NMR Restraints Grid

Result table
 (Save to zip file containing files for each block)

image mrblock_id pdb_id bmrb_id cing stage program type subtype item_count
480706 2l1p 17092 cing 4-filtered-FRED STAR entry full 919


data_FRED_restraints_with_modified_coordinates_PDB_code_2l1p

# This FRED archive file contains, for PDB entry <2l1p>:
# 
# - Coordinates and sequence information from the PDB mmCIF file
# - NMR restraints from the PDB MR file
# 
# In this file, the coordinates and NMR restraints share the same atom names,
# and in this way can differ from the data deposited at the wwPDB. To achieve
# this aim, the NMR restraints were parsed from their original format files, and
# the coordinates and NMR restraints information were subsequently harmonized.
# 
# Due to the complexity of this harmonization process and the filtering process
# used in creating these files, the NMR restraints information in these files
# may differ significantly from that in the originally deposited file. Other 
# modifications could have occurred to the NMR restraints information, or data 
# could have been lost because of parsing or conversion errors. The PDB file 
# remains the authoritative reference for the atomic coordinates and the 
# originally deposited restraints files remain the primary reference for these 
# data.
# 
# This file is generated at the BioMagResBank (BMRB) in collaboration with the 
# PDBe (formerly MSD) group at the European Bioinformatics Institute (EBI) and 
# the CMBI/IMM group at the Radboud University of Nijmegen.
# 
# Several software packages were used to produce this file:
# 
# - Wattos (BMRB and CMBI/IMM).
# - FormatConverter and NMRStarExport (PDBe).
# - CCPN framework (http://www.ccpn.ac.uk/).
# 
# More information about this process can be found in the references below.
# Please cite the original reference for this PDB entry.
# 
# JF Doreleijers, A Nederveen, W Vranken, J Lin, AM Bonvin, R Kaptein, JL
# Markley, and EL Ulrich (2005). BioMagResBank databases DOCR and FRED
# containing converted and filtered sets of experimental NMR restraints and
# coordinates from over 500 protein PDB structures. J. Biomol. NMR 32, 1-12.
# 
# WF Vranken, W Boucher, TJ Stevens, RH Fogh, A Pajon, M Llinas, EL Ulrich, JL
# Markley, J Ionides, ED Laue (2005). The CCPN data model for NMR spectroscopy:
# development of a software pipeline. Proteins 59, 687-696. 
# 
# JF Doreleijers, WF Vranken, C Schulte, J Lin, JR Wedell, CJ Penkett, GW Vuister, 
# G Vriend, JL Markley, and EL Ulrich (2009). The NMR Restraints Grid at BMRB for 
# 5,266 Protein and Nucleic Acid PDB Entries. J Biomol. NMR 45, 389?396.




save_Conversion_project_for_entry_Name_1
    _Study_list.Sf_category  study_list
    _Study_list.Entry_ID     1
    _Study_list.ID           1

    loop_
       _Study.ID
       _Study.Name
       _Study.Type
       _Study.Details
       _Study.Entry_ID
       _Study.Study_list_ID

       1 "Conversion project for entry 1" NMR . 1 1 
    stop_

save_


save_originalConstraints_1
    _Entry.PDB_coordinate_file_version  .
    _Entry.Sf_category                  entry_information
    _Entry.ID                           1
    _Entry.Title                        "Data for entry 1"
    _Entry.NMR_STAR_version             3.1.0.8
    _Entry.Experimental_method          NMR
    _Entry.Details                      .

save_


save_assembly_2l1p
    _Assembly.Sf_category           assembly
    _Assembly.Entry_ID              1
    _Assembly.ID                    1
    _Assembly.Name                  2l1p
    _Assembly.Number_of_components  1
    _Assembly.Organic_ligands       .
    _Assembly.Metal_ions            .
    _Assembly.Paramagnetic          .
    _Assembly.Thiol_state           "all free"
    _Assembly.Molecular_mass        9693.08

    loop_
       _Entity_assembly.ID
       _Entity_assembly.Entity_assembly_name
       _Entity_assembly.Entity_ID
       _Entity_assembly.Entity_label
       _Entity_assembly.Asym_ID
       _Entity_assembly.Details
       _Entity_assembly.Entry_ID
       _Entity_assembly.Assembly_ID

       1 . 1 $DNA_binding_protein_SATB1 A . 1 1 
    stop_

save_


save_DNA_binding_protein_SATB1
    _Entity.Sf_category                  entity
    _Entity.Entry_ID                     1
    _Entity.ID                           1
    _Entity.Name                         "DNA binding protein SATB1"
    _Entity.Type                         polymer
    _Entity.Polymer_type                 polypeptide(L)
    _Entity.Polymer_seq_one_letter_code  MGHHHHHHSHMLPPEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWYKHFKKTKDMM
    _Entity.Number_of_monomers           83

    loop_
       _Entity_comp_index.ID
       _Entity_comp_index.Comp_ID
       _Entity_comp_index.Comp_label
       _Entity_comp_index.Entry_ID
       _Entity_comp_index.Entity_ID

        1 MET . 1 1 
        2 GLY . 1 1 
        3 HIS . 1 1 
        4 HIS . 1 1 
        5 HIS . 1 1 
        6 HIS . 1 1 
        7 HIS . 1 1 
        8 HIS . 1 1 
        9 SER . 1 1 
       10 HIS . 1 1 
       11 MET . 1 1 
       12 LEU . 1 1 
       13 PRO . 1 1 
       14 PRO . 1 1 
       15 GLU . 1 1 
       16 GLN . 1 1 
       17 TRP . 1 1 
       18 SER . 1 1 
       19 HIS . 1 1 
       20 THR . 1 1 
       21 THR . 1 1 
       22 VAL . 1 1 
       23 ARG . 1 1 
       24 ASN . 1 1 
       25 ALA . 1 1 
       26 LEU . 1 1 
       27 LYS . 1 1 
       28 ASP . 1 1 
       29 LEU . 1 1 
       30 LEU . 1 1 
       31 LYS . 1 1 
       32 ASP . 1 1 
       33 MET . 1 1 
       34 ASN . 1 1 
       35 GLN . 1 1 
       36 SER . 1 1 
       37 SER . 1 1 
       38 LEU . 1 1 
       39 ALA . 1 1 
       40 LYS . 1 1 
       41 GLU . 1 1 
       42 CYS . 1 1 
       43 PRO . 1 1 
       44 LEU . 1 1 
       45 SER . 1 1 
       46 GLN . 1 1 
       47 SER . 1 1 
       48 MET . 1 1 
       49 ILE . 1 1 
       50 SER . 1 1 
       51 SER . 1 1 
       52 ILE . 1 1 
       53 VAL . 1 1 
       54 ASN . 1 1 
       55 SER . 1 1 
       56 THR . 1 1 
       57 TYR . 1 1 
       58 TYR . 1 1 
       59 ALA . 1 1 
       60 ASN . 1 1 
       61 VAL . 1 1 
       62 SER . 1 1 
       63 ALA . 1 1 
       64 ALA . 1 1 
       65 LYS . 1 1 
       66 CYS . 1 1 
       67 GLN . 1 1 
       68 GLU . 1 1 
       69 PHE . 1 1 
       70 GLY . 1 1 
       71 ARG . 1 1 
       72 TRP . 1 1 
       73 TYR . 1 1 
       74 LYS . 1 1 
       75 HIS . 1 1 
       76 PHE . 1 1 
       77 LYS . 1 1 
       78 LYS . 1 1 
       79 THR . 1 1 
       80 LYS . 1 1 
       81 ASP . 1 1 
       82 MET . 1 1 
       83 MET . 1 1 
    stop_

    loop_
       _Entity_poly_seq.Mon_ID
       _Entity_poly_seq.Num
       _Entity_poly_seq.Comp_index_ID
       _Entity_poly_seq.Entry_ID
       _Entity_poly_seq.Entity_ID

       MET  1  1 1 1 
       GLY  2  2 1 1 
       HIS  3  3 1 1 
       HIS  4  4 1 1 
       HIS  5  5 1 1 
       HIS  6  6 1 1 
       HIS  7  7 1 1 
       HIS  8  8 1 1 
       SER  9  9 1 1 
       HIS 10 10 1 1 
       MET 11 11 1 1 
       LEU 12 12 1 1 
       PRO 13 13 1 1 
       PRO 14 14 1 1 
       GLU 15 15 1 1 
       GLN 16 16 1 1 
       TRP 17 17 1 1 
       SER 18 18 1 1 
       HIS 19 19 1 1 
       THR 20 20 1 1 
       THR 21 21 1 1 
       VAL 22 22 1 1 
       ARG 23 23 1 1 
       ASN 24 24 1 1 
       ALA 25 25 1 1 
       LEU 26 26 1 1 
       LYS 27 27 1 1 
       ASP 28 28 1 1 
       LEU 29 29 1 1 
       LEU 30 30 1 1 
       LYS 31 31 1 1 
       ASP 32 32 1 1 
       MET 33 33 1 1 
       ASN 34 34 1 1 
       GLN 35 35 1 1 
       SER 36 36 1 1 
       SER 37 37 1 1 
       LEU 38 38 1 1 
       ALA 39 39 1 1 
       LYS 40 40 1 1 
       GLU 41 41 1 1 
       CYS 42 42 1 1 
       PRO 43 43 1 1 
       LEU 44 44 1 1 
       SER 45 45 1 1 
       GLN 46 46 1 1 
       SER 47 47 1 1 
       MET 48 48 1 1 
       ILE 49 49 1 1 
       SER 50 50 1 1 
       SER 51 51 1 1 
       ILE 52 52 1 1 
       VAL 53 53 1 1 
       ASN 54 54 1 1 
       SER 55 55 1 1 
       THR 56 56 1 1 
       TYR 57 57 1 1 
       TYR 58 58 1 1 
       ALA 59 59 1 1 
       ASN 60 60 1 1 
       VAL 61 61 1 1 
       SER 62 62 1 1 
       ALA 63 63 1 1 
       ALA 64 64 1 1 
       LYS 65 65 1 1 
       CYS 66 66 1 1 
       GLN 67 67 1 1 
       GLU 68 68 1 1 
       PHE 69 69 1 1 
       GLY 70 70 1 1 
       ARG 71 71 1 1 
       TRP 72 72 1 1 
       TYR 73 73 1 1 
       LYS 74 74 1 1 
       HIS 75 75 1 1 
       PHE 76 76 1 1 
       LYS 77 77 1 1 
       LYS 78 78 1 1 
       THR 79 79 1 1 
       LYS 80 80 1 1 
       ASP 81 81 1 1 
       MET 82 82 1 1 
       MET 83 83 1 1 
    stop_

save_


save_CNS/XPLOR_distance_constraints_2_1
    _Distance_constraint_list.Sf_category         distance_constraints
    _Distance_constraint_list.Entry_ID            1
    _Distance_constraint_list.ID                  1
    _Distance_constraint_list.Constraint_type     NOE
    _Distance_constraint_list.Constraint_file_ID  .
    _Distance_constraint_list.Block_ID            .

    loop_
       _Dist_constraint_tree.Constraint_ID
       _Dist_constraint_tree.Node_ID
       _Dist_constraint_tree.Down_node_ID
       _Dist_constraint_tree.Right_node_ID
       _Dist_constraint_tree.Logic_operation
       _Dist_constraint_tree.Entry_ID
       _Dist_constraint_tree.Distance_constraint_list_ID

