H    1 1 
        3  2982 1 1  4 GLY HA2  H  -30.198 -14.184  11.261 1.00 . A A . 660 GLY HA2  1 1 
        3  2983 1 1  4 GLY HA3  H  -31.112 -12.702  11.023 1.00 . A A . 660 GLY HA3  1 1 
        3  2984 1 1  4 GLY N    N  -31.187 -13.491  12.950 1.00 . A A . 660 GLY N    1 1 
        3  2985 1 1  4 GLY O    O  -29.205 -11.190  11.789 1.00 . A A . 660 GLY O    1 1 
        3  2986 1 1  5 GLU C    C  -26.088 -12.256  11.033 1.00 . A A . 661 GLU C    1 1 
        3  2987 1 1  5 GLU CA   C  -26.795 -12.423  12.393 1.00 . A A . 661 GLU CA   1 1 
        3  2988 1 1  5 GLU CB   C  -25.908 -13.195  13.388 1.00 . A A . 661 GLU CB   1 1 
        3  2989 1 1  5 GLU CD   C  -24.819 -15.395  14.041 1.00 . A A . 661 GLU CD   1 1 
        3  2990 1 1  5 GLU CG   C  -25.563 -14.620  12.962 1.00 . A A . 661 GLU CG   1 1 
        3  2991 1 1  5 GLU H    H  -28.145 -14.065  12.356 1.00 . A A . 661 GLU H    1 1 
        3  2992 1 1  5 GLU HA   H  -26.990 -11.437  12.799 1.00 . A A . 661 GLU HA   1 1 
        3  2993 1 1  5 GLU HB2  H  -24.984 -12.652  13.525 1.00 . A A . 661 GLU HB2  1 1 
        3  2994 1 1  5 GLU HB3  H  -26.425 -13.244  14.338 1.00 . A A . 661 GLU HB3  1 1 
        3  2995 1 1  5 GLU HG2  H  -26.480 -15.143  12.729 1.00 . A A . 661 GLU HG2  1 1 
        3  2996 1 1  5 GLU HG3  H  -24.943 -14.579  12.075 1.00 . A A . 661 GLU HG3  1 1 
        3  2997 1 1  5 GLU N    N  -28.089 -13.094  12.227 1.00 . A A . 661 GLU N    1 1 
        3  2998 1 1  5 GLU O    O  -25.820 -13.235  10.331 1.00 . A A . 661 GLU O    1 1 
        3  2999 1 1  5 GLU OE1  O  -23.644 -15.071  14.317 1.00 . A A . 661 GLU OE1  1 1 
        3  3000 1 1  5 GLU OE2  O  -25.406 -16.342  14.611 1.00 . A A . 661 GLU OE2  1 1 
        3  3001 1 1  6 THR C    C  -23.772 -10.199   9.475 1.00 . A A . 662 THR C    1 1 
        3  3002 1 1  6 THR CA   C  -25.214 -10.703   9.346 1.00 . A A . 662 THR CA   1 1 
        3  3003 1 1  6 THR CB   C  -26.049  -9.648   8.577 1.00 . A A . 662 THR CB   1 1 
        3  3004 1 1  6 THR CG2  C  -27.451 -10.171   8.274 1.00 . A A . 662 THR CG2  1 1 
        3  3005 1 1  6 THR H    H  -25.987 -10.273  11.281 1.00 . A A . 662 THR H    1 1 
        3  3006 1 1  6 THR HA   H  -25.210 -11.614   8.763 1.00 . A A . 662 THR HA   1 1 
        3  3007 1 1  6 THR HB   H  -25.554  -9.433   7.640 1.00 . A A . 662 THR HB   1 1 
        3  3008 1 1  6 THR HG1  H  -26.781  -8.551  10.054 1.00 . A A . 662 THR HG1  1 1 
        3  3009 1 1  6 THR HG21 H  -28.012  -9.413   7.745 1.00 . A A . 662 THR HG21 1 1 
        3  3010 1 1  6 THR HG22 H  -27.955 -10.410   9.199 1.00 . A A . 662 THR HG22 1 1 
        3  3011 1 1  6 THR HG23 H  -27.381 -11.058   7.662 1.00 . A A . 662 THR HG23 1 1 
        3  3012 1 1  6 THR N    N  -25.805 -11.009  10.659 1.00 . A A . 662 THR N    1 1 
        3  3013 1 1  6 THR O    O  -23.480  -9.306  10.273 1.00 . A A . 662 THR O    1 1 
        3  3014 1 1  6 THR OG1  O  -26.144  -8.433   9.337 1.00 . A A . 662 THR OG1  1 1 
        3  3015 1 1  7 SER C    C  -21.036  -9.513   7.575 1.00 . A A . 663 SER C    1 1 
        3  3016 1 1  7 SER CA   C  -21.447 -10.436   8.731 1.00 . A A . 663 SER CA   1 1 
        3  3017 1 1  7 SER CB   C  -20.601 -11.718   8.680 1.00 . A A . 663 SER CB   1 1 
        3  3018 1 1  7 SER H    H  -23.177 -11.463   8.051 1.00 . A A . 663 SER H    1 1 
        3  3019 1 1  7 SER HA   H  -21.254  -9.932   9.667 1.00 . A A . 663 SER HA   1 1 
        3  3020 1 1  7 SER HB2  H  -20.769 -12.221   7.739 1.00 . A A . 663 SER HB2  1 1 
        3  3021 1 1  7 SER HB3  H  -19.554 -11.462   8.769 1.00 . A A . 663 SER HB3  1 1 
        3  3022 1 1  7 SER HG   H  -21.000 -13.505   9.392 1.00 . A A . 663 SER HG   1 1 
        3  3023 1 1  7 SER N    N  -22.876 -10.778   8.681 1.00 . A A . 663 SER N    1 1 
        3  3024 1 1  7 SER O    O  -21.274  -9.820   6.404 1.00 . A A . 663 SER O    1 1 
        3  3025 1 1  7 SER OG   O  -20.943 -12.602   9.735 1.00 . A A . 663 SER OG   1 1 
        3  3026 1 1  8 ASP C    C  -18.520  -8.030   6.364 1.00 . A A . 664 ASP C    1 1 
        3  3027 1 1  8 ASP CA   C  -19.852  -7.479   6.901 1.00 . A A . 664 ASP CA   1 1 
        3  3028 1 1  8 ASP CB   C  -19.648  -6.077   7.495 1.00 . A A . 664 ASP CB   1 1 
        3  3029 1 1  8 ASP CG   C  -18.706  -5.216   6.661 1.00 . A A . 664 ASP CG   1 1 
        3  3030 1 1  8 ASP H    H  -20.351  -8.141   8.856 1.00 . A A . 664 ASP H    1 1 
        3  3031 1 1  8 ASP HA   H  -20.554  -7.413   6.083 1.00 . A A . 664 ASP HA   1 1 
        3  3032 1 1  8 ASP HB2  H  -20.604  -5.577   7.556 1.00 . A A . 664 ASP HB2  1 1 
        3  3033 1 1  8 ASP HB3  H  -19.238  -6.172   8.490 1.00 . A A . 664 ASP HB3  1 1 
        3  3034 1 1  8 ASP N    N  -20.422  -8.381   7.909 1.00 . A A . 664 ASP N    1 1 
        3  3035 1 1  8 ASP O    O  -17.730  -8.613   7.109 1.00 . A A . 664 ASP O    1 1 
        3  3036 1 1  8 ASP OD1  O  -19.110  -4.722   5.592 1.00 . A A . 664 ASP OD1  1 1 
        3  3037 1 1  8 ASP OD2  O  -17.540  -5.034   7.061 1.00 . A A . 664 ASP OD2  1 1 
        3  3038 1 1  9 LEU C    C  -15.911  -7.249   4.716 1.00 . A A . 665 LEU C    1 1 
        3  3039 1 1  9 LEU CA   C  -17.028  -8.270   4.450 1.00 . A A . 665 LEU CA   1 1 
        3  3040 1 1  9 LEU CB   C  -17.224  -8.443   2.936 1.00 . A A . 665 LEU CB   1 1 
        3  3041 1 1  9 LEU CD1  C  -18.421  -9.519   0.994 1.00 . A A . 665 LEU CD1  1 1 
        3  3042 1 1  9 LEU CD2  C  -18.105 -10.798   3.133 1.00 . A A . 665 LEU CD2  1 1 
        3  3043 1 1  9 LEU CG   C  -18.336  -9.421   2.517 1.00 . A A . 665 LEU CG   1 1 
        3  3044 1 1  9 LEU H    H  -18.956  -7.393   4.526 1.00 . A A . 665 LEU H    1 1 
        3  3045 1 1  9 LEU HA   H  -16.746  -9.222   4.882 1.00 . A A . 665 LEU HA   1 1 
        3  3046 1 1  9 LEU HB2  H  -17.449  -7.473   2.512 1.00 . A A . 665 LEU HB2  1 1 
        3  3047 1 1  9 LEU HB3  H  -16.292  -8.790   2.512 1.00 . A A . 665 LEU HB3  1 1 
        3  3048 1 1  9 LEU HD11 H  -19.198 -10.219   0.719 1.00 . A A . 665 LEU HD11 1 1 
        3  3049 1 1  9 LEU HD12 H  -17.475  -9.860   0.598 1.00 . A A . 665 LEU HD12 1 1 
        3  3050 1 1  9 LEU HD13 H  -18.652  -8.547   0.583 1.00 . A A . 665 LEU HD13 1 1 
        3  3051 1 1  9 LEU HD21 H  -17.154 -11.189   2.801 1.00 . A A . 665 LEU HD21 1 1 
        3  3052 1 1  9 LEU HD22 H  -18.896 -11.467   2.825 1.00 . A A . 665 LEU HD22 1 1 
        3  3053 1 1  9 LEU HD23 H  -18.104 -10.717   4.211 1.00 . A A . 665 LEU HD23 1 1 
        3  3054 1 1  9 LEU HG   H  -19.286  -9.049   2.878 1.00 . A A . 665 LEU HG   1 1 
        3  3055 1 1  9 LEU N    N  -18.280  -7.839   5.073 1.00 . A A . 665 LEU N    1 1 
        3  3056 1 1  9 LEU O    O  -16.036  -6.081   4.346 1.00 . A A . 665 LEU O    1 1 
        3  3057 1 1 10 GLU C    C  -13.149  -6.233   4.304 1.00 . A A . 666 GLU C    1 1 
        3  3058 1 1 10 GLU CA   C  -13.693  -6.796   5.627 1.00 . A A . 666 GLU CA   1 1 
        3  3059 1 1 10 GLU CB   C  -12.562  -7.521   6.381 1.00 . A A . 666 GLU CB   1 1 
        3  3060 1 1 10 GLU CD   C  -13.550  -9.571   7.532 1.00 . A A . 666 GLU CD   1 1 
        3  3061 1 1 10 GLU CG   C  -12.978  -8.174   7.703 1.00 . A A . 666 GLU CG   1 1 
        3  3062 1 1 10 GLU H    H  -14.818  -8.600   5.712 1.00 . A A . 666 GLU H    1 1 
        3  3063 1 1 10 GLU HA   H  -14.044  -5.973   6.234 1.00 . A A . 666 GLU HA   1 1 
        3  3064 1 1 10 GLU HB2  H  -12.154  -8.290   5.740 1.00 . A A . 666 GLU HB2  1 1 
        3  3065 1 1 10 GLU HB3  H  -11.784  -6.799   6.598 1.00 . A A . 666 GLU HB3  1 1 
        3  3066 1 1 10 GLU HG2  H  -12.110  -8.238   8.345 1.00 . A A . 666 GLU HG2  1 1 
        3  3067 1 1 10 GLU HG3  H  -13.722  -7.550   8.179 1.00 . A A . 666 GLU HG3  1 1 
        3  3068 1 1 10 GLU N    N  -14.835  -7.681   5.377 1.00 . A A . 666 GLU N    1 1 
        3  3069 1 1 10 GLU O    O  -13.124  -6.939   3.289 1.00 . A A . 666 GLU O    1 1 
        3  3070 1 1 10 GLU OE1  O  -12.764 -10.539   7.519 1.00 . A A . 666 GLU OE1  1 1 
        3  3071 1 1 10 GLU OE2  O  -14.784  -9.712   7.421 1.00 . A A . 666 GLU OE2  1 1 
        3  3072 1 1 11 PRO C    C  -11.158  -5.042   2.315 1.00 . A A . 667 PRO C    1 1 
        3  3073 1 1 11 PRO CA   C  -12.255  -4.278   3.074 1.00 . A A . 667 PRO CA   1 1 
        3  3074 1 1 11 PRO CB   C  -11.725  -2.920   3.578 1.00 . A A . 667 PRO CB   1 1 
        3  3075 1 1 11 PRO CD   C  -12.517  -4.115   5.491 1.00 . A A . 667 PRO CD   1 1 
        3  3076 1 1 11 PRO CG   C  -11.494  -3.109   5.040 1.00 . A A . 667 PRO CG   1 1 
        3  3077 1 1 11 PRO HA   H  -13.098  -4.114   2.412 1.00 . A A . 667 PRO HA   1 1 
        3  3078 1 1 11 PRO HB2  H  -10.809  -2.668   3.061 1.00 . A A . 667 PRO HB2  1 1 
        3  3079 1 1 11 PRO HB3  H  -12.466  -2.154   3.394 1.00 . A A . 667 PRO HB3  1 1 
        3  3080 1 1 11 PRO HD2  H  -12.144  -4.684   6.332 1.00 . A A . 667 PRO HD2  1 1 
        3  3081 1 1 11 PRO HD3  H  -13.447  -3.627   5.744 1.00 . A A . 667 PRO HD3  1 1 
        3  3082 1 1 11 PRO HG2  H  -10.494  -3.484   5.211 1.00 . A A . 667 PRO HG2  1 1 
        3  3083 1 1 11 PRO HG3  H  -11.634  -2.172   5.561 1.00 . A A . 667 PRO HG3  1 1 
        3  3084 1 1 11 PRO N    N  -12.683  -4.968   4.303 1.00 . A A . 667 PRO N    1 1 
        3  3085 1 1 11 PRO O    O  -10.183  -5.513   2.910 1.00 . A A . 667 PRO O    1 1 
        3  3086 1 1 12 LYS C    C   -9.178  -4.938  -0.187 1.00 . A A . 668 LYS C    1 1 
        3  3087 1 1 12 LYS CA   C  -10.346  -5.870   0.172 1.00 . A A . 668 LYS CA   1 1 
        3  3088 1 1 12 LYS CB   C  -11.011  -6.405  -1.107 1.00 . A A . 668 LYS CB   1 1 
        3  3089 1 1 12 LYS CD   C   -9.726  -8.578  -1.114 1.00 . A A . 668 LYS CD   1 1 
        3  3090 1 1 12 LYS CE   C   -8.769  -9.483  -1.880 1.00 . A A . 668 LYS CE   1 1 
        3  3091 1 1 12 LYS CG   C  -10.115  -7.339  -1.920 1.00 . A A . 668 LYS CG   1 1 
        3  3092 1 1 12 LYS H    H  -12.115  -4.774   0.582 1.00 . A A . 668 LYS H    1 1 
        3  3093 1 1 12 LYS HA   H   -9.964  -6.706   0.744 1.00 . A A . 668 LYS HA   1 1 
        3  3094 1 1 12 LYS HB2  H  -11.908  -6.945  -0.835 1.00 . A A . 668 LYS HB2  1 1 
        3  3095 1 1 12 LYS HB3  H  -11.285  -5.568  -1.735 1.00 . A A . 668 LYS HB3  1 1 
        3  3096 1 1 12 LYS HD2  H   -9.245  -8.263  -0.198 1.00 . A A . 668 LYS HD2  1 1 
        3  3097 1 1 12 LYS HD3  H  -10.620  -9.137  -0.875 1.00 . A A . 668 LYS HD3  1 1 
        3  3098 1 1 12 LYS HE2  H   -9.263  -9.835  -2.774 1.00 . A A . 668 LYS HE2  1 1 
        3  3099 1 1 12 LYS HE3  H   -7.892  -8.913  -2.153 1.00 . A A . 668 LYS HE3  1 1 
        3  3100 1 1 12 LYS HG2  H  -10.646  -7.652  -2.808 1.00 . A A . 668 LYS HG2  1 1 
        3  3101 1 1 12 LYS HG3  H   -9.217  -6.806  -2.205 1.00 . A A . 668 LYS HG3  1 1 
        3  3102 1 1 12 LYS HZ1  H   -7.649 -11.219  -1.592 1.00 . A A . 668 LYS HZ1  1 1 
        3  3103 1 1 12 LYS HZ2  H   -9.169 -11.254  -0.855 1.00 . A A . 668 LYS HZ2  1 1 
        3  3104 1 1 12 LYS HZ3  H   -7.920 -10.340  -0.174 1.00 . A A . 668 LYS HZ3  1 1 
        3  3105 1 1 12 LYS N    N  -11.321  -5.166   1.002 1.00 . A A . 668 LYS N    1 1 
        3  3106 1 1 12 LYS NZ   N   -8.349 -10.656  -1.069 1.00 . A A . 668 LYS NZ   1 1 
        3  3107 1 1 12 LYS O    O   -9.341  -3.982  -0.946 1.00 . A A . 668 LYS O    1 1 
        3  3108 1 1 13 LEU C    C   -5.904  -4.992  -0.917 1.00 . A A . 669 LEU C    1 1 
        3  3109 1 1 13 LEU CA   C   -6.815  -4.397   0.171 1.00 . A A . 669 LEU CA   1 1 
        3  3110 1 1 13 LEU CB   C   -6.047  -4.265   1.498 1.00 . A A . 669 LEU CB   1 1 
        3  3111 1 1 13 LEU CD1  C   -5.153  -1.939   1.076 1.00 . A A . 669 LEU CD1  1 1 
        3  3112 1 1 13 LEU CD2  C   -4.074  -3.410   2.810 1.00 . A A . 669 LEU CD2  1 1 
        3  3113 1 1 13 LEU CG   C   -4.794  -3.373   1.462 1.00 . A A . 669 LEU CG   1 1 
        3  3114 1 1 13 LEU H    H   -7.940  -6.018   0.951 1.00 . A A . 669 LEU H    1 1 
        3  3115 1 1 13 LEU HA   H   -7.136  -3.415  -0.145 1.00 . A A . 669 LEU HA   1 1 
        3  3116 1 1 13 LEU HB2  H   -6.725  -3.866   2.238 1.00 . A A . 669 LEU HB2  1 1 
        3  3117 1 1 13 LEU HB3  H   -5.747  -5.254   1.814 1.00 . A A . 669 LEU HB3  1 1 
        3  3118 1 1 13 LEU HD11 H   -4.258  -1.335   1.056 1.00 . A A . 669 LEU HD11 1 1 
        3  3119 1 1 13 LEU HD12 H   -5.847  -1.532   1.798 1.00 . A A . 669 LEU HD12 1 1 
        3  3120 1 1 13 LEU HD13 H   -5.610  -1.934   0.097 1.00 . A A . 669 LEU HD13 1 1 
        3  3121 1 1 13 LEU HD21 H   -4.734  -3.047   3.584 1.00 . A A . 669 LEU HD21 1 1 
        3  3122 1 1 13 LEU HD22 H   -3.194  -2.784   2.766 1.00 . A A . 669 LEU HD22 1 1 
        3  3123 1 1 13 LEU HD23 H   -3.780  -4.425   3.034 1.00 . A A . 669 LEU HD23 1 1 
        3  3124 1 1 13 LEU HG   H   -4.114  -3.754   0.714 1.00 . A A . 669 LEU HG   1 1 
        3  3125 1 1 13 LEU N    N   -8.007  -5.224   0.377 1.00 . A A . 669 LEU N    1 1 
        3  3126 1 1 13 LEU O    O   -5.330  -6.073  -0.744 1.00 . A A . 669 LEU O    1 1 
        3  3127 1 1 14 THR C    C   -3.498  -4.191  -2.965 1.00 . A A . 670 THR C    1 1 
        3  3128 1 1 14 THR CA   C   -4.924  -4.727  -3.145 1.00 . A A . 670 THR CA   1 1 
        3  3129 1 1 14 THR CB   C   -5.469  -4.254  -4.518 1.00 . A A . 670 THR CB   1 1 
        3  3130 1 1 14 THR CG2  C   -4.562  -4.702  -5.665 1.00 . A A . 670 THR CG2  1 1 
        3  3131 1 1 14 THR H    H   -6.316  -3.472  -2.145 1.00 . A A . 670 THR H    1 1 
        3  3132 1 1 14 THR HA   H   -4.896  -5.809  -3.147 1.00 . A A . 670 THR HA   1 1 
        3  3133 1 1 14 THR HB   H   -5.511  -3.173  -4.516 1.00 . A A . 670 THR HB   1 1 
        3  3134 1 1 14 THR HG1  H   -6.753  -5.726  -4.839 1.00 . A A . 670 THR HG1  1 1 
        3  3135 1 1 14 THR HG21 H   -4.491  -5.781  -5.671 1.00 . A A . 670 THR HG21 1 1 
        3  3136 1 1 14 THR HG22 H   -3.576  -4.277  -5.535 1.00 . A A . 670 THR HG22 1 1 
        3  3137 1 1 14 THR HG23 H   -4.975  -4.366  -6.604 1.00 . A A . 670 THR HG23 1 1 
        3  3138 1 1 14 THR N    N   -5.794  -4.296  -2.044 1.00 . A A . 670 THR N    1 1 
        3  3139 1 1 14 THR O    O   -3.254  -2.989  -3.089 1.00 . A A . 670 THR O    1 1 
        3  3140 1 1 14 THR OG1  O   -6.794  -4.768  -4.726 1.00 . A A . 670 THR OG1  1 1 
        3  3141 1 1 15 VAL C    C   -0.228  -5.737  -3.203 1.00 . A A . 671 VAL C    1 1 
        3  3142 1 1 15 VAL CA   C   -1.149  -4.736  -2.484 1.00 . A A . 671 VAL CA   1 1 
        3  3143 1 1 15 VAL CB   C   -0.775  -4.697  -0.974 1.00 . A A . 671 VAL CB   1 1 
        3  3144 1 1 15 VAL CG1  C    0.724  -4.456  -0.776 1.00 . A A . 671 VAL CG1  1 1 
        3  3145 1 1 15 VAL CG2  C   -1.584  -3.629  -0.242 1.00 . A A . 671 VAL CG2  1 1 
        3  3146 1 1 15 VAL H    H   -2.825  -6.035  -2.596 1.00 . A A . 671 VAL H    1 1 
        3  3147 1 1 15 VAL HA   H   -0.991  -3.749  -2.900 1.00 . A A . 671 VAL HA   1 1 
        3  3148 1 1 15 VAL HB   H   -1.020  -5.658  -0.542 1.00 . A A . 671 VAL HB   1 1 
        3  3149 1 1 15 VAL HG11 H    1.285  -5.241  -1.263 1.00 . A A . 671 VAL HG11 1 1 
        3  3150 1 1 15 VAL HG12 H    0.955  -4.456   0.280 1.00 . A A . 671 VAL HG12 1 1 
        3  3151 1 1 15 VAL HG13 H    0.996  -3.502  -1.203 1.00 . A A . 671 VAL HG13 1 1 
        3  3152 1 1 15 VAL HG21 H   -2.637  -3.844  -0.341 1.00 . A A . 671 VAL HG21 1 1 
        3  3153 1 1 15 VAL HG22 H   -1.372  -2.660  -0.671 1.00 . A A . 671 VAL HG22 1 1 
        3  3154 1 1 15 VAL HG23 H   -1.314  -3.627   0.804 1.00 . A A . 671 VAL HG23 1 1 
        3  3155 1 1 15 VAL N    N   -2.562  -5.094  -2.678 1.00 . A A . 671 VAL N    1 1 
        3  3156 1 1 15 VAL O    O   -0.376  -6.950  -3.039 1.00 . A A . 671 VAL O    1 1 
        3  3157 1 1 16 PRO C    C    2.801  -6.646  -3.822 1.00 . A A . 672 PRO C    1 1 
        3  3158 1 1 16 PRO CA   C    1.676  -6.118  -4.727 1.00 . A A . 672 PRO CA   1 1 
        3  3159 1 1 16 PRO CB   C    2.237  -5.198  -5.816 1.00 . A A . 672 PRO CB   1 1 
        3  3160 1 1 16 PRO CD   C    0.978  -3.816  -4.295 1.00 . A A . 672 PRO CD   1 1 
        3  3161 1 1 16 PRO CG   C    2.161  -3.825  -5.236 1.00 . A A . 672 PRO CG   1 1 
        3  3162 1 1 16 PRO HA   H    1.165  -6.953  -5.187 1.00 . A A . 672 PRO HA   1 1 
        3  3163 1 1 16 PRO HB2  H    3.257  -5.478  -6.043 1.00 . A A . 672 PRO HB2  1 1 
        3  3164 1 1 16 PRO HB3  H    1.631  -5.281  -6.709 1.00 . A A . 672 PRO HB3  1 1 
        3  3165 1 1 16 PRO HD2  H    1.222  -3.284  -3.385 1.00 . A A . 672 PRO HD2  1 1 
        3  3166 1 1 16 PRO HD3  H    0.119  -3.366  -4.771 1.00 . A A . 672 PRO HD3  1 1 
        3  3167 1 1 16 PRO HG2  H    3.072  -3.607  -4.695 1.00 . A A . 672 PRO HG2  1 1 
        3  3168 1 1 16 PRO HG3  H    2.017  -3.101  -6.026 1.00 . A A . 672 PRO HG3  1 1 
        3  3169 1 1 16 PRO N    N    0.733  -5.246  -4.013 1.00 . A A . 672 PRO N    1 1 
        3  3170 1 1 16 PRO O    O    3.318  -5.923  -2.971 1.00 . A A . 672 PRO O    1 1 
        3  3171 1 1 17 VAL C    C    5.600  -7.884  -3.375 1.00 . A A . 673 VAL C    1 1 
        3  3172 1 1 17 VAL CA   C    4.216  -8.536  -3.179 1.00 . A A . 673 VAL CA   1 1 
        3  3173 1 1 17 VAL CB   C    4.312 -10.060  -3.458 1.00 . A A . 673 VAL CB   1 1 
        3  3174 1 1 17 VAL CG1  C    4.701 -10.328  -4.911 1.00 . A A . 673 VAL CG1  1 1 
        3  3175 1 1 17 VAL CG2  C    5.294 -10.733  -2.495 1.00 . A A . 673 VAL CG2  1 1 
        3  3176 1 1 17 VAL H    H    2.770  -8.428  -4.738 1.00 . A A . 673 VAL H    1 1 
        3  3177 1 1 17 VAL HA   H    3.919  -8.403  -2.146 1.00 . A A . 673 VAL HA   1 1 
        3  3178 1 1 17 VAL HB   H    3.333 -10.491  -3.291 1.00 . A A . 673 VAL HB   1 1 
        3  3179 1 1 17 VAL HG11 H    3.971  -9.876  -5.568 1.00 . A A . 673 VAL HG11 1 1 
        3  3180 1 1 17 VAL HG12 H    4.731 -11.393  -5.088 1.00 . A A . 673 VAL HG12 1 1 
        3  3181 1 1 17 VAL HG13 H    5.675  -9.903  -5.109 1.00 . A A . 673 VAL HG13 1 1 
        3  3182 1 1 17 VAL HG21 H    5.333 -11.794  -2.700 1.00 . A A . 673 VAL HG21 1 1 
        3  3183 1 1 17 VAL HG22 H    4.966 -10.576  -1.476 1.00 . A A . 673 VAL HG22 1 1 
        3  3184 1 1 17 VAL HG23 H    6.278 -10.307  -2.624 1.00 . A A . 673 VAL HG23 1 1 
        3  3185 1 1 17 VAL N    N    3.188  -7.907  -4.017 1.00 . A A . 673 VAL N    1 1 
        3  3186 1 1 17 VAL O    O    6.378  -7.752  -2.425 1.00 . A A . 673 VAL O    1 1 
        3  3187 1 1 18 GLY C    C    7.146  -5.768  -5.953 1.00 . A A . 674 GLY C    1 1 
        3  3188 1 1 18 GLY CA   C    7.197  -6.875  -4.902 1.00 . A A . 674 GLY CA   1 1 
        3  3189 1 1 18 GLY H    H    5.219  -7.528  -5.309 1.00 . A A . 674 GLY H    1 1 
        3  3190 1 1 18 GLY HA2  H    7.613  -6.464  -3.992 1.00 . A A . 674 GLY HA2  1 1 
        3  3191 1 1 18 GLY HA3  H    7.851  -7.658  -5.254 1.00 . A A . 674 GLY HA3  1 1 
        3  3192 1 1 18 GLY N    N    5.894  -7.456  -4.604 1.00 . A A . 674 GLY N    1 1 
        3  3193 1 1 18 GLY O    O    6.184  -5.660  -6.716 1.00 . A A . 674 GLY O    1 1 
        3  3194 1 1 19 ALA C    C    9.759  -3.536  -7.284 1.00 . A A . 675 ALA C    1 1 
        3  3195 1 1 19 ALA CA   C    8.292  -3.834  -6.937 1.00 . A A . 675 ALA CA   1 1 
        3  3196 1 1 19 ALA CB   C    7.622  -2.592  -6.356 1.00 . A A . 675 ALA CB   1 1 
        3  3197 1 1 19 ALA H    H    8.929  -5.094  -5.356 1.00 . A A . 675 ALA H    1 1 
        3  3198 1 1 19 ALA HA   H    7.767  -4.114  -7.842 1.00 . A A . 675 ALA HA   1 1 
        3  3199 1 1 19 ALA HB1  H    8.132  -2.297  -5.450 1.00 . A A . 675 ALA HB1  1 1 
        3  3200 1 1 19 ALA HB2  H    6.588  -2.811  -6.130 1.00 . A A . 675 ALA HB2  1 1 
        3  3201 1 1 19 ALA HB3  H    7.669  -1.787  -7.073 1.00 . A A . 675 ALA HB3  1 1 
        3  3202 1 1 19 ALA N    N    8.194  -4.948  -5.990 1.00 . A A . 675 ALA N    1 1 
        3  3203 1 1 19 ALA O    O   10.665  -3.846  -6.509 1.00 . A A . 675 ALA O    1 1 
        3  3204 1 1 20 THR C    C   11.401  -1.215  -9.560 1.00 . A A . 676 THR C    1 1 
        3  3205 1 1 20 THR CA   C   11.360  -2.589  -8.874 1.00 . A A . 676 THR CA   1 1 
        3  3206 1 1 20 THR CB   C   11.970  -3.651  -9.827 1.00 . A A . 676 THR CB   1 1 
        3  3207 1 1 20 THR CG2  C   13.378  -3.259 -10.268 1.00 . A A . 676 THR CG2  1 1 
        3  3208 1 1 20 THR H    H    9.240  -2.747  -9.050 1.00 . A A . 676 THR H    1 1 
        3  3209 1 1 20 THR HA   H   11.977  -2.546  -7.985 1.00 . A A . 676 THR HA   1 1 
        3  3210 1 1 20 THR HB   H   11.342  -3.731 -10.705 1.00 . A A . 676 THR HB   1 1 
        3  3211 1 1 20 THR HG1  H   11.837  -4.823  -8.232 1.00 . A A . 676 THR HG1  1 1 
        3  3212 1 1 20 THR HG21 H   13.774  -4.018 -10.926 1.00 . A A . 676 THR HG21 1 1 
        3  3213 1 1 20 THR HG22 H   14.018  -3.166  -9.401 1.00 . A A . 676 THR HG22 1 1 
        3  3214 1 1 20 THR HG23 H   13.343  -2.314 -10.790 1.00 . A A . 676 THR HG23 1 1 
        3  3215 1 1 20 THR N    N    9.995  -2.950  -8.454 1.00 . A A . 676 THR N    1 1 
        3  3216 1 1 20 THR O    O   10.764  -1.003 -10.592 1.00 . A A . 676 THR O    1 1 
        3  3217 1 1 20 THR OG1  O   12.022  -4.934  -9.175 1.00 . A A . 676 THR OG1  1 1 
        3  3218 1 1 21 ILE C    C   13.848   1.411  -9.610 1.00 . A A . 677 ILE C    1 1 
        3  3219 1 1 21 ILE CA   C   12.355   1.045  -9.578 1.00 . A A . 677 ILE CA   1 1 
        3  3220 1 1 21 ILE CB   C   11.569   2.140  -8.809 1.00 . A A . 677 ILE CB   1 1 
        3  3221 1 1 21 ILE CD1  C   11.273   3.221  -6.508 1.00 . A A . 677 ILE CD1  1 1 
        3  3222 1 1 21 ILE CG1  C   11.982   2.164  -7.329 1.00 . A A . 677 ILE CG1  1 1 
        3  3223 1 1 21 ILE CG2  C   10.062   1.916  -8.946 1.00 . A A . 677 ILE CG2  1 1 
        3  3224 1 1 21 ILE H    H   12.609  -0.498  -8.136 1.00 . A A . 677 ILE H    1 1 
        3  3225 1 1 21 ILE HA   H   11.988   1.017 -10.596 1.00 . A A . 677 ILE HA   1 1 
        3  3226 1 1 21 ILE HB   H   11.804   3.098  -9.255 1.00 . A A . 677 ILE HB   1 1 
        3  3227 1 1 21 ILE HD11 H   11.617   3.171  -5.485 1.00 . A A . 677 ILE HD11 1 1 
        3  3228 1 1 21 ILE HD12 H   10.206   3.049  -6.538 1.00 . A A . 677 ILE HD12 1 1 
        3  3229 1 1 21 ILE HD13 H   11.490   4.200  -6.911 1.00 . A A . 677 ILE HD13 1 1 
        3  3230 1 1 21 ILE HG12 H   11.764   1.204  -6.885 1.00 . A A . 677 ILE HG12 1 1 
        3  3231 1 1 21 ILE HG13 H   13.045   2.351  -7.261 1.00 . A A . 677 ILE HG13 1 1 
        3  3232 1 1 21 ILE HG21 H    9.800   0.956  -8.524 1.00 . A A . 677 ILE HG21 1 1 
        3  3233 1 1 21 ILE HG22 H    9.789   1.934  -9.990 1.00 . A A . 677 ILE HG22 1 1 
        3  3234 1 1 21 ILE HG23 H    9.529   2.697  -8.423 1.00 . A A . 677 ILE HG23 1 1 
        3  3235 1 1 21 ILE N    N   12.159  -0.287  -8.983 1.00 . A A . 677 ILE N    1 1 
        3  3236 1 1 21 ILE O    O   14.689   0.667  -9.103 1.00 . A A . 677 ILE O    1 1 
        3  3237 1 1 22 HIS C    C   15.778   4.353  -9.608 1.00 . A A . 678 HIS C    1 1 
        3  3238 1 1 22 HIS CA   C   15.571   3.000 -10.299 1.00 . A A . 678 HIS CA   1 1 
        3  3239 1 1 22 HIS CB   C   16.008   3.113 -11.766 1.00 . A A . 678 HIS CB   1 1 
        3  3240 1 1 22 HIS CD2  C   17.023   0.878 -12.601 1.00 . A A . 678 HIS CD2  1 1 
        3  3241 1 1 22 HIS CE1  C   15.315   0.169 -13.772 1.00 . A A . 678 HIS CE1  1 1 
        3  3242 1 1 22 HIS CG   C   16.042   1.806 -12.495 1.00 . A A . 678 HIS CG   1 1 
        3  3243 1 1 22 HIS H    H   13.469   3.100 -10.612 1.00 . A A . 678 HIS H    1 1 
        3  3244 1 1 22 HIS HA   H   16.192   2.265  -9.807 1.00 . A A . 678 HIS HA   1 1 
        3  3245 1 1 22 HIS HB2  H   15.323   3.765 -12.289 1.00 . A A . 678 HIS HB2  1 1 
        3  3246 1 1 22 HIS HB3  H   17.000   3.541 -11.806 1.00 . A A . 678 HIS HB3  1 1 
        3  3247 1 1 22 HIS HD1  H   14.128   1.781 -13.375 1.00 . A A . 678 HIS HD1  1 1 
        3  3248 1 1 22 HIS HD2  H   18.001   0.921 -12.140 1.00 . A A . 678 HIS HD2  1 1 
        3  3249 1 1 22 HIS HE1  H   14.683  -0.434 -14.406 1.00 . A A . 678 HIS HE1  1 1 
        3  3250 1 1 22 HIS HE2  H   17.095  -0.826 -13.817 1.00 . A A . 678 HIS HE2  1 1 
        3  3251 1 1 22 HIS N    N   14.177   2.548 -10.212 1.00 . A A . 678 HIS N    1 1 
        3  3252 1 1 22 HIS ND1  N   14.990   1.330 -13.245 1.00 . A A . 678 HIS ND1  1 1 
        3  3253 1 1 22 HIS NE2  N   16.544  -0.129 -13.401 1.00 . A A . 678 HIS NE2  1 1 
        3  3254 1 1 22 HIS O    O   14.822   5.069  -9.302 1.00 . A A . 678 HIS O    1 1 
        3  3255 1 1 23 VAL C    C   16.884   7.111  -9.823 1.00 . A A . 679 VAL C    1 1 
        3  3256 1 1 23 VAL CA   C   17.398   6.020  -8.864 1.00 . A A . 679 VAL CA   1 1 
        3  3257 1 1 23 VAL CB   C   18.934   6.152  -8.689 1.00 . A A . 679 VAL CB   1 1 
        3  3258 1 1 23 VAL CG1  C   19.328   7.578  -8.305 1.00 . A A . 679 VAL CG1  1 1 
        3  3259 1 1 23 VAL CG2  C   19.443   5.149  -7.653 1.00 . A A . 679 VAL CG2  1 1 
        3  3260 1 1 23 VAL H    H   17.746   4.027  -9.504 1.00 . A A . 679 VAL H    1 1 
        3  3261 1 1 23 VAL HA   H   16.929   6.151  -7.896 1.00 . A A . 679 VAL HA   1 1 
        3  3262 1 1 23 VAL HB   H   19.400   5.920  -9.637 1.00 . A A . 679 VAL HB   1 1 
        3  3263 1 1 23 VAL HG11 H   19.043   8.257  -9.097 1.00 . A A . 679 VAL HG11 1 1 
        3  3264 1 1 23 VAL HG12 H   20.396   7.630  -8.154 1.00 . A A . 679 VAL HG12 1 1 
        3  3265 1 1 23 VAL HG13 H   18.821   7.860  -7.393 1.00 . A A . 679 VAL HG13 1 1 
        3  3266 1 1 23 VAL HG21 H   19.201   4.145  -7.973 1.00 . A A . 679 VAL HG21 1 1 
        3  3267 1 1 23 VAL HG22 H   18.976   5.343  -6.698 1.00 . A A . 679 VAL HG22 1 1 
        3  3268 1 1 23 VAL HG23 H   20.515   5.243  -7.554 1.00 . A A . 679 VAL HG23 1 1 
        3  3269 1 1 23 VAL N    N   17.039   4.691  -9.360 1.00 . A A . 679 VAL N    1 1 
        3  3270 1 1 23 VAL O    O   16.970   6.964 -11.042 1.00 . A A . 679 VAL O    1 1 
        3  3271 1 1 24 GLY C    C   14.294   9.110 -10.408 1.00 . A A . 680 GLY C    1 1 
        3  3272 1 1 24 GLY CA   C   15.786   9.264 -10.100 1.00 . A A . 680 GLY CA   1 1 
        3  3273 1 1 24 GLY H    H   16.275   8.251  -8.294 1.00 . A A . 680 GLY H    1 1 
        3  3274 1 1 24 GLY HA2  H   15.937  10.202  -9.584 1.00 . A A . 680 GLY HA2  1 1 
        3  3275 1 1 24 GLY HA3  H   16.331   9.294 -11.034 1.00 . A A . 680 GLY HA3  1 1 
        3  3276 1 1 24 GLY N    N   16.323   8.184  -9.272 1.00 . A A . 680 GLY N    1 1 
        3  3277 1 1 24 GLY O    O   13.635  10.078 -10.801 1.00 . A A . 680 GLY O    1 1 
        3  3278 1 1 25 ASP C    C   11.480   8.091  -9.262 1.00 . A A . 681 ASP C    1 1 
        3  3279 1 1 25 ASP CA   C   12.332   7.637 -10.463 1.00 . A A . 681 ASP CA   1 1 
        3  3280 1 1 25 ASP CB   C   12.095   6.142 -10.730 1.00 . A A . 681 ASP CB   1 1 
        3  3281 1 1 25 ASP CG   C   12.771   5.646 -11.997 1.00 . A A . 681 ASP CG   1 1 
        3  3282 1 1 25 ASP H    H   14.338   7.158  -9.958 1.00 . A A . 681 ASP H    1 1 
        3  3283 1 1 25 ASP HA   H   12.027   8.199 -11.336 1.00 . A A . 681 ASP HA   1 1 
        3  3284 1 1 25 ASP HB2  H   12.477   5.572  -9.895 1.00 . A A . 681 ASP HB2  1 1 
        3  3285 1 1 25 ASP HB3  H   11.032   5.965 -10.819 1.00 . A A . 681 ASP HB3  1 1 
        3  3286 1 1 25 ASP N    N   13.761   7.897 -10.240 1.00 . A A . 681 ASP N    1 1 
        3  3287 1 1 25 ASP O    O   11.978   8.733  -8.333 1.00 . A A . 681 ASP O    1 1 
        3  3288 1 1 25 ASP OD1  O   12.991   6.456 -12.925 1.00 . A A . 681 ASP OD1  1 1 
        3  3289 1 1 25 ASP OD2  O   13.074   4.438 -12.079 1.00 . A A . 681 ASP OD2  1 1 
        3  3290 1 1 26 SER C    C    8.274   6.958  -7.946 1.00 . A A . 682 SER C    1 1 
        3  3291 1 1 26 SER CA   C    9.275   8.093  -8.190 1.00 . A A . 682 SER CA   1 1 
        3  3292 1 1 26 SER CB   C    8.509   9.392  -8.488 1.00 . A A . 682 SER CB   1 1 
        3  3293 1 1 26 SER H    H    9.840   7.278 -10.074 1.00 . A A . 682 SER H    1 1 
        3  3294 1 1 26 SER HA   H    9.866   8.233  -7.295 1.00 . A A . 682 SER HA   1 1 
        3  3295 1 1 26 SER HB2  H    7.972   9.285  -9.420 1.00 . A A . 682 SER HB2  1 1 
        3  3296 1 1 26 SER HB3  H    7.805   9.583  -7.689 1.00 . A A . 682 SER HB3  1 1 
        3  3297 1 1 26 SER HG   H   10.230  10.218  -8.963 1.00 . A A . 682 SER HG   1 1 
        3  3298 1 1 26 SER N    N   10.191   7.762  -9.292 1.00 . A A . 682 SER N    1 1 
        3  3299 1 1 26 SER O    O    7.851   6.278  -8.881 1.00 . A A . 682 SER O    1 1 
        3  3300 1 1 26 SER OG   O    9.385  10.505  -8.595 1.00 . A A . 682 SER OG   1 1 
        3  3301 1 1 27 PHE C    C    5.691   6.384  -5.649 1.00 . A A . 683 PHE C    1 1 
        3  3302 1 1 27 PHE CA   C    6.918   5.733  -6.312 1.00 . A A . 683 PHE CA   1 1 
        3  3303 1 1 27 PHE CB   C    7.562   4.711  -5.359 1.00 . A A . 683 PHE CB   1 1 
        3  3304 1 1 27 PHE CD1  C    5.756   3.379  -4.205 1.00 . A A . 683 PHE CD1  1 1 
        3  3305 1 1 27 PHE CD2  C    6.982   2.344  -5.969 1.00 . A A . 683 PHE CD2  1 1 
        3  3306 1 1 27 PHE CE1  C    5.012   2.226  -4.042 1.00 . A A . 683 PHE CE1  1 1 
        3  3307 1 1 27 PHE CE2  C    6.243   1.190  -5.811 1.00 . A A . 683 PHE CE2  1 1 
        3  3308 1 1 27 PHE CG   C    6.750   3.454  -5.172 1.00 . A A . 683 PHE CG   1 1 
        3  3309 1 1 27 PHE CZ   C    5.256   1.130  -4.848 1.00 . A A . 683 PHE CZ   1 1 
        3  3310 1 1 27 PHE H    H    8.300   7.312  -5.981 1.00 . A A . 683 PHE H    1 1 
        3  3311 1 1 27 PHE HA   H    6.600   5.226  -7.213 1.00 . A A . 683 PHE HA   1 1 
        3  3312 1 1 27 PHE HB2  H    8.529   4.424  -5.750 1.00 . A A . 683 PHE HB2  1 1 
        3  3313 1 1 27 PHE HB3  H    7.699   5.169  -4.390 1.00 . A A . 683 PHE HB3  1 1 
        3  3314 1 1 27 PHE HD1  H    5.564   4.237  -3.576 1.00 . A A . 683 PHE HD1  1 1 
        3  3315 1 1 27 PHE HD2  H    7.753   2.388  -6.724 1.00 . A A . 683 PHE HD2  1 1 
        3  3316 1 1 27 PHE HE1  H    4.240   2.180  -3.286 1.00 . A A . 683 PHE HE1  1 1 
        3  3317 1 1 27 PHE HE2  H    6.436   0.336  -6.440 1.00 . A A . 683 PHE HE2  1 1 
        3  3318 1 1 27 PHE HZ   H    4.676   0.227  -4.723 1.00 . A A . 683 PHE HZ   1 1 
        3  3319 1 1 27 PHE N    N    7.903   6.757  -6.687 1.00 . A A . 683 PHE N    1 1 
        3  3320 1 1 27 PHE O    O    5.833   7.249  -4.780 1.00 . A A . 683 PHE O    1 1 
        3  3321 1 1 28 VAL C    C    2.352   5.483  -4.886 1.00 . A A . 684 VAL C    1 1 
        3  3322 1 1 28 VAL CA   C    3.251   6.557  -5.526 1.00 . A A . 684 VAL CA   1 1 
        3  3323 1 1 28 VAL CB   C    2.459   7.304  -6.631 1.00 . A A . 684 VAL CB   1 1 
        3  3324 1 1 28 VAL CG1  C    1.198   7.953  -6.056 1.00 . A A . 684 VAL CG1  1 1 
        3  3325 1 1 28 VAL CG2  C    3.348   8.344  -7.315 1.00 . A A . 684 VAL CG2  1 1 
        3  3326 1 1 28 VAL H    H    4.433   5.252  -6.722 1.00 . A A . 684 VAL H    1 1 
        3  3327 1 1 28 VAL HA   H    3.523   7.278  -4.766 1.00 . A A . 684 VAL HA   1 1 
        3  3328 1 1 28 VAL HB   H    2.154   6.580  -7.375 1.00 . A A . 684 VAL HB   1 1 
        3  3329 1 1 28 VAL HG11 H    0.561   7.188  -5.630 1.00 . A A . 684 VAL HG11 1 1 
        3  3330 1 1 28 VAL HG12 H    0.661   8.467  -6.840 1.00 . A A . 684 VAL HG12 1 1 
        3  3331 1 1 28 VAL HG13 H    1.471   8.660  -5.285 1.00 . A A . 684 VAL HG13 1 1 
        3  3332 1 1 28 VAL HG21 H    2.791   8.838  -8.096 1.00 . A A . 684 VAL HG21 1 1 
        3  3333 1 1 28 VAL HG22 H    4.210   7.852  -7.745 1.00 . A A . 684 VAL HG22 1 1 
        3  3334 1 1 28 VAL HG23 H    3.676   9.073  -6.589 1.00 . A A . 684 VAL HG23 1 1 
        3  3335 1 1 28 VAL N    N    4.490   5.973  -6.057 1.00 . A A . 684 VAL N    1 1 
        3  3336 1 1 28 VAL O    O    1.537   4.849  -5.565 1.00 . A A . 684 VAL O    1 1 
        3  3337 1 1 29 PRO C    C    0.191   4.445  -2.894 1.00 . A A . 685 PRO C    1 1 
        3  3338 1 1 29 PRO CA   C    1.717   4.233  -2.837 1.00 . A A . 685 PRO CA   1 1 
        3  3339 1 1 29 PRO CB   C    2.232   4.347  -1.390 1.00 . A A . 685 PRO CB   1 1 
        3  3340 1 1 29 PRO CD   C    3.382   6.014  -2.656 1.00 . A A . 685 PRO CD   1 1 
        3  3341 1 1 29 PRO CG   C    2.818   5.716  -1.295 1.00 . A A . 685 PRO CG   1 1 
        3  3342 1 1 29 PRO HA   H    1.945   3.249  -3.220 1.00 . A A . 685 PRO HA   1 1 
        3  3343 1 1 29 PRO HB2  H    1.412   4.217  -0.696 1.00 . A A . 685 PRO HB2  1 1 
        3  3344 1 1 29 PRO HB3  H    2.979   3.585  -1.211 1.00 . A A . 685 PRO HB3  1 1 
        3  3345 1 1 29 PRO HD2  H    3.347   7.075  -2.857 1.00 . A A . 685 PRO HD2  1 1 
        3  3346 1 1 29 PRO HD3  H    4.396   5.645  -2.736 1.00 . A A . 685 PRO HD3  1 1 
        3  3347 1 1 29 PRO HG2  H    2.046   6.432  -1.043 1.00 . A A . 685 PRO HG2  1 1 
        3  3348 1 1 29 PRO HG3  H    3.602   5.735  -0.550 1.00 . A A . 685 PRO HG3  1 1 
        3  3349 1 1 29 PRO N    N    2.479   5.271  -3.558 1.00 . A A . 685 PRO N    1 1 
        3  3350 1 1 29 PRO O    O   -0.576   3.487  -2.840 1.00 . A A . 685 PRO O    1 1 
        3  3351 1 1 30 MET C    C   -2.326   5.710  -4.423 1.00 . A A . 686 MET C    1 1 
        3  3352 1 1 30 MET CA   C   -1.686   6.007  -3.054 1.00 . A A . 686 MET CA   1 1 
        3  3353 1 1 30 MET CB   C   -1.913   7.476  -2.672 1.00 . A A . 686 MET CB   1 1 
        3  3354 1 1 30 MET CE   C   -3.203   5.763  -0.120 1.00 . A A . 686 MET CE   1 1 
        3  3355 1 1 30 MET CG   C   -1.599   7.803  -1.210 1.00 . A A . 686 MET CG   1 1 
        3  3356 1 1 30 MET H    H    0.405   6.425  -3.110 1.00 . A A . 686 MET H    1 1 
        3  3357 1 1 30 MET HA   H   -2.164   5.380  -2.317 1.00 . A A . 686 MET HA   1 1 
        3  3358 1 1 30 MET HB2  H   -1.287   8.097  -3.296 1.00 . A A . 686 MET HB2  1 1 
        3  3359 1 1 30 MET HB3  H   -2.949   7.728  -2.857 1.00 . A A . 686 MET HB3  1 1 
        3  3360 1 1 30 MET HE1  H   -3.497   5.453  -1.113 1.00 . A A . 686 MET HE1  1 1 
        3  3361 1 1 30 MET HE2  H   -3.968   5.476   0.588 1.00 . A A . 686 MET HE2  1 1 
        3  3362 1 1 30 MET HE3  H   -2.271   5.288   0.146 1.00 . A A . 686 MET HE3  1 1 
        3  3363 1 1 30 MET HG2  H   -0.782   7.176  -0.880 1.00 . A A . 686 MET HG2  1 1 
        3  3364 1 1 30 MET HG3  H   -1.297   8.838  -1.146 1.00 . A A . 686 MET HG3  1 1 
        3  3365 1 1 30 MET N    N   -0.248   5.695  -3.030 1.00 . A A . 686 MET N    1 1 
        3  3366 1 1 30 MET O    O   -3.552   5.694  -4.555 1.00 . A A . 686 MET O    1 1 
        3  3367 1 1 30 MET SD   S   -2.998   7.545  -0.091 1.00 . A A . 686 MET SD   1 1 
        3  3368 1 1 31 ALA C    C   -1.738   3.667  -7.128 1.00 . A A . 687 ALA C    1 1 
        3  3369 1 1 31 ALA CA   C   -1.993   5.140  -6.778 1.00 . A A . 687 ALA CA   1 1 
        3  3370 1 1 31 ALA CB   C   -1.346   6.045  -7.819 1.00 . A A . 687 ALA CB   1 1 
        3  3371 1 1 31 ALA H    H   -0.531   5.513  -5.278 1.00 . A A . 687 ALA H    1 1 
        3  3372 1 1 31 ALA HA   H   -3.059   5.323  -6.791 1.00 . A A . 687 ALA HA   1 1 
        3  3373 1 1 31 ALA HB1  H   -1.781   5.848  -8.789 1.00 . A A . 687 ALA HB1  1 1 
        3  3374 1 1 31 ALA HB2  H   -0.283   5.852  -7.857 1.00 . A A . 687 ALA HB2  1 1 
        3  3375 1 1 31 ALA HB3  H   -1.515   7.078  -7.554 1.00 . A A . 687 ALA HB3  1 1 
        3  3376 1 1 31 ALA N    N   -1.497   5.469  -5.434 1.00 . A A . 687 ALA N    1 1 
        3  3377 1 1 31 ALA O    O   -2.551   3.025  -7.794 1.00 . A A . 687 ALA O    1 1 
        3  3378 1 1 32 GLU C    C   -0.807   0.764  -5.933 1.00 . A A . 688 GLU C    1 1 
        3  3379 1 1 32 GLU CA   C   -0.209   1.751  -6.958 1.00 . A A . 688 GLU CA   1 1 
        3  3380 1 1 32 GLU CB   C    1.327   1.650  -6.998 1.00 . A A . 688 GLU CB   1 1 
        3  3381 1 1 32 GLU CD   C    3.471   2.533  -8.078 1.00 . A A . 688 GLU CD   1 1 
        3  3382 1 1 32 GLU CG   C    1.947   2.515  -8.096 1.00 . A A . 688 GLU CG   1 1 
        3  3383 1 1 32 GLU H    H    0.008   3.705  -6.156 1.00 . A A . 688 GLU H    1 1 
        3  3384 1 1 32 GLU HA   H   -0.595   1.495  -7.935 1.00 . A A . 688 GLU HA   1 1 
        3  3385 1 1 32 GLU HB2  H    1.727   1.967  -6.045 1.00 . A A . 688 GLU HB2  1 1 
        3  3386 1 1 32 GLU HB3  H    1.607   0.621  -7.176 1.00 . A A . 688 GLU HB3  1 1 
        3  3387 1 1 32 GLU HG2  H    1.622   2.138  -9.056 1.00 . A A . 688 GLU HG2  1 1 
        3  3388 1 1 32 GLU HG3  H    1.586   3.528  -7.977 1.00 . A A . 688 GLU HG3  1 1 
        3  3389 1 1 32 GLU N    N   -0.599   3.142  -6.678 1.00 . A A . 688 GLU N    1 1 
        3  3390 1 1 32 GLU O    O   -0.602  -0.448  -6.027 1.00 . A A . 688 GLU O    1 1 
        3  3391 1 1 32 GLU OE1  O    4.090   1.517  -8.464 1.00 . A A . 688 GLU OE1  1 1 
        3  3392 1 1 32 GLU OE2  O    4.057   3.579  -7.716 1.00 . A A . 688 GLU OE2  1 1 
        3  3393 1 1 33 VAL C    C   -3.776   0.852  -3.959 1.00 . A A . 689 VAL C    1 1 
        3  3394 1 1 33 VAL CA   C   -2.284   0.465  -3.982 1.00 . A A . 689 VAL CA   1 1 
        3  3395 1 1 33 VAL CB   C   -1.674   0.604  -2.562 1.00 . A A . 689 VAL CB   1 1 
        3  3396 1 1 33 VAL CG1  C   -2.439  -0.236  -1.539 1.00 . A A . 689 VAL CG1  1 1 
        3  3397 1 1 33 VAL CG2  C   -0.200   0.211  -2.579 1.00 . A A . 689 VAL CG2  1 1 
        3  3398 1 1 33 VAL H    H   -1.605   2.266  -4.884 1.00 . A A . 689 VAL H    1 1 
        3  3399 1 1 33 VAL HA   H   -2.200  -0.571  -4.290 1.00 . A A . 689 VAL HA   1 1 
        3  3400 1 1 33 VAL HB   H   -1.743   1.642  -2.264 1.00 . A A . 689 VAL HB   1 1 
        3  3401 1 1 33 VAL HG11 H   -3.462   0.107  -1.481 1.00 . A A . 689 VAL HG11 1 1 
        3  3402 1 1 33 VAL HG12 H   -1.971  -0.138  -0.569 1.00 . A A . 689 VAL HG12 1 1 
        3  3403 1 1 33 VAL HG13 H   -2.425  -1.274  -1.842 1.00 . A A . 689 VAL HG13 1 1 
        3  3404 1 1 33 VAL HG21 H   -0.104  -0.819  -2.897 1.00 . A A . 689 VAL HG21 1 1 
        3  3405 1 1 33 VAL HG22 H    0.214   0.320  -1.588 1.00 . A A . 689 VAL HG22 1 1 
        3  3406 1 1 33 VAL HG23 H    0.338   0.850  -3.266 1.00 . A A . 689 VAL HG23 1 1 
        3  3407 1 1 33 VAL N    N   -1.549   1.292  -4.957 1.00 . A A . 689 VAL N    1 1 
        3  3408 1 1 33 VAL O    O   -4.128   2.004  -4.225 1.00 . A A . 689 VAL O    1 1 
        3  3409 1 1 34 LEU C    C   -6.853  -0.609  -2.571 1.00 . A A . 690 LEU C    1 1 
        3  3410 1 1 34 LEU CA   C   -6.107   0.107  -3.720 1.00 . A A . 690 LEU CA   1 1 
        3  3411 1 1 34 LEU CB   C   -6.594  -0.386  -5.100 1.00 . A A . 690 LEU CB   1 1 
        3  3412 1 1 34 LEU CD1  C   -8.319  -0.028  -6.899 1.00 . A A . 690 LEU CD1  1 1 
        3  3413 1 1 34 LEU CD2  C   -8.876  -1.473  -4.936 1.00 . A A . 690 LEU CD2  1 1 
        3  3414 1 1 34 LEU CG   C   -8.100  -0.241  -5.403 1.00 . A A . 690 LEU CG   1 1 
        3  3415 1 1 34 LEU H    H   -4.313  -0.976  -3.331 1.00 . A A . 690 LEU H    1 1 
        3  3416 1 1 34 LEU HA   H   -6.293   1.169  -3.643 1.00 . A A . 690 LEU HA   1 1 
        3  3417 1 1 34 LEU HB2  H   -6.045   0.159  -5.856 1.00 . A A . 690 LEU HB2  1 1 
        3  3418 1 1 34 LEU HB3  H   -6.333  -1.433  -5.189 1.00 . A A . 690 LEU HB3  1 1 
        3  3419 1 1 34 LEU HD11 H   -7.796   0.863  -7.216 1.00 . A A . 690 LEU HD11 1 1 
        3  3420 1 1 34 LEU HD12 H   -9.375   0.087  -7.096 1.00 . A A . 690 LEU HD12 1 1 
        3  3421 1 1 34 LEU HD13 H   -7.942  -0.881  -7.446 1.00 . A A . 690 LEU HD13 1 1 
        3  3422 1 1 34 LEU HD21 H   -8.498  -2.353  -5.439 1.00 . A A . 690 LEU HD21 1 1 
        3  3423 1 1 34 LEU HD22 H   -9.923  -1.349  -5.166 1.00 . A A . 690 LEU HD22 1 1 
        3  3424 1 1 34 LEU HD23 H   -8.757  -1.592  -3.869 1.00 . A A . 690 LEU HD23 1 1 
        3  3425 1 1 34 LEU HG   H   -8.489   0.623  -4.883 1.00 . A A . 690 LEU HG   1 1 
        3  3426 1 1 34 LEU N    N   -4.651  -0.107  -3.636 1.00 . A A . 690 LEU N    1 1 
        3  3427 1 1 34 LEU O    O   -6.395  -1.635  -2.071 1.00 . A A . 690 LEU O    1 1 
        3  3428 1 1 35 ALA C    C  -10.319  -0.401  -1.267 1.00 . A A . 691 ALA C    1 1 
        3  3429 1 1 35 ALA CA   C   -8.809  -0.651  -1.068 1.00 . A A . 691 ALA CA   1 1 
        3  3430 1 1 35 ALA CB   C   -8.364  -0.106   0.285 1.00 . A A . 691 ALA CB   1 1 
        3  3431 1 1 35 ALA H    H   -8.297   0.787  -2.561 1.00 . A A . 691 ALA H    1 1 
        3  3432 1 1 35 ALA HA   H   -8.632  -1.719  -1.073 1.00 . A A . 691 ALA HA   1 1 
        3  3433 1 1 35 ALA HB1  H   -8.892  -0.621   1.075 1.00 . A A . 691 ALA HB1  1 1 
        3  3434 1 1 35 ALA HB2  H   -8.580   0.952   0.336 1.00 . A A . 691 ALA HB2  1 1 
        3  3435 1 1 35 ALA HB3  H   -7.303  -0.261   0.402 1.00 . A A . 691 ALA HB3  1 1 
        3  3436 1 1 35 ALA N    N   -7.997  -0.051  -2.147 1.00 . A A . 691 ALA N    1 1 
        3  3437 1 1 35 ALA O    O  -10.758   0.743  -1.387 1.00 . A A . 691 ALA O    1 1 
        3  3438 1 1 36 ILE C    C  -13.358  -2.158  -0.397 1.00 . A A . 692 ILE C    1 1 
        3  3439 1 1 36 ILE CA   C  -12.574  -1.385  -1.481 1.00 . A A . 692 ILE CA   1 1 
        3  3440 1 1 36 ILE CB   C  -12.985  -1.943  -2.877 1.00 . A A . 692 ILE CB   1 1 
        3  3441 1 1 36 ILE CD1  C  -12.729   0.302  -4.093 1.00 . A A . 692 ILE CD1  1 1 
        3  3442 1 1 36 ILE CG1  C  -12.311  -1.153  -4.014 1.00 . A A . 692 ILE CG1  1 1 
        3  3443 1 1 36 ILE CG2  C  -14.507  -1.926  -3.043 1.00 . A A . 692 ILE CG2  1 1 
        3  3444 1 1 36 ILE H    H  -10.710  -2.366  -1.140 1.00 . A A . 692 ILE H    1 1 
        3  3445 1 1 36 ILE HA   H  -12.855  -0.341  -1.436 1.00 . A A . 692 ILE HA   1 1 
        3  3446 1 1 36 ILE HB   H  -12.662  -2.973  -2.931 1.00 . A A . 692 ILE HB   1 1 
        3  3447 1 1 36 ILE HD11 H  -12.445   0.807  -3.181 1.00 . A A . 692 ILE HD11 1 1 
        3  3448 1 1 36 ILE HD12 H  -13.798   0.364  -4.221 1.00 . A A . 692 ILE HD12 1 1 
        3  3449 1 1 36 ILE HD13 H  -12.238   0.772  -4.932 1.00 . A A . 692 ILE HD13 1 1 
        3  3450 1 1 36 ILE HG12 H  -11.241  -1.176  -3.874 1.00 . A A . 692 ILE HG12 1 1 
        3  3451 1 1 36 ILE HG13 H  -12.554  -1.617  -4.961 1.00 . A A . 692 ILE HG13 1 1 
        3  3452 1 1 36 ILE HG21 H  -14.962  -2.548  -2.284 1.00 . A A . 692 ILE HG21 1 1 
        3  3453 1 1 36 ILE HG22 H  -14.770  -2.303  -4.020 1.00 . A A . 692 ILE HG22 1 1 
        3  3454 1 1 36 ILE HG23 H  -14.871  -0.912  -2.940 1.00 . A A . 692 ILE HG23 1 1 
        3  3455 1 1 36 ILE N    N  -11.114  -1.480  -1.275 1.00 . A A . 692 ILE N    1 1 
        3  3456 1 1 36 ILE O    O  -12.947  -3.237   0.026 1.00 . A A . 692 ILE O    1 1 
        3  3457 1 1 37 ASP C    C  -16.826  -2.321   0.380 1.00 . A A . 693 ASP C    1 1 
        3  3458 1 1 37 ASP CA   C  -15.404  -2.300   0.965 1.00 . A A . 693 ASP CA   1 1 
        3  3459 1 1 37 ASP CB   C  -15.417  -1.621   2.339 1.00 . A A . 693 ASP CB   1 1 
        3  3460 1 1 37 ASP CG   C  -16.140  -2.447   3.399 1.00 . A A . 693 ASP CG   1 1 
        3  3461 1 1 37 ASP H    H  -14.715  -0.695  -0.251 1.00 . A A . 693 ASP H    1 1 
        3  3462 1 1 37 ASP HA   H  -15.057  -3.318   1.072 1.00 . A A . 693 ASP HA   1 1 
        3  3463 1 1 37 ASP HB2  H  -14.399  -1.461   2.662 1.00 . A A . 693 ASP HB2  1 1 
        3  3464 1 1 37 ASP HB3  H  -15.912  -0.663   2.255 1.00 . A A . 693 ASP HB3  1 1 
        3  3465 1 1 37 ASP N    N  -14.488  -1.600   0.047 1.00 . A A . 693 ASP N    1 1 
        3  3466 1 1 37 ASP O    O  -17.264  -1.350  -0.237 1.00 . A A . 693 ASP O    1 1 
        3  3467 1 1 37 ASP OD1  O  -17.384  -2.467   3.409 1.00 . A A . 693 ASP OD1  1 1 
        3  3468 1 1 37 ASP OD2  O  -15.477  -3.082   4.237 1.00 . A A . 693 ASP OD2  1 1 
        3  3469 1 1 38 LYS C    C  -19.906  -2.571   0.535 1.00 . A A . 694 LYS C    1 1 
        3  3470 1 1 38 LYS CA   C  -18.885  -3.599   0.013 1.00 . A A . 694 LYS CA   1 1 
        3  3471 1 1 38 LYS CB   C  -19.393  -5.027   0.277 1.00 . A A . 694 LYS CB   1 1 
        3  3472 1 1 38 LYS CD   C  -21.181  -6.772  -0.170 1.00 . A A . 694 LYS CD   1 1 
        3  3473 1 1 38 LYS CE   C  -21.264  -7.235   1.283 1.00 . A A . 694 LYS CE   1 1 
        3  3474 1 1 38 LYS CG   C  -20.787  -5.302  -0.294 1.00 . A A . 694 LYS CG   1 1 
        3  3475 1 1 38 LYS H    H  -17.181  -4.118   1.180 1.00 . A A . 694 LYS H    1 1 
        3  3476 1 1 38 LYS HA   H  -18.783  -3.465  -1.055 1.00 . A A . 694 LYS HA   1 1 
        3  3477 1 1 38 LYS HB2  H  -18.700  -5.730  -0.163 1.00 . A A . 694 LYS HB2  1 1 
        3  3478 1 1 38 LYS HB3  H  -19.427  -5.191   1.345 1.00 . A A . 694 LYS HB3  1 1 
        3  3479 1 1 38 LYS HD2  H  -22.146  -6.913  -0.634 1.00 . A A . 694 LYS HD2  1 1 
        3  3480 1 1 38 LYS HD3  H  -20.446  -7.372  -0.686 1.00 . A A . 694 LYS HD3  1 1 
        3  3481 1 1 38 LYS HE2  H  -21.485  -8.292   1.296 1.00 . A A . 694 LYS HE2  1 1 
        3  3482 1 1 38 LYS HE3  H  -20.307  -7.066   1.757 1.00 . A A . 694 LYS HE3  1 1 
        3  3483 1 1 38 LYS HG2  H  -21.511  -4.703   0.241 1.00 . A A . 694 LYS HG2  1 1 
        3  3484 1 1 38 LYS HG3  H  -20.797  -5.026  -1.340 1.00 . A A . 694 LYS HG3  1 1 
        3  3485 1 1 38 LYS HZ1  H  -22.068  -5.510   2.151 1.00 . A A . 694 LYS HZ1  1 1 
        3  3486 1 1 38 LYS HZ2  H  -22.414  -6.928   3.002 1.00 . A A . 694 LYS HZ2  1 1 
        3  3487 1 1 38 LYS HZ3  H  -23.231  -6.585   1.563 1.00 . A A . 694 LYS HZ3  1 1 
        3  3488 1 1 38 LYS N    N  -17.550  -3.416   0.603 1.00 . A A . 694 LYS N    1 1 
        3  3489 1 1 38 LYS NZ   N  -22.317  -6.514   2.051 1.00 . A A . 694 LYS NZ   1 1 
        3  3490 1 1 38 LYS O    O  -20.794  -2.135  -0.205 1.00 . A A . 694 LYS O    1 1 
        3  3491 1 1 39 GLU C    C  -20.500   0.206   2.059 1.00 . A A . 695 GLU C    1 1 
        3  3492 1 1 39 GLU CA   C  -20.765  -1.266   2.418 1.00 . A A . 695 GLU CA   1 1 
        3  3493 1 1 39 GLU CB   C  -20.770  -1.428   3.949 1.00 . A A . 695 GLU CB   1 1 
        3  3494 1 1 39 GLU CD   C  -19.546  -1.048   6.133 1.00 . A A . 695 GLU CD   1 1 
        3  3495 1 1 39 GLU CG   C  -19.612  -0.731   4.656 1.00 . A A . 695 GLU CG   1 1 
        3  3496 1 1 39 GLU H    H  -19.010  -2.484   2.329 1.00 . A A . 695 GLU H    1 1 
        3  3497 1 1 39 GLU HA   H  -21.742  -1.540   2.041 1.00 . A A . 695 GLU HA   1 1 
        3  3498 1 1 39 GLU HB2  H  -21.695  -1.027   4.340 1.00 . A A . 695 GLU HB2  1 1 
        3  3499 1 1 39 GLU HB3  H  -20.723  -2.483   4.186 1.00 . A A . 695 GLU HB3  1 1 
        3  3500 1 1 39 GLU HG2  H  -18.687  -1.042   4.194 1.00 . A A . 695 GLU HG2  1 1 
        3  3501 1 1 39 GLU HG3  H  -19.724   0.339   4.536 1.00 . A A . 695 GLU HG3  1 1 
        3  3502 1 1 39 GLU N    N  -19.780  -2.170   1.800 1.00 . A A . 695 GLU N    1 1 
        3  3503 1 1 39 GLU O    O  -21.423   0.956   1.745 1.00 . A A . 695 GLU O    1 1 
        3  3504 1 1 39 GLU OE1  O  -18.908  -2.039   6.497 1.00 . A A . 695 GLU OE1  1 1 
        3  3505 1 1 39 GLU OE2  O  -20.131  -0.312   6.929 1.00 . A A . 695 GLU OE2  1 1 
        3  3506 1 1 40 ASP C    C  -18.504   2.366   0.496 1.00 . A A . 696 ASP C    1 1 
        3  3507 1 1 40 ASP CA   C  -18.871   2.025   1.952 1.00 . A A . 696 ASP CA   1 1 
        3  3508 1 1 40 ASP CB   C  -17.701   2.351   2.890 1.00 . A A . 696 ASP CB   1 1 
        3  3509 1 1 40 ASP CG   C  -17.583   3.839   3.174 1.00 . A A . 696 ASP CG   1 1 
        3  3510 1 1 40 ASP H    H  -18.528  -0.052   2.254 1.00 . A A . 696 ASP H    1 1 
        3  3511 1 1 40 ASP HA   H  -19.726   2.620   2.242 1.00 . A A . 696 ASP HA   1 1 
        3  3512 1 1 40 ASP HB2  H  -17.847   1.833   3.830 1.00 . A A . 696 ASP HB2  1 1 
        3  3513 1 1 40 ASP HB3  H  -16.779   2.010   2.440 1.00 . A A . 696 ASP HB3  1 1 
        3  3514 1 1 40 ASP N    N  -19.233   0.613   2.105 1.00 . A A . 696 ASP N    1 1 
        3  3515 1 1 40 ASP O    O  -18.905   3.407  -0.031 1.00 . A A . 696 ASP O    1 1 
        3  3516 1 1 40 ASP OD1  O  -18.269   4.320   4.104 1.00 . A A . 696 ASP OD1  1 1 
        3  3517 1 1 40 ASP OD2  O  -16.819   4.534   2.473 1.00 . A A . 696 ASP OD2  1 1 
        3  3518 1 1 41 GLY C    C  -15.765   1.785  -1.605 1.00 . A A . 697 GLY C    1 1 
        3  3519 1 1 41 GLY CA   C  -17.284   1.728  -1.509 1.00 . A A . 697 GLY CA   1 1 
        3  3520 1 1 41 GLY H    H  -17.492   0.646   0.306 1.00 . A A . 697 GLY H    1 1 
        3  3521 1 1 41 GLY HA2  H  -17.642   0.931  -2.145 1.00 . A A . 697 GLY HA2  1 1 
        3  3522 1 1 41 GLY HA3  H  -17.695   2.665  -1.859 1.00 . A A . 697 GLY HA3  1 1 
        3  3523 1 1 41 GLY N    N  -17.744   1.481  -0.145 1.00 . A A . 697 GLY N    1 1 
        3  3524 1 1 41 GLY O    O  -15.082   0.793  -1.346 1.00 . A A . 697 GLY O    1 1 
        3  3525 1 1 42 ASP C    C  -13.170   3.549  -0.713 1.00 . A A . 698 ASP C    1 1 
        3  3526 1 1 42 ASP CA   C  -13.770   3.110  -2.061 1.00 . A A . 698 ASP CA   1 1 
        3  3527 1 1 42 ASP CB   C  -13.412   4.127  -3.150 1.00 . A A . 698 ASP CB   1 1 
        3  3528 1 1 42 ASP CG   C  -11.913   4.201  -3.391 1.00 . A A . 698 ASP CG   1 1 
        3  3529 1 1 42 ASP H    H  -15.809   3.705  -2.177 1.00 . A A . 698 ASP H    1 1 
        3  3530 1 1 42 ASP HA   H  -13.347   2.152  -2.329 1.00 . A A . 698 ASP HA   1 1 
        3  3531 1 1 42 ASP HB2  H  -13.898   3.845  -4.074 1.00 . A A . 698 ASP HB2  1 1 
        3  3532 1 1 42 ASP HB3  H  -13.762   5.105  -2.850 1.00 . A A . 698 ASP HB3  1 1 
        3  3533 1 1 42 ASP N    N  -15.222   2.945  -1.967 1.00 . A A . 698 ASP N    1 1 
        3  3534 1 1 42 ASP O    O  -13.515   4.607  -0.178 1.00 . A A . 698 ASP O    1 1 
        3  3535 1 1 42 ASP OD1  O  -11.220   4.955  -2.678 1.00 . A A . 698 ASP OD1  1 1 
        3  3536 1 1 42 ASP OD2  O  -11.411   3.489  -4.284 1.00 . A A . 698 ASP OD2  1 1 
        3  3537 1 1 43 LEU C    C  -10.079   3.326   0.846 1.00 . A A . 699 LEU C    1 1 
        3  3538 1 1 43 LEU CA   C  -11.574   3.054   1.079 1.00 . A A . 699 LEU CA   1 1 
        3  3539 1 1 43 LEU CB   C  -11.740   1.916   2.099 1.00 . A A . 699 LEU CB   1 1 
        3  3540 1 1 43 LEU CD1  C  -13.182   0.621   3.706 1.00 . A A . 699 LEU CD1  1 1 
        3  3541 1 1 43 LEU CD2  C  -13.816   2.968   3.080 1.00 . A A . 699 LEU CD2  1 1 
        3  3542 1 1 43 LEU CG   C  -13.175   1.668   2.595 1.00 . A A . 699 LEU CG   1 1 
        3  3543 1 1 43 LEU H    H  -12.059   1.893  -0.633 1.00 . A A . 699 LEU H    1 1 
        3  3544 1 1 43 LEU HA   H  -12.020   3.951   1.486 1.00 . A A . 699 LEU HA   1 1 
        3  3545 1 1 43 LEU HB2  H  -11.376   1.003   1.647 1.00 . A A . 699 LEU HB2  1 1 
        3  3546 1 1 43 LEU HB3  H  -11.121   2.140   2.958 1.00 . A A . 699 LEU HB3  1 1 
        3  3547 1 1 43 LEU HD11 H  -14.199   0.449   4.033 1.00 . A A . 699 LEU HD11 1 1 
        3  3548 1 1 43 LEU HD12 H  -12.592   0.973   4.541 1.00 . A A . 699 LEU HD12 1 1 
        3  3549 1 1 43 LEU HD13 H  -12.763  -0.303   3.334 1.00 . A A . 699 LEU HD13 1 1 
        3  3550 1 1 43 LEU HD21 H  -13.843   3.681   2.269 1.00 . A A . 699 LEU HD21 1 1 
        3  3551 1 1 43 LEU HD22 H  -13.237   3.373   3.897 1.00 . A A . 699 LEU HD22 1 1 
        3  3552 1 1 43 LEU HD23 H  -14.824   2.771   3.416 1.00 . A A . 699 LEU HD23 1 1 
        3  3553 1 1 43 LEU HG   H  -13.770   1.286   1.776 1.00 . A A . 699 LEU HG   1 1 
        3  3554 1 1 43 LEU N    N  -12.267   2.734  -0.175 1.00 . A A . 699 LEU N    1 1 
        3  3555 1 1 43 LEU O    O   -9.280   3.302   1.784 1.00 . A A . 699 LEU O    1 1 
        3  3556 1 1 44 THR C    C   -7.799   5.135   0.068 1.00 . A A . 700 THR C    1 1 
        3  3557 1 1 44 THR CA   C   -8.307   3.923  -0.736 1.00 . A A . 700 THR CA   1 1 
        3  3558 1 1 44 THR CB   C   -8.134   4.193  -2.254 1.00 . A A . 700 THR CB   1 1 
        3  3559 1 1 44 THR CG2  C   -6.665   4.394  -2.621 1.00 . A A . 700 THR CG2  1 1 
        3  3560 1 1 44 THR H    H  -10.379   3.606  -1.113 1.00 . A A . 700 THR H    1 1 
        3  3561 1 1 44 THR HA   H   -7.708   3.060  -0.476 1.00 . A A . 700 THR HA   1 1 
        3  3562 1 1 44 THR HB   H   -8.682   5.090  -2.512 1.00 . A A . 700 THR HB   1 1 
        3  3563 1 1 44 THR HG1  H   -9.535   3.327  -3.359 1.00 . A A . 700 THR HG1  1 1 
        3  3564 1 1 44 THR HG21 H   -6.107   3.502  -2.375 1.00 . A A . 700 THR HG21 1 1 
        3  3565 1 1 44 THR HG22 H   -6.266   5.234  -2.068 1.00 . A A . 700 THR HG22 1 1 
        3  3566 1 1 44 THR HG23 H   -6.582   4.589  -3.681 1.00 . A A . 700 THR HG23 1 1 
        3  3567 1 1 44 THR N    N   -9.705   3.612  -0.399 1.00 . A A . 700 THR N    1 1 
        3  3568 1 1 44 THR O    O   -6.619   5.222   0.406 1.00 . A A . 700 THR O    1 1 
        3  3569 1 1 44 THR OG1  O   -8.661   3.091  -3.013 1.00 . A A . 700 THR OG1  1 1 
        3  3570 1 1 45 SER C    C   -8.056   6.810   2.686 1.00 . A A . 701 SER C    1 1 
        3  3571 1 1 45 SER CA   C   -8.374   7.220   1.239 1.00 . A A . 701 SER CA   1 1 
        3  3572 1 1 45 SER CB   C   -9.530   8.229   1.241 1.00 . A A . 701 SER CB   1 1 
        3  3573 1 1 45 SER H    H   -9.625   5.961   0.056 1.00 . A A . 701 SER H    1 1 
        3  3574 1 1 45 SER HA   H   -7.500   7.695   0.815 1.00 . A A . 701 SER HA   1 1 
        3  3575 1 1 45 SER HB2  H   -9.654   8.636   0.249 1.00 . A A . 701 SER HB2  1 1 
        3  3576 1 1 45 SER HB3  H  -10.440   7.729   1.541 1.00 . A A . 701 SER HB3  1 1 
        3  3577 1 1 45 SER HG   H   -8.757   9.977   1.695 1.00 . A A . 701 SER HG   1 1 
        3  3578 1 1 45 SER N    N   -8.707   6.056   0.396 1.00 . A A . 701 SER N    1 1 
        3  3579 1 1 45 SER O    O   -7.342   7.516   3.401 1.00 . A A . 701 SER O    1 1 
        3  3580 1 1 45 SER OG   O   -9.282   9.300   2.142 1.00 . A A . 701 SER OG   1 1 
        3  3581 1 1 46 LYS C    C   -6.992   4.548   4.677 1.00 . A A . 702 LYS C    1 1 
        3  3582 1 1 46 LYS CA   C   -8.390   5.167   4.481 1.00 . A A . 702 LYS CA   1 1 
        3  3583 1 1 46 LYS CB   C   -9.449   4.105   4.815 1.00 . A A . 702 LYS CB   1 1 
        3  3584 1 1 46 LYS CD   C  -11.264   5.535   5.863 1.00 . A A . 702 LYS CD   1 1 
        3  3585 1 1 46 LYS CE   C  -12.754   5.867   5.851 1.00 . A A . 702 LYS CE   1 1 
        3  3586 1 1 46 LYS CG   C  -10.895   4.586   4.726 1.00 . A A . 702 LYS CG   1 1 
        3  3587 1 1 46 LYS H    H   -9.115   5.126   2.483 1.00 . A A . 702 LYS H    1 1 
        3  3588 1 1 46 LYS HA   H   -8.503   6.002   5.158 1.00 . A A . 702 LYS HA   1 1 
        3  3589 1 1 46 LYS HB2  H   -9.331   3.276   4.131 1.00 . A A . 702 LYS HB2  1 1 
        3  3590 1 1 46 LYS HB3  H   -9.274   3.748   5.821 1.00 . A A . 702 LYS HB3  1 1 
        3  3591 1 1 46 LYS HD2  H  -11.019   5.067   6.806 1.00 . A A . 702 LYS HD2  1 1 
        3  3592 1 1 46 LYS HD3  H  -10.699   6.450   5.756 1.00 . A A . 702 LYS HD3  1 1 
        3  3593 1 1 46 LYS HE2  H  -12.997   6.344   4.912 1.00 . A A . 702 LYS HE2  1 1 
        3  3594 1 1 46 LYS HE3  H  -13.316   4.947   5.939 1.00 . A A . 702 LYS HE3  1 1 
        3  3595 1 1 46 LYS HG2  H  -11.033   5.099   3.785 1.00 . A A . 702 LYS HG2  1 1 
        3  3596 1 1 46 LYS HG3  H  -11.549   3.723   4.762 1.00 . A A . 702 LYS HG3  1 1 
        3  3597 1 1 46 LYS HZ1  H  -12.629   7.677   6.882 1.00 . A A . 702 LYS HZ1  1 1 
        3  3598 1 1 46 LYS HZ2  H  -12.912   6.338   7.877 1.00 . A A . 702 LYS HZ2  1 1 
        3  3599 1 1 46 LYS HZ3  H  -14.160   6.969   6.928 1.00 . A A . 702 LYS HZ3  1 1 
        3  3600 1 1 46 LYS N    N   -8.584   5.661   3.108 1.00 . A A . 702 LYS N    1 1 