         1 1 . . . 1 1 
         2 1 . . . 1 1 
         3 1 . . . 1 1 
         4 1 . . . 1 1 
         5 1 . . . 1 1 
         6 1 . . . 1 1 
         7 1 . . . 1 1 
         8 1 . . . 1 1 
         9 1 . . . 1 1 
        10 1 . . . 1 1 
        11 1 . . . 1 1 
        12 1 . . . 1 1 
        13 1 . . . 1 1 
        14 1 . . . 1 1 
        15 1 . . . 1 1 
        16 1 . . . 1 1 
        17 1 . . . 1 1 
        18 1 . . . 1 1 
        19 1 . . . 1 1 
        20 1 . . . 1 1 
        21 1 . . . 1 1 
        22 1 . . . 1 1 
        23 1 . . . 1 1 
        24 1 . . . 1 1 
        25 1 . . . 1 1 
        26 1 . . . 1 1 
        27 1 . . . 1 1 
        28 1 . . . 1 1 
        29 1 . . . 1 1 
        30 1 . . . 1 1 
        31 1 . . . 1 1 
        32 1 . . . 1 1 
        33 1 . . . 1 1 
        34 1 . . . 1 1 
        35 1 . . . 1 1 
        36 1 . . . 1 1 
        37 1 . . . 1 1 
        38 1 . . . 1 1 
        39 1 . . . 1 1 
        40 1 . . . 1 1 
        41 1 . . . 1 1 
        42 1 . . . 1 1 
        43 1 . . . 1 1 
        44 1 . . . 1 1 
        45 1 . . . 1 1 
        46 1 . . . 1 1 
        47 1 . . . 1 1 
        48 1 . . . 1 1 
        49 1 . . . 1 1 
        50 1 . . . 1 1 
        51 1 . . . 1 1 
        52 1 . . . 1 1 
        53 1 . . . 1 1 
        54 1 . . . 1 1 
        55 1 . . . 1 1 
        56 1 . . . 1 1 
        57 1 . . . 1 1 
        58 1 . . . 1 1 
        59 1 . . . 1 1 
        60 1 . . . 1 1 
        61 1 . . . 1 1 
        62 1 . . . 1 1 
        63 1 . . . 1 1 
        64 1 . . . 1 1 
        65 1 . . . 1 1 
        66 1 . . . 1 1 
        67 1 . . . 1 1 
        68 1 . . . 1 1 
        69 1 . . . 1 1 
        70 1 . . . 1 1 
        71 1 . . . 1 1 
        72 1 . . . 1 1 
        73 1 . . . 1 1 
        74 1 . . . 1 1 
        75 1 . . . 1 1 
        76 1 . . . 1 1 
        77 1 . . . 1 1 
        78 1 . . . 1 1 
        79 1 . . . 1 1 
        80 1 . . . 1 1 
        81 1 . . . 1 1 
        82 1 . . . 1 1 
        83 1 . . . 1 1 
        84 1 . . . 1 1 
        85 1 . . . 1 1 
        86 1 . . . 1 1 
        87 1 . . . 1 1 
        88 1 . . . 1 1 
        89 1 . . . 1 1 
        90 1 . . . 1 1 
        91 1 . . . 1 1 
        92 1 . . . 1 1 
        93 1 . . . 1 1 
        94 1 . . . 1 1 
        95 1 . . . 1 1 
        96 1 . . . 1 1 
        97 1 . . . 1 1 
        98 1 . . . 1 1 
        99 1 . . . 1 1 
       100 1 . . . 1 1 
       101 1 . . . 1 1 
       102 1 . . . 1 1 
       103 1 . . . 1 1 
       104 1 . . . 1 1 
       105 1 . . . 1 1 
       106 1 . . . 1 1 
       107 1 . . . 1 1 
       108 1 . . . 1 1 
       109 1 . . . 1 1 
       110 1 . . . 1 1 
       111 1 . . . 1 1 
       112 1 . . . 1 1 
       113 1 . . . 1 1 
       114 1 . . . 1 1 
       115 1 . . . 1 1 
       116 1 . . . 1 1 
       117 1 . . . 1 1 
       118 1 . . . 1 1 
       119 1 . . . 1 1 
       120 1 . . . 1 1 
       121 1 . . . 1 1 
       122 1 . . . 1 1 
       123 1 . . . 1 1 
       124 1 . . . 1 1 
       125 1 . . . 1 1 
       126 1 . . . 1 1 
       127 1 . . . 1 1 
       128 1 . . . 1 1 
       129 1 . . . 1 1 
       130 1 . . . 1 1 
       131 1 . . . 1 1 
       132 1 . . . 1 1 
       133 1 . . . 1 1 
       134 1 . . . 1 1 
       135 1 . . . 1 1 
       136 1 . . . 1 1 
       137 1 . . . 1 1 
       138 1 . . . 1 1 
       139 1 . . . 1 1 
       140 1 . . . 1 1 
       141 1 . . . 1 1 
       142 1 . . . 1 1 
       143 1 . . . 1 1 
       144 1 . . . 1 1 
       145 1 . . . 1 1 
       146 1 . . . 1 1 
       147 1 . . . 1 1 
       148 1 . . . 1 1 
       149 1 . . . 1 1 
       150 1 . . . 1 1 
       151 1 . . . 1 1 
       152 1 . . . 1 1 
       153 1 . . . 1 1 
       154 1 . . . 1 1 
       155 1 . . . 1 1 
       156 1 . . . 1 1 
       157 1 . . . 1 1 
       158 1 . . . 1 1 
       159 1 . . . 1 1 
       160 1 . . . 1 1 
       161 1 . . . 1 1 
       162 1 . . . 1 1 
       163 1 . . . 1 1 
       164 1 . . . 1 1 
       165 1 . . . 1 1 
       166 1 . . . 1 1 
       167 1 . . . 1 1 
       168 1 . . . 1 1 
       169 1 . . . 1 1 
       170 1 . . . 1 1 
       171 1 . . . 1 1 
       172 1 . . . 1 1 
       173 1 . . . 1 1 
       174 1 . . . 1 1 
       175 1 . . . 1 1 
       176 1 . . . 1 1 
       177 1 . . . 1 1 
       178 1 . . . 1 1 
       179 1 . . . 1 1 
       180 1 . . . 1 1 
       181 1 . . . 1 1 
       182 1 . . . 1 1 
       183 1 . . . 1 1 
       184 1 . . . 1 1 
       185 1 . . . 1 1 
       186 1 . . . 1 1 
       187 1 . . . 1 1 
       188 1 . . . 1 1 
       189 1 . . . 1 1 
       190 1 . . . 1 1 
       191 1 . . . 1 1 
       192 1 . . . 1 1 
       193 1 . . . 1 1 
       194 1 . . . 1 1 
       195 1 . . . 1 1 
       196 1 . . . 1 1 
       197 1 . . . 1 1 
       198 1 . . . 1 1 
       199 1 . . . 1 1 
       200 1 . . . 1 1 
       201 1 . . . 1 1 
       202 1 . . . 1 1 
       203 1 . . . 1 1 
       204 1 . . . 1 1 
       205 1 . . . 1 1 
       206 1 . . . 1 1 
       207 1 . . . 1 1 
       208 1 . . . 1 1 
       209 1 . . . 1 1 
       210 1 . . . 1 1 
       211 1 . . . 1 1 
       212 1 . . . 1 1 
       213 1 . . . 1 1 
       214 1 . . . 1 1 
       215 1 . . . 1 1 
       216 1 . . . 1 1 
       217 1 . . . 1 1 
       218 1 . . . 1 1 
       219 1 . . . 1 1 
       220 1 . . . 1 1 
       221 1 . . . 1 1 
       222 1 . . . 1 1 
       223 1 . . . 1 1 
       224 1 . . . 1 1 
       225 1 . . . 1 1 
       226 1 . . . 1 1 
       227 1 . . . 1 1 
       228 1 . . . 1 1 
       229 1 . . . 1 1 
       230 1 . . . 1 1 
       231 1 . . . 1 1 
       232 1 . . . 1 1 
       233 1 . . . 1 1 
       234 1 . . . 1 1 
       235 1 . . . 1 1 
       236 1 . . . 1 1 
       237 1 . . . 1 1 
       238 1 . . . 1 1 
       239 1 . . . 1 1 
       240 1 . . . 1 1 
       241 1 . . . 1 1 
       242 1 . . . 1 1 
       243 1 . . . 1 1 
       244 1 . . . 1 1 
       245 1 . . . 1 1 
       246 1 . . . 1 1 
       247 1 . . . 1 1 
       248 1 . . . 1 1 
       249 1 . . . 1 1 
       250 1 . . . 1 1 
       251 1 . . . 1 1 
       252 1 . . . 1 1 
       253 1 . . . 1 1 
       254 1 . . . 1 1 
       255 1 . . . 1 1 
       256 1 . . . 1 1 
       257 1 . . . 1 1 
       258 1 . . . 1 1 
       259 1 . . . 1 1 
       260 1 . . . 1 1 
       261 1 . . . 1 1 
       262 1 . . . 1 1 
       263 1 . . . 1 1 
       264 1 . . . 1 1 
       265 1 . . . 1 1 
       266 1 . . . 1 1 
       267 1 . . . 1 1 
       268 1 . . . 1 1 
       269 1 . . . 1 1 
       270 1 . . . 1 1 
       271 1 . . . 1 1 
       272 1 . . . 1 1 
       273 1 . . . 1 1 
       274 1 . . . 1 1 
       275 1 . . . 1 1 
       276 1 . . . 1 1 
       277 1 . . . 1 1 
       278 1 . . . 1 1 
       279 1 . . . 1 1 
       280 1 . . . 1 1 
       281 1 . . . 1 1 
       282 1 . . . 1 1 
       283 1 . . . 1 1 
       284 1 . . . 1 1 
       285 1 . . . 1 1 
       286 1 . . . 1 1 
       287 1 . . . 1 1 
       288 1 . . . 1 1 
       289 1 . . . 1 1 
       290 1 . . . 1 1 
       291 1 . . . 1 1 
       292 1 . . . 1 1 
       293 1 . . . 1 1 
       294 1 . . . 1 1 
       295 1 . . . 1 1 
       296 1 . . . 1 1 
       297 1 . . . 1 1 
       298 1 . . . 1 1 
       299 1 . . . 1 1 
       300 1 . . . 1 1 
       301 1 . . . 1 1 
       302 1 . . . 1 1 
       303 1 . . . 1 1 
       304 1 . . . 1 1 
       305 1 . . . 1 1 
       306 1 . . . 1 1 
       307 1 . . . 1 1 
       308 1 . . . 1 1 
       309 1 . . . 1 1 
       310 1 . . . 1 1 
       311 1 . . . 1 1 
       312 1 . . . 1 1 
       313 1 . . . 1 1 
       314 1 . . . 1 1 
       315 1 . . . 1 1 
       316 1 . . . 1 1 
       317 1 . . . 1 1 
       318 1 . . . 1 1 
       319 1 . . . 1 1 
       320 1 . . . 1 1 
       321 1 . . . 1 1 
       322 1 . . . 1 1 
       323 1 . . . 1 1 
       324 1 . . . 1 1 
       325 1 . . . 1 1 
       326 1 . . . 1 1 
       327 1 . . . 1 1 
       328 1 . . . 1 1 
       329 1 . . . 1 1 
       330 1 . . . 1 1 
       331 1 . . . 1 1 
       332 1 . . . 1 1 
       333 1 . . . 1 1 
       334 1 . . . 1 1 
       335 1 . . . 1 1 
       336 1 . . . 1 1 
       337 1 . . . 1 1 
       338 1 . . . 1 1 
       339 1 . . . 1 1 
       340 1 . . . 1 1 
       341 1 . . . 1 1 
       342 1 . . . 1 1 
       343 1 . . . 1 1 
       344 1 . . . 1 1 
       345 1 . . . 1 1 
       346 1 . . . 1 1 
       347 1 . . . 1 1 
       348 1 . . . 1 1 
       349 1 . . . 1 1 
       350 1 . . . 1 1 
       351 1 . . . 1 1 
       352 1 . . . 1 1 
       353 1 . . . 1 1 
       354 1 . . . 1 1 
       355 1 . . . 1 1 
       356 1 . . . 1 1 
       357 1 . . . 1 1 
       358 1 . . . 1 1 
       359 1 . . . 1 1 
       360 1 . . . 1 1 
       361 1 . . . 1 1 
       362 1 . . . 1 1 
       363 1 . . . 1 1 
       364 1 . . . 1 1 
       365 1 . . . 1 1 
       366 1 . . . 1 1 
       367 1 . . . 1 1 
       368 1 . . . 1 1 
       369 1 . . . 1 1 
       370 1 . . . 1 1 
       371 1 . . . 1 1 
       372 1 . . . 1 1 
       373 1 . . . 1 1 
       374 1 . . . 1 1 
       375 1 . . . 1 1 
       376 1 . . . 1 1 
       377 1 . . . 1 1 
       378 1 . . . 1 1 
       379 1 . . . 1 1 
       380 1 . . . 1 1 
       381 1 . . . 1 1 
       382 1 . . . 1 1 
       383 1 . . . 1 1 
       384 1 . . . 1 1 
       385 1 . . . 1 1 
       386 1 . . . 1 1 
       387 1 . . . 1 1 
       388 1 . . . 1 1 
       389 1 . . . 1 1 
       390 1 . . . 1 1 
       391 1 . . . 1 1 
       392 1 . . . 1 1 
       393 1 . . . 1 1 
       394 1 . . . 1 1 
       395 1 . . . 1 1 
       396 1 . . . 1 1 
       397 1 . . . 1 1 
       398 1 . . . 1 1 
       399 1 . . . 1 1 
       400 1 . . . 1 1 
       401 1 . . . 1 1 
       402 1 . . . 1 1 
       403 1 . . . 1 1 
       404 1 . . . 1 1 
       405 1 . . . 1 1 
       406 1 . . . 1 1 
       407 1 . . . 1 1 
       408 1 . . . 1 1 
       409 1 . . . 1 1 
       410 1 . . . 1 1 
       411 1 . . . 1 1 
       412 1 . . . 1 1 
       413 1 . . . 1 1 
       414 1 . . . 1 1 
       415 1 . . . 1 1 
       416 1 . . . 1 1 
       417 1 . . . 1 1 
       418 1 . . . 1 1 
       419 1 . . . 1 1 
       420 1 . . . 1 1 
       421 1 . . . 1 1 
       422 1 . . . 1 1 
       423 1 . . . 1 1 
       424 1 . . . 1 1 
       425 1 . . . 1 1 
       426 1 . . . 1 1 
       427 1 . . . 1 1 
       428 1 . . . 1 1 
       429 1 . . . 1 1 
       430 1 . . . 1 1 
       431 1 . . . 1 1 
       432 1 . . . 1 1 
       433 1 . . . 1 1 
       434 1 . . . 1 1 
       435 1 . . . 1 1 
       436 1 . . . 1 1 
       437 1 . . . 1 1 
       438 1 . . . 1 1 
       439 1 . . . 1 1 
       440 1 . . . 1 1 
       441 1 . . . 1 1 
       442 1 . . . 1 1 
       443 1 . . . 1 1 
       444 1 . . . 1 1 
       445 1 . . . 1 1 
       446 1 . . . 1 1 
       447 1 . . . 1 1 
       448 1 . . . 1 1 
       449 1 . . . 1 1 
       450 1 . . . 1 1 
       451 1 . . . 1 1 
       452 1 . . . 1 1 
       453 1 . . . 1 1 
       454 1 . . . 1 1 
       455 1 . . . 1 1 
       456 1 . . . 1 1 
       457 1 . . . 1 1 
       458 1 . . . 1 1 
       459 1 . . . 1 1 
       460 1 . . . 1 1 
       461 1 . . . 1 1 
       462 1 . . . 1 1 
       463 1 . . . 1 1 
       464 1 . . . 1 1 
       465 1 . . . 1 1 
       466 1 . . . 1 1 
       467 1 . . . 1 1 
       468 1 . . . 1 1 
       469 1 . . . 1 1 
       470 1 . . . 1 1 
       471 1 . . . 1 1 
       472 1 . . . 1 1 
       473 1 . . . 1 1 
       474 1 . . . 1 1 
       475 1 . . . 1 1 
       476 1 . . . 1 1 
       477 1 . . . 1 1 
       478 1 . . . 1 1 
       479 1 . . . 1 1 
       480 1 . . . 1 1 
       481 1 . . . 1 1 
       482 1 . . . 1 1 
       483 1 . . . 1 1 
       484 1 . . . 1 1 
       485 1 . . . 1 1 
       486 1 . . . 1 1 
       487 1 . . . 1 1 
       488 1 . . . 1 1 
       489 1 . . . 1 1 
       490 1 . . . 1 1 
       491 1 . . . 1 1 
       492 1 . . . 1 1 
       493 1 . . . 1 1 
       494 1 . . . 1 1 
       495 1 . . . 1 1 
       496 1 . . . 1 1 
       497 1 . . . 1 1 
       498 1 . . . 1 1 
       499 1 . . . 1 1 
       500 1 . . . 1 1 
       501 1 . . . 1 1 
       502 1 . . . 1 1 
       503 1 . . . 1 1 
       504 1 . . . 1 1 
       505 1 . . . 1 1 
       506 1 . . . 1 1 
       507 1 . . . 1 1 
       508 1 . . . 1 1 
       509 1 . . . 1 1 
       510 1 . . . 1 1 
       511 1 . . . 1 1 
       512 1 . . . 1 1 
       513 1 . . . 1 1 
       514 1 . . . 1 1 
       515 1 . . . 1 1 
       516 1 . . . 1 1 
       517 1 . . . 1 1 
       518 1 . . . 1 1 
       519 1 . . . 1 1 
       520 1 . . . 1 1 
       521 1 . . . 1 1 
       522 1 . . . 1 1 
       523 1 . . . 1 1 
       524 1 . . . 1 1 
       525 1 . . . 1 1 
       526 1 . . . 1 1 
       527 1 . . . 1 1 
       528 1 . . . 1 1 
       529 1 . . . 1 1 
       530 1 . . . 1 1 
       531 1 . . . 1 1 
       532 1 . . . 1 1 
       533 1 . . . 1 1 
       534 1 . . . 1 1 
       535 1 . . . 1 1 
       536 1 . . . 1 1 
       537 1 . . . 1 1 
       538 1 . . . 1 1 
       539 1 . . . 1 1 
       540 1 . . . 1 1 
       541 1 . . . 1 1 
       542 1 . . . 1 1 
       543 1 . . . 1 1 
       544 1 . . . 1 1 
       545 1 . . . 1 1 
       546 1 . . . 1 1 
       547 1 . . . 1 1 
       548 1 . . . 1 1 
       549 1 . . . 1 1 
       550 1 . . . 1 1 
       551 1 . . . 1 1 
       552 1 . . . 1 1 
       553 1 . . . 1 1 
       554 1 . . . 1 1 
       555 1 . . . 1 1 
       556 1 . . . 1 1 
       557 1 . . . 1 1 
       558 1 . . . 1 1 
       559 1 . . . 1 1 
       560 1 . . . 1 1 
       561 1 . . . 1 1 
       562 1 . . . 1 1 
       563 1 . . . 1 1 
       564 1 . . . 1 1 
       565 1 . . . 1 1 
       566 1 . . . 1 1 
       567 1 . . . 1 1 
       568 1 . . . 1 1 
       569 1 . . . 1 1 
       570 1 . . . 1 1 
       571 1 . . . 1 1 
       572 1 . . . 1 1 
       573 1 . . . 1 1 
       574 1 . . . 1 1 
       575 1 . . . 1 1 
       576 1 . . . 1 1 
       577 1 . . . 1 1 
       578 1 . . . 1 1 
       579 1 . . . 1 1 
       580 1 . . . 1 1 
       581 1 . . . 1 1 
       582 1 . . . 1 1 
       583 1 . . . 1 1 
       584 1 . . . 1 1 
       585 1 . . . 1 1 
       586 1 . . . 1 1 
       587 1 . . . 1 1 
       588 1 . . . 1 1 
       589 1 . . . 1 1 
       590 1 . . . 1 1 
       591 1 . . . 1 1 
       592 1 . . . 1 1 
       593 1 . . . 1 1 
       594 1 . . . 1 1 
       595 1 . . . 1 1 
       596 1 . . . 1 1 
       597 1 . . . 1 1 
       598 1 . . . 1 1 
       599 1 . . . 1 1 
       600 1 . . . 1 1 
       601 1 . . . 1 1 
       602 1 . . . 1 1 
       603 1 . . . 1 1 
       604 1 . . . 1 1 
       605 1 . . . 1 1 
       606 1 . . . 1 1 
       607 1 . . . 1 1 
       608 1 . . . 1 1 
       609 1 . . . 1 1 
       610 1 . . . 1 1 
       611 1 . . . 1 1 
       612 1 . . . 1 1 
       613 1 . . . 1 1 
       614 1 . . . 1 1 
       615 1 . . . 1 1 
       616 1 . . . 1 1 
       617 1 . . . 1 1 
       618 1 . . . 1 1 
       619 1 . . . 1 1 
       620 1 . . . 1 1 
       621 1 . . . 1 1 
       622 1 . . . 1 1 
       623 1 . . . 1 1 
       624 1 . . . 1 1 
       625 1 . . . 1 1 
       626 1 . . . 1 1 
       627 1 . . . 1 1 
       628 1 . . . 1 1 
       629 1 . . . 1 1 
       630 1 . . . 1 1 
       631 1 . . . 1 1 
       632 1 . . . 1 1 
       633 1 . . . 1 1 
       634 1 . . . 1 1 
       635 1 . . . 1 1 
       636 1 . . . 1 1 
       637 1 . . . 1 1 
       638 1 . . . 1 1 
       639 1 . . . 1 1 
       640 1 . . . 1 1 
       641 1 . . . 1 1 
       642 1 . . . 1 1 
       643 1 . . . 1 1 
       644 1 . . . 1 1 
       645 1 . . . 1 1 
       646 1 . . . 1 1 
       647 1 . . . 1 1 
       648 1 . . . 1 1 
       649 1 . . . 1 1 
       650 1 . . . 1 1 
       651 1 . . . 1 1 
       652 1 . . . 1 1 
       653 1 . . . 1 1 
       654 1 . . . 1 1 
       655 1 . . . 1 1 
       656 1 . . . 1 1 
       657 1 . . . 1 1 
       658 1 . . . 1 1 
       659 1 . . . 1 1 
       660 1 . . . 1 1 
       661 1 . . . 1 1 
       662 1 . . . 1 1 
       663 1 . . . 1 1 
       664 1 . . . 1 1 
       665 1 . . . 1 1 
       666 1 . . . 1 1 
       667 1 . . . 1 1 
       668 1 . . . 1 1 
       669 1 . . . 1 1 
       670 1 . . . 1 1 
       671 1 . . . 1 1 
       672 1 . . . 1 1 
       673 1 . . . 1 1 
       674 1 . . . 1 1 
       675 1 . . . 1 1 
       676 1 . . . 1 1 
       677 1 . . . 1 1 
       678 1 . . . 1 1 
       679 1 . . . 1 1 
       680 1 . . . 1 1 
       681 1 . . . 1 1 
       682 1 . . . 1 1 
       683 1 . . . 1 1 
       684 1 . . . 1 1 
       685 1 . . . 1 1 
       686 1 . . . 1 1 
       687 1 . . . 1 1 
       688 1 . . . 1 1 
       689 1 . . . 1 1 
       690 1 . . . 1 1 
       691 1 . . . 1 1 
       692 1 . . . 1 1 
       693 1 . . . 1 1 
       694 1 . . . 1 1 
       695 1 . . . 1 1 
       696 1 . . . 1 1 
       697 1 . . . 1 1 
       698 1 . . . 1 1 
       699 1 . . . 1 1 
       700 1 . . . 1 1 
       701 1 . . . 1 1 
       702 1 . . . 1 1 
       703 1 . . . 1 1 
       704 1 . . . 1 1 
       705 1 . . . 1 1 
       706 1 . . . 1 1 
       707 1 . . . 1 1 
       708 1 . . . 1 1 
       709 1 . . . 1 1 
       710 1 . . . 1 1 
       711 1 . . . 1 1 
       712 1 . . . 1 1 
       713 1 . . . 1 1 
       714 1 . . . 1 1 
       715 1 . . . 1 1 
       716 1 . . . 1 1 
       717 1 . . . 1 1 
       718 1 . . . 1 1 
       719 1 . . . 1 1 
       720 1 . . . 1 1 
       721 1 . . . 1 1 
       722 1 . . . 1 1 
       723 1 . . . 1 1 
       724 1 . . . 1 1 
       725 1 . . . 1 1 
       726 1 . . . 1 1 
       727 1 . . . 1 1 
       728 1 . . . 1 1 
       729 1 . . . 1 1 
       730 1 . . . 1 1 
       731 1 . . . 1 1 
       732 1 . . . 1 1 
       733 1 . . . 1 1 
       734 1 . . . 1 1 
       735 1 . . . 1 1 
       736 1 . . . 1 1 
       737 1 . . . 1 1 
       738 1 . . . 1 1 
       739 1 . . . 1 1 
       740 1 . . . 1 1 
       741 1 . . . 1 1 
       742 1 . . . 1 1 
       743 1 . . . 1 1 
       744 1 . . . 1 1 
       745 1 . . . 1 1 
       746 1 . . . 1 1 
       747 1 . . . 1 1 
       748 1 . . . 1 1 
       749 1 . . . 1 1 
       750 1 . . . 1 1 
       751 1 . . . 1 1 
       752 1 . . . 1 1 
       753 1 . . . 1 1 
       754 1 . . . 1 1 
       755 1 . . . 1 1 
       756 1 . . . 1 1 
       757 1 . . . 1 1 
       758 1 . . . 1 1 
       759 1 . . . 1 1 
       760 1 . . . 1 1 
       761 1 . . . 1 1 
       762 1 . . . 1 1 
       763 1 . . . 1 1 
       764 1 . . . 1 1 
       765 1 . . . 1 1 
       766 1 . . . 1 1 
       767 1 . . . 1 1 
       768 1 . . . 1 1 
       769 1 . . . 1 1 
       770 1 . . . 1 1 
       771 1 . . . 1 1 
       772 1 . . . 1 1 
       773 1 . . . 1 1 
       774 1 . . . 1 1 
       775 1 . . . 1 1 
       776 1 . . . 1 1 
       777 1 . . . 1 1 
       778 1 . . . 1 1 
       779 1 . . . 1 1 
       780 1 . . . 1 1 
       781 1 . . . 1 1 
       782 1 . . . 1 1 
       783 1 . . . 1 1 
       784 1 . . . 1 1 
       785 1 . . . 1 1 
       786 1 . . . 1 1 
       787 1 . . . 1 1 
       788 1 . . . 1 1 
       789 1 . . . 1 1 
       790 1 . . . 1 1 
       791 1 . . . 1 1 
       792 1 . . . 1 1 
       793 1 . . . 1 1 
       794 1 . . . 1 1 
       795 1 . . . 1 1 
       796 1 . . . 1 1 
       797 1 . . . 1 1 
       798 1 . . . 1 1 
       799 1 . . . 1 1 
       800 1 . . . 1 1 
       801 1 . . . 1 1 
       802 1 . . . 1 1 
       803 1 . . . 1 1 
       804 1 . . . 1 1 
       805 1 . . . 1 1 
       806 1 . . . 1 1 
       807 1 . . . 1 1 
       808 1 . . . 1 1 
       809 1 . . . 1 1 
       810 1 . . . 1 1 
       811 1 . . . 1 1 
       812 1 . . . 1 1 
       813 1 . . . 1 1 
       814 1 . . . 1 1 
       815 1 . . . 1 1 
       816 1 . . . 1 1 
       817 1 . . . 1 1 
       818 1 . . . 1 1 
       819 1 . . . 1 1 
       820 1 . . . 1 1 
       821 1 . . . 1 1 
       822 1 . . . 1 1 
       823 1 . . . 1 1 
       824 1 . . . 1 1 
       825 1 . . . 1 1 
       826 1 . . . 1 1 
       827 1 . . . 1 1 
       828 1 . . . 1 1 
       829 1 . . . 1 1 
    stop_

    loop_
       _Dist_constraint.Tree_node_member_constraint_ID
       _Dist_constraint.Tree_node_member_node_ID
       _Dist_constraint.Constraint_tree_node_member_ID
       _Dist_constraint.Entity_assembly_ID
       _Dist_constraint.Entity_ID
       _Dist_constraint.Comp_index_ID
       _Dist_constraint.Comp_ID
       _Dist_constraint.Atom_ID
       _Dist_constraint.Auth_asym_ID
       _Dist_constraint.Auth_seq_ID
       _Dist_constraint.Auth_comp_ID
       _Dist_constraint.Auth_atom_ID
       _Dist_constraint.Entry_ID
       _Dist_constraint.Distance_constraint_list_ID