        3  3601 1 1 46 LYS NZ   N  -13.140   6.775   6.961 1.00 . A A . 702 LYS NZ   1 1 
        3  3602 1 1 46 LYS O    O   -6.518   4.411   5.809 1.00 . A A . 702 LYS O    1 1 
        3  3603 1 1 47 ILE C    C   -3.962   4.272   4.321 1.00 . A A . 703 ILE C    1 1 
        3  3604 1 1 47 ILE CA   C   -5.062   3.457   3.624 1.00 . A A . 703 ILE CA   1 1 
        3  3605 1 1 47 ILE CB   C   -4.569   3.069   2.204 1.00 . A A . 703 ILE CB   1 1 
        3  3606 1 1 47 ILE CD1  C   -5.208   1.792   0.077 1.00 . A A . 703 ILE CD1  1 1 
        3  3607 1 1 47 ILE CG1  C   -5.608   2.188   1.487 1.00 . A A . 703 ILE CG1  1 1 
        3  3608 1 1 47 ILE CG2  C   -3.216   2.355   2.279 1.00 . A A . 703 ILE CG2  1 1 
        3  3609 1 1 47 ILE H    H   -6.736   4.383   2.700 1.00 . A A . 703 ILE H    1 1 
        3  3610 1 1 47 ILE HA   H   -5.219   2.542   4.181 1.00 . A A . 703 ILE HA   1 1 
        3  3611 1 1 47 ILE HB   H   -4.432   3.980   1.638 1.00 . A A . 703 ILE HB   1 1 
        3  3612 1 1 47 ILE HD11 H   -4.271   1.256   0.105 1.00 . A A . 703 ILE HD11 1 1 
        3  3613 1 1 47 ILE HD12 H   -5.098   2.678  -0.531 1.00 . A A . 703 ILE HD12 1 1 
        3  3614 1 1 47 ILE HD13 H   -5.972   1.157  -0.348 1.00 . A A . 703 ILE HD13 1 1 
        3  3615 1 1 47 ILE HG12 H   -5.757   1.280   2.053 1.00 . A A . 703 ILE HG12 1 1 
        3  3616 1 1 47 ILE HG13 H   -6.545   2.726   1.425 1.00 . A A . 703 ILE HG13 1 1 
        3  3617 1 1 47 ILE HG21 H   -2.877   2.117   1.281 1.00 . A A . 703 ILE HG21 1 1 
        3  3618 1 1 47 ILE HG22 H   -3.319   1.443   2.849 1.00 . A A . 703 ILE HG22 1 1 
        3  3619 1 1 47 ILE HG23 H   -2.492   2.999   2.760 1.00 . A A . 703 ILE HG23 1 1 
        3  3620 1 1 47 ILE N    N   -6.345   4.171   3.574 1.00 . A A . 703 ILE N    1 1 
        3  3621 1 1 47 ILE O    O   -3.521   5.309   3.821 1.00 . A A . 703 ILE O    1 1 
        3  3622 1 1 48 LYS C    C   -1.086   3.724   5.678 1.00 . A A . 704 LYS C    1 1 
        3  3623 1 1 48 LYS CA   C   -2.383   4.371   6.184 1.00 . A A . 704 LYS CA   1 1 
        3  3624 1 1 48 LYS CB   C   -2.543   4.171   7.708 1.00 . A A . 704 LYS CB   1 1 
        3  3625 1 1 48 LYS CD   C   -0.190   3.967   8.694 1.00 . A A . 704 LYS CD   1 1 
        3  3626 1 1 48 LYS CE   C    0.858   4.608   9.603 1.00 . A A . 704 LYS CE   1 1 
        3  3627 1 1 48 LYS CG   C   -1.454   4.825   8.574 1.00 . A A . 704 LYS CG   1 1 
        3  3628 1 1 48 LYS H    H   -4.001   3.036   5.883 1.00 . A A . 704 LYS H    1 1 
        3  3629 1 1 48 LYS HA   H   -2.357   5.431   5.965 1.00 . A A . 704 LYS HA   1 1 
        3  3630 1 1 48 LYS HB2  H   -3.497   4.580   8.008 1.00 . A A . 704 LYS HB2  1 1 
        3  3631 1 1 48 LYS HB3  H   -2.545   3.108   7.916 1.00 . A A . 704 LYS HB3  1 1 
        3  3632 1 1 48 LYS HD2  H   -0.458   3.002   9.100 1.00 . A A . 704 LYS HD2  1 1 
        3  3633 1 1 48 LYS HD3  H    0.237   3.835   7.709 1.00 . A A . 704 LYS HD3  1 1 
        3  3634 1 1 48 LYS HE2  H    0.430   4.747  10.586 1.00 . A A . 704 LYS HE2  1 1 
        3  3635 1 1 48 LYS HE3  H    1.707   3.943   9.675 1.00 . A A . 704 LYS HE3  1 1 
        3  3636 1 1 48 LYS HG2  H   -1.187   5.774   8.135 1.00 . A A . 704 LYS HG2  1 1 
        3  3637 1 1 48 LYS HG3  H   -1.856   4.994   9.564 1.00 . A A . 704 LYS HG3  1 1 
        3  3638 1 1 48 LYS HZ1  H    1.632   5.842   8.104 1.00 . A A . 704 LYS HZ1  1 1 
        3  3639 1 1 48 LYS HZ2  H    2.120   6.272   9.663 1.00 . A A . 704 LYS HZ2  1 1 
        3  3640 1 1 48 LYS HZ3  H    0.551   6.622   9.140 1.00 . A A . 704 LYS HZ3  1 1 
        3  3641 1 1 48 LYS N    N   -3.530   3.794   5.481 1.00 . A A . 704 LYS N    1 1 
        3  3642 1 1 48 LYS NZ   N    1.320   5.926   9.090 1.00 . A A . 704 LYS NZ   1 1 
        3  3643 1 1 48 LYS O    O   -0.910   2.507   5.779 1.00 . A A . 704 LYS O    1 1 
        3  3644 1 1 49 VAL C    C    2.205   4.186   5.660 1.00 . A A . 705 VAL C    1 1 
        3  3645 1 1 49 VAL CA   C    1.090   4.040   4.613 1.00 . A A . 705 VAL CA   1 1 
        3  3646 1 1 49 VAL CB   C    1.501   4.793   3.321 1.00 . A A . 705 VAL CB   1 1 
        3  3647 1 1 49 VAL CG1  C    2.805   4.231   2.750 1.00 . A A . 705 VAL CG1  1 1 
        3  3648 1 1 49 VAL CG2  C    0.379   4.741   2.280 1.00 . A A . 705 VAL CG2  1 1 
        3  3649 1 1 49 VAL H    H   -0.387   5.497   5.070 1.00 . A A . 705 VAL H    1 1 
        3  3650 1 1 49 VAL HA   H    0.969   2.990   4.371 1.00 . A A . 705 VAL HA   1 1 
        3  3651 1 1 49 VAL HB   H    1.669   5.832   3.577 1.00 . A A . 705 VAL HB   1 1 
        3  3652 1 1 49 VAL HG11 H    2.667   3.193   2.484 1.00 . A A . 705 VAL HG11 1 1 
        3  3653 1 1 49 VAL HG12 H    3.587   4.310   3.489 1.00 . A A . 705 VAL HG12 1 1 
        3  3654 1 1 49 VAL HG13 H    3.086   4.794   1.871 1.00 . A A . 705 VAL HG13 1 1 
        3  3655 1 1 49 VAL HG21 H    0.678   5.291   1.399 1.00 . A A . 705 VAL HG21 1 1 
        3  3656 1 1 49 VAL HG22 H   -0.518   5.183   2.691 1.00 . A A . 705 VAL HG22 1 1 
        3  3657 1 1 49 VAL HG23 H    0.181   3.713   2.010 1.00 . A A . 705 VAL HG23 1 1 
        3  3658 1 1 49 VAL N    N   -0.187   4.537   5.131 1.00 . A A . 705 VAL N    1 1 
        3  3659 1 1 49 VAL O    O    2.520   5.290   6.104 1.00 . A A . 705 VAL O    1 1 
        3  3660 1 1 50 ASP C    C    5.201   2.676   6.301 1.00 . A A . 706 ASP C    1 1 
        3  3661 1 1 50 ASP CA   C    3.897   3.059   7.020 1.00 . A A . 706 ASP CA   1 1 
        3  3662 1 1 50 ASP CB   C    3.609   2.084   8.170 1.00 . A A . 706 ASP CB   1 1 
        3  3663 1 1 50 ASP CG   C    4.542   2.284   9.351 1.00 . A A . 706 ASP CG   1 1 
        3  3664 1 1 50 ASP H    H    2.440   2.207   5.736 1.00 . A A . 706 ASP H    1 1 
        3  3665 1 1 50 ASP HA   H    3.999   4.059   7.423 1.00 . A A . 706 ASP HA   1 1 
        3  3666 1 1 50 ASP HB2  H    2.593   2.229   8.509 1.00 . A A . 706 ASP HB2  1 1 
        3  3667 1 1 50 ASP HB3  H    3.718   1.068   7.811 1.00 . A A . 706 ASP HB3  1 1 
        3  3668 1 1 50 ASP N    N    2.778   3.061   6.074 1.00 . A A . 706 ASP N    1 1 
        3  3669 1 1 50 ASP O    O    5.318   1.577   5.755 1.00 . A A . 706 ASP O    1 1 
        3  3670 1 1 50 ASP OD1  O    5.670   1.756   9.330 1.00 . A A . 706 ASP OD1  1 1 
        3  3671 1 1 50 ASP OD2  O    4.146   2.971  10.313 1.00 . A A . 706 ASP OD2  1 1 
        3  3672 1 1 51 GLY C    C    7.589   4.321   4.403 1.00 . A A . 707 GLY C    1 1 
        3  3673 1 1 51 GLY CA   C    7.419   3.365   5.578 1.00 . A A . 707 GLY CA   1 1 
        3  3674 1 1 51 GLY H    H    6.036   4.427   6.787 1.00 . A A . 707 GLY H    1 1 
        3  3675 1 1 51 GLY HA2  H    8.244   3.502   6.263 1.00 . A A . 707 GLY HA2  1 1 
        3  3676 1 1 51 GLY HA3  H    7.440   2.350   5.204 1.00 . A A . 707 GLY HA3  1 1 
        3  3677 1 1 51 GLY N    N    6.170   3.587   6.299 1.00 . A A . 707 GLY N    1 1 
        3  3678 1 1 51 GLY O    O    6.641   4.996   4.001 1.00 . A A . 707 GLY O    1 1 
        3  3679 1 1 52 GLU C    C   10.230   4.805   1.848 1.00 . A A . 708 GLU C    1 1 
        3  3680 1 1 52 GLU CA   C    9.072   5.300   2.729 1.00 . A A . 708 GLU CA   1 1 
        3  3681 1 1 52 GLU CB   C    9.397   6.696   3.279 1.00 . A A . 708 GLU CB   1 1 
        3  3682 1 1 52 GLU CD   C    9.888   9.134   2.787 1.00 . A A . 708 GLU CD   1 1 
        3  3683 1 1 52 GLU CG   C    9.575   7.763   2.203 1.00 . A A . 708 GLU CG   1 1 
        3  3684 1 1 52 GLU H    H    9.503   3.783   4.163 1.00 . A A . 708 GLU H    1 1 
        3  3685 1 1 52 GLU HA   H    8.180   5.365   2.120 1.00 . A A . 708 GLU HA   1 1 
        3  3686 1 1 52 GLU HB2  H    8.594   7.007   3.935 1.00 . A A . 708 GLU HB2  1 1 
        3  3687 1 1 52 GLU HB3  H   10.311   6.639   3.852 1.00 . A A . 708 GLU HB3  1 1 
        3  3688 1 1 52 GLU HG2  H   10.389   7.469   1.555 1.00 . A A . 708 GLU HG2  1 1 
        3  3689 1 1 52 GLU HG3  H    8.664   7.831   1.622 1.00 . A A . 708 GLU HG3  1 1 
        3  3690 1 1 52 GLU N    N    8.792   4.374   3.835 1.00 . A A . 708 GLU N    1 1 
        3  3691 1 1 52 GLU O    O   11.240   4.306   2.351 1.00 . A A . 708 GLU O    1 1 
        3  3692 1 1 52 GLU OE1  O    8.943   9.869   3.145 1.00 . A A . 708 GLU OE1  1 1 
        3  3693 1 1 52 GLU OE2  O   11.080   9.473   2.905 1.00 . A A . 708 GLU OE2  1 1 
        3  3694 1 1 53 VAL C    C   11.945   5.730  -0.900 1.00 . A A . 709 VAL C    1 1 
        3  3695 1 1 53 VAL CA   C   11.106   4.532  -0.425 1.00 . A A . 709 VAL CA   1 1 
        3  3696 1 1 53 VAL CB   C   10.472   3.841  -1.662 1.00 . A A . 709 VAL CB   1 1 
        3  3697 1 1 53 VAL CG1  C   11.546   3.421  -2.669 1.00 . A A . 709 VAL CG1  1 1 
        3  3698 1 1 53 VAL CG2  C    9.630   2.640  -1.237 1.00 . A A . 709 VAL CG2  1 1 
        3  3699 1 1 53 VAL H    H    9.242   5.348   0.193 1.00 . A A . 709 VAL H    1 1 
        3  3700 1 1 53 VAL HA   H   11.757   3.819   0.065 1.00 . A A . 709 VAL HA   1 1 
        3  3701 1 1 53 VAL HB   H    9.818   4.554  -2.149 1.00 . A A . 709 VAL HB   1 1 
        3  3702 1 1 53 VAL HG11 H   12.235   2.734  -2.199 1.00 . A A . 709 VAL HG11 1 1 
        3  3703 1 1 53 VAL HG12 H   12.085   4.294  -3.011 1.00 . A A . 709 VAL HG12 1 1 
        3  3704 1 1 53 VAL HG13 H   11.078   2.936  -3.515 1.00 . A A . 709 VAL HG13 1 1 
        3  3705 1 1 53 VAL HG21 H   10.263   1.905  -0.761 1.00 . A A . 709 VAL HG21 1 1 
        3  3706 1 1 53 VAL HG22 H    9.161   2.199  -2.106 1.00 . A A . 709 VAL HG22 1 1 
        3  3707 1 1 53 VAL HG23 H    8.867   2.959  -0.542 1.00 . A A . 709 VAL HG23 1 1 
        3  3708 1 1 53 VAL N    N   10.075   4.948   0.533 1.00 . A A . 709 VAL N    1 1 
        3  3709 1 1 53 VAL O    O   11.401   6.746  -1.336 1.00 . A A . 709 VAL O    1 1 
        3  3710 1 1 54 ASP C    C   14.668   6.296  -2.716 1.00 . A A . 710 ASP C    1 1 
        3  3711 1 1 54 ASP CA   C   14.175   6.648  -1.303 1.00 . A A . 710 ASP CA   1 1 
        3  3712 1 1 54 ASP CB   C   15.367   6.812  -0.354 1.00 . A A . 710 ASP CB   1 1 
        3  3713 1 1 54 ASP CG   C   16.342   7.872  -0.834 1.00 . A A . 710 ASP CG   1 1 
        3  3714 1 1 54 ASP H    H   13.642   4.813  -0.377 1.00 . A A . 710 ASP H    1 1 
        3  3715 1 1 54 ASP HA   H   13.628   7.581  -1.348 1.00 . A A . 710 ASP HA   1 1 
        3  3716 1 1 54 ASP HB2  H   15.005   7.093   0.623 1.00 . A A . 710 ASP HB2  1 1 
        3  3717 1 1 54 ASP HB3  H   15.893   5.870  -0.276 1.00 . A A . 710 ASP HB3  1 1 
        3  3718 1 1 54 ASP N    N   13.267   5.612  -0.801 1.00 . A A . 710 ASP N    1 1 
        3  3719 1 1 54 ASP O    O   15.018   5.147  -2.993 1.00 . A A . 710 ASP O    1 1 
        3  3720 1 1 54 ASP OD1  O   16.076   9.074  -0.636 1.00 . A A . 710 ASP OD1  1 1 
        3  3721 1 1 54 ASP OD2  O   17.373   7.509  -1.427 1.00 . A A . 710 ASP OD2  1 1 
        3  3722 1 1 55 THR C    C   16.470   7.706  -5.324 1.00 . A A . 711 THR C    1 1 
        3  3723 1 1 55 THR CA   C   15.113   7.063  -5.001 1.00 . A A . 711 THR CA   1 1 
        3  3724 1 1 55 THR CB   C   14.048   7.582  -6.001 1.00 . A A . 711 THR CB   1 1 
        3  3725 1 1 55 THR CG2  C   12.722   6.848  -5.808 1.00 . A A . 711 THR CG2  1 1 
        3  3726 1 1 55 THR H    H   14.439   8.189  -3.326 1.00 . A A . 711 THR H    1 1 
        3  3727 1 1 55 THR HA   H   15.207   5.996  -5.146 1.00 . A A . 711 THR HA   1 1 
        3  3728 1 1 55 THR HB   H   14.400   7.393  -7.006 1.00 . A A . 711 THR HB   1 1 
        3  3729 1 1 55 THR HG1  H   13.123   9.279  -6.421 1.00 . A A . 711 THR HG1  1 1 
        3  3730 1 1 55 THR HG21 H   12.861   5.794  -6.000 1.00 . A A . 711 THR HG21 1 1 
        3  3731 1 1 55 THR HG22 H   11.987   7.242  -6.496 1.00 . A A . 711 THR HG22 1 1 
        3  3732 1 1 55 THR HG23 H   12.374   6.986  -4.794 1.00 . A A . 711 THR HG23 1 1 
        3  3733 1 1 55 THR N    N   14.703   7.289  -3.607 1.00 . A A . 711 THR N    1 1 
        3  3734 1 1 55 THR O    O   16.775   7.989  -6.481 1.00 . A A . 711 THR O    1 1 
        3  3735 1 1 55 THR OG1  O   13.845   8.998  -5.841 1.00 . A A . 711 THR OG1  1 1 
        3  3736 1 1 56 THR C    C   19.681   7.312  -4.081 1.00 . A A . 712 THR C    1 1 
        3  3737 1 1 56 THR CA   C   18.674   8.394  -4.497 1.00 . A A . 712 THR CA   1 1 
        3  3738 1 1 56 THR CB   C   18.979   9.693  -3.708 1.00 . A A . 712 THR CB   1 1 
        3  3739 1 1 56 THR CG2  C   17.990  10.796  -4.065 1.00 . A A . 712 THR CG2  1 1 
        3  3740 1 1 56 THR H    H   16.966   7.764  -3.388 1.00 . A A . 712 THR H    1 1 
        3  3741 1 1 56 THR HA   H   18.809   8.601  -5.552 1.00 . A A . 712 THR HA   1 1 
        3  3742 1 1 56 THR HB   H   19.975  10.029  -3.972 1.00 . A A . 712 THR HB   1 1 
        3  3743 1 1 56 THR HG1  H   18.011   9.384  -2.007 1.00 . A A . 712 THR HG1  1 1 
        3  3744 1 1 56 THR HG21 H   18.045  11.001  -5.125 1.00 . A A . 712 THR HG21 1 1 
        3  3745 1 1 56 THR HG22 H   18.233  11.692  -3.512 1.00 . A A . 712 THR HG22 1 1 
        3  3746 1 1 56 THR HG23 H   16.989  10.478  -3.812 1.00 . A A . 712 THR HG23 1 1 
        3  3747 1 1 56 THR N    N   17.291   7.924  -4.299 1.00 . A A . 712 THR N    1 1 
        3  3748 1 1 56 THR O    O   20.809   7.273  -4.572 1.00 . A A . 712 THR O    1 1 
        3  3749 1 1 56 THR OG1  O   18.934   9.448  -2.294 1.00 . A A . 712 THR OG1  1 1 
        3  3750 1 1 57 LYS C    C   19.343   3.974  -3.081 1.00 . A A . 713 LYS C    1 1 
        3  3751 1 1 57 LYS CA   C   20.057   5.289  -2.725 1.00 . A A . 713 LYS CA   1 1 
        3  3752 1 1 57 LYS CB   C   20.318   5.355  -1.203 1.00 . A A . 713 LYS CB   1 1 
        3  3753 1 1 57 LYS CD   C   21.793   7.441  -1.169 1.00 . A A . 713 LYS CD   1 1 
        3  3754 1 1 57 LYS CE   C   21.094   8.342  -0.151 1.00 . A A . 713 LYS CE   1 1 
        3  3755 1 1 57 LYS CG   C   21.674   5.954  -0.820 1.00 . A A . 713 LYS CG   1 1 
        3  3756 1 1 57 LYS H    H   18.376   6.577  -2.761 1.00 . A A . 713 LYS H    1 1 
        3  3757 1 1 57 LYS HA   H   21.003   5.320  -3.248 1.00 . A A . 713 LYS HA   1 1 
        3  3758 1 1 57 LYS HB2  H   19.545   5.956  -0.746 1.00 . A A . 713 LYS HB2  1 1 
        3  3759 1 1 57 LYS HB3  H   20.263   4.355  -0.794 1.00 . A A . 713 LYS HB3  1 1 
        3  3760 1 1 57 LYS HD2  H   22.840   7.706  -1.200 1.00 . A A . 713 LYS HD2  1 1 
        3  3761 1 1 57 LYS HD3  H   21.355   7.608  -2.144 1.00 . A A . 713 LYS HD3  1 1 
        3  3762 1 1 57 LYS HE2  H   21.518   8.156   0.825 1.00 . A A . 713 LYS HE2  1 1 
        3  3763 1 1 57 LYS HE3  H   21.270   9.372  -0.425 1.00 . A A . 713 LYS HE3  1 1 
        3  3764 1 1 57 LYS HG2  H   21.812   5.838   0.246 1.00 . A A . 713 LYS HG2  1 1 
        3  3765 1 1 57 LYS HG3  H   22.452   5.411  -1.339 1.00 . A A . 713 LYS HG3  1 1 
        3  3766 1 1 57 LYS HZ1  H   19.431   7.161   0.291 1.00 . A A . 713 LYS HZ1  1 1 
        3  3767 1 1 57 LYS HZ2  H   19.197   8.199  -1.024 1.00 . A A . 713 LYS HZ2  1 1 
        3  3768 1 1 57 LYS HZ3  H   19.188   8.812   0.548 1.00 . A A . 713 LYS HZ3  1 1 
        3  3769 1 1 57 LYS N    N   19.259   6.443  -3.161 1.00 . A A . 713 LYS N    1 1 
        3  3770 1 1 57 LYS NZ   N   19.627   8.111  -0.081 1.00 . A A . 713 LYS NZ   1 1 
        3  3771 1 1 57 LYS O    O   18.156   3.803  -2.798 1.00 . A A . 713 LYS O    1 1 
        3  3772 1 1 58 ALA C    C   19.427   0.756  -2.964 1.00 . A A . 714 ALA C    1 1 
        3  3773 1 1 58 ALA CA   C   19.507   1.761  -4.122 1.00 . A A . 714 ALA CA   1 1 
        3  3774 1 1 58 ALA CB   C   20.322   1.172  -5.267 1.00 . A A . 714 ALA CB   1 1 
        3  3775 1 1 58 ALA H    H   21.025   3.232  -3.875 1.00 . A A . 714 ALA H    1 1 
        3  3776 1 1 58 ALA HA   H   18.507   1.946  -4.492 1.00 . A A . 714 ALA HA   1 1 
        3  3777 1 1 58 ALA HB1  H   20.324   1.861  -6.100 1.00 . A A . 714 ALA HB1  1 1 
        3  3778 1 1 58 ALA HB2  H   19.885   0.234  -5.578 1.00 . A A . 714 ALA HB2  1 1 
        3  3779 1 1 58 ALA HB3  H   21.338   1.005  -4.940 1.00 . A A . 714 ALA HB3  1 1 
        3  3780 1 1 58 ALA N    N   20.076   3.048  -3.701 1.00 . A A . 714 ALA N    1 1 
        3  3781 1 1 58 ALA O    O   20.379   0.590  -2.199 1.00 . A A . 714 ALA O    1 1 
        3  3782 1 1 59 GLY C    C   16.641  -1.374  -1.702 1.00 . A A . 715 GLY C    1 1 
        3  3783 1 1 59 GLY CA   C   18.090  -0.916  -1.807 1.00 . A A . 715 GLY CA   1 1 
        3  3784 1 1 59 GLY H    H   17.565   0.266  -3.488 1.00 . A A . 715 GLY H    1 1 
        3  3785 1 1 59 GLY HA2  H   18.714  -1.772  -2.020 1.00 . A A . 715 GLY HA2  1 1 
        3  3786 1 1 59 GLY HA3  H   18.391  -0.492  -0.858 1.00 . A A . 715 GLY HA3  1 1 
        3  3787 1 1 59 GLY N    N   18.288   0.083  -2.854 1.00 . A A . 715 GLY N    1 1 
        3  3788 1 1 59 GLY O    O   15.760  -0.813  -2.354 1.00 . A A . 715 GLY O    1 1 
        3  3789 1 1 60 THR C    C   14.341  -2.186   0.498 1.00 . A A . 716 THR C    1 1 
        3  3790 1 1 60 THR CA   C   15.019  -2.894  -0.686 1.00 . A A . 716 THR CA   1 1 
        3  3791 1 1 60 THR CB   C   14.984  -4.428  -0.453 1.00 . A A . 716 THR CB   1 1 
        3  3792 1 1 60 THR CG2  C   13.594  -4.900  -0.028 1.00 . A A . 716 THR CG2  1 1 
        3  3793 1 1 60 THR H    H   17.134  -2.845  -0.437 1.00 . A A . 716 THR H    1 1 
        3  3794 1 1 60 THR HA   H   14.452  -2.683  -1.584 1.00 . A A . 716 THR HA   1 1 
        3  3795 1 1 60 THR HB   H   15.687  -4.671   0.335 1.00 . A A . 716 THR HB   1 1 
        3  3796 1 1 60 THR HG1  H   15.453  -6.061  -1.469 1.00 . A A . 716 THR HG1  1 1 
        3  3797 1 1 60 THR HG21 H   13.595  -5.976   0.076 1.00 . A A . 716 THR HG21 1 1 
        3  3798 1 1 60 THR HG22 H   12.868  -4.611  -0.775 1.00 . A A . 716 THR HG22 1 1 
        3  3799 1 1 60 THR HG23 H   13.333  -4.450   0.919 1.00 . A A . 716 THR HG23 1 1 
        3  3800 1 1 60 THR N    N   16.387  -2.402  -0.898 1.00 . A A . 716 THR N    1 1 
        3  3801 1 1 60 THR O    O   14.850  -2.191   1.622 1.00 . A A . 716 THR O    1 1 
        3  3802 1 1 60 THR OG1  O   15.376  -5.116  -1.652 1.00 . A A . 716 THR OG1  1 1 
        3  3803 1 1 61 TYR C    C   11.046  -1.615   1.443 1.00 . A A . 717 TYR C    1 1 
        3  3804 1 1 61 TYR CA   C   12.395  -0.895   1.262 1.00 . A A . 717 TYR CA   1 1 
        3  3805 1 1 61 TYR CB   C   12.150   0.573   0.875 1.00 . A A . 717 TYR CB   1 1 
        3  3806 1 1 61 TYR CD1  C   13.977   1.337  -0.704 1.00 . A A . 717 TYR CD1  1 1 
        3  3807 1 1 61 TYR CD2  C   14.045   2.121   1.548 1.00 . A A . 717 TYR CD2  1 1 
        3  3808 1 1 61 TYR CE1  C   15.127   2.049  -0.992 1.00 . A A . 717 TYR CE1  1 1 
        3  3809 1 1 61 TYR CE2  C   15.195   2.837   1.266 1.00 . A A . 717 TYR CE2  1 1 
        3  3810 1 1 61 TYR CG   C   13.416   1.358   0.570 1.00 . A A . 717 TYR CG   1 1 
        3  3811 1 1 61 TYR CZ   C   15.732   2.797  -0.006 1.00 . A A . 717 TYR CZ   1 1 
        3  3812 1 1 61 TYR H    H   12.874  -1.555  -0.695 1.00 . A A . 717 TYR H    1 1 
        3  3813 1 1 61 TYR HA   H   12.944  -0.931   2.194 1.00 . A A . 717 TYR HA   1 1 
        3  3814 1 1 61 TYR HB2  H   11.521   0.606  -0.005 1.00 . A A . 717 TYR HB2  1 1 
        3  3815 1 1 61 TYR HB3  H   11.639   1.070   1.688 1.00 . A A . 717 TYR HB3  1 1 
        3  3816 1 1 61 TYR HD1  H   13.502   0.751  -1.478 1.00 . A A . 717 TYR HD1  1 1 
        3  3817 1 1 61 TYR HD2  H   13.624   2.149   2.544 1.00 . A A . 717 TYR HD2  1 1 
        3  3818 1 1 61 TYR HE1  H   15.544   2.017  -1.988 1.00 . A A . 717 TYR HE1  1 1 
        3  3819 1 1 61 TYR HE2  H   15.668   3.424   2.040 1.00 . A A . 717 TYR HE2  1 1 
        3  3820 1 1 61 TYR HH   H   16.819   3.883  -1.180 1.00 . A A . 717 TYR HH   1 1 
        3  3821 1 1 61 TYR N    N   13.194  -1.566   0.230 1.00 . A A . 717 TYR N    1 1 
        3  3822 1 1 61 TYR O    O   10.412  -2.014   0.464 1.00 . A A . 717 TYR O    1 1 
        3  3823 1 1 61 TYR OH   O   16.882   3.504  -0.291 1.00 . A A . 717 TYR OH   1 1 
        3  3824 1 1 62 VAL C    C    8.228  -1.481   3.344 1.00 . A A . 718 VAL C    1 1 
        3  3825 1 1 62 VAL CA   C    9.346  -2.473   2.981 1.00 . A A . 718 VAL CA   1 1 
        3  3826 1 1 62 VAL CB   C    9.513  -3.501   4.130 1.00 . A A . 718 VAL CB   1 1 
        3  3827 1 1 62 VAL CG1  C    8.202  -4.242   4.399 1.00 . A A . 718 VAL CG1  1 1 
        3  3828 1 1 62 VAL CG2  C   10.634  -4.489   3.812 1.00 . A A . 718 VAL CG2  1 1 
        3  3829 1 1 62 VAL H    H   11.142  -1.424   3.435 1.00 . A A . 718 VAL H    1 1 
        3  3830 1 1 62 VAL HA   H    9.050  -3.012   2.090 1.00 . A A . 718 VAL HA   1 1 
        3  3831 1 1 62 VAL HB   H    9.784  -2.963   5.029 1.00 . A A . 718 VAL HB   1 1 
        3  3832 1 1 62 VAL HG11 H    8.340  -4.933   5.217 1.00 . A A . 718 VAL HG11 1 1 
        3  3833 1 1 62 VAL HG12 H    7.906  -4.788   3.514 1.00 . A A . 718 VAL HG12 1 1 
        3  3834 1 1 62 VAL HG13 H    7.430  -3.530   4.656 1.00 . A A . 718 VAL HG13 1 1 
        3  3835 1 1 62 VAL HG21 H   11.560  -3.950   3.664 1.00 . A A . 718 VAL HG21 1 1 
        3  3836 1 1 62 VAL HG22 H   10.390  -5.038   2.913 1.00 . A A . 718 VAL HG22 1 1 
        3  3837 1 1 62 VAL HG23 H   10.749  -5.180   4.635 1.00 . A A . 718 VAL HG23 1 1 
        3  3838 1 1 62 VAL N    N   10.609  -1.780   2.691 1.00 . A A . 718 VAL N    1 1 
        3  3839 1 1 62 VAL O    O    8.311  -0.773   4.350 1.00 . A A . 718 VAL O    1 1 
        3  3840 1 1 63 LEU C    C    4.847  -1.298   3.338 1.00 . A A . 719 LEU C    1 1 
        3  3841 1 1 63 LEU CA   C    6.047  -0.540   2.748 1.00 . A A . 719 LEU CA   1 1 
        3  3842 1 1 63 LEU CB   C    5.633   0.139   1.432 1.00 . A A . 719 LEU CB   1 1 
        3  3843 1 1 63 LEU CD1  C    6.188   1.621  -0.531 1.00 . A A . 719 LEU CD1  1 1 
        3  3844 1 1 63 LEU CD2  C    7.256   2.052   1.708 1.00 . A A . 719 LEU CD2  1 1 
        3  3845 1 1 63 LEU CG   C    6.723   0.985   0.751 1.00 . A A . 719 LEU CG   1 1 
        3  3846 1 1 63 LEU H    H    7.176  -2.031   1.734 1.00 . A A . 719 LEU H    1 1 
        3  3847 1 1 63 LEU HA   H    6.358   0.222   3.453 1.00 . A A . 719 LEU HA   1 1 
        3  3848 1 1 63 LEU HB2  H    5.319  -0.631   0.739 1.00 . A A . 719 LEU HB2  1 1 
        3  3849 1 1 63 LEU HB3  H    4.786   0.780   1.633 1.00 . A A . 719 LEU HB3  1 1 
        3  3850 1 1 63 LEU HD11 H    5.351   2.264  -0.295 1.00 . A A . 719 LEU HD11 1 1 
        3  3851 1 1 63 LEU HD12 H    5.864   0.846  -1.210 1.00 . A A . 719 LEU HD12 1 1 
        3  3852 1 1 63 LEU HD13 H    6.968   2.203  -0.998 1.00 . A A . 719 LEU HD13 1 1 
        3  3853 1 1 63 LEU HD21 H    7.694   1.574   2.574 1.00 . A A . 719 LEU HD21 1 1 
        3  3854 1 1 63 LEU HD22 H    6.445   2.694   2.025 1.00 . A A . 719 LEU HD22 1 1 
        3  3855 1 1 63 LEU HD23 H    8.008   2.644   1.208 1.00 . A A . 719 LEU HD23 1 1 
        3  3856 1 1 63 LEU HG   H    7.548   0.342   0.478 1.00 . A A . 719 LEU HG   1 1 
        3  3857 1 1 63 LEU N    N    7.185  -1.439   2.519 1.00 . A A . 719 LEU N    1 1 
        3  3858 1 1 63 LEU O    O    4.431  -2.328   2.805 1.00 . A A . 719 LEU O    1 1 
        3  3859 1 1 64 THR C    C    1.855  -0.549   4.818 1.00 . A A . 720 THR C    1 1 
        3  3860 1 1 64 THR CA   C    3.119  -1.386   5.074 1.00 . A A . 720 THR CA   1 1 
        3  3861 1 1 64 THR CB   C    3.319  -1.537   6.608 1.00 . A A . 720 THR CB   1 1 
        3  3862 1 1 64 THR CG2  C    2.084  -2.138   7.277 1.00 . A A . 720 THR CG2  1 1 
        3  3863 1 1 64 THR H    H    4.685   0.031   4.819 1.00 . A A . 720 THR H    1 1 
        3  3864 1 1 64 THR HA   H    2.974  -2.373   4.654 1.00 . A A . 720 THR HA   1 1 
        3  3865 1 1 64 THR HB   H    3.492  -0.555   7.030 1.00 . A A . 720 THR HB   1 1 
        3  3866 1 1 64 THR HG1  H    5.178  -1.820   7.236 1.00 . A A . 720 THR HG1  1 1 
        3  3867 1 1 64 THR HG21 H    1.884  -3.115   6.861 1.00 . A A . 720 THR HG21 1 1 
        3  3868 1 1 64 THR HG22 H    1.232  -1.495   7.111 1.00 . A A . 720 THR HG22 1 1 
        3  3869 1 1 64 THR HG23 H    2.258  -2.230   8.340 1.00 . A A . 720 THR HG23 1 1 
        3  3870 1 1 64 THR N    N    4.294  -0.781   4.431 1.00 . A A . 720 THR N    1 1 
        3  3871 1 1 64 THR O    O    1.875   0.674   4.935 1.00 . A A . 720 THR O    1 1 
        3  3872 1 1 64 THR OG1  O    4.460  -2.369   6.885 1.00 . A A . 720 THR OG1  1 1 
        3  3873 1 1 65 TYR C    C   -1.629  -1.093   5.080 1.00 . A A . 721 TYR C    1 1 
        3  3874 1 1 65 TYR CA   C   -0.515  -0.546   4.184 1.00 . A A . 721 TYR CA   1 1 
        3  3875 1 1 65 TYR CB   C   -0.902  -0.745   2.712 1.00 . A A . 721 TYR CB   1 1 
        3  3876 1 1 65 TYR CD1  C    0.379   0.978   1.369 1.00 . A A . 721 TYR CD1  1 1 
        3  3877 1 1 65 TYR CD2  C    1.027  -1.313   1.175 1.00 . A A . 721 TYR CD2  1 1 
        3  3878 1 1 65 TYR CE1  C    1.371   1.336   0.478 1.00 . A A . 721 TYR CE1  1 1 
        3  3879 1 1 65 TYR CE2  C    2.019  -0.959   0.283 1.00 . A A . 721 TYR CE2  1 1 
        3  3880 1 1 65 TYR CG   C    0.188  -0.352   1.734 1.00 . A A . 721 TYR CG   1 1 
        3  3881 1 1 65 TYR CZ   C    2.186   0.364  -0.062 1.00 . A A . 721 TYR CZ   1 1 
        3  3882 1 1 65 TYR H    H    0.806  -2.190   4.393 1.00 . A A . 721 TYR H    1 1 
        3  3883 1 1 65 TYR HA   H   -0.394   0.510   4.380 1.00 . A A . 721 TYR HA   1 1 
        3  3884 1 1 65 TYR HB2  H   -1.136  -1.787   2.546 1.00 . A A . 721 TYR HB2  1 1 
        3  3885 1 1 65 TYR HB3  H   -1.777  -0.148   2.494 1.00 . A A . 721 TYR HB3  1 1 
        3  3886 1 1 65 TYR HD1  H   -0.262   1.740   1.794 1.00 . A A . 721 TYR HD1  1 1 
        3  3887 1 1 65 TYR HD2  H    0.893  -2.352   1.446 1.00 . A A . 721 TYR HD2  1 1 
        3  3888 1 1 65 TYR HE1  H    1.502   2.374   0.208 1.00 . A A . 721 TYR HE1  1 1 
        3  3889 1 1 65 TYR HE2  H    2.662  -1.720  -0.139 1.00 . A A . 721 TYR HE2  1 1 
        3  3890 1 1 65 TYR HH   H    3.092   0.157  -1.737 1.00 . A A . 721 TYR HH   1 1 
        3  3891 1 1 65 TYR N    N    0.760  -1.218   4.468 1.00 . A A . 721 TYR N    1 1 
        3  3892 1 1 65 TYR O    O   -1.926  -2.286   5.054 1.00 . A A . 721 TYR O    1 1 
        3  3893 1 1 65 TYR OH   O    3.166   0.715  -0.959 1.00 . A A . 721 TYR OH   1 1 
        3  3894 1 1 66 THR C    C   -4.617   0.162   6.515 1.00 . A A . 722 THR C    1 1 
        3  3895 1 1 66 THR CA   C   -3.330  -0.633   6.781 1.00 . A A . 722 THR CA   1 1 
        3  3896 1 1 66 THR CB   C   -2.918  -0.454   8.263 1.00 . A A . 722 THR CB   1 1 
        3  3897 1 1 66 THR CG2  C   -4.010  -0.949   9.210 1.00 . A A . 722 THR CG2  1 1 
        3  3898 1 1 66 THR H    H   -1.965   0.718   5.854 1.00 . A A . 722 THR H    1 1 
        3  3899 1 1 66 THR HA   H   -3.529  -1.683   6.612 1.00 . A A . 722 THR HA   1 1 
        3  3900 1 1 66 THR HB   H   -2.747   0.598   8.449 1.00 . A A . 722 THR HB   1 1 
        3  3901 1 1 66 THR HG1  H   -1.248  -0.775   9.278 1.00 . A A . 722 THR HG1  1 1 
        3  3902 1 1 66 THR HG21 H   -4.915  -0.383   9.045 1.00 . A A . 722 THR HG21 1 1 
        3  3903 1 1 66 THR HG22 H   -3.686  -0.817  10.233 1.00 . A A . 722 THR HG22 1 1 
        3  3904 1 1 66 THR HG23 H   -4.202  -1.996   9.027 1.00 . A A . 722 THR HG23 1 1 
        3  3905 1 1 66 THR N    N   -2.246  -0.221   5.872 1.00 . A A . 722 THR N    1 1 
        3  3906 1 1 66 THR O    O   -4.586   1.384   6.382 1.00 . A A . 722 THR O    1 1 
        3  3907 1 1 66 THR OG1  O   -1.699  -1.174   8.524 1.00 . A A . 722 THR OG1  1 1 
        3  3908 1 1 67 VAL C    C   -8.128  -0.350   7.156 1.00 . A A . 723 VAL C    1 1 
        3  3909 1 1 67 VAL CA   C   -7.044   0.097   6.158 1.00 . A A . 723 VAL CA   1 1 
        3  3910 1 1 67 VAL CB   C   -7.510  -0.198   4.704 1.00 . A A . 723 VAL CB   1 1 
        3  3911 1 1 67 VAL CG1  C   -7.604  -1.701   4.444 1.00 . A A . 723 VAL CG1  1 1 
        3  3912 1 1 67 VAL CG2  C   -8.842   0.489   4.402 1.00 . A A . 723 VAL CG2  1 1 
        3  3913 1 1 67 VAL H    H   -5.714  -1.512   6.573 1.00 . A A . 723 VAL H    1 1 
        3  3914 1 1 67 VAL HA   H   -6.912   1.168   6.255 1.00 . A A . 723 VAL HA   1 1 
        3  3915 1 1 67 VAL HB   H   -6.766   0.204   4.029 1.00 . A A . 723 VAL HB   1 1 
        3  3916 1 1 67 VAL HG11 H   -7.904  -1.874   3.420 1.00 . A A . 723 VAL HG11 1 1 
        3  3917 1 1 67 VAL HG12 H   -8.335  -2.141   5.110 1.00 . A A . 723 VAL HG12 1 1 
        3  3918 1 1 67 VAL HG13 H   -6.642  -2.159   4.618 1.00 . A A . 723 VAL HG13 1 1 
        3  3919 1 1 67 VAL HG21 H   -8.732   1.556   4.526 1.00 . A A . 723 VAL HG21 1 1 
        3  3920 1 1 67 VAL HG22 H   -9.601   0.124   5.079 1.00 . A A . 723 VAL HG22 1 1 
        3  3921 1 1 67 VAL HG23 H   -9.135   0.274   3.385 1.00 . A A . 723 VAL HG23 1 1 
        3  3922 1 1 67 VAL N    N   -5.748  -0.540   6.438 1.00 . A A . 723 VAL N    1 1 
        3  3923 1 1 67 VAL O    O   -8.260  -1.540   7.467 1.00 . A A . 723 VAL O    1 1 
        3  3924 1 1 68 THR C    C  -11.363   0.534   7.991 1.00 . A A . 724 THR C    1 1 
        3  3925 1 1 68 THR CA   C   -9.974   0.343   8.621 1.00 . A A . 724 THR CA   1 1 
        3  3926 1 1 68 THR CB   C   -9.862   1.256   9.870 1.00 . A A . 724 THR CB   1 1 
        3  3927 1 1 68 THR CG2  C  -10.902   0.882  10.924 1.00 . A A . 724 THR CG2  1 1 
        3  3928 1 1 68 THR H    H   -8.743   1.543   7.375 1.00 . A A . 724 THR H    1 1 
        3  3929 1 1 68 THR HA   H   -9.878  -0.684   8.947 1.00 . A A . 724 THR HA   1 1 
        3  3930 1 1 68 THR HB   H  -10.030   2.283   9.569 1.00 . A A . 724 THR HB   1 1 
        3  3931 1 1 68 THR HG1  H   -8.532   0.432  11.090 1.00 . A A . 724 THR HG1  1 1 
        3  3932 1 1 68 THR HG21 H  -10.749  -0.142  11.234 1.00 . A A . 724 THR HG21 1 1 
        3  3933 1 1 68 THR HG22 H  -11.893   0.988  10.507 1.00 . A A . 724 THR HG22 1 1 
        3  3934 1 1 68 THR HG23 H  -10.802   1.534  11.779 1.00 . A A . 724 THR HG23 1 1 
        3  3935 1 1 68 THR N    N   -8.900   0.617   7.657 1.00 . A A . 724 THR N    1 1 
        3  3936 1 1 68 THR O    O  -11.579   1.437   7.183 1.00 . A A . 724 THR O    1 1 
        3  3937 1 1 68 THR OG1  O   -8.549   1.153  10.446 1.00 . A A . 724 THR OG1  1 1 
        3  3938 1 1 69 ASP C    C  -14.656   0.335   8.852 1.00 . A A . 725 ASP C    1 1 
        3  3939 1 1 69 ASP CA   C  -13.668  -0.306   7.856 1.00 . A A . 725 ASP CA   1 1 
        3  3940 1 1 69 ASP CB   C  -14.086  -1.744   7.526 1.00 . A A . 725 ASP CB   1 1 
        3  3941 1 1 69 ASP CG   C  -15.563  -1.901   7.225 1.00 . A A . 725 ASP CG   1 1 
        3  3942 1 1 69 ASP H    H  -12.059  -1.003   9.043 1.00 . A A . 725 ASP H    1 1 
        3  3943 1 1 69 ASP HA   H  -13.668   0.275   6.944 1.00 . A A . 725 ASP HA   1 1 
        3  3944 1 1 69 ASP HB2  H  -13.533  -2.075   6.661 1.00 . A A . 725 ASP HB2  1 1 
        3  3945 1 1 69 ASP HB3  H  -13.837  -2.381   8.364 1.00 . A A . 725 ASP HB3  1 1 
        3  3946 1 1 69 ASP N    N  -12.299  -0.325   8.382 1.00 . A A . 725 ASP N    1 1 
        3  3947 1 1 69 ASP O    O  -14.387   0.408  10.054 1.00 . A A . 725 ASP O    1 1 
        3  3948 1 1 69 ASP OD1  O  -16.078  -1.203   6.336 1.00 . A A . 725 ASP OD1  1 1 
        3  3949 1 1 69 ASP OD2  O  -16.217  -2.743   7.863 1.00 . A A . 725 ASP OD2  1 1 
        3  3950 1 1 70 SER C    C  -17.383   0.551  10.276 1.00 . A A . 726 SER C    1 1 
        3  3951 1 1 70 SER CA   C  -16.835   1.445   9.151 1.00 . A A . 726 SER CA   1 1 
        3  3952 1 1 70 SER CB   C  -17.992   1.912   8.259 1.00 . A A . 726 SER CB   1 1 
        3  3953 1 1 70 SER H    H  -15.980   0.631   7.381 1.00 . A A . 726 SER H    1 1 
        3  3954 1 1 70 SER HA   H  -16.375   2.315   9.601 1.00 . A A . 726 SER HA   1 1 
        3  3955 1 1 70 SER HB2  H  -18.442   1.056   7.777 1.00 . A A . 726 SER HB2  1 1 
        3  3956 1 1 70 SER HB3  H  -18.734   2.414   8.866 1.00 . A A . 726 SER HB3  1 1 
        3  3957 1 1 70 SER HG   H  -18.246   2.950   6.615 1.00 . A A . 726 SER HG   1 1 
        3  3958 1 1 70 SER N    N  -15.809   0.770   8.340 1.00 . A A . 726 SER N    1 1 
        3  3959 1 1 70 SER O    O  -17.735   1.044  11.351 1.00 . A A . 726 SER O    1 1 
        3  3960 1 1 70 SER OG   O  -17.541   2.811   7.258 1.00 . A A . 726 SER OG   1 1 
        3  3961 1 1 71 LYS C    C  -16.789  -2.088  12.026 1.00 . A A . 727 LYS C    1 1 
        3  3962 1 1 71 LYS CA   C  -17.927  -1.708  11.060 1.00 . A A . 727 LYS CA   1 1 
        3  3963 1 1 71 LYS CB   C  -18.505  -2.976  10.410 1.00 . A A . 727 LYS CB   1 1 
        3  3964 1 1 71 LYS CD   C  -20.868  -2.089  10.074 1.00 . A A . 727 LYS CD   1 1 
        3  3965 1 1 71 LYS CE   C  -21.629  -3.091  10.935 1.00 . A A . 727 LYS CE   1 1 
        3  3966 1 1 71 LYS CG   C  -19.631  -2.705   9.420 1.00 . A A . 727 LYS CG   1 1 
        3  3967 1 1 71 LYS H    H  -17.226  -1.098   9.137 1.00 . A A . 727 LYS H    1 1 
        3  3968 1 1 71 LYS HA   H  -18.710  -1.221  11.627 1.00 . A A . 727 LYS HA   1 1 
        3  3969 1 1 71 LYS HB2  H  -17.712  -3.490   9.884 1.00 . A A . 727 LYS HB2  1 1 
        3  3970 1 1 71 LYS HB3  H  -18.885  -3.625  11.187 1.00 . A A . 727 LYS HB3  1 1 
        3  3971 1 1 71 LYS HD2  H  -20.559  -1.259  10.696 1.00 . A A . 727 LYS HD2  1 1 
        3  3972 1 1 71 LYS HD3  H  -21.525  -1.725   9.297 1.00 . A A . 727 LYS HD3  1 1 
        3  3973 1 1 71 LYS HE2  H  -21.796  -3.992  10.361 1.00 . A A . 727 LYS HE2  1 1 
        3  3974 1 1 71 LYS HE3  H  -21.034  -3.325  11.807 1.00 . A A . 727 LYS HE3  1 1 
        3  3975 1 1 71 LYS HG2  H  -19.268  -2.023   8.665 1.00 . A A . 727 LYS HG2  1 1 
        3  3976 1 1 71 LYS HG3  H  -19.912  -3.639   8.948 1.00 . A A . 727 LYS HG3  1 1 
        3  3977 1 1 71 LYS HZ1  H  -23.399  -3.211  12.037 1.00 . A A . 727 LYS HZ1  1 1 
        3  3978 1 1 71 LYS HZ2  H  -23.572  -2.417  10.555 1.00 . A A . 727 LYS HZ2  1 1 
        3  3979 1 1 71 LYS HZ3  H  -22.817  -1.637  11.853 1.00 . A A . 727 LYS HZ3  1 1 
        3  3980 1 1 71 LYS N    N  -17.466  -0.759  10.031 1.00 . A A . 727 LYS N    1 1 
        3  3981 1 1 71 LYS NZ   N  -22.943  -2.551  11.376 1.00 . A A . 727 LYS NZ   1 1 
        3  3982 1 1 71 LYS O    O  -16.958  -2.947  12.890 1.00 . A A . 727 LYS O    1 1 
        3  3983 1 1 72 GLY C    C  -13.555  -2.800  12.301 1.00 . A A . 728 GLY C    1 1 
        3  3984 1 1 72 GLY CA   C  -14.497  -1.690  12.766 1.00 . A A . 728 GLY CA   1 1 
        3  3985 1 1 72 GLY H    H  -15.536  -0.799  11.140 1.00 . A A . 728 GLY H    1 1 
        3  3986 1 1 72 GLY HA2  H  -13.929  -0.776  12.850 1.00 . A A . 728 GLY HA2  1 1 
        3  3987 1 1 72 GLY HA3  H  -14.880  -1.946  13.745 1.00 . A A . 728 GLY HA3  1 1 
        3  3988 1 1 72 GLY N    N  -15.627  -1.451  11.866 1.00 . A A . 728 GLY N    1 1 
        3  3989 1 1 72 GLY O    O  -12.734  -3.286  13.081 1.00 . A A . 728 GLY O    1 1 
        3  3990 1 1 73 HIS C    C  -11.509  -3.643   9.900 1.00 . A A . 729 HIS C    1 1 
        3  3991 1 1 73 HIS CA   C  -12.797  -4.246  10.477 1.00 . A A . 729 HIS CA   1 1 
        3  3992 1 1 73 HIS CB   C  -13.547  -5.027   9.392 1.00 . A A . 729 HIS CB   1 1 
        3  3993 1 1 73 HIS CD2  C  -14.994  -6.560  10.908 1.00 . A A . 729 HIS CD2  1 1 
        3  3994 1 1 73 HIS CE1  C  -16.935  -6.194   9.969 1.00 . A A . 729 HIS CE1  1 1 
        3  3995 1 1 73 HIS CG   C  -14.797  -5.687   9.890 1.00 . A A . 729 HIS CG   1 1 
        3  3996 1 1 73 HIS H    H  -14.343  -2.791  10.462 1.00 . A A . 729 HIS H    1 1 
        3  3997 1 1 73 HIS HA   H  -12.536  -4.926  11.279 1.00 . A A . 729 HIS HA   1 1 
        3  3998 1 1 73 HIS HB2  H  -13.823  -4.352   8.595 1.00 . A A . 729 HIS HB2  1 1 
        3  3999 1 1 73 HIS HB3  H  -12.900  -5.795   8.997 1.00 . A A . 729 HIS HB3  1 1 
        3  4000 1 1 73 HIS HD1  H  -16.232  -4.900   8.553 1.00 . A A . 729 HIS HD1  1 1 
        3  4001 1 1 73 HIS HD2  H  -14.236  -6.950  11.574 1.00 . A A . 729 HIS HD2  1 1 
        3  4002 1 1 73 HIS HE1  H  -17.991  -6.230   9.744 1.00 . A A . 729 HIS HE1  1 1 
        3  4003 1 1 73 HIS HE2  H  -16.801  -7.282  11.687 1.00 . A A . 729 HIS HE2  1 1 
        3  4004 1 1 73 HIS N    N  -13.665  -3.203  11.035 1.00 . A A . 729 HIS N    1 1 
        3  4005 1 1 73 HIS ND1  N  -16.037  -5.483   9.324 1.00 . A A . 729 HIS ND1  1 1 
        3  4006 1 1 73 HIS NE2  N  -16.334  -6.859  10.932 1.00 . A A . 729 HIS NE2  1 1 
        3  4007 1 1 73 HIS O    O  -11.558  -2.809   9.002 1.00 . A A . 729 HIS O    1 1 
        3  4008 1 1 74 GLU C    C   -8.101  -4.576   9.478 1.00 . A A . 730 GLU C    1 1 
        3  4009 1 1 74 GLU CA   C   -9.070  -3.497   9.986 1.00 . A A . 730 GLU CA   1 1 
        3  4010 1 1 74 GLU CB   C   -8.429  -2.728  11.151 1.00 . A A . 730 GLU CB   1 1 
        3  4011 1 1 74 GLU CD   C   -6.439  -1.387  11.984 1.00 . A A . 730 GLU CD   1 1 
        3  4012 1 1 74 GLU CG   C   -7.084  -2.095  10.803 1.00 . A A . 730 GLU CG   1 1 
        3  4013 1 1 74 GLU H    H  -10.366  -4.796  11.069 1.00 . A A . 730 GLU H    1 1 
        3  4014 1 1 74 GLU HA   H   -9.265  -2.801   9.179 1.00 . A A . 730 GLU HA   1 1 
        3  4015 1 1 74 GLU HB2  H   -9.103  -1.940  11.461 1.00 . A A . 730 GLU HB2  1 1 
        3  4016 1 1 74 GLU HB3  H   -8.281  -3.408  11.978 1.00 . A A . 730 GLU HB3  1 1 
        3  4017 1 1 74 GLU HG2  H   -6.415  -2.870  10.459 1.00 . A A . 730 GLU HG2  1 1 
        3  4018 1 1 74 GLU HG3  H   -7.236  -1.375  10.008 1.00 . A A . 730 GLU HG3  1 1 
        3  4019 1 1 74 GLU N    N  -10.357  -4.071  10.408 1.00 . A A . 730 GLU N    1 1 
        3  4020 1 1 74 GLU O    O   -7.767  -5.515  10.202 1.00 . A A . 730 GLU O    1 1 
        3  4021 1 1 74 GLU OE1  O   -6.732  -0.192  12.199 1.00 . A A . 730 GLU OE1  1 1 
        3  4022 1 1 74 GLU OE2  O   -5.641  -2.021  12.705 1.00 . A A . 730 GLU OE2  1 1 
        3  4023 1 1 75 VAL C    C   -5.409  -4.615   7.186 1.00 . A A . 731 VAL C    1 1 
        3  4024 1 1 75 VAL CA   C   -6.679  -5.356   7.637 1.00 . A A . 731 VAL CA   1 1 
        3  4025 1 1 75 VAL CB   C   -7.289  -6.115   6.428 1.00 . A A . 731 VAL CB   1 1 
        3  4026 1 1 75 VAL CG1  C   -8.464  -6.984   6.871 1.00 . A A . 731 VAL CG1  1 1 
        3  4027 1 1 75 VAL CG2  C   -7.718  -5.143   5.330 1.00 . A A . 731 VAL CG2  1 1 
        3  4028 1 1 75 VAL H    H   -7.962  -3.662   7.705 1.00 . A A . 731 VAL H    1 1 
        3  4029 1 1 75 VAL HA   H   -6.404  -6.084   8.388 1.00 . A A . 731 VAL HA   1 1 
        3  4030 1 1 75 VAL HB   H   -6.526  -6.769   6.019 1.00 . A A . 731 VAL HB   1 1 
        3  4031 1 1 75 VAL HG11 H   -8.878  -7.498   6.016 1.00 . A A . 731 VAL HG11 1 1 
        3  4032 1 1 75 VAL HG12 H   -9.227  -6.361   7.318 1.00 . A A . 731 VAL HG12 1 1 
        3  4033 1 1 75 VAL HG13 H   -8.125  -7.710   7.596 1.00 . A A . 731 VAL HG13 1 1 
        3  4034 1 1 75 VAL HG21 H   -6.861  -4.577   4.990 1.00 . A A . 731 VAL HG21 1 1 
        3  4035 1 1 75 VAL HG22 H   -8.466  -4.463   5.719 1.00 . A A . 731 VAL HG22 1 1 
        3  4036 1 1 75 VAL HG23 H   -8.134  -5.695   4.501 1.00 . A A . 731 VAL HG23 1 1 
        3  4037 1 1 75 VAL N    N   -7.647  -4.427   8.235 1.00 . A A . 731 VAL N    1 1 
        3  4038 1 1 75 VAL O    O   -5.428  -3.399   6.985 1.00 . A A . 731 VAL O    1 1 
        3  4039 1 1 76 THR C    C   -2.231  -5.663   5.689 1.00 . A A . 732 THR C    1 1 
        3  4040 1 1 76 THR CA   C   -3.026  -4.746   6.632 1.00 . A A . 732 THR CA   1 1 
        3  4041 1 1 76 THR CB   C   -2.150  -4.408   7.867 1.00 . A A . 732 THR CB   1 1 
        3  4042 1 1 76 THR CG2  C   -1.792  -5.666   8.657 1.00 . A A . 732 THR CG2  1 1 
        3  4043 1 1 76 THR H    H   -4.355  -6.319   7.176 1.00 . A A . 732 THR H    1 1 
        3  4044 1 1 76 THR HA   H   -3.242  -3.823   6.111 1.00 . A A . 732 THR HA   1 1 
        3  4045 1 1 76 THR HB   H   -2.714  -3.747   8.514 1.00 . A A . 732 THR HB   1 1 
        3  4046 1 1 76 THR HG1  H   -1.123  -2.785   7.384 1.00 . A A . 732 THR HG1  1 1 
        3  4047 1 1 76 THR HG21 H   -1.184  -5.396   9.508 1.00 . A A . 732 THR HG21 1 1 
        3  4048 1 1 76 THR HG22 H   -1.242  -6.348   8.025 1.00 . A A . 732 THR HG22 1 1 
        3  4049 1 1 76 THR HG23 H   -2.698  -6.147   9.002 1.00 . A A . 732 THR HG23 1 1 
        3  4050 1 1 76 THR N    N   -4.308  -5.349   7.028 1.00 . A A . 732 THR N    1 1 
        3  4051 1 1 76 THR O    O   -2.412  -6.881   5.692 1.00 . A A . 732 THR O    1 1 
        3  4052 1 1 76 THR OG1  O   -0.949  -3.734   7.460 1.00 . A A . 732 THR OG1  1 1 
        3  4053 1 1 77 ALA C    C    0.839  -5.117   3.713 1.00 . A A . 733 ALA C    1 1 
        3  4054 1 1 77 ALA CA   C   -0.516  -5.818   3.930 1.00 . A A . 733 ALA CA   1 1 
        3  4055 1 1 77 ALA CB   C   -1.244  -5.998   2.602 1.00 . A A . 733 ALA CB   1 1 
        3  4056 1 1 77 ALA H    H   -1.273  -4.091   4.914 1.00 . A A . 733 ALA H    1 1 
        3  4057 1 1 77 ALA HA   H   -0.335  -6.799   4.350 1.00 . A A . 733 ALA HA   1 1 
        3  4058 1 1 77 ALA HB1  H   -1.397  -5.034   2.137 1.00 . A A . 733 ALA HB1  1 1 
        3  4059 1 1 77 ALA HB2  H   -2.201  -6.469   2.775 1.00 . A A . 733 ALA HB2  1 1 
        3  4060 1 1 77 ALA HB3  H   -0.652  -6.622   1.947 1.00 . A A . 733 ALA HB3  1 1 
        3  4061 1 1 77 ALA N    N   -1.358  -5.068   4.875 1.00 . A A . 733 ALA N    1 1 
        3  4062 1 1 77 ALA O    O    0.983  -3.931   4.000 1.00 . A A . 733 ALA O    1 1 
        3  4063 1 1 78 LYS C    C    3.665  -5.475   1.545 1.00 . A A . 734 LYS C    1 1 
        3  4064 1 1 78 LYS CA   C    3.182  -5.297   2.995 1.00 . A A . 734 LYS CA   1 1 
        3  4065 1 1 78 LYS CB   C    4.176  -5.959   3.962 1.00 . A A . 734 LYS CB   1 1 
        3  4066 1 1 78 LYS CD   C    4.871  -6.393   6.355 1.00 . A A . 734 LYS CD   1 1 
        3  4067 1 1 78 LYS CE   C    4.620  -6.065   7.824 1.00 . A A . 734 LYS CE   1 1 
        3  4068 1 1 78 LYS CG   C    3.916  -5.640   5.433 1.00 . A A . 734 LYS CG   1 1 
        3  4069 1 1 78 LYS H    H    1.655  -6.782   2.954 1.00 . A A . 734 LYS H    1 1 
        3  4070 1 1 78 LYS HA   H    3.142  -4.237   3.213 1.00 . A A . 734 LYS HA   1 1 
        3  4071 1 1 78 LYS HB2  H    4.123  -7.032   3.834 1.00 . A A . 734 LYS HB2  1 1 
        3  4072 1 1 78 LYS HB3  H    5.175  -5.628   3.716 1.00 . A A . 734 LYS HB3  1 1 
        3  4073 1 1 78 LYS HD2  H    4.734  -7.456   6.207 1.00 . A A . 734 LYS HD2  1 1 
        3  4074 1 1 78 LYS HD3  H    5.887  -6.122   6.102 1.00 . A A . 734 LYS HD3  1 1 
        3  4075 1 1 78 LYS HE2  H    3.585  -6.268   8.058 1.00 . A A . 734 LYS HE2  1 1 
        3  4076 1 1 78 LYS HE3  H    5.254  -6.694   8.433 1.00 . A A . 734 LYS HE3  1 1 
        3  4077 1 1 78 LYS HG2  H    4.047  -4.578   5.588 1.00 . A A . 734 LYS HG2  1 1 
        3  4078 1 1 78 LYS HG3  H    2.900  -5.916   5.676 1.00 . A A . 734 LYS HG3  1 1 
        3  4079 1 1 78 LYS HZ1  H    5.938  -4.461   8.057 1.00 . A A . 734 LYS HZ1  1 1 
        3  4080 1 1 78 LYS HZ2  H    4.611  -4.410   9.103 1.00 . A A . 734 LYS HZ2  1 1 
        3  4081 1 1 78 LYS HZ3  H    4.418  -4.013   7.469 1.00 . A A . 734 LYS HZ3  1 1 
        3  4082 1 1 78 LYS N    N    1.830  -5.851   3.202 1.00 . A A . 734 LYS N    1 1 
        3  4083 1 1 78 LYS NZ   N    4.915  -4.640   8.133 1.00 . A A . 734 LYS NZ   1 1 
        3  4084 1 1 78 LYS O    O    3.228  -6.382   0.837 1.00 . A A . 734 LYS O    1 1 
        3  4085 1 1 79 GLN C    C    6.683  -4.557  -0.197 1.00 . A A . 735 GLN C    1 1 
        3  4086 1 1 79 GLN CA   C    5.147  -4.639  -0.235 1.00 . A A . 735 GLN CA   1 1 
        3  4087 1 1 79 GLN CB   C    4.600  -3.476  -1.080 1.00 . A A . 735 GLN CB   1 1 
        3  4088 1 1 79 GLN CD   C    4.834  -2.119  -3.229 1.00 . A A . 735 GLN CD   1 1 
        3  4089 1 1 79 GLN CG   C    5.223  -3.380  -2.474 1.00 . A A . 735 GLN CG   1 1 
        3  4090 1 1 79 GLN H    H    4.872  -3.895   1.736 1.00 . A A . 735 GLN H    1 1 
        3  4091 1 1 79 GLN HA   H    4.859  -5.575  -0.695 1.00 . A A . 735 GLN HA   1 1 
        3  4092 1 1 79 GLN HB2  H    3.529  -3.599  -1.197 1.00 . A A . 735 GLN HB2  1 1 
        3  4093 1 1 79 GLN HB3  H    4.789  -2.547  -0.559 1.00 . A A . 735 GLN HB3  1 1 
        3  4094 1 1 79 GLN HE21 H    4.708  -1.078  -1.545 1.00 . A A . 735 GLN HE21 1 1 
        3  4095 1 1 79 GLN HE22 H    4.385  -0.212  -3.000 1.00 . A A . 735 GLN HE22 1 1 
        3  4096 1 1 79 GLN HG2  H    6.300  -3.398  -2.375 1.00 . A A . 735 GLN HG2  1 1 
        3  4097 1 1 79 GLN HG3  H    4.907  -4.236  -3.054 1.00 . A A . 735 GLN HG3  1 1 
        3  4098 1 1 79 GLN N    N    4.576  -4.597   1.120 1.00 . A A . 735 GLN N    1 1 
        3  4099 1 1 79 GLN NE2  N    4.615  -1.029  -2.518 1.00 . A A . 735 GLN NE2  1 1 
        3  4100 1 1 79 GLN O    O    7.255  -3.769   0.562 1.00 . A A . 735 GLN O    1 1 
        3  4101 1 1 79 GLN OE1  O    4.753  -2.114  -4.451 1.00 . A A . 735 GLN OE1  1 1 
        3  4102 1 1 80 THR C    C    9.260  -4.490  -2.333 1.00 . A A . 736 THR C    1 1 
        3  4103 1 1 80 THR CA   C    8.810  -5.343  -1.137 1.00 . A A . 736 THR CA   1 1 
        3  4104 1 1 80 THR CB   C    9.383  -6.774  -1.301 1.00 . A A . 736 THR CB   1 1 
        3  4105 1 1 80 THR CG2  C   10.905  -6.759  -1.447 1.00 . A A . 736 THR CG2  1 1 
        3  4106 1 1 80 THR H    H    6.833  -6.005  -1.575 1.00 . A A . 736 THR H    1 1 
        3  4107 1 1 80 THR HA   H    9.213  -4.916  -0.228 1.00 . A A . 736 THR HA   1 1 
        3  4108 1 1 80 THR HB   H    8.958  -7.211  -2.196 1.00 . A A . 736 THR HB   1 1 
        3  4109 1 1 80 THR HG1  H    8.181  -8.029  -0.364 1.00 . A A . 736 THR HG1  1 1 
        3  4110 1 1 80 THR HG21 H   11.267  -7.768  -1.583 1.00 . A A . 736 THR HG21 1 1 
        3  4111 1 1 80 THR HG22 H   11.349  -6.337  -0.558 1.00 . A A . 736 THR HG22 1 1 
        3  4112 1 1 80 THR HG23 H   11.182  -6.161  -2.306 1.00 . A A . 736 THR HG23 1 1 
        3  4113 1 1 80 THR N    N    7.343  -5.367  -1.024 1.00 . A A . 736 THR N    1 1 
        3  4114 1 1 80 THR O    O    9.171  -4.926  -3.480 1.00 . A A . 736 THR O    1 1 
        3  4115 1 1 80 THR OG1  O    9.017  -7.588  -0.175 1.00 . A A . 736 THR OG1  1 1 
        3  4116 1 1 81 VAL C    C   11.724  -2.356  -3.266 1.00 . A A . 737 VAL C    1 1 
        3  4117 1 1 81 VAL CA   C   10.190  -2.367  -3.131 1.00 . A A . 737 VAL CA   1 1 
        3  4118 1 1 81 VAL CB   C    9.696  -0.918  -2.884 1.00 . A A . 737 VAL CB   1 1 
        3  4119 1 1 81 VAL CG1  C   10.090  -0.001  -4.046 1.00 . A A . 737 VAL CG1  1 1 
        3  4120 1 1 81 VAL CG2  C    8.185  -0.895  -2.662 1.00 . A A . 737 VAL CG2  1 1 
        3  4121 1 1 81 VAL H    H    9.803  -2.984  -1.130 1.00 . A A . 737 VAL H    1 1 
        3  4122 1 1 81 VAL HA   H    9.763  -2.712  -4.066 1.00 . A A . 737 VAL HA   1 1 
        3  4123 1 1 81 VAL HB   H   10.174  -0.547  -1.984 1.00 . A A . 737 VAL HB   1 1 
        3  4124 1 1 81 VAL HG11 H   11.162  -0.019  -4.175 1.00 . A A . 737 VAL HG11 1 1 
        3  4125 1 1 81 VAL HG12 H    9.771   1.008  -3.835 1.00 . A A . 737 VAL HG12 1 1 
        3  4126 1 1 81 VAL HG13 H    9.613  -0.344  -4.953 1.00 . A A . 737 VAL HG13 1 1 
        3  4127 1 1 81 VAL HG21 H    7.861   0.118  -2.476 1.00 . A A . 737 VAL HG21 1 1 
        3  4128 1 1 81 VAL HG22 H    7.933  -1.513  -1.814 1.00 . A A . 737 VAL HG22 1 1 
        3  4129 1 1 81 VAL HG23 H    7.685  -1.274  -3.543 1.00 . A A . 737 VAL HG23 1 1 
        3  4130 1 1 81 VAL N    N    9.746  -3.277  -2.066 1.00 . A A . 737 VAL N    1 1 
        3  4131 1 1 81 VAL O    O   12.425  -1.774  -2.441 1.00 . A A . 737 VAL O    1 1 
        3  4132 1 1 82 THR C    C   14.123  -1.968  -5.552 1.00 . A A . 738 THR C    1 1 
        3  4133 1 1 82 THR CA   C   13.686  -3.051  -4.554 1.00 . A A . 738 THR CA   1 1 
        3  4134 1 1 82 THR CB   C   14.121  -4.436  -5.097 1.00 . A A . 738 THR CB   1 1 
        3  4135 1 1 82 THR CG2  C   15.631  -4.501  -5.312 1.00 . A A . 738 THR CG2  1 1 
        3  4136 1 1 82 THR H    H   11.634  -3.462  -4.926 1.00 . A A . 738 THR H    1 1 
        3  4137 1 1 82 THR HA   H   14.194  -2.884  -3.611 1.00 . A A . 738 THR HA   1 1 
        3  4138 1 1 82 THR HB   H   13.630  -4.602  -6.046 1.00 . A A . 738 THR HB   1 1 
        3  4139 1 1 82 THR HG1  H   14.235  -5.388  -3.365 1.00 . A A . 738 THR HG1  1 1 
        3  4140 1 1 82 THR HG21 H   15.928  -3.741  -6.022 1.00 . A A . 738 THR HG21 1 1 
        3  4141 1 1 82 THR HG22 H   15.897  -5.476  -5.698 1.00 . A A . 738 THR HG22 1 1 
        3  4142 1 1 82 THR HG23 H   16.140  -4.335  -4.374 1.00 . A A . 738 THR HG23 1 1 
        3  4143 1 1 82 THR N    N   12.239  -3.002  -4.306 1.00 . A A . 738 THR N    1 1 
        3  4144 1 1 82 THR O    O   13.685  -1.955  -6.705 1.00 . A A . 738 THR O    1 1 
        3  4145 1 1 82 THR OG1  O   13.722  -5.470  -4.182 1.00 . A A . 738 THR OG1  1 1 
        3  4146 1 1 83 VAL C    C   16.905  -0.345  -6.508 1.00 . A A . 739 VAL C    1 1 
        3  4147 1 1 83 VAL CA   C   15.514   0.012  -5.954 1.00 . A A . 739 VAL CA   1 1 
        3  4148 1 1 83 VAL CB   C   15.614   1.349  -5.173 1.00 . A A . 739 VAL CB   1 1 
        3  4149 1 1 83 VAL CG1  C   16.057   2.491  -6.088 1.00 . A A . 739 VAL CG1  1 1 
        3  4150 1 1 83 VAL CG2  C   14.284   1.682  -4.504 1.00 . A A . 739 VAL CG2  1 1 
        3  4151 1 1 83 VAL H    H   15.265  -1.103  -4.162 1.00 . A A . 739 VAL H    1 1 
        3  4152 1 1 83 VAL HA   H   14.831   0.153  -6.781 1.00 . A A . 739 VAL HA   1 1 
        3  4153 1 1 83 VAL HB   H   16.358   1.232  -4.396 1.00 . A A . 739 VAL HB   1 1 
        3  4154 1 1 83 VAL HG11 H   17.023   2.261  -6.510 1.00 . A A . 739 VAL HG11 1 1 
        3  4155 1 1 83 VAL HG12 H   16.123   3.407  -5.518 1.00 . A A . 739 VAL HG12 1 1 
        3  4156 1 1 83 VAL HG13 H   15.336   2.617  -6.884 1.00 . A A . 739 VAL HG13 1 1 
        3  4157 1 1 83 VAL HG21 H   14.022   0.895  -3.810 1.00 . A A . 739 VAL HG21 1 1 
        3  4158 1 1 83 VAL HG22 H   13.514   1.770  -5.254 1.00 . A A . 739 VAL HG22 1 1 
        3  4159 1 1 83 VAL HG23 H   14.375   2.617  -3.968 1.00 . A A . 739 VAL HG23 1 1 
        3  4160 1 1 83 VAL N    N   14.983  -1.060  -5.100 1.00 . A A . 739 VAL N    1 1 
        3  4161 1 1 83 VAL O    O   17.742  -0.903  -5.798 1.00 . A A . 739 VAL O    1 1 
        3  4162 1 1 84 LYS C    C   19.014   1.087  -8.964 1.00 . A A . 740 LYS C    1 1 
        3  4163 1 1 84 LYS CA   C   18.444  -0.238  -8.423 1.00 . A A . 740 LYS CA   1 1 
        3  4164 1 1 84 LYS CB   C   18.308  -1.263  -9.559 1.00 . A A . 740 LYS CB   1 1 
        3  4165 1 1 84 LYS CD   C   17.680  -3.613 -10.261 1.00 . A A . 740 LYS CD   1 1 
        3  4166 1 1 84 LYS CE   C   17.249  -5.000  -9.793 1.00 . A A . 740 LYS CE   1 1 
        3  4167 1 1 84 LYS CG   C   17.828  -2.636  -9.094 1.00 . A A . 740 LYS CG   1 1 
        3  4168 1 1 84 LYS H    H   16.414   0.380  -8.307 1.00 . A A . 740 LYS H    1 1 
        3  4169 1 1 84 LYS HA   H   19.123  -0.627  -7.676 1.00 . A A . 740 LYS HA   1 1 
        3  4170 1 1 84 LYS HB2  H   17.602  -0.886 -10.287 1.00 . A A . 740 LYS HB2  1 1 
        3  4171 1 1 84 LYS HB3  H   19.272  -1.385 -10.035 1.00 . A A . 740 LYS HB3  1 1 
        3  4172 1 1 84 LYS HD2  H   16.940  -3.231 -10.948 1.00 . A A . 740 LYS HD2  1 1 
        3  4173 1 1 84 LYS HD3  H   18.633  -3.697 -10.768 1.00 . A A . 740 LYS HD3  1 1 
        3  4174 1 1 84 LYS HE2  H   18.009  -5.395  -9.134 1.00 . A A . 740 LYS HE2  1 1 
        3  4175 1 1 84 LYS HE3  H   16.316  -4.912  -9.253 1.00 . A A . 740 LYS HE3  1 1 
        3  4176 1 1 84 LYS HG2  H   18.547  -3.036  -8.393 1.00 . A A . 740 LYS HG2  1 1 
        3  4177 1 1 84 LYS HG3  H   16.869  -2.526  -8.605 1.00 . A A . 740 LYS HG3  1 1 
        3  4178 1 1 84 LYS HZ1  H   16.792  -6.884 -10.576 1.00 . A A . 740 LYS HZ1  1 1 
        3  4179 1 1 84 LYS HZ2  H   17.946  -6.034 -11.473 1.00 . A A . 740 LYS HZ2  1 1 
        3  4180 1 1 84 LYS HZ3  H   16.315  -5.600 -11.564 1.00 . A A . 740 LYS HZ3  1 1 
        3  4181 1 1 84 LYS N    N   17.139  -0.019  -7.780 1.00 . A A . 740 LYS N    1 1 
        3  4182 1 1 84 LYS NZ   N   17.063  -5.944 -10.930 1.00 . A A . 740 LYS NZ   1 1 
        3  4183 1 1 84 LYS O    O   18.268   2.026  -9.250 1.00 . A A . 740 LYS O    1 1 
        3  4184 1 1 85 VAL C    C   20.948   2.593 -11.066 1.00 . A A . 741 VAL C    1 1 
        3  4185 1 1 85 VAL CA   C   20.988   2.410  -9.541 1.00 . A A . 741 VAL CA   1 1 
        3  4186 1 1 85 VAL CB   C   22.465   2.472  -9.070 1.00 . A A . 741 VAL CB   1 1 
        3  4187 1 1 85 VAL CG1  C   23.097   3.819  -9.419 1.00 . A A . 741 VAL CG1  1 1 
        3  4188 1 1 85 VAL CG2  C   22.572   2.201  -7.573 1.00 . A A . 741 VAL CG2  1 1 
        3  4189 1 1 85 VAL H    H   20.886   0.369  -8.943 1.00 . A A . 741 VAL H    1 1 
        3  4190 1 1 85 VAL HA   H   20.455   3.232  -9.083 1.00 . A A . 741 VAL HA   1 1 
        3  4191 1 1 85 VAL HB   H   23.017   1.699  -9.591 1.00 . A A . 741 VAL HB   1 1 
        3  4192 1 1 85 VAL HG11 H   23.088   3.956 -10.490 1.00 . A A . 741 VAL HG11 1 1 
        3  4193 1 1 85 VAL HG12 H   24.117   3.842  -9.063 1.00 . A A . 741 VAL HG12 1 1 
        3  4194 1 1 85 VAL HG13 H   22.536   4.616  -8.950 1.00 . A A . 741 VAL HG13 1 1 
        3  4195 1 1 85 VAL HG21 H   22.204   1.207  -7.359 1.00 . A A . 741 VAL HG21 1 1 
        3  4196 1 1 85 VAL HG22 H   21.984   2.927  -7.030 1.00 . A A . 741 VAL HG22 1 1 
        3  4197 1 1 85 VAL HG23 H   23.605   2.273  -7.266 1.00 . A A . 741 VAL HG23 1 1 
        3  4198 1 1 85 VAL N    N   20.335   1.164  -9.115 1.00 . A A . 741 VAL N    1 1 
        3  4199 1 1 85 VAL O    O   21.010   1.625 -11.823 1.00 . A A . 741 VAL O    1 1 
        3  4200 1 1 86 ARG C    C   22.306   4.821 -13.215 1.00 . A A . 742 ARG C    1 1 
        3  4201 1 1 86 ARG CA   C   20.936   4.194 -12.922 1.00 . A A . 742 ARG CA   1 1 
        3  4202 1 1 86 ARG CB   C   19.823   5.175 -13.330 1.00 . A A . 742 ARG CB   1 1 
        3  4203 1 1 86 ARG CD   C   18.932   7.546 -13.201 1.00 . A A . 742 ARG CD   1 1 
        3  4204 1 1 86 ARG CG   C   19.870   6.511 -12.585 1.00 . A A . 742 ARG CG   1 1 
        3  4205 1 1 86 ARG CZ   C   18.402   9.919 -12.905 1.00 . A A . 742 ARG CZ   1 1 
        3  4206 1 1 86 ARG H    H   20.673   4.561 -10.850 1.00 . A A . 742 ARG H    1 1 
        3  4207 1 1 86 ARG HA   H   20.836   3.285 -13.499 1.00 . A A . 742 ARG HA   1 1 
        3  4208 1 1 86 ARG HB2  H   19.907   5.374 -14.389 1.00 . A A . 742 ARG HB2  1 1 
        3  4209 1 1 86 ARG HB3  H   18.865   4.713 -13.136 1.00 . A A . 742 ARG HB3  1 1 
        3  4210 1 1 86 ARG HD2  H   19.237   7.727 -14.220 1.00 . A A . 742 ARG HD2  1 1 
        3  4211 1 1 86 ARG HD3  H   17.924   7.150 -13.193 1.00 . A A . 742 ARG HD3  1 1 
        3  4212 1 1 86 ARG HE   H   19.387   8.828 -11.595 1.00 . A A . 742 ARG HE   1 1 
        3  4213 1 1 86 ARG HG2  H   19.582   6.347 -11.555 1.00 . A A . 742 ARG HG2  1 1 
        3  4214 1 1 86 ARG HG3  H   20.882   6.893 -12.617 1.00 . A A . 742 ARG HG3  1 1 
        3  4215 1 1 86 ARG HH11 H   17.832   9.158 -14.651 1.00 . A A . 742 ARG HH11 1 1 
        3  4216 1 1 86 ARG HH12 H   17.427  10.818 -14.383 1.00 . A A . 742 ARG HH12 1 1 
        3  4217 1 1 86 ARG HH21 H   18.854  10.971 -11.276 1.00 . A A . 742 ARG HH21 1 1 
        3  4218 1 1 86 ARG HH22 H   18.011  11.827 -12.516 1.00 . A A . 742 ARG HH22 1 1 
        3  4219 1 1 86 ARG N    N   20.829   3.847 -11.501 1.00 . A A . 742 ARG N    1 1 