         1 1 1 1 1 12 LEU H    A 12 . HN   1 1 
         1 1 2 1 1 12 LEU HG   A 12 . HG   1 1 
         2 1 1 1 1 12 LEU HA   A 12 . HA   1 1 
         2 1 2 1 1 77 LYS QD   A 77 . HD*  1 1 
         3 1 1 1 1 12 LEU QB   A 12 . HB*  1 1 
         3 1 2 1 1 77 LYS QD   A 77 . HD*  1 1 
         4 1 1 1 1 12 LEU QD   A 12 . HD*  1 1 
         4 1 2 1 1 13 PRO HD2  A 13 . HD2  1 1 
         5 1 1 1 1 12 LEU QD   A 12 . HD*  1 1 
         5 1 2 1 1 13 PRO HD3  A 13 . HD1  1 1 
         6 1 1 1 1 12 LEU QD   A 12 . HD*  1 1 
         6 1 2 1 1 73 TYR QE   A 73 . HE*  1 1 
         7 1 1 1 1 12 LEU QD   A 12 . HD*  1 1 
         7 1 2 1 1 77 LYS QD   A 77 . HD*  1 1 
         8 1 1 1 1 13 PRO HA   A 13 . HA   1 1 
         8 1 2 1 1 14 PRO HD2  A 14 . HD2  1 1 
         9 1 1 1 1 13 PRO HA   A 13 . HA   1 1 
         9 1 2 1 1 14 PRO HD3  A 14 . HD1  1 1 
        10 1 1 1 1 13 PRO HB2  A 13 . HB2  1 1 
        10 1 2 1 1 14 PRO QD   A 14 . HD*  1 1 
        11 1 1 1 1 13 PRO HB3  A 13 . HB1  1 1 
        11 1 2 1 1 14 PRO QD   A 14 . HD*  1 1 
        12 1 1 1 1 14 PRO HA   A 14 . HA   1 1 
        12 1 2 1 1 15 GLU H    A 15 . HN   1 1 
        13 1 1 1 1 14 PRO HA   A 14 . HA   1 1 
        13 1 2 1 1 16 GLN H    A 16 . HN   1 1 
        14 1 1 1 1 14 PRO HA   A 14 . HA   1 1 
        14 1 2 1 1 17 TRP HE1  A 17 . HE1  1 1 
        15 1 1 1 1 14 PRO QB   A 14 . HB*  1 1 
        15 1 2 1 1 17 TRP HE1  A 17 . HE1  1 1 
        16 1 1 1 1 14 PRO HB2  A 14 . HB2  1 1 
        16 1 2 1 1 15 GLU H    A 15 . HN   1 1 
        17 1 1 1 1 14 PRO HB3  A 14 . HB1  1 1 
        17 1 2 1 1 15 GLU H    A 15 . HN   1 1 
        18 1 1 1 1 15 GLU H    A 15 . HN   1 1 
        18 1 2 1 1 16 GLN H    A 16 . HN   1 1 
        19 1 1 1 1 15 GLU HA   A 15 . HA   1 1 
        19 1 2 1 1 16 GLN H    A 16 . HN   1 1 
        20 1 1 1 1 16 GLN H    A 16 . HN   1 1 
        20 1 2 1 1 17 TRP HE1  A 17 . HE1  1 1 
        21 1 1 1 1 16 GLN HA   A 16 . HA   1 1 
        21 1 2 1 1 17 TRP H    A 17 . HN   1 1 
        22 1 1 1 1 16 GLN HB2  A 16 . HB2  1 1 
        22 1 2 1 1 17 TRP H    A 17 . HN   1 1 
        23 1 1 1 1 16 GLN HB3  A 16 . HB1  1 1 
        23 1 2 1 1 17 TRP H    A 17 . HN   1 1 
        24 1 1 1 1 16 GLN QG   A 16 . HG*  1 1 
        24 1 2 1 1 17 TRP H    A 17 . HN   1 1 
        25 1 1 1 1 17 TRP HA   A 17 . HA   1 1 
        25 1 2 1 1 17 TRP HE3  A 17 . HE3  1 1 
        26 1 1 1 1 17 TRP HA   A 17 . HA   1 1 
        26 1 2 1 1 18 SER H    A 18 . HN   1 1 
        27 1 1 1 1 17 TRP HA   A 17 . HA   1 1 
        27 1 2 1 1 21 THR HB   A 21 . HB   1 1 
        28 1 1 1 1 17 TRP HA   A 17 . HA   1 1 
        28 1 2 1 1 21 THR MG   A 21 . HG2* 1 1 
        29 1 1 1 1 17 TRP QB   A 17 . HB*  1 1 
        29 1 2 1 1 18 SER HA   A 18 . HA   1 1 
        30 1 1 1 1 17 TRP QB   A 17 . HB*  1 1 
        30 1 2 1 1 21 THR HB   A 21 . HB   1 1 
        31 1 1 1 1 17 TRP HB2  A 17 . HB2  1 1 
        31 1 2 1 1 18 SER H    A 18 . HN   1 1 
        32 1 1 1 1 17 TRP HB2  A 17 . HB2  1 1 
        32 1 2 1 1 22 VAL QG   A 22 . HG*  1 1 
        33 1 1 1 1 17 TRP HB3  A 17 . HB1  1 1 
        33 1 2 1 1 18 SER H    A 18 . HN   1 1 
        34 1 1 1 1 17 TRP HB3  A 17 . HB1  1 1 
        34 1 2 1 1 22 VAL QG   A 22 . HG*  1 1 
        35 1 1 1 1 17 TRP HE3  A 17 . HE3  1 1 
        35 1 2 1 1 21 THR HB   A 21 . HB   1 1 
        36 1 1 1 1 17 TRP HE3  A 17 . HE3  1 1 
        36 1 2 1 1 21 THR MG   A 21 . HG2* 1 1 
        37 1 1 1 1 17 TRP HE3  A 17 . HE3  1 1 
        37 1 2 1 1 22 VAL H    A 22 . HN   1 1 
        38 1 1 1 1 17 TRP HE3  A 17 . HE3  1 1 
        38 1 2 1 1 22 VAL HA   A 22 . HA   1 1 
        39 1 1 1 1 17 TRP HE3  A 17 . HE3  1 1 
        39 1 2 1 1 22 VAL MG1  A 22 . HG1* 1 1 
        40 1 1 1 1 17 TRP HE3  A 17 . HE3  1 1 
        40 1 2 1 1 22 VAL MG2  A 22 . HG2* 1 1 
        41 1 1 1 1 17 TRP HE3  A 17 . HE3  1 1 
        41 1 2 1 1 70 GLY QA   A 70 . HA*  1 1 
        42 1 1 1 1 17 TRP HZ2  A 17 . HZ2  1 1 
        42 1 2 1 1 25 ALA MB   A 25 . HB*  1 1 
        43 1 1 1 1 17 TRP HZ2  A 17 . HZ2  1 1 
        43 1 2 1 1 73 TYR QD   A 73 . HD*  1 1 
        44 1 1 1 1 17 TRP HZ3  A 17 . HZ3  1 1 
        44 1 2 1 1 22 VAL HA   A 22 . HA   1 1 
        45 1 1 1 1 17 TRP HZ3  A 17 . HZ3  1 1 
        45 1 2 1 1 22 VAL QG   A 22 . HG*  1 1 
        46 1 1 1 1 17 TRP HZ3  A 17 . HZ3  1 1 
        46 1 2 1 1 25 ALA MB   A 25 . HB*  1 1 
        47 1 1 1 1 17 TRP HZ3  A 17 . HZ3  1 1 
        47 1 2 1 1 69 PHE QE   A 69 . HE*  1 1 
        48 1 1 1 1 18 SER H    A 18 . HN   1 1 
        48 1 2 1 1 21 THR HB   A 21 . HB   1 1 
        49 1 1 1 1 18 SER H    A 18 . HN   1 1 
        49 1 2 1 1 21 THR MG   A 21 . HG2* 1 1 
        50 1 1 1 1 18 SER H    A 18 . HN   1 1 
        50 1 2 1 1 22 VAL QG   A 22 . HG*  1 1 
        51 1 1 1 1 18 SER QB   A 18 . HB*  1 1 
        51 1 2 1 1 21 THR H    A 21 . HN   1 1 
        52 1 1 1 1 18 SER HB2  A 18 . HB2  1 1 
        52 1 2 1 1 20 THR H    A 20 . HN   1 1 
        53 1 1 1 1 18 SER HB3  A 18 . HB1  1 1 
        53 1 2 1 1 20 THR H    A 20 . HN   1 1 
        54 1 1 1 1 19 HIS HA   A 19 . HA   1 1 
        54 1 2 1 1 19 HIS HD2  A 19 . HD2  1 1 
        55 1 1 1 1 19 HIS HA   A 19 . HA   1 1 
        55 1 2 1 1 22 VAL H    A 22 . HN   1 1 
        56 1 1 1 1 19 HIS HA   A 19 . HA   1 1 
        56 1 2 1 1 22 VAL MG2  A 22 . HG2* 1 1 
        57 1 1 1 1 19 HIS QB   A 19 . HB*  1 1 
        57 1 2 1 1 61 VAL QG   A 61 . HG*  1 1 
        58 1 1 1 1 19 HIS HB2  A 19 . HB2  1 1 
        58 1 2 1 1 20 THR H    A 20 . HN   1 1 
        59 1 1 1 1 19 HIS HB3  A 19 . HB1  1 1 
        59 1 2 1 1 20 THR H    A 20 . HN   1 1 
        60 1 1 1 1 19 HIS HD2  A 19 . HD2  1 1 
        60 1 2 1 1 61 VAL QG   A 61 . HG*  1 1 
        61 1 1 1 1 20 THR H    A 20 . HN   1 1 
        61 1 2 1 1 21 THR H    A 21 . HN   1 1 
        62 1 1 1 1 20 THR HA   A 20 . HA   1 1 
        62 1 2 1 1 21 THR H    A 21 . HN   1 1 
        63 1 1 1 1 20 THR HA   A 20 . HA   1 1 
        63 1 2 1 1 23 ARG H    A 23 . HN   1 1 
        64 1 1 1 1 20 THR HA   A 20 . HA   1 1 
        64 1 2 1 1 23 ARG HB2  A 23 . HB2  1 1 
        65 1 1 1 1 20 THR HA   A 20 . HA   1 1 
        65 1 2 1 1 23 ARG HB3  A 23 . HB1  1 1 
        66 1 1 1 1 20 THR HA   A 20 . HA   1 1 
        66 1 2 1 1 24 ASN H    A 24 . HN   1 1 
        67 1 1 1 1 20 THR HB   A 20 . HB   1 1 
        67 1 2 1 1 21 THR H    A 21 . HN   1 1 
        68 1 1 1 1 20 THR MG   A 20 . HG2* 1 1 
        68 1 2 1 1 21 THR H    A 21 . HN   1 1 
        69 1 1 1 1 20 THR MG   A 20 . HG2* 1 1 
        69 1 2 1 1 21 THR HA   A 21 . HA   1 1 
        70 1 1 1 1 20 THR MG   A 20 . HG2* 1 1 
        70 1 2 1 1 23 ARG QD   A 23 . HD*  1 1 
        71 1 1 1 1 20 THR MG   A 20 . HG2* 1 1 
        71 1 2 1 1 24 ASN H    A 24 . HN   1 1 
        72 1 1 1 1 21 THR H    A 21 . HN   1 1 
        72 1 2 1 1 22 VAL H    A 22 . HN   1 1 
        73 1 1 1 1 21 THR H    A 21 . HN   1 1 
        73 1 2 1 1 22 VAL QG   A 22 . HG*  1 1 
        74 1 1 1 1 21 THR HA   A 21 . HA   1 1 
        74 1 2 1 1 24 ASN H    A 24 . HN   1 1 
        75 1 1 1 1 21 THR HA   A 21 . HA   1 1 
        75 1 2 1 1 24 ASN QB   A 24 . HB*  1 1 
        76 1 1 1 1 21 THR HA   A 21 . HA   1 1 
        76 1 2 1 1 25 ALA H    A 25 . HN   1 1 
        77 1 1 1 1 21 THR HB   A 21 . HB   1 1 
        77 1 2 1 1 22 VAL H    A 22 . HN   1 1 
        78 1 1 1 1 21 THR HB   A 21 . HB   1 1 
        78 1 2 1 1 22 VAL QG   A 22 . HG*  1 1 
        79 1 1 1 1 21 THR MG   A 21 . HG2* 1 1 
        79 1 2 1 1 25 ALA MB   A 25 . HB*  1 1 
        80 1 1 1 1 22 VAL H    A 22 . HN   1 1 
        80 1 2 1 1 25 ALA H    A 25 . HN   1 1 
        81 1 1 1 1 22 VAL HA   A 22 . HA   1 1 
        81 1 2 1 1 23 ARG H    A 23 . HN   1 1 
        82 1 1 1 1 22 VAL HA   A 22 . HA   1 1 
        82 1 2 1 1 25 ALA H    A 25 . HN   1 1 
        83 1 1 1 1 22 VAL HA   A 22 . HA   1 1 
        83 1 2 1 1 25 ALA MB   A 25 . HB*  1 1 
        84 1 1 1 1 22 VAL HA   A 22 . HA   1 1 
        84 1 2 1 1 26 LEU H    A 26 . HN   1 1 
        85 1 1 1 1 22 VAL HA   A 22 . HA   1 1 
        85 1 2 1 1 26 LEU QD   A 26 . HD*  1 1 
        86 1 1 1 1 22 VAL HA   A 22 . HA   1 1 
        86 1 2 1 1 69 PHE QE   A 69 . HE*  1 1 
        87 1 1 1 1 22 VAL HB   A 22 . HB   1 1 
        87 1 2 1 1 23 ARG H    A 23 . HN   1 1 
        88 1 1 1 1 22 VAL QG   A 22 . HG*  1 1 
        88 1 2 1 1 23 ARG H    A 23 . HN   1 1 
        89 1 1 1 1 22 VAL QG   A 22 . HG*  1 1 
        89 1 2 1 1 23 ARG HA   A 23 . HA   1 1 
        90 1 1 1 1 22 VAL QG   A 22 . HG*  1 1 
        90 1 2 1 1 23 ARG QB   A 23 . HB*  1 1 
        91 1 1 1 1 22 VAL QG   A 22 . HG*  1 1 
        91 1 2 1 1 26 LEU H    A 26 . HN   1 1 
        92 1 1 1 1 22 VAL QG   A 22 . HG*  1 1 
        92 1 2 1 1 26 LEU MD1  A 26 . HD1* 1 1 
        93 1 1 1 1 22 VAL QG   A 22 . HG*  1 1 
        93 1 2 1 1 26 LEU MD2  A 26 . HD2* 1 1 
        94 1 1 1 1 22 VAL QG   A 22 . HG*  1 1 
        94 1 2 1 1 52 ILE MG   A 52 . HG2* 1 1 
        95 1 1 1 1 22 VAL QG   A 22 . HG*  1 1 
        95 1 2 1 1 61 VAL QG   A 61 . HG*  1 1 
        96 1 1 1 1 22 VAL QG   A 22 . HG*  1 1 
        96 1 2 1 1 65 LYS QD   A 65 . HD*  1 1 
        97 1 1 1 1 22 VAL QG   A 22 . HG*  1 1 
        97 1 2 1 1 66 CYS HB2  A 66 . HB2  1 1 
        98 1 1 1 1 22 VAL QG   A 22 . HG*  1 1 
        98 1 2 1 1 69 PHE HB2  A 69 . HB2  1 1 
        99 1 1 1 1 22 VAL QG   A 22 . HG*  1 1 
        99 1 2 1 1 69 PHE HB3  A 69 . HB1  1 1 
       100 1 1 1 1 22 VAL QG   A 22 . HG*  1 1 
       100 1 2 1 1 69 PHE QE   A 69 . HE*  1 1 
       101 1 1 1 1 22 VAL MG1  A 22 . HG1* 1 1 
       101 1 2 1 1 23 ARG H    A 23 . HN   1 1 
       102 1 1 1 1 22 VAL MG1  A 22 . HG1* 1 1 
       102 1 2 1 1 44 LEU MD1  A 44 . HD1* 1 1 
       103 1 1 1 1 22 VAL MG1  A 22 . HG1* 1 1 
       103 1 2 1 1 52 ILE MD   A 52 . HD1* 1 1 
       104 1 1 1 1 22 VAL MG1  A 22 . HG1* 1 1 
       104 1 2 1 1 69 PHE QD   A 69 . HD*  1 1 
       105 1 1 1 1 22 VAL MG2  A 22 . HG2* 1 1 
       105 1 2 1 1 44 LEU MD1  A 44 . HD1* 1 1 
       106 1 1 1 1 22 VAL MG2  A 22 . HG2* 1 1 
       106 1 2 1 1 66 CYS HA   A 66 . HA   1 1 
       107 1 1 1 1 22 VAL MG2  A 22 . HG2* 1 1 
       107 1 2 1 1 69 PHE QD   A 69 . HD*  1 1 
       108 1 1 1 1 23 ARG H    A 23 . HN   1 1 
       108 1 2 1 1 23 ARG HB3  A 23 . HB1  1 1 
       109 1 1 1 1 23 ARG H    A 23 . HN   1 1 
       109 1 2 1 1 23 ARG QD   A 23 . HD*  1 1 
       110 1 1 1 1 23 ARG H    A 23 . HN   1 1 
       110 1 2 1 1 23 ARG HG2  A 23 . HG2  1 1 
       111 1 1 1 1 23 ARG H    A 23 . HN   1 1 
       111 1 2 1 1 23 ARG HG3  A 23 . HG1  1 1 
       112 1 1 1 1 23 ARG H    A 23 . HN   1 1 
       112 1 2 1 1 24 ASN H    A 24 . HN   1 1 
       113 1 1 1 1 23 ARG H    A 23 . HN   1 1 
       113 1 2 1 1 24 ASN QB   A 24 . HB*  1 1 
       114 1 1 1 1 23 ARG H    A 23 . HN   1 1 
       114 1 2 1 1 26 LEU QD   A 26 . HD*  1 1 
       115 1 1 1 1 23 ARG H    A 23 . HN   1 1 
       115 1 2 1 1 52 ILE MG   A 52 . HG2* 1 1 
       116 1 1 1 1 23 ARG HA   A 23 . HA   1 1 
       116 1 2 1 1 24 ASN H    A 24 . HN   1 1 
       117 1 1 1 1 23 ARG HA   A 23 . HA   1 1 
       117 1 2 1 1 26 LEU H    A 26 . HN   1 1 
       118 1 1 1 1 23 ARG HA   A 23 . HA   1 1 
       118 1 2 1 1 26 LEU HB2  A 26 . HB2  1 1 
       119 1 1 1 1 23 ARG HA   A 23 . HA   1 1 
       119 1 2 1 1 26 LEU HB3  A 26 . HB1  1 1 
       120 1 1 1 1 23 ARG HA   A 23 . HA   1 1 
       120 1 2 1 1 26 LEU MD1  A 26 . HD1* 1 1 
       121 1 1 1 1 23 ARG HA   A 23 . HA   1 1 
       121 1 2 1 1 26 LEU MD2  A 26 . HD2* 1 1 
       122 1 1 1 1 23 ARG HA   A 23 . HA   1 1 
       122 1 2 1 1 27 LYS H    A 27 . HN   1 1 
       123 1 1 1 1 23 ARG HA   A 23 . HA   1 1 
       123 1 2 1 1 52 ILE MG   A 52 . HG2* 1 1 
       124 1 1 1 1 23 ARG QB   A 23 . HB*  1 1 
       124 1 2 1 1 52 ILE MG   A 52 . HG2* 1 1 
       125 1 1 1 1 23 ARG HB2  A 23 . HB2  1 1 
       125 1 2 1 1 24 ASN H    A 24 . HN   1 1 
       126 1 1 1 1 23 ARG HB3  A 23 . HB1  1 1 
       126 1 2 1 1 24 ASN H    A 24 . HN   1 1 
       127 1 1 1 1 23 ARG QD   A 23 . HD*  1 1 
       127 1 2 1 1 52 ILE MG   A 52 . HG2* 1 1 
       128 1 1 1 1 23 ARG QG   A 23 . HG*  1 1 
       128 1 2 1 1 24 ASN H    A 24 . HN   1 1 
       129 1 1 1 1 23 ARG HG2  A 23 . HG2  1 1 
       129 1 2 1 1 52 ILE MG   A 52 . HG2* 1 1 
       130 1 1 1 1 23 ARG HG3  A 23 . HG1  1 1 
       130 1 2 1 1 52 ILE MG   A 52 . HG2* 1 1 
       131 1 1 1 1 24 ASN H    A 24 . HN   1 1 
       131 1 2 1 1 24 ASN QB   A 24 . HB*  1 1 
       132 1 1 1 1 24 ASN H    A 24 . HN   1 1 
       132 1 2 1 1 24 ASN QD   A 24 . HD2* 1 1 
       133 1 1 1 1 24 ASN H    A 24 . HN   1 1 
       133 1 2 1 1 25 ALA H    A 25 . HN   1 1 
       134 1 1 1 1 24 ASN H    A 24 . HN   1 1 
       134 1 2 1 1 25 ALA MB   A 25 . HB*  1 1 
       135 1 1 1 1 24 ASN HA   A 24 . HA   1 1 
       135 1 2 1 1 25 ALA H    A 25 . HN   1 1 
       136 1 1 1 1 24 ASN HA   A 24 . HA   1 1 
       136 1 2 1 1 27 LYS H    A 27 . HN   1 1 
       137 1 1 1 1 24 ASN HA   A 24 . HA   1 1 
       137 1 2 1 1 27 LYS QD   A 27 . HD*  1 1 
       138 1 1 1 1 24 ASN HA   A 24 . HA   1 1 
       138 1 2 1 1 27 LYS HG2  A 27 . HG2  1 1 
       139 1 1 1 1 24 ASN QB   A 24 . HB*  1 1 
       139 1 2 1 1 25 ALA H    A 25 . HN   1 1 
       140 1 1 1 1 25 ALA H    A 25 . HN   1 1 
       140 1 2 1 1 26 LEU H    A 26 . HN   1 1 
       141 1 1 1 1 25 ALA H    A 25 . HN   1 1 
       141 1 2 1 1 26 LEU QB   A 26 . HB*  1 1 
       142 1 1 1 1 25 ALA HA   A 25 . HA   1 1 
       142 1 2 1 1 26 LEU H    A 26 . HN   1 1 
       143 1 1 1 1 25 ALA HA   A 25 . HA   1 1 
       143 1 2 1 1 26 LEU HA   A 26 . HA   1 1 
       144 1 1 1 1 25 ALA HA   A 25 . HA   1 1 
       144 1 2 1 1 28 ASP H    A 28 . HN   1 1 
       145 1 1 1 1 25 ALA HA   A 25 . HA   1 1 
       145 1 2 1 1 28 ASP HB2  A 28 . HB2  1 1 
       146 1 1 1 1 25 ALA HA   A 25 . HA   1 1 
       146 1 2 1 1 29 LEU H    A 29 . HN   1 1 
       147 1 1 1 1 25 ALA MB   A 25 . HB*  1 1 
       147 1 2 1 1 26 LEU H    A 26 . HN   1 1 
       148 1 1 1 1 25 ALA MB   A 25 . HB*  1 1 
       148 1 2 1 1 28 ASP H    A 28 . HN   1 1 
       149 1 1 1 1 25 ALA MB   A 25 . HB*  1 1 
       149 1 2 1 1 69 PHE QE   A 69 . HE*  1 1 
       150 1 1 1 1 25 ALA MB   A 25 . HB*  1 1 
       150 1 2 1 1 69 PHE HZ   A 69 . HZ   1 1 
       151 1 1 1 1 26 LEU H    A 26 . HN   1 1 
       151 1 2 1 1 26 LEU MD1  A 26 . HD1* 1 1 
       152 1 1 1 1 26 LEU H    A 26 . HN   1 1 
       152 1 2 1 1 26 LEU MD2  A 26 . HD2* 1 1 
       153 1 1 1 1 26 LEU H    A 26 . HN   1 1 
       153 1 2 1 1 27 LYS H    A 27 . HN   1 1 
       154 1 1 1 1 26 LEU H    A 26 . HN   1 1 
       154 1 2 1 1 29 LEU H    A 29 . HN   1 1 
       155 1 1 1 1 26 LEU H    A 26 . HN   1 1 
       155 1 2 1 1 29 LEU QB   A 29 . HB*  1 1 
       156 1 1 1 1 26 LEU H    A 26 . HN   1 1 
       156 1 2 1 1 69 PHE QE   A 69 . HE*  1 1 
       157 1 1 1 1 26 LEU HA   A 26 . HA   1 1 
       157 1 2 1 1 27 LYS H    A 27 . HN   1 1 
       158 1 1 1 1 26 LEU HA   A 26 . HA   1 1 
       158 1 2 1 1 28 ASP H    A 28 . HN   1 1 
       159 1 1 1 1 26 LEU HA   A 26 . HA   1 1 
       159 1 2 1 1 29 LEU H    A 29 . HN   1 1 
       160 1 1 1 1 26 LEU HA   A 26 . HA   1 1 
       160 1 2 1 1 29 LEU HB2  A 29 . HB2  1 1 
       161 1 1 1 1 26 LEU HA   A 26 . HA   1 1 
       161 1 2 1 1 29 LEU HB3  A 29 . HB1  1 1 
       162 1 1 1 1 26 LEU HA   A 26 . HA   1 1 
       162 1 2 1 1 29 LEU QD   A 29 . HD*  1 1 
       163 1 1 1 1 26 LEU HA   A 26 . HA   1 1 
       163 1 2 1 1 29 LEU HG   A 29 . HG   1 1 
       164 1 1 1 1 26 LEU HA   A 26 . HA   1 1 
       164 1 2 1 1 30 LEU H    A 30 . HN   1 1 
       165 1 1 1 1 26 LEU HA   A 26 . HA   1 1 
       165 1 2 1 1 38 LEU MD2  A 38 . HD2* 1 1 
       166 1 1 1 1 26 LEU HA   A 26 . HA   1 1 
       166 1 2 1 1 69 PHE QE   A 69 . HE*  1 1 