        3  4220 1 1 86 ARG NE   N   18.949   8.814 -12.469 1.00 . A A . 742 ARG NE   1 1 
        3  4221 1 1 86 ARG NH1  N   17.844   9.969 -14.069 1.00 . A A . 742 ARG NH1  1 1 
        3  4222 1 1 86 ARG NH2  N   18.423  10.986 -12.176 1.00 . A A . 742 ARG NH2  1 1 
        3  4223 1 1 86 ARG O    O   22.817   5.613 -12.418 1.00 . A A . 742 ARG O    1 1 
        3  4224 1 1 87 GLU C    C   24.103   6.511 -15.088 1.00 . A A . 743 GLU C    1 1 
        3  4225 1 1 87 GLU CA   C   24.201   5.021 -14.727 1.00 . A A . 743 GLU CA   1 1 
        3  4226 1 1 87 GLU CB   C   24.810   4.223 -15.887 1.00 . A A . 743 GLU CB   1 1 
        3  4227 1 1 87 GLU CD   C   26.291   2.730 -14.455 1.00 . A A . 743 GLU CD   1 1 
        3  4228 1 1 87 GLU CG   C   25.196   2.794 -15.516 1.00 . A A . 743 GLU CG   1 1 
        3  4229 1 1 87 GLU H    H   22.460   3.823 -14.939 1.00 . A A . 743 GLU H    1 1 
        3  4230 1 1 87 GLU HA   H   24.852   4.924 -13.868 1.00 . A A . 743 GLU HA   1 1 
        3  4231 1 1 87 GLU HB2  H   24.092   4.182 -16.695 1.00 . A A . 743 GLU HB2  1 1 
        3  4232 1 1 87 GLU HB3  H   25.697   4.734 -16.235 1.00 . A A . 743 GLU HB3  1 1 
        3  4233 1 1 87 GLU HG2  H   24.319   2.283 -15.141 1.00 . A A . 743 GLU HG2  1 1 
        3  4234 1 1 87 GLU HG3  H   25.545   2.290 -16.408 1.00 . A A . 743 GLU HG3  1 1 
        3  4235 1 1 87 GLU N    N   22.898   4.469 -14.348 1.00 . A A . 743 GLU N    1 1 
        3  4236 1 1 87 GLU O    O   23.873   6.876 -16.246 1.00 . A A . 743 GLU O    1 1 
        3  4237 1 1 87 GLU OE1  O   27.484   2.766 -14.823 1.00 . A A . 743 GLU OE1  1 1 
        3  4238 1 1 87 GLU OE2  O   25.969   2.637 -13.249 1.00 . A A . 743 GLU OE2  1 1 
        3  4239 1 1 88 GLU C    C   25.618   9.348 -14.670 1.00 . A A . 744 GLU C    1 1 
        3  4240 1 1 88 GLU CA   C   24.232   8.822 -14.284 1.00 . A A . 744 GLU CA   1 1 
        3  4241 1 1 88 GLU CB   C   23.724   9.547 -13.025 1.00 . A A . 744 GLU CB   1 1 
        3  4242 1 1 88 GLU CD   C   21.738  10.086 -11.528 1.00 . A A . 744 GLU CD   1 1 
        3  4243 1 1 88 GLU CG   C   22.252   9.287 -12.720 1.00 . A A . 744 GLU CG   1 1 
        3  4244 1 1 88 GLU H    H   24.386   7.014 -13.173 1.00 . A A . 744 GLU H    1 1 
        3  4245 1 1 88 GLU HA   H   23.550   9.028 -15.099 1.00 . A A . 744 GLU HA   1 1 
        3  4246 1 1 88 GLU HB2  H   24.309   9.223 -12.176 1.00 . A A . 744 GLU HB2  1 1 
        3  4247 1 1 88 GLU HB3  H   23.858  10.611 -13.158 1.00 . A A . 744 GLU HB3  1 1 
        3  4248 1 1 88 GLU HG2  H   21.667   9.553 -13.588 1.00 . A A . 744 GLU HG2  1 1 
        3  4249 1 1 88 GLU HG3  H   22.123   8.232 -12.514 1.00 . A A . 744 GLU HG3  1 1 
        3  4250 1 1 88 GLU N    N   24.255   7.369 -14.080 1.00 . A A . 744 GLU N    1 1 
        3  4251 1 1 88 GLU O    O   26.469   9.593 -13.810 1.00 . A A . 744 GLU O    1 1 
        3  4252 1 1 88 GLU OE1  O   21.691  11.331 -11.618 1.00 . A A . 744 GLU OE1  1 1 
        3  4253 1 1 88 GLU OE2  O   21.355   9.471 -10.506 1.00 . A A . 744 GLU OE2  1 1 
        3  4254 1 1 89 VAL C    C   27.296  11.507 -16.126 1.00 . A A . 745 VAL C    1 1 
        3  4255 1 1 89 VAL CA   C   27.118  10.018 -16.476 1.00 . A A . 745 VAL CA   1 1 
        3  4256 1 1 89 VAL CB   C   27.242   9.814 -18.010 1.00 . A A . 745 VAL CB   1 1 
        3  4257 1 1 89 VAL CG1  C   26.073  10.464 -18.744 1.00 . A A . 745 VAL CG1  1 1 
        3  4258 1 1 89 VAL CG2  C   28.578  10.347 -18.528 1.00 . A A . 745 VAL CG2  1 1 
        3  4259 1 1 89 VAL H    H   25.141   9.259 -16.608 1.00 . A A . 745 VAL H    1 1 
        3  4260 1 1 89 VAL HA   H   27.909   9.453 -16.000 1.00 . A A . 745 VAL HA   1 1 
        3  4261 1 1 89 VAL HB   H   27.206   8.751 -18.208 1.00 . A A . 745 VAL HB   1 1 
        3  4262 1 1 89 VAL HG11 H   26.185  10.312 -19.809 1.00 . A A . 745 VAL HG11 1 1 
        3  4263 1 1 89 VAL HG12 H   26.057  11.524 -18.533 1.00 . A A . 745 VAL HG12 1 1 
        3  4264 1 1 89 VAL HG13 H   25.147  10.019 -18.415 1.00 . A A . 745 VAL HG13 1 1 
        3  4265 1 1 89 VAL HG21 H   28.647  10.179 -19.594 1.00 . A A . 745 VAL HG21 1 1 
        3  4266 1 1 89 VAL HG22 H   29.390   9.835 -18.032 1.00 . A A . 745 VAL HG22 1 1 
        3  4267 1 1 89 VAL HG23 H   28.647  11.408 -18.328 1.00 . A A . 745 VAL HG23 1 1 
        3  4268 1 1 89 VAL N    N   25.846   9.500 -15.971 1.00 . A A . 745 VAL N    1 1 
        3  4269 1 1 89 VAL O    O   26.350  12.296 -16.194 1.00 . A A . 745 VAL O    1 1 
        3  4270 1 1 90 LYS C    C   28.649  14.245 -16.528 1.00 . A A . 746 LYS C    1 1 
        3  4271 1 1 90 LYS CA   C   28.812  13.259 -15.348 1.00 . A A . 746 LYS CA   1 1 
        3  4272 1 1 90 LYS CB   C   30.228  13.334 -14.747 1.00 . A A . 746 LYS CB   1 1 
        3  4273 1 1 90 LYS CD   C   32.654  12.637 -14.919 1.00 . A A . 746 LYS CD   1 1 
        3  4274 1 1 90 LYS CE   C   33.140  13.979 -14.381 1.00 . A A . 746 LYS CE   1 1 
        3  4275 1 1 90 LYS CG   C   31.320  12.760 -15.648 1.00 . A A . 746 LYS CG   1 1 
        3  4276 1 1 90 LYS H    H   29.220  11.203 -15.687 1.00 . A A . 746 LYS H    1 1 
        3  4277 1 1 90 LYS HA   H   28.104  13.539 -14.580 1.00 . A A . 746 LYS HA   1 1 
        3  4278 1 1 90 LYS HB2  H   30.466  14.368 -14.545 1.00 . A A . 746 LYS HB2  1 1 
        3  4279 1 1 90 LYS HB3  H   30.235  12.785 -13.814 1.00 . A A . 746 LYS HB3  1 1 
        3  4280 1 1 90 LYS HD2  H   32.538  11.952 -14.093 1.00 . A A . 746 LYS HD2  1 1 
        3  4281 1 1 90 LYS HD3  H   33.393  12.246 -15.608 1.00 . A A . 746 LYS HD3  1 1 
        3  4282 1 1 90 LYS HE2  H   33.325  14.644 -15.213 1.00 . A A . 746 LYS HE2  1 1 
        3  4283 1 1 90 LYS HE3  H   32.375  14.402 -13.747 1.00 . A A . 746 LYS HE3  1 1 
        3  4284 1 1 90 LYS HG2  H   31.015  11.779 -15.984 1.00 . A A . 746 LYS HG2  1 1 
        3  4285 1 1 90 LYS HG3  H   31.444  13.410 -16.503 1.00 . A A . 746 LYS HG3  1 1 
        3  4286 1 1 90 LYS HZ1  H   34.673  14.746 -13.185 1.00 . A A . 746 LYS HZ1  1 1 
        3  4287 1 1 90 LYS HZ2  H   35.160  13.487 -14.204 1.00 . A A . 746 LYS HZ2  1 1 
        3  4288 1 1 90 LYS HZ3  H   34.251  13.151 -12.818 1.00 . A A . 746 LYS HZ3  1 1 
        3  4289 1 1 90 LYS N    N   28.509  11.879 -15.732 1.00 . A A . 746 LYS N    1 1 
        3  4290 1 1 90 LYS NZ   N   34.393  13.833 -13.593 1.00 . A A . 746 LYS NZ   1 1 
        3  4291 1 1 90 LYS O    O   29.596  14.540 -17.261 1.00 . A A . 746 LYS O    1 1 
        3  4292 1 1 91 ASN C    C   27.288  17.148 -17.197 1.00 . A A . 747 ASN C    1 1 
        3  4293 1 1 91 ASN CA   C   27.122  15.728 -17.749 1.00 . A A . 747 ASN CA   1 1 
        3  4294 1 1 91 ASN CB   C   25.686  15.554 -18.264 1.00 . A A . 747 ASN CB   1 1 
        3  4295 1 1 91 ASN CG   C   25.434  14.196 -18.893 1.00 . A A . 747 ASN CG   1 1 
        3  4296 1 1 91 ASN H    H   26.687  14.389 -16.161 1.00 . A A . 747 ASN H    1 1 
        3  4297 1 1 91 ASN HA   H   27.810  15.586 -18.573 1.00 . A A . 747 ASN HA   1 1 
        3  4298 1 1 91 ASN HB2  H   24.998  15.677 -17.441 1.00 . A A . 747 ASN HB2  1 1 
        3  4299 1 1 91 ASN HB3  H   25.485  16.314 -19.006 1.00 . A A . 747 ASN HB3  1 1 
        3  4300 1 1 91 ASN HD21 H   27.296  14.098 -19.561 1.00 . A A . 747 ASN HD21 1 1 
        3  4301 1 1 91 ASN HD22 H   26.283  12.760 -19.946 1.00 . A A . 747 ASN HD22 1 1 
        3  4302 1 1 91 ASN N    N   27.420  14.727 -16.720 1.00 . A A . 747 ASN N    1 1 
        3  4303 1 1 91 ASN ND2  N   26.440  13.629 -19.526 1.00 . A A . 747 ASN ND2  1 1 
        3  4304 1 1 91 ASN O    O   26.751  17.476 -16.139 1.00 . A A . 747 ASN O    1 1 
        3  4305 1 1 91 ASN OD1  O   24.329  13.667 -18.827 1.00 . A A . 747 ASN OD1  1 1 
        3  4306 1 1 92 ASP C    C   26.880  20.161 -17.850 1.00 . A A . 748 ASP C    1 1 
        3  4307 1 1 92 ASP CA   C   28.173  19.394 -17.525 1.00 . A A . 748 ASP CA   1 1 
        3  4308 1 1 92 ASP CB   C   29.372  20.024 -18.246 1.00 . A A . 748 ASP CB   1 1 
        3  4309 1 1 92 ASP CG   C   29.695  21.419 -17.735 1.00 . A A . 748 ASP CG   1 1 
        3  4310 1 1 92 ASP H    H   28.498  17.661 -18.705 1.00 . A A . 748 ASP H    1 1 
        3  4311 1 1 92 ASP HA   H   28.345  19.433 -16.455 1.00 . A A . 748 ASP HA   1 1 
        3  4312 1 1 92 ASP HB2  H   30.242  19.397 -18.103 1.00 . A A . 748 ASP HB2  1 1 
        3  4313 1 1 92 ASP HB3  H   29.157  20.086 -19.305 1.00 . A A . 748 ASP HB3  1 1 
        3  4314 1 1 92 ASP N    N   28.032  17.989 -17.907 1.00 . A A . 748 ASP N    1 1 
        3  4315 1 1 92 ASP O    O   26.620  20.507 -19.006 1.00 . A A . 748 ASP O    1 1 
        3  4316 1 1 92 ASP OD1  O   30.329  21.531 -16.664 1.00 . A A . 748 ASP OD1  1 1 
        3  4317 1 1 92 ASP OD2  O   29.335  22.410 -18.403 1.00 . A A . 748 ASP OD2  1 1 
        3  4318 1 1 93 LYS C    C   24.344  21.859 -15.771 1.00 . A A . 749 LYS C    1 1 
        3  4319 1 1 93 LYS CA   C   24.758  21.056 -17.021 1.00 . A A . 749 LYS CA   1 1 
        3  4320 1 1 93 LYS CB   C   23.686  20.012 -17.401 1.00 . A A . 749 LYS CB   1 1 
        3  4321 1 1 93 LYS CD   C   22.745  17.687 -16.997 1.00 . A A . 749 LYS CD   1 1 
        3  4322 1 1 93 LYS CE   C   21.297  18.118 -17.212 1.00 . A A . 749 LYS CE   1 1 
        3  4323 1 1 93 LYS CG   C   23.615  18.817 -16.448 1.00 . A A . 749 LYS CG   1 1 
        3  4324 1 1 93 LYS H    H   26.309  20.087 -15.934 1.00 . A A . 749 LYS H    1 1 
        3  4325 1 1 93 LYS HA   H   24.866  21.750 -17.844 1.00 . A A . 749 LYS HA   1 1 
        3  4326 1 1 93 LYS HB2  H   22.719  20.493 -17.414 1.00 . A A . 749 LYS HB2  1 1 
        3  4327 1 1 93 LYS HB3  H   23.903  19.640 -18.393 1.00 . A A . 749 LYS HB3  1 1 
        3  4328 1 1 93 LYS HD2  H   23.152  17.360 -17.943 1.00 . A A . 749 LYS HD2  1 1 
        3  4329 1 1 93 LYS HD3  H   22.764  16.862 -16.298 1.00 . A A . 749 LYS HD3  1 1 
        3  4330 1 1 93 LYS HE2  H   20.891  18.467 -16.273 1.00 . A A . 749 LYS HE2  1 1 
        3  4331 1 1 93 LYS HE3  H   21.275  18.921 -17.934 1.00 . A A . 749 LYS HE3  1 1 
        3  4332 1 1 93 LYS HG2  H   24.614  18.435 -16.289 1.00 . A A . 749 LYS HG2  1 1 
        3  4333 1 1 93 LYS HG3  H   23.205  19.149 -15.504 1.00 . A A . 749 LYS HG3  1 1 
        3  4334 1 1 93 LYS HZ1  H   20.837  16.640 -18.613 1.00 . A A . 749 LYS HZ1  1 1 
        3  4335 1 1 93 LYS HZ2  H   19.479  17.318 -17.867 1.00 . A A . 749 LYS HZ2  1 1 
        3  4336 1 1 93 LYS HZ3  H   20.447  16.218 -17.023 1.00 . A A . 749 LYS HZ3  1 1 
        3  4337 1 1 93 LYS N    N   26.051  20.385 -16.835 1.00 . A A . 749 LYS N    1 1 
        3  4338 1 1 93 LYS NZ   N   20.458  16.996 -17.713 1.00 . A A . 749 LYS NZ   1 1 
        3  4339 1 1 93 LYS O    O   23.378  21.515 -15.078 1.00 . A A . 749 LYS O    1 1 
        3  4340 1 1 94 PRO C    C   23.898  25.021 -14.771 1.00 . A A . 750 PRO C    1 1 
        3  4341 1 1 94 PRO CA   C   24.770  23.828 -14.338 1.00 . A A . 750 PRO CA   1 1 
        3  4342 1 1 94 PRO CB   C   26.160  24.284 -13.884 1.00 . A A . 750 PRO CB   1 1 
        3  4343 1 1 94 PRO CD   C   26.332  23.367 -16.131 1.00 . A A . 750 PRO CD   1 1 
        3  4344 1 1 94 PRO CG   C   26.987  24.311 -15.138 1.00 . A A . 750 PRO CG   1 1 
        3  4345 1 1 94 PRO HA   H   24.280  23.298 -13.533 1.00 . A A . 750 PRO HA   1 1 
        3  4346 1 1 94 PRO HB2  H   26.095  25.263 -13.428 1.00 . A A . 750 PRO HB2  1 1 
        3  4347 1 1 94 PRO HB3  H   26.558  23.577 -13.168 1.00 . A A . 750 PRO HB3  1 1 
        3  4348 1 1 94 PRO HD2  H   26.105  23.886 -17.052 1.00 . A A . 750 PRO HD2  1 1 
        3  4349 1 1 94 PRO HD3  H   26.975  22.521 -16.327 1.00 . A A . 750 PRO HD3  1 1 
        3  4350 1 1 94 PRO HG2  H   27.008  25.315 -15.539 1.00 . A A . 750 PRO HG2  1 1 
        3  4351 1 1 94 PRO HG3  H   27.995  23.982 -14.917 1.00 . A A . 750 PRO HG3  1 1 
        3  4352 1 1 94 PRO N    N   25.093  22.937 -15.451 1.00 . A A . 750 PRO N    1 1 
        3  4353 1 1 94 PRO O    O   24.404  26.073 -15.171 1.00 . A A . 750 PRO O    1 1 
        3  4354 1 1 95 ILE C    C   21.396  26.905 -13.992 1.00 . A A . 751 ILE C    1 1 
        3  4355 1 1 95 ILE CA   C   21.644  25.892 -15.125 1.00 . A A . 751 ILE CA   1 1 
        3  4356 1 1 95 ILE CB   C   20.291  25.287 -15.590 1.00 . A A . 751 ILE CB   1 1 
        3  4357 1 1 95 ILE CD1  C   21.161  24.848 -17.963 1.00 . A A . 751 ILE CD1  1 1 
        3  4358 1 1 95 ILE CG1  C   20.514  24.264 -16.723 1.00 . A A . 751 ILE CG1  1 1 
        3  4359 1 1 95 ILE CG2  C   19.327  26.388 -16.039 1.00 . A A . 751 ILE CG2  1 1 
        3  4360 1 1 95 ILE H    H   22.230  23.995 -14.367 1.00 . A A . 751 ILE H    1 1 
        3  4361 1 1 95 ILE HA   H   22.085  26.414 -15.965 1.00 . A A . 751 ILE HA   1 1 
        3  4362 1 1 95 ILE HB   H   19.844  24.779 -14.747 1.00 . A A . 751 ILE HB   1 1 
        3  4363 1 1 95 ILE HD11 H   20.529  25.627 -18.364 1.00 . A A . 751 ILE HD11 1 1 
        3  4364 1 1 95 ILE HD12 H   21.289  24.072 -18.702 1.00 . A A . 751 ILE HD12 1 1 
        3  4365 1 1 95 ILE HD13 H   22.125  25.263 -17.706 1.00 . A A . 751 ILE HD13 1 1 
        3  4366 1 1 95 ILE HG12 H   21.154  23.472 -16.363 1.00 . A A . 751 ILE HG12 1 1 
        3  4367 1 1 95 ILE HG13 H   19.561  23.843 -17.013 1.00 . A A . 751 ILE HG13 1 1 
        3  4368 1 1 95 ILE HG21 H   19.769  26.952 -16.847 1.00 . A A . 751 ILE HG21 1 1 
        3  4369 1 1 95 ILE HG22 H   19.123  27.050 -15.208 1.00 . A A . 751 ILE HG22 1 1 
        3  4370 1 1 95 ILE HG23 H   18.400  25.943 -16.375 1.00 . A A . 751 ILE HG23 1 1 
        3  4371 1 1 95 ILE N    N   22.582  24.845 -14.706 1.00 . A A . 751 ILE N    1 1 
        3  4372 1 1 95 ILE O    O   20.536  26.694 -13.129 1.00 . A A . 751 ILE O    1 1 
        3  4373 1 1 96 LEU C    C   20.721  29.867 -13.281 1.00 . A A . 752 LEU C    1 1 
        3  4374 1 1 96 LEU CA   C   21.993  29.053 -12.986 1.00 . A A . 752 LEU CA   1 1 
        3  4375 1 1 96 LEU CB   C   23.228  29.969 -12.957 1.00 . A A . 752 LEU CB   1 1 
        3  4376 1 1 96 LEU CD1  C   23.120  30.502 -10.489 1.00 . A A . 752 LEU CD1  1 1 
        3  4377 1 1 96 LEU CD2  C   24.427  31.991 -12.041 1.00 . A A . 752 LEU CD2  1 1 
        3  4378 1 1 96 LEU CG   C   23.203  31.088 -11.898 1.00 . A A . 752 LEU CG   1 1 
        3  4379 1 1 96 LEU H    H   22.881  28.075 -14.653 1.00 . A A . 752 LEU H    1 1 
        3  4380 1 1 96 LEU HA   H   21.883  28.582 -12.018 1.00 . A A . 752 LEU HA   1 1 
        3  4381 1 1 96 LEU HB2  H   24.099  29.352 -12.781 1.00 . A A . 752 LEU HB2  1 1 
        3  4382 1 1 96 LEU HB3  H   23.331  30.429 -13.931 1.00 . A A . 752 LEU HB3  1 1 
        3  4383 1 1 96 LEU HD11 H   23.088  31.304  -9.767 1.00 . A A . 752 LEU HD11 1 1 
        3  4384 1 1 96 LEU HD12 H   23.987  29.884 -10.301 1.00 . A A . 752 LEU HD12 1 1 
        3  4385 1 1 96 LEU HD13 H   22.225  29.904 -10.400 1.00 . A A . 752 LEU HD13 1 1 
        3  4386 1 1 96 LEU HD21 H   24.381  32.777 -11.301 1.00 . A A . 752 LEU HD21 1 1 
        3  4387 1 1 96 LEU HD22 H   24.437  32.431 -13.027 1.00 . A A . 752 LEU HD22 1 1 
        3  4388 1 1 96 LEU HD23 H   25.326  31.412 -11.895 1.00 . A A . 752 LEU HD23 1 1 
        3  4389 1 1 96 LEU HG   H   22.322  31.696 -12.054 1.00 . A A . 752 LEU HG   1 1 
        3  4390 1 1 96 LEU N    N   22.171  27.990 -13.981 1.00 . A A . 752 LEU N    1 1 
        3  4391 1 1 96 LEU O    O   20.757  30.884 -13.976 1.00 . A A . 752 LEU O    1 1 
        3  4392 1 1 97 GLU C    C   17.897  30.947 -11.849 1.00 . A A . 753 GLU C    1 1 
        3  4393 1 1 97 GLU CA   C   18.294  30.024 -13.009 1.00 . A A . 753 GLU CA   1 1 
        3  4394 1 1 97 GLU CB   C   17.225  28.943 -13.225 1.00 . A A . 753 GLU CB   1 1 
        3  4395 1 1 97 GLU CD   C   16.243  26.746 -12.431 1.00 . A A . 753 GLU CD   1 1 
        3  4396 1 1 97 GLU CG   C   17.154  27.915 -12.100 1.00 . A A . 753 GLU CG   1 1 
        3  4397 1 1 97 GLU H    H   19.630  28.565 -12.238 1.00 . A A . 753 GLU H    1 1 
        3  4398 1 1 97 GLU HA   H   18.371  30.619 -13.909 1.00 . A A . 753 GLU HA   1 1 
        3  4399 1 1 97 GLU HB2  H   16.257  29.419 -13.313 1.00 . A A . 753 GLU HB2  1 1 
        3  4400 1 1 97 GLU HB3  H   17.442  28.422 -14.148 1.00 . A A . 753 GLU HB3  1 1 
        3  4401 1 1 97 GLU HG2  H   18.147  27.535 -11.914 1.00 . A A . 753 GLU HG2  1 1 
        3  4402 1 1 97 GLU HG3  H   16.786  28.402 -11.206 1.00 . A A . 753 GLU HG3  1 1 
        3  4403 1 1 97 GLU N    N   19.593  29.385 -12.775 1.00 . A A . 753 GLU N    1 1 
        3  4404 1 1 97 GLU O    O   18.377  30.805 -10.717 1.00 . A A . 753 GLU O    1 1 
        3  4405 1 1 97 GLU OE1  O   16.670  25.852 -13.189 1.00 . A A . 753 GLU OE1  1 1 
        3  4406 1 1 97 GLU OE2  O   15.101  26.707 -11.927 1.00 . A A . 753 GLU OE2  1 1 
        3  4407 2 2  1 CA  CA   CA -17.325  -3.124   5.714 1.00 . B A . 762 CA  CA   1 1 
        4  4408 1 1  1 MET C    C  -37.203 -11.422  17.201 1.00 . A A . 657 MET C    1 1 
        4  4409 1 1  1 MET CA   C  -37.251 -12.917  17.538 1.00 . A A . 657 MET CA   1 1 
        4  4410 1 1  1 MET CB   C  -38.069 -13.135  18.821 1.00 . A A . 657 MET CB   1 1 
        4  4411 1 1  1 MET CE   C  -40.584 -15.072  18.092 1.00 . A A . 657 MET CE   1 1 
        4  4412 1 1  1 MET CG   C  -39.496 -12.601  18.743 1.00 . A A . 657 MET CG   1 1 
        4  4413 1 1  1 MET H1   H  -35.377 -12.986  18.468 1.00 . A A . 657 MET H1   1 1 
        4  4414 1 1  1 MET H2   H  -35.337 -13.360  16.818 1.00 . A A . 657 MET H2   1 1 
        4  4415 1 1  1 MET H3   H  -35.931 -14.490  17.926 1.00 . A A . 657 MET H3   1 1 
        4  4416 1 1  1 MET HA   H  -37.731 -13.441  16.721 1.00 . A A . 657 MET HA   1 1 
        4  4417 1 1  1 MET HB2  H  -38.117 -14.195  19.027 1.00 . A A . 657 MET HB2  1 1 
        4  4418 1 1  1 MET HB3  H  -37.567 -12.643  19.642 1.00 . A A . 657 MET HB3  1 1 
        4  4419 1 1  1 MET HE1  H  -41.078 -15.057  19.054 1.00 . A A . 657 MET HE1  1 1 
        4  4420 1 1  1 MET HE2  H  -39.592 -15.485  18.205 1.00 . A A . 657 MET HE2  1 1 
        4  4421 1 1  1 MET HE3  H  -41.151 -15.683  17.405 1.00 . A A . 657 MET HE3  1 1 
        4  4422 1 1  1 MET HG2  H  -39.980 -12.769  19.694 1.00 . A A . 657 MET HG2  1 1 
        4  4423 1 1  1 MET HG3  H  -39.461 -11.539  18.542 1.00 . A A . 657 MET HG3  1 1 
        4  4424 1 1  1 MET N    N  -35.880 -13.476  17.698 1.00 . A A . 657 MET N    1 1 
        4  4425 1 1  1 MET O    O  -37.038 -10.582  18.087 1.00 . A A . 657 MET O    1 1 
        4  4426 1 1  1 MET SD   S  -40.470 -13.399  17.452 1.00 . A A . 657 MET SD   1 1 
        4  4427 1 1  2 GLY C    C  -36.694  -9.526  14.102 1.00 . A A . 658 GLY C    1 1 
        4  4428 1 1  2 GLY CA   C  -37.308  -9.703  15.487 1.00 . A A . 658 GLY CA   1 1 
        4  4429 1 1  2 GLY H    H  -37.456 -11.810  15.252 1.00 . A A . 658 GLY H    1 1 
        4  4430 1 1  2 GLY HA2  H  -38.319  -9.326  15.469 1.00 . A A . 658 GLY HA2  1 1 
        4  4431 1 1  2 GLY HA3  H  -36.735  -9.126  16.199 1.00 . A A . 658 GLY HA3  1 1 
        4  4432 1 1  2 GLY N    N  -37.338 -11.098  15.917 1.00 . A A . 658 GLY N    1 1 
        4  4433 1 1  2 GLY O    O  -37.252  -9.987  13.102 1.00 . A A . 658 GLY O    1 1 
        4  4434 1 1  3 ASN C    C  -33.600  -9.581  12.680 1.00 . A A . 659 ASN C    1 1 
        4  4435 1 1  3 ASN CA   C  -34.820  -8.645  12.782 1.00 . A A . 659 ASN CA   1 1 
        4  4436 1 1  3 ASN CB   C  -34.369  -7.178  12.676 1.00 . A A . 659 ASN CB   1 1 
        4  4437 1 1  3 ASN CG   C  -35.538  -6.206  12.631 1.00 . A A . 659 ASN CG   1 1 
        4  4438 1 1  3 ASN H    H  -35.169  -8.485  14.873 1.00 . A A . 659 ASN H    1 1 
        4  4439 1 1  3 ASN HA   H  -35.494  -8.867  11.966 1.00 . A A . 659 ASN HA   1 1 
        4  4440 1 1  3 ASN HB2  H  -33.755  -6.934  13.532 1.00 . A A . 659 ASN HB2  1 1 
        4  4441 1 1  3 ASN HB3  H  -33.785  -7.050  11.774 1.00 . A A . 659 ASN HB3  1 1 
        4  4442 1 1  3 ASN HD21 H  -34.499  -4.847  13.626 1.00 . A A . 659 ASN HD21 1 1 
        4  4443 1 1  3 ASN HD22 H  -36.108  -4.398  13.194 1.00 . A A . 659 ASN HD22 1 1 
        4  4444 1 1  3 ASN N    N  -35.544  -8.854  14.042 1.00 . A A . 659 ASN N    1 1 
        4  4445 1 1  3 ASN ND2  N  -35.362  -5.033  13.204 1.00 . A A . 659 ASN ND2  1 1 
        4  4446 1 1  3 ASN O    O  -33.362 -10.411  13.563 1.00 . A A . 659 ASN O    1 1 
        4  4447 1 1  3 ASN OD1  O  -36.595  -6.510  12.088 1.00 . A A . 659 ASN OD1  1 1 
        4  4448 1 1  4 GLY C    C  -30.388  -9.376  11.130 1.00 . A A . 660 GLY C    1 1 
        4  4449 1 1  4 GLY CA   C  -31.614 -10.239  11.425 1.00 . A A . 660 GLY CA   1 1 
        4  4450 1 1  4 GLY H    H  -33.110  -8.825  10.893 1.00 . A A . 660 GLY H    1 1 
        4  4451 1 1  4 GLY HA2  H  -31.431 -10.809  12.326 1.00 . A A . 660 GLY HA2  1 1 
        4  4452 1 1  4 GLY HA3  H  -31.759 -10.928  10.604 1.00 . A A . 660 GLY HA3  1 1 
        4  4453 1 1  4 GLY N    N  -32.837  -9.451  11.596 1.00 . A A . 660 GLY N    1 1 
        4  4454 1 1  4 GLY O    O  -30.364  -8.639  10.142 1.00 . A A . 660 GLY O    1 1 
        4  4455 1 1  5 GLU C    C  -27.287  -9.213  10.638 1.00 . A A . 661 GLU C    1 1 
        4  4456 1 1  5 GLU CA   C  -28.133  -8.689  11.812 1.00 . A A . 661 GLU CA   1 1 
        4  4457 1 1  5 GLU CB   C  -27.302  -8.711  13.106 1.00 . A A . 661 GLU CB   1 1 
        4  4458 1 1  5 GLU CD   C  -27.914  -6.393  13.930 1.00 . A A . 661 GLU CD   1 1 
        4  4459 1 1  5 GLU CG   C  -27.898  -7.882  14.243 1.00 . A A . 661 GLU CG   1 1 
        4  4460 1 1  5 GLU H    H  -29.449 -10.060  12.761 1.00 . A A . 661 GLU H    1 1 
        4  4461 1 1  5 GLU HA   H  -28.416  -7.665  11.601 1.00 . A A . 661 GLU HA   1 1 
        4  4462 1 1  5 GLU HB2  H  -27.214  -9.735  13.445 1.00 . A A . 661 GLU HB2  1 1 
        4  4463 1 1  5 GLU HB3  H  -26.312  -8.330  12.892 1.00 . A A . 661 GLU HB3  1 1 
        4  4464 1 1  5 GLU HG2  H  -28.912  -8.213  14.420 1.00 . A A . 661 GLU HG2  1 1 
        4  4465 1 1  5 GLU HG3  H  -27.309  -8.044  15.135 1.00 . A A . 661 GLU HG3  1 1 
        4  4466 1 1  5 GLU N    N  -29.369  -9.463  11.987 1.00 . A A . 661 GLU N    1 1 
        4  4467 1 1  5 GLU O    O  -27.028 -10.412  10.532 1.00 . A A . 661 GLU O    1 1 
        4  4468 1 1  5 GLU OE1  O  -26.895  -5.714  14.180 1.00 . A A . 661 GLU OE1  1 1 
        4  4469 1 1  5 GLU OE2  O  -28.939  -5.894  13.417 1.00 . A A . 661 GLU OE2  1 1 
        4  4470 1 1  6 THR C    C  -24.547  -8.679   8.900 1.00 . A A . 662 THR C    1 1 
        4  4471 1 1  6 THR CA   C  -26.051  -8.672   8.587 1.00 . A A . 662 THR CA   1 1 
        4  4472 1 1  6 THR CB   C  -26.313  -7.702   7.407 1.00 . A A . 662 THR CB   1 1 
        4  4473 1 1  6 THR CG2  C  -25.579  -8.151   6.145 1.00 . A A . 662 THR CG2  1 1 
        4  4474 1 1  6 THR H    H  -27.074  -7.359   9.916 1.00 . A A . 662 THR H    1 1 
        4  4475 1 1  6 THR HA   H  -26.349  -9.666   8.279 1.00 . A A . 662 THR HA   1 1 
        4  4476 1 1  6 THR HB   H  -25.957  -6.717   7.683 1.00 . A A . 662 THR HB   1 1 
        4  4477 1 1  6 THR HG1  H  -27.887  -7.929   6.232 1.00 . A A . 662 THR HG1  1 1 
        4  4478 1 1  6 THR HG21 H  -24.515  -8.177   6.334 1.00 . A A . 662 THR HG21 1 1 
        4  4479 1 1  6 THR HG22 H  -25.784  -7.457   5.342 1.00 . A A . 662 THR HG22 1 1 
        4  4480 1 1  6 THR HG23 H  -25.918  -9.137   5.862 1.00 . A A . 662 THR HG23 1 1 
        4  4481 1 1  6 THR N    N  -26.851  -8.305   9.767 1.00 . A A . 662 THR N    1 1 
        4  4482 1 1  6 THR O    O  -24.044  -7.806   9.610 1.00 . A A . 662 THR O    1 1 
        4  4483 1 1  6 THR OG1  O  -27.720  -7.627   7.134 1.00 . A A . 662 THR OG1  1 1 
        4  4484 1 1  7 SER C    C  -21.564  -8.975   7.587 1.00 . A A . 663 SER C    1 1 
        4  4485 1 1  7 SER CA   C  -22.382  -9.801   8.590 1.00 . A A . 663 SER CA   1 1 
        4  4486 1 1  7 SER CB   C  -21.964 -11.277   8.487 1.00 . A A . 663 SER CB   1 1 
        4  4487 1 1  7 SER H    H  -24.284 -10.321   7.787 1.00 . A A . 663 SER H    1 1 
        4  4488 1 1  7 SER HA   H  -22.169  -9.448   9.590 1.00 . A A . 663 SER HA   1 1 
        4  4489 1 1  7 SER HB2  H  -22.158 -11.637   7.487 1.00 . A A . 663 SER HB2  1 1 
        4  4490 1 1  7 SER HB3  H  -20.907 -11.366   8.699 1.00 . A A . 663 SER HB3  1 1 
        4  4491 1 1  7 SER HG   H  -22.206 -12.113  10.246 1.00 . A A . 663 SER HG   1 1 
        4  4492 1 1  7 SER N    N  -23.830  -9.662   8.357 1.00 . A A . 663 SER N    1 1 
        4  4493 1 1  7 SER O    O  -21.576  -9.258   6.385 1.00 . A A . 663 SER O    1 1 
        4  4494 1 1  7 SER OG   O  -22.681 -12.085   9.406 1.00 . A A . 663 SER OG   1 1 
        4  4495 1 1  8 ASP C    C  -18.687  -7.910   6.862 1.00 . A A . 664 ASP C    1 1 
        4  4496 1 1  8 ASP CA   C  -19.976  -7.150   7.215 1.00 . A A . 664 ASP CA   1 1 
        4  4497 1 1  8 ASP CB   C  -19.621  -5.818   7.899 1.00 . A A . 664 ASP CB   1 1 
        4  4498 1 1  8 ASP CG   C  -18.725  -4.943   7.031 1.00 . A A . 664 ASP CG   1 1 
        4  4499 1 1  8 ASP H    H  -20.908  -7.751   9.033 1.00 . A A . 664 ASP H    1 1 
        4  4500 1 1  8 ASP HA   H  -20.517  -6.938   6.303 1.00 . A A . 664 ASP HA   1 1 
        4  4501 1 1  8 ASP HB2  H  -20.532  -5.276   8.110 1.00 . A A . 664 ASP HB2  1 1 
        4  4502 1 1  8 ASP HB3  H  -19.107  -6.021   8.829 1.00 . A A . 664 ASP HB3  1 1 
        4  4503 1 1  8 ASP N    N  -20.850  -7.960   8.077 1.00 . A A . 664 ASP N    1 1 
        4  4504 1 1  8 ASP O    O  -18.079  -8.556   7.718 1.00 . A A . 664 ASP O    1 1 
        4  4505 1 1  8 ASP OD1  O  -17.487  -5.087   7.087 1.00 . A A . 664 ASP OD1  1 1 
        4  4506 1 1  8 ASP OD2  O  -19.244  -4.117   6.263 1.00 . A A . 664 ASP OD2  1 1 
        4  4507 1 1  9 LEU C    C  -15.894  -7.364   5.247 1.00 . A A . 665 LEU C    1 1 
        4  4508 1 1  9 LEU CA   C  -17.017  -8.408   5.147 1.00 . A A . 665 LEU CA   1 1 
        4  4509 1 1  9 LEU CB   C  -17.141  -8.901   3.696 1.00 . A A . 665 LEU CB   1 1 
        4  4510 1 1  9 LEU CD1  C  -18.309 -10.326   1.976 1.00 . A A . 665 LEU CD1  1 1 
        4  4511 1 1  9 LEU CD2  C  -17.870 -11.245   4.269 1.00 . A A . 665 LEU CD2  1 1 
        4  4512 1 1  9 LEU CG   C  -18.199  -9.992   3.460 1.00 . A A . 665 LEU CG   1 1 
        4  4513 1 1  9 LEU H    H  -18.873  -7.394   4.940 1.00 . A A . 665 LEU H    1 1 
        4  4514 1 1  9 LEU HA   H  -16.777  -9.247   5.786 1.00 . A A . 665 LEU HA   1 1 
        4  4515 1 1  9 LEU HB2  H  -17.381  -8.052   3.071 1.00 . A A . 665 LEU HB2  1 1 
        4  4516 1 1  9 LEU HB3  H  -16.180  -9.291   3.389 1.00 . A A . 665 LEU HB3  1 1 
        4  4517 1 1  9 LEU HD11 H  -19.055 -11.094   1.831 1.00 . A A . 665 LEU HD11 1 1 
        4  4518 1 1  9 LEU HD12 H  -17.354 -10.679   1.611 1.00 . A A . 665 LEU HD12 1 1 
        4  4519 1 1  9 LEU HD13 H  -18.596  -9.440   1.426 1.00 . A A . 665 LEU HD13 1 1 
        4  4520 1 1  9 LEU HD21 H  -16.905 -11.629   3.966 1.00 . A A . 665 LEU HD21 1 1 
        4  4521 1 1  9 LEU HD22 H  -18.626 -11.997   4.092 1.00 . A A . 665 LEU HD22 1 1 
        4  4522 1 1  9 LEU HD23 H  -17.846 -11.002   5.321 1.00 . A A . 665 LEU HD23 1 1 
        4  4523 1 1  9 LEU HG   H  -19.163  -9.628   3.788 1.00 . A A . 665 LEU HG   1 1 
        4  4524 1 1  9 LEU N    N  -18.289  -7.838   5.597 1.00 . A A . 665 LEU N    1 1 
        4  4525 1 1  9 LEU O    O  -16.094  -6.198   4.900 1.00 . A A . 665 LEU O    1 1 
        4  4526 1 1 10 GLU C    C  -13.069  -6.443   4.438 1.00 . A A . 666 GLU C    1 1 
        4  4527 1 1 10 GLU CA   C  -13.570  -6.866   5.835 1.00 . A A . 666 GLU CA   1 1 
        4  4528 1 1 10 GLU CB   C  -12.422  -7.477   6.674 1.00 . A A . 666 GLU CB   1 1 
        4  4529 1 1 10 GLU CD   C  -13.187  -9.765   7.475 1.00 . A A . 666 GLU CD   1 1 
        4  4530 1 1 10 GLU CG   C  -12.247  -8.993   6.556 1.00 . A A . 666 GLU CG   1 1 
        4  4531 1 1 10 GLU H    H  -14.639  -8.696   6.048 1.00 . A A . 666 GLU H    1 1 
        4  4532 1 1 10 GLU HA   H  -13.916  -5.973   6.339 1.00 . A A . 666 GLU HA   1 1 
        4  4533 1 1 10 GLU HB2  H  -11.493  -7.012   6.375 1.00 . A A . 666 GLU HB2  1 1 
        4  4534 1 1 10 GLU HB3  H  -12.599  -7.240   7.714 1.00 . A A . 666 GLU HB3  1 1 
        4  4535 1 1 10 GLU HG2  H  -12.439  -9.289   5.535 1.00 . A A . 666 GLU HG2  1 1 
        4  4536 1 1 10 GLU HG3  H  -11.228  -9.245   6.814 1.00 . A A . 666 GLU HG3  1 1 
        4  4537 1 1 10 GLU N    N  -14.727  -7.772   5.743 1.00 . A A . 666 GLU N    1 1 
        4  4538 1 1 10 GLU O    O  -13.025  -7.253   3.508 1.00 . A A . 666 GLU O    1 1 
        4  4539 1 1 10 GLU OE1  O  -12.945  -9.783   8.699 1.00 . A A . 666 GLU OE1  1 1 
        4  4540 1 1 10 GLU OE2  O  -14.176 -10.345   6.979 1.00 . A A . 666 GLU OE2  1 1 
        4  4541 1 1 11 PRO C    C  -11.319  -5.289   2.146 1.00 . A A . 667 PRO C    1 1 
        4  4542 1 1 11 PRO CA   C  -12.375  -4.544   2.980 1.00 . A A . 667 PRO CA   1 1 
        4  4543 1 1 11 PRO CB   C  -11.876  -3.129   3.339 1.00 . A A . 667 PRO CB   1 1 
        4  4544 1 1 11 PRO CD   C  -12.495  -4.193   5.387 1.00 . A A . 667 PRO CD   1 1 
        4  4545 1 1 11 PRO CG   C  -11.561  -3.176   4.797 1.00 . A A . 667 PRO CG   1 1 
        4  4546 1 1 11 PRO HA   H  -13.278  -4.457   2.392 1.00 . A A . 667 PRO HA   1 1 
        4  4547 1 1 11 PRO HB2  H  -10.998  -2.890   2.754 1.00 . A A . 667 PRO HB2  1 1 
        4  4548 1 1 11 PRO HB3  H  -12.655  -2.407   3.129 1.00 . A A . 667 PRO HB3  1 1 
        4  4549 1 1 11 PRO HD2  H  -12.048  -4.664   6.250 1.00 . A A . 667 PRO HD2  1 1 
        4  4550 1 1 11 PRO HD3  H  -13.438  -3.735   5.651 1.00 . A A . 667 PRO HD3  1 1 
        4  4551 1 1 11 PRO HG2  H  -10.534  -3.480   4.943 1.00 . A A . 667 PRO HG2  1 1 
        4  4552 1 1 11 PRO HG3  H  -11.730  -2.206   5.245 1.00 . A A . 667 PRO HG3  1 1 
        4  4553 1 1 11 PRO N    N  -12.674  -5.158   4.291 1.00 . A A . 667 PRO N    1 1 
        4  4554 1 1 11 PRO O    O  -10.361  -5.859   2.673 1.00 . A A . 667 PRO O    1 1 
        4  4555 1 1 12 LYS C    C   -9.432  -4.879  -0.446 1.00 . A A . 668 LYS C    1 1 
        4  4556 1 1 12 LYS CA   C  -10.573  -5.862  -0.117 1.00 . A A . 668 LYS CA   1 1 
        4  4557 1 1 12 LYS CB   C  -11.347  -6.291  -1.380 1.00 . A A . 668 LYS CB   1 1 
        4  4558 1 1 12 LYS CD   C  -10.150  -5.795  -3.558 1.00 . A A . 668 LYS CD   1 1 
        4  4559 1 1 12 LYS CE   C   -9.404  -6.386  -4.743 1.00 . A A . 668 LYS CE   1 1 
        4  4560 1 1 12 LYS CG   C  -10.492  -6.857  -2.516 1.00 . A A . 668 LYS CG   1 1 
        4  4561 1 1 12 LYS H    H  -12.309  -4.809   0.482 1.00 . A A . 668 LYS H    1 1 
        4  4562 1 1 12 LYS HA   H  -10.150  -6.743   0.349 1.00 . A A . 668 LYS HA   1 1 
        4  4563 1 1 12 LYS HB2  H  -12.063  -7.050  -1.096 1.00 . A A . 668 LYS HB2  1 1 
        4  4564 1 1 12 LYS HB3  H  -11.889  -5.434  -1.757 1.00 . A A . 668 LYS HB3  1 1 
        4  4565 1 1 12 LYS HD2  H  -11.066  -5.344  -3.912 1.00 . A A . 668 LYS HD2  1 1 
        4  4566 1 1 12 LYS HD3  H   -9.531  -5.037  -3.097 1.00 . A A . 668 LYS HD3  1 1 
        4  4567 1 1 12 LYS HE2  H  -10.001  -7.177  -5.173 1.00 . A A . 668 LYS HE2  1 1 
        4  4568 1 1 12 LYS HE3  H   -9.255  -5.610  -5.482 1.00 . A A . 668 LYS HE3  1 1 
        4  4569 1 1 12 LYS HG2  H   -9.573  -7.251  -2.103 1.00 . A A . 668 LYS HG2  1 1 
        4  4570 1 1 12 LYS HG3  H  -11.038  -7.657  -3.000 1.00 . A A . 668 LYS HG3  1 1 
        4  4571 1 1 12 LYS HZ1  H   -8.195  -7.691  -3.642 1.00 . A A . 668 LYS HZ1  1 1 
        4  4572 1 1 12 LYS HZ2  H   -7.484  -6.189  -3.955 1.00 . A A . 668 LYS HZ2  1 1 
        4  4573 1 1 12 LYS HZ3  H   -7.599  -7.338  -5.187 1.00 . A A . 668 LYS HZ3  1 1 
        4  4574 1 1 12 LYS N    N  -11.509  -5.258   0.830 1.00 . A A . 668 LYS N    1 1 
        4  4575 1 1 12 LYS NZ   N   -8.081  -6.940  -4.354 1.00 . A A . 668 LYS NZ   1 1 
        4  4576 1 1 12 LYS O    O   -9.618  -3.907  -1.181 1.00 . A A . 668 LYS O    1 1 
        4  4577 1 1 13 LEU C    C   -6.113  -4.800  -1.081 1.00 . A A . 669 LEU C    1 1 
        4  4578 1 1 13 LEU CA   C   -7.097  -4.246  -0.034 1.00 . A A . 669 LEU CA   1 1 
        4  4579 1 1 13 LEU CB   C   -6.391  -4.073   1.323 1.00 . A A . 669 LEU CB   1 1 
        4  4580 1 1 13 LEU CD1  C   -5.576  -1.715   0.926 1.00 . A A . 669 LEU CD1  1 1 
        4  4581 1 1 13 LEU CD2  C   -4.495  -3.132   2.701 1.00 . A A . 669 LEU CD2  1 1 
        4  4582 1 1 13 LEU CG   C   -5.174  -3.131   1.329 1.00 . A A . 669 LEU CG   1 1 
        4  4583 1 1 13 LEU H    H   -8.172  -5.926   0.695 1.00 . A A . 669 LEU H    1 1 
        4  4584 1 1 13 LEU HA   H   -7.453  -3.279  -0.366 1.00 . A A . 669 LEU HA   1 1 
        4  4585 1 1 13 LEU HB2  H   -7.114  -3.696   2.033 1.00 . A A . 669 LEU HB2  1 1 
        4  4586 1 1 13 LEU HB3  H   -6.064  -5.049   1.658 1.00 . A A . 669 LEU HB3  1 1 
        4  4587 1 1 13 LEU HD11 H   -4.702  -1.078   0.927 1.00 . A A . 669 LEU HD11 1 1 
        4  4588 1 1 13 LEU HD12 H   -6.301  -1.327   1.628 1.00 . A A . 669 LEU HD12 1 1 
        4  4589 1 1 13 LEU HD13 H   -6.007  -1.729  -0.065 1.00 . A A . 669 LEU HD13 1 1 
        4  4590 1 1 13 LEU HD21 H   -5.197  -2.804   3.454 1.00 . A A . 669 LEU HD21 1 1 
        4  4591 1 1 13 LEU HD22 H   -3.648  -2.461   2.683 1.00 . A A . 669 LEU HD22 1 1 
        4  4592 1 1 13 LEU HD23 H   -4.156  -4.130   2.935 1.00 . A A . 669 LEU HD23 1 1 
        4  4593 1 1 13 LEU HG   H   -4.454  -3.486   0.603 1.00 . A A . 669 LEU HG   1 1 
        4  4594 1 1 13 LEU N    N   -8.260  -5.127   0.133 1.00 . A A . 669 LEU N    1 1 
        4  4595 1 1 13 LEU O    O   -5.482  -5.836  -0.866 1.00 . A A . 669 LEU O    1 1 
        4  4596 1 1 14 THR C    C   -3.680  -3.909  -3.094 1.00 . A A . 670 THR C    1 1 
        4  4597 1 1 14 THR CA   C   -5.069  -4.533  -3.284 1.00 . A A . 670 THR CA   1 1 
        4  4598 1 1 14 THR CB   C   -5.593  -4.150  -4.693 1.00 . A A . 670 THR CB   1 1 
        4  4599 1 1 14 THR CG2  C   -4.627  -4.601  -5.785 1.00 . A A . 670 THR CG2  1 1 
        4  4600 1 1 14 THR H    H   -6.547  -3.316  -2.355 1.00 . A A . 670 THR H    1 1 
        4  4601 1 1 14 THR HA   H   -4.977  -5.611  -3.243 1.00 . A A . 670 THR HA   1 1 
        4  4602 1 1 14 THR HB   H   -5.694  -3.074  -4.745 1.00 . A A . 670 THR HB   1 1 
        4  4603 1 1 14 THR HG1  H   -6.913  -5.071  -5.842 1.00 . A A . 670 THR HG1  1 1 
        4  4604 1 1 14 THR HG21 H   -3.657  -4.154  -5.620 1.00 . A A . 670 THR HG21 1 1 
        4  4605 1 1 14 THR HG22 H   -5.003  -4.294  -6.750 1.00 . A A . 670 THR HG22 1 1 
        4  4606 1 1 14 THR HG23 H   -4.535  -5.678  -5.762 1.00 . A A . 670 THR HG23 1 1 
        4  4607 1 1 14 THR N    N   -5.997  -4.117  -2.221 1.00 . A A . 670 THR N    1 1 
        4  4608 1 1 14 THR O    O   -3.507  -2.695  -3.229 1.00 . A A . 670 THR O    1 1 
        4  4609 1 1 14 THR OG1  O   -6.875  -4.749  -4.928 1.00 . A A . 670 THR OG1  1 1 
        4  4610 1 1 15 VAL C    C   -0.346  -5.269  -3.345 1.00 . A A . 671 VAL C    1 1 
        4  4611 1 1 15 VAL CA   C   -1.304  -4.308  -2.620 1.00 . A A . 671 VAL CA   1 1 
        4  4612 1 1 15 VAL CB   C   -0.893  -4.226  -1.126 1.00 . A A . 671 VAL CB   1 1 
        4  4613 1 1 15 VAL CG1  C    0.578  -3.838  -0.970 1.00 . A A . 671 VAL CG1  1 1 
        4  4614 1 1 15 VAL CG2  C   -1.785  -3.248  -0.369 1.00 . A A . 671 VAL CG2  1 1 
        4  4615 1 1 15 VAL H    H   -2.915  -5.693  -2.619 1.00 . A A . 671 VAL H    1 1 
        4  4616 1 1 15 VAL HA   H   -1.212  -3.323  -3.055 1.00 . A A . 671 VAL HA   1 1 
        4  4617 1 1 15 VAL HB   H   -1.028  -5.207  -0.687 1.00 . A A . 671 VAL HB   1 1 
        4  4618 1 1 15 VAL HG11 H    0.747  -2.868  -1.416 1.00 . A A . 671 VAL HG11 1 1 
        4  4619 1 1 15 VAL HG12 H    1.202  -4.571  -1.461 1.00 . A A . 671 VAL HG12 1 1 
        4  4620 1 1 15 VAL HG13 H    0.832  -3.798   0.079 1.00 . A A . 671 VAL HG13 1 1 
        4  4621 1 1 15 VAL HG21 H   -2.811  -3.577  -0.427 1.00 . A A . 671 VAL HG21 1 1 
        4  4622 1 1 15 VAL HG22 H   -1.695  -2.266  -0.810 1.00 . A A . 671 VAL HG22 1 1 
        4  4623 1 1 15 VAL HG23 H   -1.478  -3.207   0.667 1.00 . A A . 671 VAL HG23 1 1 
        4  4624 1 1 15 VAL N    N   -2.698  -4.748  -2.771 1.00 . A A . 671 VAL N    1 1 
        4  4625 1 1 15 VAL O    O   -0.416  -6.488  -3.147 1.00 . A A . 671 VAL O    1 1 
        4  4626 1 1 16 PRO C    C    2.685  -6.036  -3.937 1.00 . A A . 672 PRO C    1 1 
        4  4627 1 1 16 PRO CA   C    1.559  -5.580  -4.885 1.00 . A A . 672 PRO CA   1 1 
        4  4628 1 1 16 PRO CB   C    2.098  -4.653  -5.982 1.00 . A A . 672 PRO CB   1 1 
        4  4629 1 1 16 PRO CD   C    0.681  -3.318  -4.560 1.00 . A A . 672 PRO CD   1 1 
        4  4630 1 1 16 PRO CG   C    1.899  -3.271  -5.453 1.00 . A A . 672 PRO CG   1 1 
        4  4631 1 1 16 PRO HA   H    1.098  -6.447  -5.337 1.00 . A A . 672 PRO HA   1 1 
        4  4632 1 1 16 PRO HB2  H    3.145  -4.862  -6.157 1.00 . A A . 672 PRO HB2  1 1 
        4  4633 1 1 16 PRO HB3  H    1.540  -4.808  -6.895 1.00 . A A . 672 PRO HB3  1 1 
        4  4634 1 1 16 PRO HD2  H    0.836  -2.709  -3.678 1.00 . A A . 672 PRO HD2  1 1 
        4  4635 1 1 16 PRO HD3  H   -0.194  -2.982  -5.095 1.00 . A A . 672 PRO HD3  1 1 
        4  4636 1 1 16 PRO HG2  H    2.769  -2.970  -4.886 1.00 . A A . 672 PRO HG2  1 1 
        4  4637 1 1 16 PRO HG3  H    1.736  -2.586  -6.274 1.00 . A A . 672 PRO HG3  1 1 
        4  4638 1 1 16 PRO N    N    0.560  -4.747  -4.197 1.00 . A A . 672 PRO N    1 1 
        4  4639 1 1 16 PRO O    O    3.291  -5.224  -3.244 1.00 . A A . 672 PRO O    1 1 
        4  4640 1 1 17 VAL C    C    5.383  -7.394  -3.265 1.00 . A A . 673 VAL C    1 1 
        4  4641 1 1 17 VAL CA   C    3.951  -7.909  -2.991 1.00 . A A . 673 VAL CA   1 1 
        4  4642 1 1 17 VAL CB   C    3.934  -9.462  -3.053 1.00 . A A . 673 VAL CB   1 1 
        4  4643 1 1 17 VAL CG1  C    4.455  -9.966  -4.402 1.00 . A A . 673 VAL CG1  1 1 
        4  4644 1 1 17 VAL CG2  C    4.723 -10.072  -1.891 1.00 . A A . 673 VAL CG2  1 1 
        4  4645 1 1 17 VAL H    H    2.485  -7.936  -4.536 1.00 . A A . 673 VAL H    1 1 
        4  4646 1 1 17 VAL HA   H    3.665  -7.612  -1.992 1.00 . A A . 673 VAL HA   1 1 
        4  4647 1 1 17 VAL HB   H    2.904  -9.784  -2.959 1.00 . A A . 673 VAL HB   1 1 
        4  4648 1 1 17 VAL HG11 H    3.853  -9.555  -5.200 1.00 . A A . 673 VAL HG11 1 1 
        4  4649 1 1 17 VAL HG12 H    4.398 -11.046  -4.432 1.00 . A A . 673 VAL HG12 1 1 
        4  4650 1 1 17 VAL HG13 H    5.483  -9.658  -4.532 1.00 . A A . 673 VAL HG13 1 1 
        4  4651 1 1 17 VAL HG21 H    4.696 -11.151  -1.962 1.00 . A A . 673 VAL HG21 1 1 
        4  4652 1 1 17 VAL HG22 H    4.284  -9.764  -0.953 1.00 . A A . 673 VAL HG22 1 1 
        4  4653 1 1 17 VAL HG23 H    5.749  -9.736  -1.935 1.00 . A A . 673 VAL HG23 1 1 
        4  4654 1 1 17 VAL N    N    2.962  -7.338  -3.919 1.00 . A A . 673 VAL N    1 1 
        4  4655 1 1 17 VAL O    O    6.259  -7.466  -2.396 1.00 . A A . 673 VAL O    1 1 
        4  4656 1 1 18 GLY C    C    6.933  -5.333  -5.936 1.00 . A A . 674 GLY C    1 1 
        4  4657 1 1 18 GLY CA   C    6.947  -6.372  -4.818 1.00 . A A . 674 GLY CA   1 1 
        4  4658 1 1 18 GLY H    H    4.886  -6.803  -5.112 1.00 . A A . 674 GLY H    1 1 
        4  4659 1 1 18 GLY HA2  H    7.396  -5.927  -3.941 1.00 . A A . 674 GLY HA2  1 1 
        4  4660 1 1 18 GLY HA3  H    7.554  -7.210  -5.129 1.00 . A A . 674 GLY HA3  1 1 
        4  4661 1 1 18 GLY N    N    5.618  -6.866  -4.465 1.00 . A A . 674 GLY N    1 1 
        4  4662 1 1 18 GLY O    O    6.005  -5.296  -6.747 1.00 . A A . 674 GLY O    1 1 
        4  4663 1 1 19 ALA C    C    9.577  -3.133  -7.291 1.00 . A A . 675 ALA C    1 1 
        4  4664 1 1 19 ALA CA   C    8.098  -3.458  -7.016 1.00 . A A . 675 ALA CA   1 1 
        4  4665 1 1 19 ALA CB   C    7.344  -2.195  -6.605 1.00 . A A . 675 ALA CB   1 1 
        4  4666 1 1 19 ALA H    H    8.659  -4.556  -5.285 1.00 . A A . 675 ALA H    1 1 
        4  4667 1 1 19 ALA HA   H    7.649  -3.839  -7.925 1.00 . A A . 675 ALA HA   1 1 
        4  4668 1 1 19 ALA HB1  H    7.755  -1.813  -5.682 1.00 . A A . 675 ALA HB1  1 1 
        4  4669 1 1 19 ALA HB2  H    6.298  -2.429  -6.462 1.00 . A A . 675 ALA HB2  1 1 
        4  4670 1 1 19 ALA HB3  H    7.441  -1.447  -7.379 1.00 . A A . 675 ALA HB3  1 1 
        4  4671 1 1 19 ALA N    N    7.966  -4.489  -5.977 1.00 . A A . 675 ALA N    1 1 
        4  4672 1 1 19 ALA O    O   10.408  -3.170  -6.383 1.00 . A A . 675 ALA O    1 1 
        4  4673 1 1 20 THR C    C   11.417  -1.097  -9.535 1.00 . A A . 676 THR C    1 1 
        4  4674 1 1 20 THR CA   C   11.293  -2.506  -8.935 1.00 . A A . 676 THR CA   1 1 
        4  4675 1 1 20 THR CB   C   11.847  -3.531  -9.958 1.00 . A A . 676 THR CB   1 1 
        4  4676 1 1 20 THR CG2  C   13.290  -3.212 -10.343 1.00 . A A . 676 THR CG2  1 1 
        4  4677 1 1 20 THR H    H    9.202  -2.827  -9.234 1.00 . A A . 676 THR H    1 1 
        4  4678 1 1 20 THR HA   H   11.908  -2.559  -8.043 1.00 . A A . 676 THR HA   1 1 
        4  4679 1 1 20 THR HB   H   11.237  -3.495 -10.851 1.00 . A A . 676 THR HB   1 1 
        4  4680 1 1 20 THR HG1  H   11.145  -4.886  -8.694 1.00 . A A . 676 THR HG1  1 1 
        4  4681 1 1 20 THR HG21 H   13.653  -3.963 -11.030 1.00 . A A . 676 THR HG21 1 1 
        4  4682 1 1 20 THR HG22 H   13.907  -3.209  -9.456 1.00 . A A . 676 THR HG22 1 1 
        4  4683 1 1 20 THR HG23 H   13.336  -2.241 -10.816 1.00 . A A . 676 THR HG23 1 1 
        4  4684 1 1 20 THR N    N    9.905  -2.824  -8.547 1.00 . A A . 676 THR N    1 1 
        4  4685 1 1 20 THR O    O   10.736  -0.757 -10.507 1.00 . A A . 676 THR O    1 1 
        4  4686 1 1 20 THR OG1  O   11.790  -4.859  -9.413 1.00 . A A . 676 THR OG1  1 1 
        4  4687 1 1 21 ILE C    C   14.106   1.335  -9.490 1.00 . A A . 677 ILE C    1 1 
        4  4688 1 1 21 ILE CA   C   12.590   1.065  -9.468 1.00 . A A . 677 ILE CA   1 1 
        4  4689 1 1 21 ILE CB   C   11.882   2.170  -8.633 1.00 . A A . 677 ILE CB   1 1 
        4  4690 1 1 21 ILE CD1  C   11.648   3.145  -6.277 1.00 . A A . 677 ILE CD1  1 1 
        4  4691 1 1 21 ILE CG1  C   12.281   2.078  -7.151 1.00 . A A . 677 ILE CG1  1 1 
        4  4692 1 1 21 ILE CG2  C   10.363   2.080  -8.793 1.00 . A A . 677 ILE CG2  1 1 
        4  4693 1 1 21 ILE H    H   12.778  -0.601  -8.156 1.00 . A A . 677 ILE H    1 1 
        4  4694 1 1 21 ILE HA   H   12.221   1.121 -10.484 1.00 . A A . 677 ILE HA   1 1 
        4  4695 1 1 21 ILE HB   H   12.194   3.130  -9.020 1.00 . A A . 677 ILE HB   1 1 
        4  4696 1 1 21 ILE HD11 H   11.982   3.017  -5.258 1.00 . A A . 677 ILE HD11 1 1 
        4  4697 1 1 21 ILE HD12 H   10.571   3.052  -6.317 1.00 . A A . 677 ILE HD12 1 1 
        4  4698 1 1 21 ILE HD13 H   11.938   4.122  -6.632 1.00 . A A . 677 ILE HD13 1 1 
        4  4699 1 1 21 ILE HG12 H   11.983   1.115  -6.763 1.00 . A A . 677 ILE HG12 1 1 
        4  4700 1 1 21 ILE HG13 H   13.354   2.176  -7.068 1.00 . A A . 677 ILE HG13 1 1 
        4  4701 1 1 21 ILE HG21 H   10.020   1.114  -8.449 1.00 . A A . 677 ILE HG21 1 1 
        4  4702 1 1 21 ILE HG22 H   10.099   2.205  -9.833 1.00 . A A . 677 ILE HG22 1 1 
        4  4703 1 1 21 ILE HG23 H    9.890   2.856  -8.209 1.00 . A A . 677 ILE HG23 1 1 
        4  4704 1 1 21 ILE N    N   12.301  -0.285  -8.955 1.00 . A A . 677 ILE N    1 1 
        4  4705 1 1 21 ILE O    O   14.905   0.490  -9.081 1.00 . A A . 677 ILE O    1 1 
        4  4706 1 1 22 HIS C    C   16.223   4.191  -9.353 1.00 . A A . 678 HIS C    1 1 
        4  4707 1 1 22 HIS CA   C   15.927   2.867 -10.062 1.00 . A A . 678 HIS CA   1 1 
        4  4708 1 1 22 HIS CB   C   16.372   2.987 -11.524 1.00 . A A . 678 HIS CB   1 1 
        4  4709 1 1 22 HIS CD2  C   16.918   0.667 -12.521 1.00 . A A . 678 HIS CD2  1 1 
        4  4710 1 1 22 HIS CE1  C   15.048   0.352 -13.619 1.00 . A A . 678 HIS CE1  1 1 
        4  4711 1 1 22 HIS CG   C   16.134   1.750 -12.319 1.00 . A A . 678 HIS CG   1 1 
        4  4712 1 1 22 HIS H    H   13.833   3.135 -10.317 1.00 . A A . 678 HIS H    1 1 
        4  4713 1 1 22 HIS HA   H   16.501   2.084  -9.588 1.00 . A A . 678 HIS HA   1 1 
        4  4714 1 1 22 HIS HB2  H   15.831   3.792 -11.995 1.00 . A A . 678 HIS HB2  1 1 
        4  4715 1 1 22 HIS HB3  H   17.431   3.207 -11.556 1.00 . A A . 678 HIS HB3  1 1 
        4  4716 1 1 22 HIS HD1  H   14.208   2.137 -13.081 1.00 . A A . 678 HIS HD1  1 1 
        4  4717 1 1 22 HIS HD2  H   17.914   0.510 -12.119 1.00 . A A . 678 HIS HD2  1 1 
        4  4718 1 1 22 HIS HE1  H   14.287  -0.089 -14.246 1.00 . A A . 678 HIS HE1  1 1 
        4  4719 1 1 22 HIS HE2  H   16.535  -1.054 -13.665 1.00 . A A . 678 HIS HE2  1 1 
        4  4720 1 1 22 HIS N    N   14.505   2.503  -9.987 1.00 . A A . 678 HIS N    1 1 
        4  4721 1 1 22 HIS ND1  N   14.975   1.523 -13.027 1.00 . A A . 678 HIS ND1  1 1 
        4  4722 1 1 22 HIS NE2  N   16.215  -0.186 -13.331 1.00 . A A . 678 HIS NE2  1 1 
        4  4723 1 1 22 HIS O    O   15.315   4.939  -8.990 1.00 . A A . 678 HIS O    1 1 
        4  4724 1 1 23 VAL C    C   17.583   6.858  -9.721 1.00 . A A . 679 VAL C    1 1 
        4  4725 1 1 23 VAL CA   C   17.949   5.779  -8.687 1.00 . A A . 679 VAL CA   1 1 
        4  4726 1 1 23 VAL CB   C   19.478   5.798  -8.426 1.00 . A A . 679 VAL CB   1 1 
        4  4727 1 1 23 VAL CG1  C   19.948   7.188  -7.992 1.00 . A A . 679 VAL CG1  1 1 
        4  4728 1 1 23 VAL CG2  C   19.855   4.749  -7.381 1.00 . A A . 679 VAL CG2  1 1 
        4  4729 1 1 23 VAL H    H   18.177   3.772  -9.330 1.00 . A A . 679 VAL H    1 1 
        4  4730 1 1 23 VAL HA   H   17.438   5.991  -7.757 1.00 . A A . 679 VAL HA   1 1 
        4  4731 1 1 23 VAL HB   H   19.982   5.549  -9.350 1.00 . A A . 679 VAL HB   1 1 
        4  4732 1 1 23 VAL HG11 H   19.726   7.905  -8.767 1.00 . A A . 679 VAL HG11 1 1 
        4  4733 1 1 23 VAL HG12 H   21.015   7.169  -7.816 1.00 . A A . 679 VAL HG12 1 1 
        4  4734 1 1 23 VAL HG13 H   19.439   7.474  -7.083 1.00 . A A . 679 VAL HG13 1 1 
        4  4735 1 1 23 VAL HG21 H   20.921   4.780  -7.202 1.00 . A A . 679 VAL HG21 1 1 
        4  4736 1 1 23 VAL HG22 H   19.581   3.766  -7.739 1.00 . A A . 679 VAL HG22 1 1 
        4  4737 1 1 23 VAL HG23 H   19.330   4.952  -6.457 1.00 . A A . 679 VAL HG23 1 1 
        4  4738 1 1 23 VAL N    N   17.510   4.469  -9.160 1.00 . A A . 679 VAL N    1 1 
        4  4739 1 1 23 VAL O    O   18.137   6.892 -10.823 1.00 . A A . 679 VAL O    1 1 
        4  4740 1 1 24 GLY C    C   14.735   8.455 -10.800 1.00 . A A . 680 GLY C    1 1 
        4  4741 1 1 24 GLY CA   C   16.149   8.739 -10.290 1.00 . A A . 680 GLY CA   1 1 
        4  4742 1 1 24 GLY H    H   16.282   7.685  -8.449 1.00 . A A . 680 GLY H    1 1 
        4  4743 1 1 24 GLY HA2  H   16.148   9.695  -9.786 1.00 . A A . 680 GLY HA2  1 1 
        4  4744 1 1 24 GLY HA3  H   16.817   8.798 -11.138 1.00 . A A . 680 GLY HA3  1 1 
        4  4745 1 1 24 GLY N    N   16.642   7.726  -9.361 1.00 . A A . 680 GLY N    1 1 
        4  4746 1 1 24 GLY O    O   14.164   9.256 -11.545 1.00 . A A . 680 GLY O    1 1 
        4  4747 1 1 25 ASP C    C   11.778   7.530  -9.789 1.00 . A A . 681 ASP C    1 1 
        4  4748 1 1 25 ASP CA   C   12.797   6.954 -10.790 1.00 . A A . 681 ASP CA   1 1 
        4  4749 1 1 25 ASP CB   C   12.641   5.426 -10.874 1.00 . A A . 681 ASP CB   1 1 
        4  4750 1 1 25 ASP CG   C   13.399   4.792 -12.035 1.00 . A A . 681 ASP CG   1 1 
        4  4751 1 1 25 ASP H    H   14.698   6.674  -9.885 1.00 . A A . 681 ASP H    1 1 
        4  4752 1 1 25 ASP HA   H   12.598   7.378 -11.765 1.00 . A A . 681 ASP HA   1 1 
        4  4753 1 1 25 ASP HB2  H   13.007   4.984  -9.957 1.00 . A A . 681 ASP HB2  1 1 
        4  4754 1 1 25 ASP HB3  H   11.592   5.186 -10.983 1.00 . A A . 681 ASP HB3  1 1 
        4  4755 1 1 25 ASP N    N   14.174   7.307 -10.420 1.00 . A A . 681 ASP N    1 1 
        4  4756 1 1 25 ASP O    O   12.144   8.059  -8.738 1.00 . A A . 681 ASP O    1 1 
        4  4757 1 1 25 ASP OD1  O   14.305   5.435 -12.602 1.00 . A A . 681 ASP OD1  1 1 
        4  4758 1 1 25 ASP OD2  O   13.094   3.628 -12.378 1.00 . A A . 681 ASP OD2  1 1 
        4  4759 1 1 26 SER C    C    8.546   6.741  -8.759 1.00 . A A . 682 SER C    1 1 
        4  4760 1 1 26 SER CA   C    9.415   7.908  -9.253 1.00 . A A . 682 SER CA   1 1 
        4  4761 1 1 26 SER CB   C    8.541   8.930  -9.994 1.00 . A A . 682 SER CB   1 1 
        4  4762 1 1 26 SER H    H   10.264   7.021 -10.990 1.00 . A A . 682 SER H    1 1 
        4  4763 1 1 26 SER HA   H    9.865   8.390  -8.397 1.00 . A A . 682 SER HA   1 1 
        4  4764 1 1 26 SER HB2  H    7.739   9.253  -9.346 1.00 . A A . 682 SER HB2  1 1 
        4  4765 1 1 26 SER HB3  H    9.144   9.785 -10.269 1.00 . A A . 682 SER HB3  1 1 
        4  4766 1 1 26 SER HG   H    7.064   8.104 -10.992 1.00 . A A . 682 SER HG   1 1 
        4  4767 1 1 26 SER N    N   10.497   7.430 -10.128 1.00 . A A . 682 SER N    1 1 
        4  4768 1 1 26 SER O    O    8.442   5.705  -9.420 1.00 . A A . 682 SER O    1 1 
        4  4769 1 1 26 SER OG   O    7.975   8.376 -11.172 1.00 . A A . 682 SER OG   1 1 
        4  4770 1 1 27 PHE C    C    6.104   6.426  -5.977 1.00 . A A . 683 PHE C    1 1 
        4  4771 1 1 27 PHE CA   C    7.100   5.854  -7.000 1.00 . A A . 683 PHE CA   1 1 
        4  4772 1 1 27 PHE CB   C    7.996   4.799  -6.327 1.00 . A A . 683 PHE CB   1 1 
        4  4773 1 1 27 PHE CD1  C    6.860   2.567  -6.568 1.00 . A A . 683 PHE CD1  1 1 
        4  4774 1 1 27 PHE CD2  C    6.892   3.585  -4.410 1.00 . A A . 683 PHE CD2  1 1 
        4  4775 1 1 27 PHE CE1  C    6.159   1.494  -6.052 1.00 . A A . 683 PHE CE1  1 1 
        4  4776 1 1 27 PHE CE2  C    6.190   2.515  -3.892 1.00 . A A . 683 PHE CE2  1 1 
        4  4777 1 1 27 PHE CG   C    7.236   3.626  -5.755 1.00 . A A . 683 PHE CG   1 1 
        4  4778 1 1 27 PHE CZ   C    5.824   1.469  -4.713 1.00 . A A . 683 PHE CZ   1 1 
        4  4779 1 1 27 PHE H    H    8.006   7.771  -7.129 1.00 . A A . 683 PHE H    1 1 
        4  4780 1 1 27 PHE HA   H    6.544   5.380  -7.798 1.00 . A A . 683 PHE HA   1 1 
        4  4781 1 1 27 PHE HB2  H    8.698   4.418  -7.055 1.00 . A A . 683 PHE HB2  1 1 
        4  4782 1 1 27 PHE HB3  H    8.546   5.267  -5.521 1.00 . A A . 683 PHE HB3  1 1 
        4  4783 1 1 27 PHE HD1  H    7.122   2.585  -7.617 1.00 . A A . 683 PHE HD1  1 1 
        4  4784 1 1 27 PHE HD2  H    7.177   4.403  -3.763 1.00 . A A . 683 PHE HD2  1 1 
        4  4785 1 1 27 PHE HE1  H    5.874   0.674  -6.699 1.00 . A A . 683 PHE HE1  1 1 
        4  4786 1 1 27 PHE HE2  H    5.929   2.494  -2.843 1.00 . A A . 683 PHE HE2  1 1 
        4  4787 1 1 27 PHE HZ   H    5.273   0.631  -4.308 1.00 . A A . 683 PHE HZ   1 1 
        4  4788 1 1 27 PHE N    N    7.923   6.911  -7.596 1.00 . A A . 683 PHE N    1 1 
        4  4789 1 1 27 PHE O    O    6.502   6.940  -4.929 1.00 . A A . 683 PHE O    1 1 
        4  4790 1 1 28 VAL C    C    3.051   5.571  -4.712 1.00 . A A . 684 VAL C    1 1 
        4  4791 1 1 28 VAL CA   C    3.756   6.775  -5.370 1.00 . A A . 684 VAL CA   1 1 
        4  4792 1 1 28 VAL CB   C    2.704   7.643  -6.108 1.00 . A A . 684 VAL CB   1 1 
        4  4793 1 1 28 VAL CG1  C    1.573   8.053  -5.166 1.00 . A A . 684 VAL CG1  1 1 
        4  4794 1 1 28 VAL CG2  C    3.364   8.872  -6.730 1.00 . A A . 684 VAL CG2  1 1 
        4  4795 1 1 28 VAL H    H    4.562   5.950  -7.155 1.00 . A A . 684 VAL H    1 1 
        4  4796 1 1 28 VAL HA   H    4.213   7.382  -4.597 1.00 . A A . 684 VAL HA   1 1 
        4  4797 1 1 28 VAL HB   H    2.277   7.050  -6.909 1.00 . A A . 684 VAL HB   1 1 
        4  4798 1 1 28 VAL HG11 H    0.862   8.668  -5.701 1.00 . A A . 684 VAL HG11 1 1 
        4  4799 1 1 28 VAL HG12 H    1.977   8.611  -4.334 1.00 . A A . 684 VAL HG12 1 1 
        4  4800 1 1 28 VAL HG13 H    1.073   7.167  -4.797 1.00 . A A . 684 VAL HG13 1 1 
        4  4801 1 1 28 VAL HG21 H    3.793   9.485  -5.950 1.00 . A A . 684 VAL HG21 1 1 
        4  4802 1 1 28 VAL HG22 H    2.624   9.446  -7.271 1.00 . A A . 684 VAL HG22 1 1 
        4  4803 1 1 28 VAL HG23 H    4.141   8.559  -7.411 1.00 . A A . 684 VAL HG23 1 1 
        4  4804 1 1 28 VAL N    N    4.814   6.329  -6.285 1.00 . A A . 684 VAL N    1 1 
        4  4805 1 1 28 VAL O    O    2.247   4.886  -5.353 1.00 . A A . 684 VAL O    1 1 
        4  4806 1 1 29 PRO C    C    1.216   4.184  -2.664 1.00 . A A . 685 PRO C    1 1 
        4  4807 1 1 29 PRO CA   C    2.757   4.147  -2.704 1.00 . A A . 685 PRO CA   1 1 
        4  4808 1 1 29 PRO CB   C    3.344   4.263  -1.284 1.00 . A A . 685 PRO CB   1 1 
        4  4809 1 1 29 PRO CD   C    4.308   6.028  -2.586 1.00 . A A . 685 PRO CD   1 1 
        4  4810 1 1 29 PRO CG   C    3.891   5.650  -1.190 1.00 . A A . 685 PRO CG   1 1 
        4  4811 1 1 29 PRO HA   H    3.071   3.210  -3.143 1.00 . A A . 685 PRO HA   1 1 
        4  4812 1 1 29 PRO HB2  H    2.565   4.096  -0.552 1.00 . A A . 685 PRO HB2  1 1 
        4  4813 1 1 29 PRO HB3  H    4.124   3.524  -1.154 1.00 . A A . 685 PRO HB3  1 1 
        4  4814 1 1 29 PRO HD2  H    4.210   7.095  -2.736 1.00 . A A . 685 PRO HD2  1 1 
        4  4815 1 1 29 PRO HD3  H    5.323   5.710  -2.781 1.00 . A A . 685 PRO HD3  1 1 
        4  4816 1 1 29 PRO HG2  H    3.125   6.325  -0.832 1.00 . A A . 685 PRO HG2  1 1 
        4  4817 1 1 29 PRO HG3  H    4.744   5.666  -0.527 1.00 . A A . 685 PRO HG3  1 1 
        4  4818 1 1 29 PRO N    N    3.354   5.286  -3.428 1.00 . A A . 685 PRO N    1 1 
        4  4819 1 1 29 PRO O    O    0.562   3.145  -2.740 1.00 . A A . 685 PRO O    1 1 
        4  4820 1 1 30 MET C    C   -1.486   5.396  -3.883 1.00 . A A . 686 MET C    1 1 
        4  4821 1 1 30 MET CA   C   -0.826   5.533  -2.503 1.00 . A A . 686 MET CA   1 1 
        4  4822 1 1 30 MET CB   C   -1.201   6.884  -1.872 1.00 . A A . 686 MET CB   1 1 
        4  4823 1 1 30 MET CE   C   -2.492   4.713   0.234 1.00 . A A . 686 MET CE   1 1 
        4  4824 1 1 30 MET CG   C   -0.926   6.973  -0.370 1.00 . A A . 686 MET CG   1 1 
        4  4825 1 1 30 MET H    H    1.203   6.187  -2.529 1.00 . A A . 686 MET H    1 1 
        4  4826 1 1 30 MET HA   H   -1.204   4.742  -1.871 1.00 . A A . 686 MET HA   1 1 
        4  4827 1 1 30 MET HB2  H   -0.641   7.664  -2.364 1.00 . A A . 686 MET HB2  1 1 
        4  4828 1 1 30 MET HB3  H   -2.256   7.060  -2.030 1.00 . A A . 686 MET HB3  1 1 
        4  4829 1 1 30 MET HE1  H   -2.732   4.621  -0.813 1.00 . A A . 686 MET HE1  1 1 
        4  4830 1 1 30 MET HE2  H   -3.284   4.276   0.825 1.00 . A A . 686 MET HE2  1 1 
        4  4831 1 1 30 MET HE3  H   -1.565   4.200   0.440 1.00 . A A . 686 MET HE3  1 1 
        4  4832 1 1 30 MET HG2  H   -0.077   6.348  -0.134 1.00 . A A . 686 MET HG2  1 1 
        4  4833 1 1 30 MET HG3  H   -0.688   7.999  -0.123 1.00 . A A . 686 MET HG3  1 1 
        4  4834 1 1 30 MET N    N    0.638   5.384  -2.566 1.00 . A A . 686 MET N    1 1 
        4  4835 1 1 30 MET O    O   -2.711   5.389  -3.995 1.00 . A A . 686 MET O    1 1 
        4  4836 1 1 30 MET SD   S   -2.325   6.447   0.655 1.00 . A A . 686 MET SD   1 1 
        4  4837 1 1 31 ALA C    C   -1.182   3.558  -6.623 1.00 . A A . 687 ALA C    1 1 
        4  4838 1 1 31 ALA CA   C   -1.193   5.054  -6.283 1.00 . A A . 687 ALA CA   1 1 