       167 1 1 1 1 26 LEU QB   A 26 . HB*  1 1 
       167 1 2 1 1 30 LEU QD   A 30 . HD*  1 1 
       168 1 1 1 1 26 LEU QB   A 26 . HB*  1 1 
       168 1 2 1 1 53 VAL QG   A 53 . HG*  1 1 
       169 1 1 1 1 26 LEU HB2  A 26 . HB2  1 1 
       169 1 2 1 1 27 LYS H    A 27 . HN   1 1 
       170 1 1 1 1 26 LEU HB3  A 26 . HB1  1 1 
       170 1 2 1 1 27 LYS H    A 27 . HN   1 1 
       171 1 1 1 1 26 LEU QD   A 26 . HD*  1 1 
       171 1 2 1 1 29 LEU HB2  A 29 . HB2  1 1 
       172 1 1 1 1 26 LEU QD   A 26 . HD*  1 1 
       172 1 2 1 1 29 LEU HB3  A 29 . HB1  1 1 
       173 1 1 1 1 26 LEU QD   A 26 . HD*  1 1 
       173 1 2 1 1 38 LEU HB3  A 38 . HB1  1 1 
       174 1 1 1 1 26 LEU QD   A 26 . HD*  1 1 
       174 1 2 1 1 49 ILE MD   A 49 . HD1* 1 1 
       175 1 1 1 1 26 LEU QD   A 26 . HD*  1 1 
       175 1 2 1 1 69 PHE QE   A 69 . HE*  1 1 
       176 1 1 1 1 26 LEU QD   A 26 . HD*  1 1 
       176 1 2 1 1 69 PHE HZ   A 69 . HZ   1 1 
       177 1 1 1 1 26 LEU MD1  A 26 . HD1* 1 1 
       177 1 2 1 1 27 LYS H    A 27 . HN   1 1 
       178 1 1 1 1 26 LEU MD1  A 26 . HD1* 1 1 
       178 1 2 1 1 38 LEU QD   A 38 . HD*  1 1 
       179 1 1 1 1 26 LEU MD1  A 26 . HD1* 1 1 
       179 1 2 1 1 44 LEU QD   A 44 . HD*  1 1 
       180 1 1 1 1 26 LEU MD1  A 26 . HD1* 1 1 
       180 1 2 1 1 49 ILE HA   A 49 . HA   1 1 
       181 1 1 1 1 26 LEU MD1  A 26 . HD1* 1 1 
       181 1 2 1 1 49 ILE QG   A 49 . HG1* 1 1 
       182 1 1 1 1 26 LEU MD2  A 26 . HD2* 1 1 
       182 1 2 1 1 27 LYS H    A 27 . HN   1 1 
       183 1 1 1 1 26 LEU MD2  A 26 . HD2* 1 1 
       183 1 2 1 1 38 LEU QD   A 38 . HD*  1 1 
       184 1 1 1 1 26 LEU MD2  A 26 . HD2* 1 1 
       184 1 2 1 1 38 LEU HG   A 38 . HG   1 1 
       185 1 1 1 1 26 LEU MD2  A 26 . HD2* 1 1 
       185 1 2 1 1 44 LEU QD   A 44 . HD*  1 1 
       186 1 1 1 1 26 LEU MD2  A 26 . HD2* 1 1 
       186 1 2 1 1 49 ILE QG   A 49 . HG1* 1 1 
       187 1 1 1 1 26 LEU MD2  A 26 . HD2* 1 1 
       187 1 2 1 1 69 PHE QE   A 69 . HE*  1 1 
       188 1 1 1 1 26 LEU HG   A 26 . HG   1 1 
       188 1 2 1 1 29 LEU HB2  A 29 . HB2  1 1 
       189 1 1 1 1 26 LEU HG   A 26 . HG   1 1 
       189 1 2 1 1 29 LEU QD   A 29 . HD*  1 1 
       190 1 1 1 1 26 LEU HG   A 26 . HG   1 1 
       190 1 2 1 1 38 LEU QD   A 38 . HD*  1 1 
       191 1 1 1 1 26 LEU HG   A 26 . HG   1 1 
       191 1 2 1 1 69 PHE QE   A 69 . HE*  1 1 
       192 1 1 1 1 27 LYS H    A 27 . HN   1 1 
       192 1 2 1 1 27 LYS QD   A 27 . HD*  1 1 
       193 1 1 1 1 27 LYS H    A 27 . HN   1 1 
       193 1 2 1 1 27 LYS HG2  A 27 . HG2  1 1 
       194 1 1 1 1 27 LYS H    A 27 . HN   1 1 
       194 1 2 1 1 27 LYS HG3  A 27 . HG1  1 1 
       195 1 1 1 1 27 LYS H    A 27 . HN   1 1 
       195 1 2 1 1 28 ASP H    A 28 . HN   1 1 
       196 1 1 1 1 27 LYS H    A 27 . HN   1 1 
       196 1 2 1 1 28 ASP QB   A 28 . HB*  1 1 
       197 1 1 1 1 27 LYS HA   A 27 . HA   1 1 
       197 1 2 1 1 28 ASP H    A 28 . HN   1 1 
       198 1 1 1 1 27 LYS HA   A 27 . HA   1 1 
       198 1 2 1 1 30 LEU H    A 30 . HN   1 1 
       199 1 1 1 1 27 LYS HA   A 27 . HA   1 1 
       199 1 2 1 1 30 LEU HB3  A 30 . HB1  1 1 
       200 1 1 1 1 27 LYS HA   A 27 . HA   1 1 
       200 1 2 1 1 30 LEU QD   A 30 . HD*  1 1 
       201 1 1 1 1 27 LYS HA   A 27 . HA   1 1 
       201 1 2 1 1 31 LYS H    A 31 . HN   1 1 
       202 1 1 1 1 27 LYS QB   A 27 . HB*  1 1 
       202 1 2 1 1 28 ASP H    A 28 . HN   1 1 
       203 1 1 1 1 27 LYS QD   A 27 . HD*  1 1 
       203 1 2 1 1 28 ASP H    A 28 . HN   1 1 
       204 1 1 1 1 27 LYS HG2  A 27 . HG2  1 1 
       204 1 2 1 1 28 ASP H    A 28 . HN   1 1 
       205 1 1 1 1 27 LYS HG3  A 27 . HG1  1 1 
       205 1 2 1 1 28 ASP H    A 28 . HN   1 1 
       206 1 1 1 1 28 ASP H    A 28 . HN   1 1 
       206 1 2 1 1 28 ASP HB2  A 28 . HB2  1 1 
       207 1 1 1 1 28 ASP H    A 28 . HN   1 1 
       207 1 2 1 1 28 ASP HB3  A 28 . HB1  1 1 
       208 1 1 1 1 28 ASP H    A 28 . HN   1 1 
       208 1 2 1 1 29 LEU H    A 29 . HN   1 1 
       209 1 1 1 1 28 ASP HA   A 28 . HA   1 1 
       209 1 2 1 1 29 LEU H    A 29 . HN   1 1 
       210 1 1 1 1 28 ASP HA   A 28 . HA   1 1 
       210 1 2 1 1 31 LYS H    A 31 . HN   1 1 
       211 1 1 1 1 28 ASP HA   A 28 . HA   1 1 
       211 1 2 1 1 31 LYS QB   A 31 . HB*  1 1 
       212 1 1 1 1 28 ASP HA   A 28 . HA   1 1 
       212 1 2 1 1 31 LYS QG   A 31 . HG*  1 1 
       213 1 1 1 1 28 ASP QB   A 28 . HB*  1 1 
       213 1 2 1 1 29 LEU HA   A 29 . HA   1 1 
       214 1 1 1 1 28 ASP HB2  A 28 . HB2  1 1 
       214 1 2 1 1 29 LEU H    A 29 . HN   1 1 
       215 1 1 1 1 28 ASP HB3  A 28 . HB1  1 1 
       215 1 2 1 1 29 LEU H    A 29 . HN   1 1 
       216 1 1 1 1 29 LEU H    A 29 . HN   1 1 
       216 1 2 1 1 29 LEU HG   A 29 . HG   1 1 
       217 1 1 1 1 29 LEU H    A 29 . HN   1 1 
       217 1 2 1 1 30 LEU H    A 30 . HN   1 1 
       218 1 1 1 1 29 LEU H    A 29 . HN   1 1 
       218 1 2 1 1 30 LEU QB   A 30 . HB*  1 1 
       219 1 1 1 1 29 LEU HA   A 29 . HA   1 1 
       219 1 2 1 1 30 LEU H    A 30 . HN   1 1 
       220 1 1 1 1 29 LEU HA   A 29 . HA   1 1 
       220 1 2 1 1 31 LYS H    A 31 . HN   1 1 
       221 1 1 1 1 29 LEU HB2  A 29 . HB2  1 1 
       221 1 2 1 1 30 LEU H    A 30 . HN   1 1 
       222 1 1 1 1 29 LEU HB2  A 29 . HB2  1 1 
       222 1 2 1 1 38 LEU QD   A 38 . HD*  1 1 
       223 1 1 1 1 29 LEU HB3  A 29 . HB1  1 1 
       223 1 2 1 1 30 LEU H    A 30 . HN   1 1 
       224 1 1 1 1 29 LEU HB3  A 29 . HB1  1 1 
       224 1 2 1 1 38 LEU QD   A 38 . HD*  1 1 
       225 1 1 1 1 29 LEU QD   A 29 . HD*  1 1 
       225 1 2 1 1 73 TYR QD   A 73 . HD*  1 1 
       226 1 1 1 1 29 LEU QD   A 29 . HD*  1 1 
       226 1 2 1 1 73 TYR QE   A 73 . HE*  1 1 
       227 1 1 1 1 29 LEU QD   A 29 . HD*  1 1 
       227 1 2 1 1 76 PHE QE   A 76 . HE*  1 1 
       228 1 1 1 1 29 LEU HG   A 29 . HG   1 1 
       228 1 2 1 1 30 LEU H    A 30 . HN   1 1 
       229 1 1 1 1 30 LEU H    A 30 . HN   1 1 
       229 1 2 1 1 30 LEU MD1  A 30 . HD1* 1 1 
       230 1 1 1 1 30 LEU H    A 30 . HN   1 1 
       230 1 2 1 1 30 LEU HG   A 30 . HG   1 1 
       231 1 1 1 1 30 LEU H    A 30 . HN   1 1 
       231 1 2 1 1 31 LYS H    A 31 . HN   1 1 
       232 1 1 1 1 30 LEU H    A 30 . HN   1 1 
       232 1 2 1 1 32 ASP H    A 32 . HN   1 1 
       233 1 1 1 1 30 LEU H    A 30 . HN   1 1 
       233 1 2 1 1 33 MET H    A 33 . HN   1 1 
       234 1 1 1 1 30 LEU HA   A 30 . HA   1 1 
       234 1 2 1 1 31 LYS H    A 31 . HN   1 1 
       235 1 1 1 1 30 LEU HA   A 30 . HA   1 1 
       235 1 2 1 1 32 ASP H    A 32 . HN   1 1 
       236 1 1 1 1 30 LEU HA   A 30 . HA   1 1 
       236 1 2 1 1 33 MET H    A 33 . HN   1 1 
       237 1 1 1 1 30 LEU QD   A 30 . HD*  1 1 
       237 1 2 1 1 31 LYS H    A 31 . HN   1 1 
       238 1 1 1 1 30 LEU QD   A 30 . HD*  1 1 
       238 1 2 1 1 33 MET H    A 33 . HN   1 1 
       239 1 1 1 1 30 LEU QD   A 30 . HD*  1 1 
       239 1 2 1 1 35 GLN H    A 35 . HN   1 1 
       240 1 1 1 1 30 LEU QD   A 30 . HD*  1 1 
       240 1 2 1 1 35 GLN HE21 A 35 . HE21 1 1 
       241 1 1 1 1 30 LEU QD   A 30 . HD*  1 1 
       241 1 2 1 1 35 GLN HE22 A 35 . HE22 1 1 
       242 1 1 1 1 30 LEU QD   A 30 . HD*  1 1 
       242 1 2 1 1 38 LEU H    A 38 . HN   1 1 
       243 1 1 1 1 30 LEU QD   A 30 . HD*  1 1 
       243 1 2 1 1 38 LEU QD   A 38 . HD*  1 1 
       244 1 1 1 1 30 LEU QD   A 30 . HD*  1 1 
       244 1 2 1 1 38 LEU HG   A 38 . HG   1 1 
       245 1 1 1 1 30 LEU MD1  A 30 . HD1* 1 1 
       245 1 2 1 1 34 ASN HA   A 34 . HA   1 1 
       246 1 1 1 1 30 LEU MD1  A 30 . HD1* 1 1 
       246 1 2 1 1 35 GLN QB   A 35 . HB*  1 1 
       247 1 1 1 1 30 LEU MD1  A 30 . HD1* 1 1 
       247 1 2 1 1 36 SER H    A 36 . HN   1 1 
       248 1 1 1 1 30 LEU MD1  A 30 . HD1* 1 1 
       248 1 2 1 1 38 LEU HB2  A 38 . HB2  1 1 
       249 1 1 1 1 30 LEU MD1  A 30 . HD1* 1 1 
       249 1 2 1 1 38 LEU HB3  A 38 . HB1  1 1 
       250 1 1 1 1 30 LEU MD2  A 30 . HD2* 1 1 
       250 1 2 1 1 35 GLN QB   A 35 . HB*  1 1 
       251 1 1 1 1 30 LEU MD2  A 30 . HD2* 1 1 
       251 1 2 1 1 35 GLN QG   A 35 . HG*  1 1 
       252 1 1 1 1 30 LEU HG   A 30 . HG   1 1 
       252 1 2 1 1 31 LYS HA   A 31 . HA   1 1 
       253 1 1 1 1 31 LYS H    A 31 . HN   1 1 
       253 1 2 1 1 31 LYS QB   A 31 . HB*  1 1 
       254 1 1 1 1 31 LYS H    A 31 . HN   1 1 
       254 1 2 1 1 31 LYS QD   A 31 . HD*  1 1 
       255 1 1 1 1 31 LYS H    A 31 . HN   1 1 
       255 1 2 1 1 31 LYS QE   A 31 . HE*  1 1 
       256 1 1 1 1 31 LYS H    A 31 . HN   1 1 
       256 1 2 1 1 31 LYS HG2  A 31 . HG2  1 1 
       257 1 1 1 1 31 LYS H    A 31 . HN   1 1 
       257 1 2 1 1 31 LYS HG3  A 31 . HG1  1 1 
       258 1 1 1 1 31 LYS H    A 31 . HN   1 1 
       258 1 2 1 1 32 ASP H    A 32 . HN   1 1 
       259 1 1 1 1 31 LYS HA   A 31 . HA   1 1 
       259 1 2 1 1 32 ASP H    A 32 . HN   1 1 
       260 1 1 1 1 31 LYS HA   A 31 . HA   1 1 
       260 1 2 1 1 33 MET H    A 33 . HN   1 1 
       261 1 1 1 1 31 LYS QB   A 31 . HB*  1 1 
       261 1 2 1 1 32 ASP H    A 32 . HN   1 1 
       262 1 1 1 1 31 LYS QG   A 31 . HG*  1 1 
       262 1 2 1 1 32 ASP H    A 32 . HN   1 1 
       263 1 1 1 1 32 ASP H    A 32 . HN   1 1 
       263 1 2 1 1 33 MET H    A 33 . HN   1 1 
       264 1 1 1 1 32 ASP H    A 32 . HN   1 1 
       264 1 2 1 1 33 MET HA   A 33 . HA   1 1 
       265 1 1 1 1 32 ASP HA   A 32 . HA   1 1 
       265 1 2 1 1 33 MET H    A 33 . HN   1 1 
       266 1 1 1 1 32 ASP HA   A 32 . HA   1 1 
       266 1 2 1 1 33 MET HA   A 33 . HA   1 1 
       267 1 1 1 1 32 ASP QB   A 32 . HB*  1 1 
       267 1 2 1 1 33 MET HA   A 33 . HA   1 1 
       268 1 1 1 1 32 ASP QB   A 32 . HB*  1 1 
       268 1 2 1 1 33 MET QB   A 33 . HB*  1 1 
       269 1 1 1 1 32 ASP QB   A 32 . HB*  1 1 
       269 1 2 1 1 33 MET ME   A 33 . HE*  1 1 
       270 1 1 1 1 32 ASP HB2  A 32 . HB2  1 1 
       270 1 2 1 1 33 MET H    A 33 . HN   1 1 
       271 1 1 1 1 32 ASP HB3  A 32 . HB1  1 1 
       271 1 2 1 1 33 MET H    A 33 . HN   1 1 
       272 1 1 1 1 33 MET H    A 33 . HN   1 1 
       272 1 2 1 1 33 MET HG2  A 33 . HG2  1 1 
       273 1 1 1 1 33 MET H    A 33 . HN   1 1 
       273 1 2 1 1 33 MET HG3  A 33 . HG1  1 1 
       274 1 1 1 1 33 MET H    A 33 . HN   1 1 
       274 1 2 1 1 34 ASN H    A 34 . HN   1 1 
       275 1 1 1 1 33 MET HA   A 33 . HA   1 1 
       275 1 2 1 1 33 MET ME   A 33 . HE*  1 1 
       276 1 1 1 1 33 MET HA   A 33 . HA   1 1 
       276 1 2 1 1 34 ASN H    A 34 . HN   1 1 
       277 1 1 1 1 33 MET HA   A 33 . HA   1 1 
       277 1 2 1 1 34 ASN QD   A 34 . HD2* 1 1 
       278 1 1 1 1 33 MET QB   A 33 . HB*  1 1 
       278 1 2 1 1 34 ASN HA   A 34 . HA   1 1 
       279 1 1 1 1 33 MET QB   A 33 . HB*  1 1 
       279 1 2 1 1 37 SER QB   A 37 . HB*  1 1 
       280 1 1 1 1 33 MET QB   A 33 . HB*  1 1 
       280 1 2 1 1 38 LEU QB   A 38 . HB*  1 1 
       281 1 1 1 1 33 MET QB   A 33 . HB*  1 1 
       281 1 2 1 1 38 LEU QD   A 38 . HD*  1 1 
       282 1 1 1 1 33 MET HB2  A 33 . HB2  1 1 
       282 1 2 1 1 34 ASN H    A 34 . HN   1 1 
       283 1 1 1 1 33 MET HB3  A 33 . HB1  1 1 
       283 1 2 1 1 34 ASN H    A 34 . HN   1 1 
       284 1 1 1 1 33 MET ME   A 33 . HE*  1 1 
       284 1 2 1 1 37 SER QB   A 37 . HB*  1 1 
       285 1 1 1 1 33 MET ME   A 33 . HE*  1 1 
       285 1 2 1 1 38 LEU QB   A 38 . HB*  1 1 
       286 1 1 1 1 33 MET ME   A 33 . HE*  1 1 
       286 1 2 1 1 38 LEU MD1  A 38 . HD1* 1 1 
       287 1 1 1 1 33 MET QG   A 33 . HG*  1 1 
       287 1 2 1 1 34 ASN HA   A 34 . HA   1 1 
       288 1 1 1 1 33 MET QG   A 33 . HG*  1 1 
       288 1 2 1 1 38 LEU H    A 38 . HN   1 1 
       289 1 1 1 1 33 MET HG2  A 33 . HG2  1 1 
       289 1 2 1 1 34 ASN H    A 34 . HN   1 1 
       290 1 1 1 1 33 MET HG2  A 33 . HG2  1 1 
       290 1 2 1 1 38 LEU QD   A 38 . HD*  1 1 
       291 1 1 1 1 33 MET HG3  A 33 . HG1  1 1 
       291 1 2 1 1 34 ASN H    A 34 . HN   1 1 
       292 1 1 1 1 33 MET HG3  A 33 . HG1  1 1 
       292 1 2 1 1 38 LEU QB   A 38 . HB*  1 1 
       293 1 1 1 1 33 MET HG3  A 33 . HG1  1 1 
       293 1 2 1 1 38 LEU QD   A 38 . HD*  1 1 
       294 1 1 1 1 34 ASN H    A 34 . HN   1 1 
       294 1 2 1 1 35 GLN H    A 35 . HN   1 1 
       295 1 1 1 1 34 ASN H    A 34 . HN   1 1 
       295 1 2 1 1 37 SER QB   A 37 . HB*  1 1 
       296 1 1 1 1 34 ASN HA   A 34 . HA   1 1 
       296 1 2 1 1 35 GLN H    A 35 . HN   1 1 
       297 1 1 1 1 34 ASN HA   A 34 . HA   1 1 
       297 1 2 1 1 35 GLN QB   A 35 . HB*  1 1 
       298 1 1 1 1 34 ASN HA   A 34 . HA   1 1 
       298 1 2 1 1 37 SER QB   A 37 . HB*  1 1 
       299 1 1 1 1 34 ASN HB2  A 34 . HB2  1 1 
       299 1 2 1 1 35 GLN H    A 35 . HN   1 1 
       300 1 1 1 1 34 ASN HB2  A 34 . HB2  1 1 
       300 1 2 1 1 36 SER H    A 36 . HN   1 1 
       301 1 1 1 1 34 ASN HB3  A 34 . HB1  1 1 
       301 1 2 1 1 35 GLN H    A 35 . HN   1 1 
       302 1 1 1 1 34 ASN HB3  A 34 . HB1  1 1 
       302 1 2 1 1 36 SER H    A 36 . HN   1 1 
       303 1 1 1 1 35 GLN H    A 35 . HN   1 1 
       303 1 2 1 1 36 SER H    A 36 . HN   1 1 
       304 1 1 1 1 35 GLN HA   A 35 . HA   1 1 
       304 1 2 1 1 36 SER H    A 36 . HN   1 1 
       305 1 1 1 1 35 GLN HA   A 35 . HA   1 1 
       305 1 2 1 1 38 LEU H    A 38 . HN   1 1 
       306 1 1 1 1 35 GLN HA   A 35 . HA   1 1 
       306 1 2 1 1 38 LEU HB2  A 38 . HB2  1 1 
       307 1 1 1 1 35 GLN HA   A 35 . HA   1 1 
       307 1 2 1 1 38 LEU HB3  A 38 . HB1  1 1 
       308 1 1 1 1 35 GLN HA   A 35 . HA   1 1 
       308 1 2 1 1 38 LEU QD   A 38 . HD*  1 1 
       309 1 1 1 1 35 GLN HA   A 35 . HA   1 1 
       309 1 2 1 1 39 ALA H    A 39 . HN   1 1 
       310 1 1 1 1 35 GLN HA   A 35 . HA   1 1 
       310 1 2 1 1 46 GLN QG   A 46 . HG*  1 1 
       311 1 1 1 1 35 GLN HA   A 35 . HA   1 1 
       311 1 2 1 1 49 ILE MD   A 49 . HD1* 1 1 
       312 1 1 1 1 35 GLN QB   A 35 . HB*  1 1 
       312 1 2 1 1 36 SER H    A 36 . HN   1 1 
       313 1 1 1 1 35 GLN QB   A 35 . HB*  1 1 
       313 1 2 1 1 36 SER HA   A 36 . HA   1 1 
       314 1 1 1 1 35 GLN QB   A 35 . HB*  1 1 
       314 1 2 1 1 46 GLN QG   A 46 . HG*  1 1 
       315 1 1 1 1 35 GLN QB   A 35 . HB*  1 1 
       315 1 2 1 1 49 ILE MD   A 49 . HD1* 1 1 
       316 1 1 1 1 35 GLN HE21 A 35 . HE21 1 1 
       316 1 2 1 1 46 GLN QG   A 46 . HG*  1 1 
       317 1 1 1 1 35 GLN HE21 A 35 . HE21 1 1 
       317 1 2 1 1 49 ILE MG   A 49 . HG2* 1 1 
       318 1 1 1 1 35 GLN HE21 A 35 . HE21 1 1 
       318 1 2 1 1 50 SER H    A 50 . HN   1 1 
       319 1 1 1 1 35 GLN HE22 A 35 . HE22 1 1 
       319 1 2 1 1 50 SER H    A 50 . HN   1 1 
       320 1 1 1 1 35 GLN QG   A 35 . HG*  1 1 
       320 1 2 1 1 36 SER H    A 36 . HN   1 1 
       321 1 1 1 1 35 GLN QG   A 35 . HG*  1 1 
       321 1 2 1 1 46 GLN QG   A 46 . HG*  1 1 
       322 1 1 1 1 35 GLN QG   A 35 . HG*  1 1 
       322 1 2 1 1 49 ILE MG   A 49 . HG2* 1 1 
       323 1 1 1 1 36 SER H    A 36 . HN   1 1 
       323 1 2 1 1 37 SER H    A 37 . HN   1 1 
       324 1 1 1 1 36 SER HA   A 36 . HA   1 1 
       324 1 2 1 1 37 SER H    A 37 . HN   1 1 
       325 1 1 1 1 36 SER HA   A 36 . HA   1 1 
       325 1 2 1 1 39 ALA H    A 39 . HN   1 1 
       326 1 1 1 1 36 SER HA   A 36 . HA   1 1 
       326 1 2 1 1 39 ALA MB   A 39 . HB*  1 1 
       327 1 1 1 1 36 SER HA   A 36 . HA   1 1 
       327 1 2 1 1 40 LYS H    A 40 . HN   1 1 
       328 1 1 1 1 36 SER HA   A 36 . HA   1 1 
       328 1 2 1 1 46 GLN QG   A 46 . HG*  1 1 
       329 1 1 1 1 36 SER QB   A 36 . HB*  1 1 
       329 1 2 1 1 37 SER H    A 37 . HN   1 1 
       330 1 1 1 1 37 SER H    A 37 . HN   1 1 
       330 1 2 1 1 37 SER QB   A 37 . HB*  1 1 
       331 1 1 1 1 37 SER H    A 37 . HN   1 1 
       331 1 2 1 1 38 LEU H    A 38 . HN   1 1 
       332 1 1 1 1 37 SER HA   A 37 . HA   1 1 