        4  4839 1 1 31 ALA CB   C   -0.380   5.835  -7.306 1.00 . A A . 687 ALA CB   1 1 
        4  4840 1 1 31 ALA H    H    0.289   5.393  -4.799 1.00 . A A . 687 ALA H    1 1 
        4  4841 1 1 31 ALA HA   H   -2.213   5.414  -6.322 1.00 . A A . 687 ALA HA   1 1 
        4  4842 1 1 31 ALA HB1  H   -0.394   6.885  -7.052 1.00 . A A . 687 ALA HB1  1 1 
        4  4843 1 1 31 ALA HB2  H   -0.808   5.697  -8.289 1.00 . A A . 687 ALA HB2  1 1 
        4  4844 1 1 31 ALA HB3  H    0.640   5.480  -7.304 1.00 . A A . 687 ALA HB3  1 1 
        4  4845 1 1 31 ALA N    N   -0.676   5.296  -4.933 1.00 . A A . 687 ALA N    1 1 
        4  4846 1 1 31 ALA O    O   -1.984   3.084  -7.428 1.00 . A A . 687 ALA O    1 1 
        4  4847 1 1 32 GLU C    C   -1.071   0.555  -5.346 1.00 . A A . 688 GLU C    1 1 
        4  4848 1 1 32 GLU CA   C   -0.125   1.375  -6.240 1.00 . A A . 688 GLU CA   1 1 
        4  4849 1 1 32 GLU CB   C    1.330   0.934  -5.998 1.00 . A A . 688 GLU CB   1 1 
        4  4850 1 1 32 GLU CD   C    2.127   1.638  -8.311 1.00 . A A . 688 GLU CD   1 1 
        4  4851 1 1 32 GLU CG   C    2.363   1.717  -6.808 1.00 . A A . 688 GLU CG   1 1 
        4  4852 1 1 32 GLU H    H    0.341   3.256  -5.363 1.00 . A A . 688 GLU H    1 1 
        4  4853 1 1 32 GLU HA   H   -0.378   1.187  -7.274 1.00 . A A . 688 GLU HA   1 1 
        4  4854 1 1 32 GLU HB2  H    1.561   1.056  -4.948 1.00 . A A . 688 GLU HB2  1 1 
        4  4855 1 1 32 GLU HB3  H    1.421  -0.112  -6.255 1.00 . A A . 688 GLU HB3  1 1 
        4  4856 1 1 32 GLU HG2  H    2.327   2.754  -6.505 1.00 . A A . 688 GLU HG2  1 1 
        4  4857 1 1 32 GLU HG3  H    3.346   1.320  -6.592 1.00 . A A . 688 GLU HG3  1 1 
        4  4858 1 1 32 GLU N    N   -0.263   2.820  -5.999 1.00 . A A . 688 GLU N    1 1 
        4  4859 1 1 32 GLU O    O   -1.232  -0.654  -5.531 1.00 . A A . 688 GLU O    1 1 
        4  4860 1 1 32 GLU OE1  O    2.509   0.623  -8.928 1.00 . A A . 688 GLU OE1  1 1 
        4  4861 1 1 32 GLU OE2  O    1.552   2.593  -8.880 1.00 . A A . 688 GLU OE2  1 1 
        4  4862 1 1 33 VAL C    C   -4.016   1.095  -3.496 1.00 . A A . 689 VAL C    1 1 
        4  4863 1 1 33 VAL CA   C   -2.580   0.557  -3.411 1.00 . A A . 689 VAL CA   1 1 
        4  4864 1 1 33 VAL CB   C   -2.045   0.736  -1.969 1.00 . A A . 689 VAL CB   1 1 
        4  4865 1 1 33 VAL CG1  C   -2.977   0.088  -0.948 1.00 . A A . 689 VAL CG1  1 1 
        4  4866 1 1 33 VAL CG2  C   -0.638   0.159  -1.855 1.00 . A A . 689 VAL CG2  1 1 
        4  4867 1 1 33 VAL H    H   -1.565   2.189  -4.309 1.00 . A A . 689 VAL H    1 1 
        4  4868 1 1 33 VAL HA   H   -2.591  -0.501  -3.637 1.00 . A A . 689 VAL HA   1 1 
        4  4869 1 1 33 VAL HB   H   -1.992   1.795  -1.754 1.00 . A A . 689 VAL HB   1 1 
        4  4870 1 1 33 VAL HG11 H   -2.565   0.209   0.045 1.00 . A A . 689 VAL HG11 1 1 
        4  4871 1 1 33 VAL HG12 H   -3.078  -0.964  -1.168 1.00 . A A . 689 VAL HG12 1 1 
        4  4872 1 1 33 VAL HG13 H   -3.948   0.560  -0.991 1.00 . A A . 689 VAL HG13 1 1 
        4  4873 1 1 33 VAL HG21 H   -0.273   0.298  -0.848 1.00 . A A . 689 VAL HG21 1 1 
        4  4874 1 1 33 VAL HG22 H    0.018   0.664  -2.549 1.00 . A A . 689 VAL HG22 1 1 
        4  4875 1 1 33 VAL HG23 H   -0.661  -0.897  -2.084 1.00 . A A . 689 VAL HG23 1 1 
        4  4876 1 1 33 VAL N    N   -1.696   1.221  -4.376 1.00 . A A . 689 VAL N    1 1 
        4  4877 1 1 33 VAL O    O   -4.237   2.305  -3.535 1.00 . A A . 689 VAL O    1 1 
        4  4878 1 1 34 LEU C    C   -7.276  -0.359  -2.754 1.00 . A A . 690 LEU C    1 1 
        4  4879 1 1 34 LEU CA   C   -6.405   0.547  -3.648 1.00 . A A . 690 LEU CA   1 1 
        4  4880 1 1 34 LEU CB   C   -6.814   0.419  -5.132 1.00 . A A . 690 LEU CB   1 1 
        4  4881 1 1 34 LEU CD1  C   -8.156   1.210  -7.113 1.00 . A A . 690 LEU CD1  1 1 
        4  4882 1 1 34 LEU CD2  C   -9.324   0.769  -4.941 1.00 . A A . 690 LEU CD2  1 1 
        4  4883 1 1 34 LEU CG   C   -8.030   1.253  -5.590 1.00 . A A . 690 LEU CG   1 1 
        4  4884 1 1 34 LEU H    H   -4.745  -0.767  -3.429 1.00 . A A . 690 LEU H    1 1 
        4  4885 1 1 34 LEU HA   H   -6.522   1.575  -3.332 1.00 . A A . 690 LEU HA   1 1 
        4  4886 1 1 34 LEU HB2  H   -5.966   0.713  -5.735 1.00 . A A . 690 LEU HB2  1 1 
        4  4887 1 1 34 LEU HB3  H   -7.025  -0.622  -5.334 1.00 . A A . 690 LEU HB3  1 1 
        4  4888 1 1 34 LEU HD11 H   -9.008   1.797  -7.423 1.00 . A A . 690 LEU HD11 1 1 
        4  4889 1 1 34 LEU HD12 H   -8.286   0.187  -7.439 1.00 . A A . 690 LEU HD12 1 1 
        4  4890 1 1 34 LEU HD13 H   -7.260   1.617  -7.560 1.00 . A A . 690 LEU HD13 1 1 
        4  4891 1 1 34 LEU HD21 H  -10.154   1.356  -5.309 1.00 . A A . 690 LEU HD21 1 1 
        4  4892 1 1 34 LEU HD22 H   -9.255   0.883  -3.868 1.00 . A A . 690 LEU HD22 1 1 
        4  4893 1 1 34 LEU HD23 H   -9.486  -0.272  -5.181 1.00 . A A . 690 LEU HD23 1 1 
        4  4894 1 1 34 LEU HG   H   -7.877   2.283  -5.302 1.00 . A A . 690 LEU HG   1 1 
        4  4895 1 1 34 LEU N    N   -4.987   0.181  -3.511 1.00 . A A . 690 LEU N    1 1 
        4  4896 1 1 34 LEU O    O   -7.066  -1.571  -2.700 1.00 . A A . 690 LEU O    1 1 
        4  4897 1 1 35 ALA C    C  -10.600  -0.429  -1.493 1.00 . A A . 691 ALA C    1 1 
        4  4898 1 1 35 ALA CA   C   -9.112  -0.549  -1.138 1.00 . A A . 691 ALA CA   1 1 
        4  4899 1 1 35 ALA CB   C   -8.887  -0.102   0.303 1.00 . A A . 691 ALA CB   1 1 
        4  4900 1 1 35 ALA H    H   -8.409   1.189  -2.160 1.00 . A A . 691 ALA H    1 1 
        4  4901 1 1 35 ALA HA   H   -8.822  -1.592  -1.210 1.00 . A A . 691 ALA HA   1 1 
        4  4902 1 1 35 ALA HB1  H   -9.185   0.930   0.413 1.00 . A A . 691 ALA HB1  1 1 
        4  4903 1 1 35 ALA HB2  H   -7.839  -0.200   0.551 1.00 . A A . 691 ALA HB2  1 1 
        4  4904 1 1 35 ALA HB3  H   -9.472  -0.718   0.971 1.00 . A A . 691 ALA HB3  1 1 
        4  4905 1 1 35 ALA N    N   -8.253   0.224  -2.054 1.00 . A A . 691 ALA N    1 1 
        4  4906 1 1 35 ALA O    O  -11.166   0.665  -1.504 1.00 . A A . 691 ALA O    1 1 
        4  4907 1 1 36 ILE C    C  -13.435  -2.517  -1.078 1.00 . A A . 692 ILE C    1 1 
        4  4908 1 1 36 ILE CA   C  -12.673  -1.619  -2.063 1.00 . A A . 692 ILE CA   1 1 
        4  4909 1 1 36 ILE CB   C  -12.926  -2.140  -3.505 1.00 . A A . 692 ILE CB   1 1 
        4  4910 1 1 36 ILE CD1  C  -12.913   0.200  -4.530 1.00 . A A . 692 ILE CD1  1 1 
        4  4911 1 1 36 ILE CG1  C  -12.316  -1.193  -4.547 1.00 . A A . 692 ILE CG1  1 1 
        4  4912 1 1 36 ILE CG2  C  -14.424  -2.322  -3.764 1.00 . A A . 692 ILE CG2  1 1 
        4  4913 1 1 36 ILE H    H  -10.730  -2.411  -1.728 1.00 . A A . 692 ILE H    1 1 
        4  4914 1 1 36 ILE HA   H  -13.065  -0.612  -1.992 1.00 . A A . 692 ILE HA   1 1 
        4  4915 1 1 36 ILE HB   H  -12.456  -3.110  -3.596 1.00 . A A . 692 ILE HB   1 1 
        4  4916 1 1 36 ILE HD11 H  -12.746   0.655  -3.564 1.00 . A A . 692 ILE HD11 1 1 
        4  4917 1 1 36 ILE HD12 H  -13.974   0.137  -4.722 1.00 . A A . 692 ILE HD12 1 1 
        4  4918 1 1 36 ILE HD13 H  -12.443   0.801  -5.294 1.00 . A A . 692 ILE HD13 1 1 
        4  4919 1 1 36 ILE HG12 H  -11.256  -1.099  -4.363 1.00 . A A . 692 ILE HG12 1 1 
        4  4920 1 1 36 ILE HG13 H  -12.467  -1.607  -5.535 1.00 . A A . 692 ILE HG13 1 1 
        4  4921 1 1 36 ILE HG21 H  -14.823  -3.062  -3.086 1.00 . A A . 692 ILE HG21 1 1 
        4  4922 1 1 36 ILE HG22 H  -14.576  -2.648  -4.782 1.00 . A A . 692 ILE HG22 1 1 
        4  4923 1 1 36 ILE HG23 H  -14.935  -1.381  -3.609 1.00 . A A . 692 ILE HG23 1 1 
        4  4924 1 1 36 ILE N    N  -11.238  -1.572  -1.749 1.00 . A A . 692 ILE N    1 1 
        4  4925 1 1 36 ILE O    O  -13.108  -3.691  -0.907 1.00 . A A . 692 ILE O    1 1 
        4  4926 1 1 37 ASP C    C  -16.749  -2.798  -0.171 1.00 . A A . 693 ASP C    1 1 
        4  4927 1 1 37 ASP CA   C  -15.335  -2.742   0.427 1.00 . A A . 693 ASP CA   1 1 
        4  4928 1 1 37 ASP CB   C  -15.368  -2.150   1.836 1.00 . A A . 693 ASP CB   1 1 
        4  4929 1 1 37 ASP CG   C  -16.170  -3.012   2.789 1.00 . A A . 693 ASP CG   1 1 
        4  4930 1 1 37 ASP H    H  -14.612  -1.000  -0.537 1.00 . A A . 693 ASP H    1 1 
        4  4931 1 1 37 ASP HA   H  -14.945  -3.749   0.479 1.00 . A A . 693 ASP HA   1 1 
        4  4932 1 1 37 ASP HB2  H  -14.356  -2.072   2.211 1.00 . A A . 693 ASP HB2  1 1 
        4  4933 1 1 37 ASP HB3  H  -15.811  -1.164   1.800 1.00 . A A . 693 ASP HB3  1 1 
        4  4934 1 1 37 ASP N    N  -14.451  -1.962  -0.435 1.00 . A A . 693 ASP N    1 1 
        4  4935 1 1 37 ASP O    O  -17.213  -1.834  -0.780 1.00 . A A . 693 ASP O    1 1 
        4  4936 1 1 37 ASP OD1  O  -15.654  -4.038   3.257 1.00 . A A . 693 ASP OD1  1 1 
        4  4937 1 1 37 ASP OD2  O  -17.334  -2.685   3.065 1.00 . A A . 693 ASP OD2  1 1 
        4  4938 1 1 38 LYS C    C  -19.839  -3.298   0.087 1.00 . A A . 694 LYS C    1 1 
        4  4939 1 1 38 LYS CA   C  -18.748  -4.146  -0.591 1.00 . A A . 694 LYS CA   1 1 
        4  4940 1 1 38 LYS CB   C  -19.105  -5.640  -0.525 1.00 . A A . 694 LYS CB   1 1 
        4  4941 1 1 38 LYS CD   C  -18.414  -8.028  -1.104 1.00 . A A . 694 LYS CD   1 1 
        4  4942 1 1 38 LYS CE   C  -19.619  -8.432  -1.953 1.00 . A A . 694 LYS CE   1 1 
        4  4943 1 1 38 LYS CG   C  -18.076  -6.537  -1.211 1.00 . A A . 694 LYS CG   1 1 
        4  4944 1 1 38 LYS H    H  -17.030  -4.636   0.562 1.00 . A A . 694 LYS H    1 1 
        4  4945 1 1 38 LYS HA   H  -18.684  -3.854  -1.630 1.00 . A A . 694 LYS HA   1 1 
        4  4946 1 1 38 LYS HB2  H  -19.181  -5.937   0.512 1.00 . A A . 694 LYS HB2  1 1 
        4  4947 1 1 38 LYS HB3  H  -20.062  -5.792  -1.005 1.00 . A A . 694 LYS HB3  1 1 
        4  4948 1 1 38 LYS HD2  H  -17.558  -8.602  -1.430 1.00 . A A . 694 LYS HD2  1 1 
        4  4949 1 1 38 LYS HD3  H  -18.624  -8.262  -0.069 1.00 . A A . 694 LYS HD3  1 1 
        4  4950 1 1 38 LYS HE2  H  -19.529  -7.970  -2.925 1.00 . A A . 694 LYS HE2  1 1 
        4  4951 1 1 38 LYS HE3  H  -19.614  -9.507  -2.070 1.00 . A A . 694 LYS HE3  1 1 
        4  4952 1 1 38 LYS HG2  H  -18.025  -6.271  -2.257 1.00 . A A . 694 LYS HG2  1 1 
        4  4953 1 1 38 LYS HG3  H  -17.109  -6.367  -0.754 1.00 . A A . 694 LYS HG3  1 1 
        4  4954 1 1 38 LYS HZ1  H  -20.985  -8.369  -0.373 1.00 . A A . 694 LYS HZ1  1 1 
        4  4955 1 1 38 LYS HZ2  H  -21.706  -8.413  -1.901 1.00 . A A . 694 LYS HZ2  1 1 
        4  4956 1 1 38 LYS HZ3  H  -21.002  -6.984  -1.341 1.00 . A A . 694 LYS HZ3  1 1 
        4  4957 1 1 38 LYS N    N  -17.425  -3.928   0.010 1.00 . A A . 694 LYS N    1 1 
        4  4958 1 1 38 LYS NZ   N  -20.917  -8.020  -1.350 1.00 . A A . 694 LYS NZ   1 1 
        4  4959 1 1 38 LYS O    O  -20.694  -2.717  -0.585 1.00 . A A . 694 LYS O    1 1 
        4  4960 1 1 39 GLU C    C  -20.465  -0.982   2.276 1.00 . A A . 695 GLU C    1 1 
        4  4961 1 1 39 GLU CA   C  -20.816  -2.481   2.176 1.00 . A A . 695 GLU CA   1 1 
        4  4962 1 1 39 GLU CB   C  -20.967  -3.064   3.591 1.00 . A A . 695 GLU CB   1 1 
        4  4963 1 1 39 GLU CD   C  -20.066  -5.474   3.547 1.00 . A A . 695 GLU CD   1 1 
        4  4964 1 1 39 GLU CG   C  -21.291  -4.563   3.636 1.00 . A A . 695 GLU CG   1 1 
        4  4965 1 1 39 GLU H    H  -19.098  -3.706   1.900 1.00 . A A . 695 GLU H    1 1 
        4  4966 1 1 39 GLU HA   H  -21.760  -2.578   1.659 1.00 . A A . 695 GLU HA   1 1 
        4  4967 1 1 39 GLU HB2  H  -20.044  -2.904   4.132 1.00 . A A . 695 GLU HB2  1 1 
        4  4968 1 1 39 GLU HB3  H  -21.761  -2.534   4.099 1.00 . A A . 695 GLU HB3  1 1 
        4  4969 1 1 39 GLU HG2  H  -21.799  -4.776   4.565 1.00 . A A . 695 GLU HG2  1 1 
        4  4970 1 1 39 GLU HG3  H  -21.951  -4.795   2.812 1.00 . A A . 695 GLU HG3  1 1 
        4  4971 1 1 39 GLU N    N  -19.812  -3.235   1.414 1.00 . A A . 695 GLU N    1 1 
        4  4972 1 1 39 GLU O    O  -21.265  -0.115   1.920 1.00 . A A . 695 GLU O    1 1 
        4  4973 1 1 39 GLU OE1  O  -18.929  -4.970   3.442 1.00 . A A . 695 GLU OE1  1 1 
        4  4974 1 1 39 GLU OE2  O  -20.238  -6.705   3.609 1.00 . A A . 695 GLU OE2  1 1 
        4  4975 1 1 40 ASP C    C  -18.406   1.452   1.804 1.00 . A A . 696 ASP C    1 1 
        4  4976 1 1 40 ASP CA   C  -18.834   0.675   3.070 1.00 . A A . 696 ASP CA   1 1 
        4  4977 1 1 40 ASP CB   C  -17.689   0.617   4.101 1.00 . A A . 696 ASP CB   1 1 
        4  4978 1 1 40 ASP CG   C  -17.456   1.937   4.825 1.00 . A A . 696 ASP CG   1 1 
        4  4979 1 1 40 ASP H    H  -18.639  -1.426   2.924 1.00 . A A . 696 ASP H    1 1 
        4  4980 1 1 40 ASP HA   H  -19.675   1.184   3.516 1.00 . A A . 696 ASP HA   1 1 
        4  4981 1 1 40 ASP HB2  H  -17.924  -0.134   4.842 1.00 . A A . 696 ASP HB2  1 1 
        4  4982 1 1 40 ASP HB3  H  -16.774   0.336   3.596 1.00 . A A . 696 ASP HB3  1 1 
        4  4983 1 1 40 ASP N    N  -19.262  -0.695   2.760 1.00 . A A . 696 ASP N    1 1 
        4  4984 1 1 40 ASP O    O  -18.520   2.679   1.748 1.00 . A A . 696 ASP O    1 1 
        4  4985 1 1 40 ASP OD1  O  -18.390   2.766   4.884 1.00 . A A . 696 ASP OD1  1 1 
        4  4986 1 1 40 ASP OD2  O  -16.338   2.149   5.349 1.00 . A A . 696 ASP OD2  1 1 
        4  4987 1 1 41 GLY C    C  -16.035   1.500  -0.683 1.00 . A A . 697 GLY C    1 1 
        4  4988 1 1 41 GLY CA   C  -17.545   1.369  -0.480 1.00 . A A . 697 GLY CA   1 1 
        4  4989 1 1 41 GLY H    H  -17.801  -0.231   0.903 1.00 . A A . 697 GLY H    1 1 
        4  4990 1 1 41 GLY HA2  H  -17.946   0.775  -1.286 1.00 . A A . 697 GLY HA2  1 1 
        4  4991 1 1 41 GLY HA3  H  -17.990   2.355  -0.525 1.00 . A A . 697 GLY HA3  1 1 
        4  4992 1 1 41 GLY N    N  -17.914   0.735   0.791 1.00 . A A . 697 GLY N    1 1 
        4  4993 1 1 41 GLY O    O  -15.257   0.725  -0.125 1.00 . A A . 697 GLY O    1 1 
        4  4994 1 1 42 ASP C    C  -13.554   3.316  -0.459 1.00 . A A . 698 ASP C    1 1 
        4  4995 1 1 42 ASP CA   C  -14.194   2.739  -1.729 1.00 . A A . 698 ASP CA   1 1 
        4  4996 1 1 42 ASP CB   C  -14.010   3.710  -2.904 1.00 . A A . 698 ASP CB   1 1 
        4  4997 1 1 42 ASP CG   C  -12.542   3.961  -3.235 1.00 . A A . 698 ASP CG   1 1 
        4  4998 1 1 42 ASP H    H  -16.288   3.003  -1.983 1.00 . A A . 698 ASP H    1 1 
        4  4999 1 1 42 ASP HA   H  -13.712   1.800  -1.968 1.00 . A A . 698 ASP HA   1 1 
        4  5000 1 1 42 ASP HB2  H  -14.493   3.300  -3.781 1.00 . A A . 698 ASP HB2  1 1 
        4  5001 1 1 42 ASP HB3  H  -14.473   4.656  -2.657 1.00 . A A . 698 ASP HB3  1 1 
        4  5002 1 1 42 ASP N    N  -15.620   2.465  -1.507 1.00 . A A . 698 ASP N    1 1 
        4  5003 1 1 42 ASP O    O  -13.940   4.388   0.014 1.00 . A A . 698 ASP O    1 1 
        4  5004 1 1 42 ASP OD1  O  -11.879   4.722  -2.500 1.00 . A A . 698 ASP OD1  1 1 
        4  5005 1 1 42 ASP OD2  O  -12.044   3.406  -4.236 1.00 . A A . 698 ASP OD2  1 1 
        4  5006 1 1 43 LEU C    C  -10.458   3.400   1.113 1.00 . A A . 699 LEU C    1 1 
        4  5007 1 1 43 LEU CA   C  -11.928   3.009   1.340 1.00 . A A . 699 LEU CA   1 1 
        4  5008 1 1 43 LEU CB   C  -12.012   1.868   2.367 1.00 . A A . 699 LEU CB   1 1 
        4  5009 1 1 43 LEU CD1  C  -13.404   0.252   3.720 1.00 . A A . 699 LEU CD1  1 1 
        4  5010 1 1 43 LEU CD2  C  -14.480   2.300   2.736 1.00 . A A . 699 LEU CD2  1 1 
        4  5011 1 1 43 LEU CG   C  -13.404   1.233   2.550 1.00 . A A . 699 LEU CG   1 1 
        4  5012 1 1 43 LEU H    H  -12.280   1.780  -0.360 1.00 . A A . 699 LEU H    1 1 
        4  5013 1 1 43 LEU HA   H  -12.456   3.869   1.730 1.00 . A A . 699 LEU HA   1 1 
        4  5014 1 1 43 LEU HB2  H  -11.324   1.089   2.062 1.00 . A A . 699 LEU HB2  1 1 
        4  5015 1 1 43 LEU HB3  H  -11.687   2.252   3.324 1.00 . A A . 699 LEU HB3  1 1 
        4  5016 1 1 43 LEU HD11 H  -14.389  -0.179   3.828 1.00 . A A . 699 LEU HD11 1 1 
        4  5017 1 1 43 LEU HD12 H  -13.136   0.770   4.630 1.00 . A A . 699 LEU HD12 1 1 
        4  5018 1 1 43 LEU HD13 H  -12.689  -0.535   3.529 1.00 . A A . 699 LEU HD13 1 1 
        4  5019 1 1 43 LEU HD21 H  -15.448   1.826   2.820 1.00 . A A . 699 LEU HD21 1 1 
        4  5020 1 1 43 LEU HD22 H  -14.482   2.964   1.883 1.00 . A A . 699 LEU HD22 1 1 
        4  5021 1 1 43 LEU HD23 H  -14.282   2.868   3.631 1.00 . A A . 699 LEU HD23 1 1 
        4  5022 1 1 43 LEU HG   H  -13.647   0.673   1.658 1.00 . A A . 699 LEU HG   1 1 
        4  5023 1 1 43 LEU N    N  -12.576   2.602   0.088 1.00 . A A . 699 LEU N    1 1 
        4  5024 1 1 43 LEU O    O   -9.666   3.442   2.057 1.00 . A A . 699 LEU O    1 1 
        4  5025 1 1 44 THR C    C   -8.151   5.199   0.314 1.00 . A A . 700 THR C    1 1 
        4  5026 1 1 44 THR CA   C   -8.730   4.037  -0.517 1.00 . A A . 700 THR CA   1 1 
        4  5027 1 1 44 THR CB   C   -8.633   4.382  -2.027 1.00 . A A . 700 THR CB   1 1 
        4  5028 1 1 44 THR CG2  C   -7.194   4.681  -2.443 1.00 . A A . 700 THR CG2  1 1 
        4  5029 1 1 44 THR H    H  -10.811   3.729  -0.828 1.00 . A A . 700 THR H    1 1 
        4  5030 1 1 44 THR HA   H   -8.132   3.155  -0.340 1.00 . A A . 700 THR HA   1 1 
        4  5031 1 1 44 THR HB   H   -9.239   5.258  -2.222 1.00 . A A . 700 THR HB   1 1 
        4  5032 1 1 44 THR HG1  H  -10.038   3.489  -3.107 1.00 . A A . 700 THR HG1  1 1 
        4  5033 1 1 44 THR HG21 H   -6.578   3.812  -2.262 1.00 . A A . 700 THR HG21 1 1 
        4  5034 1 1 44 THR HG22 H   -6.816   5.514  -1.868 1.00 . A A . 700 THR HG22 1 1 
        4  5035 1 1 44 THR HG23 H   -7.166   4.928  -3.495 1.00 . A A . 700 THR HG23 1 1 
        4  5036 1 1 44 THR N    N  -10.114   3.713  -0.136 1.00 . A A . 700 THR N    1 1 
        4  5037 1 1 44 THR O    O   -6.975   5.183   0.689 1.00 . A A . 700 THR O    1 1 
        4  5038 1 1 44 THR OG1  O   -9.137   3.287  -2.811 1.00 . A A . 700 THR OG1  1 1 
        4  5039 1 1 45 SER C    C   -8.328   6.976   2.896 1.00 . A A . 701 SER C    1 1 
        4  5040 1 1 45 SER CA   C   -8.553   7.353   1.422 1.00 . A A . 701 SER CA   1 1 
        4  5041 1 1 45 SER CB   C   -9.584   8.489   1.334 1.00 . A A . 701 SER CB   1 1 
        4  5042 1 1 45 SER H    H   -9.904   6.165   0.279 1.00 . A A . 701 SER H    1 1 
        4  5043 1 1 45 SER HA   H   -7.616   7.704   1.015 1.00 . A A . 701 SER HA   1 1 
        4  5044 1 1 45 SER HB2  H  -10.556   8.114   1.630 1.00 . A A . 701 SER HB2  1 1 
        4  5045 1 1 45 SER HB3  H   -9.292   9.293   1.997 1.00 . A A . 701 SER HB3  1 1 
        4  5046 1 1 45 SER HG   H  -10.573   9.332  -0.138 1.00 . A A . 701 SER HG   1 1 
        4  5047 1 1 45 SER N    N   -8.981   6.197   0.614 1.00 . A A . 701 SER N    1 1 
        4  5048 1 1 45 SER O    O   -7.642   7.691   3.628 1.00 . A A . 701 SER O    1 1 
        4  5049 1 1 45 SER OG   O   -9.676   9.004   0.013 1.00 . A A . 701 SER OG   1 1 
        4  5050 1 1 46 LYS C    C   -7.549   4.413   4.848 1.00 . A A . 702 LYS C    1 1 
        4  5051 1 1 46 LYS CA   C   -8.734   5.388   4.717 1.00 . A A . 702 LYS CA   1 1 
        4  5052 1 1 46 LYS CB   C  -10.029   4.737   5.230 1.00 . A A . 702 LYS CB   1 1 
        4  5053 1 1 46 LYS CD   C  -12.363   5.150   6.134 1.00 . A A . 702 LYS CD   1 1 
        4  5054 1 1 46 LYS CE   C  -12.985   3.920   5.487 1.00 . A A . 702 LYS CE   1 1 
        4  5055 1 1 46 LYS CG   C  -11.203   5.711   5.313 1.00 . A A . 702 LYS CG   1 1 
        4  5056 1 1 46 LYS H    H   -9.445   5.323   2.713 1.00 . A A . 702 LYS H    1 1 
        4  5057 1 1 46 LYS HA   H   -8.526   6.256   5.330 1.00 . A A . 702 LYS HA   1 1 
        4  5058 1 1 46 LYS HB2  H  -10.303   3.929   4.563 1.00 . A A . 702 LYS HB2  1 1 
        4  5059 1 1 46 LYS HB3  H   -9.853   4.333   6.218 1.00 . A A . 702 LYS HB3  1 1 
        4  5060 1 1 46 LYS HD2  H  -11.995   4.878   7.113 1.00 . A A . 702 LYS HD2  1 1 
        4  5061 1 1 46 LYS HD3  H  -13.121   5.916   6.236 1.00 . A A . 702 LYS HD3  1 1 
        4  5062 1 1 46 LYS HE2  H  -13.357   4.192   4.510 1.00 . A A . 702 LYS HE2  1 1 
        4  5063 1 1 46 LYS HE3  H  -12.224   3.160   5.381 1.00 . A A . 702 LYS HE3  1 1 
        4  5064 1 1 46 LYS HG2  H  -10.864   6.629   5.774 1.00 . A A . 702 LYS HG2  1 1 
        4  5065 1 1 46 LYS HG3  H  -11.549   5.922   4.310 1.00 . A A . 702 LYS HG3  1 1 
        4  5066 1 1 46 LYS HZ1  H  -14.799   4.115   6.506 1.00 . A A . 702 LYS HZ1  1 1 
        4  5067 1 1 46 LYS HZ2  H  -13.748   2.986   7.194 1.00 . A A . 702 LYS HZ2  1 1 
        4  5068 1 1 46 LYS HZ3  H  -14.596   2.611   5.774 1.00 . A A . 702 LYS HZ3  1 1 
        4  5069 1 1 46 LYS N    N   -8.902   5.854   3.332 1.00 . A A . 702 LYS N    1 1 
        4  5070 1 1 46 LYS NZ   N  -14.108   3.368   6.294 1.00 . A A . 702 LYS NZ   1 1 
        4  5071 1 1 46 LYS O    O   -7.383   3.757   5.878 1.00 . A A . 702 LYS O    1 1 
        4  5072 1 1 47 ILE C    C   -4.331   4.362   4.378 1.00 . A A . 703 ILE C    1 1 
        4  5073 1 1 47 ILE CA   C   -5.501   3.522   3.843 1.00 . A A . 703 ILE CA   1 1 
        4  5074 1 1 47 ILE CB   C   -5.105   2.997   2.440 1.00 . A A . 703 ILE CB   1 1 
        4  5075 1 1 47 ILE CD1  C   -5.975   1.814   0.355 1.00 . A A . 703 ILE CD1  1 1 
        4  5076 1 1 47 ILE CG1  C   -6.272   2.252   1.776 1.00 . A A . 703 ILE CG1  1 1 
        4  5077 1 1 47 ILE CG2  C   -3.874   2.090   2.535 1.00 . A A . 703 ILE CG2  1 1 
        4  5078 1 1 47 ILE H    H   -6.966   4.788   2.970 1.00 . A A . 703 ILE H    1 1 
        4  5079 1 1 47 ILE HA   H   -5.665   2.673   4.495 1.00 . A A . 703 ILE HA   1 1 
        4  5080 1 1 47 ILE HB   H   -4.841   3.849   1.828 1.00 . A A . 703 ILE HB   1 1 
        4  5081 1 1 47 ILE HD11 H   -5.729   2.678  -0.245 1.00 . A A . 703 ILE HD11 1 1 
        4  5082 1 1 47 ILE HD12 H   -6.845   1.326  -0.059 1.00 . A A . 703 ILE HD12 1 1 
        4  5083 1 1 47 ILE HD13 H   -5.145   1.126   0.354 1.00 . A A . 703 ILE HD13 1 1 
        4  5084 1 1 47 ILE HG12 H   -6.506   1.368   2.351 1.00 . A A . 703 ILE HG12 1 1 
        4  5085 1 1 47 ILE HG13 H   -7.137   2.898   1.749 1.00 . A A . 703 ILE HG13 1 1 
        4  5086 1 1 47 ILE HG21 H   -3.604   1.744   1.548 1.00 . A A . 703 ILE HG21 1 1 
        4  5087 1 1 47 ILE HG22 H   -4.098   1.240   3.163 1.00 . A A . 703 ILE HG22 1 1 
        4  5088 1 1 47 ILE HG23 H   -3.047   2.642   2.961 1.00 . A A . 703 ILE HG23 1 1 
        4  5089 1 1 47 ILE N    N   -6.733   4.317   3.798 1.00 . A A . 703 ILE N    1 1 
        4  5090 1 1 47 ILE O    O   -3.992   5.397   3.803 1.00 . A A . 703 ILE O    1 1 
        4  5091 1 1 48 LYS C    C   -1.255   3.889   5.452 1.00 . A A . 704 LYS C    1 1 
        4  5092 1 1 48 LYS CA   C   -2.515   4.581   5.990 1.00 . A A . 704 LYS CA   1 1 
        4  5093 1 1 48 LYS CB   C   -2.477   4.567   7.526 1.00 . A A . 704 LYS CB   1 1 
        4  5094 1 1 48 LYS CD   C   -1.086   5.084   9.594 1.00 . A A . 704 LYS CD   1 1 
        4  5095 1 1 48 LYS CE   C    0.136   5.833  10.117 1.00 . A A . 704 LYS CE   1 1 
        4  5096 1 1 48 LYS CG   C   -1.257   5.291   8.094 1.00 . A A . 704 LYS CG   1 1 
        4  5097 1 1 48 LYS H    H   -4.103   3.167   5.965 1.00 . A A . 704 LYS H    1 1 
        4  5098 1 1 48 LYS HA   H   -2.522   5.609   5.651 1.00 . A A . 704 LYS HA   1 1 
        4  5099 1 1 48 LYS HB2  H   -3.370   5.047   7.902 1.00 . A A . 704 LYS HB2  1 1 
        4  5100 1 1 48 LYS HB3  H   -2.458   3.541   7.867 1.00 . A A . 704 LYS HB3  1 1 
        4  5101 1 1 48 LYS HD2  H   -1.966   5.448  10.105 1.00 . A A . 704 LYS HD2  1 1 
        4  5102 1 1 48 LYS HD3  H   -0.963   4.027   9.795 1.00 . A A . 704 LYS HD3  1 1 
        4  5103 1 1 48 LYS HE2  H   -0.007   6.891   9.953 1.00 . A A . 704 LYS HE2  1 1 
        4  5104 1 1 48 LYS HE3  H    0.233   5.646  11.177 1.00 . A A . 704 LYS HE3  1 1 
        4  5105 1 1 48 LYS HG2  H   -0.373   4.924   7.592 1.00 . A A . 704 LYS HG2  1 1 
        4  5106 1 1 48 LYS HG3  H   -1.361   6.349   7.897 1.00 . A A . 704 LYS HG3  1 1 
        4  5107 1 1 48 LYS HZ1  H    1.632   4.432   9.705 1.00 . A A . 704 LYS HZ1  1 1 
        4  5108 1 1 48 LYS HZ2  H    2.176   6.033   9.709 1.00 . A A . 704 LYS HZ2  1 1 
        4  5109 1 1 48 LYS HZ3  H    1.276   5.450   8.403 1.00 . A A . 704 LYS HZ3  1 1 
        4  5110 1 1 48 LYS N    N   -3.726   3.931   5.481 1.00 . A A . 704 LYS N    1 1 
        4  5111 1 1 48 LYS NZ   N    1.390   5.407   9.435 1.00 . A A . 704 LYS NZ   1 1 
        4  5112 1 1 48 LYS O    O   -1.239   2.671   5.253 1.00 . A A . 704 LYS O    1 1 
        4  5113 1 1 49 VAL C    C    2.103   4.111   5.947 1.00 . A A . 705 VAL C    1 1 
        4  5114 1 1 49 VAL CA   C    1.090   4.128   4.785 1.00 . A A . 705 VAL CA   1 1 
        4  5115 1 1 49 VAL CB   C    1.671   4.960   3.610 1.00 . A A . 705 VAL CB   1 1 
        4  5116 1 1 49 VAL CG1  C    2.970   4.343   3.087 1.00 . A A . 705 VAL CG1  1 1 
        4  5117 1 1 49 VAL CG2  C    0.645   5.099   2.485 1.00 . A A . 705 VAL CG2  1 1 
        4  5118 1 1 49 VAL H    H   -0.288   5.637   5.357 1.00 . A A . 705 VAL H    1 1 
        4  5119 1 1 49 VAL HA   H    0.931   3.114   4.440 1.00 . A A . 705 VAL HA   1 1 
        4  5120 1 1 49 VAL HB   H    1.900   5.952   3.979 1.00 . A A . 705 VAL HB   1 1 
        4  5121 1 1 49 VAL HG11 H    3.366   4.957   2.290 1.00 . A A . 705 VAL HG11 1 1 
        4  5122 1 1 49 VAL HG12 H    2.773   3.349   2.710 1.00 . A A . 705 VAL HG12 1 1 
        4  5123 1 1 49 VAL HG13 H    3.692   4.286   3.889 1.00 . A A . 705 VAL HG13 1 1 
        4  5124 1 1 49 VAL HG21 H    0.395   4.120   2.099 1.00 . A A . 705 VAL HG21 1 1 
        4  5125 1 1 49 VAL HG22 H    1.057   5.705   1.691 1.00 . A A . 705 VAL HG22 1 1 
        4  5126 1 1 49 VAL HG23 H   -0.249   5.570   2.868 1.00 . A A . 705 VAL HG23 1 1 
        4  5127 1 1 49 VAL N    N   -0.200   4.669   5.224 1.00 . A A . 705 VAL N    1 1 
        4  5128 1 1 49 VAL O    O    2.068   4.970   6.832 1.00 . A A . 705 VAL O    1 1 
        4  5129 1 1 50 ASP C    C    5.393   2.669   6.258 1.00 . A A . 706 ASP C    1 1 
        4  5130 1 1 50 ASP CA   C    4.067   3.045   6.939 1.00 . A A . 706 ASP CA   1 1 
        4  5131 1 1 50 ASP CB   C    3.730   2.040   8.048 1.00 . A A . 706 ASP CB   1 1 
        4  5132 1 1 50 ASP CG   C    4.776   2.028   9.149 1.00 . A A . 706 ASP CG   1 1 
        4  5133 1 1 50 ASP H    H    2.889   2.391   5.299 1.00 . A A . 706 ASP H    1 1 
        4  5134 1 1 50 ASP HA   H    4.176   4.027   7.379 1.00 . A A . 706 ASP HA   1 1 
        4  5135 1 1 50 ASP HB2  H    2.778   2.306   8.486 1.00 . A A . 706 ASP HB2  1 1 
        4  5136 1 1 50 ASP HB3  H    3.661   1.048   7.623 1.00 . A A . 706 ASP HB3  1 1 
        4  5137 1 1 50 ASP N    N    2.981   3.110   5.959 1.00 . A A . 706 ASP N    1 1 
        4  5138 1 1 50 ASP O    O    5.465   1.693   5.507 1.00 . A A . 706 ASP O    1 1 
        4  5139 1 1 50 ASP OD1  O    4.824   2.999   9.931 1.00 . A A . 706 ASP OD1  1 1 
        4  5140 1 1 50 ASP OD2  O    5.564   1.063   9.229 1.00 . A A . 706 ASP OD2  1 1 
        4  5141 1 1 51 GLY C    C    7.984   4.222   4.748 1.00 . A A . 707 GLY C    1 1 
        4  5142 1 1 51 GLY CA   C    7.733   3.231   5.883 1.00 . A A . 707 GLY CA   1 1 
        4  5143 1 1 51 GLY H    H    6.339   4.170   7.186 1.00 . A A . 707 GLY H    1 1 
        4  5144 1 1 51 GLY HA2  H    8.513   3.343   6.622 1.00 . A A . 707 GLY HA2  1 1 
        4  5145 1 1 51 GLY HA3  H    7.772   2.226   5.485 1.00 . A A . 707 GLY HA3  1 1 
        4  5146 1 1 51 GLY N    N    6.440   3.442   6.531 1.00 . A A . 707 GLY N    1 1 
        4  5147 1 1 51 GLY O    O    7.107   5.018   4.413 1.00 . A A . 707 GLY O    1 1 
        4  5148 1 1 52 GLU C    C   10.570   4.461   2.098 1.00 . A A . 708 GLU C    1 1 
        4  5149 1 1 52 GLU CA   C    9.547   5.091   3.059 1.00 . A A . 708 GLU CA   1 1 
        4  5150 1 1 52 GLU CB   C   10.112   6.405   3.634 1.00 . A A . 708 GLU CB   1 1 
        4  5151 1 1 52 GLU CD   C    8.385   8.038   2.744 1.00 . A A . 708 GLU CD   1 1 
        4  5152 1 1 52 GLU CG   C    9.053   7.450   3.981 1.00 . A A . 708 GLU CG   1 1 
        4  5153 1 1 52 GLU H    H    9.819   3.488   4.434 1.00 . A A . 708 GLU H    1 1 
        4  5154 1 1 52 GLU HA   H    8.648   5.315   2.500 1.00 . A A . 708 GLU HA   1 1 
        4  5155 1 1 52 GLU HB2  H   10.667   6.180   4.535 1.00 . A A . 708 GLU HB2  1 1 
        4  5156 1 1 52 GLU HB3  H   10.788   6.841   2.912 1.00 . A A . 708 GLU HB3  1 1 
        4  5157 1 1 52 GLU HG2  H    8.295   6.986   4.597 1.00 . A A . 708 GLU HG2  1 1 
        4  5158 1 1 52 GLU HG3  H    9.523   8.250   4.537 1.00 . A A . 708 GLU HG3  1 1 
        4  5159 1 1 52 GLU N    N    9.173   4.168   4.147 1.00 . A A . 708 GLU N    1 1 
        4  5160 1 1 52 GLU O    O   11.443   3.700   2.513 1.00 . A A . 708 GLU O    1 1 
        4  5161 1 1 52 GLU OE1  O    8.890   9.051   2.209 1.00 . A A . 708 GLU OE1  1 1 
        4  5162 1 1 52 GLU OE2  O    7.364   7.485   2.287 1.00 . A A . 708 GLU OE2  1 1 
        4  5163 1 1 53 VAL C    C   12.217   5.429  -0.820 1.00 . A A . 709 VAL C    1 1 
        4  5164 1 1 53 VAL CA   C   11.384   4.288  -0.216 1.00 . A A . 709 VAL CA   1 1 
        4  5165 1 1 53 VAL CB   C   10.625   3.564  -1.365 1.00 . A A . 709 VAL CB   1 1 
        4  5166 1 1 53 VAL CG1  C   11.596   3.076  -2.445 1.00 . A A . 709 VAL CG1  1 1 
        4  5167 1 1 53 VAL CG2  C    9.795   2.404  -0.820 1.00 . A A . 709 VAL CG2  1 1 
        4  5168 1 1 53 VAL H    H    9.724   5.384   0.539 1.00 . A A . 709 VAL H    1 1 
        4  5169 1 1 53 VAL HA   H   12.052   3.573   0.250 1.00 . A A . 709 VAL HA   1 1 
        4  5170 1 1 53 VAL HB   H    9.948   4.276  -1.821 1.00 . A A . 709 VAL HB   1 1 
        4  5171 1 1 53 VAL HG11 H   12.328   2.414  -2.004 1.00 . A A . 709 VAL HG11 1 1 
        4  5172 1 1 53 VAL HG12 H   12.099   3.923  -2.887 1.00 . A A . 709 VAL HG12 1 1 
        4  5173 1 1 53 VAL HG13 H   11.048   2.546  -3.210 1.00 . A A . 709 VAL HG13 1 1 
        4  5174 1 1 53 VAL HG21 H    9.085   2.778  -0.095 1.00 . A A . 709 VAL HG21 1 1 
        4  5175 1 1 53 VAL HG22 H   10.445   1.683  -0.345 1.00 . A A . 709 VAL HG22 1 1 
        4  5176 1 1 53 VAL HG23 H    9.262   1.928  -1.630 1.00 . A A . 709 VAL HG23 1 1 
        4  5177 1 1 53 VAL N    N   10.455   4.789   0.809 1.00 . A A . 709 VAL N    1 1 
        4  5178 1 1 53 VAL O    O   11.686   6.292  -1.523 1.00 . A A . 709 VAL O    1 1 
        4  5179 1 1 54 ASP C    C   14.640   6.178  -2.619 1.00 . A A . 710 ASP C    1 1 
        4  5180 1 1 54 ASP CA   C   14.435   6.421  -1.114 1.00 . A A . 710 ASP CA   1 1 
        4  5181 1 1 54 ASP CB   C   15.784   6.368  -0.390 1.00 . A A . 710 ASP CB   1 1 
        4  5182 1 1 54 ASP CG   C   15.655   6.688   1.088 1.00 . A A . 710 ASP CG   1 1 
        4  5183 1 1 54 ASP H    H   13.873   4.774   0.094 1.00 . A A . 710 ASP H    1 1 
        4  5184 1 1 54 ASP HA   H   13.999   7.402  -0.974 1.00 . A A . 710 ASP HA   1 1 
        4  5185 1 1 54 ASP HB2  H   16.200   5.375  -0.486 1.00 . A A . 710 ASP HB2  1 1 
        4  5186 1 1 54 ASP HB3  H   16.459   7.083  -0.844 1.00 . A A . 710 ASP HB3  1 1 
        4  5187 1 1 54 ASP N    N   13.521   5.435  -0.537 1.00 . A A . 710 ASP N    1 1 
        4  5188 1 1 54 ASP O    O   14.843   5.046  -3.055 1.00 . A A . 710 ASP O    1 1 
        4  5189 1 1 54 ASP OD1  O   14.948   5.950   1.801 1.00 . A A . 710 ASP OD1  1 1 
        4  5190 1 1 54 ASP OD2  O   16.267   7.676   1.546 1.00 . A A . 710 ASP OD2  1 1 
        4  5191 1 1 55 THR C    C   16.138   7.632  -5.338 1.00 . A A . 711 THR C    1 1 
        4  5192 1 1 55 THR CA   C   14.764   7.144  -4.864 1.00 . A A . 711 THR CA   1 1 
        4  5193 1 1 55 THR CB   C   13.665   7.940  -5.608 1.00 . A A . 711 THR CB   1 1 
        4  5194 1 1 55 THR CG2  C   12.279   7.359  -5.331 1.00 . A A . 711 THR CG2  1 1 
        4  5195 1 1 55 THR H    H   14.471   8.135  -3.000 1.00 . A A . 711 THR H    1 1 
        4  5196 1 1 55 THR HA   H   14.661   6.102  -5.136 1.00 . A A . 711 THR HA   1 1 
        4  5197 1 1 55 THR HB   H   13.855   7.878  -6.672 1.00 . A A . 711 THR HB   1 1 
        4  5198 1 1 55 THR HG1  H   13.367   9.863  -5.945 1.00 . A A . 711 THR HG1  1 1 
        4  5199 1 1 55 THR HG21 H   12.236   6.339  -5.685 1.00 . A A . 711 THR HG21 1 1 
        4  5200 1 1 55 THR HG22 H   11.533   7.949  -5.841 1.00 . A A . 711 THR HG22 1 1 
        4  5201 1 1 55 THR HG23 H   12.086   7.377  -4.267 1.00 . A A . 711 THR HG23 1 1 
        4  5202 1 1 55 THR N    N   14.611   7.251  -3.405 1.00 . A A . 711 THR N    1 1 
        4  5203 1 1 55 THR O    O   16.481   7.496  -6.513 1.00 . A A . 711 THR O    1 1 
        4  5204 1 1 55 THR OG1  O   13.697   9.321  -5.214 1.00 . A A . 711 THR OG1  1 1 
        4  5205 1 1 56 THR C    C   19.361   7.647  -4.309 1.00 . A A . 712 THR C    1 1 
        4  5206 1 1 56 THR CA   C   18.291   8.653  -4.763 1.00 . A A . 712 THR CA   1 1 
        4  5207 1 1 56 THR CB   C   18.617  10.032  -4.135 1.00 . A A . 712 THR CB   1 1 
        4  5208 1 1 56 THR CG2  C   18.614   9.961  -2.611 1.00 . A A . 712 THR CG2  1 1 
        4  5209 1 1 56 THR H    H   16.589   8.329  -3.514 1.00 . A A . 712 THR H    1 1 
        4  5210 1 1 56 THR HA   H   18.352   8.754  -5.838 1.00 . A A . 712 THR HA   1 1 
        4  5211 1 1 56 THR HB   H   17.864  10.742  -4.451 1.00 . A A . 712 THR HB   1 1 
        4  5212 1 1 56 THR HG1  H   20.592   9.922  -4.206 1.00 . A A . 712 THR HG1  1 1 
        4  5213 1 1 56 THR HG21 H   18.802  10.944  -2.203 1.00 . A A . 712 THR HG21 1 1 
        4  5214 1 1 56 THR HG22 H   19.385   9.280  -2.279 1.00 . A A . 712 THR HG22 1 1 
        4  5215 1 1 56 THR HG23 H   17.653   9.609  -2.268 1.00 . A A . 712 THR HG23 1 1 
        4  5216 1 1 56 THR N    N   16.929   8.199  -4.427 1.00 . A A . 712 THR N    1 1 
        4  5217 1 1 56 THR O    O   20.555   7.865  -4.511 1.00 . A A . 712 THR O    1 1 
        4  5218 1 1 56 THR OG1  O   19.904  10.486  -4.584 1.00 . A A . 712 THR OG1  1 1 
        4  5219 1 1 57 LYS C    C   19.326   4.119  -3.354 1.00 . A A . 713 LYS C    1 1 
        4  5220 1 1 57 LYS CA   C   19.873   5.545  -3.179 1.00 . A A . 713 LYS CA   1 1 
        4  5221 1 1 57 LYS CB   C   20.167   5.834  -1.701 1.00 . A A . 713 LYS CB   1 1 
        4  5222 1 1 57 LYS CD   C   21.669   5.446   0.287 1.00 . A A . 713 LYS CD   1 1 
        4  5223 1 1 57 LYS CE   C   22.805   4.621   0.876 1.00 . A A . 713 LYS CE   1 1 
        4  5224 1 1 57 LYS CG   C   21.257   4.953  -1.098 1.00 . A A . 713 LYS CG   1 1 
        4  5225 1 1 57 LYS H    H   17.972   6.388  -3.614 1.00 . A A . 713 LYS H    1 1 
        4  5226 1 1 57 LYS HA   H   20.794   5.630  -3.740 1.00 . A A . 713 LYS HA   1 1 
        4  5227 1 1 57 LYS HB2  H   20.476   6.867  -1.605 1.00 . A A . 713 LYS HB2  1 1 
        4  5228 1 1 57 LYS HB3  H   19.261   5.687  -1.130 1.00 . A A . 713 LYS HB3  1 1 
        4  5229 1 1 57 LYS HD2  H   21.995   6.474   0.208 1.00 . A A . 713 LYS HD2  1 1 
        4  5230 1 1 57 LYS HD3  H   20.815   5.391   0.949 1.00 . A A . 713 LYS HD3  1 1 
        4  5231 1 1 57 LYS HE2  H   22.458   3.610   1.037 1.00 . A A . 713 LYS HE2  1 1 
        4  5232 1 1 57 LYS HE3  H   23.629   4.612   0.177 1.00 . A A . 713 LYS HE3  1 1 
        4  5233 1 1 57 LYS HG2  H   20.883   3.941  -1.017 1.00 . A A . 713 LYS HG2  1 1 
        4  5234 1 1 57 LYS HG3  H   22.120   4.969  -1.749 1.00 . A A . 713 LYS HG3  1 1 
        4  5235 1 1 57 LYS HZ1  H   22.531   5.105   2.890 1.00 . A A . 713 LYS HZ1  1 1 
        4  5236 1 1 57 LYS HZ2  H   23.532   6.183   2.057 1.00 . A A . 713 LYS HZ2  1 1 
        4  5237 1 1 57 LYS HZ3  H   24.113   4.664   2.500 1.00 . A A . 713 LYS HZ3  1 1 
        4  5238 1 1 57 LYS N    N   18.934   6.544  -3.704 1.00 . A A . 713 LYS N    1 1 
        4  5239 1 1 57 LYS NZ   N   23.278   5.181   2.170 1.00 . A A . 713 LYS NZ   1 1 
        4  5240 1 1 57 LYS O    O   18.163   3.850  -3.050 1.00 . A A . 713 LYS O    1 1 
        4  5241 1 1 58 ALA C    C   19.639   0.986  -2.849 1.00 . A A . 714 ALA C    1 1 
        4  5242 1 1 58 ALA CA   C   19.769   1.833  -4.122 1.00 . A A . 714 ALA CA   1 1 
        4  5243 1 1 58 ALA CB   C   20.752   1.184  -5.086 1.00 . A A . 714 ALA CB   1 1 
        4  5244 1 1 58 ALA H    H   21.109   3.474  -3.993 1.00 . A A . 714 ALA H    1 1 
        4  5245 1 1 58 ALA HA   H   18.805   1.871  -4.614 1.00 . A A . 714 ALA HA   1 1 
        4  5246 1 1 58 ALA HB1  H   21.719   1.092  -4.611 1.00 . A A . 714 ALA HB1  1 1 
        4  5247 1 1 58 ALA HB2  H   20.845   1.795  -5.972 1.00 . A A . 714 ALA HB2  1 1 
        4  5248 1 1 58 ALA HB3  H   20.395   0.202  -5.362 1.00 . A A . 714 ALA HB3  1 1 
        4  5249 1 1 58 ALA N    N   20.176   3.213  -3.835 1.00 . A A . 714 ALA N    1 1 
        4  5250 1 1 58 ALA O    O   20.400   1.152  -1.893 1.00 . A A . 714 ALA O    1 1 
        4  5251 1 1 59 GLY C    C   17.016  -1.347  -1.666 1.00 . A A . 715 GLY C    1 1 
        4  5252 1 1 59 GLY CA   C   18.435  -0.788  -1.699 1.00 . A A . 715 GLY CA   1 1 
        4  5253 1 1 59 GLY H    H   18.099  -0.008  -3.641 1.00 . A A . 715 GLY H    1 1 
        4  5254 1 1 59 GLY HA2  H   19.134  -1.611  -1.737 1.00 . A A . 715 GLY HA2  1 1 
        4  5255 1 1 59 GLY HA3  H   18.609  -0.225  -0.791 1.00 . A A . 715 GLY HA3  1 1 
        4  5256 1 1 59 GLY N    N   18.666   0.080  -2.848 1.00 . A A . 715 GLY N    1 1 
        4  5257 1 1 59 GLY O    O   16.153  -0.903  -2.421 1.00 . A A . 715 GLY O    1 1 
        4  5258 1 1 60 THR C    C   14.653  -2.278   0.503 1.00 . A A . 716 THR C    1 1 
        4  5259 1 1 60 THR CA   C   15.427  -2.914  -0.666 1.00 . A A . 716 THR CA   1 1 
        4  5260 1 1 60 THR CB   C   15.493  -4.449  -0.462 1.00 . A A . 716 THR CB   1 1 
        4  5261 1 1 60 THR CG2  C   14.098  -5.048  -0.295 1.00 . A A . 716 THR CG2  1 1 
        4  5262 1 1 60 THR H    H   17.502  -2.678  -0.252 1.00 . A A . 716 THR H    1 1 
        4  5263 1 1 60 THR HA   H   14.886  -2.723  -1.584 1.00 . A A . 716 THR HA   1 1 
        4  5264 1 1 60 THR HB   H   16.064  -4.651   0.431 1.00 . A A . 716 THR HB   1 1 
        4  5265 1 1 60 THR HG1  H   15.533  -5.121  -2.326 1.00 . A A . 716 THR HG1  1 1 
        4  5266 1 1 60 THR HG21 H   14.176  -6.121  -0.197 1.00 . A A . 716 THR HG21 1 1 
        4  5267 1 1 60 THR HG22 H   13.498  -4.808  -1.159 1.00 . A A . 716 THR HG22 1 1 
        4  5268 1 1 60 THR HG23 H   13.633  -4.637   0.592 1.00 . A A . 716 THR HG23 1 1 
        4  5269 1 1 60 THR N    N   16.769  -2.330  -0.804 1.00 . A A . 716 THR N    1 1 
        4  5270 1 1 60 THR O    O   15.115  -2.276   1.648 1.00 . A A . 716 THR O    1 1 
        4  5271 1 1 60 THR OG1  O   16.150  -5.070  -1.583 1.00 . A A . 716 THR OG1  1 1 
        4  5272 1 1 61 TYR C    C   11.269  -1.771   1.333 1.00 . A A . 717 TYR C    1 1 
        4  5273 1 1 61 TYR CA   C   12.636  -1.068   1.214 1.00 . A A . 717 TYR CA   1 1 
        4  5274 1 1 61 TYR CB   C   12.424   0.409   0.837 1.00 . A A . 717 TYR CB   1 1 
        4  5275 1 1 61 TYR CD1  C   14.258   1.122  -0.759 1.00 . A A . 717 TYR CD1  1 1 
        4  5276 1 1 61 TYR CD2  C   14.358   1.923   1.483 1.00 . A A . 717 TYR CD2  1 1 
        4  5277 1 1 61 TYR CE1  C   15.420   1.807  -1.062 1.00 . A A . 717 TYR CE1  1 1 
        4  5278 1 1 61 TYR CE2  C   15.523   2.615   1.186 1.00 . A A . 717 TYR CE2  1 1 
        4  5279 1 1 61 TYR CG   C   13.705   1.166   0.516 1.00 . A A . 717 TYR CG   1 1 
        4  5280 1 1 61 TYR CZ   C   16.049   2.551  -0.090 1.00 . A A . 717 TYR CZ   1 1 
        4  5281 1 1 61 TYR H    H   13.159  -1.769  -0.722 1.00 . A A . 717 TYR H    1 1 
        4  5282 1 1 61 TYR HA   H   13.145  -1.121   2.167 1.00 . A A . 717 TYR HA   1 1 
        4  5283 1 1 61 TYR HB2  H   11.786   0.459  -0.036 1.00 . A A . 717 TYR HB2  1 1 
        4  5284 1 1 61 TYR HB3  H   11.934   0.915   1.658 1.00 . A A . 717 TYR HB3  1 1 
        4  5285 1 1 61 TYR HD1  H   13.765   0.538  -1.524 1.00 . A A . 717 TYR HD1  1 1 
        4  5286 1 1 61 TYR HD2  H   13.946   1.971   2.482 1.00 . A A . 717 TYR HD2  1 1 
        4  5287 1 1 61 TYR HE1  H   15.830   1.755  -2.060 1.00 . A A . 717 TYR HE1  1 1 
        4  5288 1 1 61 TYR HE2  H   16.013   3.196   1.952 1.00 . A A . 717 TYR HE2  1 1 
        4  5289 1 1 61 TYR HH   H   17.137   3.604  -1.285 1.00 . A A . 717 TYR HH   1 1 
        4  5290 1 1 61 TYR N    N   13.477  -1.731   0.206 1.00 . A A . 717 TYR N    1 1 
        4  5291 1 1 61 TYR O    O   10.697  -2.198   0.331 1.00 . A A . 717 TYR O    1 1 
        4  5292 1 1 61 TYR OH   O   17.209   3.233  -0.395 1.00 . A A . 717 TYR OH   1 1 
        4  5293 1 1 62 VAL C    C    8.397  -1.497   3.281 1.00 . A A . 718 VAL C    1 1 
        4  5294 1 1 62 VAL CA   C    9.434  -2.519   2.780 1.00 . A A . 718 VAL CA   1 1 
        4  5295 1 1 62 VAL CB   C    9.535  -3.686   3.798 1.00 . A A . 718 VAL CB   1 1 
        4  5296 1 1 62 VAL CG1  C    8.164  -4.328   4.040 1.00 . A A . 718 VAL CG1  1 1 
        4  5297 1 1 62 VAL CG2  C   10.548  -4.727   3.322 1.00 . A A . 718 VAL CG2  1 1 
        4  5298 1 1 62 VAL H    H   11.244  -1.539   3.322 1.00 . A A . 718 VAL H    1 1 
        4  5299 1 1 62 VAL HA   H    9.091  -2.924   1.837 1.00 . A A . 718 VAL HA   1 1 
        4  5300 1 1 62 VAL HB   H    9.886  -3.285   4.741 1.00 . A A . 718 VAL HB   1 1 
        4  5301 1 1 62 VAL HG11 H    8.262  -5.136   4.749 1.00 . A A . 718 VAL HG11 1 1 
        4  5302 1 1 62 VAL HG12 H    7.773  -4.713   3.108 1.00 . A A . 718 VAL HG12 1 1 
        4  5303 1 1 62 VAL HG13 H    7.483  -3.586   4.433 1.00 . A A . 718 VAL HG13 1 1 
        4  5304 1 1 62 VAL HG21 H   11.515  -4.259   3.201 1.00 . A A . 718 VAL HG21 1 1 
        4  5305 1 1 62 VAL HG22 H   10.230  -5.140   2.375 1.00 . A A . 718 VAL HG22 1 1 
        4  5306 1 1 62 VAL HG23 H   10.623  -5.519   4.052 1.00 . A A . 718 VAL HG23 1 1 
        4  5307 1 1 62 VAL N    N   10.745  -1.887   2.554 1.00 . A A . 718 VAL N    1 1 
        4  5308 1 1 62 VAL O    O    8.661  -0.731   4.210 1.00 . A A . 718 VAL O    1 1 
        4  5309 1 1 63 LEU C    C    4.900  -1.333   3.550 1.00 . A A . 719 LEU C    1 1 
        4  5310 1 1 63 LEU CA   C    6.132  -0.570   3.026 1.00 . A A . 719 LEU CA   1 1 
        4  5311 1 1 63 LEU CB   C    5.725   0.275   1.808 1.00 . A A . 719 LEU CB   1 1 
        4  5312 1 1 63 LEU CD1  C    6.333   1.863  -0.055 1.00 . A A . 719 LEU CD1  1 1 
        4  5313 1 1 63 LEU CD2  C    7.555   1.978   2.137 1.00 . A A . 719 LEU CD2  1 1 
        4  5314 1 1 63 LEU CG   C    6.862   1.062   1.134 1.00 . A A . 719 LEU CG   1 1 
        4  5315 1 1 63 LEU H    H    7.073  -2.123   1.923 1.00 . A A . 719 LEU H    1 1 
        4  5316 1 1 63 LEU HA   H    6.495   0.088   3.806 1.00 . A A . 719 LEU HA   1 1 
        4  5317 1 1 63 LEU HB2  H    5.288  -0.384   1.070 1.00 . A A . 719 LEU HB2  1 1 
        4  5318 1 1 63 LEU HB3  H    4.969   0.982   2.124 1.00 . A A . 719 LEU HB3  1 1 
        4  5319 1 1 63 LEU HD11 H    7.149   2.392  -0.528 1.00 . A A . 719 LEU HD11 1 1 
        4  5320 1 1 63 LEU HD12 H    5.595   2.576   0.287 1.00 . A A . 719 LEU HD12 1 1 
        4  5321 1 1 63 LEU HD13 H    5.880   1.192  -0.770 1.00 . A A . 719 LEU HD13 1 1 
        4  5322 1 1 63 LEU HD21 H    7.980   1.385   2.934 1.00 . A A . 719 LEU HD21 1 1 
        4  5323 1 1 63 LEU HD22 H    6.836   2.674   2.551 1.00 . A A . 719 LEU HD22 1 1 
        4  5324 1 1 63 LEU HD23 H    8.342   2.528   1.641 1.00 . A A . 719 LEU HD23 1 1 
        4  5325 1 1 63 LEU HG   H    7.598   0.364   0.756 1.00 . A A . 719 LEU HG   1 1 
        4  5326 1 1 63 LEU N    N    7.219  -1.492   2.657 1.00 . A A . 719 LEU N    1 1 
        4  5327 1 1 63 LEU O    O    4.554  -2.396   3.037 1.00 . A A . 719 LEU O    1 1 
        4  5328 1 1 64 THR C    C    1.788  -0.495   4.887 1.00 . A A . 720 THR C    1 1 
        4  5329 1 1 64 THR CA   C    3.016  -1.384   5.123 1.00 . A A . 720 THR CA   1 1 
        4  5330 1 1 64 THR CB   C    3.162  -1.652   6.643 1.00 . A A . 720 THR CB   1 1 
        4  5331 1 1 64 THR CG2  C    1.886  -2.254   7.231 1.00 . A A . 720 THR CG2  1 1 
        4  5332 1 1 64 THR H    H    4.568   0.062   4.941 1.00 . A A . 720 THR H    1 1 
        4  5333 1 1 64 THR HA   H    2.855  -2.334   4.628 1.00 . A A . 720 THR HA   1 1 
        4  5334 1 1 64 THR HB   H    3.360  -0.712   7.140 1.00 . A A . 720 THR HB   1 1 
        4  5335 1 1 64 THR HG1  H    4.737  -2.258   7.674 1.00 . A A . 720 THR HG1  1 1 
        4  5336 1 1 64 THR HG21 H    1.656  -3.180   6.724 1.00 . A A . 720 THR HG21 1 1 
        4  5337 1 1 64 THR HG22 H    1.067  -1.561   7.100 1.00 . A A . 720 THR HG22 1 1 
        4  5338 1 1 64 THR HG23 H    2.031  -2.446   8.283 1.00 . A A . 720 THR HG23 1 1 
        4  5339 1 1 64 THR N    N    4.235  -0.776   4.560 1.00 . A A . 720 THR N    1 1 
        4  5340 1 1 64 THR O    O    1.846   0.723   5.063 1.00 . A A . 720 THR O    1 1 
        4  5341 1 1 64 THR OG1  O    4.261  -2.543   6.885 1.00 . A A . 720 THR OG1  1 1 
        4  5342 1 1 65 TYR C    C   -1.729  -0.980   5.043 1.00 . A A . 721 TYR C    1 1 
        4  5343 1 1 65 TYR CA   C   -0.575  -0.391   4.220 1.00 . A A . 721 TYR CA   1 1 
        4  5344 1 1 65 TYR CB   C   -0.925  -0.461   2.728 1.00 . A A . 721 TYR CB   1 1 
        4  5345 1 1 65 TYR CD1  C    0.446   1.278   1.494 1.00 . A A . 721 TYR CD1  1 1 
        4  5346 1 1 65 TYR CD2  C    1.070  -1.015   1.281 1.00 . A A . 721 TYR CD2  1 1 
        4  5347 1 1 65 TYR CE1  C    1.490   1.642   0.666 1.00 . A A . 721 TYR CE1  1 1 
        4  5348 1 1 65 TYR CE2  C    2.116  -0.659   0.455 1.00 . A A . 721 TYR CE2  1 1 
        4  5349 1 1 65 TYR CG   C    0.216  -0.058   1.815 1.00 . A A . 721 TYR CG   1 1 
        4  5350 1 1 65 TYR CZ   C    2.323   0.670   0.151 1.00 . A A . 721 TYR CZ   1 1 
        4  5351 1 1 65 TYR H    H    0.703  -2.085   4.347 1.00 . A A . 721 TYR H    1 1 
        4  5352 1 1 65 TYR HA   H   -0.434   0.644   4.502 1.00 . A A . 721 TYR HA   1 1 
        4  5353 1 1 65 TYR HB2  H   -1.208  -1.474   2.476 1.00 . A A . 721 TYR HB2  1 1 
        4  5354 1 1 65 TYR HB3  H   -1.759   0.198   2.530 1.00 . A A . 721 TYR HB3  1 1 
        4  5355 1 1 65 TYR HD1  H   -0.209   2.039   1.898 1.00 . A A . 721 TYR HD1  1 1 
        4  5356 1 1 65 TYR HD2  H    0.906  -2.058   1.520 1.00 . A A . 721 TYR HD2  1 1 
        4  5357 1 1 65 TYR HE1  H    1.652   2.683   0.425 1.00 . A A . 721 TYR HE1  1 1 
        4  5358 1 1 65 TYR HE2  H    2.767  -1.421   0.051 1.00 . A A . 721 TYR HE2  1 1 
        4  5359 1 1 65 TYR HH   H    3.835   1.773  -0.279 1.00 . A A . 721 TYR HH   1 1 
        4  5360 1 1 65 TYR N    N    0.680  -1.113   4.482 1.00 . A A . 721 TYR N    1 1 
        4  5361 1 1 65 TYR O    O   -1.895  -2.199   5.107 1.00 . A A . 721 TYR O    1 1 
        4  5362 1 1 65 TYR OH   O    3.365   1.030  -0.671 1.00 . A A . 721 TYR OH   1 1 
        4  5363 1 1 66 THR C    C   -4.911   0.281   6.290 1.00 . A A . 722 THR C    1 1 
        4  5364 1 1 66 THR CA   C   -3.643  -0.559   6.517 1.00 . A A . 722 THR CA   1 1 
        4  5365 1 1 66 THR CB   C   -3.254  -0.489   8.017 1.00 . A A . 722 THR CB   1 1 
        4  5366 1 1 66 THR CG2  C   -4.415  -0.908   8.914 1.00 . A A . 722 THR CG2  1 1 
        4  5367 1 1 66 THR H    H   -2.369   0.846   5.544 1.00 . A A . 722 THR H    1 1 
        4  5368 1 1 66 THR HA   H   -3.862  -1.592   6.273 1.00 . A A . 722 THR HA   1 1 
        4  5369 1 1 66 THR HB   H   -2.985   0.533   8.256 1.00 . A A . 722 THR HB   1 1 
        4  5370 1 1 66 THR HG1  H   -2.249  -1.803   9.112 1.00 . A A . 722 THR HG1  1 1 
        4  5371 1 1 66 THR HG21 H   -4.104  -0.870   9.947 1.00 . A A . 722 THR HG21 1 1 
        4  5372 1 1 66 THR HG22 H   -4.717  -1.916   8.667 1.00 . A A . 722 THR HG22 1 1 
        4  5373 1 1 66 THR HG23 H   -5.248  -0.236   8.764 1.00 . A A . 722 THR HG23 1 1 
        4  5374 1 1 66 THR N    N   -2.531  -0.115   5.658 1.00 . A A . 722 THR N    1 1 
        4  5375 1 1 66 THR O    O   -4.847   1.506   6.233 1.00 . A A . 722 THR O    1 1 
        4  5376 1 1 66 THR OG1  O   -2.120  -1.336   8.277 1.00 . A A . 722 THR OG1  1 1 
        4  5377 1 1 67 VAL C    C   -8.433  -0.232   6.933 1.00 . A A . 723 VAL C    1 1 
        4  5378 1 1 67 VAL CA   C   -7.349   0.298   5.969 1.00 . A A . 723 VAL CA   1 1 
        4  5379 1 1 67 VAL CB   C   -7.827   0.147   4.499 1.00 . A A . 723 VAL CB   1 1 
        4  5380 1 1 67 VAL CG1  C   -8.015  -1.324   4.127 1.00 . A A . 723 VAL CG1  1 1 
        4  5381 1 1 67 VAL CG2  C   -9.107   0.946   4.251 1.00 . A A . 723 VAL CG2  1 1 
        4  5382 1 1 67 VAL H    H   -6.050  -1.367   6.240 1.00 . A A . 723 VAL H    1 1 
        4  5383 1 1 67 VAL HA   H   -7.202   1.354   6.166 1.00 . A A . 723 VAL HA   1 1 
        4  5384 1 1 67 VAL HB   H   -7.055   0.550   3.859 1.00 . A A . 723 VAL HB   1 1 
        4  5385 1 1 67 VAL HG11 H   -8.333  -1.400   3.096 1.00 . A A . 723 VAL HG11 1 1 
        4  5386 1 1 67 VAL HG12 H   -8.765  -1.768   4.767 1.00 . A A . 723 VAL HG12 1 1 
        4  5387 1 1 67 VAL HG13 H   -7.080  -1.849   4.253 1.00 . A A . 723 VAL HG13 1 1 
        4  5388 1 1 67 VAL HG21 H   -9.890   0.592   4.908 1.00 . A A . 723 VAL HG21 1 1 
        4  5389 1 1 67 VAL HG22 H   -9.418   0.824   3.223 1.00 . A A . 723 VAL HG22 1 1 
        4  5390 1 1 67 VAL HG23 H   -8.921   1.992   4.446 1.00 . A A . 723 VAL HG23 1 1 
        4  5391 1 1 67 VAL N    N   -6.063  -0.386   6.178 1.00 . A A . 723 VAL N    1 1 
        4  5392 1 1 67 VAL O    O   -8.443  -1.413   7.286 1.00 . A A . 723 VAL O    1 1 
        4  5393 1 1 68 THR C    C  -11.807   0.455   7.811 1.00 . A A . 724 THR C    1 1 
        4  5394 1 1 68 THR CA   C  -10.373   0.289   8.353 1.00 . A A . 724 THR CA   1 1 
        4  5395 1 1 68 THR CB   C  -10.224   1.135   9.645 1.00 . A A . 724 THR CB   1 1 
        4  5396 1 1 68 THR CG2  C  -11.239   0.717  10.708 1.00 . A A . 724 THR CG2  1 1 
        4  5397 1 1 68 THR H    H   -9.318   1.566   7.008 1.00 . A A . 724 THR H    1 1 
        4  5398 1 1 68 THR HA   H  -10.223  -0.750   8.618 1.00 . A A . 724 THR HA   1 1 
        4  5399 1 1 68 THR HB   H  -10.393   2.175   9.396 1.00 . A A . 724 THR HB   1 1 
        4  5400 1 1 68 THR HG1  H   -8.334   0.577   9.522 1.00 . A A . 724 THR HG1  1 1 
        4  5401 1 1 68 THR HG21 H  -11.074  -0.318  10.977 1.00 . A A . 724 THR HG21 1 1 
        4  5402 1 1 68 THR HG22 H  -12.240   0.831  10.318 1.00 . A A . 724 THR HG22 1 1 
        4  5403 1 1 68 THR HG23 H  -11.121   1.339  11.583 1.00 . A A . 724 THR HG23 1 1 
        4  5404 1 1 68 THR N    N   -9.342   0.652   7.360 1.00 . A A . 724 THR N    1 1 
        4  5405 1 1 68 THR O    O  -12.161   1.496   7.252 1.00 . A A . 724 THR O    1 1 
        4  5406 1 1 68 THR OG1  O   -8.897   0.995  10.178 1.00 . A A . 724 THR OG1  1 1 
        4  5407 1 1 69 ASP C    C  -14.850   0.223   8.698 1.00 . A A . 725 ASP C    1 1 
        4  5408 1 1 69 ASP CA   C  -14.051  -0.557   7.635 1.00 . A A . 725 ASP CA   1 1 
        4  5409 1 1 69 ASP CB   C  -14.572  -2.001   7.538 1.00 . A A . 725 ASP CB   1 1 
        4  5410 1 1 69 ASP CG   C  -16.006  -2.110   7.039 1.00 . A A . 725 ASP CG   1 1 
        4  5411 1 1 69 ASP H    H  -12.248  -1.414   8.357 1.00 . A A . 725 ASP H    1 1 
        4  5412 1 1 69 ASP HA   H  -14.160  -0.068   6.677 1.00 . A A . 725 ASP HA   1 1 
        4  5413 1 1 69 ASP HB2  H  -13.936  -2.552   6.865 1.00 . A A . 725 ASP HB2  1 1 
        4  5414 1 1 69 ASP HB3  H  -14.517  -2.457   8.518 1.00 . A A . 725 ASP HB3  1 1 
        4  5415 1 1 69 ASP N    N  -12.622  -0.588   7.984 1.00 . A A . 725 ASP N    1 1 
        4  5416 1 1 69 ASP O    O  -14.431   0.311   9.850 1.00 . A A . 725 ASP O    1 1 
        4  5417 1 1 69 ASP OD1  O  -16.937  -1.818   7.813 1.00 . A A . 725 ASP OD1  1 1 
        4  5418 1 1 69 ASP OD2  O  -16.208  -2.521   5.884 1.00 . A A . 725 ASP OD2  1 1 
        4  5419 1 1 70 SER C    C  -17.208   0.728  10.514 1.00 . A A . 726 SER C    1 1 
        4  5420 1 1 70 SER CA   C  -16.860   1.530   9.244 1.00 . A A . 726 SER CA   1 1 
        4  5421 1 1 70 SER CB   C  -18.156   1.968   8.548 1.00 . A A . 726 SER CB   1 1 
        4  5422 1 1 70 SER H    H  -16.298   0.656   7.381 1.00 . A A . 726 SER H    1 1 
        4  5423 1 1 70 SER HA   H  -16.310   2.415   9.535 1.00 . A A . 726 SER HA   1 1 
        4  5424 1 1 70 SER HB2  H  -17.915   2.605   7.708 1.00 . A A . 726 SER HB2  1 1 
        4  5425 1 1 70 SER HB3  H  -18.685   1.094   8.192 1.00 . A A . 726 SER HB3  1 1 
        4  5426 1 1 70 SER HG   H  -19.352   3.463   8.987 1.00 . A A . 726 SER HG   1 1 
        4  5427 1 1 70 SER N    N  -16.007   0.766   8.312 1.00 . A A . 726 SER N    1 1 
        4  5428 1 1 70 SER O    O  -17.336   1.295  11.601 1.00 . A A . 726 SER O    1 1 
        4  5429 1 1 70 SER OG   O  -19.001   2.685   9.436 1.00 . A A . 726 SER OG   1 1 
        4  5430 1 1 71 LYS C    C  -16.468  -1.709  12.427 1.00 . A A . 727 LYS C    1 1 
        4  5431 1 1 71 LYS CA   C  -17.683  -1.462  11.516 1.00 . A A . 727 LYS CA   1 1 
        4  5432 1 1 71 LYS CB   C  -18.217  -2.816  11.021 1.00 . A A . 727 LYS CB   1 1 
        4  5433 1 1 71 LYS CD   C  -20.641  -2.082  10.948 1.00 . A A . 727 LYS CD   1 1 
        4  5434 1 1 71 LYS CE   C  -21.954  -2.185  10.178 1.00 . A A . 727 LYS CE   1 1 
        4  5435 1 1 71 LYS CG   C  -19.490  -2.730  10.184 1.00 . A A . 727 LYS CG   1 1 
        4  5436 1 1 71 LYS H    H  -17.252  -0.987   9.484 1.00 . A A . 727 LYS H    1 1 
        4  5437 1 1 71 LYS HA   H  -18.456  -0.976  12.092 1.00 . A A . 727 LYS HA   1 1 
        4  5438 1 1 71 LYS HB2  H  -17.453  -3.291  10.420 1.00 . A A . 727 LYS HB2  1 1 
        4  5439 1 1 71 LYS HB3  H  -18.420  -3.442  11.880 1.00 . A A . 727 LYS HB3  1 1 
        4  5440 1 1 71 LYS HD2  H  -20.756  -2.578  11.902 1.00 . A A . 727 LYS HD2  1 1 
        4  5441 1 1 71 LYS HD3  H  -20.410  -1.037  11.112 1.00 . A A . 727 LYS HD3  1 1 
        4  5442 1 1 71 LYS HE2  H  -22.216  -3.228  10.077 1.00 . A A . 727 LYS HE2  1 1 
        4  5443 1 1 71 LYS HE3  H  -22.726  -1.677  10.737 1.00 . A A . 727 LYS HE3  1 1 
        4  5444 1 1 71 LYS HG2  H  -19.285  -2.145   9.300 1.00 . A A . 727 LYS HG2  1 1 
        4  5445 1 1 71 LYS HG3  H  -19.780  -3.731   9.893 1.00 . A A . 727 LYS HG3  1 1 
        4  5446 1 1 71 LYS HZ1  H  -21.720  -0.554   8.893 1.00 . A A . 727 LYS HZ1  1 1 
        4  5447 1 1 71 LYS HZ2  H  -22.745  -1.753   8.294 1.00 . A A . 727 LYS HZ2  1 1 
        4  5448 1 1 71 LYS HZ3  H  -21.070  -1.992   8.291 1.00 . A A . 727 LYS HZ3  1 1 
        4  5449 1 1 71 LYS N    N  -17.356  -0.591  10.375 1.00 . A A . 727 LYS N    1 1 
        4  5450 1 1 71 LYS NZ   N  -21.864  -1.579   8.822 1.00 . A A . 727 LYS NZ   1 1 
        4  5451 1 1 71 LYS O    O  -16.619  -2.165  13.562 1.00 . A A . 727 LYS O    1 1 
        4  5452 1 1 72 GLY C    C  -13.180  -2.760  12.130 1.00 . A A . 728 GLY C    1 1 
        4  5453 1 1 72 GLY CA   C  -14.050  -1.639  12.705 1.00 . A A . 728 GLY CA   1 1 
        4  5454 1 1 72 GLY H    H  -15.215  -0.961  11.060 1.00 . A A . 728 GLY H    1 1 
        4  5455 1 1 72 GLY HA2  H  -13.468  -0.730  12.727 1.00 . A A . 728 GLY HA2  1 1 
        4  5456 1 1 72 GLY HA3  H  -14.321  -1.896  13.721 1.00 . A A . 728 GLY HA3  1 1 
        4  5457 1 1 72 GLY N    N  -15.272  -1.392  11.937 1.00 . A A . 728 GLY N    1 1 
        4  5458 1 1 72 GLY O    O  -12.174  -3.138  12.733 1.00 . A A . 728 GLY O    1 1 
        4  5459 1 1 73 HIS C    C  -11.453  -3.749   9.731 1.00 . A A . 729 HIS C    1 1 
        4  5460 1 1 73 HIS CA   C  -12.751  -4.342  10.310 1.00 . A A . 729 HIS CA   1 1 
        4  5461 1 1 73 HIS CB   C  -13.540  -5.047   9.193 1.00 . A A . 729 HIS CB   1 1 
        4  5462 1 1 73 HIS CD2  C  -14.510  -7.026  10.569 1.00 . A A . 729 HIS CD2  1 1 
        4  5463 1 1 73 HIS CE1  C  -16.557  -6.986   9.792 1.00 . A A . 729 HIS CE1  1 1 
        4  5464 1 1 73 HIS CG   C  -14.587  -6.006   9.680 1.00 . A A . 729 HIS CG   1 1 
        4  5465 1 1 73 HIS H    H  -14.406  -3.020  10.565 1.00 . A A . 729 HIS H    1 1 
        4  5466 1 1 73 HIS HA   H  -12.486  -5.077  11.061 1.00 . A A . 729 HIS HA   1 1 
        4  5467 1 1 73 HIS HB2  H  -14.033  -4.303   8.586 1.00 . A A . 729 HIS HB2  1 1 
        4  5468 1 1 73 HIS HB3  H  -12.850  -5.603   8.574 1.00 . A A . 729 HIS HB3  1 1 
        4  5469 1 1 73 HIS HD1  H  -16.259  -5.398   8.542 1.00 . A A . 729 HIS HD1  1 1 
        4  5470 1 1 73 HIS HD2  H  -13.634  -7.323  11.129 1.00 . A A . 729 HIS HD2  1 1 
        4  5471 1 1 73 HIS HE1  H  -17.594  -7.233   9.613 1.00 . A A . 729 HIS HE1  1 1 
        4  5472 1 1 73 HIS HE2  H  -16.032  -8.286  11.276 1.00 . A A . 729 HIS HE2  1 1 
        4  5473 1 1 73 HIS N    N  -13.564  -3.308  10.973 1.00 . A A . 729 HIS N    1 1 
        4  5474 1 1 73 HIS ND1  N  -15.884  -6.012   9.213 1.00 . A A . 729 HIS ND1  1 1 
        4  5475 1 1 73 HIS NE2  N  -15.749  -7.616  10.617 1.00 . A A . 729 HIS NE2  1 1 
        4  5476 1 1 73 HIS O    O  -11.468  -3.110   8.678 1.00 . A A . 729 HIS O    1 1 
        4  5477 1 1 74 GLU C    C   -8.229  -4.551   9.261 1.00 . A A . 730 GLU C    1 1 
        4  5478 1 1 74 GLU CA   C   -9.035  -3.460   9.985 1.00 . A A . 730 GLU CA   1 1 
        4  5479 1 1 74 GLU CB   C   -8.259  -2.927  11.203 1.00 . A A . 730 GLU CB   1 1 
        4  5480 1 1 74 GLU CD   C   -5.762  -3.475  11.214 1.00 . A A . 730 GLU CD   1 1 
        4  5481 1 1 74 GLU CG   C   -6.838  -2.437  10.903 1.00 . A A . 730 GLU CG   1 1 
        4  5482 1 1 74 GLU H    H  -10.393  -4.464  11.265 1.00 . A A . 730 GLU H    1 1 
        4  5483 1 1 74 GLU HA   H   -9.206  -2.643   9.297 1.00 . A A . 730 GLU HA   1 1 
        4  5484 1 1 74 GLU HB2  H   -8.813  -2.102  11.628 1.00 . A A . 730 GLU HB2  1 1 
        4  5485 1 1 74 GLU HB3  H   -8.196  -3.716  11.941 1.00 . A A . 730 GLU HB3  1 1 
        4  5486 1 1 74 GLU HG2  H   -6.773  -2.176   9.857 1.00 . A A . 730 GLU HG2  1 1 
        4  5487 1 1 74 GLU HG3  H   -6.643  -1.555  11.500 1.00 . A A . 730 GLU HG3  1 1 
        4  5488 1 1 74 GLU N    N  -10.341  -3.960  10.426 1.00 . A A . 730 GLU N    1 1 
        4  5489 1 1 74 GLU O    O   -8.017  -5.643   9.794 1.00 . A A . 730 GLU O    1 1 
        4  5490 1 1 74 GLU OE1  O   -5.497  -3.713  12.412 1.00 . A A . 730 GLU OE1  1 1 
        4  5491 1 1 74 GLU OE2  O   -5.171  -4.047  10.274 1.00 . A A . 730 GLU OE2  1 1 
        4  5492 1 1 75 VAL C    C   -5.672  -4.484   6.776 1.00 . A A . 731 VAL C    1 1 
        4  5493 1 1 75 VAL CA   C   -6.956  -5.175   7.259 1.00 . A A . 731 VAL CA   1 1 
        4  5494 1 1 75 VAL CB   C   -7.712  -5.760   6.038 1.00 . A A . 731 VAL CB   1 1 
        4  5495 1 1 75 VAL CG1  C   -8.905  -6.597   6.487 1.00 . A A . 731 VAL CG1  1 1 
        4  5496 1 1 75 VAL CG2  C   -8.155  -4.653   5.088 1.00 . A A . 731 VAL CG2  1 1 
        4  5497 1 1 75 VAL H    H   -8.031  -3.386   7.649 1.00 . A A . 731 VAL H    1 1 
        4  5498 1 1 75 VAL HA   H   -6.677  -5.999   7.906 1.00 . A A . 731 VAL HA   1 1 
        4  5499 1 1 75 VAL HB   H   -7.034  -6.412   5.500 1.00 . A A . 731 VAL HB   1 1 
        4  5500 1 1 75 VAL HG11 H   -9.415  -6.995   5.620 1.00 . A A . 731 VAL HG11 1 1 
        4  5501 1 1 75 VAL HG12 H   -9.589  -5.980   7.053 1.00 . A A . 731 VAL HG12 1 1 
        4  5502 1 1 75 VAL HG13 H   -8.562  -7.414   7.105 1.00 . A A . 731 VAL HG13 1 1 
        4  5503 1 1 75 VAL HG21 H   -8.665  -5.087   4.239 1.00 . A A . 731 VAL HG21 1 1 
        4  5504 1 1 75 VAL HG22 H   -7.290  -4.103   4.743 1.00 . A A . 731 VAL HG22 1 1 
        4  5505 1 1 75 VAL HG23 H   -8.826  -3.981   5.603 1.00 . A A . 731 VAL HG23 1 1 
        4  5506 1 1 75 VAL N    N   -7.792  -4.253   8.037 1.00 . A A . 731 VAL N    1 1 
        4  5507 1 1 75 VAL O    O   -5.639  -3.262   6.598 1.00 . A A . 731 VAL O    1 1 
        4  5508 1 1 76 THR C    C   -2.548  -5.603   5.201 1.00 . A A . 732 THR C    1 1 
        4  5509 1 1 76 THR CA   C   -3.306  -4.727   6.210 1.00 . A A . 732 THR CA   1 1 
        4  5510 1 1 76 THR CB   C   -2.438  -4.558   7.482 1.00 . A A . 732 THR CB   1 1 
        4  5511 1 1 76 THR CG2  C   -2.207  -5.900   8.177 1.00 . A A . 732 THR CG2  1 1 
        4  5512 1 1 76 THR H    H   -4.741  -6.247   6.595 1.00 . A A . 732 THR H    1 1 
        4  5513 1 1 76 THR HA   H   -3.451  -3.746   5.774 1.00 . A A . 732 THR HA   1 1 
        4  5514 1 1 76 THR HB   H   -2.960  -3.903   8.168 1.00 . A A . 732 THR HB   1 1 
        4  5515 1 1 76 THR HG1  H   -1.311  -3.054   6.850 1.00 . A A . 732 THR HG1  1 1 
        4  5516 1 1 76 THR HG21 H   -1.648  -5.743   9.089 1.00 . A A . 732 THR HG21 1 1 
        4  5517 1 1 76 THR HG22 H   -1.651  -6.556   7.523 1.00 . A A . 732 THR HG22 1 1 
        4  5518 1 1 76 THR HG23 H   -3.160  -6.352   8.416 1.00 . A A . 732 THR HG23 1 1 
        4  5519 1 1 76 THR N    N   -4.625  -5.273   6.545 1.00 . A A . 732 THR N    1 1 
        4  5520 1 1 76 THR O    O   -2.691  -6.828   5.179 1.00 . A A . 732 THR O    1 1 
        4  5521 1 1 76 THR OG1  O   -1.169  -3.961   7.156 1.00 . A A . 732 THR OG1  1 1 
        4  5522 1 1 77 ALA C    C    0.410  -4.888   3.155 1.00 . A A . 733 ALA C    1 1 
        4  5523 1 1 77 ALA CA   C   -0.901  -5.654   3.384 1.00 . A A . 733 ALA CA   1 1 
        4  5524 1 1 77 ALA CB   C   -1.659  -5.833   2.073 1.00 . A A . 733 ALA CB   1 1 
        4  5525 1 1 77 ALA H    H   -1.701  -3.979   4.409 1.00 . A A . 733 ALA H    1 1 
        4  5526 1 1 77 ALA HA   H   -0.669  -6.635   3.779 1.00 . A A . 733 ALA HA   1 1 
        4  5527 1 1 77 ALA HB1  H   -1.898  -4.864   1.659 1.00 . A A . 733 ALA HB1  1 1 
        4  5528 1 1 77 ALA HB2  H   -2.574  -6.380   2.256 1.00 . A A . 733 ALA HB2  1 1 
        4  5529 1 1 77 ALA HB3  H   -1.046  -6.382   1.375 1.00 . A A . 733 ALA HB3  1 1 
        4  5530 1 1 77 ALA N    N   -1.740  -4.958   4.365 1.00 . A A . 733 ALA N    1 1 
        4  5531 1 1 77 ALA O    O    0.464  -3.672   3.343 1.00 . A A . 733 ALA O    1 1 
        4  5532 1 1 78 LYS C    C    3.396  -5.138   1.221 1.00 . A A . 734 LYS C    1 1 
        4  5533 1 1 78 LYS CA   C    2.799  -4.988   2.635 1.00 . A A . 734 LYS CA   1 1 
        4  5534 1 1 78 LYS CB   C    3.734  -5.604   3.687 1.00 . A A . 734 LYS CB   1 1 
        4  5535 1 1 78 LYS CD   C    4.129  -6.080   6.151 1.00 . A A . 734 LYS CD   1 1 
        4  5536 1 1 78 LYS CE   C    3.591  -5.874   7.564 1.00 . A A . 734 LYS CE   1 1 
        4  5537 1 1 78 LYS CG   C    3.233  -5.405   5.117 1.00 . A A . 734 LYS CG   1 1 
        4  5538 1 1 78 LYS H    H    1.345  -6.543   2.527 1.00 . A A . 734 LYS H    1 1 
        4  5539 1 1 78 LYS HA   H    2.698  -3.931   2.847 1.00 . A A . 734 LYS HA   1 1 
        4  5540 1 1 78 LYS HB2  H    3.829  -6.665   3.497 1.00 . A A . 734 LYS HB2  1 1 
        4  5541 1 1 78 LYS HB3  H    4.708  -5.143   3.603 1.00 . A A . 734 LYS HB3  1 1 
        4  5542 1 1 78 LYS HD2  H    4.174  -7.140   5.940 1.00 . A A . 734 LYS HD2  1 1 
        4  5543 1 1 78 LYS HD3  H    5.120  -5.654   6.084 1.00 . A A . 734 LYS HD3  1 1 
        4  5544 1 1 78 LYS HE2  H    3.568  -4.817   7.777 1.00 . A A . 734 LYS HE2  1 1 
        4  5545 1 1 78 LYS HE3  H    2.587  -6.272   7.615 1.00 . A A . 734 LYS HE3  1 1 
        4  5546 1 1 78 LYS HG2  H    3.198  -4.347   5.328 1.00 . A A . 734 LYS HG2  1 1 
        4  5547 1 1 78 LYS HG3  H    2.235  -5.819   5.195 1.00 . A A . 734 LYS HG3  1 1 
        4  5548 1 1 78 LYS HZ1  H    4.472  -7.569   8.402 1.00 . A A . 734 LYS HZ1  1 1 
        4  5549 1 1 78 LYS HZ2  H    4.021  -6.400   9.536 1.00 . A A . 734 LYS HZ2  1 1 
        4  5550 1 1 78 LYS HZ3  H    5.390  -6.161   8.578 1.00 . A A . 734 LYS HZ3  1 1 
        4  5551 1 1 78 LYS N    N    1.463  -5.595   2.753 1.00 . A A . 734 LYS N    1 1 
        4  5552 1 1 78 LYS NZ   N    4.427  -6.549   8.590 1.00 . A A . 734 LYS NZ   1 1 
        4  5553 1 1 78 LYS O    O    3.093  -6.090   0.498 1.00 . A A . 734 LYS O    1 1 
        4  5554 1 1 79 GLN C    C    6.411  -3.971  -0.368 1.00 . A A . 735 GLN C    1 1 
        4  5555 1 1 79 GLN CA   C    4.888  -4.149  -0.480 1.00 . A A . 735 GLN CA   1 1 
        4  5556 1 1 79 GLN CB   C    4.297  -2.998  -1.315 1.00 . A A . 735 GLN CB   1 1 
        4  5557 1 1 79 GLN CD   C    4.442  -1.600  -3.448 1.00 . A A . 735 GLN CD   1 1 
        4  5558 1 1 79 GLN CG   C    5.022  -2.755  -2.639 1.00 . A A . 735 GLN CG   1 1 
        4  5559 1 1 79 GLN H    H    4.483  -3.483   1.495 1.00 . A A . 735 GLN H    1 1 
        4  5560 1 1 79 GLN HA   H    4.681  -5.086  -0.978 1.00 . A A . 735 GLN HA   1 1 
        4  5561 1 1 79 GLN HB2  H    3.260  -3.224  -1.535 1.00 . A A . 735 GLN HB2  1 1 
        4  5562 1 1 79 GLN HB3  H    4.338  -2.086  -0.733 1.00 . A A . 735 GLN HB3  1 1 
        4  5563 1 1 79 GLN HE21 H    3.902  -0.635  -1.800 1.00 . A A . 735 GLN HE21 1 1 
        4  5564 1 1 79 GLN HE22 H    3.530   0.142  -3.291 1.00 . A A . 735 GLN HE22 1 1 
        4  5565 1 1 79 GLN HG2  H    6.058  -2.535  -2.431 1.00 . A A . 735 GLN HG2  1 1 
        4  5566 1 1 79 GLN HG3  H    4.963  -3.657  -3.234 1.00 . A A . 735 GLN HG3  1 1 
        4  5567 1 1 79 GLN N    N    4.259  -4.187   0.850 1.00 . A A . 735 GLN N    1 1 
        4  5568 1 1 79 GLN NE2  N    3.906  -0.598  -2.779 1.00 . A A . 735 GLN NE2  1 1 
        4  5569 1 1 79 GLN O    O    6.891  -3.060   0.309 1.00 . A A . 735 GLN O    1 1 
        4  5570 1 1 79 GLN OE1  O    4.486  -1.602  -4.673 1.00 . A A . 735 GLN OE1  1 1 
        4  5571 1 1 80 THR C    C    9.178  -4.105  -2.298 1.00 . A A . 736 THR C    1 1 
        4  5572 1 1 80 THR CA   C    8.635  -4.770  -1.022 1.00 . A A . 736 THR CA   1 1 
        4  5573 1 1 80 THR CB   C    9.266  -6.176  -0.866 1.00 . A A . 736 THR CB   1 1 
        4  5574 1 1 80 THR CG2  C   10.790  -6.108  -0.879 1.00 . A A . 736 THR CG2  1 1 
        4  5575 1 1 80 THR H    H    6.727  -5.554  -1.550 1.00 . A A . 736 THR H    1 1 
        4  5576 1 1 80 THR HA   H    8.931  -4.173  -0.169 1.00 . A A . 736 THR HA   1 1 
        4  5577 1 1 80 THR HB   H    8.939  -6.796  -1.691 1.00 . A A . 736 THR HB   1 1 
        4  5578 1 1 80 THR HG1  H    8.274  -7.542   0.172 1.00 . A A . 736 THR HG1  1 1 
        4  5579 1 1 80 THR HG21 H   11.127  -5.709  -1.825 1.00 . A A . 736 THR HG21 1 1 
        4  5580 1 1 80 THR HG22 H   11.198  -7.100  -0.744 1.00 . A A . 736 THR HG22 1 1 
        4  5581 1 1 80 THR HG23 H   11.131  -5.467  -0.077 1.00 . A A . 736 THR HG23 1 1 
        4  5582 1 1 80 THR N    N    7.166  -4.842  -1.037 1.00 . A A . 736 THR N    1 1 
        4  5583 1 1 80 THR O    O    9.116  -4.680  -3.385 1.00 . A A . 736 THR O    1 1 
        4  5584 1 1 80 THR OG1  O    8.829  -6.774   0.365 1.00 . A A . 736 THR OG1  1 1 
        4  5585 1 1 81 VAL C    C   11.766  -2.110  -3.314 1.00 . A A . 737 VAL C    1 1 
        4  5586 1 1 81 VAL CA   C   10.227  -2.123  -3.295 1.00 . A A . 737 VAL CA   1 1 
        4  5587 1 1 81 VAL CB   C    9.712  -0.660  -3.259 1.00 . A A . 737 VAL CB   1 1 
        4  5588 1 1 81 VAL CG1  C   10.157   0.111  -4.504 1.00 . A A . 737 VAL CG1  1 1 
        4  5589 1 1 81 VAL CG2  C    8.190  -0.625  -3.104 1.00 . A A . 737 VAL CG2  1 1 
        4  5590 1 1 81 VAL H    H    9.757  -2.499  -1.260 1.00 . A A . 737 VAL H    1 1 
        4  5591 1 1 81 VAL HA   H    9.867  -2.585  -4.205 1.00 . A A . 737 VAL HA   1 1 
        4  5592 1 1 81 VAL HB   H   10.147  -0.174  -2.394 1.00 . A A . 737 VAL HB   1 1 
        4  5593 1 1 81 VAL HG11 H    9.755  -0.363  -5.389 1.00 . A A . 737 VAL HG11 1 1 
        4  5594 1 1 81 VAL HG12 H   11.237   0.116  -4.559 1.00 . A A . 737 VAL HG12 1 1 
        4  5595 1 1 81 VAL HG13 H    9.798   1.130  -4.447 1.00 . A A . 737 VAL HG13 1 1 
        4  5596 1 1 81 VAL HG21 H    7.847   0.400  -3.092 1.00 . A A . 737 VAL HG21 1 1 
        4  5597 1 1 81 VAL HG22 H    7.911  -1.104  -2.177 1.00 . A A . 737 VAL HG22 1 1 
        4  5598 1 1 81 VAL HG23 H    7.729  -1.149  -3.929 1.00 . A A . 737 VAL HG23 1 1 
        4  5599 1 1 81 VAL N    N    9.708  -2.891  -2.156 1.00 . A A . 737 VAL N    1 1 
        4  5600 1 1 81 VAL O    O   12.406  -1.602  -2.394 1.00 . A A . 737 VAL O    1 1 
        4  5601 1 1 82 THR C    C   14.305  -1.628  -5.516 1.00 . A A . 738 THR C    1 1 
        4  5602 1 1 82 THR CA   C   13.822  -2.694  -4.520 1.00 . A A . 738 THR CA   1 1 
        4  5603 1 1 82 THR CB   C   14.325  -4.083  -4.992 1.00 . A A . 738 THR CB   1 1 
        4  5604 1 1 82 THR CG2  C   15.842  -4.097  -5.172 1.00 . A A . 738 THR CG2  1 1 
        4  5605 1 1 82 THR H    H   11.797  -3.074  -5.064 1.00 . A A . 738 THR H    1 1 
        4  5606 1 1 82 THR HA   H   14.261  -2.490  -3.550 1.00 . A A . 738 THR HA   1 1 
        4  5607 1 1 82 THR HB   H   13.866  -4.309  -5.944 1.00 . A A . 738 THR HB   1 1 
        4  5608 1 1 82 THR HG1  H   13.522  -5.827  -4.511 1.00 . A A . 738 THR HG1  1 1 
        4  5609 1 1 82 THR HG21 H   16.319  -3.834  -4.239 1.00 . A A . 738 THR HG21 1 1 
        4  5610 1 1 82 THR HG22 H   16.124  -3.383  -5.934 1.00 . A A . 738 THR HG22 1 1 
        4  5611 1 1 82 THR HG23 H   16.159  -5.084  -5.472 1.00 . A A . 738 THR HG23 1 1 
        4  5612 1 1 82 THR N    N   12.356  -2.669  -4.369 1.00 . A A . 738 THR N    1 1 
        4  5613 1 1 82 THR O    O   13.780  -1.515  -6.629 1.00 . A A . 738 THR O    1 1 
        4  5614 1 1 82 THR OG1  O   13.950  -5.098  -4.044 1.00 . A A . 738 THR OG1  1 1 
        4  5615 1 1 83 VAL C    C   17.250  -0.227  -6.543 1.00 . A A . 739 VAL C    1 1 
        4  5616 1 1 83 VAL CA   C   15.888   0.198  -5.959 1.00 . A A . 739 VAL CA   1 1 
        4  5617 1 1 83 VAL CB   C   16.071   1.516  -5.163 1.00 . A A . 739 VAL CB   1 1 
        4  5618 1 1 83 VAL CG1  C   16.574   2.639  -6.071 1.00 . A A . 739 VAL CG1  1 1 
        4  5619 1 1 83 VAL CG2  C   14.767   1.915  -4.472 1.00 . A A . 739 VAL CG2  1 1 
        4  5620 1 1 83 VAL H    H   15.681  -0.990  -4.216 1.00 . A A . 739 VAL H    1 1 
        4  5621 1 1 83 VAL HA   H   15.201   0.387  -6.774 1.00 . A A . 739 VAL HA   1 1 
        4  5622 1 1 83 VAL HB   H   16.817   1.348  -4.398 1.00 . A A . 739 VAL HB   1 1 
        4  5623 1 1 83 VAL HG11 H   17.523   2.355  -6.508 1.00 . A A . 739 VAL HG11 1 1 
        4  5624 1 1 83 VAL HG12 H   16.705   3.542  -5.492 1.00 . A A . 739 VAL HG12 1 1 
        4  5625 1 1 83 VAL HG13 H   15.856   2.818  -6.857 1.00 . A A . 739 VAL HG13 1 1 
        4  5626 1 1 83 VAL HG21 H   14.461   1.129  -3.796 1.00 . A A . 739 VAL HG21 1 1 
        4  5627 1 1 83 VAL HG22 H   13.999   2.071  -5.214 1.00 . A A . 739 VAL HG22 1 1 
        4  5628 1 1 83 VAL HG23 H   14.917   2.828  -3.914 1.00 . A A . 739 VAL HG23 1 1 
        4  5629 1 1 83 VAL N    N   15.313  -0.854  -5.112 1.00 . A A . 739 VAL N    1 1 
        4  5630 1 1 83 VAL O    O   18.129  -0.701  -5.816 1.00 . A A . 739 VAL O    1 1 
        4  5631 1 1 84 LYS C    C   19.336   0.890  -9.132 1.00 . A A . 740 LYS C    1 1 
        4  5632 1 1 84 LYS CA   C   18.685  -0.372  -8.539 1.00 . A A . 740 LYS CA   1 1 
        4  5633 1 1 84 LYS CB   C   18.440  -1.408  -9.649 1.00 . A A . 740 LYS CB   1 1 
        4  5634 1 1 84 LYS CD   C   17.652  -3.747 -10.257 1.00 . A A . 740 LYS CD   1 1 
        4  5635 1 1 84 LYS CE   C   18.990  -4.400 -10.613 1.00 . A A . 740 LYS CE   1 1 
        4  5636 1 1 84 LYS CG   C   17.781  -2.693  -9.156 1.00 . A A . 740 LYS CG   1 1 
        4  5637 1 1 84 LYS H    H   16.672   0.302  -8.382 1.00 . A A . 740 LYS H    1 1 
        4  5638 1 1 84 LYS HA   H   19.362  -0.797  -7.809 1.00 . A A . 740 LYS HA   1 1 
        4  5639 1 1 84 LYS HB2  H   17.801  -0.969 -10.404 1.00 . A A . 740 LYS HB2  1 1 
        4  5640 1 1 84 LYS HB3  H   19.389  -1.665 -10.100 1.00 . A A . 740 LYS HB3  1 1 
        4  5641 1 1 84 LYS HD2  H   16.972  -4.517  -9.918 1.00 . A A . 740 LYS HD2  1 1 
        4  5642 1 1 84 LYS HD3  H   17.243  -3.278 -11.143 1.00 . A A . 740 LYS HD3  1 1 
        4  5643 1 1 84 LYS HE2  H   19.461  -4.740  -9.702 1.00 . A A . 740 LYS HE2  1 1 
        4  5644 1 1 84 LYS HE3  H   18.797  -5.255 -11.247 1.00 . A A . 740 LYS HE3  1 1 
        4  5645 1 1 84 LYS HG2  H   18.375  -3.102  -8.351 1.00 . A A . 740 LYS HG2  1 1 
        4  5646 1 1 84 LYS HG3  H   16.794  -2.453  -8.783 1.00 . A A . 740 LYS HG3  1 1 
        4  5647 1 1 84 LYS HZ1  H   20.751  -4.014 -11.672 1.00 . A A . 740 LYS HZ1  1 1 
        4  5648 1 1 84 LYS HZ2  H   20.263  -2.741 -10.671 1.00 . A A . 740 LYS HZ2  1 1 
        4  5649 1 1 84 LYS HZ3  H   19.453  -3.033 -12.124 1.00 . A A . 740 LYS HZ3  1 1 
        4  5650 1 1 84 LYS N    N   17.419  -0.051  -7.856 1.00 . A A . 740 LYS N    1 1 
        4  5651 1 1 84 LYS NZ   N   19.929  -3.482 -11.317 1.00 . A A . 740 LYS NZ   1 1 
        4  5652 1 1 84 LYS O    O   18.658   1.875  -9.419 1.00 . A A . 740 LYS O    1 1 
        4  5653 1 1 85 VAL C    C   21.480   2.024 -11.366 1.00 . A A . 741 VAL C    1 1 
        4  5654 1 1 85 VAL CA   C   21.389   2.021  -9.831 1.00 . A A . 741 VAL CA   1 1 
        4  5655 1 1 85 VAL CB   C   22.827   2.074  -9.249 1.00 . A A . 741 VAL CB   1 1 
        4  5656 1 1 85 VAL CG1  C   23.558   3.338  -9.701 1.00 . A A . 741 VAL CG1  1 1 
        4  5657 1 1 85 VAL CG2  C   22.803   1.978  -7.725 1.00 . A A . 741 VAL CG2  1 1 
        4  5658 1 1 85 VAL H    H   21.142   0.027  -9.124 1.00 . A A . 741 VAL H    1 1 
        4  5659 1 1 85 VAL HA   H   20.860   2.908  -9.514 1.00 . A A . 741 VAL HA   1 1 
        4  5660 1 1 85 VAL HB   H   23.374   1.221  -9.628 1.00 . A A . 741 VAL HB   1 1 
        4  5661 1 1 85 VAL HG11 H   23.619   3.355 -10.780 1.00 . A A . 741 VAL HG11 1 1 
        4  5662 1 1 85 VAL HG12 H   24.557   3.347  -9.287 1.00 . A A . 741 VAL HG12 1 1 
        4  5663 1 1 85 VAL HG13 H   23.020   4.211  -9.358 1.00 . A A . 741 VAL HG13 1 1 
        4  5664 1 1 85 VAL HG21 H   22.342   1.047  -7.429 1.00 . A A . 741 VAL HG21 1 1 
        4  5665 1 1 85 VAL HG22 H   22.237   2.804  -7.318 1.00 . A A . 741 VAL HG22 1 1 
        4  5666 1 1 85 VAL HG23 H   23.813   2.014  -7.344 1.00 . A A . 741 VAL HG23 1 1 
        4  5667 1 1 85 VAL N    N   20.651   0.855  -9.323 1.00 . A A . 741 VAL N    1 1 
        4  5668 1 1 85 VAL O    O   21.677   0.980 -11.990 1.00 . A A . 741 VAL O    1 1 
        4  5669 1 1 86 ARG C    C   22.990   3.673 -13.751 1.00 . A A . 742 ARG C    1 1 
        4  5670 1 1 86 ARG CA   C   21.519   3.370 -13.414 1.00 . A A . 742 ARG CA   1 1 
        4  5671 1 1 86 ARG CB   C   20.617   4.494 -13.947 1.00 . A A . 742 ARG CB   1 1 
        4  5672 1 1 86 ARG CD   C   18.302   5.288 -14.554 1.00 . A A . 742 ARG CD   1 1 
        4  5673 1 1 86 ARG CG   C   19.137   4.138 -13.997 1.00 . A A . 742 ARG CG   1 1 
        4  5674 1 1 86 ARG CZ   C   18.502   5.497 -16.990 1.00 . A A . 742 ARG CZ   1 1 
        4  5675 1 1 86 ARG H    H   21.101   3.986 -11.425 1.00 . A A . 742 ARG H    1 1 
        4  5676 1 1 86 ARG HA   H   21.239   2.441 -13.892 1.00 . A A . 742 ARG HA   1 1 
        4  5677 1 1 86 ARG HB2  H   20.734   5.361 -13.312 1.00 . A A . 742 ARG HB2  1 1 
        4  5678 1 1 86 ARG HB3  H   20.937   4.751 -14.948 1.00 . A A . 742 ARG HB3  1 1 
        4  5679 1 1 86 ARG HD2  H   17.303   4.928 -14.757 1.00 . A A . 742 ARG HD2  1 1 
        4  5680 1 1 86 ARG HD3  H   18.256   6.074 -13.813 1.00 . A A . 742 ARG HD3  1 1 
        4  5681 1 1 86 ARG HE   H   19.578   6.506 -15.694 1.00 . A A . 742 ARG HE   1 1 
        4  5682 1 1 86 ARG HG2  H   19.007   3.272 -14.630 1.00 . A A . 742 ARG HG2  1 1 
        4  5683 1 1 86 ARG HG3  H   18.796   3.907 -12.996 1.00 . A A . 742 ARG HG3  1 1 
        4  5684 1 1 86 ARG HH11 H   17.170   4.147 -16.390 1.00 . A A . 742 ARG HH11 1 1 
        4  5685 1 1 86 ARG HH12 H   17.325   4.337 -18.101 1.00 . A A . 742 ARG HH12 1 1 
        4  5686 1 1 86 ARG HH21 H   19.765   6.750 -17.879 1.00 . A A . 742 ARG HH21 1 1 
        4  5687 1 1 86 ARG HH22 H   18.759   5.821 -18.934 1.00 . A A . 742 ARG HH22 1 1 
        4  5688 1 1 86 ARG N    N   21.335   3.205 -11.967 1.00 . A A . 742 ARG N    1 1 
        4  5689 1 1 86 ARG NE   N   18.876   5.833 -15.785 1.00 . A A . 742 ARG NE   1 1 
        4  5690 1 1 86 ARG NH1  N   17.593   4.594 -17.174 1.00 . A A . 742 ARG NH1  1 1 
        4  5691 1 1 86 ARG NH2  N   19.054   6.064 -18.013 1.00 . A A . 742 ARG NH2  1 1 
        4  5692 1 1 86 ARG O    O   23.747   2.784 -14.145 1.00 . A A . 742 ARG O    1 1 
        4  5693 1 1 87 GLU C    C   25.621   5.154 -12.538 1.00 . A A . 743 GLU C    1 1 
        4  5694 1 1 87 GLU CA   C   24.780   5.338 -13.814 1.00 . A A . 743 GLU CA   1 1 
        4  5695 1 1 87 GLU CB   C   24.850   6.806 -14.279 1.00 . A A . 743 GLU CB   1 1 
        4  5696 1 1 87 GLU CD   C   22.681   6.892 -15.622 1.00 . A A . 743 GLU CD   1 1 
        4  5697 1 1 87 GLU CG   C   24.192   7.082 -15.635 1.00 . A A . 743 GLU CG   1 1 
        4  5698 1 1 87 GLU H    H   22.738   5.607 -13.306 1.00 . A A . 743 GLU H    1 1 
        4  5699 1 1 87 GLU HA   H   25.186   4.706 -14.592 1.00 . A A . 743 GLU HA   1 1 
        4  5700 1 1 87 GLU HB2  H   24.363   7.426 -13.541 1.00 . A A . 743 GLU HB2  1 1 
        4  5701 1 1 87 GLU HB3  H   25.888   7.097 -14.345 1.00 . A A . 743 GLU HB3  1 1 
        4  5702 1 1 87 GLU HG2  H   24.404   8.103 -15.920 1.00 . A A . 743 GLU HG2  1 1 
        4  5703 1 1 87 GLU HG3  H   24.622   6.413 -16.369 1.00 . A A . 743 GLU HG3  1 1 
        4  5704 1 1 87 GLU N    N   23.391   4.931 -13.584 1.00 . A A . 743 GLU N    1 1 
        4  5705 1 1 87 GLU O    O   25.362   5.796 -11.517 1.00 . A A . 743 GLU O    1 1 
        4  5706 1 1 87 GLU OE1  O   22.002   7.568 -14.817 1.00 . A A . 743 GLU OE1  1 1 
        4  5707 1 1 87 GLU OE2  O   22.166   6.076 -16.419 1.00 . A A . 743 GLU OE2  1 1 
        4  5708 1 1 88 GLU C    C   28.725   4.859 -11.389 1.00 . A A . 744 GLU C    1 1 
        4  5709 1 1 88 GLU CA   C   27.467   3.974 -11.435 1.00 . A A . 744 GLU CA   1 1 
        4  5710 1 1 88 GLU CB   C   27.887   2.498 -11.461 1.00 . A A . 744 GLU CB   1 1 
        4  5711 1 1 88 GLU CD   C   27.174   0.068 -11.511 1.00 . A A . 744 GLU CD   1 1 
        4  5712 1 1 88 GLU CG   C   26.719   1.520 -11.527 1.00 . A A . 744 GLU CG   1 1 
        4  5713 1 1 88 GLU H    H   26.800   3.822 -13.454 1.00 . A A . 744 GLU H    1 1 
        4  5714 1 1 88 GLU HA   H   26.882   4.154 -10.543 1.00 . A A . 744 GLU HA   1 1 
        4  5715 1 1 88 GLU HB2  H   28.515   2.333 -12.324 1.00 . A A . 744 GLU HB2  1 1 
        4  5716 1 1 88 GLU HB3  H   28.458   2.284 -10.567 1.00 . A A . 744 GLU HB3  1 1 
        4  5717 1 1 88 GLU HG2  H   26.071   1.693 -10.678 1.00 . A A . 744 GLU HG2  1 1 
        4  5718 1 1 88 GLU HG3  H   26.167   1.701 -12.440 1.00 . A A . 744 GLU HG3  1 1 
        4  5719 1 1 88 GLU N    N   26.622   4.279 -12.602 1.00 . A A . 744 GLU N    1 1 
        4  5720 1 1 88 GLU O    O   28.935   5.706 -12.257 1.00 . A A . 744 GLU O    1 1 
        4  5721 1 1 88 GLU OE1  O   27.584  -0.443 -12.579 1.00 . A A . 744 GLU OE1  1 1 
        4  5722 1 1 88 GLU OE2  O   27.131  -0.566 -10.437 1.00 . A A . 744 GLU OE2  1 1 
        4  5723 1 1 89 VAL C    C   31.950   4.756 -11.037 1.00 . A A . 745 VAL C    1 1 
        4  5724 1 1 89 VAL CA   C   30.815   5.403 -10.224 1.00 . A A . 745 VAL CA   1 1 
        4  5725 1 1 89 VAL CB   C   31.240   5.496  -8.734 1.00 . A A . 745 VAL CB   1 1 
        4  5726 1 1 89 VAL CG1  C   32.502   6.348  -8.569 1.00 . A A . 745 VAL CG1  1 1 
        4  5727 1 1 89 VAL CG2  C   30.092   6.045  -7.885 1.00 . A A . 745 VAL CG2  1 1 
        4  5728 1 1 89 VAL H    H   29.341   3.966  -9.707 1.00 . A A . 745 VAL H    1 1 
        4  5729 1 1 89 VAL HA   H   30.647   6.407 -10.593 1.00 . A A . 745 VAL HA   1 1 
        4  5730 1 1 89 VAL HB   H   31.465   4.497  -8.384 1.00 . A A . 745 VAL HB   1 1 
        4  5731 1 1 89 VAL HG11 H   32.770   6.399  -7.524 1.00 . A A . 745 VAL HG11 1 1 
        4  5732 1 1 89 VAL HG12 H   32.320   7.345  -8.942 1.00 . A A . 745 VAL HG12 1 1 
        4  5733 1 1 89 VAL HG13 H   33.315   5.901  -9.125 1.00 . A A . 745 VAL HG13 1 1 
        4  5734 1 1 89 VAL HG21 H   29.236   5.392  -7.972 1.00 . A A . 745 VAL HG21 1 1 
        4  5735 1 1 89 VAL HG22 H   29.824   7.034  -8.230 1.00 . A A . 745 VAL HG22 1 1 
        4  5736 1 1 89 VAL HG23 H   30.398   6.097  -6.850 1.00 . A A . 745 VAL HG23 1 1 
        4  5737 1 1 89 VAL N    N   29.564   4.648 -10.373 1.00 . A A . 745 VAL N    1 1 
        4  5738 1 1 89 VAL O    O   32.061   3.531 -11.093 1.00 . A A . 745 VAL O    1 1 
        4  5739 1 1 90 LYS C    C   35.018   4.454 -11.618 1.00 . A A . 746 LYS C    1 1 
        4  5740 1 1 90 LYS CA   C   33.915   5.100 -12.477 1.00 . A A . 746 LYS CA   1 1 
        4  5741 1 1 90 LYS CB   C   34.533   6.251 -13.291 1.00 . A A . 746 LYS CB   1 1 
        4  5742 1 1 90 LYS CD   C   34.310   7.963 -15.129 1.00 . A A . 746 LYS CD   1 1 
        4  5743 1 1 90 LYS CE   C   33.371   8.667 -16.103 1.00 . A A . 746 LYS CE   1 1 
        4  5744 1 1 90 LYS CG   C   33.590   6.898 -14.302 1.00 . A A . 746 LYS CG   1 1 
        4  5745 1 1 90 LYS H    H   32.621   6.555 -11.605 1.00 . A A . 746 LYS H    1 1 
        4  5746 1 1 90 LYS HA   H   33.534   4.359 -13.164 1.00 . A A . 746 LYS HA   1 1 
        4  5747 1 1 90 LYS HB2  H   34.868   7.019 -12.605 1.00 . A A . 746 LYS HB2  1 1 
        4  5748 1 1 90 LYS HB3  H   35.391   5.869 -13.827 1.00 . A A . 746 LYS HB3  1 1 
        4  5749 1 1 90 LYS HD2  H   34.731   8.698 -14.459 1.00 . A A . 746 LYS HD2  1 1 
        4  5750 1 1 90 LYS HD3  H   35.104   7.489 -15.688 1.00 . A A . 746 LYS HD3  1 1 
        4  5751 1 1 90 LYS HE2  H   32.595   9.163 -15.541 1.00 . A A . 746 LYS HE2  1 1 
        4  5752 1 1 90 LYS HE3  H   33.935   9.402 -16.658 1.00 . A A . 746 LYS HE3  1 1 
        4  5753 1 1 90 LYS HG2  H   33.209   6.136 -14.968 1.00 . A A . 746 LYS HG2  1 1 
        4  5754 1 1 90 LYS HG3  H   32.766   7.360 -13.774 1.00 . A A . 746 LYS HG3  1 1 
        4  5755 1 1 90 LYS HZ1  H   33.467   7.186 -17.574 1.00 . A A . 746 LYS HZ1  1 1 
        4  5756 1 1 90 LYS HZ2  H   32.158   8.242 -17.749 1.00 . A A . 746 LYS HZ2  1 1 
        4  5757 1 1 90 LYS HZ3  H   32.127   7.051 -16.553 1.00 . A A . 746 LYS HZ3  1 1 
        4  5758 1 1 90 LYS N    N   32.782   5.587 -11.668 1.00 . A A . 746 LYS N    1 1 
        4  5759 1 1 90 LYS NZ   N   32.739   7.720 -17.061 1.00 . A A . 746 LYS NZ   1 1 
        4  5760 1 1 90 LYS O    O   35.785   3.619 -12.099 1.00 . A A . 746 LYS O    1 1 
        4  5761 1 1 91 ASN C    C   35.705   3.372  -8.436 1.00 . A A . 747 ASN C    1 1 
        4  5762 1 1 91 ASN CA   C   36.189   4.403  -9.466 1.00 . A A . 747 ASN CA   1 1 
        4  5763 1 1 91 ASN CB   C   36.811   5.603  -8.744 1.00 . A A . 747 ASN CB   1 1 
        4  5764 1 1 91 ASN CG   C   37.478   6.565  -9.709 1.00 . A A . 747 ASN CG   1 1 
        4  5765 1 1 91 ASN H    H   34.433   5.469 -10.005 1.00 . A A . 747 ASN H    1 1 
        4  5766 1 1 91 ASN HA   H   36.950   3.940 -10.079 1.00 . A A . 747 ASN HA   1 1 
        4  5767 1 1 91 ASN HB2  H   36.038   6.135  -8.207 1.00 . A A . 747 ASN HB2  1 1 
        4  5768 1 1 91 ASN HB3  H   37.554   5.250  -8.042 1.00 . A A . 747 ASN HB3  1 1 
        4  5769 1 1 91 ASN HD21 H   39.180   5.561  -9.581 1.00 . A A . 747 ASN HD21 1 1 
        4  5770 1 1 91 ASN HD22 H   39.195   6.950 -10.610 1.00 . A A . 747 ASN HD22 1 1 
        4  5771 1 1 91 ASN N    N   35.110   4.859 -10.355 1.00 . A A . 747 ASN N    1 1 
        4  5772 1 1 91 ASN ND2  N   38.744   6.335  -9.997 1.00 . A A . 747 ASN ND2  1 1 
        4  5773 1 1 91 ASN O    O   34.536   3.359  -8.045 1.00 . A A . 747 ASN O    1 1 
        4  5774 1 1 91 ASN OD1  O   36.856   7.494 -10.212 1.00 . A A . 747 ASN OD1  1 1 
        4  5775 1 1 92 ASP C    C   36.094   2.073  -5.604 1.00 . A A . 748 ASP C    1 1 
        4  5776 1 1 92 ASP CA   C   36.332   1.482  -7.001 1.00 . A A . 748 ASP CA   1 1 
        4  5777 1 1 92 ASP CB   C   37.487   0.477  -6.936 1.00 . A A . 748 ASP CB   1 1 
        4  5778 1 1 92 ASP CG   C   37.693  -0.249  -8.246 1.00 . A A . 748 ASP CG   1 1 
        4  5779 1 1 92 ASP H    H   37.545   2.596  -8.339 1.00 . A A . 748 ASP H    1 1 
        4  5780 1 1 92 ASP HA   H   35.438   0.966  -7.323 1.00 . A A . 748 ASP HA   1 1 
        4  5781 1 1 92 ASP HB2  H   38.399   1.000  -6.686 1.00 . A A . 748 ASP HB2  1 1 
        4  5782 1 1 92 ASP HB3  H   37.279  -0.255  -6.166 1.00 . A A . 748 ASP HB3  1 1 
        4  5783 1 1 92 ASP N    N   36.631   2.523  -7.991 1.00 . A A . 748 ASP N    1 1 
        4  5784 1 1 92 ASP O    O   37.006   2.647  -5.000 1.00 . A A . 748 ASP O    1 1 
        4  5785 1 1 92 ASP OD1  O   38.399   0.284  -9.123 1.00 . A A . 748 ASP OD1  1 1 
        4  5786 1 1 92 ASP OD2  O   37.146  -1.361  -8.405 1.00 . A A . 748 ASP OD2  1 1 
        4  5787 1 1 93 LYS C    C   33.182   1.848  -3.272 1.00 . A A . 749 LYS C    1 1 
        4  5788 1 1 93 LYS CA   C   34.552   2.381  -3.737 1.00 . A A . 749 LYS CA   1 1 
        4  5789 1 1 93 LYS CB   C   34.589   3.917  -3.659 1.00 . A A . 749 LYS CB   1 1 
        4  5790 1 1 93 LYS CD   C   35.270   5.954  -2.326 1.00 . A A . 749 LYS CD   1 1 
        4  5791 1 1 93 LYS CE   C   36.109   6.404  -1.138 1.00 . A A . 749 LYS CE   1 1 
        4  5792 1 1 93 LYS CG   C   35.019   4.447  -2.296 1.00 . A A . 749 LYS CG   1 1 
        4  5793 1 1 93 LYS H    H   34.166   1.532  -5.647 1.00 . A A . 749 LYS H    1 1 
        4  5794 1 1 93 LYS HA   H   35.311   1.981  -3.078 1.00 . A A . 749 LYS HA   1 1 
        4  5795 1 1 93 LYS HB2  H   35.283   4.287  -4.401 1.00 . A A . 749 LYS HB2  1 1 
        4  5796 1 1 93 LYS HB3  H   33.602   4.305  -3.881 1.00 . A A . 749 LYS HB3  1 1 
        4  5797 1 1 93 LYS HD2  H   35.793   6.206  -3.237 1.00 . A A . 749 LYS HD2  1 1 
        4  5798 1 1 93 LYS HD3  H   34.321   6.469  -2.301 1.00 . A A . 749 LYS HD3  1 1 
        4  5799 1 1 93 LYS HE2  H   36.278   7.468  -1.212 1.00 . A A . 749 LYS HE2  1 1 
        4  5800 1 1 93 LYS HE3  H   35.571   6.188  -0.225 1.00 . A A . 749 LYS HE3  1 1 
        4  5801 1 1 93 LYS HG2  H   34.241   4.235  -1.576 1.00 . A A . 749 LYS HG2  1 1 
        4  5802 1 1 93 LYS HG3  H   35.928   3.945  -2.000 1.00 . A A . 749 LYS HG3  1 1 
        4  5803 1 1 93 LYS HZ1  H   37.288   4.695  -0.903 1.00 . A A . 749 LYS HZ1  1 1 
        4  5804 1 1 93 LYS HZ2  H   38.027   6.111  -0.353 1.00 . A A . 749 LYS HZ2  1 1 
        4  5805 1 1 93 LYS HZ3  H   37.914   5.805  -2.013 1.00 . A A . 749 LYS HZ3  1 1 
        4  5806 1 1 93 LYS N    N   34.869   1.932  -5.095 1.00 . A A . 749 LYS N    1 1 
        4  5807 1 1 93 LYS NZ   N   37.425   5.708  -1.100 1.00 . A A . 749 LYS NZ   1 1 
        4  5808 1 1 93 LYS O    O   32.197   2.587  -3.228 1.00 . A A . 749 LYS O    1 1 
        4  5809 1 1 94 PRO C    C   31.540   0.327  -0.996 1.00 . A A . 750 PRO C    1 1 
        4  5810 1 1 94 PRO CA   C   31.849  -0.062  -2.451 1.00 . A A . 750 PRO CA   1 1 
        4  5811 1 1 94 PRO CB   C   32.119  -1.568  -2.582 1.00 . A A . 750 PRO CB   1 1 
        4  5812 1 1 94 PRO CD   C   34.199  -0.441  -3.010 1.00 . A A . 750 PRO CD   1 1 
        4  5813 1 1 94 PRO CG   C   33.599  -1.698  -2.423 1.00 . A A . 750 PRO CG   1 1 
        4  5814 1 1 94 PRO HA   H   31.010   0.210  -3.078 1.00 . A A . 750 PRO HA   1 1 
        4  5815 1 1 94 PRO HB2  H   31.586  -2.109  -1.811 1.00 . A A . 750 PRO HB2  1 1 
        4  5816 1 1 94 PRO HB3  H   31.796  -1.913  -3.556 1.00 . A A . 750 PRO HB3  1 1 
        4  5817 1 1 94 PRO HD2  H   35.044  -0.115  -2.421 1.00 . A A . 750 PRO HD2  1 1 
        4  5818 1 1 94 PRO HD3  H   34.497  -0.608  -4.036 1.00 . A A . 750 PRO HD3  1 1 
        4  5819 1 1 94 PRO HG2  H   33.848  -1.782  -1.373 1.00 . A A . 750 PRO HG2  1 1 
        4  5820 1 1 94 PRO HG3  H   33.951  -2.568  -2.960 1.00 . A A . 750 PRO HG3  1 1 
        4  5821 1 1 94 PRO N    N   33.097   0.545  -2.936 1.00 . A A . 750 PRO N    1 1 
        4  5822 1 1 94 PRO O    O   31.914  -0.373  -0.054 1.00 . A A . 750 PRO O    1 1 
        4  5823 1 1 95 ILE C    C   29.322   1.279   1.138 1.00 . A A . 751 ILE C    1 1 
        4  5824 1 1 95 ILE CA   C   30.544   1.980   0.520 1.00 . A A . 751 ILE CA   1 1 
        4  5825 1 1 95 ILE CB   C   30.299   3.510   0.482 1.00 . A A . 751 ILE CB   1 1 
        4  5826 1 1 95 ILE CD1  C   28.885   5.334  -0.632 1.00 . A A . 751 ILE CD1  1 1 
        4  5827 1 1 95 ILE CG1  C   29.160   3.849  -0.498 1.00 . A A . 751 ILE CG1  1 1 
        4  5828 1 1 95 ILE CG2  C   31.584   4.243   0.102 1.00 . A A . 751 ILE CG2  1 1 
        4  5829 1 1 95 ILE H    H   30.606   1.986  -1.609 1.00 . A A . 751 ILE H    1 1 
        4  5830 1 1 95 ILE HA   H   31.400   1.795   1.158 1.00 . A A . 751 ILE HA   1 1 
        4  5831 1 1 95 ILE HB   H   30.016   3.830   1.477 1.00 . A A . 751 ILE HB   1 1 
        4  5832 1 1 95 ILE HD11 H   28.061   5.488  -1.314 1.00 . A A . 751 ILE HD11 1 1 
        4  5833 1 1 95 ILE HD12 H   29.764   5.833  -1.013 1.00 . A A . 751 ILE HD12 1 1 
        4  5834 1 1 95 ILE HD13 H   28.630   5.744   0.335 1.00 . A A . 751 ILE HD13 1 1 
        4  5835 1 1 95 ILE HG12 H   29.412   3.472  -1.479 1.00 . A A . 751 ILE HG12 1 1 
        4  5836 1 1 95 ILE HG13 H   28.249   3.374  -0.161 1.00 . A A . 751 ILE HG13 1 1 
        4  5837 1 1 95 ILE HG21 H   32.354   4.023   0.827 1.00 . A A . 751 ILE HG21 1 1 
        4  5838 1 1 95 ILE HG22 H   31.402   5.309   0.088 1.00 . A A . 751 ILE HG22 1 1 
        4  5839 1 1 95 ILE HG23 H   31.910   3.922  -0.876 1.00 . A A . 751 ILE HG23 1 1 
        4  5840 1 1 95 ILE N    N   30.872   1.466  -0.820 1.00 . A A . 751 ILE N    1 1 
        4  5841 1 1 95 ILE O    O   28.861   1.653   2.221 1.00 . A A . 751 ILE O    1 1 
        4  5842 1 1 96 LEU C    C   28.174  -1.916   1.436 1.00 . A A . 752 LEU C    1 1 
        4  5843 1 1 96 LEU CA   C   27.683  -0.535   0.965 1.00 . A A . 752 LEU CA   1 1 
        4  5844 1 1 96 LEU CB   C   26.598  -0.694  -0.113 1.00 . A A . 752 LEU CB   1 1 
        4  5845 1 1 96 LEU CD1  C   24.924   0.352  -1.693 1.00 . A A . 752 LEU CD1  1 1 
        4  5846 1 1 96 LEU CD2  C   25.346   1.399   0.551 1.00 . A A . 752 LEU CD2  1 1 
        4  5847 1 1 96 LEU CG   C   25.967   0.621  -0.610 1.00 . A A . 752 LEU CG   1 1 
        4  5848 1 1 96 LEU H    H   29.159   0.067  -0.439 1.00 . A A . 752 LEU H    1 1 
        4  5849 1 1 96 LEU HA   H   27.259  -0.013   1.812 1.00 . A A . 752 LEU HA   1 1 
        4  5850 1 1 96 LEU HB2  H   27.037  -1.202  -0.961 1.00 . A A . 752 LEU HB2  1 1 
        4  5851 1 1 96 LEU HB3  H   25.810  -1.317   0.288 1.00 . A A . 752 LEU HB3  1 1 
        4  5852 1 1 96 LEU HD11 H   24.151  -0.293  -1.300 1.00 . A A . 752 LEU HD11 1 1 
        4  5853 1 1 96 LEU HD12 H   25.395  -0.126  -2.539 1.00 . A A . 752 LEU HD12 1 1 
        4  5854 1 1 96 LEU HD13 H   24.485   1.287  -2.010 1.00 . A A . 752 LEU HD13 1 1 
        4  5855 1 1 96 LEU HD21 H   26.108   1.628   1.281 1.00 . A A . 752 LEU HD21 1 1 
        4  5856 1 1 96 LEU HD22 H   24.571   0.804   1.013 1.00 . A A . 752 LEU HD22 1 1 
        4  5857 1 1 96 LEU HD23 H   24.918   2.319   0.180 1.00 . A A . 752 LEU HD23 1 1 
        4  5858 1 1 96 LEU HG   H   26.741   1.238  -1.046 1.00 . A A . 752 LEU HG   1 1 
        4  5859 1 1 96 LEU N    N   28.795   0.273   0.447 1.00 . A A . 752 LEU N    1 1 
        4  5860 1 1 96 LEU O    O   29.365  -2.225   1.358 1.00 . A A . 752 LEU O    1 1 
        4  5861 1 1 97 GLU C    C   27.798  -5.052   1.222 1.00 . A A . 753 GLU C    1 1 
        4  5862 1 1 97 GLU CA   C   27.613  -4.091   2.402 1.00 . A A . 753 GLU CA   1 1 
        4  5863 1 1 97 GLU CB   C   26.535  -4.630   3.360 1.00 . A A . 753 GLU CB   1 1 
        4  5864 1 1 97 GLU CD   C   27.616  -3.571   5.405 1.00 . A A . 753 GLU CD   1 1 
        4  5865 1 1 97 GLU CG   C   26.332  -3.777   4.613 1.00 . A A . 753 GLU CG   1 1 
        4  5866 1 1 97 GLU H    H   26.332  -2.437   2.019 1.00 . A A . 753 GLU H    1 1 
        4  5867 1 1 97 GLU HA   H   28.549  -4.021   2.938 1.00 . A A . 753 GLU HA   1 1 
        4  5868 1 1 97 GLU HB2  H   25.593  -4.680   2.831 1.00 . A A . 753 GLU HB2  1 1 
        4  5869 1 1 97 GLU HB3  H   26.815  -5.627   3.672 1.00 . A A . 753 GLU HB3  1 1 
        4  5870 1 1 97 GLU HG2  H   25.947  -2.810   4.318 1.00 . A A . 753 GLU HG2  1 1 
        4  5871 1 1 97 GLU HG3  H   25.607  -4.265   5.251 1.00 . A A . 753 GLU HG3  1 1 
        4  5872 1 1 97 GLU N    N   27.260  -2.742   1.942 1.00 . A A . 753 GLU N    1 1 
        4  5873 1 1 97 GLU O    O   27.930  -6.267   1.407 1.00 . A A . 753 GLU O    1 1 
        4  5874 1 1 97 GLU OE1  O   28.005  -4.481   6.167 1.00 . A A . 753 GLU OE1  1 1 
        4  5875 1 1 97 GLU OE2  O   28.241  -2.498   5.269 1.00 . A A . 753 GLU OE2  1 1 
        4  5876 2 2  1 CA  CA   CA -17.339  -4.175   4.863 1.00 . B A . 762 CA  CA   1 1 
        5  5877 1 1  1 MET C    C  -41.293  -6.875  10.290 1.00 . A A . 657 MET C    1 1 
        5  5878 1 1  1 MET CA   C  -42.600  -6.348  10.910 1.00 . A A . 657 MET CA   1 1 
        5  5879 1 1  1 MET CB   C  -43.788  -7.245  10.511 1.00 . A A . 657 MET CB   1 1 
        5  5880 1 1  1 MET CE   C  -44.817  -9.872   8.968 1.00 . A A . 657 MET CE   1 1 
        5  5881 1 1  1 MET CG   C  -44.156  -7.179   9.033 1.00 . A A . 657 MET CG   1 1 
        5  5882 1 1  1 MET H1   H  -42.980  -4.865   9.479 1.00 . A A . 657 MET H1   1 1 
        5  5883 1 1  1 MET H2   H  -42.065  -4.331  10.796 1.00 . A A . 657 MET H2   1 1 
        5  5884 1 1  1 MET H3   H  -43.725  -4.589  10.973 1.00 . A A . 657 MET H3   1 1 
        5  5885 1 1  1 MET HA   H  -42.498  -6.371  11.987 1.00 . A A . 657 MET HA   1 1 
        5  5886 1 1  1 MET HB2  H  -43.547  -8.272  10.753 1.00 . A A . 657 MET HB2  1 1 
        5  5887 1 1  1 MET HB3  H  -44.655  -6.947  11.085 1.00 . A A . 657 MET HB3  1 1 
        5  5888 1 1  1 MET HE1  H  -43.946 -10.030   8.348 1.00 . A A . 657 MET HE1  1 1 
        5  5889 1 1  1 MET HE2  H  -45.547 -10.641   8.764 1.00 . A A . 657 MET HE2  1 1 
        5  5890 1 1  1 MET HE3  H  -44.531  -9.913  10.009 1.00 . A A . 657 MET HE3  1 1 
        5  5891 1 1  1 MET HG2  H  -44.436  -6.165   8.792 1.00 . A A . 657 MET HG2  1 1 
        5  5892 1 1  1 MET HG3  H  -43.294  -7.464   8.446 1.00 . A A . 657 MET HG3  1 1 
        5  5893 1 1  1 MET N    N  -42.861  -4.938  10.511 1.00 . A A . 657 MET N    1 1 
        5  5894 1 1  1 MET O    O  -41.194  -7.043   9.075 1.00 . A A . 657 MET O    1 1 
        5  5895 1 1  1 MET SD   S  -45.528  -8.267   8.606 1.00 . A A . 657 MET SD   1 1 
        5  5896 1 1  2 GLY C    C  -37.815  -7.220  11.503 1.00 . A A . 658 GLY C    1 1 
        5  5897 1 1  2 GLY CA   C  -39.007  -7.634  10.638 1.00 . A A . 658 GLY CA   1 1 
        5  5898 1 1  2 GLY H    H  -40.403  -6.949  12.088 1.00 . A A . 658 GLY H    1 1 
        5  5899 1 1  2 GLY HA2  H  -39.057  -8.713  10.610 1.00 . A A . 658 GLY HA2  1 1 
        5  5900 1 1  2 GLY HA3  H  -38.846  -7.272   9.631 1.00 . A A . 658 GLY HA3  1 1 
        5  5901 1 1  2 GLY N    N  -40.284  -7.120  11.129 1.00 . A A . 658 GLY N    1 1 
        5  5902 1 1  2 GLY O    O  -37.620  -6.035  11.777 1.00 . A A . 658 GLY O    1 1 
        5  5903 1 1  3 ASN C    C  -34.769  -9.044  12.588 1.00 . A A . 659 ASN C    1 1 
        5  5904 1 1  3 ASN CA   C  -35.813  -7.922  12.735 1.00 . A A . 659 ASN CA   1 1 
        5  5905 1 1  3 ASN CB   C  -36.181  -7.742  14.216 1.00 . A A . 659 ASN CB   1 1 
        5  5906 1 1  3 ASN CG   C  -36.589  -9.044  14.887 1.00 . A A . 659 ASN CG   1 1 
        5  5907 1 1  3 ASN H    H  -37.234  -9.128  11.704 1.00 . A A . 659 ASN H    1 1 
        5  5908 1 1  3 ASN HA   H  -35.376  -7.002  12.369 1.00 . A A . 659 ASN HA   1 1 
        5  5909 1 1  3 ASN HB2  H  -35.330  -7.338  14.745 1.00 . A A . 659 ASN HB2  1 1 
        5  5910 1 1  3 ASN HB3  H  -37.004  -7.046  14.292 1.00 . A A . 659 ASN HB3  1 1 
        5  5911 1 1  3 ASN HD21 H  -38.467  -8.796  14.312 1.00 . A A . 659 ASN HD21 1 1 
        5  5912 1 1  3 ASN HD22 H  -38.136 -10.224  15.227 1.00 . A A . 659 ASN HD22 1 1 
        5  5913 1 1  3 ASN N    N  -37.016  -8.198  11.934 1.00 . A A . 659 ASN N    1 1 
        5  5914 1 1  3 ASN ND2  N  -37.857  -9.388  14.800 1.00 . A A . 659 ASN ND2  1 1 
        5  5915 1 1  3 ASN O    O  -35.058 -10.111  12.041 1.00 . A A . 659 ASN O    1 1 
        5  5916 1 1  3 ASN OD1  O  -35.765  -9.740  15.475 1.00 . A A . 659 ASN OD1  1 1 
        5  5917 1 1  4 GLY C    C  -31.105  -9.190  13.177 1.00 . A A . 660 GLY C    1 1 
        5  5918 1 1  4 GLY CA   C  -32.497  -9.794  13.032 1.00 . A A . 660 GLY CA   1 1 
        5  5919 1 1  4 GLY H    H  -33.385  -7.927  13.508 1.00 . A A . 660 GLY H    1 1 
        5  5920 1 1  4 GLY HA2  H  -32.649 -10.509  13.828 1.00 . A A . 660 GLY HA2  1 1 
        5  5921 1 1  4 GLY HA3  H  -32.554 -10.311  12.084 1.00 . A A . 660 GLY HA3  1 1 
        5  5922 1 1  4 GLY N    N  -33.561  -8.797  13.092 1.00 . A A . 660 GLY N    1 1 
        5  5923 1 1  4 GLY O    O  -30.961  -7.994  13.442 1.00 . A A . 660 GLY O    1 1 
        5  5924 1 1  5 GLU C    C  -27.845 -10.152  11.942 1.00 . A A . 661 GLU C    1 1 
        5  5925 1 1  5 GLU CA   C  -28.680  -9.568  13.091 1.00 . A A . 661 GLU CA   1 1 
        5  5926 1 1  5 GLU CB   C  -28.058  -9.966  14.439 1.00 . A A . 661 GLU CB   1 1 
        5  5927 1 1  5 GLU CD   C  -28.012  -9.635  16.950 1.00 . A A . 661 GLU CD   1 1 
        5  5928 1 1  5 GLU CG   C  -28.730  -9.323  15.648 1.00 . A A . 661 GLU CG   1 1 
        5  5929 1 1  5 GLU H    H  -30.259 -10.965  12.815 1.00 . A A . 661 GLU H    1 1 
        5  5930 1 1  5 GLU HA   H  -28.673  -8.489  13.008 1.00 . A A . 661 GLU HA   1 1 
        5  5931 1 1  5 GLU HB2  H  -28.121 -11.040  14.551 1.00 . A A . 661 GLU HB2  1 1 
        5  5932 1 1  5 GLU HB3  H  -27.015  -9.678  14.441 1.00 . A A . 661 GLU HB3  1 1 
        5  5933 1 1  5 GLU HG2  H  -28.746  -8.250  15.509 1.00 . A A . 661 GLU HG2  1 1 
        5  5934 1 1  5 GLU HG3  H  -29.745  -9.690  15.714 1.00 . A A . 661 GLU HG3  1 1 
        5  5935 1 1  5 GLU N    N  -30.077 -10.020  13.008 1.00 . A A . 661 GLU N    1 1 
        5  5936 1 1  5 GLU O    O  -27.982 -11.323  11.601 1.00 . A A . 661 GLU O    1 1 
        5  5937 1 1  5 GLU OE1  O  -26.941  -9.040  17.199 1.00 . A A . 661 GLU OE1  1 1 
        5  5938 1 1  5 GLU OE2  O  -28.506 -10.478  17.727 1.00 . A A . 661 GLU OE2  1 1 
        5  5939 1 1  6 THR C    C  -24.674  -9.338  10.402 1.00 . A A . 662 THR C    1 1 
        5  5940 1 1  6 THR CA   C  -26.139  -9.764  10.223 1.00 . A A . 662 THR CA   1 1 
        5  5941 1 1  6 THR CB   C  -26.666  -9.208   8.876 1.00 . A A . 662 THR CB   1 1 
        5  5942 1 1  6 THR CG2  C  -26.757  -7.684   8.900 1.00 . A A . 662 THR CG2  1 1 
        5  5943 1 1  6 THR H    H  -26.899  -8.408  11.679 1.00 . A A . 662 THR H    1 1 
        5  5944 1 1  6 THR HA   H  -26.179 -10.844  10.176 1.00 . A A . 662 THR HA   1 1 
        5  5945 1 1  6 THR HB   H  -27.657  -9.608   8.707 1.00 . A A . 662 THR HB   1 1 
        5  5946 1 1  6 THR HG1  H  -26.031 -10.531   7.549 1.00 . A A . 662 THR HG1  1 1 
        5  5947 1 1  6 THR HG21 H  -25.774  -7.265   9.066 1.00 . A A . 662 THR HG21 1 1 
        5  5948 1 1  6 THR HG22 H  -27.421  -7.373   9.695 1.00 . A A . 662 THR HG22 1 1 
        5  5949 1 1  6 THR HG23 H  -27.143  -7.331   7.954 1.00 . A A . 662 THR HG23 1 1 
        5  5950 1 1  6 THR N    N  -26.979  -9.329  11.351 1.00 . A A . 662 THR N    1 1 
        5  5951 1 1  6 THR O    O  -24.389  -8.293  10.989 1.00 . A A . 662 THR O    1 1 
        5  5952 1 1  6 THR OG1  O  -25.811  -9.624   7.798 1.00 . A A . 662 THR OG1  1 1 
        5  5953 1 1  7 SER C    C  -21.818  -8.994   8.859 1.00 . A A . 663 SER C    1 1 
        5  5954 1 1  7 SER CA   C  -22.309  -9.873  10.019 1.00 . A A . 663 SER CA   1 1 
        5  5955 1 1  7 SER CB   C  -21.500 -11.178  10.039 1.00 . A A . 663 SER CB   1 1 
        5  5956 1 1  7 SER H    H  -24.038 -10.986   9.462 1.00 . A A . 663 SER H    1 1 
        5  5957 1 1  7 SER HA   H  -22.144  -9.345  10.950 1.00 . A A . 663 SER HA   1 1 
        5  5958 1 1  7 SER HB2  H  -21.659 -11.717   9.116 1.00 . A A . 663 SER HB2  1 1 
        5  5959 1 1  7 SER HB3  H  -20.448 -10.948  10.141 1.00 . A A . 663 SER HB3  1 1 
        5  5960 1 1  7 SER HG   H  -22.831 -12.218  11.042 1.00 . A A . 663 SER HG   1 1 
        5  5961 1 1  7 SER N    N  -23.749 -10.161   9.909 1.00 . A A . 663 SER N    1 1 
        5  5962 1 1  7 SER O    O  -22.184  -9.213   7.703 1.00 . A A . 663 SER O    1 1 
        5  5963 1 1  7 SER OG   O  -21.888 -12.012  11.119 1.00 . A A . 663 SER OG   1 1 
        5  5964 1 1  8 ASP C    C  -19.128  -7.736   7.553 1.00 . A A . 664 ASP C    1 1 
        5  5965 1 1  8 ASP CA   C  -20.411  -7.127   8.147 1.00 . A A . 664 ASP CA   1 1 
        5  5966 1 1  8 ASP CB   C  -20.117  -5.746   8.731 1.00 . A A . 664 ASP CB   1 1 
        5  5967 1 1  8 ASP CG   C  -19.860  -4.712   7.652 1.00 . A A . 664 ASP CG   1 1 
        5  5968 1 1  8 ASP H    H  -20.773  -7.841  10.114 1.00 . A A . 664 ASP H    1 1 
        5  5969 1 1  8 ASP HA   H  -21.140  -7.023   7.355 1.00 . A A . 664 ASP HA   1 1 
        5  5970 1 1  8 ASP HB2  H  -20.966  -5.423   9.320 1.00 . A A . 664 ASP HB2  1 1 
        5  5971 1 1  8 ASP HB3  H  -19.249  -5.803   9.369 1.00 . A A . 664 ASP HB3  1 1 
        5  5972 1 1  8 ASP N    N  -20.991  -8.002   9.172 1.00 . A A . 664 ASP N    1 1 
        5  5973 1 1  8 ASP O    O  -18.453  -8.543   8.196 1.00 . A A . 664 ASP O    1 1 
        5  5974 1 1  8 ASP OD1  O  -18.687  -4.550   7.218 1.00 . A A . 664 ASP OD1  1 1 
        5  5975 1 1  8 ASP OD2  O  -20.833  -4.049   7.238 1.00 . A A . 664 ASP OD2  1 1 
        5  5976 1 1  9 LEU C    C  -16.436  -6.935   5.617 1.00 . A A . 665 LEU C    1 1 
        5  5977 1 1  9 LEU CA   C  -17.648  -7.886   5.605 1.00 . A A . 665 LEU CA   1 1 
        5  5978 1 1  9 LEU CB   C  -18.058  -8.208   4.161 1.00 . A A . 665 LEU CB   1 1 
        5  5979 1 1  9 LEU CD1  C  -19.626  -9.366   2.561 1.00 . A A . 665 LEU CD1  1 1 
        5  5980 1 1  9 LEU CD2  C  -19.024 -10.476   4.736 1.00 . A A . 665 LEU CD2  1 1 
        5  5981 1 1  9 LEU CG   C  -19.273  -9.143   4.027 1.00 . A A . 665 LEU CG   1 1 
        5  5982 1 1  9 LEU H    H  -19.333  -6.632   5.901 1.00 . A A . 665 LEU H    1 1 
        5  5983 1 1  9 LEU HA   H  -17.363  -8.810   6.094 1.00 . A A . 665 LEU HA   1 1 
        5  5984 1 1  9 LEU HB2  H  -18.288  -7.278   3.659 1.00 . A A . 665 LEU HB2  1 1 
        5  5985 1 1  9 LEU HB3  H  -17.218  -8.669   3.660 1.00 . A A . 665 LEU HB3  1 1 
        5  5986 1 1  9 LEU HD11 H  -19.860  -8.419   2.099 1.00 . A A . 665 LEU HD11 1 1 
        5  5987 1 1  9 LEU HD12 H  -20.488 -10.016   2.493 1.00 . A A . 665 LEU HD12 1 1 
        5  5988 1 1  9 LEU HD13 H  -18.791  -9.821   2.051 1.00 . A A . 665 LEU HD13 1 1 
        5  5989 1 1  9 LEU HD21 H  -18.149 -10.954   4.317 1.00 . A A . 665 LEU HD21 1 1 
        5  5990 1 1  9 LEU HD22 H  -19.882 -11.120   4.605 1.00 . A A . 665 LEU HD22 1 1 
        5  5991 1 1  9 LEU HD23 H  -18.867 -10.300   5.790 1.00 . A A . 665 LEU HD23 1 1 
        5  5992 1 1  9 LEU HG   H  -20.124  -8.674   4.499 1.00 . A A . 665 LEU HG   1 1 
        5  5993 1 1  9 LEU N    N  -18.796  -7.332   6.329 1.00 . A A . 665 LEU N    1 1 
        5  5994 1 1  9 LEU O    O  -16.583  -5.711   5.467 1.00 . A A . 665 LEU O    1 1 
        5  5995 1 1 10 GLU C    C  -13.685  -6.242   4.363 1.00 . A A . 666 GLU C    1 1 
        5  5996 1 1 10 GLU CA   C  -13.988  -6.744   5.791 1.00 . A A . 666 GLU CA   1 1 
        5  5997 1 1 10 GLU CB   C  -12.794  -7.593   6.289 1.00 . A A . 666 GLU CB   1 1 
        5  5998 1 1 10 GLU CD   C  -13.963  -9.354   7.726 1.00 . A A . 666 GLU CD   1 1 
        5  5999 1 1 10 GLU CG   C  -12.954  -8.216   7.678 1.00 . A A . 666 GLU CG   1 1 
        5  6000 1 1 10 GLU H    H  -15.214  -8.467   6.011 1.00 . A A . 666 GLU H    1 1 
        5  6001 1 1 10 GLU HA   H  -14.105  -5.888   6.442 1.00 . A A . 666 GLU HA   1 1 
        5  6002 1 1 10 GLU HB2  H  -12.615  -8.391   5.583 1.00 . A A . 666 GLU HB2  1 1 
        5  6003 1 1 10 GLU HB3  H  -11.920  -6.953   6.316 1.00 . A A . 666 GLU HB3  1 1 
        5  6004 1 1 10 GLU HG2  H  -11.993  -8.600   7.996 1.00 . A A . 666 GLU HG2  1 1 
        5  6005 1 1 10 GLU HG3  H  -13.268  -7.445   8.366 1.00 . A A . 666 GLU HG3  1 1 
        5  6006 1 1 10 GLU N    N  -15.245  -7.507   5.826 1.00 . A A . 666 GLU N    1 1 
        5  6007 1 1 10 GLU O    O  -14.065  -6.883   3.378 1.00 . A A . 666 GLU O    1 1 
        5  6008 1 1 10 GLU OE1  O  -13.649 -10.457   7.228 1.00 . A A . 666 GLU OE1  1 1 
        5  6009 1 1 10 GLU OE2  O  -15.071  -9.150   8.259 1.00 . A A . 666 GLU OE2  1 1 
        5  6010 1 1 11 PRO C    C  -11.573  -5.315   2.140 1.00 . A A . 667 PRO C    1 1 
        5  6011 1 1 11 PRO CA   C  -12.639  -4.521   2.916 1.00 . A A . 667 PRO CA   1 1 
        5  6012 1 1 11 PRO CB   C  -12.110  -3.128   3.278 1.00 . A A . 667 PRO CB   1 1 
        5  6013 1 1 11 PRO CD   C  -12.426  -4.301   5.341 1.00 . A A . 667 PRO CD   1 1 
        5  6014 1 1 11 PRO CG   C  -11.553  -3.284   4.652 1.00 . A A . 667 PRO CG   1 1 
        5  6015 1 1 11 PRO HA   H  -13.523  -4.421   2.300 1.00 . A A . 667 PRO HA   1 1 
        5  6016 1 1 11 PRO HB2  H  -11.349  -2.826   2.572 1.00 . A A . 667 PRO HB2  1 1 
        5  6017 1 1 11 PRO HB3  H  -12.923  -2.415   3.262 1.00 . A A . 667 PRO HB3  1 1 
        5  6018 1 1 11 PRO HD2  H  -11.840  -4.912   6.011 1.00 . A A . 667 PRO HD2  1 1 
        5  6019 1 1 11 PRO HD3  H  -13.225  -3.812   5.878 1.00 . A A . 667 PRO HD3  1 1 
        5  6020 1 1 11 PRO HG2  H  -10.532  -3.640   4.597 1.00 . A A . 667 PRO HG2  1 1 
        5  6021 1 1 11 PRO HG3  H  -11.590  -2.338   5.175 1.00 . A A . 667 PRO HG3  1 1 
        5  6022 1 1 11 PRO N    N  -12.966  -5.107   4.230 1.00 . A A . 667 PRO N    1 1 
        5  6023 1 1 11 PRO O    O  -10.743  -6.012   2.728 1.00 . A A . 667 PRO O    1 1 
        5  6024 1 1 12 LYS C    C   -9.443  -4.964  -0.347 1.00 . A A . 668 LYS C    1 1 
        5  6025 1 1 12 LYS CA   C  -10.641  -5.885  -0.052 1.00 . A A . 668 LYS CA   1 1 
        5  6026 1 1 12 LYS CB   C  -11.341  -6.323  -1.354 1.00 . A A . 668 LYS CB   1 1 
        5  6027 1 1 12 LYS CD   C   -9.441  -6.818  -2.997 1.00 . A A . 668 LYS CD   1 1 
        5  6028 1 1 12 LYS CE   C   -8.791  -7.900  -3.861 1.00 . A A . 668 LYS CE   1 1 
        5  6029 1 1 12 LYS CG   C  -10.592  -7.388  -2.163 1.00 . A A . 668 LYS CG   1 1 
        5  6030 1 1 12 LYS H    H  -12.307  -4.658   0.405 1.00 . A A . 668 LYS H    1 1 
        5  6031 1 1 12 LYS HA   H  -10.285  -6.764   0.468 1.00 . A A . 668 LYS HA   1 1 
        5  6032 1 1 12 LYS HB2  H  -12.313  -6.724  -1.101 1.00 . A A . 668 LYS HB2  1 1 
        5  6033 1 1 12 LYS HB3  H  -11.481  -5.455  -1.983 1.00 . A A . 668 LYS HB3  1 1 
        5  6034 1 1 12 LYS HD2  H   -9.822  -6.039  -3.639 1.00 . A A . 668 LYS HD2  1 1 
        5  6035 1 1 12 LYS HD3  H   -8.695  -6.406  -2.332 1.00 . A A . 668 LYS HD3  1 1 
        5  6036 1 1 12 LYS HE2  H   -8.333  -8.632  -3.213 1.00 . A A . 668 LYS HE2  1 1 
        5  6037 1 1 12 LYS HE3  H   -9.558  -8.378  -4.453 1.00 . A A . 668 LYS HE3  1 1 
        5  6038 1 1 12 LYS HG2  H  -10.189  -8.120  -1.479 1.00 . A A . 668 LYS HG2  1 1 
        5  6039 1 1 12 LYS HG3  H  -11.296  -7.873  -2.827 1.00 . A A . 668 LYS HG3  1 1 
        5  6040 1 1 12 LYS HZ1  H   -7.334  -8.118  -5.341 1.00 . A A . 668 LYS HZ1  1 1 
        5  6041 1 1 12 LYS HZ2  H   -6.991  -6.898  -4.224 1.00 . A A . 668 LYS HZ2  1 1 
        5  6042 1 1 12 LYS HZ3  H   -8.163  -6.645  -5.412 1.00 . A A . 668 LYS HZ3  1 1 
        5  6043 1 1 12 LYS N    N  -11.608  -5.207   0.815 1.00 . A A . 668 LYS N    1 1 
        5  6044 1 1 12 LYS NZ   N   -7.750  -7.352  -4.772 1.00 . A A . 668 LYS NZ   1 1 
        5  6045 1 1 12 LYS O    O   -9.548  -4.009  -1.125 1.00 . A A . 668 LYS O    1 1 
        5  6046 1 1 13 LEU C    C   -6.167  -5.053  -0.940 1.00 . A A . 669 LEU C    1 1 
        5  6047 1 1 13 LEU CA   C   -7.093  -4.446   0.128 1.00 . A A . 669 LEU CA   1 1 
        5  6048 1 1 13 LEU CB   C   -6.354  -4.339   1.473 1.00 . A A . 669 LEU CB   1 1 
        5  6049 1 1 13 LEU CD1  C   -5.305  -2.079   1.015 1.00 . A A . 669 LEU CD1  1 1 
        5  6050 1 1 13 LEU CD2  C   -4.374  -3.552   2.825 1.00 . A A . 669 LEU CD2  1 1 
        5  6051 1 1 13 LEU CG   C   -5.047  -3.520   1.456 1.00 . A A . 669 LEU CG   1 1 
        5  6052 1 1 13 LEU H    H   -8.293  -6.023   0.898 1.00 . A A . 669 LEU H    1 1 
        5  6053 1 1 13 LEU HA   H   -7.388  -3.456  -0.187 1.00 . A A . 669 LEU HA   1 1 
        5  6054 1 1 13 LEU HB2  H   -7.028  -3.890   2.190 1.00 . A A . 669 LEU HB2  1 1 
        5  6055 1 1 13 LEU HB3  H   -6.121  -5.339   1.808 1.00 . A A . 669 LEU HB3  1 1 
        5  6056 1 1 13 LEU HD11 H   -6.006  -1.612   1.693 1.00 . A A . 669 LEU HD11 1 1 
        5  6057 1 1 13 LEU HD12 H   -5.715  -2.075   0.016 1.00 . A A . 669 LEU HD12 1 1 
        5  6058 1 1 13 LEU HD13 H   -4.375  -1.526   1.022 1.00 . A A . 669 LEU HD13 1 1 
        5  6059 1 1 13 LEU HD21 H   -5.029  -3.106   3.562 1.00 . A A . 669 LEU HD21 1 1 
        5  6060 1 1 13 LEU HD22 H   -3.448  -2.998   2.786 1.00 . A A . 669 LEU HD22 1 1 
        5  6061 1 1 13 LEU HD23 H   -4.168  -4.576   3.102 1.00 . A A . 669 LEU HD23 1 1 
        5  6062 1 1 13 LEU HG   H   -4.365  -3.963   0.741 1.00 . A A . 669 LEU HG   1 1 
        5  6063 1 1 13 LEU N    N   -8.312  -5.248   0.295 1.00 . A A . 669 LEU N    1 1 
        5  6064 1 1 13 LEU O    O   -5.715  -6.191  -0.812 1.00 . A A . 669 LEU O    1 1 
        5  6065 1 1 14 THR C    C   -3.614  -4.160  -2.976 1.00 . A A . 670 THR C    1 1 
        5  6066 1 1 14 THR CA   C   -5.024  -4.753  -3.089 1.00 . A A . 670 THR CA   1 1 
        5  6067 1 1 14 THR CB   C   -5.622  -4.385  -4.473 1.00 . A A . 670 THR CB   1 1 
        5  6068 1 1 14 THR CG2  C   -4.744  -4.896  -5.614 1.00 . A A . 670 THR CG2  1 1 
        5  6069 1 1 14 THR H    H   -6.255  -3.383  -2.027 1.00 . A A . 670 THR H    1 1 
        5  6070 1 1 14 THR HA   H   -4.956  -5.830  -3.028 1.00 . A A . 670 THR HA   1 1 
        5  6071 1 1 14 THR HB   H   -5.692  -3.307  -4.546 1.00 . A A . 670 THR HB   1 1 
        5  6072 1 1 14 THR HG1  H   -7.587  -4.230  -4.623 1.00 . A A . 670 THR HG1  1 1 
        5  6073 1 1 14 THR HG21 H   -4.664  -5.972  -5.556 1.00 . A A . 670 THR HG21 1 1 
        5  6074 1 1 14 THR HG22 H   -3.760  -4.459  -5.536 1.00 . A A . 670 THR HG22 1 1 
        5  6075 1 1 14 THR HG23 H   -5.184  -4.620  -6.563 1.00 . A A . 670 THR HG23 1 1 
        5  6076 1 1 14 THR N    N   -5.886  -4.287  -1.990 1.00 . A A . 670 THR N    1 1 
        5  6077 1 1 14 THR O    O   -3.417  -2.958  -3.166 1.00 . A A . 670 THR O    1 1 