       332 1 2 1 1 38 LEU H    A 38 . HN   1 1 
       333 1 1 1 1 37 SER HA   A 37 . HA   1 1 
       333 1 2 1 1 39 ALA H    A 39 . HN   1 1 
       334 1 1 1 1 37 SER HA   A 37 . HA   1 1 
       334 1 2 1 1 39 ALA MB   A 39 . HB*  1 1 
       335 1 1 1 1 37 SER HA   A 37 . HA   1 1 
       335 1 2 1 1 40 LYS H    A 40 . HN   1 1 
       336 1 1 1 1 37 SER HA   A 37 . HA   1 1 
       336 1 2 1 1 40 LYS QB   A 40 . HB*  1 1 
       337 1 1 1 1 37 SER QB   A 37 . HB*  1 1 
       337 1 2 1 1 38 LEU H    A 38 . HN   1 1 
       338 1 1 1 1 38 LEU H    A 38 . HN   1 1 
       338 1 2 1 1 38 LEU HB2  A 38 . HB2  1 1 
       339 1 1 1 1 38 LEU H    A 38 . HN   1 1 
       339 1 2 1 1 38 LEU HB3  A 38 . HB1  1 1 
       340 1 1 1 1 38 LEU H    A 38 . HN   1 1 
       340 1 2 1 1 38 LEU MD2  A 38 . HD2* 1 1 
       341 1 1 1 1 38 LEU H    A 38 . HN   1 1 
       341 1 2 1 1 39 ALA H    A 39 . HN   1 1 
       342 1 1 1 1 38 LEU HA   A 38 . HA   1 1 
       342 1 2 1 1 39 ALA H    A 39 . HN   1 1 
       343 1 1 1 1 38 LEU QB   A 38 . HB*  1 1 
       343 1 2 1 1 39 ALA MB   A 39 . HB*  1 1 
       344 1 1 1 1 38 LEU QB   A 38 . HB*  1 1 
       344 1 2 1 1 49 ILE MD   A 49 . HD1* 1 1 
       345 1 1 1 1 38 LEU HB2  A 38 . HB2  1 1 
       345 1 2 1 1 39 ALA H    A 39 . HN   1 1 
       346 1 1 1 1 38 LEU HB3  A 38 . HB1  1 1 
       346 1 2 1 1 39 ALA H    A 39 . HN   1 1 
       347 1 1 1 1 38 LEU QD   A 38 . HD*  1 1 
       347 1 2 1 1 39 ALA H    A 39 . HN   1 1 
       348 1 1 1 1 38 LEU QD   A 38 . HD*  1 1 
       348 1 2 1 1 39 ALA HA   A 39 . HA   1 1 
       349 1 1 1 1 38 LEU QD   A 38 . HD*  1 1 
       349 1 2 1 1 42 CYS H    A 42 . HN   1 1 
       350 1 1 1 1 38 LEU QD   A 38 . HD*  1 1 
       350 1 2 1 1 49 ILE MD   A 49 . HD1* 1 1 
       351 1 1 1 1 38 LEU QD   A 38 . HD*  1 1 
       351 1 2 1 1 72 TRP HZ2  A 72 . HZ2  1 1 
       352 1 1 1 1 38 LEU QD   A 38 . HD*  1 1 
       352 1 2 1 1 72 TRP HZ3  A 72 . HZ3  1 1 
       353 1 1 1 1 38 LEU MD1  A 38 . HD1* 1 1 
       353 1 2 1 1 69 PHE QE   A 69 . HE*  1 1 
       354 1 1 1 1 38 LEU MD2  A 38 . HD2* 1 1 
       354 1 2 1 1 39 ALA H    A 39 . HN   1 1 
       355 1 1 1 1 38 LEU MD2  A 38 . HD2* 1 1 
       355 1 2 1 1 41 GLU QB   A 41 . HB*  1 1 
       356 1 1 1 1 38 LEU MD2  A 38 . HD2* 1 1 
       356 1 2 1 1 69 PHE QE   A 69 . HE*  1 1 
       357 1 1 1 1 39 ALA H    A 39 . HN   1 1 
       357 1 2 1 1 40 LYS H    A 40 . HN   1 1 
       358 1 1 1 1 39 ALA H    A 39 . HN   1 1 
       358 1 2 1 1 40 LYS QB   A 40 . HB*  1 1 
       359 1 1 1 1 39 ALA HA   A 39 . HA   1 1 
       359 1 2 1 1 40 LYS H    A 40 . HN   1 1 
       360 1 1 1 1 39 ALA HA   A 39 . HA   1 1 
       360 1 2 1 1 42 CYS H    A 42 . HN   1 1 
       361 1 1 1 1 39 ALA HA   A 39 . HA   1 1 
       361 1 2 1 1 42 CYS QB   A 42 . HB*  1 1 
       362 1 1 1 1 39 ALA HA   A 39 . HA   1 1 
       362 1 2 1 1 49 ILE MD   A 49 . HD1* 1 1 
       363 1 1 1 1 39 ALA MB   A 39 . HB*  1 1 
       363 1 2 1 1 40 LYS H    A 40 . HN   1 1 
       364 1 1 1 1 39 ALA MB   A 39 . HB*  1 1 
       364 1 2 1 1 40 LYS QG   A 40 . HG*  1 1 
       365 1 1 1 1 39 ALA MB   A 39 . HB*  1 1 
       365 1 2 1 1 41 GLU H    A 41 . HN   1 1 
       366 1 1 1 1 39 ALA MB   A 39 . HB*  1 1 
       366 1 2 1 1 42 CYS H    A 42 . HN   1 1 
       367 1 1 1 1 39 ALA MB   A 39 . HB*  1 1 
       367 1 2 1 1 45 SER HA   A 45 . HA   1 1 
       368 1 1 1 1 39 ALA MB   A 39 . HB*  1 1 
       368 1 2 1 1 46 GLN H    A 46 . HN   1 1 
       369 1 1 1 1 39 ALA MB   A 39 . HB*  1 1 
       369 1 2 1 1 46 GLN HA   A 46 . HA   1 1 
       370 1 1 1 1 39 ALA MB   A 39 . HB*  1 1 
       370 1 2 1 1 46 GLN QB   A 46 . HB*  1 1 
       371 1 1 1 1 39 ALA MB   A 39 . HB*  1 1 
       371 1 2 1 1 46 GLN QG   A 46 . HG*  1 1 
       372 1 1 1 1 39 ALA MB   A 39 . HB*  1 1 
       372 1 2 1 1 49 ILE MD   A 49 . HD1* 1 1 
       373 1 1 1 1 40 LYS H    A 40 . HN   1 1 
       373 1 2 1 1 40 LYS QB   A 40 . HB*  1 1 
       374 1 1 1 1 40 LYS H    A 40 . HN   1 1 
       374 1 2 1 1 42 CYS H    A 42 . HN   1 1 
       375 1 1 1 1 40 LYS HA   A 40 . HA   1 1 
       375 1 2 1 1 40 LYS QE   A 40 . HE*  1 1 
       376 1 1 1 1 40 LYS HA   A 40 . HA   1 1 
       376 1 2 1 1 41 GLU H    A 41 . HN   1 1 
       377 1 1 1 1 40 LYS QB   A 40 . HB*  1 1 
       377 1 2 1 1 41 GLU H    A 41 . HN   1 1 
       378 1 1 1 1 41 GLU H    A 41 . HN   1 1 
       378 1 2 1 1 41 GLU HB3  A 41 . HB1  1 1 
       379 1 1 1 1 41 GLU H    A 41 . HN   1 1 
       379 1 2 1 1 41 GLU HG2  A 41 . HG2  1 1 
       380 1 1 1 1 41 GLU H    A 41 . HN   1 1 
       380 1 2 1 1 41 GLU HG3  A 41 . HG1  1 1 
       381 1 1 1 1 41 GLU H    A 41 . HN   1 1 
       381 1 2 1 1 42 CYS H    A 42 . HN   1 1 
       382 1 1 1 1 41 GLU H    A 41 . HN   1 1 
       382 1 2 1 1 42 CYS QB   A 42 . HB*  1 1 
       383 1 1 1 1 41 GLU HA   A 41 . HA   1 1 
       383 1 2 1 1 42 CYS H    A 42 . HN   1 1 
       384 1 1 1 1 41 GLU HB2  A 41 . HB2  1 1 
       384 1 2 1 1 42 CYS H    A 42 . HN   1 1 
       385 1 1 1 1 41 GLU HB2  A 41 . HB2  1 1 
       385 1 2 1 1 72 TRP HE1  A 72 . HE1  1 1 
       386 1 1 1 1 41 GLU HB2  A 41 . HB2  1 1 
       386 1 2 1 1 72 TRP HZ2  A 72 . HZ2  1 1 
       387 1 1 1 1 41 GLU HB3  A 41 . HB1  1 1 
       387 1 2 1 1 42 CYS H    A 42 . HN   1 1 
       388 1 1 1 1 41 GLU HB3  A 41 . HB1  1 1 
       388 1 2 1 1 72 TRP HZ2  A 72 . HZ2  1 1 
       389 1 1 1 1 41 GLU QG   A 41 . HG*  1 1 
       389 1 2 1 1 42 CYS H    A 42 . HN   1 1 
       390 1 1 1 1 41 GLU HG3  A 41 . HG1  1 1 
       390 1 2 1 1 72 TRP HZ2  A 72 . HZ2  1 1 
       391 1 1 1 1 42 CYS H    A 42 . HN   1 1 
       391 1 2 1 1 43 PRO HD2  A 43 . HD2  1 1 
       392 1 1 1 1 42 CYS H    A 42 . HN   1 1 
       392 1 2 1 1 43 PRO HD3  A 43 . HD1  1 1 
       393 1 1 1 1 42 CYS HA   A 42 . HA   1 1 
       393 1 2 1 1 43 PRO HA   A 43 . HA   1 1 
       394 1 1 1 1 42 CYS HA   A 42 . HA   1 1 
       394 1 2 1 1 43 PRO HD2  A 43 . HD2  1 1 
       395 1 1 1 1 42 CYS HA   A 42 . HA   1 1 
       395 1 2 1 1 43 PRO HD3  A 43 . HD1  1 1 
       396 1 1 1 1 42 CYS HA   A 42 . HA   1 1 
       396 1 2 1 1 72 TRP HE1  A 72 . HE1  1 1 
       397 1 1 1 1 42 CYS QB   A 42 . HB*  1 1 
       397 1 2 1 1 69 PHE QE   A 69 . HE*  1 1 
       398 1 1 1 1 42 CYS QB   A 42 . HB*  1 1 
       398 1 2 1 1 72 TRP HE3  A 72 . HE3  1 1 
       399 1 1 1 1 42 CYS QB   A 42 . HB*  1 1 
       399 1 2 1 1 72 TRP HZ3  A 72 . HZ3  1 1 
       400 1 1 1 1 43 PRO HA   A 43 . HA   1 1 
       400 1 2 1 1 44 LEU H    A 44 . HN   1 1 
       401 1 1 1 1 43 PRO QB   A 43 . HB*  1 1 
       401 1 2 1 1 44 LEU HA   A 44 . HA   1 1 
       402 1 1 1 1 43 PRO QB   A 43 . HB*  1 1 
       402 1 2 1 1 44 LEU QD   A 44 . HD*  1 1 
       403 1 1 1 1 43 PRO HB2  A 43 . HB2  1 1 
       403 1 2 1 1 44 LEU H    A 44 . HN   1 1 
       404 1 1 1 1 43 PRO HB3  A 43 . HB1  1 1 
       404 1 2 1 1 44 LEU H    A 44 . HN   1 1 
       405 1 1 1 1 43 PRO QD   A 43 . HD*  1 1 
       405 1 2 1 1 44 LEU QD   A 44 . HD*  1 1 
       406 1 1 1 1 43 PRO QD   A 43 . HD*  1 1 
       406 1 2 1 1 69 PHE HA   A 69 . HA   1 1 
       407 1 1 1 1 43 PRO QD   A 43 . HD*  1 1 
       407 1 2 1 1 69 PHE QD   A 69 . HD*  1 1 
       408 1 1 1 1 43 PRO QD   A 43 . HD*  1 1 
       408 1 2 1 1 72 TRP H    A 72 . HN   1 1 
       409 1 1 1 1 43 PRO HD2  A 43 . HD2  1 1 
       409 1 2 1 1 44 LEU H    A 44 . HN   1 1 
       410 1 1 1 1 43 PRO HD2  A 43 . HD2  1 1 
       410 1 2 1 1 72 TRP QB   A 72 . HB*  1 1 
       411 1 1 1 1 43 PRO HD3  A 43 . HD1  1 1 
       411 1 2 1 1 44 LEU H    A 44 . HN   1 1 
       412 1 1 1 1 43 PRO HD3  A 43 . HD1  1 1 
       412 1 2 1 1 72 TRP QB   A 72 . HB*  1 1 
       413 1 1 1 1 43 PRO QG   A 43 . HG*  1 1 
       413 1 2 1 1 44 LEU H    A 44 . HN   1 1 
       414 1 1 1 1 43 PRO QG   A 43 . HG*  1 1 
       414 1 2 1 1 44 LEU QD   A 44 . HD*  1 1 
       415 1 1 1 1 43 PRO QG   A 43 . HG*  1 1 
       415 1 2 1 1 72 TRP H    A 72 . HN   1 1 
       416 1 1 1 1 43 PRO QG   A 43 . HG*  1 1 
       416 1 2 1 1 72 TRP QB   A 72 . HB*  1 1 
       417 1 1 1 1 43 PRO HG2  A 43 . HG2  1 1 
       417 1 2 1 1 68 GLU QB   A 68 . HB*  1 1 
       418 1 1 1 1 43 PRO HG2  A 43 . HG2  1 1 
       418 1 2 1 1 69 PHE HA   A 69 . HA   1 1 
       419 1 1 1 1 43 PRO HG3  A 43 . HG1  1 1 
       419 1 2 1 1 68 GLU QB   A 68 . HB*  1 1 
       420 1 1 1 1 44 LEU H    A 44 . HN   1 1 
       420 1 2 1 1 44 LEU MD1  A 44 . HD1* 1 1 
       421 1 1 1 1 44 LEU H    A 44 . HN   1 1 
       421 1 2 1 1 44 LEU MD2  A 44 . HD2* 1 1 
       422 1 1 1 1 44 LEU H    A 44 . HN   1 1 
       422 1 2 1 1 44 LEU HG   A 44 . HG   1 1 
       423 1 1 1 1 44 LEU H    A 44 . HN   1 1 
       423 1 2 1 1 45 SER H    A 45 . HN   1 1 
       424 1 1 1 1 44 LEU H    A 44 . HN   1 1 
       424 1 2 1 1 49 ILE MD   A 49 . HD1* 1 1 
       425 1 1 1 1 44 LEU HA   A 44 . HA   1 1 
       425 1 2 1 1 45 SER H    A 45 . HN   1 1 
       426 1 1 1 1 44 LEU QB   A 44 . HB*  1 1 
       426 1 2 1 1 49 ILE QG   A 49 . HG1* 1 1 
       427 1 1 1 1 44 LEU HB2  A 44 . HB2  1 1 
       427 1 2 1 1 45 SER H    A 45 . HN   1 1 
       428 1 1 1 1 44 LEU HB2  A 44 . HB2  1 1 
       428 1 2 1 1 49 ILE H    A 49 . HN   1 1 
       429 1 1 1 1 44 LEU HB2  A 44 . HB2  1 1 
       429 1 2 1 1 49 ILE MD   A 49 . HD1* 1 1 
       430 1 1 1 1 44 LEU HB3  A 44 . HB1  1 1 
       430 1 2 1 1 45 SER H    A 45 . HN   1 1 
       431 1 1 1 1 44 LEU HB3  A 44 . HB1  1 1 
       431 1 2 1 1 48 MET HB2  A 48 . HB2  1 1 
       432 1 1 1 1 44 LEU HB3  A 44 . HB1  1 1 
       432 1 2 1 1 48 MET HB3  A 48 . HB1  1 1 
       433 1 1 1 1 44 LEU HB3  A 44 . HB1  1 1 
       433 1 2 1 1 48 MET QG   A 48 . HG*  1 1 
       434 1 1 1 1 44 LEU HB3  A 44 . HB1  1 1 
       434 1 2 1 1 49 ILE H    A 49 . HN   1 1 
       435 1 1 1 1 44 LEU HB3  A 44 . HB1  1 1 
       435 1 2 1 1 49 ILE MD   A 49 . HD1* 1 1 
       436 1 1 1 1 44 LEU QD   A 44 . HD*  1 1 
       436 1 2 1 1 45 SER H    A 45 . HN   1 1 
       437 1 1 1 1 44 LEU QD   A 44 . HD*  1 1 
       437 1 2 1 1 48 MET HB2  A 48 . HB2  1 1 
       438 1 1 1 1 44 LEU QD   A 44 . HD*  1 1 
       438 1 2 1 1 48 MET HB3  A 48 . HB1  1 1 
       439 1 1 1 1 44 LEU QD   A 44 . HD*  1 1 
       439 1 2 1 1 48 MET ME   A 48 . HE*  1 1 
       440 1 1 1 1 44 LEU QD   A 44 . HD*  1 1 
       440 1 2 1 1 48 MET QG   A 48 . HG*  1 1 
       441 1 1 1 1 44 LEU QD   A 44 . HD*  1 1 
       441 1 2 1 1 65 LYS QE   A 65 . HE*  1 1 
       442 1 1 1 1 44 LEU QD   A 44 . HD*  1 1 
       442 1 2 1 1 68 GLU QB   A 68 . HB*  1 1 
       443 1 1 1 1 44 LEU QD   A 44 . HD*  1 1 
       443 1 2 1 1 69 PHE H    A 69 . HN   1 1 
       444 1 1 1 1 44 LEU QD   A 44 . HD*  1 1 
       444 1 2 1 1 69 PHE QE   A 69 . HE*  1 1 
       445 1 1 1 1 44 LEU QD   A 44 . HD*  1 1 
       445 1 2 1 1 72 TRP QB   A 72 . HB*  1 1 
       446 1 1 1 1 44 LEU MD1  A 44 . HD1* 1 1 
       446 1 2 1 1 65 LYS QB   A 65 . HB*  1 1 
       447 1 1 1 1 44 LEU MD1  A 44 . HD1* 1 1 
       447 1 2 1 1 69 PHE HB3  A 69 . HB1  1 1 
       448 1 1 1 1 44 LEU MD1  A 44 . HD1* 1 1 
       448 1 2 1 1 69 PHE QD   A 69 . HD*  1 1 
       449 1 1 1 1 44 LEU MD2  A 44 . HD2* 1 1 
       449 1 2 1 1 65 LYS QB   A 65 . HB*  1 1 
       450 1 1 1 1 44 LEU MD2  A 44 . HD2* 1 1 
       450 1 2 1 1 69 PHE HB2  A 69 . HB2  1 1 
       451 1 1 1 1 44 LEU MD2  A 44 . HD2* 1 1 
       451 1 2 1 1 69 PHE HB3  A 69 . HB1  1 1 
       452 1 1 1 1 44 LEU MD2  A 44 . HD2* 1 1 
       452 1 2 1 1 69 PHE QD   A 69 . HD*  1 1 
       453 1 1 1 1 44 LEU HG   A 44 . HG   1 1 
       453 1 2 1 1 69 PHE HA   A 69 . HA   1 1 
       454 1 1 1 1 44 LEU HG   A 44 . HG   1 1 
       454 1 2 1 1 69 PHE HB2  A 69 . HB2  1 1 
       455 1 1 1 1 44 LEU HG   A 44 . HG   1 1 
       455 1 2 1 1 69 PHE QD   A 69 . HD*  1 1 
       456 1 1 1 1 45 SER H    A 45 . HN   1 1 
       456 1 2 1 1 48 MET H    A 48 . HN   1 1 
       457 1 1 1 1 45 SER H    A 45 . HN   1 1 
       457 1 2 1 1 48 MET QB   A 48 . HB*  1 1 
       458 1 1 1 1 45 SER H    A 45 . HN   1 1 
       458 1 2 1 1 48 MET ME   A 48 . HE*  1 1 
       459 1 1 1 1 45 SER H    A 45 . HN   1 1 
       459 1 2 1 1 48 MET QG   A 48 . HG*  1 1 
       460 1 1 1 1 45 SER HA   A 45 . HA   1 1 
       460 1 2 1 1 46 GLN H    A 46 . HN   1 1 
       461 1 1 1 1 45 SER HA   A 45 . HA   1 1 
       461 1 2 1 1 46 GLN QB   A 46 . HB*  1 1 
       462 1 1 1 1 45 SER QB   A 45 . HB*  1 1 
       462 1 2 1 1 46 GLN HA   A 46 . HA   1 1 
       463 1 1 1 1 45 SER HB2  A 45 . HB2  1 1 
       463 1 2 1 1 46 GLN H    A 46 . HN   1 1 
       464 1 1 1 1 45 SER HB2  A 45 . HB2  1 1 
       464 1 2 1 1 48 MET H    A 48 . HN   1 1 
       465 1 1 1 1 45 SER HB3  A 45 . HB1  1 1 
       465 1 2 1 1 46 GLN H    A 46 . HN   1 1 
       466 1 1 1 1 45 SER HB3  A 45 . HB1  1 1 
       466 1 2 1 1 48 MET H    A 48 . HN   1 1 
       467 1 1 1 1 46 GLN H    A 46 . HN   1 1 
       467 1 2 1 1 47 SER H    A 47 . HN   1 1 
       468 1 1 1 1 46 GLN HA   A 46 . HA   1 1 
       468 1 2 1 1 47 SER HA   A 47 . HA   1 1 
       469 1 1 1 1 46 GLN HA   A 46 . HA   1 1 
       469 1 2 1 1 49 ILE H    A 49 . HN   1 1 
       470 1 1 1 1 46 GLN HA   A 46 . HA   1 1 
       470 1 2 1 1 49 ILE HB   A 49 . HB   1 1 
       471 1 1 1 1 46 GLN HA   A 46 . HA   1 1 
       471 1 2 1 1 49 ILE MD   A 49 . HD1* 1 1 
       472 1 1 1 1 46 GLN HA   A 46 . HA   1 1 
       472 1 2 1 1 49 ILE MG   A 49 . HG2* 1 1 
       473 1 1 1 1 46 GLN HA   A 46 . HA   1 1 
       473 1 2 1 1 50 SER H    A 50 . HN   1 1 
       474 1 1 1 1 46 GLN QB   A 46 . HB*  1 1 
       474 1 2 1 1 47 SER H    A 47 . HN   1 1 
       475 1 1 1 1 46 GLN QB   A 46 . HB*  1 1 
       475 1 2 1 1 47 SER HA   A 47 . HA   1 1 
       476 1 1 1 1 46 GLN QB   A 46 . HB*  1 1 
       476 1 2 1 1 49 ILE MD   A 49 . HD1* 1 1 
       477 1 1 1 1 46 GLN QE   A 46 . HE*  1 1 
       477 1 2 1 1 47 SER HA   A 47 . HA   1 1 
       478 1 1 1 1 46 GLN QE   A 46 . HE*  1 1 
       478 1 2 1 1 50 SER QB   A 50 . HB*  1 1 
       479 1 1 1 1 46 GLN QG   A 46 . HG*  1 1 
       479 1 2 1 1 47 SER H    A 47 . HN   1 1 
       480 1 1 1 1 46 GLN QG   A 46 . HG*  1 1 
       480 1 2 1 1 49 ILE MD   A 49 . HD1* 1 1 
       481 1 1 1 1 46 GLN QG   A 46 . HG*  1 1 
       481 1 2 1 1 49 ILE MG   A 49 . HG2* 1 1 
       482 1 1 1 1 46 GLN QG   A 46 . HG*  1 1 
       482 1 2 1 1 50 SER H    A 50 . HN   1 1 
       483 1 1 1 1 47 SER H    A 47 . HN   1 1 
       483 1 2 1 1 48 MET H    A 48 . HN   1 1 
       484 1 1 1 1 47 SER HA   A 47 . HA   1 1 
       484 1 2 1 1 48 MET H    A 48 . HN   1 1 
       485 1 1 1 1 47 SER HA   A 47 . HA   1 1 
       485 1 2 1 1 50 SER H    A 50 . HN   1 1 
       486 1 1 1 1 47 SER HA   A 47 . HA   1 1 
       486 1 2 1 1 50 SER QB   A 50 . HB*  1 1 
       487 1 1 1 1 47 SER HA   A 47 . HA   1 1 
       487 1 2 1 1 51 SER H    A 51 . HN   1 1 
       488 1 1 1 1 47 SER QB   A 47 . HB*  1 1 
       488 1 2 1 1 48 MET H    A 48 . HN   1 1 
       489 1 1 1 1 48 MET H    A 48 . HN   1 1 
       489 1 2 1 1 49 ILE H    A 49 . HN   1 1 
       490 1 1 1 1 48 MET H    A 48 . HN   1 1 
       490 1 2 1 1 49 ILE MD   A 49 . HD1* 1 1 
       491 1 1 1 1 48 MET H    A 48 . HN   1 1 
       491 1 2 1 1 51 SER H    A 51 . HN   1 1 
       492 1 1 1 1 48 MET HA   A 48 . HA   1 1 
       492 1 2 1 1 48 MET ME   A 48 . HE*  1 1 
       493 1 1 1 1 48 MET HA   A 48 . HA   1 1 
       493 1 2 1 1 49 ILE H    A 49 . HN   1 1 
       494 1 1 1 1 48 MET HA   A 48 . HA   1 1 
       494 1 2 1 1 51 SER H    A 51 . HN   1 1 
       495 1 1 1 1 48 MET HA   A 48 . HA   1 1 
       495 1 2 1 1 51 SER HB2  A 51 . HB2  1 1 
       496 1 1 1 1 48 MET HA   A 48 . HA   1 1 
       496 1 2 1 1 51 SER HB3  A 51 . HB1  1 1 
       497 1 1 1 1 48 MET HA   A 48 . HA   1 1 
       497 1 2 1 1 52 ILE QG   A 52 . HG1* 1 1 
       498 1 1 1 1 48 MET QB   A 48 . HB*  1 1 
       498 1 2 1 1 49 ILE H    A 49 . HN   1 1 
       499 1 1 1 1 48 MET HB2  A 48 . HB2  1 1 
       499 1 2 1 1 49 ILE HB   A 49 . HB   1 1 
       500 1 1 1 1 48 MET HB2  A 48 . HB2  1 1 
       500 1 2 1 1 49 ILE MD   A 49 . HD1* 1 1 
       501 1 1 1 1 48 MET HB2  A 48 . HB2  1 1 
       501 1 2 1 1 52 ILE MD   A 52 . HD1* 1 1 
       502 1 1 1 1 48 MET HB3  A 48 . HB1  1 1 
       502 1 2 1 1 49 ILE MD   A 49 . HD1* 1 1 
       503 1 1 1 1 48 MET HB3  A 48 . HB1  1 1 
       503 1 2 1 1 52 ILE MD   A 52 . HD1* 1 1 
       504 1 1 1 1 48 MET QG   A 48 . HG*  1 1 
       504 1 2 1 1 49 ILE H    A 49 . HN   1 1 
       505 1 1 1 1 48 MET QG   A 48 . HG*  1 1 
       505 1 2 1 1 52 ILE MD   A 52 . HD1* 1 1 
       506 1 1 1 1 48 MET QG   A 48 . HG*  1 1 
       506 1 2 1 1 52 ILE QG   A 52 . HG1* 1 1 
       507 1 1 1 1 49 ILE H    A 49 . HN   1 1 
       507 1 2 1 1 49 ILE HB   A 49 . HB   1 1 
       508 1 1 1 1 49 ILE H    A 49 . HN   1 1 
       508 1 2 1 1 49 ILE MD   A 49 . HD1* 1 1 
       509 1 1 1 1 49 ILE H    A 49 . HN   1 1 
       509 1 2 1 1 49 ILE HG12 A 49 . HG12 1 1 
       510 1 1 1 1 49 ILE H    A 49 . HN   1 1 
       510 1 2 1 1 49 ILE HG13 A 49 . HG11 1 1 
       511 1 1 1 1 49 ILE H    A 49 . HN   1 1 
       511 1 2 1 1 50 SER H    A 50 . HN   1 1 
       512 1 1 1 1 49 ILE HA   A 49 . HA   1 1 
       512 1 2 1 1 50 SER H    A 50 . HN   1 1 
       513 1 1 1 1 49 ILE HA   A 49 . HA   1 1 
       513 1 2 1 1 52 ILE H    A 52 . HN   1 1 
       514 1 1 1 1 49 ILE HA   A 49 . HA   1 1 
       514 1 2 1 1 52 ILE HB   A 52 . HB   1 1 
       515 1 1 1 1 49 ILE HA   A 49 . HA   1 1 
       515 1 2 1 1 53 VAL H    A 53 . HN   1 1 
       516 1 1 1 1 49 ILE HB   A 49 . HB   1 1 
       516 1 2 1 1 50 SER H    A 50 . HN   1 1 
       517 1 1 1 1 49 ILE HB   A 49 . HB   1 1 
       517 1 2 1 1 51 SER H    A 51 . HN   1 1 
       518 1 1 1 1 49 ILE HB   A 49 . HB   1 1 
       518 1 2 1 1 53 VAL QG   A 53 . HG*  1 1 
       519 1 1 1 1 49 ILE MD   A 49 . HD1* 1 1 
       519 1 2 1 1 50 SER H    A 50 . HN   1 1 
       520 1 1 1 1 49 ILE QG   A 49 . HG1* 1 1 
       520 1 2 1 1 50 SER H    A 50 . HN   1 1 
       521 1 1 1 1 49 ILE MG   A 49 . HG2* 1 1 
       521 1 2 1 1 50 SER H    A 50 . HN   1 1 
       522 1 1 1 1 49 ILE MG   A 49 . HG2* 1 1 
       522 1 2 1 1 50 SER HA   A 50 . HA   1 1 
       523 1 1 1 1 49 ILE MG   A 49 . HG2* 1 1 
       523 1 2 1 1 50 SER QB   A 50 . HB*  1 1 
       524 1 1 1 1 49 ILE MG   A 49 . HG2* 1 1 
       524 1 2 1 1 51 SER H    A 51 . HN   1 1 
       525 1 1 1 1 49 ILE MG   A 49 . HG2* 1 1 
       525 1 2 1 1 53 VAL H    A 53 . HN   1 1 
       526 1 1 1 1 49 ILE MG   A 49 . HG2* 1 1 
       526 1 2 1 1 53 VAL HB   A 53 . HB   1 1 
       527 1 1 1 1 49 ILE MG   A 49 . HG2* 1 1 
       527 1 2 1 1 53 VAL QG   A 53 . HG*  1 1 
       528 1 1 1 1 50 SER H    A 50 . HN   1 1 
       528 1 2 1 1 50 SER QB   A 50 . HB*  1 1 
       529 1 1 1 1 50 SER H    A 50 . HN   1 1 
       529 1 2 1 1 51 SER H    A 51 . HN   1 1 
       530 1 1 1 1 50 SER HA   A 50 . HA   1 1 
       530 1 2 1 1 51 SER H    A 51 . HN   1 1 
       531 1 1 1 1 50 SER HA   A 50 . HA   1 1 
       531 1 2 1 1 51 SER HA   A 51 . HA   1 1 
       532 1 1 1 1 50 SER HA   A 50 . HA   1 1 
       532 1 2 1 1 53 VAL H    A 53 . HN   1 1 
       533 1 1 1 1 50 SER HA   A 50 . HA   1 1 
       533 1 2 1 1 53 VAL HB   A 53 . HB   1 1 
       534 1 1 1 1 50 SER HA   A 50 . HA   1 1 
       534 1 2 1 1 53 VAL MG1  A 53 . HG1* 1 1 
       535 1 1 1 1 50 SER HA   A 50 . HA   1 1 
       535 1 2 1 1 53 VAL MG2  A 53 . HG2* 1 1 
       536 1 1 1 1 50 SER HA   A 50 . HA   1 1 
       536 1 2 1 1 54 ASN H    A 54 . HN   1 1 
       537 1 1 1 1 50 SER QB   A 50 . HB*  1 1 
       537 1 2 1 1 51 SER H    A 51 . HN   1 1 
       538 1 1 1 1 50 SER QB   A 50 . HB*  1 1 
       538 1 2 1 1 53 VAL QG   A 53 . HG*  1 1 
       539 1 1 1 1 51 SER H    A 51 . HN   1 1 
       539 1 2 1 1 52 ILE HB   A 52 . HB   1 1 
       540 1 1 1 1 51 SER H    A 51 . HN   1 1 
       540 1 2 1 1 52 ILE MD   A 52 . HD1* 1 1 
       541 1 1 1 1 51 SER H    A 51 . HN   1 1 
       541 1 2 1 1 52 ILE HG12 A 52 . HG12 1 1 
       542 1 1 1 1 51 SER H    A 51 . HN   1 1 
       542 1 2 1 1 52 ILE HG13 A 52 . HG11 1 1 
       543 1 1 1 1 51 SER H    A 51 . HN   1 1 
       543 1 2 1 1 53 VAL QG   A 53 . HG*  1 1 
       544 1 1 1 1 51 SER HA   A 51 . HA   1 1 
       544 1 2 1 1 52 ILE H    A 52 . HN   1 1 
       545 1 1 1 1 51 SER HA   A 51 . HA   1 1 
       545 1 2 1 1 54 ASN H    A 54 . HN   1 1 
       546 1 1 1 1 51 SER HA   A 51 . HA   1 1 
       546 1 2 1 1 54 ASN QB   A 54 . HB*  1 1 
       547 1 1 1 1 51 SER HA   A 51 . HA   1 1 
       547 1 2 1 1 55 SER H    A 55 . HN   1 1 
       548 1 1 1 1 51 SER HB2  A 51 . HB2  1 1 
       548 1 2 1 1 52 ILE H    A 52 . HN   1 1 
       549 1 1 1 1 51 SER HB3  A 51 . HB1  1 1 
       549 1 2 1 1 52 ILE H    A 52 . HN   1 1 
       550 1 1 1 1 52 ILE H    A 52 . HN   1 1 
       550 1 2 1 1 52 ILE HB   A 52 . HB   1 1 
       551 1 1 1 1 52 ILE H    A 52 . HN   1 1 
       551 1 2 1 1 52 ILE MD   A 52 . HD1* 1 1 
       552 1 1 1 1 52 ILE H    A 52 . HN   1 1 
       552 1 2 1 1 52 ILE HG12 A 52 . HG12 1 1 
       553 1 1 1 1 52 ILE H    A 52 . HN   1 1 
       553 1 2 1 1 52 ILE HG13 A 52 . HG11 1 1 
       554 1 1 1 1 52 ILE H    A 52 . HN   1 1 
       554 1 2 1 1 53 VAL H    A 53 . HN   1 1 
       555 1 1 1 1 52 ILE H    A 52 . HN   1 1 
       555 1 2 1 1 53 VAL QG   A 53 . HG*  1 1 
       556 1 1 1 1 52 ILE HA   A 52 . HA   1 1 
       556 1 2 1 1 53 VAL H    A 53 . HN   1 1 
       557 1 1 1 1 52 ILE HA   A 52 . HA   1 1 
       557 1 2 1 1 55 SER H    A 55 . HN   1 1 
       558 1 1 1 1 52 ILE HA   A 52 . HA   1 1 
       558 1 2 1 1 58 TYR QD   A 58 . HD*  1 1 
       559 1 1 1 1 52 ILE HB   A 52 . HB   1 1 
       559 1 2 1 1 53 VAL H    A 53 . HN   1 1 
       560 1 1 1 1 52 ILE HB   A 52 . HB   1 1 
       560 1 2 1 1 53 VAL QG   A 53 . HG*  1 1 
       561 1 1 1 1 52 ILE MD   A 52 . HD1* 1 1 
       561 1 2 1 1 53 VAL H    A 53 . HN   1 1 
       562 1 1 1 1 52 ILE MD   A 52 . HD1* 1 1 
       562 1 2 1 1 61 VAL QG   A 61 . HG*  1 1 
       563 1 1 1 1 52 ILE MG   A 52 . HG2* 1 1 
       563 1 2 1 1 53 VAL H    A 53 . HN   1 1 
       564 1 1 1 1 53 VAL H    A 53 . HN   1 1 
       564 1 2 1 1 53 VAL HB   A 53 . HB   1 1 
       565 1 1 1 1 53 VAL H    A 53 . HN   1 1 
       565 1 2 1 1 54 ASN H    A 54 . HN   1 1 
       566 1 1 1 1 53 VAL H    A 53 . HN   1 1 
       566 1 2 1 1 54 ASN QB   A 54 . HB*  1 1 
       567 1 1 1 1 53 VAL HA   A 53 . HA   1 1 
       567 1 2 1 1 54 ASN H    A 54 . HN   1 1 
       568 1 1 1 1 53 VAL HB   A 53 . HB   1 1 
       568 1 2 1 1 54 ASN H    A 54 . HN   1 1 
       569 1 1 1 1 53 VAL QG   A 53 . HG*  1 1 
       569 1 2 1 1 54 ASN H    A 54 . HN   1 1 
       570 1 1 1 1 53 VAL QG   A 53 . HG*  1 1 
       570 1 2 1 1 54 ASN QB   A 54 . HB*  1 1 
       571 1 1 1 1 53 VAL QG   A 53 . HG*  1 1 
       571 1 2 1 1 54 ASN QD   A 54 . HD2* 1 1 
       572 1 1 1 1 53 VAL QG   A 53 . HG*  1 1 
       572 1 2 1 1 55 SER H    A 55 . HN   1 1 
       573 1 1 1 1 53 VAL MG2  A 53 . HG2* 1 1 
       573 1 2 1 1 54 ASN H    A 54 . HN   1 1 
       574 1 1 1 1 54 ASN H    A 54 . HN   1 1 
       574 1 2 1 1 54 ASN QB   A 54 . HB*  1 1 
       575 1 1 1 1 54 ASN H    A 54 . HN   1 1 
       575 1 2 1 1 54 ASN QD   A 54 . HD2* 1 1 
       576 1 1 1 1 54 ASN H    A 54 . HN   1 1 
       576 1 2 1 1 55 SER H    A 55 . HN   1 1 
       577 1 1 1 1 54 ASN H    A 54 . HN   1 1 
       577 1 2 1 1 55 SER HA   A 55 . HA   1 1 
       578 1 1 1 1 54 ASN H    A 54 . HN   1 1 
       578 1 2 1 1 55 SER QB   A 55 . HB*  1 1 
       579 1 1 1 1 54 ASN HA   A 54 . HA   1 1 
       579 1 2 1 1 55 SER H    A 55 . HN   1 1 
       580 1 1 1 1 54 ASN HA   A 54 . HA   1 1 
       580 1 2 1 1 55 SER QB   A 55 . HB*  1 1 
       581 1 1 1 1 54 ASN QB   A 54 . HB*  1 1 
       581 1 2 1 1 55 SER H    A 55 . HN   1 1 
       582 1 1 1 1 54 ASN QB   A 54 . HB*  1 1 
       582 1 2 1 1 55 SER QB   A 55 . HB*  1 1 
       583 1 1 1 1 54 ASN QB   A 54 . HB*  1 1 
       583 1 2 1 1 56 THR MG   A 56 . HG2* 1 1 
       584 1 1 1 1 55 SER H    A 55 . HN   1 1 
       584 1 2 1 1 56 THR H    A 56 . HN   1 1 
       585 1 1 1 1 55 SER HA   A 55 . HA   1 1 
       585 1 2 1 1 56 THR H    A 56 . HN   1 1 
       586 1 1 1 1 55 SER HA   A 55 . HA   1 1 
       586 1 2 1 1 57 TYR H    A 57 . HN   1 1 
       587 1 1 1 1 55 SER QB   A 55 . HB*  1 1 
       587 1 2 1 1 56 THR H    A 56 . HN   1 1 
       588 1 1 1 1 55 SER QB   A 55 . HB*  1 1 
       588 1 2 1 1 56 THR MG   A 56 . HG2* 1 1 
       589 1 1 1 1 55 SER QB   A 55 . HB*  1 1 
       589 1 2 1 1 57 TYR H    A 57 . HN   1 1 
       590 1 1 1 1 56 THR H    A 56 . HN   1 1 
       590 1 2 1 1 57 TYR H    A 57 . HN   1 1 
       591 1 1 1 1 56 THR HA   A 56 . HA   1 1 
       591 1 2 1 1 57 TYR H    A 57 . HN   1 1 
       592 1 1 1 1 56 THR HB   A 56 . HB   1 1 
       592 1 2 1 1 57 TYR H    A 57 . HN   1 1 
       593 1 1 1 1 56 THR MG   A 56 . HG2* 1 1 
       593 1 2 1 1 57 TYR QD   A 57 . HD*  1 1 
       594 1 1 1 1 56 THR MG   A 56 . HG2* 1 1 
       594 1 2 1 1 57 TYR QE   A 57 . HE*  1 1 
       595 1 1 1 1 57 TYR H    A 57 . HN   1 1 
       595 1 2 1 1 57 TYR QD   A 57 . HD*  1 1 
       596 1 1 1 1 57 TYR H    A 57 . HN   1 1 
       596 1 2 1 1 58 TYR H    A 58 . HN   1 1 
       597 1 1 1 1 57 TYR HA   A 57 . HA   1 1 
       597 1 2 1 1 58 TYR H    A 58 . HN   1 1 
       598 1 1 1 1 57 TYR HB2  A 57 . HB2  1 1 
       598 1 2 1 1 58 TYR H    A 58 . HN   1 1 
       599 1 1 1 1 57 TYR HB3  A 57 . HB1  1 1 
       599 1 2 1 1 58 TYR H    A 58 . HN   1 1 
       600 1 1 1 1 57 TYR QD   A 57 . HD*  1 1 
       600 1 2 1 1 58 TYR H    A 58 . HN   1 1 
       601 1 1 1 1 57 TYR QD   A 57 . HD*  1 1 
       601 1 2 1 1 58 TYR HA   A 58 . HA   1 1 
       602 1 1 1 1 58 TYR H    A 58 . HN   1 1 
       602 1 2 1 1 58 TYR QD   A 58 . HD*  1 1 
       603 1 1 1 1 58 TYR H    A 58 . HN   1 1 
       603 1 2 1 1 59 ALA H    A 59 . HN   1 1 
       604 1 1 1 1 58 TYR H    A 58 . HN   1 1 
       604 1 2 1 1 59 ALA HA   A 59 . HA   1 1 
       605 1 1 1 1 58 TYR HA   A 58 . HA   1 1 
       605 1 2 1 1 59 ALA H    A 59 . HN   1 1 
       606 1 1 1 1 58 TYR QD   A 58 . HD*  1 1 
       606 1 2 1 1 59 ALA H    A 59 . HN   1 1 
       607 1 1 1 1 58 TYR QD   A 58 . HD*  1 1 
       607 1 2 1 1 61 VAL QG   A 61 . HG*  1 1 
       608 1 1 1 1 59 ALA H    A 59 . HN   1 1 
       608 1 2 1 1 60 ASN H    A 60 . HN   1 1 
       609 1 1 1 1 59 ALA HA   A 59 . HA   1 1 
       609 1 2 1 1 60 ASN H    A 60 . HN   1 1 
       610 1 1 1 1 59 ALA MB   A 59 . HB*  1 1 
       610 1 2 1 1 60 ASN H    A 60 . HN   1 1 
       611 1 1 1 1 60 ASN H    A 60 . HN   1 1 
       611 1 2 1 1 61 VAL H    A 61 . HN   1 1 
       612 1 1 1 1 60 ASN HA   A 60 . HA   1 1 
       612 1 2 1 1 61 VAL H    A 61 . HN   1 1 
       613 1 1 1 1 60 ASN HA   A 60 . HA   1 1 
       613 1 2 1 1 61 VAL QG   A 61 . HG*  1 1 
       614 1 1 1 1 60 ASN HB2  A 60 . HB2  1 1 
       614 1 2 1 1 61 VAL H    A 61 . HN   1 1 
       615 1 1 1 1 60 ASN HB3  A 60 . HB1  1 1 
       615 1 2 1 1 61 VAL H    A 61 . HN   1 1 
       616 1 1 1 1 61 VAL H    A 61 . HN   1 1 
       616 1 2 1 1 61 VAL HB   A 61 . HB   1 1 
       617 1 1 1 1 61 VAL H    A 61 . HN   1 1 
       617 1 2 1 1 62 SER H    A 62 . HN   1 1 
       618 1 1 1 1 61 VAL HA   A 61 . HA   1 1 
       618 1 2 1 1 62 SER H    A 62 . HN   1 1 
       619 1 1 1 1 61 VAL HB   A 61 . HB   1 1 
       619 1 2 1 1 62 SER H    A 62 . HN   1 1 
       620 1 1 1 1 61 VAL QG   A 61 . HG*  1 1 
       620 1 2 1 1 62 SER H    A 62 . HN   1 1 
       621 1 1 1 1 61 VAL QG   A 61 . HG*  1 1 
       621 1 2 1 1 65 LYS H    A 65 . HN   1 1 
       622 1 1 1 1 61 VAL QG   A 61 . HG*  1 1 
       622 1 2 1 1 65 LYS HB2  A 65 . HB2  1 1 
       623 1 1 1 1 61 VAL QG   A 61 . HG*  1 1 
       623 1 2 1 1 65 LYS HB3  A 65 . HB1  1 1 
       624 1 1 1 1 61 VAL QG   A 61 . HG*  1 1 
       624 1 2 1 1 65 LYS QE   A 65 . HE*  1 1 
       625 1 1 1 1 61 VAL QG   A 61 . HG*  1 1 
       625 1 2 1 1 65 LYS HG2  A 65 . HG2  1 1 
       626 1 1 1 1 61 VAL QG   A 61 . HG*  1 1 
       626 1 2 1 1 65 LYS HG3  A 65 . HG1  1 1 
       627 1 1 1 1 61 VAL QG   A 61 . HG*  1 1 
       627 1 2 1 1 66 CYS H    A 66 . HN   1 1 
       628 1 1 1 1 62 SER H    A 62 . HN   1 1 
       628 1 2 1 1 65 LYS H    A 65 . HN   1 1 
       629 1 1 1 1 62 SER HA   A 62 . HA   1 1 
       629 1 2 1 1 63 ALA H    A 63 . HN   1 1 
       630 1 1 1 1 62 SER HA   A 62 . HA   1 1 
       630 1 2 1 1 63 ALA MB   A 63 . HB*  1 1 
       631 1 1 1 1 62 SER QB   A 62 . HB*  1 1 
       631 1 2 1 1 64 ALA MB   A 64 . HB*  1 1 
       632 1 1 1 1 62 SER HB2  A 62 . HB2  1 1 
       632 1 2 1 1 63 ALA H    A 63 . HN   1 1 
       633 1 1 1 1 62 SER HB2  A 62 . HB2  1 1 
       633 1 2 1 1 64 ALA H    A 64 . HN   1 1 
       634 1 1 1 1 62 SER HB2  A 62 . HB2  1 1 
       634 1 2 1 1 65 LYS H    A 65 . HN   1 1 
       635 1 1 1 1 62 SER HB3  A 62 . HB1  1 1 
       635 1 2 1 1 63 ALA H    A 63 . HN   1 1 
       636 1 1 1 1 62 SER HB3  A 62 . HB1  1 1 
       636 1 2 1 1 64 ALA H    A 64 . HN   1 1 
       637 1 1 1 1 62 SER HB3  A 62 . HB1  1 1 
       637 1 2 1 1 65 LYS H    A 65 . HN   1 1 
       638 1 1 1 1 63 ALA H    A 63 . HN   1 1 
       638 1 2 1 1 64 ALA H    A 64 . HN   1 1 
       639 1 1 1 1 63 ALA HA   A 63 . HA   1 1 
       639 1 2 1 1 64 ALA H    A 64 . HN   1 1 
       640 1 1 1 1 63 ALA HA   A 63 . HA   1 1 
       640 1 2 1 1 66 CYS H    A 66 . HN   1 1 
       641 1 1 1 1 63 ALA HA   A 63 . HA   1 1 
       641 1 2 1 1 66 CYS HB2  A 66 . HB2  1 1 
       642 1 1 1 1 63 ALA MB   A 63 . HB*  1 1 
       642 1 2 1 1 64 ALA H    A 64 . HN   1 1 
       643 1 1 1 1 64 ALA H    A 64 . HN   1 1 
       643 1 2 1 1 65 LYS H    A 65 . HN   1 1 
       644 1 1 1 1 64 ALA HA   A 64 . HA   1 1 
       644 1 2 1 1 65 LYS H    A 65 . HN   1 1 
       645 1 1 1 1 64 ALA HA   A 64 . HA   1 1 
       645 1 2 1 1 67 GLN H    A 67 . HN   1 1 
       646 1 1 1 1 64 ALA HA   A 64 . HA   1 1 
       646 1 2 1 1 67 GLN HB2  A 67 . HB2  1 1 
       647 1 1 1 1 64 ALA HA   A 64 . HA   1 1 
       647 1 2 1 1 67 GLN QG   A 67 . HG*  1 1 
       648 1 1 1 1 64 ALA HA   A 64 . HA   1 1 
       648 1 2 1 1 68 GLU H    A 68 . HN   1 1 
       649 1 1 1 1 64 ALA MB   A 64 . HB*  1 1 
       649 1 2 1 1 65 LYS H    A 65 . HN   1 1 
       650 1 1 1 1 64 ALA MB   A 64 . HB*  1 1 
       650 1 2 1 1 67 GLN QB   A 67 . HB*  1 1 
       651 1 1 1 1 64 ALA MB   A 64 . HB*  1 1 
       651 1 2 1 1 68 GLU H    A 68 . HN   1 1 
       652 1 1 1 1 65 LYS H    A 65 . HN   1 1 
       652 1 2 1 1 65 LYS QE   A 65 . HE*  1 1 
       653 1 1 1 1 65 LYS H    A 65 . HN   1 1 
       653 1 2 1 1 65 LYS HG2  A 65 . HG2  1 1 
       654 1 1 1 1 65 LYS H    A 65 . HN   1 1 
       654 1 2 1 1 65 LYS HG3  A 65 . HG1  1 1 
       655 1 1 1 1 65 LYS H    A 65 . HN   1 1 
       655 1 2 1 1 66 CYS H    A 66 . HN   1 1 
       656 1 1 1 1 65 LYS HA   A 65 . HA   1 1 
       656 1 2 1 1 65 LYS QE   A 65 . HE*  1 1 
       657 1 1 1 1 65 LYS HA   A 65 . HA   1 1 
       657 1 2 1 1 66 CYS H    A 66 . HN   1 1 
       658 1 1 1 1 65 LYS HA   A 65 . HA   1 1 
       658 1 2 1 1 68 GLU H    A 68 . HN   1 1 
       659 1 1 1 1 65 LYS HA   A 65 . HA   1 1 
       659 1 2 1 1 68 GLU QB   A 68 . HB*  1 1 
       660 1 1 1 1 65 LYS HA   A 65 . HA   1 1 
       660 1 2 1 1 68 GLU QG   A 68 . HG*  1 1 
       661 1 1 1 1 65 LYS HA   A 65 . HA   1 1 
       661 1 2 1 1 69 PHE H    A 69 . HN   1 1 
       662 1 1 1 1 65 LYS HB2  A 65 . HB2  1 1 
       662 1 2 1 1 66 CYS H    A 66 . HN   1 1 
       663 1 1 1 1 65 LYS HB3  A 65 . HB1  1 1 
       663 1 2 1 1 66 CYS H    A 66 . HN   1 1 
       664 1 1 1 1 65 LYS QE   A 65 . HE*  1 1 