        5  6078 1 1 14 THR OG1  O   -6.938  -4.945  -4.599 1.00 . A A . 670 THR OG1  1 1 
        5  6079 1 1 15 VAL C    C   -0.289  -5.598  -3.216 1.00 . A A . 671 VAL C    1 1 
        5  6080 1 1 15 VAL CA   C   -1.235  -4.608  -2.509 1.00 . A A . 671 VAL CA   1 1 
        5  6081 1 1 15 VAL CB   C   -0.831  -4.519  -1.010 1.00 . A A . 671 VAL CB   1 1 
        5  6082 1 1 15 VAL CG1  C    0.646  -4.160  -0.862 1.00 . A A . 671 VAL CG1  1 1 
        5  6083 1 1 15 VAL CG2  C   -1.705  -3.513  -0.264 1.00 . A A . 671 VAL CG2  1 1 
        5  6084 1 1 15 VAL H    H   -2.872  -5.961  -2.529 1.00 . A A . 671 VAL H    1 1 
        5  6085 1 1 15 VAL HA   H   -1.116  -3.628  -2.954 1.00 . A A . 671 VAL HA   1 1 
        5  6086 1 1 15 VAL HB   H   -0.984  -5.493  -0.561 1.00 . A A . 671 VAL HB   1 1 
        5  6087 1 1 15 VAL HG11 H    0.839  -3.211  -1.345 1.00 . A A . 671 VAL HG11 1 1 
        5  6088 1 1 15 VAL HG12 H    1.251  -4.925  -1.323 1.00 . A A . 671 VAL HG12 1 1 
        5  6089 1 1 15 VAL HG13 H    0.898  -4.087   0.186 1.00 . A A . 671 VAL HG13 1 1 
        5  6090 1 1 15 VAL HG21 H   -2.741  -3.805  -0.348 1.00 . A A . 671 VAL HG21 1 1 
        5  6091 1 1 15 VAL HG22 H   -1.572  -2.532  -0.694 1.00 . A A . 671 VAL HG22 1 1 
        5  6092 1 1 15 VAL HG23 H   -1.421  -3.490   0.778 1.00 . A A . 671 VAL HG23 1 1 
        5  6093 1 1 15 VAL N    N   -2.641  -5.017  -2.664 1.00 . A A . 671 VAL N    1 1 
        5  6094 1 1 15 VAL O    O   -0.341  -6.803  -2.955 1.00 . A A . 671 VAL O    1 1 
        5  6095 1 1 16 PRO C    C    2.679  -6.486  -3.916 1.00 . A A . 672 PRO C    1 1 
        5  6096 1 1 16 PRO CA   C    1.546  -5.979  -4.827 1.00 . A A . 672 PRO CA   1 1 
        5  6097 1 1 16 PRO CB   C    2.091  -5.064  -5.933 1.00 . A A . 672 PRO CB   1 1 
        5  6098 1 1 16 PRO CD   C    0.767  -3.687  -4.473 1.00 . A A . 672 PRO CD   1 1 
        5  6099 1 1 16 PRO CG   C    1.978  -3.685  -5.373 1.00 . A A . 672 PRO CG   1 1 
        5  6100 1 1 16 PRO HA   H    1.040  -6.824  -5.270 1.00 . A A . 672 PRO HA   1 1 
        5  6101 1 1 16 PRO HB2  H    3.118  -5.322  -6.150 1.00 . A A . 672 PRO HB2  1 1 
        5  6102 1 1 16 PRO HB3  H    1.491  -5.175  -6.826 1.00 . A A . 672 PRO HB3  1 1 
        5  6103 1 1 16 PRO HD2  H    0.949  -3.084  -3.593 1.00 . A A . 672 PRO HD2  1 1 
        5  6104 1 1 16 PRO HD3  H   -0.098  -3.323  -5.004 1.00 . A A . 672 PRO HD3  1 1 
        5  6105 1 1 16 PRO HG2  H    2.868  -3.447  -4.805 1.00 . A A . 672 PRO HG2  1 1 
        5  6106 1 1 16 PRO HG3  H    1.848  -2.972  -6.175 1.00 . A A . 672 PRO HG3  1 1 
        5  6107 1 1 16 PRO N    N    0.600  -5.111  -4.107 1.00 . A A . 672 PRO N    1 1 
        5  6108 1 1 16 PRO O    O    3.122  -5.779  -3.013 1.00 . A A . 672 PRO O    1 1 
        5  6109 1 1 17 VAL C    C    5.530  -7.578  -3.446 1.00 . A A . 673 VAL C    1 1 
        5  6110 1 1 17 VAL CA   C    4.186  -8.323  -3.320 1.00 . A A . 673 VAL CA   1 1 
        5  6111 1 1 17 VAL CB   C    4.387  -9.822  -3.674 1.00 . A A . 673 VAL CB   1 1 
        5  6112 1 1 17 VAL CG1  C    4.866  -9.989  -5.113 1.00 . A A . 673 VAL CG1  1 1 
        5  6113 1 1 17 VAL CG2  C    5.352 -10.493  -2.694 1.00 . A A . 673 VAL CG2  1 1 
        5  6114 1 1 17 VAL H    H    2.750  -8.233  -4.887 1.00 . A A . 673 VAL H    1 1 
        5  6115 1 1 17 VAL HA   H    3.859  -8.266  -2.291 1.00 . A A . 673 VAL HA   1 1 
        5  6116 1 1 17 VAL HB   H    3.427 -10.315  -3.587 1.00 . A A . 673 VAL HB   1 1 
        5  6117 1 1 17 VAL HG11 H    4.145  -9.550  -5.787 1.00 . A A . 673 VAL HG11 1 1 
        5  6118 1 1 17 VAL HG12 H    4.976 -11.039  -5.340 1.00 . A A . 673 VAL HG12 1 1 
        5  6119 1 1 17 VAL HG13 H    5.819  -9.493  -5.237 1.00 . A A . 673 VAL HG13 1 1 
        5  6120 1 1 17 VAL HG21 H    5.475 -11.533  -2.964 1.00 . A A . 673 VAL HG21 1 1 
        5  6121 1 1 17 VAL HG22 H    4.954 -10.427  -1.691 1.00 . A A . 673 VAL HG22 1 1 
        5  6122 1 1 17 VAL HG23 H    6.313  -9.996  -2.734 1.00 . A A . 673 VAL HG23 1 1 
        5  6123 1 1 17 VAL N    N    3.136  -7.714  -4.150 1.00 . A A . 673 VAL N    1 1 
        5  6124 1 1 17 VAL O    O    6.298  -7.497  -2.485 1.00 . A A . 673 VAL O    1 1 
        5  6125 1 1 18 GLY C    C    7.036  -5.396  -6.064 1.00 . A A . 674 GLY C    1 1 
        5  6126 1 1 18 GLY CA   C    7.062  -6.315  -4.845 1.00 . A A . 674 GLY CA   1 1 
        5  6127 1 1 18 GLY H    H    5.153  -7.097  -5.353 1.00 . A A . 674 GLY H    1 1 
        5  6128 1 1 18 GLY HA2  H    7.281  -5.718  -3.970 1.00 . A A . 674 GLY HA2  1 1 
        5  6129 1 1 18 GLY HA3  H    7.853  -7.039  -4.976 1.00 . A A . 674 GLY HA3  1 1 
        5  6130 1 1 18 GLY N    N    5.806  -7.026  -4.628 1.00 . A A . 674 GLY N    1 1 
        5  6131 1 1 18 GLY O    O    6.373  -5.689  -7.060 1.00 . A A . 674 GLY O    1 1 
        5  6132 1 1 19 ALA C    C    9.310  -2.857  -7.287 1.00 . A A . 675 ALA C    1 1 
        5  6133 1 1 19 ALA CA   C    7.858  -3.312  -7.077 1.00 . A A . 675 ALA CA   1 1 
        5  6134 1 1 19 ALA CB   C    6.960  -2.114  -6.792 1.00 . A A . 675 ALA CB   1 1 
        5  6135 1 1 19 ALA H    H    8.274  -4.116  -5.159 1.00 . A A . 675 ALA H    1 1 
        5  6136 1 1 19 ALA HA   H    7.506  -3.792  -7.981 1.00 . A A . 675 ALA HA   1 1 
        5  6137 1 1 19 ALA HB1  H    7.307  -1.601  -5.905 1.00 . A A . 675 ALA HB1  1 1 
        5  6138 1 1 19 ALA HB2  H    5.946  -2.452  -6.636 1.00 . A A . 675 ALA HB2  1 1 
        5  6139 1 1 19 ALA HB3  H    6.984  -1.434  -7.632 1.00 . A A . 675 ALA HB3  1 1 
        5  6140 1 1 19 ALA N    N    7.770  -4.286  -5.982 1.00 . A A . 675 ALA N    1 1 
        5  6141 1 1 19 ALA O    O   10.045  -2.635  -6.321 1.00 . A A . 675 ALA O    1 1 
        5  6142 1 1 20 THR C    C   11.253  -1.028  -9.582 1.00 . A A . 676 THR C    1 1 
        5  6143 1 1 20 THR CA   C   11.117  -2.382  -8.868 1.00 . A A . 676 THR CA   1 1 
        5  6144 1 1 20 THR CB   C   11.757  -3.482  -9.754 1.00 . A A . 676 THR CB   1 1 
        5  6145 1 1 20 THR CG2  C   13.199  -3.131 -10.113 1.00 . A A . 676 THR CG2  1 1 
        5  6146 1 1 20 THR H    H    9.071  -2.824  -9.277 1.00 . A A . 676 THR H    1 1 
        5  6147 1 1 20 THR HA   H   11.673  -2.341  -7.938 1.00 . A A . 676 THR HA   1 1 
        5  6148 1 1 20 THR HB   H   11.184  -3.564 -10.668 1.00 . A A . 676 THR HB   1 1 
        5  6149 1 1 20 THR HG1  H   12.607  -5.153  -9.113 1.00 . A A . 676 THR HG1  1 1 
        5  6150 1 1 20 THR HG21 H   13.615  -3.911 -10.733 1.00 . A A . 676 THR HG21 1 1 
        5  6151 1 1 20 THR HG22 H   13.785  -3.040  -9.209 1.00 . A A . 676 THR HG22 1 1 
        5  6152 1 1 20 THR HG23 H   13.221  -2.194 -10.650 1.00 . A A . 676 THR HG23 1 1 
        5  6153 1 1 20 THR N    N    9.719  -2.712  -8.545 1.00 . A A . 676 THR N    1 1 
        5  6154 1 1 20 THR O    O   10.650  -0.803 -10.630 1.00 . A A . 676 THR O    1 1 
        5  6155 1 1 20 THR OG1  O   11.728  -4.749  -9.073 1.00 . A A . 676 THR OG1  1 1 
        5  6156 1 1 21 ILE C    C   13.891   1.413  -9.645 1.00 . A A . 677 ILE C    1 1 
        5  6157 1 1 21 ILE CA   C   12.370   1.169  -9.621 1.00 . A A . 677 ILE CA   1 1 
        5  6158 1 1 21 ILE CB   C   11.677   2.338  -8.865 1.00 . A A . 677 ILE CB   1 1 
        5  6159 1 1 21 ILE CD1  C   11.525   3.513  -6.595 1.00 . A A . 677 ILE CD1  1 1 
        5  6160 1 1 21 ILE CG1  C   12.115   2.366  -7.391 1.00 . A A . 677 ILE CG1  1 1 
        5  6161 1 1 21 ILE CG2  C   10.155   2.235  -8.975 1.00 . A A . 677 ILE CG2  1 1 
        5  6162 1 1 21 ILE H    H   12.485  -0.366  -8.153 1.00 . A A . 677 ILE H    1 1 
        5  6163 1 1 21 ILE HA   H   12.005   1.157 -10.639 1.00 . A A . 677 ILE HA   1 1 
        5  6164 1 1 21 ILE HB   H   11.977   3.267  -9.336 1.00 . A A . 677 ILE HB   1 1 
        5  6165 1 1 21 ILE HD11 H   11.919   3.494  -5.589 1.00 . A A . 677 ILE HD11 1 1 
        5  6166 1 1 21 ILE HD12 H   10.449   3.413  -6.561 1.00 . A A . 677 ILE HD12 1 1 
        5  6167 1 1 21 ILE HD13 H   11.784   4.451  -7.065 1.00 . A A . 677 ILE HD13 1 1 
        5  6168 1 1 21 ILE HG12 H   11.816   1.447  -6.912 1.00 . A A . 677 ILE HG12 1 1 
        5  6169 1 1 21 ILE HG13 H   13.191   2.455  -7.346 1.00 . A A . 677 ILE HG13 1 1 
        5  6170 1 1 21 ILE HG21 H    9.696   3.069  -8.461 1.00 . A A . 677 ILE HG21 1 1 
        5  6171 1 1 21 ILE HG22 H    9.821   1.310  -8.527 1.00 . A A . 677 ILE HG22 1 1 
        5  6172 1 1 21 ILE HG23 H    9.867   2.255 -10.017 1.00 . A A . 677 ILE HG23 1 1 
        5  6173 1 1 21 ILE N    N   12.066  -0.138  -9.011 1.00 . A A . 677 ILE N    1 1 
        5  6174 1 1 21 ILE O    O   14.661   0.585  -9.164 1.00 . A A . 677 ILE O    1 1 
        5  6175 1 1 22 HIS C    C   15.993   4.198  -9.400 1.00 . A A . 678 HIS C    1 1 
        5  6176 1 1 22 HIS CA   C   15.749   2.915 -10.217 1.00 . A A . 678 HIS CA   1 1 
        5  6177 1 1 22 HIS CB   C   16.265   3.112 -11.654 1.00 . A A . 678 HIS CB   1 1 
        5  6178 1 1 22 HIS CD2  C   17.480   1.061 -12.677 1.00 . A A . 678 HIS CD2  1 1 
        5  6179 1 1 22 HIS CE1  C   15.787   0.183 -13.748 1.00 . A A . 678 HIS CE1  1 1 
        5  6180 1 1 22 HIS CG   C   16.399   1.845 -12.443 1.00 . A A . 678 HIS CG   1 1 
        5  6181 1 1 22 HIS H    H   13.676   3.120 -10.670 1.00 . A A . 678 HIS H    1 1 
        5  6182 1 1 22 HIS HA   H   16.306   2.111  -9.757 1.00 . A A . 678 HIS HA   1 1 
        5  6183 1 1 22 HIS HB2  H   15.583   3.755 -12.188 1.00 . A A . 678 HIS HB2  1 1 
        5  6184 1 1 22 HIS HB3  H   17.239   3.583 -11.619 1.00 . A A . 678 HIS HB3  1 1 
        5  6185 1 1 22 HIS HD1  H   14.428   1.588 -13.154 1.00 . A A . 678 HIS HD1  1 1 
        5  6186 1 1 22 HIS HD2  H   18.478   1.214 -12.287 1.00 . A A . 678 HIS HD2  1 1 
        5  6187 1 1 22 HIS HE1  H   15.189  -0.473 -14.363 1.00 . A A . 678 HIS HE1  1 1 
        5  6188 1 1 22 HIS HE2  H   17.679  -0.526 -14.027 1.00 . A A . 678 HIS HE2  1 1 
        5  6189 1 1 22 HIS N    N   14.324   2.533 -10.224 1.00 . A A . 678 HIS N    1 1 
        5  6190 1 1 22 HIS ND1  N   15.356   1.262 -13.128 1.00 . A A . 678 HIS ND1  1 1 
        5  6191 1 1 22 HIS NE2  N   17.072   0.037 -13.494 1.00 . A A . 678 HIS NE2  1 1 
        5  6192 1 1 22 HIS O    O   15.056   4.894  -9.010 1.00 . A A . 678 HIS O    1 1 
        5  6193 1 1 23 VAL C    C   17.264   6.963  -9.283 1.00 . A A . 679 VAL C    1 1 
        5  6194 1 1 23 VAL CA   C   17.649   5.732  -8.447 1.00 . A A . 679 VAL CA   1 1 
        5  6195 1 1 23 VAL CB   C   19.172   5.769  -8.155 1.00 . A A . 679 VAL CB   1 1 
        5  6196 1 1 23 VAL CG1  C   19.564   7.076  -7.465 1.00 . A A . 679 VAL CG1  1 1 
        5  6197 1 1 23 VAL CG2  C   19.593   4.562  -7.315 1.00 . A A . 679 VAL CG2  1 1 
        5  6198 1 1 23 VAL H    H   17.965   3.867  -9.410 1.00 . A A . 679 VAL H    1 1 
        5  6199 1 1 23 VAL HA   H   17.117   5.766  -7.504 1.00 . A A . 679 VAL HA   1 1 
        5  6200 1 1 23 VAL HB   H   19.698   5.721  -9.100 1.00 . A A . 679 VAL HB   1 1 
        5  6201 1 1 23 VAL HG11 H   19.000   7.184  -6.548 1.00 . A A . 679 VAL HG11 1 1 
        5  6202 1 1 23 VAL HG12 H   19.347   7.910  -8.117 1.00 . A A . 679 VAL HG12 1 1 
        5  6203 1 1 23 VAL HG13 H   20.620   7.065  -7.237 1.00 . A A . 679 VAL HG13 1 1 
        5  6204 1 1 23 VAL HG21 H   19.332   3.651  -7.835 1.00 . A A . 679 VAL HG21 1 1 
        5  6205 1 1 23 VAL HG22 H   19.085   4.589  -6.363 1.00 . A A . 679 VAL HG22 1 1 
        5  6206 1 1 23 VAL HG23 H   20.661   4.588  -7.154 1.00 . A A . 679 VAL HG23 1 1 
        5  6207 1 1 23 VAL N    N   17.266   4.496  -9.139 1.00 . A A . 679 VAL N    1 1 
        5  6208 1 1 23 VAL O    O   17.752   7.139 -10.398 1.00 . A A . 679 VAL O    1 1 
        5  6209 1 1 24 GLY C    C   14.604   8.758 -10.199 1.00 . A A . 680 GLY C    1 1 
        5  6210 1 1 24 GLY CA   C   15.919   8.984  -9.455 1.00 . A A . 680 GLY CA   1 1 
        5  6211 1 1 24 GLY H    H   16.051   7.615  -7.838 1.00 . A A . 680 GLY H    1 1 
        5  6212 1 1 24 GLY HA2  H   15.778   9.781  -8.739 1.00 . A A . 680 GLY HA2  1 1 
        5  6213 1 1 24 GLY HA3  H   16.674   9.288 -10.167 1.00 . A A . 680 GLY HA3  1 1 
        5  6214 1 1 24 GLY N    N   16.384   7.800  -8.740 1.00 . A A . 680 GLY N    1 1 
        5  6215 1 1 24 GLY O    O   14.170   9.609 -10.975 1.00 . A A . 680 GLY O    1 1 
        5  6216 1 1 25 ASP C    C   11.512   7.659  -9.675 1.00 . A A . 681 ASP C    1 1 
        5  6217 1 1 25 ASP CA   C   12.688   7.282 -10.592 1.00 . A A . 681 ASP CA   1 1 
        5  6218 1 1 25 ASP CB   C   12.632   5.785 -10.931 1.00 . A A . 681 ASP CB   1 1 
        5  6219 1 1 25 ASP CG   C   13.621   5.376 -12.013 1.00 . A A . 681 ASP CG   1 1 
        5  6220 1 1 25 ASP H    H   14.393   6.951  -9.374 1.00 . A A . 681 ASP H    1 1 
        5  6221 1 1 25 ASP HA   H   12.606   7.850 -11.509 1.00 . A A . 681 ASP HA   1 1 
        5  6222 1 1 25 ASP HB2  H   12.853   5.214 -10.040 1.00 . A A . 681 ASP HB2  1 1 
        5  6223 1 1 25 ASP HB3  H   11.634   5.539 -11.269 1.00 . A A . 681 ASP HB3  1 1 
        5  6224 1 1 25 ASP N    N   13.978   7.607  -9.971 1.00 . A A . 681 ASP N    1 1 
        5  6225 1 1 25 ASP O    O   11.693   7.925  -8.485 1.00 . A A . 681 ASP O    1 1 
        5  6226 1 1 25 ASP OD1  O   14.627   6.093 -12.227 1.00 . A A . 681 ASP OD1  1 1 
        5  6227 1 1 25 ASP OD2  O   13.404   4.320 -12.648 1.00 . A A . 681 ASP OD2  1 1 
        5  6228 1 1 26 SER C    C    8.399   6.784  -8.928 1.00 . A A . 682 SER C    1 1 
        5  6229 1 1 26 SER CA   C    9.094   8.031  -9.490 1.00 . A A . 682 SER CA   1 1 
        5  6230 1 1 26 SER CB   C    8.111   8.799 -10.388 1.00 . A A . 682 SER CB   1 1 
        5  6231 1 1 26 SER H    H   10.227   7.439 -11.187 1.00 . A A . 682 SER H    1 1 
        5  6232 1 1 26 SER HA   H    9.385   8.668  -8.666 1.00 . A A . 682 SER HA   1 1 
        5  6233 1 1 26 SER HB2  H    7.806   8.166 -11.210 1.00 . A A . 682 SER HB2  1 1 
        5  6234 1 1 26 SER HB3  H    7.242   9.079  -9.810 1.00 . A A . 682 SER HB3  1 1 
        5  6235 1 1 26 SER HG   H    8.746   9.900 -11.883 1.00 . A A . 682 SER HG   1 1 
        5  6236 1 1 26 SER N    N   10.307   7.677 -10.241 1.00 . A A . 682 SER N    1 1 
        5  6237 1 1 26 SER O    O    8.457   5.706  -9.523 1.00 . A A . 682 SER O    1 1 
        5  6238 1 1 26 SER OG   O    8.700   9.977 -10.921 1.00 . A A . 682 SER OG   1 1 
        5  6239 1 1 27 PHE C    C    5.810   6.362  -6.342 1.00 . A A . 683 PHE C    1 1 
        5  6240 1 1 27 PHE CA   C    6.995   5.831  -7.163 1.00 . A A . 683 PHE CA   1 1 
        5  6241 1 1 27 PHE CB   C    7.937   5.007  -6.271 1.00 . A A . 683 PHE CB   1 1 
        5  6242 1 1 27 PHE CD1  C    7.152   2.617  -6.422 1.00 . A A . 683 PHE CD1  1 1 
        5  6243 1 1 27 PHE CD2  C    6.841   3.777  -4.359 1.00 . A A . 683 PHE CD2  1 1 
        5  6244 1 1 27 PHE CE1  C    6.567   1.489  -5.878 1.00 . A A . 683 PHE CE1  1 1 
        5  6245 1 1 27 PHE CE2  C    6.255   2.651  -3.813 1.00 . A A . 683 PHE CE2  1 1 
        5  6246 1 1 27 PHE CG   C    7.296   3.776  -5.672 1.00 . A A . 683 PHE CG   1 1 
        5  6247 1 1 27 PHE CZ   C    6.120   1.506  -4.573 1.00 . A A . 683 PHE CZ   1 1 
        5  6248 1 1 27 PHE H    H    7.732   7.818  -7.350 1.00 . A A . 683 PHE H    1 1 
        5  6249 1 1 27 PHE HA   H    6.614   5.196  -7.952 1.00 . A A . 683 PHE HA   1 1 
        5  6250 1 1 27 PHE HB2  H    8.787   4.685  -6.858 1.00 . A A . 683 PHE HB2  1 1 
        5  6251 1 1 27 PHE HB3  H    8.289   5.630  -5.461 1.00 . A A . 683 PHE HB3  1 1 
        5  6252 1 1 27 PHE HD1  H    7.499   2.600  -7.446 1.00 . A A . 683 PHE HD1  1 1 
        5  6253 1 1 27 PHE HD2  H    6.946   4.673  -3.761 1.00 . A A . 683 PHE HD2  1 1 
        5  6254 1 1 27 PHE HE1  H    6.463   0.593  -6.474 1.00 . A A . 683 PHE HE1  1 1 
        5  6255 1 1 27 PHE HE2  H    5.904   2.667  -2.791 1.00 . A A . 683 PHE HE2  1 1 
        5  6256 1 1 27 PHE HZ   H    5.663   0.624  -4.147 1.00 . A A . 683 PHE HZ   1 1 
        5  6257 1 1 27 PHE N    N    7.731   6.936  -7.789 1.00 . A A . 683 PHE N    1 1 
        5  6258 1 1 27 PHE O    O    5.997   7.087  -5.362 1.00 . A A . 683 PHE O    1 1 
        5  6259 1 1 28 VAL C    C    2.582   5.307  -5.442 1.00 . A A . 684 VAL C    1 1 
        5  6260 1 1 28 VAL CA   C    3.376   6.478  -6.060 1.00 . A A . 684 VAL CA   1 1 
        5  6261 1 1 28 VAL CB   C    2.456   7.270  -7.028 1.00 . A A . 684 VAL CB   1 1 
        5  6262 1 1 28 VAL CG1  C    1.276   7.890  -6.279 1.00 . A A . 684 VAL CG1  1 1 
        5  6263 1 1 28 VAL CG2  C    3.249   8.345  -7.770 1.00 . A A . 684 VAL CG2  1 1 
        5  6264 1 1 28 VAL H    H    4.500   5.407  -7.516 1.00 . A A . 684 VAL H    1 1 
        5  6265 1 1 28 VAL HA   H    3.680   7.147  -5.265 1.00 . A A . 684 VAL HA   1 1 
        5  6266 1 1 28 VAL HB   H    2.061   6.578  -7.761 1.00 . A A . 684 VAL HB   1 1 
        5  6267 1 1 28 VAL HG11 H    1.644   8.576  -5.529 1.00 . A A . 684 VAL HG11 1 1 
        5  6268 1 1 28 VAL HG12 H    0.701   7.109  -5.799 1.00 . A A . 684 VAL HG12 1 1 
        5  6269 1 1 28 VAL HG13 H    0.645   8.424  -6.974 1.00 . A A . 684 VAL HG13 1 1 
        5  6270 1 1 28 VAL HG21 H    3.679   9.034  -7.057 1.00 . A A . 684 VAL HG21 1 1 
        5  6271 1 1 28 VAL HG22 H    2.593   8.882  -8.440 1.00 . A A . 684 VAL HG22 1 1 
        5  6272 1 1 28 VAL HG23 H    4.040   7.880  -8.341 1.00 . A A . 684 VAL HG23 1 1 
        5  6273 1 1 28 VAL N    N    4.588   6.006  -6.744 1.00 . A A . 684 VAL N    1 1 
        5  6274 1 1 28 VAL O    O    1.726   4.702  -6.094 1.00 . A A . 684 VAL O    1 1 
        5  6275 1 1 29 PRO C    C    0.659   4.022  -3.366 1.00 . A A . 685 PRO C    1 1 
        5  6276 1 1 29 PRO CA   C    2.184   3.853  -3.474 1.00 . A A . 685 PRO CA   1 1 
        5  6277 1 1 29 PRO CB   C    2.832   3.851  -2.078 1.00 . A A . 685 PRO CB   1 1 
        5  6278 1 1 29 PRO CD   C    3.791   5.686  -3.272 1.00 . A A . 685 PRO CD   1 1 
        5  6279 1 1 29 PRO CG   C    3.370   5.232  -1.901 1.00 . A A . 685 PRO CG   1 1 
        5  6280 1 1 29 PRO HA   H    2.400   2.918  -3.972 1.00 . A A . 685 PRO HA   1 1 
        5  6281 1 1 29 PRO HB2  H    2.088   3.616  -1.328 1.00 . A A . 685 PRO HB2  1 1 
        5  6282 1 1 29 PRO HB3  H    3.622   3.114  -2.047 1.00 . A A . 685 PRO HB3  1 1 
        5  6283 1 1 29 PRO HD2  H    3.689   6.758  -3.364 1.00 . A A . 685 PRO HD2  1 1 
        5  6284 1 1 29 PRO HD3  H    4.809   5.384  -3.479 1.00 . A A . 685 PRO HD3  1 1 
        5  6285 1 1 29 PRO HG2  H    2.597   5.880  -1.510 1.00 . A A . 685 PRO HG2  1 1 
        5  6286 1 1 29 PRO HG3  H    4.219   5.215  -1.231 1.00 . A A . 685 PRO HG3  1 1 
        5  6287 1 1 29 PRO N    N    2.842   4.984  -4.159 1.00 . A A . 685 PRO N    1 1 
        5  6288 1 1 29 PRO O    O   -0.091   3.047  -3.414 1.00 . A A . 685 PRO O    1 1 
        5  6289 1 1 30 MET C    C   -1.976   5.502  -4.447 1.00 . A A . 686 MET C    1 1 
        5  6290 1 1 30 MET CA   C   -1.227   5.570  -3.105 1.00 . A A . 686 MET CA   1 1 
        5  6291 1 1 30 MET CB   C   -1.406   6.953  -2.469 1.00 . A A . 686 MET CB   1 1 
        5  6292 1 1 30 MET CE   C   -2.635   4.983  -0.156 1.00 . A A . 686 MET CE   1 1 
        5  6293 1 1 30 MET CG   C   -0.930   7.048  -1.018 1.00 . A A . 686 MET CG   1 1 
        5  6294 1 1 30 MET H    H    0.850   6.012  -3.259 1.00 . A A . 686 MET H    1 1 
        5  6295 1 1 30 MET HA   H   -1.650   4.828  -2.442 1.00 . A A . 686 MET HA   1 1 
        5  6296 1 1 30 MET HB2  H   -0.854   7.676  -3.053 1.00 . A A . 686 MET HB2  1 1 
        5  6297 1 1 30 MET HB3  H   -2.455   7.216  -2.496 1.00 . A A . 686 MET HB3  1 1 
        5  6298 1 1 30 MET HE1  H   -3.393   4.644   0.534 1.00 . A A . 686 MET HE1  1 1 
        5  6299 1 1 30 MET HE2  H   -1.751   4.373  -0.045 1.00 . A A . 686 MET HE2  1 1 
        5  6300 1 1 30 MET HE3  H   -3.006   4.900  -1.167 1.00 . A A . 686 MET HE3  1 1 
        5  6301 1 1 30 MET HG2  H   -0.124   6.344  -0.870 1.00 . A A . 686 MET HG2  1 1 
        5  6302 1 1 30 MET HG3  H   -0.562   8.050  -0.840 1.00 . A A . 686 MET HG3  1 1 
        5  6303 1 1 30 MET N    N    0.205   5.271  -3.251 1.00 . A A . 686 MET N    1 1 
        5  6304 1 1 30 MET O    O   -3.191   5.711  -4.501 1.00 . A A . 686 MET O    1 1 
        5  6305 1 1 30 MET SD   S   -2.231   6.695   0.194 1.00 . A A . 686 MET SD   1 1 
        5  6306 1 1 31 ALA C    C   -1.920   3.559  -7.245 1.00 . A A . 687 ALA C    1 1 
        5  6307 1 1 31 ALA CA   C   -1.864   5.042  -6.852 1.00 . A A . 687 ALA CA   1 1 
        5  6308 1 1 31 ALA CB   C   -1.093   5.837  -7.903 1.00 . A A . 687 ALA CB   1 1 
        5  6309 1 1 31 ALA H    H   -0.278   5.142  -5.441 1.00 . A A . 687 ALA H    1 1 
        5  6310 1 1 31 ALA HA   H   -2.874   5.430  -6.811 1.00 . A A . 687 ALA HA   1 1 
        5  6311 1 1 31 ALA HB1  H   -1.576   5.729  -8.865 1.00 . A A . 687 ALA HB1  1 1 
        5  6312 1 1 31 ALA HB2  H   -0.079   5.466  -7.965 1.00 . A A . 687 ALA HB2  1 1 
        5  6313 1 1 31 ALA HB3  H   -1.077   6.881  -7.626 1.00 . A A . 687 ALA HB3  1 1 
        5  6314 1 1 31 ALA N    N   -1.251   5.221  -5.528 1.00 . A A . 687 ALA N    1 1 
        5  6315 1 1 31 ALA O    O   -2.813   3.128  -7.975 1.00 . A A . 687 ALA O    1 1 
        5  6316 1 1 32 GLU C    C   -1.635   0.496  -6.037 1.00 . A A . 688 GLU C    1 1 
        5  6317 1 1 32 GLU CA   C   -0.879   1.349  -7.071 1.00 . A A . 688 GLU CA   1 1 
        5  6318 1 1 32 GLU CB   C    0.591   0.919  -7.149 1.00 . A A . 688 GLU CB   1 1 
        5  6319 1 1 32 GLU CD   C    2.859   1.325  -8.217 1.00 . A A . 688 GLU CD   1 1 
        5  6320 1 1 32 GLU CG   C    1.405   1.754  -8.129 1.00 . A A . 688 GLU CG   1 1 
        5  6321 1 1 32 GLU H    H   -0.268   3.180  -6.186 1.00 . A A . 688 GLU H    1 1 
        5  6322 1 1 32 GLU HA   H   -1.335   1.198  -8.040 1.00 . A A . 688 GLU HA   1 1 
        5  6323 1 1 32 GLU HB2  H    1.037   1.016  -6.167 1.00 . A A . 688 GLU HB2  1 1 
        5  6324 1 1 32 GLU HB3  H    0.641  -0.115  -7.457 1.00 . A A . 688 GLU HB3  1 1 
        5  6325 1 1 32 GLU HG2  H    0.959   1.668  -9.111 1.00 . A A . 688 GLU HG2  1 1 
        5  6326 1 1 32 GLU HG3  H    1.369   2.788  -7.814 1.00 . A A . 688 GLU HG3  1 1 
        5  6327 1 1 32 GLU N    N   -0.955   2.782  -6.758 1.00 . A A . 688 GLU N    1 1 
        5  6328 1 1 32 GLU O    O   -2.127  -0.590  -6.355 1.00 . A A . 688 GLU O    1 1 
        5  6329 1 1 32 GLU OE1  O    3.639   1.669  -7.309 1.00 . A A . 688 GLU OE1  1 1 
        5  6330 1 1 32 GLU OE2  O    3.232   0.662  -9.211 1.00 . A A . 688 GLU OE2  1 1 
        5  6331 1 1 33 VAL C    C   -3.870   0.853  -3.556 1.00 . A A . 689 VAL C    1 1 
        5  6332 1 1 33 VAL CA   C   -2.451   0.291  -3.733 1.00 . A A . 689 VAL CA   1 1 
        5  6333 1 1 33 VAL CB   C   -1.688   0.386  -2.389 1.00 . A A . 689 VAL CB   1 1 
        5  6334 1 1 33 VAL CG1  C   -2.503  -0.223  -1.248 1.00 . A A . 689 VAL CG1  1 1 
        5  6335 1 1 33 VAL CG2  C   -0.324  -0.293  -2.505 1.00 . A A . 689 VAL CG2  1 1 
        5  6336 1 1 33 VAL H    H   -1.301   1.850  -4.604 1.00 . A A . 689 VAL H    1 1 
        5  6337 1 1 33 VAL HA   H   -2.522  -0.755  -4.007 1.00 . A A . 689 VAL HA   1 1 
        5  6338 1 1 33 VAL HB   H   -1.526   1.432  -2.163 1.00 . A A . 689 VAL HB   1 1 
        5  6339 1 1 33 VAL HG11 H   -3.423   0.332  -1.124 1.00 . A A . 689 VAL HG11 1 1 
        5  6340 1 1 33 VAL HG12 H   -1.933  -0.180  -0.332 1.00 . A A . 689 VAL HG12 1 1 
        5  6341 1 1 33 VAL HG13 H   -2.735  -1.253  -1.478 1.00 . A A . 689 VAL HG13 1 1 
        5  6342 1 1 33 VAL HG21 H    0.190  -0.237  -1.556 1.00 . A A . 689 VAL HG21 1 1 
        5  6343 1 1 33 VAL HG22 H    0.264   0.205  -3.263 1.00 . A A . 689 VAL HG22 1 1 
        5  6344 1 1 33 VAL HG23 H   -0.459  -1.330  -2.779 1.00 . A A . 689 VAL HG23 1 1 
        5  6345 1 1 33 VAL N    N   -1.726   0.991  -4.804 1.00 . A A . 689 VAL N    1 1 
        5  6346 1 1 33 VAL O    O   -4.054   2.053  -3.344 1.00 . A A . 689 VAL O    1 1 
        5  6347 1 1 34 LEU C    C   -7.012  -0.441  -2.444 1.00 . A A . 690 LEU C    1 1 
        5  6348 1 1 34 LEU CA   C   -6.283   0.370  -3.525 1.00 . A A . 690 LEU CA   1 1 
        5  6349 1 1 34 LEU CB   C   -7.020   0.187  -4.867 1.00 . A A . 690 LEU CB   1 1 
        5  6350 1 1 34 LEU CD1  C   -5.294   0.900  -6.578 1.00 . A A . 690 LEU CD1  1 1 
        5  6351 1 1 34 LEU CD2  C   -7.740   1.158  -7.079 1.00 . A A . 690 LEU CD2  1 1 
        5  6352 1 1 34 LEU CG   C   -6.671   1.185  -5.989 1.00 . A A . 690 LEU CG   1 1 
        5  6353 1 1 34 LEU H    H   -4.651  -0.977  -3.781 1.00 . A A . 690 LEU H    1 1 
        5  6354 1 1 34 LEU HA   H   -6.311   1.416  -3.251 1.00 . A A . 690 LEU HA   1 1 
        5  6355 1 1 34 LEU HB2  H   -6.809  -0.811  -5.230 1.00 . A A . 690 LEU HB2  1 1 
        5  6356 1 1 34 LEU HB3  H   -8.082   0.254  -4.676 1.00 . A A . 690 LEU HB3  1 1 
        5  6357 1 1 34 LEU HD11 H   -5.071   1.631  -7.341 1.00 . A A . 690 LEU HD11 1 1 
        5  6358 1 1 34 LEU HD12 H   -5.284  -0.089  -7.014 1.00 . A A . 690 LEU HD12 1 1 
        5  6359 1 1 34 LEU HD13 H   -4.550   0.957  -5.799 1.00 . A A . 690 LEU HD13 1 1 
        5  6360 1 1 34 LEU HD21 H   -7.813   0.163  -7.493 1.00 . A A . 690 LEU HD21 1 1 
        5  6361 1 1 34 LEU HD22 H   -7.477   1.855  -7.863 1.00 . A A . 690 LEU HD22 1 1 
        5  6362 1 1 34 LEU HD23 H   -8.694   1.441  -6.655 1.00 . A A . 690 LEU HD23 1 1 
        5  6363 1 1 34 LEU HG   H   -6.650   2.183  -5.574 1.00 . A A . 690 LEU HG   1 1 
        5  6364 1 1 34 LEU N    N   -4.868  -0.028  -3.641 1.00 . A A . 690 LEU N    1 1 
        5  6365 1 1 34 LEU O    O   -6.645  -1.581  -2.152 1.00 . A A . 690 LEU O    1 1 
        5  6366 1 1 35 ALA C    C  -10.383  -0.343  -1.119 1.00 . A A . 691 ALA C    1 1 
        5  6367 1 1 35 ALA CA   C   -8.887  -0.567  -0.871 1.00 . A A . 691 ALA CA   1 1 
        5  6368 1 1 35 ALA CB   C   -8.506  -0.106   0.529 1.00 . A A . 691 ALA CB   1 1 
        5  6369 1 1 35 ALA H    H   -8.326   1.043  -2.150 1.00 . A A . 691 ALA H    1 1 
        5  6370 1 1 35 ALA HA   H   -8.677  -1.626  -0.945 1.00 . A A . 691 ALA HA   1 1 
        5  6371 1 1 35 ALA HB1  H   -9.078  -0.659   1.260 1.00 . A A . 691 ALA HB1  1 1 
        5  6372 1 1 35 ALA HB2  H   -8.714   0.949   0.630 1.00 . A A . 691 ALA HB2  1 1 
        5  6373 1 1 35 ALA HB3  H   -7.452  -0.281   0.690 1.00 . A A . 691 ALA HB3  1 1 
        5  6374 1 1 35 ALA N    N   -8.074   0.129  -1.880 1.00 . A A . 691 ALA N    1 1 
        5  6375 1 1 35 ALA O    O  -10.854   0.792  -1.142 1.00 . A A . 691 ALA O    1 1 
        5  6376 1 1 36 ILE C    C  -13.394  -2.237  -0.665 1.00 . A A . 692 ILE C    1 1 
        5  6377 1 1 36 ILE CA   C  -12.560  -1.356  -1.607 1.00 . A A . 692 ILE CA   1 1 
        5  6378 1 1 36 ILE CB   C  -12.840  -1.786  -3.075 1.00 . A A . 692 ILE CB   1 1 
        5  6379 1 1 36 ILE CD1  C  -12.417   0.563  -4.024 1.00 . A A . 692 ILE CD1  1 1 
        5  6380 1 1 36 ILE CG1  C  -12.054  -0.910  -4.071 1.00 . A A . 692 ILE CG1  1 1 
        5  6381 1 1 36 ILE CG2  C  -14.338  -1.732  -3.378 1.00 . A A . 692 ILE CG2  1 1 
        5  6382 1 1 36 ILE H    H  -10.706  -2.314  -1.215 1.00 . A A . 692 ILE H    1 1 
        5  6383 1 1 36 ILE HA   H  -12.875  -0.325  -1.491 1.00 . A A . 692 ILE HA   1 1 
        5  6384 1 1 36 ILE HB   H  -12.520  -2.813  -3.187 1.00 . A A . 692 ILE HB   1 1 
        5  6385 1 1 36 ILE HD11 H  -12.178   0.962  -3.048 1.00 . A A . 692 ILE HD11 1 1 
        5  6386 1 1 36 ILE HD12 H  -13.473   0.684  -4.214 1.00 . A A . 692 ILE HD12 1 1 
        5  6387 1 1 36 ILE HD13 H  -11.854   1.095  -4.776 1.00 . A A . 692 ILE HD13 1 1 
        5  6388 1 1 36 ILE HG12 H  -10.999  -0.992  -3.857 1.00 . A A . 692 ILE HG12 1 1 
        5  6389 1 1 36 ILE HG13 H  -12.240  -1.264  -5.076 1.00 . A A . 692 ILE HG13 1 1 
        5  6390 1 1 36 ILE HG21 H  -14.865  -2.413  -2.725 1.00 . A A . 692 ILE HG21 1 1 
        5  6391 1 1 36 ILE HG22 H  -14.511  -2.015  -4.406 1.00 . A A . 692 ILE HG22 1 1 
        5  6392 1 1 36 ILE HG23 H  -14.704  -0.726  -3.217 1.00 . A A . 692 ILE HG23 1 1 
        5  6393 1 1 36 ILE N    N  -11.127  -1.433  -1.294 1.00 . A A . 692 ILE N    1 1 
        5  6394 1 1 36 ILE O    O  -13.243  -3.461  -0.645 1.00 . A A . 692 ILE O    1 1 
        5  6395 1 1 37 ASP C    C  -16.549  -2.543   0.309 1.00 . A A . 693 ASP C    1 1 
        5  6396 1 1 37 ASP CA   C  -15.192  -2.333   0.997 1.00 . A A . 693 ASP CA   1 1 
        5  6397 1 1 37 ASP CB   C  -15.369  -1.564   2.304 1.00 . A A . 693 ASP CB   1 1 
        5  6398 1 1 37 ASP CG   C  -16.226  -2.313   3.304 1.00 . A A . 693 ASP CG   1 1 
        5  6399 1 1 37 ASP H    H  -14.312  -0.633   0.085 1.00 . A A . 693 ASP H    1 1 
        5  6400 1 1 37 ASP HA   H  -14.756  -3.301   1.211 1.00 . A A . 693 ASP HA   1 1 
        5  6401 1 1 37 ASP HB2  H  -14.398  -1.396   2.748 1.00 . A A . 693 ASP HB2  1 1 
        5  6402 1 1 37 ASP HB3  H  -15.832  -0.608   2.096 1.00 . A A . 693 ASP HB3  1 1 
        5  6403 1 1 37 ASP N    N  -14.273  -1.611   0.110 1.00 . A A . 693 ASP N    1 1 
        5  6404 1 1 37 ASP O    O  -16.976  -1.723  -0.502 1.00 . A A . 693 ASP O    1 1 
        5  6405 1 1 37 ASP OD1  O  -15.768  -3.337   3.845 1.00 . A A . 693 ASP OD1  1 1 
        5  6406 1 1 37 ASP OD2  O  -17.366  -1.891   3.556 1.00 . A A . 693 ASP OD2  1 1 
        5  6407 1 1 38 LYS C    C  -19.647  -3.119   0.216 1.00 . A A . 694 LYS C    1 1 
        5  6408 1 1 38 LYS CA   C  -18.440  -4.034  -0.077 1.00 . A A . 694 LYS CA   1 1 
        5  6409 1 1 38 LYS CB   C  -18.774  -5.502   0.217 1.00 . A A . 694 LYS CB   1 1 
        5  6410 1 1 38 LYS CD   C  -19.914  -7.578  -0.683 1.00 . A A . 694 LYS CD   1 1 
        5  6411 1 1 38 LYS CE   C  -18.678  -8.102  -1.411 1.00 . A A . 694 LYS CE   1 1 
        5  6412 1 1 38 LYS CG   C  -19.926  -6.052  -0.625 1.00 . A A . 694 LYS CG   1 1 
        5  6413 1 1 38 LYS H    H  -16.922  -4.173   1.405 1.00 . A A . 694 LYS H    1 1 
        5  6414 1 1 38 LYS HA   H  -18.211  -3.948  -1.131 1.00 . A A . 694 LYS HA   1 1 
        5  6415 1 1 38 LYS HB2  H  -17.894  -6.101   0.025 1.00 . A A . 694 LYS HB2  1 1 
        5  6416 1 1 38 LYS HB3  H  -19.040  -5.598   1.261 1.00 . A A . 694 LYS HB3  1 1 
        5  6417 1 1 38 LYS HD2  H  -19.917  -7.970   0.323 1.00 . A A . 694 LYS HD2  1 1 
        5  6418 1 1 38 LYS HD3  H  -20.799  -7.917  -1.206 1.00 . A A . 694 LYS HD3  1 1 
        5  6419 1 1 38 LYS HE2  H  -18.676  -7.713  -2.419 1.00 . A A . 694 LYS HE2  1 1 
        5  6420 1 1 38 LYS HE3  H  -17.796  -7.757  -0.891 1.00 . A A . 694 LYS HE3  1 1 
        5  6421 1 1 38 LYS HG2  H  -20.860  -5.729  -0.191 1.00 . A A . 694 LYS HG2  1 1 
        5  6422 1 1 38 LYS HG3  H  -19.845  -5.662  -1.631 1.00 . A A . 694 LYS HG3  1 1 
        5  6423 1 1 38 LYS HZ1  H  -17.824  -9.907  -2.015 1.00 . A A . 694 LYS HZ1  1 1 
        5  6424 1 1 38 LYS HZ2  H  -19.513  -9.946  -1.927 1.00 . A A . 694 LYS HZ2  1 1 
        5  6425 1 1 38 LYS HZ3  H  -18.590  -9.982  -0.511 1.00 . A A . 694 LYS HZ3  1 1 
        5  6426 1 1 38 LYS N    N  -17.232  -3.632   0.649 1.00 . A A . 694 LYS N    1 1 
        5  6427 1 1 38 LYS NZ   N  -18.651  -9.587  -1.468 1.00 . A A . 694 LYS NZ   1 1 
        5  6428 1 1 38 LYS O    O  -20.388  -2.760  -0.703 1.00 . A A . 694 LYS O    1 1 
        5  6429 1 1 39 GLU C    C  -20.573  -0.374   1.616 1.00 . A A . 695 GLU C    1 1 
        5  6430 1 1 39 GLU CA   C  -20.981  -1.840   1.807 1.00 . A A . 695 GLU CA   1 1 
        5  6431 1 1 39 GLU CB   C  -21.517  -2.036   3.242 1.00 . A A . 695 GLU CB   1 1 
        5  6432 1 1 39 GLU CD   C  -19.774  -3.385   4.463 1.00 . A A . 695 GLU CD   1 1 
        5  6433 1 1 39 GLU CG   C  -21.176  -3.371   3.889 1.00 . A A . 695 GLU CG   1 1 
        5  6434 1 1 39 GLU H    H  -19.282  -3.081   2.192 1.00 . A A . 695 GLU H    1 1 
        5  6435 1 1 39 GLU HA   H  -21.783  -2.056   1.112 1.00 . A A . 695 GLU HA   1 1 
        5  6436 1 1 39 GLU HB2  H  -21.122  -1.252   3.872 1.00 . A A . 695 GLU HB2  1 1 
        5  6437 1 1 39 GLU HB3  H  -22.595  -1.942   3.217 1.00 . A A . 695 GLU HB3  1 1 
        5  6438 1 1 39 GLU HG2  H  -21.879  -3.562   4.689 1.00 . A A . 695 GLU HG2  1 1 
        5  6439 1 1 39 GLU HG3  H  -21.259  -4.153   3.145 1.00 . A A . 695 GLU HG3  1 1 
        5  6440 1 1 39 GLU N    N  -19.869  -2.752   1.480 1.00 . A A . 695 GLU N    1 1 
        5  6441 1 1 39 GLU O    O  -21.318   0.416   1.033 1.00 . A A . 695 GLU O    1 1 
        5  6442 1 1 39 GLU OE1  O  -19.469  -2.517   5.315 1.00 . A A . 695 GLU OE1  1 1 
        5  6443 1 1 39 GLU OE2  O  -18.961  -4.248   4.069 1.00 . A A . 695 GLU OE2  1 1 
        5  6444 1 1 40 ASP C    C  -18.507   1.824   0.671 1.00 . A A . 696 ASP C    1 1 
        5  6445 1 1 40 ASP CA   C  -18.944   1.387   2.082 1.00 . A A . 696 ASP CA   1 1 
        5  6446 1 1 40 ASP CB   C  -17.803   1.598   3.078 1.00 . A A . 696 ASP CB   1 1 
        5  6447 1 1 40 ASP CG   C  -17.464   3.065   3.245 1.00 . A A . 696 ASP CG   1 1 
        5  6448 1 1 40 ASP H    H  -18.808  -0.687   2.529 1.00 . A A . 696 ASP H    1 1 
        5  6449 1 1 40 ASP HA   H  -19.780   2.003   2.385 1.00 . A A . 696 ASP HA   1 1 
        5  6450 1 1 40 ASP HB2  H  -18.092   1.198   4.039 1.00 . A A . 696 ASP HB2  1 1 
        5  6451 1 1 40 ASP HB3  H  -16.923   1.076   2.725 1.00 . A A . 696 ASP HB3  1 1 
        5  6452 1 1 40 ASP N    N  -19.391  -0.007   2.116 1.00 . A A . 696 ASP N    1 1 
        5  6453 1 1 40 ASP O    O  -18.934   2.868   0.172 1.00 . A A . 696 ASP O    1 1 
        5  6454 1 1 40 ASP OD1  O  -18.178   3.762   3.995 1.00 . A A . 696 ASP OD1  1 1 
        5  6455 1 1 40 ASP OD2  O  -16.504   3.539   2.609 1.00 . A A . 696 ASP OD2  1 1 
        5  6456 1 1 41 GLY C    C  -15.638   1.674  -1.256 1.00 . A A . 697 GLY C    1 1 
        5  6457 1 1 41 GLY CA   C  -17.136   1.385  -1.287 1.00 . A A . 697 GLY CA   1 1 
        5  6458 1 1 41 GLY H    H  -17.409   0.168   0.434 1.00 . A A . 697 GLY H    1 1 
        5  6459 1 1 41 GLY HA2  H  -17.315   0.568  -1.971 1.00 . A A . 697 GLY HA2  1 1 
        5  6460 1 1 41 GLY HA3  H  -17.654   2.262  -1.651 1.00 . A A . 697 GLY HA3  1 1 
        5  6461 1 1 41 GLY N    N  -17.666   1.021   0.025 1.00 . A A . 697 GLY N    1 1 
        5  6462 1 1 41 GLY O    O  -14.837   0.798  -0.937 1.00 . A A . 697 GLY O    1 1 
        5  6463 1 1 42 ASP C    C  -13.288   3.543  -0.194 1.00 . A A . 698 ASP C    1 1 
        5  6464 1 1 42 ASP CA   C  -13.832   3.282  -1.606 1.00 . A A . 698 ASP CA   1 1 
        5  6465 1 1 42 ASP CB   C  -13.620   4.531  -2.465 1.00 . A A . 698 ASP CB   1 1 
        5  6466 1 1 42 ASP CG   C  -12.166   4.978  -2.478 1.00 . A A . 698 ASP CG   1 1 
        5  6467 1 1 42 ASP H    H  -15.924   3.574  -1.818 1.00 . A A . 698 ASP H    1 1 
        5  6468 1 1 42 ASP HA   H  -13.280   2.462  -2.044 1.00 . A A . 698 ASP HA   1 1 
        5  6469 1 1 42 ASP HB2  H  -13.927   4.319  -3.480 1.00 . A A . 698 ASP HB2  1 1 
        5  6470 1 1 42 ASP HB3  H  -14.225   5.336  -2.074 1.00 . A A . 698 ASP HB3  1 1 
        5  6471 1 1 42 ASP N    N  -15.248   2.904  -1.586 1.00 . A A . 698 ASP N    1 1 
        5  6472 1 1 42 ASP O    O  -13.739   4.453   0.501 1.00 . A A . 698 ASP O    1 1 
        5  6473 1 1 42 ASP OD1  O  -11.382   4.436  -3.285 1.00 . A A . 698 ASP OD1  1 1 
        5  6474 1 1 42 ASP OD2  O  -11.799   5.865  -1.678 1.00 . A A . 698 ASP OD2  1 1 
        5  6475 1 1 43 LEU C    C  -10.091   3.226   1.185 1.00 . A A . 699 LEU C    1 1 
        5  6476 1 1 43 LEU CA   C  -11.577   2.964   1.467 1.00 . A A . 699 LEU CA   1 1 
        5  6477 1 1 43 LEU CB   C  -11.725   1.760   2.414 1.00 . A A . 699 LEU CB   1 1 
        5  6478 1 1 43 LEU CD1  C  -13.145   0.324   3.918 1.00 . A A . 699 LEU CD1  1 1 
        5  6479 1 1 43 LEU CD2  C  -13.636   2.770   3.720 1.00 . A A . 699 LEU CD2  1 1 
        5  6480 1 1 43 LEU CG   C  -13.134   1.529   2.985 1.00 . A A . 699 LEU CG   1 1 
        5  6481 1 1 43 LEU H    H  -12.079   1.964  -0.339 1.00 . A A . 699 LEU H    1 1 
        5  6482 1 1 43 LEU HA   H  -11.994   3.839   1.946 1.00 . A A . 699 LEU HA   1 1 
        5  6483 1 1 43 LEU HB2  H  -11.428   0.871   1.874 1.00 . A A . 699 LEU HB2  1 1 
        5  6484 1 1 43 LEU HB3  H  -11.044   1.897   3.243 1.00 . A A . 699 LEU HB3  1 1 
        5  6485 1 1 43 LEU HD11 H  -14.153   0.149   4.270 1.00 . A A . 699 LEU HD11 1 1 
        5  6486 1 1 43 LEU HD12 H  -12.495   0.512   4.763 1.00 . A A . 699 LEU HD12 1 1 
        5  6487 1 1 43 LEU HD13 H  -12.797  -0.548   3.385 1.00 . A A . 699 LEU HD13 1 1 
        5  6488 1 1 43 LEU HD21 H  -12.989   2.980   4.561 1.00 . A A . 699 LEU HD21 1 1 
        5  6489 1 1 43 LEU HD22 H  -14.641   2.595   4.073 1.00 . A A . 699 LEU HD22 1 1 
        5  6490 1 1 43 LEU HD23 H  -13.635   3.614   3.045 1.00 . A A . 699 LEU HD23 1 1 
        5  6491 1 1 43 LEU HG   H  -13.816   1.324   2.171 1.00 . A A . 699 LEU HG   1 1 
        5  6492 1 1 43 LEU N    N  -12.312   2.739   0.215 1.00 . A A . 699 LEU N    1 1 
        5  6493 1 1 43 LEU O    O   -9.261   3.201   2.094 1.00 . A A . 699 LEU O    1 1 
        5  6494 1 1 44 THR C    C   -7.794   4.964   0.267 1.00 . A A . 700 THR C    1 1 
        5  6495 1 1 44 THR CA   C   -8.379   3.764  -0.492 1.00 . A A . 700 THR CA   1 1 
        5  6496 1 1 44 THR CB   C   -8.278   4.026  -2.016 1.00 . A A . 700 THR CB   1 1 
        5  6497 1 1 44 THR CG2  C   -6.825   4.172  -2.462 1.00 . A A . 700 THR CG2  1 1 
        5  6498 1 1 44 THR H    H  -10.473   3.513  -0.759 1.00 . A A . 700 THR H    1 1 
        5  6499 1 1 44 THR HA   H   -7.791   2.886  -0.259 1.00 . A A . 700 THR HA   1 1 
        5  6500 1 1 44 THR HB   H   -8.804   4.942  -2.246 1.00 . A A . 700 THR HB   1 1 
        5  6501 1 1 44 THR HG1  H   -9.704   3.259  -3.153 1.00 . A A . 700 THR HG1  1 1 
        5  6502 1 1 44 THR HG21 H   -6.285   3.262  -2.238 1.00 . A A . 700 THR HG21 1 1 
        5  6503 1 1 44 THR HG22 H   -6.368   4.999  -1.940 1.00 . A A . 700 THR HG22 1 1 
        5  6504 1 1 44 THR HG23 H   -6.790   4.356  -3.527 1.00 . A A . 700 THR HG23 1 1 
        5  6505 1 1 44 THR N    N   -9.764   3.497  -0.080 1.00 . A A . 700 THR N    1 1 
        5  6506 1 1 44 THR O    O   -6.609   4.988   0.599 1.00 . A A . 700 THR O    1 1 
        5  6507 1 1 44 THR OG1  O   -8.888   2.942  -2.739 1.00 . A A . 700 THR OG1  1 1 
        5  6508 1 1 45 SER C    C   -7.938   6.780   2.800 1.00 . A A . 701 SER C    1 1 
        5  6509 1 1 45 SER CA   C   -8.213   7.129   1.330 1.00 . A A . 701 SER CA   1 1 
        5  6510 1 1 45 SER CB   C   -9.273   8.235   1.259 1.00 . A A . 701 SER CB   1 1 
        5  6511 1 1 45 SER H    H   -9.565   5.891   0.246 1.00 . A A . 701 SER H    1 1 
        5  6512 1 1 45 SER HA   H   -7.297   7.496   0.888 1.00 . A A . 701 SER HA   1 1 
        5  6513 1 1 45 SER HB2  H   -8.938   9.089   1.826 1.00 . A A . 701 SER HB2  1 1 
        5  6514 1 1 45 SER HB3  H   -9.417   8.526   0.227 1.00 . A A . 701 SER HB3  1 1 
        5  6515 1 1 45 SER HG   H  -11.235   8.186   1.267 1.00 . A A . 701 SER HG   1 1 
        5  6516 1 1 45 SER N    N   -8.638   5.950   0.560 1.00 . A A . 701 SER N    1 1 
        5  6517 1 1 45 SER O    O   -7.271   7.533   3.509 1.00 . A A . 701 SER O    1 1 
        5  6518 1 1 45 SER OG   O  -10.519   7.798   1.788 1.00 . A A . 701 SER OG   1 1 
        5  6519 1 1 46 LYS C    C   -7.027   4.328   4.822 1.00 . A A . 702 LYS C    1 1 
        5  6520 1 1 46 LYS CA   C   -8.281   5.201   4.643 1.00 . A A . 702 LYS CA   1 1 
        5  6521 1 1 46 LYS CB   C   -9.525   4.428   5.102 1.00 . A A . 702 LYS CB   1 1 
        5  6522 1 1 46 LYS CD   C  -10.834   6.498   5.724 1.00 . A A . 702 LYS CD   1 1 
        5  6523 1 1 46 LYS CE   C  -12.065   7.341   5.421 1.00 . A A . 702 LYS CE   1 1 
        5  6524 1 1 46 LYS CG   C  -10.825   5.202   4.919 1.00 . A A . 702 LYS CG   1 1 
        5  6525 1 1 46 LYS H    H   -8.953   5.065   2.632 1.00 . A A . 702 LYS H    1 1 
        5  6526 1 1 46 LYS HA   H   -8.174   6.084   5.257 1.00 . A A . 702 LYS HA   1 1 
        5  6527 1 1 46 LYS HB2  H   -9.594   3.510   4.535 1.00 . A A . 702 LYS HB2  1 1 
        5  6528 1 1 46 LYS HB3  H   -9.420   4.185   6.150 1.00 . A A . 702 LYS HB3  1 1 
        5  6529 1 1 46 LYS HD2  H  -10.827   6.255   6.777 1.00 . A A . 702 LYS HD2  1 1 
        5  6530 1 1 46 LYS HD3  H   -9.948   7.069   5.480 1.00 . A A . 702 LYS HD3  1 1 
        5  6531 1 1 46 LYS HE2  H  -12.951   6.755   5.622 1.00 . A A . 702 LYS HE2  1 1 
        5  6532 1 1 46 LYS HE3  H  -12.058   8.210   6.063 1.00 . A A . 702 LYS HE3  1 1 
        5  6533 1 1 46 LYS HG2  H  -10.945   5.441   3.872 1.00 . A A . 702 LYS HG2  1 1 
        5  6534 1 1 46 LYS HG3  H  -11.650   4.581   5.243 1.00 . A A . 702 LYS HG3  1 1 
        5  6535 1 1 46 LYS HZ1  H  -12.999   8.257   3.795 1.00 . A A . 702 LYS HZ1  1 1 
        5  6536 1 1 46 LYS HZ2  H  -11.983   6.976   3.366 1.00 . A A . 702 LYS HZ2  1 1 
        5  6537 1 1 46 LYS HZ3  H  -11.322   8.464   3.823 1.00 . A A . 702 LYS HZ3  1 1 
        5  6538 1 1 46 LYS N    N   -8.449   5.636   3.250 1.00 . A A . 702 LYS N    1 1 
        5  6539 1 1 46 LYS NZ   N  -12.093   7.789   4.004 1.00 . A A . 702 LYS NZ   1 1 
        5  6540 1 1 46 LYS O    O   -6.761   3.827   5.917 1.00 . A A . 702 LYS O    1 1 
        5  6541 1 1 47 ILE C    C   -3.885   4.068   4.482 1.00 . A A . 703 ILE C    1 1 
        5  6542 1 1 47 ILE CA   C   -5.045   3.332   3.792 1.00 . A A . 703 ILE CA   1 1 
        5  6543 1 1 47 ILE CB   C   -4.588   2.909   2.371 1.00 . A A . 703 ILE CB   1 1 
        5  6544 1 1 47 ILE CD1  C   -5.325   1.699   0.247 1.00 . A A . 703 ILE CD1  1 1 
        5  6545 1 1 47 ILE CG1  C   -5.691   2.107   1.660 1.00 . A A . 703 ILE CG1  1 1 
        5  6546 1 1 47 ILE CG2  C   -3.294   2.096   2.437 1.00 . A A . 703 ILE CG2  1 1 
        5  6547 1 1 47 ILE H    H   -6.513   4.586   2.907 1.00 . A A . 703 ILE H    1 1 
        5  6548 1 1 47 ILE HA   H   -5.271   2.435   4.354 1.00 . A A . 703 ILE HA   1 1 
        5  6549 1 1 47 ILE HB   H   -4.386   3.807   1.803 1.00 . A A . 703 ILE HB   1 1 
        5  6550 1 1 47 ILE HD11 H   -5.090   2.579  -0.335 1.00 . A A . 703 ILE HD11 1 1 
        5  6551 1 1 47 ILE HD12 H   -6.157   1.179  -0.205 1.00 . A A . 703 ILE HD12 1 1 
        5  6552 1 1 47 ILE HD13 H   -4.464   1.045   0.272 1.00 . A A . 703 ILE HD13 1 1 
        5  6553 1 1 47 ILE HG12 H   -5.898   1.208   2.221 1.00 . A A . 703 ILE HG12 1 1 
        5  6554 1 1 47 ILE HG13 H   -6.588   2.708   1.609 1.00 . A A . 703 ILE HG13 1 1 
        5  6555 1 1 47 ILE HG21 H   -2.999   1.800   1.440 1.00 . A A . 703 ILE HG21 1 1 
        5  6556 1 1 47 ILE HG22 H   -3.449   1.216   3.043 1.00 . A A . 703 ILE HG22 1 1 
        5  6557 1 1 47 ILE HG23 H   -2.512   2.700   2.875 1.00 . A A . 703 ILE HG23 1 1 
        5  6558 1 1 47 ILE N    N   -6.260   4.152   3.749 1.00 . A A . 703 ILE N    1 1 
        5  6559 1 1 47 ILE O    O   -3.529   5.190   4.111 1.00 . A A . 703 ILE O    1 1 
        5  6560 1 1 48 LYS C    C   -0.849   3.329   5.495 1.00 . A A . 704 LYS C    1 1 
        5  6561 1 1 48 LYS CA   C   -2.095   3.941   6.134 1.00 . A A . 704 LYS CA   1 1 
        5  6562 1 1 48 LYS CB   C   -2.110   3.649   7.639 1.00 . A A . 704 LYS CB   1 1 
        5  6563 1 1 48 LYS CD   C   -3.091   4.190   9.901 1.00 . A A . 704 LYS CD   1 1 
        5  6564 1 1 48 LYS CE   C   -3.897   5.195  10.719 1.00 . A A . 704 LYS CE   1 1 
        5  6565 1 1 48 LYS CG   C   -3.030   4.572   8.426 1.00 . A A . 704 LYS CG   1 1 
        5  6566 1 1 48 LYS H    H   -3.709   2.603   5.825 1.00 . A A . 704 LYS H    1 1 
        5  6567 1 1 48 LYS HA   H   -2.068   5.013   5.987 1.00 . A A . 704 LYS HA   1 1 
        5  6568 1 1 48 LYS HB2  H   -2.435   2.629   7.795 1.00 . A A . 704 LYS HB2  1 1 
        5  6569 1 1 48 LYS HB3  H   -1.107   3.760   8.028 1.00 . A A . 704 LYS HB3  1 1 
        5  6570 1 1 48 LYS HD2  H   -3.552   3.216   9.992 1.00 . A A . 704 LYS HD2  1 1 
        5  6571 1 1 48 LYS HD3  H   -2.083   4.148  10.292 1.00 . A A . 704 LYS HD3  1 1 
        5  6572 1 1 48 LYS HE2  H   -3.872   4.898  11.757 1.00 . A A . 704 LYS HE2  1 1 
        5  6573 1 1 48 LYS HE3  H   -3.441   6.170  10.618 1.00 . A A . 704 LYS HE3  1 1 
        5  6574 1 1 48 LYS HG2  H   -2.660   5.584   8.342 1.00 . A A . 704 LYS HG2  1 1 
        5  6575 1 1 48 LYS HG3  H   -4.021   4.517   8.001 1.00 . A A . 704 LYS HG3  1 1 
        5  6576 1 1 48 LYS HZ1  H   -5.838   5.932  10.899 1.00 . A A . 704 LYS HZ1  1 1 
        5  6577 1 1 48 LYS HZ2  H   -5.761   4.342  10.327 1.00 . A A . 704 LYS HZ2  1 1 
        5  6578 1 1 48 LYS HZ3  H   -5.369   5.632   9.306 1.00 . A A . 704 LYS HZ3  1 1 
        5  6579 1 1 48 LYS N    N   -3.308   3.433   5.494 1.00 . A A . 704 LYS N    1 1 
        5  6580 1 1 48 LYS NZ   N   -5.314   5.280  10.281 1.00 . A A . 704 LYS NZ   1 1 
        5  6581 1 1 48 LYS O    O   -0.703   2.106   5.431 1.00 . A A . 704 LYS O    1 1 
        5  6582 1 1 49 VAL C    C    2.441   3.761   5.414 1.00 . A A . 705 VAL C    1 1 
        5  6583 1 1 49 VAL CA   C    1.291   3.748   4.396 1.00 . A A . 705 VAL CA   1 1 
        5  6584 1 1 49 VAL CB   C    1.669   4.639   3.183 1.00 . A A . 705 VAL CB   1 1 
        5  6585 1 1 49 VAL CG1  C    2.947   4.134   2.509 1.00 . A A . 705 VAL CG1  1 1 
        5  6586 1 1 49 VAL CG2  C    0.514   4.702   2.183 1.00 . A A . 705 VAL CG2  1 1 
        5  6587 1 1 49 VAL H    H   -0.154   5.149   5.087 1.00 . A A . 705 VAL H    1 1 
        5  6588 1 1 49 VAL HA   H    1.148   2.733   4.039 1.00 . A A . 705 VAL HA   1 1 
        5  6589 1 1 49 VAL HB   H    1.854   5.642   3.546 1.00 . A A . 705 VAL HB   1 1 
        5  6590 1 1 49 VAL HG11 H    2.787   3.133   2.132 1.00 . A A . 705 VAL HG11 1 1 
        5  6591 1 1 49 VAL HG12 H    3.753   4.121   3.228 1.00 . A A . 705 VAL HG12 1 1 
        5  6592 1 1 49 VAL HG13 H    3.208   4.788   1.690 1.00 . A A . 705 VAL HG13 1 1 
        5  6593 1 1 49 VAL HG21 H   -0.351   5.142   2.658 1.00 . A A . 705 VAL HG21 1 1 
        5  6594 1 1 49 VAL HG22 H    0.271   3.704   1.848 1.00 . A A . 705 VAL HG22 1 1 
        5  6595 1 1 49 VAL HG23 H    0.803   5.306   1.334 1.00 . A A . 705 VAL HG23 1 1 
        5  6596 1 1 49 VAL N    N    0.039   4.188   5.019 1.00 . A A . 705 VAL N    1 1 
        5  6597 1 1 49 VAL O    O    2.919   4.825   5.814 1.00 . A A . 705 VAL O    1 1 
        5  6598 1 1 50 ASP C    C    5.287   2.121   6.171 1.00 . A A . 706 ASP C    1 1 
        5  6599 1 1 50 ASP CA   C    3.942   2.453   6.838 1.00 . A A . 706 ASP CA   1 1 
        5  6600 1 1 50 ASP CB   C    3.573   1.372   7.859 1.00 . A A . 706 ASP CB   1 1 
        5  6601 1 1 50 ASP CG   C    4.639   1.181   8.924 1.00 . A A . 706 ASP CG   1 1 
        5  6602 1 1 50 ASP H    H    2.448   1.765   5.495 1.00 . A A . 706 ASP H    1 1 
        5  6603 1 1 50 ASP HA   H    4.032   3.402   7.352 1.00 . A A . 706 ASP HA   1 1 
        5  6604 1 1 50 ASP HB2  H    2.651   1.650   8.347 1.00 . A A . 706 ASP HB2  1 1 
        5  6605 1 1 50 ASP HB3  H    3.430   0.433   7.341 1.00 . A A . 706 ASP HB3  1 1 
        5  6606 1 1 50 ASP N    N    2.867   2.578   5.846 1.00 . A A . 706 ASP N    1 1 
        5  6607 1 1 50 ASP O    O    5.369   1.235   5.316 1.00 . A A . 706 ASP O    1 1 
        5  6608 1 1 50 ASP OD1  O    4.683   1.984   9.875 1.00 . A A . 706 ASP OD1  1 1 
        5  6609 1 1 50 ASP OD2  O    5.447   0.238   8.803 1.00 . A A . 706 ASP OD2  1 1 
        5  6610 1 1 51 GLY C    C    8.202   3.875   5.315 1.00 . A A . 707 GLY C    1 1 
        5  6611 1 1 51 GLY CA   C    7.665   2.625   6.003 1.00 . A A . 707 GLY CA   1 1 
        5  6612 1 1 51 GLY H    H    6.217   3.491   7.293 1.00 . A A . 707 GLY H    1 1 
        5  6613 1 1 51 GLY HA2  H    8.349   2.342   6.791 1.00 . A A . 707 GLY HA2  1 1 
        5  6614 1 1 51 GLY HA3  H    7.620   1.820   5.281 1.00 . A A . 707 GLY HA3  1 1 
        5  6615 1 1 51 GLY N    N    6.338   2.826   6.581 1.00 . A A . 707 GLY N    1 1 
        5  6616 1 1 51 GLY O    O    7.634   4.962   5.455 1.00 . A A . 707 GLY O    1 1 
        5  6617 1 1 52 GLU C    C   10.779   4.378   2.681 1.00 . A A . 708 GLU C    1 1 
        5  6618 1 1 52 GLU CA   C    9.910   4.852   3.859 1.00 . A A . 708 GLU CA   1 1 
        5  6619 1 1 52 GLU CB   C   10.757   5.690   4.830 1.00 . A A . 708 GLU CB   1 1 
        5  6620 1 1 52 GLU CD   C   10.204   7.912   3.747 1.00 . A A . 708 GLU CD   1 1 
        5  6621 1 1 52 GLU CG   C   11.305   6.977   4.223 1.00 . A A . 708 GLU CG   1 1 
        5  6622 1 1 52 GLU H    H    9.701   2.832   4.498 1.00 . A A . 708 GLU H    1 1 
        5  6623 1 1 52 GLU HA   H    9.112   5.470   3.470 1.00 . A A . 708 GLU HA   1 1 
        5  6624 1 1 52 GLU HB2  H   10.148   5.951   5.685 1.00 . A A . 708 GLU HB2  1 1 
        5  6625 1 1 52 GLU HB3  H   11.592   5.092   5.168 1.00 . A A . 708 GLU HB3  1 1 
        5  6626 1 1 52 GLU HG2  H   11.898   7.490   4.968 1.00 . A A . 708 GLU HG2  1 1 
        5  6627 1 1 52 GLU HG3  H   11.933   6.722   3.381 1.00 . A A . 708 GLU HG3  1 1 
        5  6628 1 1 52 GLU N    N    9.294   3.722   4.570 1.00 . A A . 708 GLU N    1 1 
        5  6629 1 1 52 GLU O    O   11.532   3.410   2.798 1.00 . A A . 708 GLU O    1 1 
        5  6630 1 1 52 GLU OE1  O    9.644   8.651   4.580 1.00 . A A . 708 GLU OE1  1 1 
        5  6631 1 1 52 GLU OE2  O    9.888   7.908   2.536 1.00 . A A . 708 GLU OE2  1 1 
        5  6632 1 1 53 VAL C    C   12.230   5.966  -0.167 1.00 . A A . 709 VAL C    1 1 
        5  6633 1 1 53 VAL CA   C   11.455   4.742   0.346 1.00 . A A . 709 VAL CA   1 1 
        5  6634 1 1 53 VAL CB   C   10.545   4.213  -0.799 1.00 . A A . 709 VAL CB   1 1 
        5  6635 1 1 53 VAL CG1  C   11.367   3.871  -2.044 1.00 . A A . 709 VAL CG1  1 1 
        5  6636 1 1 53 VAL CG2  C    9.740   3.000  -0.336 1.00 . A A . 709 VAL CG2  1 1 
        5  6637 1 1 53 VAL H    H   10.062   5.843   1.519 1.00 . A A . 709 VAL H    1 1 
        5  6638 1 1 53 VAL HA   H   12.161   3.964   0.608 1.00 . A A . 709 VAL HA   1 1 
        5  6639 1 1 53 VAL HB   H    9.848   4.997  -1.063 1.00 . A A . 709 VAL HB   1 1 
        5  6640 1 1 53 VAL HG11 H   12.078   3.091  -1.807 1.00 . A A . 709 VAL HG11 1 1 
        5  6641 1 1 53 VAL HG12 H   11.899   4.750  -2.381 1.00 . A A . 709 VAL HG12 1 1 
        5  6642 1 1 53 VAL HG13 H   10.708   3.528  -2.829 1.00 . A A . 709 VAL HG13 1 1 
        5  6643 1 1 53 VAL HG21 H   10.413   2.212  -0.033 1.00 . A A . 709 VAL HG21 1 1 
        5  6644 1 1 53 VAL HG22 H    9.116   2.649  -1.146 1.00 . A A . 709 VAL HG22 1 1 
        5  6645 1 1 53 VAL HG23 H    9.114   3.279   0.500 1.00 . A A . 709 VAL HG23 1 1 
        5  6646 1 1 53 VAL N    N   10.675   5.074   1.548 1.00 . A A . 709 VAL N    1 1 
        5  6647 1 1 53 VAL O    O   11.639   7.009  -0.453 1.00 . A A . 709 VAL O    1 1 
        5  6648 1 1 54 ASP C    C   14.604   6.762  -2.325 1.00 . A A . 710 ASP C    1 1 
        5  6649 1 1 54 ASP CA   C   14.381   6.922  -0.815 1.00 . A A . 710 ASP CA   1 1 
        5  6650 1 1 54 ASP CB   C   15.728   6.983  -0.086 1.00 . A A . 710 ASP CB   1 1 
        5  6651 1 1 54 ASP CG   C   16.633   8.089  -0.615 1.00 . A A . 710 ASP CG   1 1 
        5  6652 1 1 54 ASP H    H   13.974   5.003  -0.001 1.00 . A A . 710 ASP H    1 1 
        5  6653 1 1 54 ASP HA   H   13.855   7.852  -0.644 1.00 . A A . 710 ASP HA   1 1 
        5  6654 1 1 54 ASP HB2  H   15.553   7.163   0.965 1.00 . A A . 710 ASP HB2  1 1 
        5  6655 1 1 54 ASP HB3  H   16.236   6.035  -0.204 1.00 . A A . 710 ASP HB3  1 1 
        5  6656 1 1 54 ASP N    N   13.550   5.839  -0.281 1.00 . A A . 710 ASP N    1 1 
        5  6657 1 1 54 ASP O    O   14.777   5.653  -2.830 1.00 . A A . 710 ASP O    1 1 
        5  6658 1 1 54 ASP OD1  O   16.119   9.151  -1.032 1.00 . A A . 710 ASP OD1  1 1 
        5  6659 1 1 54 ASP OD2  O   17.866   7.912  -0.613 1.00 . A A . 710 ASP OD2  1 1 
        5  6660 1 1 55 THR C    C   16.200   8.285  -4.911 1.00 . A A . 711 THR C    1 1 
        5  6661 1 1 55 THR CA   C   14.773   7.902  -4.490 1.00 . A A . 711 THR CA   1 1 
        5  6662 1 1 55 THR CB   C   13.781   8.892  -5.149 1.00 . A A . 711 THR CB   1 1 
        5  6663 1 1 55 THR CG2  C   12.337   8.426  -4.972 1.00 . A A . 711 THR CG2  1 1 
        5  6664 1 1 55 THR H    H   14.496   8.741  -2.559 1.00 . A A . 711 THR H    1 1 
        5  6665 1 1 55 THR HA   H   14.557   6.910  -4.865 1.00 . A A . 711 THR HA   1 1 
        5  6666 1 1 55 THR HB   H   13.998   8.947  -6.208 1.00 . A A . 711 THR HB   1 1 
        5  6667 1 1 55 THR HG1  H   13.218  10.369  -3.952 1.00 . A A . 711 THR HG1  1 1 
        5  6668 1 1 55 THR HG21 H   12.214   7.448  -5.417 1.00 . A A . 711 THR HG21 1 1 
        5  6669 1 1 55 THR HG22 H   11.670   9.125  -5.454 1.00 . A A . 711 THR HG22 1 1 
        5  6670 1 1 55 THR HG23 H   12.101   8.372  -3.918 1.00 . A A . 711 THR HG23 1 1 
        5  6671 1 1 55 THR N    N   14.608   7.888  -3.032 1.00 . A A . 711 THR N    1 1 
        5  6672 1 1 55 THR O    O   16.556   8.174  -6.082 1.00 . A A . 711 THR O    1 1 
        5  6673 1 1 55 THR OG1  O   13.940  10.202  -4.574 1.00 . A A . 711 THR OG1  1 1 
        5  6674 1 1 56 THR C    C   19.467   8.153  -3.892 1.00 . A A . 712 THR C    1 1 
        5  6675 1 1 56 THR CA   C   18.390   9.184  -4.272 1.00 . A A . 712 THR CA   1 1 
        5  6676 1 1 56 THR CB   C   18.723  10.535  -3.587 1.00 . A A . 712 THR CB   1 1 
        5  6677 1 1 56 THR CG2  C   17.858  11.659  -4.150 1.00 . A A . 712 THR CG2  1 1 
        5  6678 1 1 56 THR H    H   16.700   8.763  -3.034 1.00 . A A . 712 THR H    1 1 
        5  6679 1 1 56 THR HA   H   18.441   9.341  -5.342 1.00 . A A . 712 THR HA   1 1 
        5  6680 1 1 56 THR HB   H   19.758  10.773  -3.790 1.00 . A A . 712 THR HB   1 1 
        5  6681 1 1 56 THR HG1  H   17.763   9.910  -1.962 1.00 . A A . 712 THR HG1  1 1 
        5  6682 1 1 56 THR HG21 H   16.816  11.432  -3.983 1.00 . A A . 712 THR HG21 1 1 
        5  6683 1 1 56 THR HG22 H   18.038  11.760  -5.211 1.00 . A A . 712 THR HG22 1 1 
        5  6684 1 1 56 THR HG23 H   18.108  12.588  -3.656 1.00 . A A . 712 THR HG23 1 1 
        5  6685 1 1 56 THR N    N   17.019   8.732  -3.959 1.00 . A A . 712 THR N    1 1 
        5  6686 1 1 56 THR O    O   20.657   8.391  -4.100 1.00 . A A . 712 THR O    1 1 
        5  6687 1 1 56 THR OG1  O   18.542  10.451  -2.160 1.00 . A A . 712 THR OG1  1 1 
        5  6688 1 1 57 LYS C    C   19.381   4.550  -3.261 1.00 . A A . 713 LYS C    1 1 
        5  6689 1 1 57 LYS CA   C   20.010   5.932  -3.027 1.00 . A A . 713 LYS CA   1 1 
        5  6690 1 1 57 LYS CB   C   20.517   6.055  -1.572 1.00 . A A . 713 LYS CB   1 1 
        5  6691 1 1 57 LYS CD   C   22.734   4.873  -1.950 1.00 . A A . 713 LYS CD   1 1 
        5  6692 1 1 57 LYS CE   C   24.256   4.971  -1.855 1.00 . A A . 713 LYS CE   1 1 
        5  6693 1 1 57 LYS CG   C   22.042   6.142  -1.447 1.00 . A A . 713 LYS CG   1 1 
        5  6694 1 1 57 LYS H    H   18.111   6.892  -3.137 1.00 . A A . 713 LYS H    1 1 
        5  6695 1 1 57 LYS HA   H   20.852   6.038  -3.699 1.00 . A A . 713 LYS HA   1 1 
        5  6696 1 1 57 LYS HB2  H   20.094   6.947  -1.130 1.00 . A A . 713 LYS HB2  1 1 