       664 1 2 1 1 66 CYS H    A 66 . HN   1 1 
       665 1 1 1 1 65 LYS HG2  A 65 . HG2  1 1 
       665 1 2 1 1 66 CYS H    A 66 . HN   1 1 
       666 1 1 1 1 65 LYS HG3  A 65 . HG1  1 1 
       666 1 2 1 1 66 CYS H    A 66 . HN   1 1 
       667 1 1 1 1 66 CYS H    A 66 . HN   1 1 
       667 1 2 1 1 67 GLN H    A 67 . HN   1 1 
       668 1 1 1 1 66 CYS HA   A 66 . HA   1 1 
       668 1 2 1 1 67 GLN H    A 67 . HN   1 1 
       669 1 1 1 1 66 CYS HA   A 66 . HA   1 1 
       669 1 2 1 1 69 PHE H    A 69 . HN   1 1 
       670 1 1 1 1 66 CYS HA   A 66 . HA   1 1 
       670 1 2 1 1 69 PHE QB   A 69 . HB*  1 1 
       671 1 1 1 1 66 CYS HB2  A 66 . HB2  1 1 
       671 1 2 1 1 67 GLN H    A 67 . HN   1 1 
       672 1 1 1 1 66 CYS HB3  A 66 . HB1  1 1 
       672 1 2 1 1 67 GLN H    A 67 . HN   1 1 
       673 1 1 1 1 67 GLN H    A 67 . HN   1 1 
       673 1 2 1 1 67 GLN QE   A 67 . HE*  1 1 
       674 1 1 1 1 67 GLN H    A 67 . HN   1 1 
       674 1 2 1 1 68 GLU H    A 68 . HN   1 1 
       675 1 1 1 1 67 GLN HA   A 67 . HA   1 1 
       675 1 2 1 1 67 GLN QE   A 67 . HE*  1 1 
       676 1 1 1 1 67 GLN HA   A 67 . HA   1 1 
       676 1 2 1 1 68 GLU H    A 68 . HN   1 1 
       677 1 1 1 1 67 GLN HA   A 67 . HA   1 1 
       677 1 2 1 1 68 GLU HA   A 68 . HA   1 1 
       678 1 1 1 1 67 GLN HA   A 67 . HA   1 1 
       678 1 2 1 1 70 GLY H    A 70 . HN   1 1 
       679 1 1 1 1 67 GLN HA   A 67 . HA   1 1 
       679 1 2 1 1 71 ARG H    A 71 . HN   1 1 
       680 1 1 1 1 67 GLN QB   A 67 . HB*  1 1 
       680 1 2 1 1 68 GLU HA   A 68 . HA   1 1 
       681 1 1 1 1 67 GLN HB2  A 67 . HB2  1 1 
       681 1 2 1 1 68 GLU H    A 68 . HN   1 1 
       682 1 1 1 1 67 GLN HB3  A 67 . HB1  1 1 
       682 1 2 1 1 68 GLU H    A 68 . HN   1 1 
       683 1 1 1 1 67 GLN QG   A 67 . HG*  1 1 
       683 1 2 1 1 68 GLU H    A 68 . HN   1 1 
       684 1 1 1 1 68 GLU H    A 68 . HN   1 1 
       684 1 2 1 1 68 GLU QB   A 68 . HB*  1 1 
       685 1 1 1 1 68 GLU H    A 68 . HN   1 1 
       685 1 2 1 1 69 PHE H    A 69 . HN   1 1 
       686 1 1 1 1 68 GLU HA   A 68 . HA   1 1 
       686 1 2 1 1 69 PHE H    A 69 . HN   1 1 
       687 1 1 1 1 68 GLU HA   A 68 . HA   1 1 
       687 1 2 1 1 71 ARG H    A 71 . HN   1 1 
       688 1 1 1 1 68 GLU HA   A 68 . HA   1 1 
       688 1 2 1 1 71 ARG HB2  A 71 . HB2  1 1 
       689 1 1 1 1 68 GLU HA   A 68 . HA   1 1 
       689 1 2 1 1 71 ARG HB3  A 71 . HB1  1 1 
       690 1 1 1 1 68 GLU HA   A 68 . HA   1 1 
       690 1 2 1 1 72 TRP H    A 72 . HN   1 1 
       691 1 1 1 1 68 GLU QB   A 68 . HB*  1 1 
       691 1 2 1 1 69 PHE H    A 69 . HN   1 1 
       692 1 1 1 1 68 GLU QG   A 68 . HG*  1 1 
       692 1 2 1 1 69 PHE H    A 69 . HN   1 1 
       693 1 1 1 1 69 PHE H    A 69 . HN   1 1 
       693 1 2 1 1 69 PHE QD   A 69 . HD*  1 1 
       694 1 1 1 1 69 PHE H    A 69 . HN   1 1 
       694 1 2 1 1 70 GLY H    A 70 . HN   1 1 
       695 1 1 1 1 69 PHE H    A 69 . HN   1 1 
       695 1 2 1 1 70 GLY QA   A 70 . HA*  1 1 
       696 1 1 1 1 69 PHE HA   A 69 . HA   1 1 
       696 1 2 1 1 70 GLY H    A 70 . HN   1 1 
       697 1 1 1 1 69 PHE HA   A 69 . HA   1 1 
       697 1 2 1 1 70 GLY QA   A 70 . HA*  1 1 
       698 1 1 1 1 69 PHE HA   A 69 . HA   1 1 
       698 1 2 1 1 72 TRP H    A 72 . HN   1 1 
       699 1 1 1 1 69 PHE HA   A 69 . HA   1 1 
       699 1 2 1 1 72 TRP QB   A 72 . HB*  1 1 
       700 1 1 1 1 69 PHE HA   A 69 . HA   1 1 
       700 1 2 1 1 72 TRP HE3  A 72 . HE3  1 1 
       701 1 1 1 1 69 PHE HA   A 69 . HA   1 1 
       701 1 2 1 1 73 TYR H    A 73 . HN   1 1 
       702 1 1 1 1 69 PHE HB2  A 69 . HB2  1 1 
       702 1 2 1 1 70 GLY H    A 70 . HN   1 1 
       703 1 1 1 1 69 PHE HB3  A 69 . HB1  1 1 
       703 1 2 1 1 70 GLY H    A 70 . HN   1 1 
       704 1 1 1 1 69 PHE QD   A 69 . HD*  1 1 
       704 1 2 1 1 70 GLY H    A 70 . HN   1 1 
       705 1 1 1 1 69 PHE QD   A 69 . HD*  1 1 
       705 1 2 1 1 70 GLY QA   A 70 . HA*  1 1 
       706 1 1 1 1 69 PHE QD   A 69 . HD*  1 1 
       706 1 2 1 1 73 TYR H    A 73 . HN   1 1 
       707 1 1 1 1 69 PHE QE   A 69 . HE*  1 1 
       707 1 2 1 1 72 TRP HE3  A 72 . HE3  1 1 
       708 1 1 1 1 69 PHE QE   A 69 . HE*  1 1 
       708 1 2 1 1 72 TRP HZ3  A 72 . HZ3  1 1 
       709 1 1 1 1 69 PHE HZ   A 69 . HZ   1 1 
       709 1 2 1 1 72 TRP HZ3  A 72 . HZ3  1 1 
       710 1 1 1 1 70 GLY H    A 70 . HN   1 1 
       710 1 2 1 1 71 ARG H    A 71 . HN   1 1 
       711 1 1 1 1 70 GLY QA   A 70 . HA*  1 1 
       711 1 2 1 1 71 ARG H    A 71 . HN   1 1 
       712 1 1 1 1 70 GLY QA   A 70 . HA*  1 1 
       712 1 2 1 1 73 TYR H    A 73 . HN   1 1 
       713 1 1 1 1 70 GLY QA   A 70 . HA*  1 1 
       713 1 2 1 1 73 TYR HB2  A 73 . HB2  1 1 
       714 1 1 1 1 70 GLY QA   A 70 . HA*  1 1 
       714 1 2 1 1 73 TYR HB3  A 73 . HB1  1 1 
       715 1 1 1 1 70 GLY QA   A 70 . HA*  1 1 
       715 1 2 1 1 73 TYR QD   A 73 . HD*  1 1 
       716 1 1 1 1 70 GLY QA   A 70 . HA*  1 1 
       716 1 2 1 1 74 LYS H    A 74 . HN   1 1 
       717 1 1 1 1 71 ARG H    A 71 . HN   1 1 
       717 1 2 1 1 71 ARG QD   A 71 . HD*  1 1 
       718 1 1 1 1 71 ARG H    A 71 . HN   1 1 
       718 1 2 1 1 71 ARG HG2  A 71 . HG2  1 1 
       719 1 1 1 1 71 ARG H    A 71 . HN   1 1 
       719 1 2 1 1 71 ARG HG3  A 71 . HG1  1 1 
       720 1 1 1 1 71 ARG H    A 71 . HN   1 1 
       720 1 2 1 1 72 TRP QB   A 72 . HB*  1 1 
       721 1 1 1 1 71 ARG HA   A 71 . HA   1 1 
       721 1 2 1 1 71 ARG HD2  A 71 . HD2  1 1 
       722 1 1 1 1 71 ARG HA   A 71 . HA   1 1 
       722 1 2 1 1 71 ARG HD3  A 71 . HD1  1 1 
       723 1 1 1 1 71 ARG HA   A 71 . HA   1 1 
       723 1 2 1 1 72 TRP H    A 72 . HN   1 1 
       724 1 1 1 1 71 ARG HA   A 71 . HA   1 1 
       724 1 2 1 1 74 LYS H    A 74 . HN   1 1 
       725 1 1 1 1 71 ARG HA   A 71 . HA   1 1 
       725 1 2 1 1 74 LYS QB   A 74 . HB*  1 1 
       726 1 1 1 1 71 ARG QB   A 71 . HB*  1 1 
       726 1 2 1 1 72 TRP H    A 72 . HN   1 1 
       727 1 1 1 1 71 ARG QD   A 71 . HD*  1 1 
       727 1 2 1 1 72 TRP HA   A 72 . HA   1 1 
       728 1 1 1 1 71 ARG QG   A 71 . HG*  1 1 
       728 1 2 1 1 72 TRP H    A 72 . HN   1 1 
       729 1 1 1 1 72 TRP H    A 72 . HN   1 1 
       729 1 2 1 1 72 TRP HE3  A 72 . HE3  1 1 
       730 1 1 1 1 72 TRP H    A 72 . HN   1 1 
       730 1 2 1 1 73 TYR H    A 73 . HN   1 1 
       731 1 1 1 1 72 TRP HA   A 72 . HA   1 1 
       731 1 2 1 1 73 TYR H    A 73 . HN   1 1 
       732 1 1 1 1 72 TRP HA   A 72 . HA   1 1 
       732 1 2 1 1 75 HIS H    A 75 . HN   1 1 
       733 1 1 1 1 72 TRP HA   A 72 . HA   1 1 
       733 1 2 1 1 75 HIS HB2  A 75 . HB2  1 1 
       734 1 1 1 1 72 TRP HA   A 72 . HA   1 1 
       734 1 2 1 1 75 HIS HB3  A 75 . HB1  1 1 
       735 1 1 1 1 72 TRP HA   A 72 . HA   1 1 
       735 1 2 1 1 76 PHE H    A 76 . HN   1 1 
       736 1 1 1 1 72 TRP QB   A 72 . HB*  1 1 
       736 1 2 1 1 73 TYR H    A 73 . HN   1 1 
       737 1 1 1 1 72 TRP HE1  A 72 . HE1  1 1 
       737 1 2 1 1 76 PHE QB   A 76 . HB*  1 1 
       738 1 1 1 1 72 TRP HE1  A 72 . HE1  1 1 
       738 1 2 1 1 76 PHE QD   A 76 . HD*  1 1 
       739 1 1 1 1 72 TRP HE3  A 72 . HE3  1 1 
       739 1 2 1 1 73 TYR H    A 73 . HN   1 1 
       740 1 1 1 1 72 TRP HE3  A 72 . HE3  1 1 
       740 1 2 1 1 73 TYR HA   A 73 . HA   1 1 
       741 1 1 1 1 72 TRP HE3  A 72 . HE3  1 1 
       741 1 2 1 1 73 TYR HB2  A 73 . HB2  1 1 
       742 1 1 1 1 72 TRP HE3  A 72 . HE3  1 1 
       742 1 2 1 1 73 TYR HB3  A 73 . HB1  1 1 
       743 1 1 1 1 73 TYR H    A 73 . HN   1 1 
       743 1 2 1 1 73 TYR QD   A 73 . HD*  1 1 
       744 1 1 1 1 73 TYR H    A 73 . HN   1 1 
       744 1 2 1 1 74 LYS H    A 74 . HN   1 1 
       745 1 1 1 1 73 TYR HA   A 73 . HA   1 1 
       745 1 2 1 1 74 LYS H    A 74 . HN   1 1 
       746 1 1 1 1 73 TYR HA   A 73 . HA   1 1 
       746 1 2 1 1 75 HIS H    A 75 . HN   1 1 
       747 1 1 1 1 73 TYR HA   A 73 . HA   1 1 
       747 1 2 1 1 76 PHE H    A 76 . HN   1 1 
       748 1 1 1 1 73 TYR HA   A 73 . HA   1 1 
       748 1 2 1 1 76 PHE HB2  A 76 . HB2  1 1 
       749 1 1 1 1 73 TYR HA   A 73 . HA   1 1 
       749 1 2 1 1 76 PHE HB3  A 76 . HB1  1 1 
       750 1 1 1 1 73 TYR HA   A 73 . HA   1 1 
       750 1 2 1 1 76 PHE QD   A 76 . HD*  1 1 
       751 1 1 1 1 73 TYR HA   A 73 . HA   1 1 
       751 1 2 1 1 77 LYS H    A 77 . HN   1 1 
       752 1 1 1 1 73 TYR HB2  A 73 . HB2  1 1 
       752 1 2 1 1 74 LYS H    A 74 . HN   1 1 
       753 1 1 1 1 73 TYR HB3  A 73 . HB1  1 1 
       753 1 2 1 1 74 LYS H    A 74 . HN   1 1 
       754 1 1 1 1 73 TYR QD   A 73 . HD*  1 1 
       754 1 2 1 1 74 LYS HA   A 74 . HA   1 1 
       755 1 1 1 1 73 TYR QD   A 73 . HD*  1 1 
       755 1 2 1 1 76 PHE HB2  A 76 . HB2  1 1 
       756 1 1 1 1 73 TYR QD   A 73 . HD*  1 1 
       756 1 2 1 1 76 PHE HB3  A 76 . HB1  1 1 
       757 1 1 1 1 73 TYR QD   A 73 . HD*  1 1 
       757 1 2 1 1 77 LYS QD   A 77 . HD*  1 1 
       758 1 1 1 1 73 TYR QD   A 73 . HD*  1 1 
       758 1 2 1 1 77 LYS QG   A 77 . HG*  1 1 
       759 1 1 1 1 73 TYR QE   A 73 . HE*  1 1 
       759 1 2 1 1 77 LYS QE   A 77 . HE*  1 1 
       760 1 1 1 1 73 TYR QE   A 73 . HE*  1 1 
       760 1 2 1 1 77 LYS QG   A 77 . HG*  1 1 
       761 1 1 1 1 74 LYS H    A 74 . HN   1 1 
       761 1 2 1 1 74 LYS QE   A 74 . HE*  1 1 
       762 1 1 1 1 74 LYS H    A 74 . HN   1 1 
       762 1 2 1 1 74 LYS HG2  A 74 . HG2  1 1 
       763 1 1 1 1 74 LYS H    A 74 . HN   1 1 
       763 1 2 1 1 74 LYS HG3  A 74 . HG1  1 1 
       764 1 1 1 1 74 LYS H    A 74 . HN   1 1 
       764 1 2 1 1 75 HIS H    A 75 . HN   1 1 
       765 1 1 1 1 74 LYS H    A 74 . HN   1 1 
       765 1 2 1 1 75 HIS QB   A 75 . HB*  1 1 
       766 1 1 1 1 74 LYS H    A 74 . HN   1 1 
       766 1 2 1 1 77 LYS H    A 77 . HN   1 1 
       767 1 1 1 1 74 LYS HA   A 74 . HA   1 1 
       767 1 2 1 1 75 HIS H    A 75 . HN   1 1 
       768 1 1 1 1 74 LYS HA   A 74 . HA   1 1 
       768 1 2 1 1 77 LYS H    A 77 . HN   1 1 
       769 1 1 1 1 74 LYS HA   A 74 . HA   1 1 
       769 1 2 1 1 77 LYS QB   A 77 . HB*  1 1 
       770 1 1 1 1 74 LYS HB2  A 74 . HB2  1 1 
       770 1 2 1 1 75 HIS H    A 75 . HN   1 1 
       771 1 1 1 1 74 LYS HB3  A 74 . HB1  1 1 
       771 1 2 1 1 75 HIS H    A 75 . HN   1 1 
       772 1 1 1 1 74 LYS HG2  A 74 . HG2  1 1 
       772 1 2 1 1 75 HIS H    A 75 . HN   1 1 
       773 1 1 1 1 74 LYS HG3  A 74 . HG1  1 1 
       773 1 2 1 1 75 HIS H    A 75 . HN   1 1 
       774 1 1 1 1 75 HIS H    A 75 . HN   1 1 
       774 1 2 1 1 75 HIS HB2  A 75 . HB2  1 1 
       775 1 1 1 1 75 HIS H    A 75 . HN   1 1 
       775 1 2 1 1 75 HIS HB3  A 75 . HB1  1 1 
       776 1 1 1 1 75 HIS H    A 75 . HN   1 1 
       776 1 2 1 1 76 PHE H    A 76 . HN   1 1 
       777 1 1 1 1 75 HIS HA   A 75 . HA   1 1 
       777 1 2 1 1 76 PHE H    A 76 . HN   1 1 
       778 1 1 1 1 75 HIS HA   A 75 . HA   1 1 
       778 1 2 1 1 78 LYS H    A 78 . HN   1 1 
       779 1 1 1 1 75 HIS HA   A 75 . HA   1 1 
       779 1 2 1 1 78 LYS QB   A 78 . HB*  1 1 
       780 1 1 1 1 75 HIS HA   A 75 . HA   1 1 
       780 1 2 1 1 78 LYS QG   A 78 . HG*  1 1 
       781 1 1 1 1 75 HIS HB2  A 75 . HB2  1 1 
       781 1 2 1 1 76 PHE H    A 76 . HN   1 1 
       782 1 1 1 1 75 HIS HB3  A 75 . HB1  1 1 
       782 1 2 1 1 76 PHE H    A 76 . HN   1 1 
       783 1 1 1 1 76 PHE H    A 76 . HN   1 1 
       783 1 2 1 1 76 PHE HB2  A 76 . HB2  1 1 
       784 1 1 1 1 76 PHE H    A 76 . HN   1 1 
       784 1 2 1 1 76 PHE HB3  A 76 . HB1  1 1 
       785 1 1 1 1 76 PHE H    A 76 . HN   1 1 
       785 1 2 1 1 76 PHE QD   A 76 . HD*  1 1 
       786 1 1 1 1 76 PHE H    A 76 . HN   1 1 
       786 1 2 1 1 77 LYS H    A 77 . HN   1 1 
       787 1 1 1 1 76 PHE HA   A 76 . HA   1 1 
       787 1 2 1 1 77 LYS H    A 77 . HN   1 1 
       788 1 1 1 1 76 PHE QB   A 76 . HB*  1 1 
       788 1 2 1 1 77 LYS HA   A 77 . HA   1 1 
       789 1 1 1 1 76 PHE HB2  A 76 . HB2  1 1 
       789 1 2 1 1 77 LYS H    A 77 . HN   1 1 
       790 1 1 1 1 76 PHE HB3  A 76 . HB1  1 1 
       790 1 2 1 1 77 LYS H    A 77 . HN   1 1 
       791 1 1 1 1 76 PHE QD   A 76 . HD*  1 1 
       791 1 2 1 1 77 LYS H    A 77 . HN   1 1 
       792 1 1 1 1 76 PHE QD   A 76 . HD*  1 1 
       792 1 2 1 1 77 LYS HA   A 77 . HA   1 1 
       793 1 1 1 1 76 PHE QD   A 76 . HD*  1 1 
       793 1 2 1 1 77 LYS QG   A 77 . HG*  1 1 
       794 1 1 1 1 77 LYS H    A 77 . HN   1 1 
       794 1 2 1 1 77 LYS QD   A 77 . HD*  1 1 
       795 1 1 1 1 77 LYS H    A 77 . HN   1 1 
       795 1 2 1 1 78 LYS H    A 78 . HN   1 1 
       796 1 1 1 1 77 LYS HA   A 77 . HA   1 1 
       796 1 2 1 1 78 LYS H    A 78 . HN   1 1 
       797 1 1 1 1 77 LYS QB   A 77 . HB*  1 1 
       797 1 2 1 1 79 THR H    A 79 . HN   1 1 
       798 1 1 1 1 77 LYS HB2  A 77 . HB2  1 1 
       798 1 2 1 1 78 LYS H    A 78 . HN   1 1 
       799 1 1 1 1 77 LYS HB3  A 77 . HB1  1 1 
       799 1 2 1 1 78 LYS H    A 78 . HN   1 1 
       800 1 1 1 1 77 LYS QG   A 77 . HG*  1 1 
       800 1 2 1 1 78 LYS H    A 78 . HN   1 1 
       801 1 1 1 1 78 LYS H    A 78 . HN   1 1 
       801 1 2 1 1 78 LYS QB   A 78 . HB*  1 1 
       802 1 1 1 1 78 LYS H    A 78 . HN   1 1 
       802 1 2 1 1 78 LYS HG2  A 78 . HG2  1 1 
       803 1 1 1 1 78 LYS H    A 78 . HN   1 1 
       803 1 2 1 1 78 LYS HG3  A 78 . HG1  1 1 
       804 1 1 1 1 78 LYS H    A 78 . HN   1 1 
       804 1 2 1 1 79 THR H    A 79 . HN   1 1 
       805 1 1 1 1 78 LYS HA   A 78 . HA   1 1 
       805 1 2 1 1 79 THR H    A 79 . HN   1 1 
       806 1 1 1 1 78 LYS HA   A 78 . HA   1 1 
       806 1 2 1 1 80 LYS H    A 80 . HN   1 1 
       807 1 1 1 1 78 LYS QB   A 78 . HB*  1 1 
       807 1 2 1 1 79 THR H    A 79 . HN   1 1 
       808 1 1 1 1 78 LYS QG   A 78 . HG*  1 1 
       808 1 2 1 1 79 THR H    A 79 . HN   1 1 
       809 1 1 1 1 79 THR H    A 79 . HN   1 1 
       809 1 2 1 1 80 LYS H    A 80 . HN   1 1 
       810 1 1 1 1 79 THR HA   A 79 . HA   1 1 
       810 1 2 1 1 80 LYS H    A 80 . HN   1 1 
       811 1 1 1 1 79 THR HB   A 79 . HB   1 1 
       811 1 2 1 1 80 LYS H    A 80 . HN   1 1 
       812 1 1 1 1 79 THR MG   A 79 . HG2* 1 1 
       812 1 2 1 1 80 LYS H    A 80 . HN   1 1 
       813 1 1 1 1 80 LYS H    A 80 . HN   1 1 
       813 1 2 1 1 81 ASP H    A 81 . HN   1 1 
       814 1 1 1 1 80 LYS HA   A 80 . HA   1 1 
       814 1 2 1 1 81 ASP H    A 81 . HN   1 1 
       815 1 1 1 1 80 LYS HA   A 80 . HA   1 1 
       815 1 2 1 1 81 ASP HA   A 81 . HA   1 1 
       816 1 1 1 1 80 LYS HA   A 80 . HA   1 1 
       816 1 2 1 1 81 ASP QB   A 81 . HB*  1 1 
       817 1 1 1 1 80 LYS HA   A 80 . HA   1 1 
       817 1 2 1 1 82 MET H    A 82 . HN   1 1 
       818 1 1 1 1 80 LYS HB2  A 80 . HB2  1 1 
       818 1 2 1 1 81 ASP H    A 81 . HN   1 1 
       819 1 1 1 1 80 LYS HB3  A 80 . HB1  1 1 
       819 1 2 1 1 81 ASP H    A 81 . HN   1 1 
       820 1 1 1 1 80 LYS QG   A 80 . HG*  1 1 
       820 1 2 1 1 81 ASP H    A 81 . HN   1 1 
       821 1 1 1 1 81 ASP H    A 81 . HN   1 1 
       821 1 2 1 1 82 MET H    A 82 . HN   1 1 
       822 1 1 1 1 81 ASP HA   A 81 . HA   1 1 
       822 1 2 1 1 82 MET H    A 82 . HN   1 1 
       823 1 1 1 1 81 ASP HB2  A 81 . HB2  1 1 
       823 1 2 1 1 82 MET H    A 82 . HN   1 1 
       824 1 1 1 1 81 ASP HB3  A 81 . HB1  1 1 
       824 1 2 1 1 82 MET H    A 82 . HN   1 1 
       825 1 1 1 1 82 MET HA   A 82 . HA   1 1 
       825 1 2 1 1 83 MET H    A 83 . HN   1 1 
       826 1 1 1 1 82 MET HB2  A 82 . HB2  1 1 
       826 1 2 1 1 83 MET H    A 83 . HN   1 1 
       827 1 1 1 1 82 MET HB3  A 82 . HB1  1 1 
       827 1 2 1 1 83 MET H    A 83 . HN   1 1 
       828 1 1 1 1 82 MET QG   A 82 . HG*  1 1 
       828 1 2 1 1 83 MET H    A 83 . HN   1 1 
       829 1 1 1 1 83 MET HA   A 83 . HA   1 1 
       829 1 2 1 1 83 MET ME   A 83 . HE*  1 1 
    stop_