        5  6697 1 1 57 LYS HB3  H   20.179   5.196  -1.007 1.00 . A A . 713 LYS HB3  1 1 
        5  6698 1 1 57 LYS HD2  H   22.403   4.034  -1.355 1.00 . A A . 713 LYS HD2  1 1 
        5  6699 1 1 57 LYS HD3  H   22.459   4.711  -2.984 1.00 . A A . 713 LYS HD3  1 1 
        5  6700 1 1 57 LYS HE2  H   24.529   5.202  -0.835 1.00 . A A . 713 LYS HE2  1 1 
        5  6701 1 1 57 LYS HE3  H   24.684   4.017  -2.130 1.00 . A A . 713 LYS HE3  1 1 
        5  6702 1 1 57 LYS HG2  H   22.394   6.985  -2.026 1.00 . A A . 713 LYS HG2  1 1 
        5  6703 1 1 57 LYS HG3  H   22.297   6.291  -0.406 1.00 . A A . 713 LYS HG3  1 1 
        5  6704 1 1 57 LYS HZ1  H   24.455   6.959  -2.473 1.00 . A A . 713 LYS HZ1  1 1 
        5  6705 1 1 57 LYS HZ2  H   24.536   5.842  -3.736 1.00 . A A . 713 LYS HZ2  1 1 
        5  6706 1 1 57 LYS HZ3  H   25.848   6.034  -2.692 1.00 . A A . 713 LYS HZ3  1 1 
        5  6707 1 1 57 LYS N    N   19.061   7.013  -3.343 1.00 . A A . 713 LYS N    1 1 
        5  6708 1 1 57 LYS NZ   N   24.811   6.024  -2.750 1.00 . A A . 713 LYS NZ   1 1 
        5  6709 1 1 57 LYS O    O   18.230   4.309  -2.892 1.00 . A A . 713 LYS O    1 1 
        5  6710 1 1 58 ALA C    C   19.544   1.439  -2.892 1.00 . A A . 714 ALA C    1 1 
        5  6711 1 1 58 ALA CA   C   19.688   2.290  -4.164 1.00 . A A . 714 ALA CA   1 1 
        5  6712 1 1 58 ALA CB   C   20.638   1.612  -5.142 1.00 . A A . 714 ALA CB   1 1 
        5  6713 1 1 58 ALA H    H   21.054   3.913  -4.154 1.00 . A A . 714 ALA H    1 1 
        5  6714 1 1 58 ALA HA   H   18.721   2.365  -4.642 1.00 . A A . 714 ALA HA   1 1 
        5  6715 1 1 58 ALA HB1  H   20.751   2.231  -6.022 1.00 . A A . 714 ALA HB1  1 1 
        5  6716 1 1 58 ALA HB2  H   20.239   0.651  -5.430 1.00 . A A . 714 ALA HB2  1 1 
        5  6717 1 1 58 ALA HB3  H   21.604   1.476  -4.675 1.00 . A A . 714 ALA HB3  1 1 
        5  6718 1 1 58 ALA N    N   20.150   3.651  -3.876 1.00 . A A . 714 ALA N    1 1 
        5  6719 1 1 58 ALA O    O   20.325   1.570  -1.944 1.00 . A A . 714 ALA O    1 1 
        5  6720 1 1 59 GLY C    C   16.878  -0.864  -1.709 1.00 . A A . 715 GLY C    1 1 
        5  6721 1 1 59 GLY CA   C   18.291  -0.291  -1.726 1.00 . A A . 715 GLY CA   1 1 
        5  6722 1 1 59 GLY H    H   17.957   0.505  -3.668 1.00 . A A . 715 GLY H    1 1 
        5  6723 1 1 59 GLY HA2  H   19.000  -1.107  -1.744 1.00 . A A . 715 GLY HA2  1 1 
        5  6724 1 1 59 GLY HA3  H   18.442   0.283  -0.822 1.00 . A A . 715 GLY HA3  1 1 
        5  6725 1 1 59 GLY N    N   18.537   0.570  -2.880 1.00 . A A . 715 GLY N    1 1 
        5  6726 1 1 59 GLY O    O   16.009  -0.411  -2.453 1.00 . A A . 715 GLY O    1 1 
        5  6727 1 1 60 THR C    C   14.569  -1.943   0.500 1.00 . A A . 716 THR C    1 1 
        5  6728 1 1 60 THR CA   C   15.307  -2.469  -0.741 1.00 . A A . 716 THR CA   1 1 
        5  6729 1 1 60 THR CB   C   15.380  -4.019  -0.689 1.00 . A A . 716 THR CB   1 1 
        5  6730 1 1 60 THR CG2  C   14.010  -4.630  -0.408 1.00 . A A . 716 THR CG2  1 1 
        5  6731 1 1 60 THR H    H   17.374  -2.196  -0.300 1.00 . A A . 716 THR H    1 1 
        5  6732 1 1 60 THR HA   H   14.739  -2.193  -1.623 1.00 . A A . 716 THR HA   1 1 
        5  6733 1 1 60 THR HB   H   16.055  -4.306   0.107 1.00 . A A . 716 THR HB   1 1 
        5  6734 1 1 60 THR HG1  H   15.185  -4.489  -2.611 1.00 . A A . 716 THR HG1  1 1 
        5  6735 1 1 60 THR HG21 H   14.086  -5.708  -0.420 1.00 . A A . 716 THR HG21 1 1 
        5  6736 1 1 60 THR HG22 H   13.313  -4.312  -1.169 1.00 . A A . 716 THR HG22 1 1 
        5  6737 1 1 60 THR HG23 H   13.658  -4.306   0.560 1.00 . A A . 716 THR HG23 1 1 
        5  6738 1 1 60 THR N    N   16.641  -1.862  -0.863 1.00 . A A . 716 THR N    1 1 
        5  6739 1 1 60 THR O    O   15.075  -2.022   1.619 1.00 . A A . 716 THR O    1 1 
        5  6740 1 1 60 THR OG1  O   15.884  -4.536  -1.938 1.00 . A A . 716 THR OG1  1 1 
        5  6741 1 1 61 TYR C    C   11.196  -1.511   1.465 1.00 . A A . 717 TYR C    1 1 
        5  6742 1 1 61 TYR CA   C   12.567  -0.815   1.367 1.00 . A A . 717 TYR CA   1 1 
        5  6743 1 1 61 TYR CB   C   12.372   0.689   1.113 1.00 . A A . 717 TYR CB   1 1 
        5  6744 1 1 61 TYR CD1  C   14.471   1.963   1.766 1.00 . A A . 717 TYR CD1  1 1 
        5  6745 1 1 61 TYR CD2  C   14.050   1.603  -0.553 1.00 . A A . 717 TYR CD2  1 1 
        5  6746 1 1 61 TYR CE1  C   15.638   2.637   1.450 1.00 . A A . 717 TYR CE1  1 1 
        5  6747 1 1 61 TYR CE2  C   15.213   2.275  -0.873 1.00 . A A . 717 TYR CE2  1 1 
        5  6748 1 1 61 TYR CG   C   13.655   1.433   0.772 1.00 . A A . 717 TYR CG   1 1 
        5  6749 1 1 61 TYR CZ   C   16.002   2.790   0.128 1.00 . A A . 717 TYR CZ   1 1 
        5  6750 1 1 61 TYR H    H   13.013  -1.391  -0.626 1.00 . A A . 717 TYR H    1 1 
        5  6751 1 1 61 TYR HA   H   13.099  -0.950   2.300 1.00 . A A . 717 TYR HA   1 1 
        5  6752 1 1 61 TYR HB2  H   11.684   0.822   0.289 1.00 . A A . 717 TYR HB2  1 1 
        5  6753 1 1 61 TYR HB3  H   11.951   1.143   1.999 1.00 . A A . 717 TYR HB3  1 1 
        5  6754 1 1 61 TYR HD1  H   14.184   1.841   2.801 1.00 . A A . 717 TYR HD1  1 1 
        5  6755 1 1 61 TYR HD2  H   13.429   1.199  -1.342 1.00 . A A . 717 TYR HD2  1 1 
        5  6756 1 1 61 TYR HE1  H   16.256   3.041   2.236 1.00 . A A . 717 TYR HE1  1 1 
        5  6757 1 1 61 TYR HE2  H   15.497   2.394  -1.907 1.00 . A A . 717 TYR HE2  1 1 
        5  6758 1 1 61 TYR HH   H   17.047   3.926  -1.024 1.00 . A A . 717 TYR HH   1 1 
        5  6759 1 1 61 TYR N    N   13.372  -1.400   0.286 1.00 . A A . 717 TYR N    1 1 
        5  6760 1 1 61 TYR O    O   10.523  -1.721   0.454 1.00 . A A . 717 TYR O    1 1 
        5  6761 1 1 61 TYR OH   O   17.167   3.454  -0.192 1.00 . A A . 717 TYR OH   1 1 
        5  6762 1 1 62 VAL C    C    8.381  -1.552   3.252 1.00 . A A . 718 VAL C    1 1 
        5  6763 1 1 62 VAL CA   C    9.498  -2.549   2.895 1.00 . A A . 718 VAL CA   1 1 
        5  6764 1 1 62 VAL CB   C    9.607  -3.615   4.017 1.00 . A A . 718 VAL CB   1 1 
        5  6765 1 1 62 VAL CG1  C    8.271  -4.335   4.222 1.00 . A A . 718 VAL CG1  1 1 
        5  6766 1 1 62 VAL CG2  C   10.725  -4.612   3.704 1.00 . A A . 718 VAL CG2  1 1 
        5  6767 1 1 62 VAL H    H   11.353  -1.670   3.454 1.00 . A A . 718 VAL H    1 1 
        5  6768 1 1 62 VAL HA   H    9.232  -3.054   1.974 1.00 . A A . 718 VAL HA   1 1 
        5  6769 1 1 62 VAL HB   H    9.859  -3.108   4.938 1.00 . A A . 718 VAL HB   1 1 
        5  6770 1 1 62 VAL HG11 H    7.981  -4.831   3.306 1.00 . A A . 718 VAL HG11 1 1 
        5  6771 1 1 62 VAL HG12 H    7.512  -3.618   4.496 1.00 . A A . 718 VAL HG12 1 1 
        5  6772 1 1 62 VAL HG13 H    8.371  -5.069   5.012 1.00 . A A . 718 VAL HG13 1 1 
        5  6773 1 1 62 VAL HG21 H   11.665  -4.085   3.621 1.00 . A A . 718 VAL HG21 1 1 
        5  6774 1 1 62 VAL HG22 H   10.513  -5.116   2.771 1.00 . A A . 718 VAL HG22 1 1 
        5  6775 1 1 62 VAL HG23 H   10.792  -5.342   4.499 1.00 . A A . 718 VAL HG23 1 1 
        5  6776 1 1 62 VAL N    N   10.784  -1.868   2.681 1.00 . A A . 718 VAL N    1 1 
        5  6777 1 1 62 VAL O    O    8.562  -0.680   4.101 1.00 . A A . 718 VAL O    1 1 
        5  6778 1 1 63 LEU C    C    4.858  -1.685   3.334 1.00 . A A . 719 LEU C    1 1 
        5  6779 1 1 63 LEU CA   C    6.057  -0.841   2.874 1.00 . A A . 719 LEU CA   1 1 
        5  6780 1 1 63 LEU CB   C    5.666  -0.040   1.623 1.00 . A A . 719 LEU CB   1 1 
        5  6781 1 1 63 LEU CD1  C    6.231   1.649  -0.161 1.00 . A A . 719 LEU CD1  1 1 
        5  6782 1 1 63 LEU CD2  C    7.085   1.971   2.182 1.00 . A A . 719 LEU CD2  1 1 
        5  6783 1 1 63 LEU CG   C    6.724   0.949   1.105 1.00 . A A . 719 LEU CG   1 1 
        5  6784 1 1 63 LEU H    H    7.157  -2.376   1.902 1.00 . A A . 719 LEU H    1 1 
        5  6785 1 1 63 LEU HA   H    6.320  -0.150   3.665 1.00 . A A . 719 LEU HA   1 1 
        5  6786 1 1 63 LEU HB2  H    5.444  -0.741   0.829 1.00 . A A . 719 LEU HB2  1 1 
        5  6787 1 1 63 LEU HB3  H    4.767   0.517   1.845 1.00 . A A . 719 LEU HB3  1 1 
        5  6788 1 1 63 LEU HD11 H    5.337   2.213   0.064 1.00 . A A . 719 LEU HD11 1 1 
        5  6789 1 1 63 LEU HD12 H    6.008   0.911  -0.917 1.00 . A A . 719 LEU HD12 1 1 
        5  6790 1 1 63 LEU HD13 H    6.996   2.318  -0.529 1.00 . A A . 719 LEU HD13 1 1 
        5  6791 1 1 63 LEU HD21 H    7.502   1.461   3.038 1.00 . A A . 719 LEU HD21 1 1 
        5  6792 1 1 63 LEU HD22 H    6.197   2.512   2.482 1.00 . A A . 719 LEU HD22 1 1 
        5  6793 1 1 63 LEU HD23 H    7.814   2.665   1.791 1.00 . A A . 719 LEU HD23 1 1 
        5  6794 1 1 63 LEU HG   H    7.621   0.402   0.849 1.00 . A A . 719 LEU HG   1 1 
        5  6795 1 1 63 LEU N    N    7.227  -1.689   2.597 1.00 . A A . 719 LEU N    1 1 
        5  6796 1 1 63 LEU O    O    4.471  -2.644   2.669 1.00 . A A . 719 LEU O    1 1 
        5  6797 1 1 64 THR C    C    1.847  -1.137   4.942 1.00 . A A . 720 THR C    1 1 
        5  6798 1 1 64 THR CA   C    3.097  -2.023   5.009 1.00 . A A . 720 THR CA   1 1 
        5  6799 1 1 64 THR CB   C    3.318  -2.467   6.478 1.00 . A A . 720 THR CB   1 1 
        5  6800 1 1 64 THR CG2  C    2.086  -3.180   7.036 1.00 . A A . 720 THR CG2  1 1 
        5  6801 1 1 64 THR H    H    4.630  -0.549   4.959 1.00 . A A . 720 THR H    1 1 
        5  6802 1 1 64 THR HA   H    2.932  -2.910   4.409 1.00 . A A . 720 THR HA   1 1 
        5  6803 1 1 64 THR HB   H    3.510  -1.587   7.080 1.00 . A A . 720 THR HB   1 1 
        5  6804 1 1 64 THR HG1  H    5.253  -2.815   6.664 1.00 . A A . 720 THR HG1  1 1 
        5  6805 1 1 64 THR HG21 H    1.862  -4.042   6.425 1.00 . A A . 720 THR HG21 1 1 
        5  6806 1 1 64 THR HG22 H    1.241  -2.506   7.027 1.00 . A A . 720 THR HG22 1 1 
        5  6807 1 1 64 THR HG23 H    2.281  -3.500   8.051 1.00 . A A . 720 THR HG23 1 1 
        5  6808 1 1 64 THR N    N    4.271  -1.317   4.470 1.00 . A A . 720 THR N    1 1 
        5  6809 1 1 64 THR O    O    1.813  -0.051   5.522 1.00 . A A . 720 THR O    1 1 
        5  6810 1 1 64 THR OG1  O    4.451  -3.342   6.563 1.00 . A A . 720 THR OG1  1 1 
        5  6811 1 1 65 TYR C    C   -1.543  -1.429   4.938 1.00 . A A . 721 TYR C    1 1 
        5  6812 1 1 65 TYR CA   C   -0.420  -0.845   4.069 1.00 . A A . 721 TYR CA   1 1 
        5  6813 1 1 65 TYR CB   C   -0.852  -0.855   2.598 1.00 . A A . 721 TYR CB   1 1 
        5  6814 1 1 65 TYR CD1  C    1.139  -1.271   1.094 1.00 . A A . 721 TYR CD1  1 1 
        5  6815 1 1 65 TYR CD2  C    0.320   0.962   1.268 1.00 . A A . 721 TYR CD2  1 1 
        5  6816 1 1 65 TYR CE1  C    2.115  -0.848   0.215 1.00 . A A . 721 TYR CE1  1 1 
        5  6817 1 1 65 TYR CE2  C    1.295   1.391   0.388 1.00 . A A . 721 TYR CE2  1 1 
        5  6818 1 1 65 TYR CG   C    0.223  -0.377   1.638 1.00 . A A . 721 TYR CG   1 1 
        5  6819 1 1 65 TYR CZ   C    2.189   0.481  -0.134 1.00 . A A . 721 TYR CZ   1 1 
        5  6820 1 1 65 TYR H    H    0.907  -2.479   3.800 1.00 . A A . 721 TYR H    1 1 
        5  6821 1 1 65 TYR HA   H   -0.235   0.177   4.373 1.00 . A A . 721 TYR HA   1 1 
        5  6822 1 1 65 TYR HB2  H   -1.123  -1.864   2.318 1.00 . A A . 721 TYR HB2  1 1 
        5  6823 1 1 65 TYR HB3  H   -1.715  -0.214   2.480 1.00 . A A . 721 TYR HB3  1 1 
        5  6824 1 1 65 TYR HD1  H    1.082  -2.313   1.369 1.00 . A A . 721 TYR HD1  1 1 
        5  6825 1 1 65 TYR HD2  H   -0.381   1.673   1.680 1.00 . A A . 721 TYR HD2  1 1 
        5  6826 1 1 65 TYR HE1  H    2.816  -1.560  -0.196 1.00 . A A . 721 TYR HE1  1 1 
        5  6827 1 1 65 TYR HE2  H    1.354   2.435   0.111 1.00 . A A . 721 TYR HE2  1 1 
        5  6828 1 1 65 TYR HH   H    3.128   0.355  -1.800 1.00 . A A . 721 TYR HH   1 1 
        5  6829 1 1 65 TYR N    N    0.825  -1.603   4.232 1.00 . A A . 721 TYR N    1 1 
        5  6830 1 1 65 TYR O    O   -1.915  -2.592   4.785 1.00 . A A . 721 TYR O    1 1 
        5  6831 1 1 65 TYR OH   O    3.158   0.901  -1.014 1.00 . A A . 721 TYR OH   1 1 
        5  6832 1 1 66 THR C    C   -4.410  -0.141   6.558 1.00 . A A . 722 THR C    1 1 
        5  6833 1 1 66 THR CA   C   -3.190  -1.064   6.710 1.00 . A A . 722 THR CA   1 1 
        5  6834 1 1 66 THR CB   C   -2.764  -1.114   8.199 1.00 . A A . 722 THR CB   1 1 
        5  6835 1 1 66 THR CG2  C   -3.894  -1.632   9.081 1.00 . A A . 722 THR CG2  1 1 
        5  6836 1 1 66 THR H    H   -1.716   0.284   5.959 1.00 . A A . 722 THR H    1 1 
        5  6837 1 1 66 THR HA   H   -3.472  -2.065   6.406 1.00 . A A . 722 THR HA   1 1 
        5  6838 1 1 66 THR HB   H   -2.507  -0.114   8.520 1.00 . A A . 722 THR HB   1 1 
        5  6839 1 1 66 THR HG1  H   -0.811  -1.429   8.266 1.00 . A A . 722 THR HG1  1 1 
        5  6840 1 1 66 THR HG21 H   -3.561  -1.676  10.108 1.00 . A A . 722 THR HG21 1 1 
        5  6841 1 1 66 THR HG22 H   -4.183  -2.621   8.755 1.00 . A A . 722 THR HG22 1 1 
        5  6842 1 1 66 THR HG23 H   -4.743  -0.968   9.008 1.00 . A A . 722 THR HG23 1 1 
        5  6843 1 1 66 THR N    N   -2.080  -0.624   5.849 1.00 . A A . 722 THR N    1 1 
        5  6844 1 1 66 THR O    O   -4.312   1.071   6.766 1.00 . A A . 722 THR O    1 1 
        5  6845 1 1 66 THR OG1  O   -1.612  -1.962   8.359 1.00 . A A . 722 THR OG1  1 1 
        5  6846 1 1 67 VAL C    C   -7.919  -0.340   6.930 1.00 . A A . 723 VAL C    1 1 
        5  6847 1 1 67 VAL CA   C   -6.784   0.068   5.968 1.00 . A A . 723 VAL CA   1 1 
        5  6848 1 1 67 VAL CB   C   -7.263  -0.072   4.496 1.00 . A A . 723 VAL CB   1 1 
        5  6849 1 1 67 VAL CG1  C   -7.591  -1.523   4.160 1.00 . A A . 723 VAL CG1  1 1 
        5  6850 1 1 67 VAL CG2  C   -8.460   0.835   4.215 1.00 . A A . 723 VAL CG2  1 1 
        5  6851 1 1 67 VAL H    H   -5.591  -1.691   6.097 1.00 . A A . 723 VAL H    1 1 
        5  6852 1 1 67 VAL HA   H   -6.546   1.110   6.142 1.00 . A A . 723 VAL HA   1 1 
        5  6853 1 1 67 VAL HB   H   -6.451   0.239   3.851 1.00 . A A . 723 VAL HB   1 1 
        5  6854 1 1 67 VAL HG11 H   -7.893  -1.594   3.125 1.00 . A A . 723 VAL HG11 1 1 
        5  6855 1 1 67 VAL HG12 H   -8.395  -1.868   4.794 1.00 . A A . 723 VAL HG12 1 1 
        5  6856 1 1 67 VAL HG13 H   -6.718  -2.138   4.321 1.00 . A A . 723 VAL HG13 1 1 
        5  6857 1 1 67 VAL HG21 H   -8.182   1.865   4.388 1.00 . A A . 723 VAL HG21 1 1 
        5  6858 1 1 67 VAL HG22 H   -9.279   0.570   4.868 1.00 . A A . 723 VAL HG22 1 1 
        5  6859 1 1 67 VAL HG23 H   -8.769   0.716   3.185 1.00 . A A . 723 VAL HG23 1 1 
        5  6860 1 1 67 VAL N    N   -5.559  -0.714   6.201 1.00 . A A . 723 VAL N    1 1 
        5  6861 1 1 67 VAL O    O   -8.033  -1.505   7.321 1.00 . A A . 723 VAL O    1 1 
        5  6862 1 1 68 THR C    C  -11.238   0.463   7.588 1.00 . A A . 724 THR C    1 1 
        5  6863 1 1 68 THR CA   C   -9.854   0.399   8.259 1.00 . A A . 724 THR CA   1 1 
        5  6864 1 1 68 THR CB   C   -9.818   1.431   9.417 1.00 . A A . 724 THR CB   1 1 
        5  6865 1 1 68 THR CG2  C  -10.923   1.167  10.435 1.00 . A A . 724 THR CG2  1 1 
        5  6866 1 1 68 THR H    H   -8.640   1.528   6.925 1.00 . A A . 724 THR H    1 1 
        5  6867 1 1 68 THR HA   H   -9.721  -0.586   8.687 1.00 . A A . 724 THR HA   1 1 
        5  6868 1 1 68 THR HB   H   -9.961   2.421   9.005 1.00 . A A . 724 THR HB   1 1 
        5  6869 1 1 68 THR HG1  H   -7.843   1.274   9.433 1.00 . A A . 724 THR HG1  1 1 
        5  6870 1 1 68 THR HG21 H  -10.804   0.174  10.846 1.00 . A A . 724 THR HG21 1 1 
        5  6871 1 1 68 THR HG22 H  -11.887   1.244   9.953 1.00 . A A . 724 THR HG22 1 1 
        5  6872 1 1 68 THR HG23 H  -10.859   1.895  11.232 1.00 . A A . 724 THR HG23 1 1 
        5  6873 1 1 68 THR N    N   -8.758   0.632   7.303 1.00 . A A . 724 THR N    1 1 
        5  6874 1 1 68 THR O    O  -11.529   1.378   6.819 1.00 . A A . 724 THR O    1 1 
        5  6875 1 1 68 THR OG1  O   -8.548   1.388  10.087 1.00 . A A . 724 THR OG1  1 1 
        5  6876 1 1 69 ASP C    C  -14.356   0.461   8.109 1.00 . A A . 725 ASP C    1 1 
        5  6877 1 1 69 ASP CA   C  -13.466  -0.576   7.400 1.00 . A A . 725 ASP CA   1 1 
        5  6878 1 1 69 ASP CB   C  -14.015  -1.994   7.639 1.00 . A A . 725 ASP CB   1 1 
        5  6879 1 1 69 ASP CG   C  -15.416  -2.260   7.098 1.00 . A A . 725 ASP CG   1 1 
        5  6880 1 1 69 ASP H    H  -11.759  -1.247   8.470 1.00 . A A . 725 ASP H    1 1 
        5  6881 1 1 69 ASP HA   H  -13.454  -0.373   6.340 1.00 . A A . 725 ASP HA   1 1 
        5  6882 1 1 69 ASP HB2  H  -13.345  -2.701   7.180 1.00 . A A . 725 ASP HB2  1 1 
        5  6883 1 1 69 ASP HB3  H  -14.026  -2.178   8.705 1.00 . A A . 725 ASP HB3  1 1 
        5  6884 1 1 69 ASP N    N  -12.081  -0.520   7.899 1.00 . A A . 725 ASP N    1 1 
        5  6885 1 1 69 ASP O    O  -14.090   0.850   9.250 1.00 . A A . 725 ASP O    1 1 
        5  6886 1 1 69 ASP OD1  O  -15.918  -1.496   6.261 1.00 . A A . 725 ASP OD1  1 1 
        5  6887 1 1 69 ASP OD2  O  -16.032  -3.257   7.517 1.00 . A A . 725 ASP OD2  1 1 
        5  6888 1 1 70 SER C    C  -16.989   1.250   9.331 1.00 . A A . 726 SER C    1 1 
        5  6889 1 1 70 SER CA   C  -16.392   1.816   8.035 1.00 . A A . 726 SER CA   1 1 
        5  6890 1 1 70 SER CB   C  -17.513   2.129   7.039 1.00 . A A . 726 SER CB   1 1 
        5  6891 1 1 70 SER H    H  -15.576   0.550   6.528 1.00 . A A . 726 SER H    1 1 
        5  6892 1 1 70 SER HA   H  -15.865   2.731   8.268 1.00 . A A . 726 SER HA   1 1 
        5  6893 1 1 70 SER HB2  H  -17.095   2.622   6.174 1.00 . A A . 726 SER HB2  1 1 
        5  6894 1 1 70 SER HB3  H  -17.984   1.206   6.732 1.00 . A A . 726 SER HB3  1 1 
        5  6895 1 1 70 SER HG   H  -18.190   3.892   7.578 1.00 . A A . 726 SER HG   1 1 
        5  6896 1 1 70 SER N    N  -15.427   0.880   7.442 1.00 . A A . 726 SER N    1 1 
        5  6897 1 1 70 SER O    O  -17.368   1.996  10.234 1.00 . A A . 726 SER O    1 1 
        5  6898 1 1 70 SER OG   O  -18.499   2.976   7.615 1.00 . A A . 726 SER OG   1 1 
        5  6899 1 1 71 LYS C    C  -16.444  -1.059  11.636 1.00 . A A . 727 LYS C    1 1 
        5  6900 1 1 71 LYS CA   C  -17.569  -0.755  10.627 1.00 . A A . 727 LYS CA   1 1 
        5  6901 1 1 71 LYS CB   C  -18.268  -2.065  10.257 1.00 . A A . 727 LYS CB   1 1 
        5  6902 1 1 71 LYS CD   C  -20.408  -0.931   9.474 1.00 . A A . 727 LYS CD   1 1 
        5  6903 1 1 71 LYS CE   C  -21.621  -1.121   8.561 1.00 . A A . 727 LYS CE   1 1 
        5  6904 1 1 71 LYS CG   C  -19.310  -1.941   9.154 1.00 . A A . 727 LYS CG   1 1 
        5  6905 1 1 71 LYS H    H  -16.778  -0.623   8.653 1.00 . A A . 727 LYS H    1 1 
        5  6906 1 1 71 LYS HA   H  -18.287  -0.097  11.098 1.00 . A A . 727 LYS HA   1 1 
        5  6907 1 1 71 LYS HB2  H  -17.522  -2.776   9.928 1.00 . A A . 727 LYS HB2  1 1 
        5  6908 1 1 71 LYS HB3  H  -18.757  -2.459  11.139 1.00 . A A . 727 LYS HB3  1 1 
        5  6909 1 1 71 LYS HD2  H  -20.718  -1.061  10.502 1.00 . A A . 727 LYS HD2  1 1 
        5  6910 1 1 71 LYS HD3  H  -20.018   0.068   9.337 1.00 . A A . 727 LYS HD3  1 1 
        5  6911 1 1 71 LYS HE2  H  -22.134  -2.027   8.851 1.00 . A A . 727 LYS HE2  1 1 
        5  6912 1 1 71 LYS HE3  H  -22.285  -0.279   8.688 1.00 . A A . 727 LYS HE3  1 1 
        5  6913 1 1 71 LYS HG2  H  -18.815  -1.637   8.242 1.00 . A A . 727 LYS HG2  1 1 
        5  6914 1 1 71 LYS HG3  H  -19.763  -2.910   9.003 1.00 . A A . 727 LYS HG3  1 1 
        5  6915 1 1 71 LYS HZ1  H  -20.687  -0.394   6.836 1.00 . A A . 727 LYS HZ1  1 1 
        5  6916 1 1 71 LYS HZ2  H  -22.096  -1.279   6.532 1.00 . A A . 727 LYS HZ2  1 1 
        5  6917 1 1 71 LYS HZ3  H  -20.670  -2.085   6.960 1.00 . A A . 727 LYS HZ3  1 1 
        5  6918 1 1 71 LYS N    N  -17.060  -0.082   9.421 1.00 . A A . 727 LYS N    1 1 
        5  6919 1 1 71 LYS NZ   N  -21.240  -1.226   7.123 1.00 . A A . 727 LYS NZ   1 1 
        5  6920 1 1 71 LYS O    O  -16.711  -1.452  12.773 1.00 . A A . 727 LYS O    1 1 
        5  6921 1 1 72 GLY C    C  -13.188  -2.353  11.729 1.00 . A A . 728 GLY C    1 1 
        5  6922 1 1 72 GLY CA   C  -14.050  -1.143  12.106 1.00 . A A . 728 GLY CA   1 1 
        5  6923 1 1 72 GLY H    H  -15.028  -0.588  10.298 1.00 . A A . 728 GLY H    1 1 
        5  6924 1 1 72 GLY HA2  H  -13.419  -0.268  12.098 1.00 . A A . 728 GLY HA2  1 1 
        5  6925 1 1 72 GLY HA3  H  -14.421  -1.284  13.112 1.00 . A A . 728 GLY HA3  1 1 
        5  6926 1 1 72 GLY N    N  -15.186  -0.898  11.212 1.00 . A A . 728 GLY N    1 1 
        5  6927 1 1 72 GLY O    O  -12.201  -2.642  12.406 1.00 . A A . 728 GLY O    1 1 
        5  6928 1 1 73 HIS C    C  -11.394  -3.692   9.617 1.00 . A A . 729 HIS C    1 1 
        5  6929 1 1 73 HIS CA   C  -12.723  -4.194  10.199 1.00 . A A . 729 HIS CA   1 1 
        5  6930 1 1 73 HIS CB   C  -13.462  -5.022   9.141 1.00 . A A . 729 HIS CB   1 1 
        5  6931 1 1 73 HIS CD2  C  -14.694  -6.753  10.625 1.00 . A A . 729 HIS CD2  1 1 
        5  6932 1 1 73 HIS CE1  C  -16.698  -6.520   9.786 1.00 . A A . 729 HIS CE1  1 1 
        5  6933 1 1 73 HIS CG   C  -14.628  -5.796   9.670 1.00 . A A . 729 HIS CG   1 1 
        5  6934 1 1 73 HIS H    H  -14.377  -2.860  10.195 1.00 . A A . 729 HIS H    1 1 
        5  6935 1 1 73 HIS HA   H  -12.512  -4.826  11.052 1.00 . A A . 729 HIS HA   1 1 
        5  6936 1 1 73 HIS HB2  H  -13.829  -4.363   8.371 1.00 . A A . 729 HIS HB2  1 1 
        5  6937 1 1 73 HIS HB3  H  -12.771  -5.725   8.699 1.00 . A A . 729 HIS HB3  1 1 
        5  6938 1 1 73 HIS HD1  H  -16.189  -5.056   8.457 1.00 . A A . 729 HIS HD1  1 1 
        5  6939 1 1 73 HIS HD2  H  -13.875  -7.107  11.235 1.00 . A A . 729 HIS HD2  1 1 
        5  6940 1 1 73 HIS HE1  H  -17.749  -6.654   9.591 1.00 . A A . 729 HIS HE1  1 1 
        5  6941 1 1 73 HIS HE2  H  -16.293  -8.011  11.110 1.00 . A A . 729 HIS HE2  1 1 
        5  6942 1 1 73 HIS N    N  -13.548  -3.075  10.666 1.00 . A A . 729 HIS N    1 1 
        5  6943 1 1 73 HIS ND1  N  -15.903  -5.677   9.165 1.00 . A A . 729 HIS ND1  1 1 
        5  6944 1 1 73 HIS NE2  N  -15.994  -7.186  10.675 1.00 . A A . 729 HIS NE2  1 1 
        5  6945 1 1 73 HIS O    O  -11.353  -3.149   8.515 1.00 . A A . 729 HIS O    1 1 
        5  6946 1 1 74 GLU C    C   -8.207  -4.575   9.274 1.00 . A A . 730 GLU C    1 1 
        5  6947 1 1 74 GLU CA   C   -8.992  -3.419   9.925 1.00 . A A . 730 GLU CA   1 1 
        5  6948 1 1 74 GLU CB   C   -8.215  -2.845  11.116 1.00 . A A . 730 GLU CB   1 1 
        5  6949 1 1 74 GLU CD   C   -6.079  -1.779  11.963 1.00 . A A . 730 GLU CD   1 1 
        5  6950 1 1 74 GLU CG   C   -6.862  -2.247  10.747 1.00 . A A . 730 GLU CG   1 1 
        5  6951 1 1 74 GLU H    H  -10.406  -4.312  11.233 1.00 . A A . 730 GLU H    1 1 
        5  6952 1 1 74 GLU HA   H   -9.132  -2.638   9.190 1.00 . A A . 730 GLU HA   1 1 
        5  6953 1 1 74 GLU HB2  H   -8.811  -2.069  11.576 1.00 . A A . 730 GLU HB2  1 1 
        5  6954 1 1 74 GLU HB3  H   -8.051  -3.633  11.838 1.00 . A A . 730 GLU HB3  1 1 
        5  6955 1 1 74 GLU HG2  H   -6.278  -2.997  10.229 1.00 . A A . 730 GLU HG2  1 1 
        5  6956 1 1 74 GLU HG3  H   -7.023  -1.403  10.090 1.00 . A A . 730 GLU HG3  1 1 
        5  6957 1 1 74 GLU N    N  -10.316  -3.867  10.364 1.00 . A A . 730 GLU N    1 1 
        5  6958 1 1 74 GLU O    O   -8.058  -5.649   9.864 1.00 . A A . 730 GLU O    1 1 
        5  6959 1 1 74 GLU OE1  O   -5.373  -2.607  12.575 1.00 . A A . 730 GLU OE1  1 1 
        5  6960 1 1 74 GLU OE2  O   -6.169  -0.584  12.317 1.00 . A A . 730 GLU OE2  1 1 
        5  6961 1 1 75 VAL C    C   -5.608  -4.771   6.833 1.00 . A A . 731 VAL C    1 1 
        5  6962 1 1 75 VAL CA   C   -6.939  -5.362   7.324 1.00 . A A . 731 VAL CA   1 1 
        5  6963 1 1 75 VAL CB   C   -7.719  -5.953   6.118 1.00 . A A . 731 VAL CB   1 1 
        5  6964 1 1 75 VAL CG1  C   -8.979  -6.682   6.586 1.00 . A A . 731 VAL CG1  1 1 
        5  6965 1 1 75 VAL CG2  C   -8.068  -4.866   5.102 1.00 . A A . 731 VAL CG2  1 1 
        5  6966 1 1 75 VAL H    H   -7.900  -3.488   7.619 1.00 . A A . 731 VAL H    1 1 
        5  6967 1 1 75 VAL HA   H   -6.721  -6.171   8.011 1.00 . A A . 731 VAL HA   1 1 
        5  6968 1 1 75 VAL HB   H   -7.081  -6.675   5.628 1.00 . A A . 731 VAL HB   1 1 
        5  6969 1 1 75 VAL HG11 H   -9.523  -7.052   5.728 1.00 . A A . 731 VAL HG11 1 1 
        5  6970 1 1 75 VAL HG12 H   -9.607  -6.001   7.143 1.00 . A A . 731 VAL HG12 1 1 
        5  6971 1 1 75 VAL HG13 H   -8.701  -7.512   7.220 1.00 . A A . 731 VAL HG13 1 1 
        5  6972 1 1 75 VAL HG21 H   -7.160  -4.400   4.745 1.00 . A A . 731 VAL HG21 1 1 
        5  6973 1 1 75 VAL HG22 H   -8.694  -4.120   5.571 1.00 . A A . 731 VAL HG22 1 1 
        5  6974 1 1 75 VAL HG23 H   -8.596  -5.306   4.268 1.00 . A A . 731 VAL HG23 1 1 
        5  6975 1 1 75 VAL N    N   -7.729  -4.356   8.048 1.00 . A A . 731 VAL N    1 1 
        5  6976 1 1 75 VAL O    O   -5.478  -3.556   6.680 1.00 . A A . 731 VAL O    1 1 
        5  6977 1 1 76 THR C    C   -2.599  -6.062   5.163 1.00 . A A . 732 THR C    1 1 
        5  6978 1 1 76 THR CA   C   -3.274  -5.167   6.211 1.00 . A A . 732 THR CA   1 1 
        5  6979 1 1 76 THR CB   C   -2.360  -5.084   7.459 1.00 . A A . 732 THR CB   1 1 
        5  6980 1 1 76 THR CG2  C   -2.324  -6.413   8.211 1.00 . A A . 732 THR CG2  1 1 
        5  6981 1 1 76 THR H    H   -4.802  -6.596   6.620 1.00 . A A . 732 THR H    1 1 
        5  6982 1 1 76 THR HA   H   -3.366  -4.171   5.801 1.00 . A A . 732 THR HA   1 1 
        5  6983 1 1 76 THR HB   H   -2.757  -4.328   8.121 1.00 . A A . 732 THR HB   1 1 
        5  6984 1 1 76 THR HG1  H   -0.964  -3.745   7.054 1.00 . A A . 732 THR HG1  1 1 
        5  6985 1 1 76 THR HG21 H   -1.686  -6.319   9.079 1.00 . A A . 732 THR HG21 1 1 
        5  6986 1 1 76 THR HG22 H   -1.936  -7.185   7.562 1.00 . A A . 732 THR HG22 1 1 
        5  6987 1 1 76 THR HG23 H   -3.323  -6.679   8.526 1.00 . A A . 732 THR HG23 1 1 
        5  6988 1 1 76 THR N    N   -4.623  -5.632   6.573 1.00 . A A . 732 THR N    1 1 
        5  6989 1 1 76 THR O    O   -2.853  -7.266   5.092 1.00 . A A . 732 THR O    1 1 
        5  6990 1 1 76 THR OG1  O   -1.027  -4.709   7.079 1.00 . A A . 732 THR OG1  1 1 
        5  6991 1 1 77 ALA C    C    0.404  -5.470   3.128 1.00 . A A . 733 ALA C    1 1 
        5  6992 1 1 77 ALA CA   C   -0.950  -6.168   3.338 1.00 . A A . 733 ALA CA   1 1 
        5  6993 1 1 77 ALA CB   C   -1.725  -6.259   2.027 1.00 . A A . 733 ALA CB   1 1 
        5  6994 1 1 77 ALA H    H   -1.630  -4.481   4.429 1.00 . A A . 733 ALA H    1 1 
        5  6995 1 1 77 ALA HA   H   -0.772  -7.173   3.700 1.00 . A A . 733 ALA HA   1 1 
        5  6996 1 1 77 ALA HB1  H   -2.669  -6.754   2.201 1.00 . A A . 733 ALA HB1  1 1 
        5  6997 1 1 77 ALA HB2  H   -1.152  -6.822   1.305 1.00 . A A . 733 ALA HB2  1 1 
        5  6998 1 1 77 ALA HB3  H   -1.905  -5.264   1.646 1.00 . A A . 733 ALA HB3  1 1 
        5  6999 1 1 77 ALA N    N   -1.742  -5.453   4.348 1.00 . A A . 733 ALA N    1 1 
        5  7000 1 1 77 ALA O    O    0.529  -4.267   3.368 1.00 . A A . 733 ALA O    1 1 
        5  7001 1 1 78 LYS C    C    3.331  -5.681   1.134 1.00 . A A . 734 LYS C    1 1 
        5  7002 1 1 78 LYS CA   C    2.781  -5.656   2.570 1.00 . A A . 734 LYS CA   1 1 
        5  7003 1 1 78 LYS CB   C    3.737  -6.414   3.504 1.00 . A A . 734 LYS CB   1 1 
        5  7004 1 1 78 LYS CD   C    4.404  -6.960   5.886 1.00 . A A . 734 LYS CD   1 1 
        5  7005 1 1 78 LYS CE   C    4.055  -6.786   7.362 1.00 . A A . 734 LYS CE   1 1 
        5  7006 1 1 78 LYS CG   C    3.380  -6.280   4.982 1.00 . A A . 734 LYS CG   1 1 
        5  7007 1 1 78 LYS H    H    1.254  -7.141   2.413 1.00 . A A . 734 LYS H    1 1 
        5  7008 1 1 78 LYS HA   H    2.739  -4.623   2.894 1.00 . A A . 734 LYS HA   1 1 
        5  7009 1 1 78 LYS HB2  H    3.719  -7.465   3.243 1.00 . A A . 734 LYS HB2  1 1 
        5  7010 1 1 78 LYS HB3  H    4.740  -6.035   3.361 1.00 . A A . 734 LYS HB3  1 1 
        5  7011 1 1 78 LYS HD2  H    4.430  -8.016   5.654 1.00 . A A . 734 LYS HD2  1 1 
        5  7012 1 1 78 LYS HD3  H    5.378  -6.527   5.700 1.00 . A A . 734 LYS HD3  1 1 
        5  7013 1 1 78 LYS HE2  H    4.003  -5.730   7.586 1.00 . A A . 734 LYS HE2  1 1 
        5  7014 1 1 78 LYS HE3  H    3.091  -7.238   7.548 1.00 . A A . 734 LYS HE3  1 1 
        5  7015 1 1 78 LYS HG2  H    3.334  -5.230   5.235 1.00 . A A . 734 LYS HG2  1 1 
        5  7016 1 1 78 LYS HG3  H    2.411  -6.731   5.147 1.00 . A A . 734 LYS HG3  1 1 
        5  7017 1 1 78 LYS HZ1  H    4.820  -7.233   9.250 1.00 . A A . 734 LYS HZ1  1 1 
        5  7018 1 1 78 LYS HZ2  H    6.004  -7.027   8.064 1.00 . A A . 734 LYS HZ2  1 1 
        5  7019 1 1 78 LYS HZ3  H    5.086  -8.445   8.103 1.00 . A A . 734 LYS HZ3  1 1 
        5  7020 1 1 78 LYS N    N    1.419  -6.210   2.679 1.00 . A A . 734 LYS N    1 1 
        5  7021 1 1 78 LYS NZ   N    5.062  -7.417   8.256 1.00 . A A . 734 LYS NZ   1 1 
        5  7022 1 1 78 LYS O    O    2.922  -6.499   0.305 1.00 . A A . 734 LYS O    1 1 
        5  7023 1 1 79 GLN C    C    6.457  -4.465  -0.254 1.00 . A A . 735 GLN C    1 1 
        5  7024 1 1 79 GLN CA   C    4.945  -4.684  -0.440 1.00 . A A . 735 GLN CA   1 1 
        5  7025 1 1 79 GLN CB   C    4.376  -3.526  -1.280 1.00 . A A . 735 GLN CB   1 1 
        5  7026 1 1 79 GLN CD   C    4.662  -2.103  -3.384 1.00 . A A . 735 GLN CD   1 1 
        5  7027 1 1 79 GLN CG   C    5.053  -3.375  -2.644 1.00 . A A . 735 GLN CG   1 1 
        5  7028 1 1 79 GLN H    H    4.523  -4.135   1.564 1.00 . A A . 735 GLN H    1 1 
        5  7029 1 1 79 GLN HA   H    4.785  -5.616  -0.965 1.00 . A A . 735 GLN HA   1 1 
        5  7030 1 1 79 GLN HB2  H    3.319  -3.698  -1.442 1.00 . A A . 735 GLN HB2  1 1 
        5  7031 1 1 79 GLN HB3  H    4.501  -2.601  -0.733 1.00 . A A . 735 GLN HB3  1 1 
        5  7032 1 1 79 GLN HE21 H    4.512  -1.097  -1.685 1.00 . A A . 735 GLN HE21 1 1 
        5  7033 1 1 79 GLN HE22 H    4.206  -0.202  -3.130 1.00 . A A . 735 GLN HE22 1 1 
        5  7034 1 1 79 GLN HG2  H    6.123  -3.367  -2.498 1.00 . A A . 735 GLN HG2  1 1 
        5  7035 1 1 79 GLN HG3  H    4.786  -4.225  -3.258 1.00 . A A . 735 GLN HG3  1 1 
        5  7036 1 1 79 GLN N    N    4.270  -4.771   0.862 1.00 . A A . 735 GLN N    1 1 
        5  7037 1 1 79 GLN NE2  N    4.429  -1.028  -2.657 1.00 . A A . 735 GLN NE2  1 1 
        5  7038 1 1 79 GLN O    O    6.876  -3.509   0.400 1.00 . A A . 735 GLN O    1 1 
        5  7039 1 1 79 GLN OE1  O    4.599  -2.076  -4.607 1.00 . A A . 735 GLN OE1  1 1 
        5  7040 1 1 80 THR C    C    9.256  -4.453  -2.025 1.00 . A A . 736 THR C    1 1 
        5  7041 1 1 80 THR CA   C    8.733  -5.191  -0.781 1.00 . A A . 736 THR CA   1 1 
        5  7042 1 1 80 THR CB   C    9.441  -6.568  -0.653 1.00 . A A . 736 THR CB   1 1 
        5  7043 1 1 80 THR CG2  C   10.962  -6.427  -0.670 1.00 . A A . 736 THR CG2  1 1 
        5  7044 1 1 80 THR H    H    6.886  -6.116  -1.300 1.00 . A A . 736 THR H    1 1 
        5  7045 1 1 80 THR HA   H    8.974  -4.605   0.097 1.00 . A A . 736 THR HA   1 1 
        5  7046 1 1 80 THR HB   H    9.144  -7.184  -1.488 1.00 . A A . 736 THR HB   1 1 
        5  7047 1 1 80 THR HG1  H    9.808  -7.310   1.148 1.00 . A A . 736 THR HG1  1 1 
        5  7048 1 1 80 THR HG21 H   11.274  -5.971  -1.599 1.00 . A A . 736 THR HG21 1 1 
        5  7049 1 1 80 THR HG22 H   11.413  -7.404  -0.582 1.00 . A A . 736 THR HG22 1 1 
        5  7050 1 1 80 THR HG23 H   11.278  -5.808   0.158 1.00 . A A . 736 THR HG23 1 1 
        5  7051 1 1 80 THR N    N    7.272  -5.342  -0.832 1.00 . A A . 736 THR N    1 1 
        5  7052 1 1 80 THR O    O    9.311  -5.013  -3.121 1.00 . A A . 736 THR O    1 1 
        5  7053 1 1 80 THR OG1  O    9.041  -7.216   0.567 1.00 . A A . 736 THR OG1  1 1 
        5  7054 1 1 81 VAL C    C   11.623  -2.331  -3.084 1.00 . A A . 737 VAL C    1 1 
        5  7055 1 1 81 VAL CA   C   10.090  -2.349  -2.972 1.00 . A A . 737 VAL CA   1 1 
        5  7056 1 1 81 VAL CB   C    9.579  -0.895  -2.807 1.00 . A A . 737 VAL CB   1 1 
        5  7057 1 1 81 VAL CG1  C    9.964  -0.030  -4.007 1.00 . A A . 737 VAL CG1  1 1 
        5  7058 1 1 81 VAL CG2  C    8.069  -0.875  -2.588 1.00 . A A . 737 VAL CG2  1 1 
        5  7059 1 1 81 VAL H    H    9.625  -2.807  -0.947 1.00 . A A . 737 VAL H    1 1 
        5  7060 1 1 81 VAL HA   H    9.675  -2.754  -3.886 1.00 . A A . 737 VAL HA   1 1 
        5  7061 1 1 81 VAL HB   H   10.049  -0.474  -1.928 1.00 . A A . 737 VAL HB   1 1 
        5  7062 1 1 81 VAL HG11 H   11.040  -0.006  -4.105 1.00 . A A . 737 VAL HG11 1 1 
        5  7063 1 1 81 VAL HG12 H    9.594   0.975  -3.857 1.00 . A A . 737 VAL HG12 1 1 
        5  7064 1 1 81 VAL HG13 H    9.529  -0.442  -4.906 1.00 . A A . 737 VAL HG13 1 1 
        5  7065 1 1 81 VAL HG21 H    7.740   0.146  -2.451 1.00 . A A . 737 VAL HG21 1 1 
        5  7066 1 1 81 VAL HG22 H    7.823  -1.451  -1.707 1.00 . A A . 737 VAL HG22 1 1 
        5  7067 1 1 81 VAL HG23 H    7.570  -1.299  -3.447 1.00 . A A . 737 VAL HG23 1 1 
        5  7068 1 1 81 VAL N    N    9.639  -3.189  -1.852 1.00 . A A . 737 VAL N    1 1 
        5  7069 1 1 81 VAL O    O   12.325  -2.297  -2.077 1.00 . A A . 737 VAL O    1 1 
        5  7070 1 1 82 THR C    C   14.029  -1.251  -5.524 1.00 . A A . 738 THR C    1 1 
        5  7071 1 1 82 THR CA   C   13.592  -2.349  -4.540 1.00 . A A . 738 THR CA   1 1 
        5  7072 1 1 82 THR CB   C   14.074  -3.724  -5.063 1.00 . A A . 738 THR CB   1 1 
        5  7073 1 1 82 THR CG2  C   15.566  -3.710  -5.394 1.00 . A A . 738 THR CG2  1 1 
        5  7074 1 1 82 THR H    H   11.532  -2.362  -5.083 1.00 . A A . 738 THR H    1 1 
        5  7075 1 1 82 THR HA   H   14.078  -2.168  -3.589 1.00 . A A . 738 THR HA   1 1 
        5  7076 1 1 82 THR HB   H   13.522  -3.960  -5.961 1.00 . A A . 738 THR HB   1 1 
        5  7077 1 1 82 THR HG1  H   13.201  -5.388  -4.447 1.00 . A A . 738 THR HG1  1 1 
        5  7078 1 1 82 THR HG21 H   15.757  -2.985  -6.174 1.00 . A A . 738 THR HG21 1 1 
        5  7079 1 1 82 THR HG22 H   15.870  -4.690  -5.733 1.00 . A A . 738 THR HG22 1 1 
        5  7080 1 1 82 THR HG23 H   16.130  -3.445  -4.513 1.00 . A A . 738 THR HG23 1 1 
        5  7081 1 1 82 THR N    N   12.139  -2.347  -4.312 1.00 . A A . 738 THR N    1 1 
        5  7082 1 1 82 THR O    O   13.555  -1.185  -6.661 1.00 . A A . 738 THR O    1 1 
        5  7083 1 1 82 THR OG1  O   13.811  -4.738  -4.080 1.00 . A A . 738 THR OG1  1 1 
        5  7084 1 1 83 VAL C    C   16.867   0.207  -6.489 1.00 . A A . 739 VAL C    1 1 
        5  7085 1 1 83 VAL CA   C   15.523   0.665  -5.897 1.00 . A A . 739 VAL CA   1 1 
        5  7086 1 1 83 VAL CB   C   15.740   1.966  -5.078 1.00 . A A . 739 VAL CB   1 1 
        5  7087 1 1 83 VAL CG1  C   16.281   3.089  -5.961 1.00 . A A . 739 VAL CG1  1 1 
        5  7088 1 1 83 VAL CG2  C   14.446   2.393  -4.384 1.00 . A A . 739 VAL CG2  1 1 
        5  7089 1 1 83 VAL H    H   15.217  -0.461  -4.130 1.00 . A A . 739 VAL H    1 1 
        5  7090 1 1 83 VAL HA   H   14.836   0.880  -6.706 1.00 . A A . 739 VAL HA   1 1 
        5  7091 1 1 83 VAL HB   H   16.477   1.763  -4.312 1.00 . A A . 739 VAL HB   1 1 
        5  7092 1 1 83 VAL HG11 H   17.230   2.792  -6.385 1.00 . A A . 739 VAL HG11 1 1 
        5  7093 1 1 83 VAL HG12 H   16.417   3.981  -5.367 1.00 . A A . 739 VAL HG12 1 1 
        5  7094 1 1 83 VAL HG13 H   15.580   3.292  -6.758 1.00 . A A . 739 VAL HG13 1 1 
        5  7095 1 1 83 VAL HG21 H   14.133   1.621  -3.695 1.00 . A A . 739 VAL HG21 1 1 
        5  7096 1 1 83 VAL HG22 H   13.673   2.550  -5.121 1.00 . A A . 739 VAL HG22 1 1 
        5  7097 1 1 83 VAL HG23 H   14.613   3.311  -3.840 1.00 . A A . 739 VAL HG23 1 1 
        5  7098 1 1 83 VAL N    N   14.934  -0.390  -5.065 1.00 . A A . 739 VAL N    1 1 
        5  7099 1 1 83 VAL O    O   17.777  -0.183  -5.755 1.00 . A A . 739 VAL O    1 1 
        5  7100 1 1 84 LYS C    C   19.098   0.944  -8.956 1.00 . A A . 740 LYS C    1 1 
        5  7101 1 1 84 LYS CA   C   18.188  -0.212  -8.511 1.00 . A A . 740 LYS CA   1 1 
        5  7102 1 1 84 LYS CB   C   17.795  -1.045  -9.741 1.00 . A A . 740 LYS CB   1 1 
        5  7103 1 1 84 LYS CD   C   16.670  -3.107 -10.670 1.00 . A A . 740 LYS CD   1 1 
        5  7104 1 1 84 LYS CE   C   17.934  -3.616 -11.355 1.00 . A A . 740 LYS CE   1 1 
        5  7105 1 1 84 LYS CG   C   16.985  -2.294  -9.414 1.00 . A A . 740 LYS CG   1 1 
        5  7106 1 1 84 LYS H    H   16.256   0.643  -8.336 1.00 . A A . 740 LYS H    1 1 
        5  7107 1 1 84 LYS HA   H   18.741  -0.844  -7.827 1.00 . A A . 740 LYS HA   1 1 
        5  7108 1 1 84 LYS HB2  H   17.208  -0.427 -10.406 1.00 . A A . 740 LYS HB2  1 1 
        5  7109 1 1 84 LYS HB3  H   18.695  -1.352 -10.255 1.00 . A A . 740 LYS HB3  1 1 
        5  7110 1 1 84 LYS HD2  H   16.060  -3.954 -10.394 1.00 . A A . 740 LYS HD2  1 1 
        5  7111 1 1 84 LYS HD3  H   16.123  -2.482 -11.361 1.00 . A A . 740 LYS HD3  1 1 
        5  7112 1 1 84 LYS HE2  H   18.552  -2.771 -11.623 1.00 . A A . 740 LYS HE2  1 1 
        5  7113 1 1 84 LYS HE3  H   18.473  -4.252 -10.668 1.00 . A A . 740 LYS HE3  1 1 
        5  7114 1 1 84 LYS HG2  H   17.552  -2.911  -8.731 1.00 . A A . 740 LYS HG2  1 1 
        5  7115 1 1 84 LYS HG3  H   16.056  -1.998  -8.945 1.00 . A A . 740 LYS HG3  1 1 
        5  7116 1 1 84 LYS HZ1  H   16.973  -5.173 -12.367 1.00 . A A . 740 LYS HZ1  1 1 
        5  7117 1 1 84 LYS HZ2  H   18.494  -4.782 -12.994 1.00 . A A . 740 LYS HZ2  1 1 
        5  7118 1 1 84 LYS HZ3  H   17.172  -3.774 -13.293 1.00 . A A . 740 LYS HZ3  1 1 
        5  7119 1 1 84 LYS N    N   16.989   0.267  -7.813 1.00 . A A . 740 LYS N    1 1 
        5  7120 1 1 84 LYS NZ   N   17.623  -4.389 -12.586 1.00 . A A . 740 LYS NZ   1 1 
        5  7121 1 1 84 LYS O    O   18.637   2.054  -9.238 1.00 . A A . 740 LYS O    1 1 
        5  7122 1 1 85 VAL C    C   21.351   1.939 -10.960 1.00 . A A . 741 VAL C    1 1 
        5  7123 1 1 85 VAL CA   C   21.395   1.647  -9.449 1.00 . A A . 741 VAL CA   1 1 
        5  7124 1 1 85 VAL CB   C   22.819   1.151  -9.084 1.00 . A A . 741 VAL CB   1 1 
        5  7125 1 1 85 VAL CG1  C   23.882   2.145  -9.538 1.00 . A A . 741 VAL CG1  1 1 
        5  7126 1 1 85 VAL CG2  C   22.940   0.888  -7.587 1.00 . A A . 741 VAL CG2  1 1 
        5  7127 1 1 85 VAL H    H   20.687  -0.251  -8.832 1.00 . A A . 741 VAL H    1 1 
        5  7128 1 1 85 VAL HA   H   21.204   2.563  -8.905 1.00 . A A . 741 VAL HA   1 1 
        5  7129 1 1 85 VAL HB   H   22.992   0.218  -9.602 1.00 . A A . 741 VAL HB   1 1 
        5  7130 1 1 85 VAL HG11 H   24.861   1.779  -9.260 1.00 . A A . 741 VAL HG11 1 1 
        5  7131 1 1 85 VAL HG12 H   23.710   3.101  -9.062 1.00 . A A . 741 VAL HG12 1 1 
        5  7132 1 1 85 VAL HG13 H   23.834   2.263 -10.609 1.00 . A A . 741 VAL HG13 1 1 
        5  7133 1 1 85 VAL HG21 H   23.937   0.537  -7.363 1.00 . A A . 741 VAL HG21 1 1 
        5  7134 1 1 85 VAL HG22 H   22.222   0.139  -7.291 1.00 . A A . 741 VAL HG22 1 1 
        5  7135 1 1 85 VAL HG23 H   22.752   1.804  -7.044 1.00 . A A . 741 VAL HG23 1 1 
        5  7136 1 1 85 VAL N    N   20.391   0.659  -9.045 1.00 . A A . 741 VAL N    1 1 
        5  7137 1 1 85 VAL O    O   21.019   1.064 -11.764 1.00 . A A . 741 VAL O    1 1 
        5  7138 1 1 86 ARG C    C   22.999   4.609 -12.884 1.00 . A A . 742 ARG C    1 1 
        5  7139 1 1 86 ARG CA   C   21.916   3.526 -12.742 1.00 . A A . 742 ARG CA   1 1 
        5  7140 1 1 86 ARG CB   C   20.624   3.947 -13.471 1.00 . A A . 742 ARG CB   1 1 
        5  7141 1 1 86 ARG CD   C   18.701   5.550 -13.738 1.00 . A A . 742 ARG CD   1 1 
        5  7142 1 1 86 ARG CG   C   19.807   5.055 -12.801 1.00 . A A . 742 ARG CG   1 1 
        5  7143 1 1 86 ARG CZ   C   17.410   7.599 -13.341 1.00 . A A . 742 ARG CZ   1 1 
        5  7144 1 1 86 ARG H    H   21.747   3.872 -10.651 1.00 . A A . 742 ARG H    1 1 
        5  7145 1 1 86 ARG HA   H   22.292   2.628 -13.220 1.00 . A A . 742 ARG HA   1 1 
        5  7146 1 1 86 ARG HB2  H   20.890   4.285 -14.463 1.00 . A A . 742 ARG HB2  1 1 
        5  7147 1 1 86 ARG HB3  H   19.990   3.076 -13.568 1.00 . A A . 742 ARG HB3  1 1 
        5  7148 1 1 86 ARG HD2  H   19.150   6.147 -14.517 1.00 . A A . 742 ARG HD2  1 1 
        5  7149 1 1 86 ARG HD3  H   18.218   4.691 -14.186 1.00 . A A . 742 ARG HD3  1 1 
        5  7150 1 1 86 ARG HE   H   17.143   5.914 -12.371 1.00 . A A . 742 ARG HE   1 1 
        5  7151 1 1 86 ARG HG2  H   19.360   4.668 -11.897 1.00 . A A . 742 ARG HG2  1 1 
        5  7152 1 1 86 ARG HG3  H   20.461   5.881 -12.560 1.00 . A A . 742 ARG HG3  1 1 
        5  7153 1 1 86 ARG HH11 H   18.886   7.826 -14.658 1.00 . A A . 742 ARG HH11 1 1 
        5  7154 1 1 86 ARG HH12 H   17.889   9.216 -14.396 1.00 . A A . 742 ARG HH12 1 1 
        5  7155 1 1 86 ARG HH21 H   15.865   7.671 -12.097 1.00 . A A . 742 ARG HH21 1 1 
        5  7156 1 1 86 ARG HH22 H   16.194   9.126 -12.976 1.00 . A A . 742 ARG HH22 1 1 
        5  7157 1 1 86 ARG N    N   21.672   3.178 -11.335 1.00 . A A . 742 ARG N    1 1 
        5  7158 1 1 86 ARG NE   N   17.684   6.353 -13.057 1.00 . A A . 742 ARG NE   1 1 
        5  7159 1 1 86 ARG NH1  N   18.115   8.263 -14.200 1.00 . A A . 742 ARG NH1  1 1 
        5  7160 1 1 86 ARG NH2  N   16.413   8.178 -12.760 1.00 . A A . 742 ARG NH2  1 1 
        5  7161 1 1 86 ARG O    O   23.756   4.598 -13.850 1.00 . A A . 742 ARG O    1 1 
        5  7162 1 1 87 GLU C    C   24.735   6.802 -10.553 1.00 . A A . 743 GLU C    1 1 
        5  7163 1 1 87 GLU CA   C   24.100   6.593 -11.941 1.00 . A A . 743 GLU CA   1 1 
        5  7164 1 1 87 GLU CB   C   23.486   7.914 -12.441 1.00 . A A . 743 GLU CB   1 1 
        5  7165 1 1 87 GLU CD   C   24.375   7.945 -14.824 1.00 . A A . 743 GLU CD   1 1 
        5  7166 1 1 87 GLU CG   C   23.141   7.928 -13.929 1.00 . A A . 743 GLU CG   1 1 
        5  7167 1 1 87 GLU H    H   22.434   5.511 -11.187 1.00 . A A . 743 GLU H    1 1 
        5  7168 1 1 87 GLU HA   H   24.878   6.289 -12.631 1.00 . A A . 743 GLU HA   1 1 
        5  7169 1 1 87 GLU HB2  H   22.577   8.104 -11.885 1.00 . A A . 743 GLU HB2  1 1 
        5  7170 1 1 87 GLU HB3  H   24.184   8.719 -12.250 1.00 . A A . 743 GLU HB3  1 1 
        5  7171 1 1 87 GLU HG2  H   22.558   7.047 -14.160 1.00 . A A . 743 GLU HG2  1 1 
        5  7172 1 1 87 GLU HG3  H   22.549   8.809 -14.141 1.00 . A A . 743 GLU HG3  1 1 
        5  7173 1 1 87 GLU N    N   23.077   5.532 -11.921 1.00 . A A . 743 GLU N    1 1 
        5  7174 1 1 87 GLU O    O   24.161   7.469  -9.691 1.00 . A A . 743 GLU O    1 1 
        5  7175 1 1 87 GLU OE1  O   24.865   9.050 -15.143 1.00 . A A . 743 GLU OE1  1 1 
        5  7176 1 1 87 GLU OE2  O   24.855   6.861 -15.216 1.00 . A A . 743 GLU OE2  1 1 
        5  7177 1 1 88 GLU C    C   27.595   7.624  -9.128 1.00 . A A . 744 GLU C    1 1 
        5  7178 1 1 88 GLU CA   C   26.663   6.401  -9.080 1.00 . A A . 744 GLU CA   1 1 
        5  7179 1 1 88 GLU CB   C   27.473   5.134  -8.766 1.00 . A A . 744 GLU CB   1 1 
        5  7180 1 1 88 GLU CD   C   25.843   3.966  -7.188 1.00 . A A . 744 GLU CD   1 1 
        5  7181 1 1 88 GLU CG   C   26.616   3.899  -8.502 1.00 . A A . 744 GLU CG   1 1 
        5  7182 1 1 88 GLU H    H   26.315   5.671 -11.052 1.00 . A A . 744 GLU H    1 1 
        5  7183 1 1 88 GLU HA   H   25.938   6.556  -8.293 1.00 . A A . 744 GLU HA   1 1 
        5  7184 1 1 88 GLU HB2  H   28.124   4.919  -9.602 1.00 . A A . 744 GLU HB2  1 1 
        5  7185 1 1 88 GLU HB3  H   28.081   5.316  -7.889 1.00 . A A . 744 GLU HB3  1 1 
        5  7186 1 1 88 GLU HG2  H   25.909   3.791  -9.313 1.00 . A A . 744 GLU HG2  1 1 
        5  7187 1 1 88 GLU HG3  H   27.261   3.030  -8.480 1.00 . A A . 744 GLU HG3  1 1 
        5  7188 1 1 88 GLU N    N   25.924   6.231 -10.344 1.00 . A A . 744 GLU N    1 1 
        5  7189 1 1 88 GLU O    O   28.530   7.745  -8.332 1.00 . A A . 744 GLU O    1 1 
        5  7190 1 1 88 GLU OE1  O   24.751   4.574  -7.155 1.00 . A A . 744 GLU OE1  1 1 
        5  7191 1 1 88 GLU OE2  O   26.328   3.406  -6.179 1.00 . A A . 744 GLU OE2  1 1 
        5  7192 1 1 89 VAL C    C   27.773  10.834  -9.214 1.00 . A A . 745 VAL C    1 1 
        5  7193 1 1 89 VAL CA   C   28.128   9.743 -10.237 1.00 . A A . 745 VAL CA   1 1 
        5  7194 1 1 89 VAL CB   C   27.946  10.318 -11.665 1.00 . A A . 745 VAL CB   1 1 
        5  7195 1 1 89 VAL CG1  C   28.360   9.294 -12.719 1.00 . A A . 745 VAL CG1  1 1 
        5  7196 1 1 89 VAL CG2  C   26.502  10.769 -11.886 1.00 . A A . 745 VAL CG2  1 1 
        5  7197 1 1 89 VAL H    H   26.544   8.392 -10.634 1.00 . A A . 745 VAL H    1 1 
        5  7198 1 1 89 VAL HA   H   29.169   9.472 -10.112 1.00 . A A . 745 VAL HA   1 1 
        5  7199 1 1 89 VAL HB   H   28.589  11.182 -11.767 1.00 . A A . 745 VAL HB   1 1 
        5  7200 1 1 89 VAL HG11 H   29.398   9.030 -12.579 1.00 . A A . 745 VAL HG11 1 1 
        5  7201 1 1 89 VAL HG12 H   28.228   9.714 -13.706 1.00 . A A . 745 VAL HG12 1 1 
        5  7202 1 1 89 VAL HG13 H   27.749   8.407 -12.622 1.00 . A A . 745 VAL HG13 1 1 
        5  7203 1 1 89 VAL HG21 H   25.834   9.931 -11.744 1.00 . A A . 745 VAL HG21 1 1 
        5  7204 1 1 89 VAL HG22 H   26.392  11.151 -12.890 1.00 . A A . 745 VAL HG22 1 1 
        5  7205 1 1 89 VAL HG23 H   26.254  11.548 -11.179 1.00 . A A . 745 VAL HG23 1 1 
        5  7206 1 1 89 VAL N    N   27.319   8.534 -10.056 1.00 . A A . 745 VAL N    1 1 
        5  7207 1 1 89 VAL O    O   26.762  10.748  -8.513 1.00 . A A . 745 VAL O    1 1 
        5  7208 1 1 90 LYS C    C   28.549  14.342  -9.073 1.00 . A A . 746 LYS C    1 1 
        5  7209 1 1 90 LYS CA   C   28.328  13.032  -8.293 1.00 . A A . 746 LYS CA   1 1 
        5  7210 1 1 90 LYS CB   C   29.182  13.008  -7.008 1.00 . A A . 746 LYS CB   1 1 
        5  7211 1 1 90 LYS CD   C   31.466  13.180  -5.927 1.00 . A A . 746 LYS CD   1 1 
        5  7212 1 1 90 LYS CE   C   32.968  13.340  -6.158 1.00 . A A . 746 LYS CE   1 1 
        5  7213 1 1 90 LYS CG   C   30.693  13.019  -7.238 1.00 . A A . 746 LYS CG   1 1 
        5  7214 1 1 90 LYS H    H   29.439  11.847  -9.664 1.00 . A A . 746 LYS H    1 1 
        5  7215 1 1 90 LYS HA   H   27.283  12.983  -8.011 1.00 . A A . 746 LYS HA   1 1 
        5  7216 1 1 90 LYS HB2  H   28.928  13.873  -6.412 1.00 . A A . 746 LYS HB2  1 1 
        5  7217 1 1 90 LYS HB3  H   28.933  12.117  -6.448 1.00 . A A . 746 LYS HB3  1 1 
        5  7218 1 1 90 LYS HD2  H   31.099  14.057  -5.411 1.00 . A A . 746 LYS HD2  1 1 
        5  7219 1 1 90 LYS HD3  H   31.297  12.307  -5.311 1.00 . A A . 746 LYS HD3  1 1 
        5  7220 1 1 90 LYS HE2  H   33.133  14.189  -6.806 1.00 . A A . 746 LYS HE2  1 1 
        5  7221 1 1 90 LYS HE3  H   33.448  13.518  -5.207 1.00 . A A . 746 LYS HE3  1 1 
        5  7222 1 1 90 LYS HG2  H   30.984  12.087  -7.704 1.00 . A A . 746 LYS HG2  1 1 
        5  7223 1 1 90 LYS HG3  H   30.941  13.841  -7.895 1.00 . A A . 746 LYS HG3  1 1 
        5  7224 1 1 90 LYS HZ1  H   33.171  11.975  -7.729 1.00 . A A . 746 LYS HZ1  1 1 
        5  7225 1 1 90 LYS HZ2  H   33.395  11.294  -6.196 1.00 . A A . 746 LYS HZ2  1 1 
        5  7226 1 1 90 LYS HZ3  H   34.601  12.259  -6.880 1.00 . A A . 746 LYS HZ3  1 1 
        5  7227 1 1 90 LYS N    N   28.610  11.867  -9.138 1.00 . A A . 746 LYS N    1 1 
        5  7228 1 1 90 LYS NZ   N   33.574  12.136  -6.784 1.00 . A A . 746 LYS NZ   1 1 
        5  7229 1 1 90 LYS O    O   29.682  14.714  -9.390 1.00 . A A . 746 LYS O    1 1 
        5  7230 1 1 91 ASN C    C   28.125  17.399  -9.231 1.00 . A A . 747 ASN C    1 1 
        5  7231 1 1 91 ASN CA   C   27.536  16.299 -10.128 1.00 . A A . 747 ASN CA   1 1 
        5  7232 1 1 91 ASN CB   C   26.148  16.719 -10.631 1.00 . A A . 747 ASN CB   1 1 
        5  7233 1 1 91 ASN CG   C   25.437  15.625 -11.418 1.00 . A A . 747 ASN CG   1 1 
        5  7234 1 1 91 ASN H    H   26.577  14.672  -9.153 1.00 . A A . 747 ASN H    1 1 
        5  7235 1 1 91 ASN HA   H   28.188  16.154 -10.980 1.00 . A A . 747 ASN HA   1 1 
        5  7236 1 1 91 ASN HB2  H   25.530  16.981  -9.786 1.00 . A A . 747 ASN HB2  1 1 
        5  7237 1 1 91 ASN HB3  H   26.252  17.584 -11.272 1.00 . A A . 747 ASN HB3  1 1 
        5  7238 1 1 91 ASN HD21 H   27.160  14.857 -12.028 1.00 . A A . 747 ASN HD21 1 1 
        5  7239 1 1 91 ASN HD22 H   25.739  14.056 -12.584 1.00 . A A . 747 ASN HD22 1 1 
        5  7240 1 1 91 ASN N    N   27.457  15.027  -9.403 1.00 . A A . 747 ASN N    1 1 
        5  7241 1 1 91 ASN ND2  N   26.189  14.760 -12.073 1.00 . A A . 747 ASN ND2  1 1 
        5  7242 1 1 91 ASN O    O   27.568  17.712  -8.177 1.00 . A A . 747 ASN O    1 1 
        5  7243 1 1 91 ASN OD1  O   24.212  15.561 -11.440 1.00 . A A . 747 ASN OD1  1 1 
        5  7244 1 1 92 ASP C    C   29.105  20.331  -8.880 1.00 . A A . 748 ASP C    1 1 
        5  7245 1 1 92 ASP CA   C   29.911  19.022  -8.849 1.00 . A A . 748 ASP CA   1 1 
        5  7246 1 1 92 ASP CB   C   31.343  19.254  -9.346 1.00 . A A . 748 ASP CB   1 1 
        5  7247 1 1 92 ASP CG   C   32.200  19.993  -8.329 1.00 . A A . 748 ASP CG   1 1 
        5  7248 1 1 92 ASP H    H   29.641  17.710 -10.501 1.00 . A A . 748 ASP H    1 1 
        5  7249 1 1 92 ASP HA   H   29.950  18.670  -7.826 1.00 . A A . 748 ASP HA   1 1 
        5  7250 1 1 92 ASP HB2  H   31.802  18.299  -9.554 1.00 . A A . 748 ASP HB2  1 1 
        5  7251 1 1 92 ASP HB3  H   31.312  19.836 -10.255 1.00 . A A . 748 ASP HB3  1 1 
        5  7252 1 1 92 ASP N    N   29.248  17.983  -9.645 1.00 . A A . 748 ASP N    1 1 
        5  7253 1 1 92 ASP O    O   29.423  21.266  -9.624 1.00 . A A . 748 ASP O    1 1 
        5  7254 1 1 92 ASP OD1  O   32.156  21.241  -8.289 1.00 . A A . 748 ASP OD1  1 1 
        5  7255 1 1 92 ASP OD2  O   32.912  19.322  -7.553 1.00 . A A . 748 ASP OD2  1 1 
        5  7256 1 1 93 LYS C    C   26.118  21.324  -6.871 1.00 . A A . 749 LYS C    1 1 
        5  7257 1 1 93 LYS CA   C   27.162  21.532  -7.981 1.00 . A A . 749 LYS CA   1 1 
        5  7258 1 1 93 LYS CB   C   26.458  21.812  -9.319 1.00 . A A . 749 LYS CB   1 1 
        5  7259 1 1 93 LYS CD   C   24.888  23.299 -10.660 1.00 . A A . 749 LYS CD   1 1 
        5  7260 1 1 93 LYS CE   C   25.855  23.658 -11.790 1.00 . A A . 749 LYS CE   1 1 
        5  7261 1 1 93 LYS CG   C   25.597  23.075  -9.319 1.00 . A A . 749 LYS CG   1 1 
        5  7262 1 1 93 LYS H    H   27.815  19.556  -7.573 1.00 . A A . 749 LYS H    1 1 
        5  7263 1 1 93 LYS HA   H   27.782  22.381  -7.725 1.00 . A A . 749 LYS HA   1 1 
        5  7264 1 1 93 LYS HB2  H   27.209  21.915 -10.090 1.00 . A A . 749 LYS HB2  1 1 
        5  7265 1 1 93 LYS HB3  H   25.825  20.969  -9.560 1.00 . A A . 749 LYS HB3  1 1 
        5  7266 1 1 93 LYS HD2  H   24.360  22.396 -10.932 1.00 . A A . 749 LYS HD2  1 1 
        5  7267 1 1 93 LYS HD3  H   24.175  24.105 -10.544 1.00 . A A . 749 LYS HD3  1 1 
        5  7268 1 1 93 LYS HE2  H   25.279  23.970 -12.650 1.00 . A A . 749 LYS HE2  1 1 
        5  7269 1 1 93 LYS HE3  H   26.477  24.480 -11.465 1.00 . A A . 749 LYS HE3  1 1 
        5  7270 1 1 93 LYS HG2  H   24.850  22.983  -8.543 1.00 . A A . 749 LYS HG2  1 1 
        5  7271 1 1 93 LYS HG3  H   26.227  23.928  -9.110 1.00 . A A . 749 LYS HG3  1 1 
        5  7272 1 1 93 LYS HZ1  H   26.153  21.672 -12.369 1.00 . A A . 749 LYS HZ1  1 1 
        5  7273 1 1 93 LYS HZ2  H   27.413  22.307 -11.438 1.00 . A A . 749 LYS HZ2  1 1 
        5  7274 1 1 93 LYS HZ3  H   27.247  22.753 -13.062 1.00 . A A . 749 LYS HZ3  1 1 
        5  7275 1 1 93 LYS N    N   28.034  20.359  -8.093 1.00 . A A . 749 LYS N    1 1 
        5  7276 1 1 93 LYS NZ   N   26.728  22.519 -12.190 1.00 . A A . 749 LYS NZ   1 1 
        5  7277 1 1 93 LYS O    O   25.067  20.727  -7.101 1.00 . A A . 749 LYS O    1 1 
        5  7278 1 1 94 PRO C    C   24.273  22.576  -4.572 1.00 . A A . 750 PRO C    1 1 
        5  7279 1 1 94 PRO CA   C   25.485  21.629  -4.506 1.00 . A A . 750 PRO CA   1 1 
        5  7280 1 1 94 PRO CB   C   26.372  21.965  -3.301 1.00 . A A . 750 PRO CB   1 1 
        5  7281 1 1 94 PRO CD   C   27.632  22.526  -5.266 1.00 . A A . 750 PRO CD   1 1 
        5  7282 1 1 94 PRO CG   C   27.378  22.931  -3.833 1.00 . A A . 750 PRO CG   1 1 
        5  7283 1 1 94 PRO HA   H   25.137  20.609  -4.424 1.00 . A A . 750 PRO HA   1 1 
        5  7284 1 1 94 PRO HB2  H   25.775  22.403  -2.514 1.00 . A A . 750 PRO HB2  1 1 
        5  7285 1 1 94 PRO HB3  H   26.846  21.063  -2.937 1.00 . A A . 750 PRO HB3  1 1 
        5  7286 1 1 94 PRO HD2  H   27.768  23.400  -5.889 1.00 . A A . 750 PRO HD2  1 1 
        5  7287 1 1 94 PRO HD3  H   28.497  21.880  -5.331 1.00 . A A . 750 PRO HD3  1 1 
        5  7288 1 1 94 PRO HG2  H   26.980  23.936  -3.792 1.00 . A A . 750 PRO HG2  1 1 
        5  7289 1 1 94 PRO HG3  H   28.291  22.867  -3.257 1.00 . A A . 750 PRO HG3  1 1 
        5  7290 1 1 94 PRO N    N   26.403  21.794  -5.644 1.00 . A A . 750 PRO N    1 1 
        5  7291 1 1 94 PRO O    O   24.421  23.772  -4.836 1.00 . A A . 750 PRO O    1 1 
        5  7292 1 1 95 ILE C    C   21.952  23.911  -3.184 1.00 . A A . 751 ILE C    1 1 
        5  7293 1 1 95 ILE CA   C   21.855  22.855  -4.296 1.00 . A A . 751 ILE CA   1 1 
        5  7294 1 1 95 ILE CB   C   20.574  21.992  -4.090 1.00 . A A . 751 ILE CB   1 1 
        5  7295 1 1 95 ILE CD1  C   21.293  19.982  -5.541 1.00 . A A . 751 ILE CD1  1 1 
        5  7296 1 1 95 ILE CG1  C   20.289  21.099  -5.320 1.00 . A A . 751 ILE CG1  1 1 
        5  7297 1 1 95 ILE CG2  C   19.365  22.882  -3.791 1.00 . A A . 751 ILE CG2  1 1 
        5  7298 1 1 95 ILE H    H   23.009  21.075  -4.165 1.00 . A A . 751 ILE H    1 1 
        5  7299 1 1 95 ILE HA   H   21.773  23.363  -5.250 1.00 . A A . 751 ILE HA   1 1 
        5  7300 1 1 95 ILE HB   H   20.737  21.358  -3.229 1.00 . A A . 751 ILE HB   1 1 
        5  7301 1 1 95 ILE HD11 H   22.269  20.405  -5.721 1.00 . A A . 751 ILE HD11 1 1 
        5  7302 1 1 95 ILE HD12 H   20.992  19.394  -6.396 1.00 . A A . 751 ILE HD12 1 1 
        5  7303 1 1 95 ILE HD13 H   21.330  19.350  -4.665 1.00 . A A . 751 ILE HD13 1 1 
        5  7304 1 1 95 ILE HG12 H   19.318  20.639  -5.204 1.00 . A A . 751 ILE HG12 1 1 
        5  7305 1 1 95 ILE HG13 H   20.281  21.714  -6.208 1.00 . A A . 751 ILE HG13 1 1 
        5  7306 1 1 95 ILE HG21 H   19.217  23.577  -4.605 1.00 . A A . 751 ILE HG21 1 1 
        5  7307 1 1 95 ILE HG22 H   19.537  23.433  -2.876 1.00 . A A . 751 ILE HG22 1 1 
        5  7308 1 1 95 ILE HG23 H   18.483  22.267  -3.678 1.00 . A A . 751 ILE HG23 1 1 
        5  7309 1 1 95 ILE N    N   23.074  22.038  -4.328 1.00 . A A . 751 ILE N    1 1 
        5  7310 1 1 95 ILE O    O   21.916  23.583  -1.995 1.00 . A A . 751 ILE O    1 1 
        5  7311 1 1 96 LEU C    C   21.075  26.529  -1.763 1.00 . A A . 752 LEU C    1 1 
        5  7312 1 1 96 LEU CA   C   22.313  26.261  -2.626 1.00 . A A . 752 LEU CA   1 1 
        5  7313 1 1 96 LEU CB   C   22.729  27.542  -3.363 1.00 . A A . 752 LEU CB   1 1 
        5  7314 1 1 96 LEU CD1  C   24.373  28.771  -4.825 1.00 . A A . 752 LEU CD1  1 1 
        5  7315 1 1 96 LEU CD2  C   25.155  26.845  -3.411 1.00 . A A . 752 LEU CD2  1 1 
        5  7316 1 1 96 LEU CG   C   23.996  27.420  -4.226 1.00 . A A . 752 LEU CG   1 1 
        5  7317 1 1 96 LEU H    H   22.043  25.381  -4.538 1.00 . A A . 752 LEU H    1 1 
        5  7318 1 1 96 LEU HA   H   23.125  25.962  -1.977 1.00 . A A . 752 LEU HA   1 1 
        5  7319 1 1 96 LEU HB2  H   21.910  27.848  -4.001 1.00 . A A . 752 LEU HB2  1 1 
        5  7320 1 1 96 LEU HB3  H   22.897  28.317  -2.628 1.00 . A A . 752 LEU HB3  1 1 
        5  7321 1 1 96 LEU HD11 H   23.557  29.137  -5.430 1.00 . A A . 752 LEU HD11 1 1 
        5  7322 1 1 96 LEU HD12 H   25.254  28.661  -5.441 1.00 . A A . 752 LEU HD12 1 1 
        5  7323 1 1 96 LEU HD13 H   24.576  29.476  -4.031 1.00 . A A . 752 LEU HD13 1 1 
        5  7324 1 1 96 LEU HD21 H   24.880  25.871  -3.031 1.00 . A A . 752 LEU HD21 1 1 
        5  7325 1 1 96 LEU HD22 H   25.380  27.504  -2.584 1.00 . A A . 752 LEU HD22 1 1 
        5  7326 1 1 96 LEU HD23 H   26.027  26.750  -4.043 1.00 . A A . 752 LEU HD23 1 1 
        5  7327 1 1 96 LEU HG   H   23.799  26.743  -5.046 1.00 . A A . 752 LEU HG   1 1 
        5  7328 1 1 96 LEU N    N   22.092  25.174  -3.579 1.00 . A A . 752 LEU N    1 1 
        5  7329 1 1 96 LEU O    O   20.044  26.987  -2.260 1.00 . A A . 752 LEU O    1 1 
        5  7330 1 1 97 GLU C    C   18.769  26.020   0.079 1.00 . A A . 753 GLU C    1 1 
        5  7331 1 1 97 GLU CA   C   20.153  26.511   0.524 1.00 . A A . 753 GLU CA   1 1 
        5  7332 1 1 97 GLU CB   C   20.113  28.019   0.835 1.00 . A A . 753 GLU CB   1 1 
        5  7333 1 1 97 GLU CD   C   22.612  28.522   0.586 1.00 . A A . 753 GLU CD   1 1 
        5  7334 1 1 97 GLU CG   C   21.386  28.562   1.495 1.00 . A A . 753 GLU CG   1 1 
        5  7335 1 1 97 GLU H    H   22.022  25.793  -0.168 1.00 . A A . 753 GLU H    1 1 
        5  7336 1 1 97 GLU HA   H   20.421  25.984   1.428 1.00 . A A . 753 GLU HA   1 1 
        5  7337 1 1 97 GLU HB2  H   19.955  28.561  -0.088 1.00 . A A . 753 GLU HB2  1 1 
        5  7338 1 1 97 GLU HB3  H   19.281  28.214   1.499 1.00 . A A . 753 GLU HB3  1 1 
        5  7339 1 1 97 GLU HG2  H   21.212  29.588   1.790 1.00 . A A . 753 GLU HG2  1 1 
        5  7340 1 1 97 GLU HG3  H   21.593  27.973   2.379 1.00 . A A . 753 GLU HG3  1 1 
        5  7341 1 1 97 GLU N    N   21.193  26.223  -0.470 1.00 . A A . 753 GLU N    1 1 
        5  7342 1 1 97 GLU O    O   17.922  25.669   0.910 1.00 . A A . 753 GLU O    1 1 
        5  7343 1 1 97 GLU OE1  O   22.844  29.502  -0.156 1.00 . A A . 753 GLU OE1  1 1 
        5  7344 1 1 97 GLU OE2  O   23.352  27.512   0.614 1.00 . A A . 753 GLU OE2  1 1 
        5  7345 2 2  1 CA  CA   CA -17.361  -3.370   5.528 1.00 . B A . 762 CA  CA   1 1 
        6  7346 1 1  1 MET C    C  -33.682 -15.682  18.720 1.00 . A A . 657 MET C    1 1 
        6  7347 1 1  1 MET CA   C  -33.457 -15.091  20.127 1.00 . A A . 657 MET CA   1 1 
        6  7348 1 1  1 MET CB   C  -32.064 -14.445  20.231 1.00 . A A . 657 MET CB   1 1 
        6  7349 1 1  1 MET CE   C  -32.097 -11.467  17.295 1.00 . A A . 657 MET CE   1 1 
        6  7350 1 1  1 MET CG   C  -31.949 -13.094  19.533 1.00 . A A . 657 MET CG   1 1 
        6  7351 1 1  1 MET H1   H  -32.934 -16.917  21.013 1.00 . A A . 657 MET H1   1 1 
        6  7352 1 1  1 MET H2   H  -34.576 -16.535  21.144 1.00 . A A . 657 MET H2   1 1 
        6  7353 1 1  1 MET H3   H  -33.447 -15.743  22.116 1.00 . A A . 657 MET H3   1 1 
        6  7354 1 1  1 MET HA   H  -34.209 -14.334  20.305 1.00 . A A . 657 MET HA   1 1 
        6  7355 1 1  1 MET HB2  H  -31.824 -14.304  21.276 1.00 . A A . 657 MET HB2  1 1 
        6  7356 1 1  1 MET HB3  H  -31.335 -15.113  19.794 1.00 . A A . 657 MET HB3  1 1 
        6  7357 1 1  1 MET HE1  H  -32.288 -11.363  16.237 1.00 . A A . 657 MET HE1  1 1 
        6  7358 1 1  1 MET HE2  H  -31.095 -11.132  17.516 1.00 . A A . 657 MET HE2  1 1 
        6  7359 1 1  1 MET HE3  H  -32.807 -10.868  17.848 1.00 . A A . 657 MET HE3  1 1 
        6  7360 1 1  1 MET HG2  H  -32.662 -12.412  19.980 1.00 . A A . 657 MET HG2  1 1 
        6  7361 1 1  1 MET HG3  H  -30.949 -12.710  19.681 1.00 . A A . 657 MET HG3  1 1 
        6  7362 1 1  1 MET N    N  -33.613 -16.143  21.171 1.00 . A A . 657 MET N    1 1 
        6  7363 1 1  1 MET O    O  -34.594 -15.267  18.003 1.00 . A A . 657 MET O    1 1 
        6  7364 1 1  1 MET SD   S  -32.272 -13.189  17.763 1.00 . A A . 657 MET SD   1 1 
        6  7365 1 1  2 GLY C    C  -32.542 -16.620  15.830 1.00 . A A . 658 GLY C    1 1 
        6  7366 1 1  2 GLY CA   C  -33.043 -17.364  17.069 1.00 . A A . 658 GLY CA   1 1 
        6  7367 1 1  2 GLY H    H  -32.078 -16.875  18.900 1.00 . A A . 658 GLY H    1 1 
        6  7368 1 1  2 GLY HA2  H  -32.524 -18.308  17.132 1.00 . A A . 658 GLY HA2  1 1 
        6  7369 1 1  2 GLY HA3  H  -34.100 -17.564  16.949 1.00 . A A . 658 GLY HA3  1 1 
        6  7370 1 1  2 GLY N    N  -32.842 -16.645  18.328 1.00 . A A . 658 GLY N    1 1 
        6  7371 1 1  2 GLY O    O  -31.692 -17.127  15.094 1.00 . A A . 658 GLY O    1 1 
        6  7372 1 1  3 ASN C    C  -31.267 -14.197  14.365 1.00 . A A . 659 ASN C    1 1 
        6  7373 1 1  3 ASN CA   C  -32.741 -14.646  14.389 1.00 . A A . 659 ASN CA   1 1 
        6  7374 1 1  3 ASN CB   C  -33.664 -13.428  14.297 1.00 . A A . 659 ASN CB   1 1 
        6  7375 1 1  3 ASN CG   C  -35.129 -13.811  14.175 1.00 . A A . 659 ASN CG   1 1 
        6  7376 1 1  3 ASN H    H  -33.686 -15.041  16.255 1.00 . A A . 659 ASN H    1 1 
        6  7377 1 1  3 ASN HA   H  -32.922 -15.282  13.532 1.00 . A A . 659 ASN HA   1 1 
        6  7378 1 1  3 ASN HB2  H  -33.542 -12.826  15.186 1.00 . A A . 659 ASN HB2  1 1 
        6  7379 1 1  3 ASN HB3  H  -33.391 -12.840  13.431 1.00 . A A . 659 ASN HB3  1 1 
        6  7380 1 1  3 ASN HD21 H  -34.694 -15.315  12.956 1.00 . A A . 659 ASN HD21 1 1 
        6  7381 1 1  3 ASN HD22 H  -36.368 -15.100  13.325 1.00 . A A . 659 ASN HD22 1 1 
        6  7382 1 1  3 ASN N    N  -33.068 -15.423  15.596 1.00 . A A . 659 ASN N    1 1 
        6  7383 1 1  3 ASN ND2  N  -35.424 -14.845  13.409 1.00 . A A . 659 ASN ND2  1 1 
        6  7384 1 1  3 ASN O    O  -30.665 -13.929  15.407 1.00 . A A . 659 ASN O    1 1 
        6  7385 1 1  3 ASN OD1  O  -35.999 -13.173  14.754 1.00 . A A . 659 ASN OD1  1 1 
        6  7386 1 1  4 GLY C    C  -29.134 -12.189  12.847 1.00 . A A . 660 GLY C    1 1 
        6  7387 1 1  4 GLY CA   C  -29.302 -13.701  13.015 1.00 . A A . 660 GLY CA   1 1 
        6  7388 1 1  4 GLY H    H  -31.220 -14.343  12.368 1.00 . A A . 660 GLY H    1 1 
        6  7389 1 1  4 GLY HA2  H  -28.745 -14.017  13.886 1.00 . A A . 660 GLY HA2  1 1 
        6  7390 1 1  4 GLY HA3  H  -28.889 -14.194  12.146 1.00 . A A . 660 GLY HA3  1 1 
        6  7391 1 1  4 GLY N    N  -30.695 -14.116  13.165 1.00 . A A . 660 GLY N    1 1 
        6  7392 1 1  4 GLY O    O  -30.109 -11.462  12.656 1.00 . A A . 660 GLY O    1 1 
        6  7393 1 1  5 GLU C    C  -26.869  -9.995  11.439 1.00 . A A . 661 GLU C    1 1 
        6  7394 1 1  5 GLU CA   C  -27.577 -10.289  12.775 1.00 . A A . 661 GLU CA   1 1 
        6  7395 1 1  5 GLU CB   C  -26.701  -9.823  13.948 1.00 . A A . 661 GLU CB   1 1 
        6  7396 1 1  5 GLU CD   C  -26.485  -9.502  16.461 1.00 . A A . 661 GLU CD   1 1 
        6  7397 1 1  5 GLU CG   C  -27.397  -9.896  15.306 1.00 . A A . 661 GLU CG   1 1 
        6  7398 1 1  5 GLU H    H  -27.156 -12.349  13.081 1.00 . A A . 661 GLU H    1 1 
        6  7399 1 1  5 GLU HA   H  -28.510  -9.739  12.796 1.00 . A A . 661 GLU HA   1 1 
        6  7400 1 1  5 GLU HB2  H  -25.816 -10.443  13.986 1.00 . A A . 661 GLU HB2  1 1 
        6  7401 1 1  5 GLU HB3  H  -26.402  -8.798  13.774 1.00 . A A . 661 GLU HB3  1 1 
        6  7402 1 1  5 GLU HG2  H  -28.248  -9.227  15.297 1.00 . A A . 661 GLU HG2  1 1 
        6  7403 1 1  5 GLU HG3  H  -27.745 -10.909  15.465 1.00 . A A . 661 GLU HG3  1 1 
        6  7404 1 1  5 GLU N    N  -27.889 -11.718  12.920 1.00 . A A . 661 GLU N    1 1 
        6  7405 1 1  5 GLU O    O  -26.562 -10.904  10.669 1.00 . A A . 661 GLU O    1 1 
        6  7406 1 1  5 GLU OE1  O  -26.232  -8.291  16.640 1.00 . A A . 661 GLU OE1  1 1 
        6  7407 1 1  5 GLU OE2  O  -26.028 -10.398  17.202 1.00 . A A . 661 GLU OE2  1 1 
        6  7408 1 1  6 THR C    C  -24.419  -8.308  10.054 1.00 . A A . 662 THR C    1 1 
        6  7409 1 1  6 THR CA   C  -25.953  -8.295   9.925 1.00 . A A . 662 THR CA   1 1 
        6  7410 1 1  6 THR CB   C  -26.401  -6.872   9.506 1.00 . A A . 662 THR CB   1 1 
        6  7411 1 1  6 THR CG2  C  -27.892  -6.837   9.175 1.00 . A A . 662 THR CG2  1 1 
        6  7412 1 1  6 THR H    H  -26.886  -8.031  11.817 1.00 . A A . 662 THR H    1 1 
        6  7413 1 1  6 THR HA   H  -26.242  -8.983   9.142 1.00 . A A . 662 THR HA   1 1 
        6  7414 1 1  6 THR HB   H  -25.846  -6.579   8.624 1.00 . A A . 662 THR HB   1 1 
        6  7415 1 1  6 THR HG1  H  -25.196  -6.012  10.828 1.00 . A A . 662 THR HG1  1 1 
        6  7416 1 1  6 THR HG21 H  -28.174  -5.834   8.893 1.00 . A A . 662 THR HG21 1 1 
        6  7417 1 1  6 THR HG22 H  -28.460  -7.138  10.044 1.00 . A A . 662 THR HG22 1 1 
        6  7418 1 1  6 THR HG23 H  -28.100  -7.512   8.357 1.00 . A A . 662 THR HG23 1 1 
        6  7419 1 1  6 THR N    N  -26.617  -8.716  11.170 1.00 . A A . 662 THR N    1 1 
        6  7420 1 1  6 THR O    O  -23.834  -7.462  10.732 1.00 . A A . 662 THR O    1 1 
        6  7421 1 1  6 THR OG1  O  -26.125  -5.937  10.563 1.00 . A A . 662 THR OG1  1 1 
        6  7422 1 1  7 SER C    C  -21.681  -8.459   8.327 1.00 . A A . 663 SER C    1 1 
        6  7423 1 1  7 SER CA   C  -22.300  -9.359   9.407 1.00 . A A . 663 SER CA   1 1 
        6  7424 1 1  7 SER CB   C  -21.843 -10.811   9.188 1.00 . A A . 663 SER CB   1 1 
        6  7425 1 1  7 SER H    H  -24.288  -9.946   8.912 1.00 . A A . 663 SER H    1 1 
        6  7426 1 1  7 SER HA   H  -21.951  -9.027  10.377 1.00 . A A . 663 SER HA   1 1 
        6  7427 1 1  7 SER HB2  H  -22.239 -11.174   8.251 1.00 . A A . 663 SER HB2  1 1 
        6  7428 1 1  7 SER HB3  H  -20.762 -10.846   9.158 1.00 . A A . 663 SER HB3  1 1 
        6  7429 1 1  7 SER HG   H  -21.855 -12.514  10.163 1.00 . A A . 663 SER HG   1 1 
        6  7430 1 1  7 SER N    N  -23.771  -9.270   9.402 1.00 . A A . 663 SER N    1 1 
        6  7431 1 1  7 SER O    O  -22.115  -8.470   7.174 1.00 . A A . 663 SER O    1 1 
        6  7432 1 1  7 SER OG   O  -22.296 -11.661  10.232 1.00 . A A . 663 SER OG   1 1 
        6  7433 1 1  8 ASP C    C  -19.063  -7.581   6.802 1.00 . A A . 664 ASP C    1 1 
        6  7434 1 1  8 ASP CA   C  -19.977  -6.798   7.758 1.00 . A A . 664 ASP CA   1 1 
        6  7435 1 1  8 ASP CB   C  -19.151  -5.748   8.517 1.00 . A A . 664 ASP CB   1 1 
        6  7436 1 1  8 ASP CG   C  -18.411  -4.798   7.580 1.00 . A A . 664 ASP CG   1 1 
        6  7437 1 1  8 ASP H    H  -20.369  -7.707   9.635 1.00 . A A . 664 ASP H    1 1 
        6  7438 1 1  8 ASP HA   H  -20.733  -6.288   7.175 1.00 . A A . 664 ASP HA   1 1 
        6  7439 1 1  8 ASP HB2  H  -19.810  -5.164   9.146 1.00 . A A . 664 ASP HB2  1 1 
        6  7440 1 1  8 ASP HB3  H  -18.425  -6.251   9.141 1.00 . A A . 664 ASP HB3  1 1 
        6  7441 1 1  8 ASP N    N  -20.664  -7.684   8.703 1.00 . A A . 664 ASP N    1 1 
        6  7442 1 1  8 ASP O    O  -18.414  -8.552   7.194 1.00 . A A . 664 ASP O    1 1 
        6  7443 1 1  8 ASP OD1  O  -17.265  -5.098   7.200 1.00 . A A . 664 ASP OD1  1 1 
        6  7444 1 1  8 ASP OD2  O  -18.973  -3.752   7.202 1.00 . A A . 664 ASP OD2  1 1 
        6  7445 1 1  9 LEU C    C  -16.737  -6.988   4.678 1.00 . A A . 665 LEU C    1 1 
        6  7446 1 1  9 LEU CA   C  -18.088  -7.707   4.571 1.00 . A A . 665 LEU CA   1 1 
        6  7447 1 1  9 LEU CB   C  -18.662  -7.554   3.155 1.00 . A A . 665 LEU CB   1 1 
        6  7448 1 1  9 LEU CD1  C  -20.570  -7.878   1.540 1.00 . A A . 665 LEU CD1  1 1 
        6  7449 1 1  9 LEU CD2  C  -20.057  -9.657   3.235 1.00 . A A . 665 LEU CD2  1 1 
        6  7450 1 1  9 LEU CG   C  -20.063  -8.155   2.951 1.00 . A A . 665 LEU CG   1 1 
        6  7451 1 1  9 LEU H    H  -19.635  -6.433   5.271 1.00 . A A . 665 LEU H    1 1 
        6  7452 1 1  9 LEU HA   H  -17.952  -8.758   4.790 1.00 . A A . 665 LEU HA   1 1 
        6  7453 1 1  9 LEU HB2  H  -18.706  -6.498   2.919 1.00 . A A . 665 LEU HB2  1 1 
        6  7454 1 1  9 LEU HB3  H  -17.985  -8.031   2.461 1.00 . A A . 665 LEU HB3  1 1 
        6  7455 1 1  9 LEU HD11 H  -21.560  -8.299   1.422 1.00 . A A . 665 LEU HD11 1 1 
        6  7456 1 1  9 LEU HD12 H  -19.902  -8.326   0.820 1.00 . A A . 665 LEU HD12 1 1 
        6  7457 1 1  9 LEU HD13 H  -20.613  -6.811   1.375 1.00 . A A . 665 LEU HD13 1 1 
        6  7458 1 1  9 LEU HD21 H  -19.359 -10.149   2.572 1.00 . A A . 665 LEU HD21 1 1 
        6  7459 1 1  9 LEU HD22 H  -21.048 -10.059   3.076 1.00 . A A . 665 LEU HD22 1 1 
        6  7460 1 1  9 LEU HD23 H  -19.762  -9.829   4.261 1.00 . A A . 665 LEU HD23 1 1 
        6  7461 1 1  9 LEU HG   H  -20.748  -7.688   3.644 1.00 . A A . 665 LEU HG   1 1 
        6  7462 1 1  9 LEU N    N  -19.022  -7.150   5.550 1.00 . A A . 665 LEU N    1 1 
        6  7463 1 1  9 LEU O    O  -16.662  -5.771   4.497 1.00 . A A . 665 LEU O    1 1 
        6  7464 1 1 10 GLU C    C  -13.794  -6.580   3.851 1.00 . A A . 666 GLU C    1 1 
        6  7465 1 1 10 GLU CA   C  -14.351  -7.122   5.180 1.00 . A A . 666 GLU CA   1 1 
        6  7466 1 1 10 GLU CB   C  -13.378  -8.131   5.811 1.00 . A A . 666 GLU CB   1 1 
        6  7467 1 1 10 GLU CD   C  -12.213 -10.369   5.652 1.00 . A A . 666 GLU CD   1 1 
        6  7468 1 1 10 GLU CG   C  -13.093  -9.352   4.947 1.00 . A A . 666 GLU CG   1 1 
        6  7469 1 1 10 GLU H    H  -15.781  -8.693   5.101 1.00 . A A . 666 GLU H    1 1 
        6  7470 1 1 10 GLU HA   H  -14.472  -6.288   5.861 1.00 . A A . 666 GLU HA   1 1 
        6  7471 1 1 10 GLU HB2  H  -12.439  -7.630   6.007 1.00 . A A . 666 GLU HB2  1 1 
        6  7472 1 1 10 GLU HB3  H  -13.793  -8.470   6.750 1.00 . A A . 666 GLU HB3  1 1 
        6  7473 1 1 10 GLU HG2  H  -14.030  -9.823   4.688 1.00 . A A . 666 GLU HG2  1 1 
        6  7474 1 1 10 GLU HG3  H  -12.594  -9.031   4.044 1.00 . A A . 666 GLU HG3  1 1 
        6  7475 1 1 10 GLU N    N  -15.675  -7.727   4.996 1.00 . A A . 666 GLU N    1 1 
        6  7476 1 1 10 GLU O    O  -14.022  -7.164   2.788 1.00 . A A . 666 GLU O    1 1 
        6  7477 1 1 10 GLU OE1  O  -10.973 -10.231   5.600 1.00 . A A . 666 GLU OE1  1 1 
        6  7478 1 1 10 GLU OE2  O  -12.753 -11.305   6.270 1.00 . A A . 666 GLU OE2  1 1 
        6  7479 1 1 11 PRO C    C  -11.412  -5.492   1.989 1.00 . A A . 667 PRO C    1 1 
        6  7480 1 1 11 PRO CA   C  -12.584  -4.775   2.679 1.00 . A A . 667 PRO CA   1 1 
        6  7481 1 1 11 PRO CB   C  -12.141  -3.408   3.208 1.00 . A A . 667 PRO CB   1 1 
        6  7482 1 1 11 PRO CD   C  -12.576  -4.784   5.122 1.00 . A A . 667 PRO CD   1 1 
        6  7483 1 1 11 PRO CG   C  -11.694  -3.673   4.606 1.00 . A A . 667 PRO CG   1 1 
        6  7484 1 1 11 PRO HA   H  -13.391  -4.645   1.970 1.00 . A A . 667 PRO HA   1 1 
        6  7485 1 1 11 PRO HB2  H  -11.336  -3.019   2.598 1.00 . A A . 667 PRO HB2  1 1 
        6  7486 1 1 11 PRO HB3  H  -12.976  -2.723   3.185 1.00 . A A . 667 PRO HB3  1 1 
        6  7487 1 1 11 PRO HD2  H  -12.007  -5.463   5.741 1.00 . A A . 667 PRO HD2  1 1 
        6  7488 1 1 11 PRO HD3  H  -13.409  -4.378   5.679 1.00 . A A . 667 PRO HD3  1 1 
        6  7489 1 1 11 PRO HG2  H  -10.657  -3.983   4.608 1.00 . A A . 667 PRO HG2  1 1 
        6  7490 1 1 11 PRO HG3  H  -11.818  -2.782   5.207 1.00 . A A . 667 PRO HG3  1 1 
        6  7491 1 1 11 PRO N    N  -13.047  -5.460   3.894 1.00 . A A . 667 PRO N    1 1 
        6  7492 1 1 11 PRO O    O  -10.560  -6.096   2.645 1.00 . A A . 667 PRO O    1 1 
        6  7493 1 1 12 LYS C    C   -9.128  -5.008  -0.248 1.00 . A A . 668 LYS C    1 1 
        6  7494 1 1 12 LYS CA   C  -10.277  -6.019  -0.101 1.00 . A A . 668 LYS CA   1 1 
        6  7495 1 1 12 LYS CB   C  -10.773  -6.477  -1.488 1.00 . A A . 668 LYS CB   1 1 
        6  7496 1 1 12 LYS CD   C   -8.523  -7.369  -2.306 1.00 . A A . 668 LYS CD   1 1 
        6  7497 1 1 12 LYS CE   C   -7.763  -8.604  -2.776 1.00 . A A . 668 LYS CE   1 1 
        6  7498 1 1 12 LYS CG   C  -10.005  -7.669  -2.073 1.00 . A A . 668 LYS CG   1 1 
        6  7499 1 1 12 LYS H    H  -12.091  -4.956   0.185 1.00 . A A . 668 LYS H    1 1 
        6  7500 1 1 12 LYS HA   H   -9.919  -6.880   0.449 1.00 . A A . 668 LYS HA   1 1 
        6  7501 1 1 12 LYS HB2  H  -11.815  -6.757  -1.406 1.00 . A A . 668 LYS HB2  1 1 
        6  7502 1 1 12 LYS HB3  H  -10.692  -5.650  -2.177 1.00 . A A . 668 LYS HB3  1 1 
        6  7503 1 1 12 LYS HD2  H   -8.433  -6.597  -3.056 1.00 . A A . 668 LYS HD2  1 1 
        6  7504 1 1 12 LYS HD3  H   -8.086  -7.021  -1.379 1.00 . A A . 668 LYS HD3  1 1 
        6  7505 1 1 12 LYS HE2  H   -8.218  -8.969  -3.685 1.00 . A A . 668 LYS HE2  1 1 
        6  7506 1 1 12 LYS HE3  H   -6.737  -8.327  -2.973 1.00 . A A . 668 LYS HE3  1 1 
        6  7507 1 1 12 LYS HG2  H  -10.085  -8.501  -1.389 1.00 . A A . 668 LYS HG2  1 1 
        6  7508 1 1 12 LYS HG3  H  -10.459  -7.943  -3.017 1.00 . A A . 668 LYS HG3  1 1 
        6  7509 1 1 12 LYS HZ1  H   -8.758  -9.877  -1.448 1.00 . A A . 668 LYS HZ1  1 1 
        6  7510 1 1 12 LYS HZ2  H   -7.217  -9.416  -0.925 1.00 . A A . 668 LYS HZ2  1 1 
        6  7511 1 1 12 LYS HZ3  H   -7.385 -10.562  -2.156 1.00 . A A . 668 LYS HZ3  1 1 
        6  7512 1 1 12 LYS N    N  -11.371  -5.421   0.662 1.00 . A A . 668 LYS N    1 1 
        6  7513 1 1 12 LYS NZ   N   -7.782  -9.690  -1.758 1.00 . A A . 668 LYS NZ   1 1 
        6  7514 1 1 12 LYS O    O   -9.254  -4.008  -0.959 1.00 . A A . 668 LYS O    1 1 
        6  7515 1 1 13 LEU C    C   -5.863  -4.967  -0.716 1.00 . A A . 669 LEU C    1 1 
        6  7516 1 1 13 LEU CA   C   -6.827  -4.418   0.349 1.00 . A A . 669 LEU CA   1 1 
        6  7517 1 1 13 LEU CB   C   -6.132  -4.333   1.718 1.00 . A A . 669 LEU CB   1 1 
        6  7518 1 1 13 LEU CD1  C   -5.185  -2.009   1.398 1.00 . A A . 669 LEU CD1  1 1 
        6  7519 1 1 13 LEU CD2  C   -4.226  -3.524   3.160 1.00 . A A . 669 LEU CD2  1 1 
        6  7520 1 1 13 LEU CG   C   -4.866  -3.455   1.772 1.00 . A A . 669 LEU CG   1 1 
        6  7521 1 1 13 LEU H    H   -8.005  -6.043   1.044 1.00 . A A . 669 LEU H    1 1 
        6  7522 1 1 13 LEU HA   H   -7.145  -3.426   0.054 1.00 . A A . 669 LEU HA   1 1 
        6  7523 1 1 13 LEU HB2  H   -6.846  -3.943   2.431 1.00 . A A . 669 LEU HB2  1 1 
        6  7524 1 1 13 LEU HB3  H   -5.863  -5.335   2.021 1.00 . A A . 669 LEU HB3  1 1 
        6  7525 1 1 13 LEU HD11 H   -4.281  -1.417   1.443 1.00 . A A . 669 LEU HD11 1 1 
        6  7526 1 1 13 LEU HD12 H   -5.913  -1.607   2.088 1.00 . A A . 669 LEU HD12 1 1 
        6  7527 1 1 13 LEU HD13 H   -5.584  -1.976   0.394 1.00 . A A . 669 LEU HD13 1 1 
        6  7528 1 1 13 LEU HD21 H   -4.921  -3.150   3.899 1.00 . A A . 669 LEU HD21 1 1 
        6  7529 1 1 13 LEU HD22 H   -3.328  -2.923   3.175 1.00 . A A . 669 LEU HD22 1 1 
        6  7530 1 1 13 LEU HD23 H   -3.975  -4.549   3.392 1.00 . A A . 669 LEU HD23 1 1 
        6  7531 1 1 13 LEU HG   H   -4.146  -3.830   1.056 1.00 . A A . 669 LEU HG   1 1 
        6  7532 1 1 13 LEU N    N   -8.022  -5.264   0.447 1.00 . A A . 669 LEU N    1 1 
        6  7533 1 1 13 LEU O    O   -5.201  -5.986  -0.510 1.00 . A A . 669 LEU O    1 1 
        6  7534 1 1 14 THR C    C   -3.521  -4.160  -2.835 1.00 . A A . 670 THR C    1 1 
        6  7535 1 1 14 THR CA   C   -4.946  -4.715  -2.977 1.00 . A A . 670 THR CA   1 1 
        6  7536 1 1 14 THR CB   C   -5.531  -4.263  -4.342 1.00 . A A . 670 THR CB   1 1 
        6  7537 1 1 14 THR CG2  C   -4.644  -4.713  -5.500 1.00 . A A . 670 THR CG2  1 1 
        6  7538 1 1 14 THR H    H   -6.344  -3.479  -1.957 1.00 . A A . 670 THR H    1 1 
        6  7539 1 1 14 THR HA   H   -4.902  -5.797  -2.970 1.00 . A A . 670 THR HA   1 1 
        6  7540 1 1 14 THR HB   H   -5.590  -3.182  -4.351 1.00 . A A . 670 THR HB   1 1 
        6  7541 1 1 14 THR HG1  H   -7.488  -4.074  -4.589 1.00 . A A . 670 THR HG1  1 1 
        6  7542 1 1 14 THR HG21 H   -5.078  -4.392  -6.437 1.00 . A A . 670 THR HG21 1 1 
        6  7543 1 1 14 THR HG22 H   -4.559  -5.790  -5.493 1.00 . A A . 670 THR HG22 1 1 
        6  7544 1 1 14 THR HG23 H   -3.663  -4.274  -5.394 1.00 . A A . 670 THR HG23 1 1 
        6  7545 1 1 14 THR N    N   -5.801  -4.289  -1.860 1.00 . A A . 670 THR N    1 1 
        6  7546 1 1 14 THR O    O   -3.297  -2.956  -2.974 1.00 . A A . 670 THR O    1 1 
        6  7547 1 1 14 THR OG1  O   -6.852  -4.799  -4.515 1.00 . A A . 670 THR OG1  1 1 
        6  7548 1 1 15 VAL C    C   -0.208  -5.653  -3.078 1.00 . A A . 671 VAL C    1 1 
        6  7549 1 1 15 VAL CA   C   -1.155  -4.661  -2.375 1.00 . A A . 671 VAL CA   1 1 
        6  7550 1 1 15 VAL CB   C   -0.783  -4.605  -0.865 1.00 . A A . 671 VAL CB   1 1 
        6  7551 1 1 15 VAL CG1  C    0.699  -4.281  -0.674 1.00 . A A . 671 VAL CG1  1 1 
        6  7552 1 1 15 VAL CG2  C   -1.654  -3.593  -0.122 1.00 . A A . 671 VAL CG2  1 1 
        6  7553 1 1 15 VAL H    H   -2.804  -5.994  -2.489 1.00 . A A . 671 VAL H    1 1 
        6  7554 1 1 15 VAL HA   H   -1.014  -3.675  -2.799 1.00 . A A . 671 VAL HA   1 1 
        6  7555 1 1 15 VAL HB   H   -0.968  -5.582  -0.438 1.00 . A A . 671 VAL HB   1 1 
        6  7556 1 1 15 VAL HG11 H    0.923  -3.326  -1.127 1.00 . A A . 671 VAL HG11 1 1 
        6  7557 1 1 15 VAL HG12 H    1.300  -5.048  -1.141 1.00 . A A . 671 VAL HG12 1 1 
        6  7558 1 1 15 VAL HG13 H    0.929  -4.240   0.381 1.00 . A A . 671 VAL HG13 1 1 
        6  7559 1 1 15 VAL HG21 H   -1.374  -3.569   0.920 1.00 . A A . 671 VAL HG21 1 1 
        6  7560 1 1 15 VAL HG22 H   -2.694  -3.880  -0.209 1.00 . A A . 671 VAL HG22 1 1 
        6  7561 1 1 15 VAL HG23 H   -1.517  -2.613  -0.553 1.00 . A A . 671 VAL HG23 1 1 
        6  7562 1 1 15 VAL N    N   -2.562  -5.047  -2.565 1.00 . A A . 671 VAL N    1 1 
        6  7563 1 1 15 VAL O    O   -0.312  -6.865  -2.873 1.00 . A A . 671 VAL O    1 1 
        6  7564 1 1 16 PRO C    C    2.851  -6.441  -3.625 1.00 . A A . 672 PRO C    1 1 
        6  7565 1 1 16 PRO CA   C    1.714  -6.029  -4.579 1.00 . A A . 672 PRO CA   1 1 
        6  7566 1 1 16 PRO CB   C    2.236  -5.145  -5.716 1.00 . A A . 672 PRO CB   1 1 
        6  7567 1 1 16 PRO CD   C    0.920  -3.739  -4.263 1.00 . A A . 672 PRO CD   1 1 
        6  7568 1 1 16 PRO CG   C    2.110  -3.748  -5.196 1.00 . A A . 672 PRO CG   1 1 
        6  7569 1 1 16 PRO HA   H    1.248  -6.916  -4.989 1.00 . A A . 672 PRO HA   1 1 
        6  7570 1 1 16 PRO HB2  H    3.265  -5.397  -5.935 1.00 . A A . 672 PRO HB2  1 1 
        6  7571 1 1 16 PRO HB3  H    1.631  -5.292  -6.598 1.00 . A A . 672 PRO HB3  1 1 
        6  7572 1 1 16 PRO HD2  H    1.141  -3.155  -3.381 1.00 . A A . 672 PRO HD2  1 1 
        6  7573 1 1 16 PRO HD3  H    0.051  -3.346  -4.764 1.00 . A A . 672 PRO HD3  1 1 
        6  7574 1 1 16 PRO HG2  H    3.009  -3.476  -4.659 1.00 . A A . 672 PRO HG2  1 1 
        6  7575 1 1 16 PRO HG3  H    1.948  -3.063  -6.017 1.00 . A A . 672 PRO HG3  1 1 
        6  7576 1 1 16 PRO N    N    0.730  -5.164  -3.914 1.00 . A A . 672 PRO N    1 1 
        6  7577 1 1 16 PRO O    O    3.422  -5.602  -2.932 1.00 . A A . 672 PRO O    1 1 
        6  7578 1 1 17 VAL C    C    5.591  -7.672  -2.922 1.00 . A A . 673 VAL C    1 1 
        6  7579 1 1 17 VAL CA   C    4.186  -8.242  -2.651 1.00 . A A . 673 VAL CA   1 1 
        6  7580 1 1 17 VAL CB   C    4.248  -9.792  -2.670 1.00 . A A . 673 VAL CB   1 1 
        6  7581 1 1 17 VAL CG1  C    4.722 -10.311  -4.028 1.00 . A A . 673 VAL CG1  1 1 
        6  7582 1 1 17 VAL CG2  C    5.137 -10.310  -1.541 1.00 . A A . 673 VAL CG2  1 1 
        6  7583 1 1 17 VAL H    H    2.734  -8.356  -4.208 1.00 . A A . 673 VAL H    1 1 
        6  7584 1 1 17 VAL HA   H    3.881  -7.937  -1.658 1.00 . A A . 673 VAL HA   1 1 
        6  7585 1 1 17 VAL HB   H    3.248 -10.167  -2.504 1.00 . A A . 673 VAL HB   1 1 
        6  7586 1 1 17 VAL HG11 H    4.057  -9.956  -4.802 1.00 . A A . 673 VAL HG11 1 1 
        6  7587 1 1 17 VAL HG12 H    4.719 -11.393  -4.023 1.00 . A A . 673 VAL HG12 1 1 
        6  7588 1 1 17 VAL HG13 H    5.723  -9.956  -4.223 1.00 . A A . 673 VAL HG13 1 1 
        6  7589 1 1 17 VAL HG21 H    5.169 -11.390  -1.574 1.00 . A A . 673 VAL HG21 1 1 
        6  7590 1 1 17 VAL HG22 H    4.734  -9.994  -0.589 1.00 . A A . 673 VAL HG22 1 1 
        6  7591 1 1 17 VAL HG23 H    6.137  -9.918  -1.657 1.00 . A A . 673 VAL HG23 1 1 
        6  7592 1 1 17 VAL N    N    3.180  -7.731  -3.594 1.00 . A A . 673 VAL N    1 1 
        6  7593 1 1 17 VAL O    O    6.387  -7.500  -1.998 1.00 . A A . 673 VAL O    1 1 
        6  7594 1 1 18 GLY C    C    7.219  -5.974  -5.771 1.00 . A A . 674 GLY C    1 1 
        6  7595 1 1 18 GLY CA   C    7.215  -6.879  -4.544 1.00 . A A . 674 GLY CA   1 1 
        6  7596 1 1 18 GLY H    H    5.200  -7.467  -4.875 1.00 . A A . 674 GLY H    1 1 
        6  7597 1 1 18 GLY HA2  H    7.622  -6.327  -3.707 1.00 . A A . 674 GLY HA2  1 1 
        6  7598 1 1 18 GLY HA3  H    7.855  -7.727  -4.739 1.00 . A A . 674 GLY HA3  1 1 
        6  7599 1 1 18 GLY N    N    5.887  -7.369  -4.184 1.00 . A A . 674 GLY N    1 1 
        6  7600 1 1 18 GLY O    O    6.484  -6.206  -6.732 1.00 . A A . 674 GLY O    1 1 
        6  7601 1 1 19 ALA C    C    9.656  -3.603  -7.071 1.00 . A A . 675 ALA C    1 1 
        6  7602 1 1 19 ALA CA   C    8.188  -3.994  -6.848 1.00 . A A . 675 ALA CA   1 1 
        6  7603 1 1 19 ALA CB   C    7.344  -2.753  -6.569 1.00 . A A . 675 ALA CB   1 1 
        6  7604 1 1 19 ALA H    H    8.624  -4.823  -4.943 1.00 . A A . 675 ALA H    1 1 
        6  7605 1 1 19 ALA HA   H    7.811  -4.467  -7.746 1.00 . A A . 675 ALA HA   1 1 
        6  7606 1 1 19 ALA HB1  H    7.703  -2.264  -5.674 1.00 . A A . 675 ALA HB1  1 1 
        6  7607 1 1 19 ALA HB2  H    6.312  -3.042  -6.430 1.00 . A A . 675 ALA HB2  1 1 
        6  7608 1 1 19 ALA HB3  H    7.414  -2.070  -7.403 1.00 . A A . 675 ALA HB3  1 1 
        6  7609 1 1 19 ALA N    N    8.062  -4.947  -5.738 1.00 . A A . 675 ALA N    1 1 
        6  7610 1 1 19 ALA O    O   10.482  -3.724  -6.166 1.00 . A A . 675 ALA O    1 1 
        6  7611 1 1 20 THR C    C   11.383  -1.399  -9.380 1.00 . A A . 676 THR C    1 1 
        6  7612 1 1 20 THR CA   C   11.355  -2.724  -8.605 1.00 . A A . 676 THR CA   1 1 
        6  7613 1 1 20 THR CB   C   12.094  -3.809  -9.432 1.00 . A A . 676 THR CB   1 1 
        6  7614 1 1 20 THR CG2  C   13.455  -3.311  -9.915 1.00 . A A . 676 THR CG2  1 1 
        6  7615 1 1 20 THR H    H    9.282  -3.067  -8.962 1.00 . A A . 676 THR H    1 1 
        6  7616 1 1 20 THR HA   H   11.891  -2.589  -7.674 1.00 . A A . 676 THR HA   1 1 
        6  7617 1 1 20 THR HB   H   11.490  -4.054 -10.296 1.00 . A A . 676 THR HB   1 1 
        6  7618 1 1 20 THR HG1  H   11.412  -5.319  -8.344 1.00 . A A . 676 THR HG1  1 1 
        6  7619 1 1 20 THR HG21 H   13.949  -4.095 -10.472 1.00 . A A . 676 THR HG21 1 1 
        6  7620 1 1 20 THR HG22 H   14.062  -3.037  -9.065 1.00 . A A . 676 THR HG22 1 1 
        6  7621 1 1 20 THR HG23 H   13.319  -2.451 -10.553 1.00 . A A . 676 THR HG23 1 1 
        6  7622 1 1 20 THR N    N    9.979  -3.136  -8.275 1.00 . A A . 676 THR N    1 1 
        6  7623 1 1 20 THR O    O   10.691  -1.235 -10.382 1.00 . A A . 676 THR O    1 1 
        6  7624 1 1 20 THR OG1  O   12.275  -4.998  -8.643 1.00 . A A . 676 THR OG1  1 1 
        6  7625 1 1 21 ILE C    C   13.855   1.207  -9.689 1.00 . A A . 677 ILE C    1 1 
        6  7626 1 1 21 ILE CA   C   12.366   0.848  -9.557 1.00 . A A . 677 ILE CA   1 1 
        6  7627 1 1 21 ILE CB   C   11.634   1.983  -8.791 1.00 . A A . 677 ILE CB   1 1 
        6  7628 1 1 21 ILE CD1  C   11.586   3.276  -6.584 1.00 . A A . 677 ILE CD1  1 1 
        6  7629 1 1 21 ILE CG1  C   12.190   2.123  -7.362 1.00 . A A . 677 ILE CG1  1 1 
        6  7630 1 1 21 ILE CG2  C   10.124   1.737  -8.765 1.00 . A A . 677 ILE CG2  1 1 
        6  7631 1 1 21 ILE H    H   12.704  -0.644  -8.082 1.00 . A A . 677 ILE H    1 1 
        6  7632 1 1 21 ILE HA   H   11.941   0.782 -10.551 1.00 . A A . 677 ILE HA   1 1 
        6  7633 1 1 21 ILE HB   H   11.807   2.909  -9.324 1.00 . A A . 677 ILE HB   1 1 
        6  7634 1 1 21 ILE HD11 H   10.527   3.109  -6.455 1.00 . A A . 677 ILE HD11 1 1 
        6  7635 1 1 21 ILE HD12 H   11.744   4.199  -7.124 1.00 . A A . 677 ILE HD12 1 1 
        6  7636 1 1 21 ILE HD13 H   12.058   3.340  -5.614 1.00 . A A . 677 ILE HD13 1 1 
        6  7637 1 1 21 ILE HG12 H   11.991   1.214  -6.811 1.00 . A A . 677 ILE HG12 1 1 
        6  7638 1 1 21 ILE HG13 H   13.258   2.281  -7.409 1.00 . A A . 677 ILE HG13 1 1 
        6  7639 1 1 21 ILE HG21 H    9.919   0.789  -8.289 1.00 . A A . 677 ILE HG21 1 1 
        6  7640 1 1 21 ILE HG22 H    9.743   1.720  -9.777 1.00 . A A . 677 ILE HG22 1 1 
        6  7641 1 1 21 ILE HG23 H    9.636   2.529  -8.214 1.00 . A A . 677 ILE HG23 1 1 
        6  7642 1 1 21 ILE N    N   12.195  -0.457  -8.901 1.00 . A A . 677 ILE N    1 1 
        6  7643 1 1 21 ILE O    O   14.726   0.452  -9.255 1.00 . A A . 677 ILE O    1 1 
        6  7644 1 1 22 HIS C    C   15.767   4.193  -9.862 1.00 . A A . 678 HIS C    1 1 
        6  7645 1 1 22 HIS CA   C   15.535   2.802 -10.474 1.00 . A A . 678 HIS CA   1 1 
        6  7646 1 1 22 HIS CB   C   15.922   2.815 -11.958 1.00 . A A . 678 HIS CB   1 1 
        6  7647 1 1 22 HIS CD2  C   16.812   0.438 -12.467 1.00 . A A . 678 HIS CD2  1 1 
        6  7648 1 1 22 HIS CE1  C   15.225  -0.215 -13.829 1.00 . A A . 678 HIS CE1  1 1 
        6  7649 1 1 22 HIS CG   C   15.930   1.456 -12.582 1.00 . A A . 678 HIS CG   1 1 
        6  7650 1 1 22 HIS H    H   13.421   2.898 -10.671 1.00 . A A . 678 HIS H    1 1 
        6  7651 1 1 22 HIS HA   H   16.173   2.095  -9.959 1.00 . A A . 678 HIS HA   1 1 
        6  7652 1 1 22 HIS HB2  H   15.217   3.426 -12.503 1.00 . A A . 678 HIS HB2  1 1 
        6  7653 1 1 22 HIS HB3  H   16.912   3.237 -12.065 1.00 . A A . 678 HIS HB3  1 1 
        6  7654 1 1 22 HIS HD1  H   14.172   1.533 -13.748 1.00 . A A . 678 HIS HD1  1 1 
        6  7655 1 1 22 HIS HD2  H   17.718   0.438 -11.875 1.00 . A A . 678 HIS HD2  1 1 
        6  7656 1 1 22 HIS HE1  H   14.631  -0.811 -14.507 1.00 . A A . 678 HIS HE1  1 1 
        6  7657 1 1 22 HIS HE2  H   16.834  -1.417 -13.457 1.00 . A A . 678 HIS HE2  1 1 
        6  7658 1 1 22 HIS N    N   14.149   2.347 -10.312 1.00 . A A . 678 HIS N    1 1 
        6  7659 1 1 22 HIS ND1  N   14.953   1.015 -13.448 1.00 . A A . 678 HIS ND1  1 1 
        6  7660 1 1 22 HIS NE2  N   16.347  -0.589 -13.252 1.00 . A A . 678 HIS NE2  1 1 
        6  7661 1 1 22 HIS O    O   14.834   4.978  -9.693 1.00 . A A . 678 HIS O    1 1 
        6  7662 1 1 23 VAL C    C   17.137   6.913 -10.010 1.00 . A A . 679 VAL C    1 1 
        6  7663 1 1 23 VAL CA   C   17.418   5.789  -8.997 1.00 . A A . 679 VAL CA   1 1 
        6  7664 1 1 23 VAL CB   C   18.921   5.810  -8.609 1.00 . A A . 679 VAL CB   1 1 
        6  7665 1 1 23 VAL CG1  C   19.339   7.182  -8.082 1.00 . A A . 679 VAL CG1  1 1 
        6  7666 1 1 23 VAL CG2  C   19.226   4.723  -7.581 1.00 . A A . 679 VAL CG2  1 1 
        6  7667 1 1 23 VAL H    H   17.708   3.783  -9.629 1.00 . A A . 679 VAL H    1 1 
        6  7668 1 1 23 VAL HA   H   16.835   5.970  -8.104 1.00 . A A . 679 VAL HA   1 1 
        6  7669 1 1 23 VAL HB   H   19.502   5.602  -9.498 1.00 . A A . 679 VAL HB   1 1 
        6  7670 1 1 23 VAL HG11 H   18.736   7.439  -7.222 1.00 . A A . 679 VAL HG11 1 1 
        6  7671 1 1 23 VAL HG12 H   19.196   7.924  -8.855 1.00 . A A . 679 VAL HG12 1 1 
        6  7672 1 1 23 VAL HG13 H   20.381   7.159  -7.797 1.00 . A A . 679 VAL HG13 1 1 
        6  7673 1 1 23 VAL HG21 H   18.618   4.874  -6.702 1.00 . A A . 679 VAL HG21 1 1 
        6  7674 1 1 23 VAL HG22 H   20.271   4.768  -7.307 1.00 . A A . 679 VAL HG22 1 1 
        6  7675 1 1 23 VAL HG23 H   19.009   3.754  -8.005 1.00 . A A . 679 VAL HG23 1 1 
        6  7676 1 1 23 VAL N    N   17.025   4.478  -9.529 1.00 . A A . 679 VAL N    1 1 
        6  7677 1 1 23 VAL O    O   17.542   6.833 -11.170 1.00 . A A . 679 VAL O    1 1 
        6  7678 1 1 24 GLY C    C   14.656   8.993 -10.951 1.00 . A A . 680 GLY C    1 1 
        6  7679 1 1 24 GLY CA   C   16.092   9.069 -10.442 1.00 . A A . 680 GLY CA   1 1 
        6  7680 1 1 24 GLY H    H   16.174   7.978  -8.620 1.00 . A A . 680 GLY H    1 1 
        6  7681 1 1 24 GLY HA2  H   16.217   9.993  -9.898 1.00 . A A . 680 GLY HA2  1 1 
        6  7682 1 1 24 GLY HA3  H   16.763   9.073 -11.291 1.00 . A A . 680 GLY HA3  1 1 
        6  7683 1 1 24 GLY N    N   16.446   7.958  -9.562 1.00 . A A . 680 GLY N    1 1 
        6  7684 1 1 24 GLY O    O   14.110   9.986 -11.439 1.00 . A A . 680 GLY O    1 1 
        6  7685 1 1 25 ASP C    C   11.640   8.129 -10.264 1.00 . A A . 681 ASP C    1 1 
        6  7686 1 1 25 ASP CA   C   12.666   7.600 -11.283 1.00 . A A . 681 ASP CA   1 1 
        6  7687 1 1 25 ASP CB   C   12.429   6.106 -11.532 1.00 . A A . 681 ASP CB   1 1 
        6  7688 1 1 25 ASP CG   C   13.165   5.598 -12.759 1.00 . A A . 681 ASP CG   1 1 
        6  7689 1 1 25 ASP H    H   14.544   7.056 -10.463 1.00 . A A . 681 ASP H    1 1 
        6  7690 1 1 25 ASP HA   H   12.529   8.132 -12.215 1.00 . A A . 681 ASP HA   1 1 
        6  7691 1 1 25 ASP HB2  H   12.774   5.545 -10.674 1.00 . A A . 681 ASP HB2  1 1 
        6  7692 1 1 25 ASP HB3  H   11.370   5.930 -11.666 1.00 . A A . 681 ASP HB3  1 1 
        6  7693 1 1 25 ASP N    N   14.047   7.814 -10.842 1.00 . A A . 681 ASP N    1 1 
        6  7694 1 1 25 ASP O    O   12.000   8.623  -9.190 1.00 . A A . 681 ASP O    1 1 
        6  7695 1 1 25 ASP OD1  O   14.410   5.558 -12.747 1.00 . A A . 681 ASP OD1  1 1 
        6  7696 1 1 25 ASP OD2  O   12.496   5.235 -13.749 1.00 . A A . 681 ASP OD2  1 1 
        6  7697 1 1 26 SER C    C    8.582   7.183  -9.125 1.00 . A A . 682 SER C    1 1 
        6  7698 1 1 26 SER CA   C    9.260   8.420  -9.725 1.00 . A A . 682 SER CA   1 1 
        6  7699 1 1 26 SER CB   C    8.216   9.256 -10.488 1.00 . A A . 682 SER CB   1 1 
        6  7700 1 1 26 SER H    H   10.143   7.665 -11.504 1.00 . A A . 682 SER H    1 1 
        6  7701 1 1 26 SER HA   H    9.674   9.017  -8.923 1.00 . A A . 682 SER HA   1 1 
        6  7702 1 1 26 SER HB2  H    7.786   8.658 -11.279 1.00 . A A . 682 SER HB2  1 1 
        6  7703 1 1 26 SER HB3  H    7.435   9.563  -9.806 1.00 . A A . 682 SER HB3  1 1 
        6  7704 1 1 26 SER HG   H    8.108  10.922 -11.522 1.00 . A A . 682 SER HG   1 1 
        6  7705 1 1 26 SER N    N   10.360   8.023 -10.618 1.00 . A A . 682 SER N    1 1 
        6  7706 1 1 26 SER O    O    8.472   6.147  -9.786 1.00 . A A . 682 SER O    1 1 
        6  7707 1 1 26 SER OG   O    8.796  10.420 -11.064 1.00 . A A . 682 SER OG   1 1 
        6  7708 1 1 27 PHE C    C    6.392   6.664  -6.217 1.00 . A A . 683 PHE C    1 1 
        6  7709 1 1 27 PHE CA   C    7.445   6.169  -7.216 1.00 . A A . 683 PHE CA   1 1 
        6  7710 1 1 27 PHE CB   C    8.458   5.266  -6.498 1.00 . A A . 683 PHE CB   1 1 
        6  7711 1 1 27 PHE CD1  C    7.361   3.000  -6.553 1.00 . A A . 683 PHE CD1  1 1 
        6  7712 1 1 27 PHE CD2  C    7.716   4.026  -4.428 1.00 . A A . 683 PHE CD2  1 1 
        6  7713 1 1 27 PHE CE1  C    6.788   1.905  -5.933 1.00 . A A . 683 PHE CE1  1 1 
        6  7714 1 1 27 PHE CE2  C    7.144   2.932  -3.803 1.00 . A A . 683 PHE CE2  1 1 
        6  7715 1 1 27 PHE CG   C    7.833   4.074  -5.811 1.00 . A A . 683 PHE CG   1 1 
        6  7716 1 1 27 PHE CZ   C    6.679   1.871  -4.557 1.00 . A A . 683 PHE CZ   1 1 
        6  7717 1 1 27 PHE H    H    8.256   8.129  -7.388 1.00 . A A . 683 PHE H    1 1 
        6  7718 1 1 27 PHE HA   H    6.947   5.589  -7.982 1.00 . A A . 683 PHE HA   1 1 
        6  7719 1 1 27 PHE HB2  H    9.171   4.894  -7.221 1.00 . A A . 683 PHE HB2  1 1 
        6  7720 1 1 27 PHE HB3  H    8.984   5.846  -5.752 1.00 . A A . 683 PHE HB3  1 1 
        6  7721 1 1 27 PHE HD1  H    7.444   3.024  -7.628 1.00 . A A . 683 PHE HD1  1 1 
        6  7722 1 1 27 PHE HD2  H    8.076   4.856  -3.836 1.00 . A A . 683 PHE HD2  1 1 
        6  7723 1 1 27 PHE HE1  H    6.425   1.077  -6.524 1.00 . A A . 683 PHE HE1  1 1 
        6  7724 1 1 27 PHE HE2  H    7.061   2.910  -2.727 1.00 . A A . 683 PHE HE2  1 1 
        6  7725 1 1 27 PHE HZ   H    6.233   1.016  -4.070 1.00 . A A . 683 PHE HZ   1 1 
        6  7726 1 1 27 PHE N    N    8.128   7.287  -7.878 1.00 . A A . 683 PHE N    1 1 
        6  7727 1 1 27 PHE O    O    6.723   7.267  -5.196 1.00 . A A . 683 PHE O    1 1 
        6  7728 1 1 28 VAL C    C    3.357   5.488  -5.045 1.00 . A A . 684 VAL C    1 1 
        6  7729 1 1 28 VAL CA   C    4.012   6.758  -5.626 1.00 . A A . 684 VAL CA   1 1 
        6  7730 1 1 28 VAL CB   C    2.937   7.603  -6.362 1.00 . A A . 684 VAL CB   1 1 
        6  7731 1 1 28 VAL CG1  C    1.788   7.961  -5.418 1.00 . A A . 684 VAL CG1  1 1 
        6  7732 1 1 28 VAL CG2  C    3.558   8.862  -6.964 1.00 . A A . 684 VAL CG2  1 1 
        6  7733 1 1 28 VAL H    H    4.923   5.960  -7.376 1.00 . A A . 684 VAL H    1 1 
        6  7734 1 1 28 VAL HA   H    4.411   7.352  -4.813 1.00 . A A . 684 VAL HA   1 1 
        6  7735 1 1 28 VAL HB   H    2.533   7.006  -7.171 1.00 . A A . 684 VAL HB   1 1 
        6  7736 1 1 28 VAL HG11 H    1.289   7.057  -5.096 1.00 . A A . 684 VAL HG11 1 1 
        6  7737 1 1 28 VAL HG12 H    1.080   8.595  -5.935 1.00 . A A . 684 VAL HG12 1 1 
        6  7738 1 1 28 VAL HG13 H    2.175   8.485  -4.557 1.00 . A A . 684 VAL HG13 1 1 
        6  7739 1 1 28 VAL HG21 H    2.802   9.419  -7.501 1.00 . A A . 684 VAL HG21 1 1 
        6  7740 1 1 28 VAL HG22 H    4.349   8.585  -7.646 1.00 . A A . 684 VAL HG22 1 1 
        6  7741 1 1 28 VAL HG23 H    3.965   9.479  -6.176 1.00 . A A . 684 VAL HG23 1 1 
        6  7742 1 1 28 VAL N    N    5.123   6.404  -6.522 1.00 . A A . 684 VAL N    1 1 
        6  7743 1 1 28 VAL O    O    2.584   4.810  -5.732 1.00 . A A . 684 VAL O    1 1 
        6  7744 1 1 29 PRO C    C    1.603   3.822  -3.135 1.00 . A A . 685 PRO C    1 1 
        6  7745 1 1 29 PRO CA   C    3.140   3.913  -3.141 1.00 . A A . 685 PRO CA   1 1 
        6  7746 1 1 29 PRO CB   C    3.695   3.978  -1.701 1.00 . A A . 685 PRO CB   1 1 
        6  7747 1 1 29 PRO CD   C    4.530   5.899  -2.861 1.00 . A A . 685 PRO CD   1 1 
        6  7748 1 1 29 PRO CG   C    4.113   5.400  -1.506 1.00 . A A . 685 PRO CG   1 1 
        6  7749 1 1 29 PRO HA   H    3.534   3.033  -3.632 1.00 . A A . 685 PRO HA   1 1 
        6  7750 1 1 29 PRO HB2  H    2.927   3.690  -0.995 1.00 . A A . 685 PRO HB2  1 1 
        6  7751 1 1 29 PRO HB3  H    4.538   3.305  -1.609 1.00 . A A . 685 PRO HB3  1 1 
        6  7752 1 1 29 PRO HD2  H    4.350   6.962  -2.947 1.00 . A A . 685 PRO HD2  1 1 
        6  7753 1 1 29 PRO HD3  H    5.572   5.674  -3.048 1.00 . A A . 685 PRO HD3  1 1 
        6  7754 1 1 29 PRO HG2  H    3.280   5.980  -1.135 1.00 . A A . 685 PRO HG2  1 1 
        6  7755 1 1 29 PRO HG3  H    4.941   5.450  -0.815 1.00 . A A . 685 PRO HG3  1 1 
        6  7756 1 1 29 PRO N    N    3.658   5.140  -3.776 1.00 . A A . 685 PRO N    1 1 
        6  7757 1 1 29 PRO O    O    1.041   2.769  -3.429 1.00 . A A . 685 PRO O    1 1 
        6  7758 1 1 30 MET C    C   -1.253   4.950  -4.083 1.00 . A A . 686 MET C    1 1 
        6  7759 1 1 30 MET CA   C   -0.545   4.912  -2.720 1.00 . A A . 686 MET CA   1 1 
        6  7760 1 1 30 MET CB   C   -1.047   6.080  -1.866 1.00 . A A . 686 MET CB   1 1 
        6  7761 1 1 30 MET CE   C   -3.348   5.743   0.240 1.00 . A A . 686 MET CE   1 1 
        6  7762 1 1 30 MET CG   C   -0.675   5.983  -0.394 1.00 . A A . 686 MET CG   1 1 
        6  7763 1 1 30 MET H    H    1.410   5.769  -2.677 1.00 . A A . 686 MET H    1 1 
        6  7764 1 1 30 MET HA   H   -0.818   3.990  -2.226 1.00 . A A . 686 MET HA   1 1 
        6  7765 1 1 30 MET HB2  H   -0.638   7.001  -2.258 1.00 . A A . 686 MET HB2  1 1 
        6  7766 1 1 30 MET HB3  H   -2.126   6.123  -1.938 1.00 . A A . 686 MET HB3  1 1 
        6  7767 1 1 30 MET HE1  H   -4.207   6.096   0.787 1.00 . A A . 686 MET HE1  1 1 
        6  7768 1 1 30 MET HE2  H   -3.155   4.712   0.497 1.00 . A A . 686 MET HE2  1 1 
        6  7769 1 1 30 MET HE3  H   -3.540   5.818  -0.823 1.00 . A A . 686 MET HE3  1 1 
        6  7770 1 1 30 MET HG2  H   -0.576   4.943  -0.123 1.00 . A A . 686 MET HG2  1 1 
        6  7771 1 1 30 MET HG3  H    0.268   6.488  -0.235 1.00 . A A . 686 MET HG3  1 1 
        6  7772 1 1 30 MET N    N    0.923   4.929  -2.832 1.00 . A A . 686 MET N    1 1 
        6  7773 1 1 30 MET O    O   -2.457   4.713  -4.163 1.00 . A A . 686 MET O    1 1 
        6  7774 1 1 30 MET SD   S   -1.921   6.742   0.664 1.00 . A A . 686 MET SD   1 1 
        6  7775 1 1 31 ALA C    C   -1.308   3.881  -7.066 1.00 . A A . 687 ALA C    1 1 
        6  7776 1 1 31 ALA CA   C   -1.125   5.290  -6.489 1.00 . A A . 687 ALA CA   1 1 
        6  7777 1 1 31 ALA CB   C   -0.285   6.144  -7.433 1.00 . A A . 687 ALA CB   1 1 
        6  7778 1 1 31 ALA H    H    0.434   5.433  -5.047 1.00 . A A . 687 ALA H    1 1 
        6  7779 1 1 31 ALA HA   H   -2.100   5.754  -6.392 1.00 . A A . 687 ALA HA   1 1 
        6  7780 1 1 31 ALA HB1  H   -0.193   7.140  -7.028 1.00 . A A . 687 ALA HB1  1 1 
        6  7781 1 1 31 ALA HB2  H   -0.762   6.193  -8.402 1.00 . A A . 687 ALA HB2  1 1 
        6  7782 1 1 31 ALA HB3  H    0.698   5.708  -7.538 1.00 . A A . 687 ALA HB3  1 1 
        6  7783 1 1 31 ALA N    N   -0.520   5.242  -5.152 1.00 . A A . 687 ALA N    1 1 
        6  7784 1 1 31 ALA O    O   -2.086   3.676  -8.000 1.00 . A A . 687 ALA O    1 1 
        6  7785 1 1 32 GLU C    C   -1.257   0.580  -5.922 1.00 . A A . 688 GLU C    1 1 
        6  7786 1 1 32 GLU CA   C   -0.653   1.526  -6.977 1.00 . A A . 688 GLU CA   1 1 
        6  7787 1 1 32 GLU CB   C    0.746   1.042  -7.393 1.00 . A A . 688 GLU CB   1 1 
        6  7788 1 1 32 GLU CD   C    2.662   1.260  -9.044 1.00 . A A . 688 GLU CD   1 1 
        6  7789 1 1 32 GLU CG   C    1.364   1.856  -8.526 1.00 . A A . 688 GLU CG   1 1 
        6  7790 1 1 32 GLU H    H    0.010   3.137  -5.757 1.00 . A A . 688 GLU H    1 1 
        6  7791 1 1 32 GLU HA   H   -1.293   1.513  -7.846 1.00 . A A . 688 GLU HA   1 1 
        6  7792 1 1 32 GLU HB2  H    1.404   1.095  -6.537 1.00 . A A . 688 GLU HB2  1 1 
        6  7793 1 1 32 GLU HB3  H    0.678   0.012  -7.717 1.00 . A A . 688 GLU HB3  1 1 
        6  7794 1 1 32 GLU HG2  H    0.658   1.906  -9.345 1.00 . A A . 688 GLU HG2  1 1 
        6  7795 1 1 32 GLU HG3  H    1.560   2.858  -8.165 1.00 . A A . 688 GLU HG3  1 1 
        6  7796 1 1 32 GLU N    N   -0.587   2.913  -6.504 1.00 . A A . 688 GLU N    1 1 
        6  7797 1 1 32 GLU O    O   -1.234  -0.643  -6.085 1.00 . A A . 688 GLU O    1 1 
        6  7798 1 1 32 GLU OE1  O    2.604   0.420  -9.966 1.00 . A A . 688 GLU OE1  1 1 
        6  7799 1 1 32 GLU OE2  O    3.742   1.630  -8.540 1.00 . A A . 688 GLU OE2  1 1 
        6  7800 1 1 33 VAL C    C   -3.907   0.805  -3.591 1.00 . A A . 689 VAL C    1 1 
        6  7801 1 1 33 VAL CA   C   -2.451   0.362  -3.794 1.00 . A A . 689 VAL CA   1 1 
        6  7802 1 1 33 VAL CB   C   -1.677   0.482  -2.456 1.00 . A A . 689 VAL CB   1 1 
        6  7803 1 1 33 VAL CG1  C   -2.414  -0.238  -1.325 1.00 . A A . 689 VAL CG1  1 1 
        6  7804 1 1 33 VAL CG2  C   -0.258  -0.063  -2.607 1.00 . A A . 689 VAL CG2  1 1 
        6  7805 1 1 33 VAL H    H   -1.782   2.126  -4.765 1.00 . A A . 689 VAL H    1 1 
        6  7806 1 1 33 VAL HA   H   -2.445  -0.680  -4.098 1.00 . A A . 689 VAL HA   1 1 
        6  7807 1 1 33 VAL HB   H   -1.608   1.530  -2.199 1.00 . A A . 689 VAL HB   1 1 
        6  7808 1 1 33 VAL HG11 H   -3.392   0.200  -1.192 1.00 . A A . 689 VAL HG11 1 1 
        6  7809 1 1 33 VAL HG12 H   -1.851  -0.144  -0.408 1.00 . A A . 689 VAL HG12 1 1 
        6  7810 1 1 33 VAL HG13 H   -2.520  -1.286  -1.573 1.00 . A A . 689 VAL HG13 1 1 
        6  7811 1 1 33 VAL HG21 H    0.262   0.023  -1.664 1.00 . A A . 689 VAL HG21 1 1 
        6  7812 1 1 33 VAL HG22 H    0.269   0.504  -3.361 1.00 . A A . 689 VAL HG22 1 1 
        6  7813 1 1 33 VAL HG23 H   -0.298  -1.101  -2.901 1.00 . A A . 689 VAL HG23 1 1 
        6  7814 1 1 33 VAL N    N   -1.806   1.149  -4.851 1.00 . A A . 689 VAL N    1 1 
        6  7815 1 1 33 VAL O    O   -4.182   1.980  -3.353 1.00 . A A . 689 VAL O    1 1 
        6  7816 1 1 34 LEU C    C   -6.915  -0.600  -2.404 1.00 . A A . 690 LEU C    1 1 
        6  7817 1 1 34 LEU CA   C   -6.271   0.154  -3.578 1.00 . A A . 690 LEU CA   1 1 
        6  7818 1 1 34 LEU CB   C   -7.020  -0.206  -4.879 1.00 . A A . 690 LEU CB   1 1 
        6  7819 1 1 34 LEU CD1  C   -5.293   0.305  -6.667 1.00 . A A . 690 LEU CD1  1 1 
        6  7820 1 1 34 LEU CD2  C   -7.740   0.455  -7.205 1.00 . A A . 690 LEU CD2  1 1 
        6  7821 1 1 34 LEU CG   C   -6.679   0.642  -6.122 1.00 . A A . 690 LEU CG   1 1 
        6  7822 1 1 34 LEU H    H   -4.553  -1.075  -3.828 1.00 . A A . 690 LEU H    1 1 
        6  7823 1 1 34 LEU HA   H   -6.375   1.217  -3.400 1.00 . A A . 690 LEU HA   1 1 
        6  7824 1 1 34 LEU HB2  H   -6.814  -1.241  -5.110 1.00 . A A . 690 LEU HB2  1 1 
        6  7825 1 1 34 LEU HB3  H   -8.082  -0.108  -4.689 1.00 . A A . 690 LEU HB3  1 1 
        6  7826 1 1 34 LEU HD11 H   -5.079   0.933  -7.520 1.00 . A A . 690 LEU HD11 1 1 
        6  7827 1 1 34 LEU HD12 H   -5.264  -0.732  -6.968 1.00 . A A . 690 LEU HD12 1 1 
        6  7828 1 1 34 LEU HD13 H   -4.554   0.478  -5.900 1.00 . A A . 690 LEU HD13 1 1 
        6  7829 1 1 34 LEU HD21 H   -7.485   1.052  -8.067 1.00 . A A . 690 LEU HD21 1 1 
        6  7830 1 1 34 LEU HD22 H   -8.702   0.768  -6.824 1.00 . A A . 690 LEU HD22 1 1 
        6  7831 1 1 34 LEU HD23 H   -7.789  -0.585  -7.491 1.00 . A A . 690 LEU HD23 1 1 
        6  7832 1 1 34 LEU HG   H   -6.675   1.685  -5.843 1.00 . A A . 690 LEU HG   1 1 
        6  7833 1 1 34 LEU N    N   -4.837  -0.146  -3.690 1.00 . A A . 690 LEU N    1 1 
        6  7834 1 1 34 LEU O    O   -6.413  -1.630  -1.957 1.00 . A A . 690 LEU O    1 1 
        6  7835 1 1 35 ALA C    C  -10.311  -0.434  -1.025 1.00 . A A . 691 ALA C    1 1 
        6  7836 1 1 35 ALA CA   C   -8.814  -0.728  -0.860 1.00 . A A . 691 ALA CA   1 1 
        6  7837 1 1 35 ALA CB   C   -8.327  -0.268   0.509 1.00 . A A . 691 ALA CB   1 1 
        6  7838 1 1 35 ALA H    H   -8.364   0.771  -2.299 1.00 . A A . 691 ALA H    1 1 
        6  7839 1 1 35 ALA HA   H   -8.658  -1.798  -0.934 1.00 . A A . 691 ALA HA   1 1 
        6  7840 1 1 35 ALA HB1  H   -8.888  -0.772   1.284 1.00 . A A . 691 ALA HB1  1 1 
        6  7841 1 1 35 ALA HB2  H   -8.466   0.800   0.603 1.00 . A A . 691 ALA HB2  1 1 
        6  7842 1 1 35 ALA HB3  H   -7.278  -0.502   0.617 1.00 . A A . 691 ALA HB3  1 1 
        6  7843 1 1 35 ALA N    N   -8.041  -0.080  -1.926 1.00 . A A . 691 ALA N    1 1 
        6  7844 1 1 35 ALA O    O  -10.721   0.726  -1.074 1.00 . A A . 691 ALA O    1 1 
        6  7845 1 1 36 ILE C    C  -13.443  -2.139  -0.424 1.00 . A A . 692 ILE C    1 1 
        6  7846 1 1 36 ILE CA   C  -12.566  -1.316  -1.387 1.00 . A A . 692 ILE CA   1 1 
        6  7847 1 1 36 ILE CB   C  -12.910  -1.728  -2.847 1.00 . A A . 692 ILE CB   1 1 
        6  7848 1 1 36 ILE CD1  C  -12.473   0.593  -3.853 1.00 . A A . 692 ILE CD1  1 1 
        6  7849 1 1 36 ILE CG1  C  -12.120  -0.882  -3.866 1.00 . A A . 692 ILE CG1  1 1 
        6  7850 1 1 36 ILE CG2  C  -14.414  -1.608  -3.105 1.00 . A A . 692 ILE CG2  1 1 
        6  7851 1 1 36 ILE H    H  -10.761  -2.388  -1.008 1.00 . A A . 692 ILE H    1 1 
        6  7852 1 1 36 ILE HA   H  -12.810  -0.268  -1.266 1.00 . A A . 692 ILE HA   1 1 
        6  7853 1 1 36 ILE HB   H  -12.637  -2.767  -2.972 1.00 . A A . 692 ILE HB   1 1 
        6  7854 1 1 36 ILE HD11 H  -12.290   1.000  -2.870 1.00 . A A . 692 ILE HD11 1 1 
        6  7855 1 1 36 ILE HD12 H  -13.517   0.716  -4.106 1.00 . A A . 692 ILE HD12 1 1 
        6  7856 1 1 36 ILE HD13 H  -11.863   1.114  -4.576 1.00 . A A . 692 ILE HD13 1 1 
        6  7857 1 1 36 ILE HG12 H  -11.065  -0.968  -3.653 1.00 . A A . 692 ILE HG12 1 1 
        6  7858 1 1 36 ILE HG13 H  -12.310  -1.260  -4.861 1.00 . A A . 692 ILE HG13 1 1 
        6  7859 1 1 36 ILE HG21 H  -14.948  -2.280  -2.447 1.00 . A A . 692 ILE HG21 1 1 
        6  7860 1 1 36 ILE HG22 H  -14.628  -1.867  -4.132 1.00 . A A . 692 ILE HG22 1 1 
        6  7861 1 1 36 ILE HG23 H  -14.734  -0.592  -2.918 1.00 . A A . 692 ILE HG23 1 1 
        6  7862 1 1 36 ILE N    N  -11.128  -1.483  -1.118 1.00 . A A . 692 ILE N    1 1 
        6  7863 1 1 36 ILE O    O  -13.200  -3.328  -0.206 1.00 . A A . 692 ILE O    1 1 
        6  7864 1 1 37 ASP C    C  -16.857  -1.984   0.182 1.00 . A A . 693 ASP C    1 1 
        6  7865 1 1 37 ASP CA   C  -15.516  -2.172   0.899 1.00 . A A . 693 ASP CA   1 1 
        6  7866 1 1 37 ASP CB   C  -15.619  -1.644   2.337 1.00 . A A . 693 ASP CB   1 1 
        6  7867 1 1 37 ASP CG   C  -16.764  -2.287   3.115 1.00 . A A . 693 ASP CG   1 1 
        6  7868 1 1 37 ASP H    H  -14.493  -0.509   0.069 1.00 . A A . 693 ASP H    1 1 
        6  7869 1 1 37 ASP HA   H  -15.279  -3.230   0.926 1.00 . A A . 693 ASP HA   1 1 
        6  7870 1 1 37 ASP HB2  H  -14.695  -1.853   2.859 1.00 . A A . 693 ASP HB2  1 1 
        6  7871 1 1 37 ASP HB3  H  -15.777  -0.573   2.312 1.00 . A A . 693 ASP HB3  1 1 
        6  7872 1 1 37 ASP N    N  -14.454  -1.487   0.152 1.00 . A A . 693 ASP N    1 1 
        6  7873 1 1 37 ASP O    O  -17.232  -0.867  -0.166 1.00 . A A . 693 ASP O    1 1 
        6  7874 1 1 37 ASP OD1  O  -17.052  -3.476   2.898 1.00 . A A . 693 ASP OD1  1 1 
        6  7875 1 1 37 ASP OD2  O  -17.391  -1.612   3.954 1.00 . A A . 693 ASP OD2  1 1 
        6  7876 1 1 38 LYS C    C  -19.884  -2.137  -0.018 1.00 . A A . 694 LYS C    1 1 
        6  7877 1 1 38 LYS CA   C  -18.858  -3.029  -0.743 1.00 . A A . 694 LYS CA   1 1 
        6  7878 1 1 38 LYS CB   C  -19.417  -4.450  -0.908 1.00 . A A . 694 LYS CB   1 1 
        6  7879 1 1 38 LYS CD   C  -19.012  -6.828  -1.680 1.00 . A A . 694 LYS CD   1 1 
        6  7880 1 1 38 LYS CE   C  -20.090  -6.842  -2.758 1.00 . A A . 694 LYS CE   1 1 
        6  7881 1 1 38 LYS CG   C  -18.410  -5.438  -1.493 1.00 . A A . 694 LYS CG   1 1 
        6  7882 1 1 38 LYS H    H  -17.258  -3.932   0.334 1.00 . A A . 694 LYS H    1 1 
        6  7883 1 1 38 LYS HA   H  -18.667  -2.612  -1.722 1.00 . A A . 694 LYS HA   1 1 
        6  7884 1 1 38 LYS HB2  H  -19.732  -4.817   0.060 1.00 . A A . 694 LYS HB2  1 1 
        6  7885 1 1 38 LYS HB3  H  -20.275  -4.413  -1.564 1.00 . A A . 694 LYS HB3  1 1 
        6  7886 1 1 38 LYS HD2  H  -18.227  -7.513  -1.965 1.00 . A A . 694 LYS HD2  1 1 
        6  7887 1 1 38 LYS HD3  H  -19.447  -7.149  -0.745 1.00 . A A . 694 LYS HD3  1 1 
        6  7888 1 1 38 LYS HE2  H  -20.560  -7.815  -2.766 1.00 . A A . 694 LYS HE2  1 1 
        6  7889 1 1 38 LYS HE3  H  -20.829  -6.089  -2.523 1.00 . A A . 694 LYS HE3  1 1 
        6  7890 1 1 38 LYS HG2  H  -18.076  -5.069  -2.452 1.00 . A A . 694 LYS HG2  1 1 
        6  7891 1 1 38 LYS HG3  H  -17.563  -5.511  -0.824 1.00 . A A . 694 LYS HG3  1 1 
        6  7892 1 1 38 LYS HZ1  H  -20.296  -6.485  -4.805 1.00 . A A . 694 LYS HZ1  1 1 
        6  7893 1 1 38 LYS HZ2  H  -18.896  -7.339  -4.397 1.00 . A A . 694 LYS HZ2  1 1 
        6  7894 1 1 38 LYS HZ3  H  -18.992  -5.681  -4.099 1.00 . A A . 694 LYS HZ3  1 1 
        6  7895 1 1 38 LYS N    N  -17.582  -3.075  -0.019 1.00 . A A . 694 LYS N    1 1 
        6  7896 1 1 38 LYS NZ   N  -19.531  -6.567  -4.107 1.00 . A A . 694 LYS NZ   1 1 
        6  7897 1 1 38 LYS O    O  -20.723  -1.492  -0.647 1.00 . A A . 694 LYS O    1 1 
        6  7898 1 1 39 GLU C    C  -20.370   0.132   2.271 1.00 . A A . 695 GLU C    1 1 
        6  7899 1 1 39 GLU CA   C  -20.750  -1.358   2.140 1.00 . A A . 695 GLU CA   1 1 
        6  7900 1 1 39 GLU CB   C  -20.825  -2.024   3.516 1.00 . A A . 695 GLU CB   1 1 
        6  7901 1 1 39 GLU CD   C  -20.623  -4.348   4.520 1.00 . A A . 695 GLU CD   1 1 
        6  7902 1 1 39 GLU CG   C  -21.262  -3.490   3.445 1.00 . A A . 695 GLU CG   1 1 
        6  7903 1 1 39 GLU H    H  -19.079  -2.608   1.746 1.00 . A A . 695 GLU H    1 1 
        6  7904 1 1 39 GLU HA   H  -21.723  -1.425   1.673 1.00 . A A . 695 GLU HA   1 1 
        6  7905 1 1 39 GLU HB2  H  -19.847  -1.978   3.977 1.00 . A A . 695 GLU HB2  1 1 
        6  7906 1 1 39 GLU HB3  H  -21.532  -1.485   4.132 1.00 . A A . 695 GLU HB3  1 1 
        6  7907 1 1 39 GLU HG2  H  -22.337  -3.537   3.555 1.00 . A A . 695 GLU HG2  1 1 
        6  7908 1 1 39 GLU HG3  H  -20.987  -3.890   2.478 1.00 . A A . 695 GLU HG3  1 1 
        6  7909 1 1 39 GLU N    N  -19.803  -2.108   1.307 1.00 . A A . 695 GLU N    1 1 
        6  7910 1 1 39 GLU O    O  -21.184   1.010   1.982 1.00 . A A . 695 GLU O    1 1 
        6  7911 1 1 39 GLU OE1  O  -19.388  -4.497   4.497 1.00 . A A . 695 GLU OE1  1 1 
        6  7912 1 1 39 GLU OE2  O  -21.341  -4.865   5.397 1.00 . A A . 695 GLU OE2  1 1 
        6  7913 1 1 40 ASP C    C  -18.328   2.470   1.540 1.00 . A A . 696 ASP C    1 1 
        6  7914 1 1 40 ASP CA   C  -18.685   1.809   2.886 1.00 . A A . 696 ASP CA   1 1 
        6  7915 1 1 40 ASP CB   C  -17.476   1.856   3.831 1.00 . A A . 696 ASP CB   1 1 
        6  7916 1 1 40 ASP CG   C  -17.142   3.275   4.275 1.00 . A A . 696 ASP CG   1 1 
        6  7917 1 1 40 ASP H    H  -18.522  -0.316   2.916 1.00 . A A . 696 ASP H    1 1 
        6  7918 1 1 40 ASP HA   H  -19.499   2.362   3.337 1.00 . A A . 696 ASP HA   1 1 
        6  7919 1 1 40 ASP HB2  H  -17.689   1.262   4.710 1.00 . A A . 696 ASP HB2  1 1 
        6  7920 1 1 40 ASP HB3  H  -16.614   1.440   3.325 1.00 . A A . 696 ASP HB3  1 1 
        6  7921 1 1 40 ASP N    N  -19.137   0.417   2.704 1.00 . A A . 696 ASP N    1 1 
        6  7922 1 1 40 ASP O    O  -18.692   3.620   1.285 1.00 . A A . 696 ASP O    1 1 
        6  7923 1 1 40 ASP OD1  O  -17.824   3.789   5.186 1.00 . A A . 696 ASP OD1  1 1 
        6  7924 1 1 40 ASP OD2  O  -16.207   3.888   3.716 1.00 . A A . 696 ASP OD2  1 1 
        6  7925 1 1 41 GLY C    C  -15.693   2.235  -0.804 1.00 . A A . 697 GLY C    1 1 
        6  7926 1 1 41 GLY CA   C  -17.208   2.263  -0.615 1.00 . A A . 697 GLY CA   1 1 
        6  7927 1 1 41 GLY H    H  -17.407   0.808   0.918 1.00 . A A . 697 GLY H    1 1 
        6  7928 1 1 41 GLY HA2  H  -17.665   1.675  -1.395 1.00 . A A . 697 GLY HA2  1 1 
        6  7929 1 1 41 GLY HA3  H  -17.551   3.286  -0.706 1.00 . A A . 697 GLY HA3  1 1 
        6  7930 1 1 41 GLY N    N  -17.632   1.732   0.679 1.00 . A A . 697 GLY N    1 1 
        6  7931 1 1 41 GLY O    O  -15.026   1.269  -0.420 1.00 . A A . 697 GLY O    1 1 
        6  7932 1 1 42 ASP C    C  -12.959   3.643  -0.299 1.00 . A A . 698 ASP C    1 1 
        6  7933 1 1 42 ASP CA   C  -13.703   3.397  -1.619 1.00 . A A . 698 ASP CA   1 1 
        6  7934 1 1 42 ASP CB   C  -13.396   4.525  -2.612 1.00 . A A . 698 ASP CB   1 1