    loop_
       _Dist_constraint_value.Constraint_ID
       _Dist_constraint_value.Tree_node_ID
       _Dist_constraint_value.Source_experiment_ID
       _Dist_constraint_value.Spectral_peak_ID
       _Dist_constraint_value.Intensity_val
       _Dist_constraint_value.Intensity_lower_val_err
       _Dist_constraint_value.Intensity_upper_val_err
       _Dist_constraint_value.Distance_val
       _Dist_constraint_value.Distance_lower_bound_val
       _Dist_constraint_value.Distance_upper_bound_val
       _Dist_constraint_value.Entry_ID
       _Dist_constraint_value.Distance_constraint_list_ID

         1 1 . . . . . 5.0 1.8 6.25 1 1 
         2 1 . . . . . 5.0 1.8 6.25 1 1 
         3 1 . . . . . 5.0 1.8 6.25 1 1 
         4 1 . . . . . 5.0 1.8 6.25 1 1 
         5 1 . . . . . 5.0 1.8 6.25 1 1 
         6 1 . . . . . 5.0 1.8 6.25 1 1 
         7 1 . . . . . 5.0 1.8 6.25 1 1 
         8 1 . . . . . 5.0 1.8 6.25 1 1 
         9 1 . . . . . 5.0 1.8 6.25 1 1 
        10 1 . . . . . 5.0 1.8 6.25 1 1 
        11 1 . . . . . 5.0 1.8 6.25 1 1 
        12 1 . . . . . 5.0 1.8 6.25 1 1 
        13 1 . . . . . 5.0 1.8 6.25 1 1 
        14 1 . . . . . 5.0 1.8 6.25 1 1 
        15 1 . . . . . 5.0 1.8 6.25 1 1 
        16 1 . . . . . 5.0 1.8 6.25 1 1 
        17 1 . . . . . 5.0 1.8 6.25 1 1 
        18 1 . . . . . 5.0 1.8 6.25 1 1 
        19 1 . . . . . 3.5 1.8 4.38 1 1 
        20 1 . . . . . 5.0 1.8 6.25 1 1 
        21 1 . . . . . 3.5 1.8 4.38 1 1 
        22 1 . . . . . 5.0 1.8 6.25 1 1 
        23 1 . . . . . 5.0 1.8 6.25 1 1 
        24 1 . . . . . 5.0 1.8 6.25 1 1 
        25 1 . . . . . 5.0 1.8 6.25 1 1 
        26 1 . . . . . 3.5 1.8 4.38 1 1 
        27 1 . . . . . 5.0 1.8 6.25 1 1 
        28 1 . . . . . 5.0 1.8 6.25 1 1 
        29 1 . . . . . 5.0 1.8 6.25 1 1 
        30 1 . . . . . 5.0 1.8 6.25 1 1 
        31 1 . . . . . 5.0 1.8 6.25 1 1 
        32 1 . . . . . 5.0 1.8 6.25 1 1 
        33 1 . . . . . 5.0 1.8 6.25 1 1 
        34 1 . . . . . 5.0 1.8 6.25 1 1 
        35 1 . . . . . 5.0 1.8 6.25 1 1 
        36 1 . . . . . 5.0 1.8 6.25 1 1 
        37 1 . . . . . 5.0 1.8 6.25 1 1 
        38 1 . . . . . 5.0 1.8 6.25 1 1 
        39 1 . . . . . 5.0 1.8 6.25 1 1 
        40 1 . . . . . 5.0 1.8 6.25 1 1 
        41 1 . . . . . 5.0 1.8 6.25 1 1 
        42 1 . . . . . 5.0 1.8 6.25 1 1 
        43 1 . . . . . 5.0 1.8 6.25 1 1 
        44 1 . . . . . 5.0 1.8 6.25 1 1 
        45 1 . . . . . 5.0 1.8 6.25 1 1 
        46 1 . . . . . 5.0 1.8 6.25 1 1 
        47 1 . . . . . 5.0 1.8 6.25 1 1 
        48 1 . . . . . 5.0 1.8 6.25 1 1 
        49 1 . . . . . 5.0 1.8 6.25 1 1 
        50 1 . . . . . 5.0 1.8 6.25 1 1 
        51 1 . . . . . 5.0 1.8 6.25 1 1 
        52 1 . . . . . 5.0 1.8 6.25 1 1 
        53 1 . . . . . 5.0 1.8 6.25 1 1 
        54 1 . . . . . 5.0 1.8 6.25 1 1 
        55 1 . . . . . 5.0 1.8 6.25 1 1 
        56 1 . . . . . 5.0 1.8 6.25 1 1 
        57 1 . . . . . 5.0 1.8 6.25 1 1 
        58 1 . . . . . 5.0 1.8 6.25 1 1 
        59 1 . . . . . 5.0 1.8 6.25 1 1 
        60 1 . . . . . 5.0 1.8 6.25 1 1 
        61 1 . . . . . 5.0 1.8 6.25 1 1 
        62 1 . . . . . 5.0 1.8 6.25 1 1 
        63 1 . . . . . 5.0 1.8 6.25 1 1 
        64 1 . . . . . 5.0 1.8 6.25 1 1 
        65 1 . . . . . 5.0 1.8 6.25 1 1 
        66 1 . . . . . 5.0 1.8 6.25 1 1 
        67 1 . . . . . 5.0 1.8 6.25 1 1 
        68 1 . . . . . 5.0 1.8 6.25 1 1 
        69 1 . . . . . 5.0 1.8 6.25 1 1 
        70 1 . . . . . 5.0 1.8 6.25 1 1 
        71 1 . . . . . 5.0 1.8 6.25 1 1 
        72 1 . . . . . 3.5 1.8 4.38 1 1 
        73 1 . . . . . 5.0 1.8 6.25 1 1 
        74 1 . . . . . 5.0 1.8 6.25 1 1 
        75 1 . . . . . 5.0 1.8 6.25 1 1 
        76 1 . . . . . 5.0 1.8 6.25 1 1 
        77 1 . . . . . 5.0 1.8 6.25 1 1 
        78 1 . . . . . 5.0 1.8 6.25 1 1 
        79 1 . . . . . 5.0 1.8 6.25 1 1 
        80 1 . . . . . 5.0 1.8 6.25 1 1 
        81 1 . . . . . 5.0 1.8 6.25 1 1 
        82 1 . . . . . 5.0 1.8 6.25 1 1 
        83 1 . . . . . 5.0 1.8 6.25 1 1 
        84 1 . . . . . 5.0 1.8 6.25 1 1 
        85 1 . . . . . 5.0 1.8 6.25 1 1 
        86 1 . . . . . 5.0 1.8 6.25 1 1 
        87 1 . . . . . 3.5 1.8 4.38 1 1 
        88 1 . . . . . 5.0 1.8 6.25 1 1 
        89 1 . . . . . 5.0 1.8 6.25 1 1 
        90 1 . . . . . 5.0 1.8 6.25 1 1 
        91 1 . . . . . 5.0 1.8 6.25 1 1 
        92 1 . . . . . 5.0 1.8 6.25 1 1 
        93 1 . . . . . 5.0 1.8 6.25 1 1 
        94 1 . . . . . 5.0 1.8 6.25 1 1 
        95 1 . . . . . 5.0 1.8 6.25 1 1 
        96 1 . . . . . 5.0 1.8 6.25 1 1 
        97 1 . . . . . 5.0 1.8 6.25 1 1 
        98 1 . . . . . 5.0 1.8 6.25 1 1 
        99 1 . . . . . 5.0 1.8 6.25 1 1 
       100 1 . . . . . 5.0 1.8 6.25 1 1 
       101 1 . . . . . 5.0 1.8 6.25 1 1 
       102 1 . . . . . 5.0 1.8 6.25 1 1 
       103 1 . . . . . 5.0 1.8 6.25 1 1 
       104 1 . . . . . 5.0 1.8 6.25 1 1 
       105 1 . . . . . 5.0 1.8 6.25 1 1 
       106 1 . . . . . 5.0 1.8 6.25 1 1 
       107 1 . . . . . 5.0 1.8 6.25 1 1 
       108 1 . . . . . 3.5 1.8 4.38 1 1 
       109 1 . . . . . 5.0 1.8 6.25 1 1 
       110 1 . . . . . 5.0 1.8 6.25 1 1 
       111 1 . . . . . 5.0 1.8 6.25 1 1 
       112 1 . . . . . 3.5 1.8 4.38 1 1 
       113 1 . . . . . 5.0 1.8 6.25 1 1 
       114 1 . . . . . 5.0 1.8 6.25 1 1 
       115 1 . . . . . 5.0 1.8 6.25 1 1 
       116 1 . . . . . 5.0 1.8 6.25 1 1 
       117 1 . . . . . 5.0 1.8 6.25 1 1 
       118 1 . . . . . 5.0 1.8 6.25 1 1 
       119 1 . . . . . 5.0 1.8 6.25 1 1 
       120 1 . . . . . 5.0 1.8 6.25 1 1 
       121 1 . . . . . 5.0 1.8 6.25 1 1 
       122 1 . . . . . 5.0 1.8 6.25 1 1 
       123 1 . . . . . 5.0 1.8 6.25 1 1 
       124 1 . . . . . 5.0 1.8 6.25 1 1 
       125 1 . . . . . 5.0 1.8 6.25 1 1 
       126 1 . . . . . 5.0 1.8 6.25 1 1 
       127 1 . . . . . 5.0 1.8 6.25 1 1 
       128 1 . . . . . 5.0 1.8 6.25 1 1 
       129 1 . . . . . 5.0 1.8 6.25 1 1 
       130 1 . . . . . 5.0 1.8 6.25 1 1 
       131 1 . . . . . 2.9 1.8 3.63 1 1 
       132 1 . . . . . 5.0 1.8 6.25 1 1 
       133 1 . . . . . 3.5 1.8 4.38 1 1 
       134 1 . . . . . 5.0 1.8 6.25 1 1 
       135 1 . . . . . 5.0 1.8 6.25 1 1 
       136 1 . . . . . 5.0 1.8 6.25 1 1 
       137 1 . . . . . 5.0 1.8 6.25 1 1 
       138 1 . . . . . 5.0 1.8 6.25 1 1 
       139 1 . . . . . 3.5 1.8 4.38 1 1 
       140 1 . . . . . 3.5 1.8 4.38 1 1 
       141 1 . . . . . 5.0 1.8 6.25 1 1 
       142 1 . . . . . 5.0 1.8 6.25 1 1 
       143 1 . . . . . 5.0 1.8 6.25 1 1 
       144 1 . . . . . 5.0 1.8 6.25 1 1 
       145 1 . . . . . 5.0 1.8 6.25 1 1 
       146 1 . . . . . 5.0 1.8 6.25 1 1 
       147 1 . . . . . 5.0 1.8 6.25 1 1 
       148 1 . . . . . 5.0 1.8 6.25 1 1 
       149 1 . . . . . 5.0 1.8 6.25 1 1 
       150 1 . . . . . 5.0 1.8 6.25 1 1 
       151 1 . . . . . 5.0 1.8 6.25 1 1 
       152 1 . . . . . 5.0 1.8 6.25 1 1 
       153 1 . . . . . 3.5 1.8 4.38 1 1 
       154 1 . . . . . 5.0 1.8 6.25 1 1 
       155 1 . . . . . 5.0 1.8 6.25 1 1 
       156 1 . . . . . 5.0 1.8 6.25 1 1 
       157 1 . . . . . 5.0 1.8 6.25 1 1 
       158 1 . . . . . 5.0 1.8 6.25 1 1 
       159 1 . . . . . 5.0 1.8 6.25 1 1 
       160 1 . . . . . 5.0 1.8 6.25 1 1 
       161 1 . . . . . 5.0 1.8 6.25 1 1 
       162 1 . . . . . 5.0 1.8 6.25 1 1 
       163 1 . . . . . 5.0 1.8 6.25 1 1 
       164 1 . . . . . 5.0 1.8 6.25 1 1 
       165 1 . . . . . 5.0 1.8 6.25 1 1 
       166 1 . . . . . 5.0 1.8 6.25 1 1 
       167 1 . . . . . 5.0 1.8 6.25 1 1 
       168 1 . . . . . 5.0 1.8 6.25 1 1 
       169 1 . . . . . 5.0 1.8 6.25 1 1 
       170 1 . . . . . 5.0 1.8 6.25 1 1 
       171 1 . . . . . 5.0 1.8 6.25 1 1 
       172 1 . . . . . 5.0 1.8 6.25 1 1 
       173 1 . . . . . 5.0 1.8 6.25 1 1 
       174 1 . . . . . 5.0 1.8 6.25 1 1 
       175 1 . . . . . 5.0 1.8 6.25 1 1 
       176 1 . . . . . 5.0 1.8 6.25 1 1 
       177 1 . . . . . 5.0 1.8 6.25 1 1 
       178 1 . . . . . 5.0 1.8 6.25 1 1 
       179 1 . . . . . 5.0 1.8 6.25 1 1 
       180 1 . . . . . 5.0 1.8 6.25 1 1 
       181 1 . . . . . 5.0 1.8 6.25 1 1 
       182 1 . . . . . 5.0 1.8 6.25 1 1 
       183 1 . . . . . 5.0 1.8 6.25 1 1 
       184 1 . . . . . 5.0 1.8 6.25 1 1 
       185 1 . . . . . 5.0 1.8 6.25 1 1 
       186 1 . . . . . 5.0 1.8 6.25 1 1 
       187 1 . . . . . 5.0 1.8 6.25 1 1 
       188 1 . . . . . 5.0 1.8 6.25 1 1 
       189 1 . . . . . 5.0 1.8 6.25 1 1 
       190 1 . . . . . 5.0 1.8 6.25 1 1 
       191 1 . . . . . 5.0 1.8 6.25 1 1 
       192 1 . . . . . 5.0 1.8 6.25 1 1 
       193 1 . . . . . 5.0 1.8 6.25 1 1 
       194 1 . . . . . 5.0 1.8 6.25 1 1 
       195 1 . . . . . 3.5 1.8 4.38 1 1 
       196 1 . . . . . 5.0 1.8 6.25 1 1 
       197 1 . . . . . 5.0 1.8 6.25 1 1 
       198 1 . . . . . 5.0 1.8 6.25 1 1 
       199 1 . . . . . 5.0 1.8 6.25 1 1 
       200 1 . . . . . 5.0 1.8 6.25 1 1 
       201 1 . . . . . 5.0 1.8 6.25 1 1 
       202 1 . . . . . 3.5 1.8 4.38 1 1 
       203 1 . . . . . 5.0 1.8 6.25 1 1 
       204 1 . . . . . 5.0 1.8 6.25 1 1 
       205 1 . . . . . 5.0 1.8 6.25 1 1 
       206 1 . . . . . 3.5 1.8 4.38 1 1 
       207 1 . . . . . 3.5 1.8 4.38 1 1 
       208 1 . . . . . 3.5 1.8 4.38 1 1 
       209 1 . . . . . 5.0 1.8 6.25 1 1 
       210 1 . . . . . 5.0 1.8 6.25 1 1 
       211 1 . . . . . 5.0 1.8 6.25 1 1 
       212 1 . . . . . 5.0 1.8 6.25 1 1 
       213 1 . . . . . 5.0 1.8 6.25 1 1 
       214 1 . . . . . 5.0 1.8 6.25 1 1 
       215 1 . . . . . 5.0 1.8 6.25 1 1 
       216 1 . . . . . 5.0 1.8 6.25 1 1 
       217 1 . . . . . 3.5 1.8 4.38 1 1 
       218 1 . . . . . 5.0 1.8 6.25 1 1 
       219 1 . . . . . 5.0 1.8 6.25 1 1 
       220 1 . . . . . 5.0 1.8 6.25 1 1 
       221 1 . . . . . 5.0 1.8 6.25 1 1 
       222 1 . . . . . 5.0 1.8 6.25 1 1 
       223 1 . . . . . 5.0 1.8 6.25 1 1 
       224 1 . . . . . 5.0 1.8 6.25 1 1 
       225 1 . . . . . 5.0 1.8 6.25 1 1 
       226 1 . . . . . 5.0 1.8 6.25 1 1 
       227 1 . . . . . 5.0 1.8 6.25 1 1 
       228 1 . . . . . 5.0 1.8 6.25 1 1 
       229 1 . . . . . 5.0 1.8 6.25 1 1 
       230 1 . . . . . 5.0 1.8 6.25 1 1 
       231 1 . . . . . 3.5 1.8 4.38 1 1 
       232 1 . . . . . 5.0 1.8 6.25 1 1 
       233 1 . . . . . 5.0 1.8 6.25 1 1 
       234 1 . . . . . 5.0 1.8 6.25 1 1 
       235 1 . . . . . 5.0 1.8 6.25 1 1 
       236 1 . . . . . 3.5 1.8 4.38 1 1 
       237 1 . . . . . 5.0 1.8 6.25 1 1 
       238 1 . . . . . 5.0 1.8 6.25 1 1 
       239 1 . . . . . 5.0 1.8 6.25 1 1 
       240 1 . . . . . 5.0 1.8 6.25 1 1 
       241 1 . . . . . 5.0 1.8 6.25 1 1 
       242 1 . . . . . 5.0 1.8 6.25 1 1 
       243 1 . . . . . 5.0 1.8 6.25 1 1 
       244 1 . . . . . 5.0 1.8 6.25 1 1 
       245 1 . . . . . 5.0 1.8 6.25 1 1 
       246 1 . . . . . 5.0 1.8 6.25 1 1 
       247 1 . . . . . 5.0 1.8 6.25 1 1 
       248 1 . . . . . 5.0 1.8 6.25 1 1 
       249 1 . . . . . 5.0 1.8 6.25 1 1 
       250 1 . . . . . 5.0 1.8 6.25 1 1 
       251 1 . . . . . 5.0 1.8 6.25 1 1 
       252 1 . . . . . 5.0 1.8 6.25 1 1 
       253 1 . . . . . 3.5 1.8 4.38 1 1 
       254 1 . . . . . 5.0 1.8 6.25 1 1 
       255 1 . . . . . 5.0 1.8 6.25 1 1 
       256 1 . . . . . 5.0 1.8 6.25 1 1 
       257 1 . . . . . 5.0 1.8 6.25 1 1 
       258 1 . . . . . 3.5 1.8 4.38 1 1 
       259 1 . . . . . 5.0 1.8 6.25 1 1 
       260 1 . . . . . 5.0 1.8 6.25 1 1 
       261 1 . . . . . 5.0 1.8 6.25 1 1 
       262 1 . . . . . 5.0 1.8 6.25 1 1 
       263 1 . . . . . 2.9 1.8 3.63 1 1 
       264 1 . . . . . 5.0 1.8 6.25 1 1 
       265 1 . . . . . 5.0 1.8 6.25 1 1 
       266 1 . . . . . 5.0 1.8 6.25 1 1 
       267 1 . . . . . 5.0 1.8 6.25 1 1 
       268 1 . . . . . 5.0 1.8 6.25 1 1 
       269 1 . . . . . 5.0 1.8 6.25 1 1 
       270 1 . . . . . 5.0 1.8 6.25 1 1 
       271 1 . . . . . 5.0 1.8 6.25 1 1 
       272 1 . . . . . 5.0 1.8 6.25 1 1 
       273 1 . . . . . 5.0 1.8 6.25 1 1 
       274 1 . . . . . 5.0 1.8 6.25 1 1 
       275 1 . . . . . 5.0 1.8 6.25 1 1 
       276 1 . . . . . 3.5 1.8 4.38 1 1 
       277 1 . . . . . 5.0 1.8 6.25 1 1 
       278 1 . . . . . 5.0 1.8 6.25 1 1 
       279 1 . . . . . 5.0 1.8 6.25 1 1 
       280 1 . . . . . 5.0 1.8 6.25 1 1 
       281 1 . . . . . 5.0 1.8 6.25 1 1 
       282 1 . . . . . 5.0 1.8 6.25 1 1 
       283 1 . . . . . 5.0 1.8 6.25 1 1 
       284 1 . . . . . 5.0 1.8 6.25 1 1 
       285 1 . . . . . 5.0 1.8 6.25 1 1 
       286 1 . . . . . 5.0 1.8 6.25 1 1 
       287 1 . . . . . 5.0 1.8 6.25 1 1 
       288 1 . . . . . 5.0 1.8 6.25 1 1 
       289 1 . . . . . 5.0 1.8 6.25 1 1 
       290 1 . . . . . 5.0 1.8 6.25 1 1 
       291 1 . . . . . 5.0 1.8 6.25 1 1 
       292 1 . . . . . 5.0 1.8 6.25 1 1 
       293 1 . . . . . 5.0 1.8 6.25 1 1 
       294 1 . . . . . 5.0 1.8 6.25 1 1 
       295 1 . . . . . 5.0 1.8 6.25 1 1 
       296 1 . . . . . 5.0 1.8 6.25 1 1 
       297 1 . . . . . 5.0 1.8 6.25 1 1 
       298 1 . . . . . 5.0 1.8 6.25 1 1 
       299 1 . . . . . 5.0 1.8 6.25 1 1 
       300 1 . . . . . 5.0 1.8 6.25 1 1 
       301 1 . . . . . 5.0 1.8 6.25 1 1 
       302 1 . . . . . 5.0 1.8 6.25 1 1 
       303 1 . . . . . 5.0 1.8 6.25 1 1 
       304 1 . . . . . 5.0 1.8 6.25 1 1 
       305 1 . . . . . 5.0 1.8 6.25 1 1 
       306 1 . . . . . 5.0 1.8 6.25 1 1 
       307 1 . . . . . 5.0 1.8 6.25 1 1 
       308 1 . . . . . 5.0 1.8 6.25 1 1 
       309 1 . . . . . 5.0 1.8 6.25 1 1 
       310 1 . . . . . 5.0 1.8 6.25 1 1 
       311 1 . . . . . 5.0 1.8 6.25 1 1 
       312 1 . . . . . 5.0 1.8 6.25 1 1 
       313 1 . . . . . 5.0 1.8 6.25 1 1 
       314 1 . . . . . 5.0 1.8 6.25 1 1 
       315 1 . . . . . 5.0 1.8 6.25 1 1 
       316 1 . . . . . 5.0 1.8 6.25 1 1 
       317 1 . . . . . 5.0 1.8 6.25 1 1 
       318 1 . . . . . 5.0 1.8 6.25 1 1 
       319 1 . . . . . 5.0 1.8 6.25 1 1 
       320 1 . . . . . 5.0 1.8 6.25 1 1 
       321 1 . . . . . 5.0 1.8 6.25 1 1 
       322 1 . . . . . 5.0 1.8 6.25 1 1 
       323 1 . . . . . 5.0 1.8 6.25 1 1 
       324 1 . . . . . 5.0 1.8 6.25 1 1 
       325 1 . . . . . 5.0 1.8 6.25 1 1 
       326 1 . . . . . 5.0 1.8 6.25 1 1 
       327 1 . . . . . 5.0 1.8 6.25 1 1 
       328 1 . . . . . 5.0 1.8 6.25 1 1 
       329 1 . . . . . 3.5 1.8 4.38 1 1 
       330 1 . . . . . 2.9 1.8 3.63 1 1 
       331 1 . . . . . 2.9 1.8 3.63 1 1 
       332 1 . . . . . 5.0 1.8 6.25 1 1 
       333 1 . . . . . 5.0 1.8 6.25 1 1 
       334 1 . . . . . 5.0 1.8 6.25 1 1 
       335 1 . . . . . 5.0 1.8 6.25 1 1 
       336 1 . . . . . 5.0 1.8 6.25 1 1 
       337 1 . . . . . 3.5 1.8 4.38 1 1 
       338 1 . . . . . 3.5 1.8 4.38 1 1 
       339 1 . . . . . 3.5 1.8 4.38 1 1 
       340 1 . . . . . 5.0 1.8 6.25 1 1 
       341 1 . . . . . 2.9 1.8 3.63 1 1 
       342 1 . . . . . 5.0 1.8 6.25 1 1 
       343 1 . . . . . 5.0 1.8 6.25 1 1 
       344 1 . . . . . 5.0 1.8 6.25 1 1 
       345 1 . . . . . 5.0 1.8 6.25 1 1 
       346 1 . . . . . 5.0 1.8 6.25 1 1 
       347 1 . . . . . 5.0 1.8 6.25 1 1 
       348 1 . . . . . 5.0 1.8 6.25 1 1 
       349 1 . . . . . 5.0 1.8 6.25 1 1 
       350 1 . . . . . 5.0 1.8 6.25 1 1 
       351 1 . . . . . 5.0 1.8 6.25 1 1 
       352 1 . . . . . 5.0 1.8 6.25 1 1 
       353 1 . . . . . 5.0 1.8 6.25 1 1 
       354 1 . . . . . 5.0 1.8 6.25 1 1 
       355 1 . . . . . 5.0 1.8 6.25 1 1 
       356 1 . . . . . 5.0 1.8 6.25 1 1 
       357 1 . . . . . 5.0 1.8 6.25 1 1 
       358 1 . . . . . 5.0 1.8 6.25 1 1 
       359 1 . . . . . 5.0 1.8 6.25 1 1 
       360 1 . . . . . 5.0 1.8 6.25 1 1 
       361 1 . . . . . 5.0 1.8 6.25 1 1 
       362 1 . . . . . 5.0 1.8 6.25 1 1 
       363 1 . . . . . 5.0 1.8 6.25 1 1 
       364 1 . . . . . 5.0 1.8 6.25 1 1 
       365 1 . . . . . 5.0 1.8 6.25 1 1 
       366 1 . . . . . 5.0 1.8 6.25 1 1 
       367 1 . . . . . 5.0 1.8 6.25 1 1 
       368 1 . . . . . 5.0 1.8 6.25 1 1 
       369 1 . . . . . 5.0 1.8 6.25 1 1 
       370 1 . . . . . 5.0 1.8 6.25 1 1 
       371 1 . . . . . 5.0 1.8 6.25 1 1 
       372 1 . . . . . 5.0 1.8 6.25 1 1 
       373 1 . . . . . 2.9 1.8 3.63 1 1 
       374 1 . . . . . 5.0 1.8 6.25 1 1 
       375 1 . . . . . 5.0 1.8 6.25 1 1 
       376 1 . . . . . 3.5 1.8 4.38 1 1 
       377 1 . . . . . 3.5 1.8 4.38 1 1 
       378 1 . . . . . 3.5 1.8 4.38 1 1 
       379 1 . . . . . 5.0 1.8 6.25 1 1 
       380 1 . . . . . 5.0 1.8 6.25 1 1 
       381 1 . . . . . 3.5 1.8 4.38 1 1 
       382 1 . . . . . 5.0 1.8 6.25 1 1 
       383 1 . . . . . 5.0 1.8 6.25 1 1 
       384 1 . . . . . 5.0 1.8 6.25 1 1 
       385 1 . . . . . 5.0 1.8 6.25 1 1 
       386 1 . . . . . 5.0 1.8 6.25 1 1 
       387 1 . . . . . 5.0 1.8 6.25 1 1 
       388 1 . . . . . 5.0 1.8 6.25 1 1 
       389 1 . . . . . 5.0 1.8 6.25 1 1 
       390 1 . . . . . 5.0 1.8 6.25 1 1 
       391 1 . . . . . 5.0 1.8 6.25 1 1 
       392 1 . . . . . 5.0 1.8 6.25 1 1 
       393 1 . . . . . 5.0 1.8 6.25 1 1 
       394 1 . . . . . 5.0 1.8 6.25 1 1 
       395 1 . . . . . 5.0 1.8 6.25 1 1 
       396 1 . . . . . 5.0 1.8 6.25 1 1 
       397 1 . . . . . 5.0 1.8 6.25 1 1 
       398 1 . . . . . 5.0 1.8 6.25 1 1 
       399 1 . . . . . 5.0 1.8 6.25 1 1 
       400 1 . . . . . 5.0 1.8 6.25 1 1 
       401 1 . . . . . 5.0 1.8 6.25 1 1 
       402 1 . . . . . 5.0 1.8 6.25 1 1 
       403 1 . . . . . 5.0 1.8 6.25 1 1 
       404 1 . . . . . 5.0 1.8 6.25 1 1 
       405 1 . . . . . 5.0 1.8 6.25 1 1 
       406 1 . . . . . 5.0 1.8 6.25 1 1 
       407 1 . . . . . 5.0 1.8 6.25 1 1 
       408 1 . . . . . 5.0 1.8 6.25 1 1 
       409 1 . . . . . 5.0 1.8 6.25 1 1 
       410 1 . . . . . 5.0 1.8 6.25 1 1 
       411 1 . . . . . 5.0 1.8 6.25 1 1 
       412 1 . . . . . 5.0 1.8 6.25 1 1 
       413 1 . . . . . 5.0 1.8 6.25 1 1 
       414 1 . . . . . 5.0 1.8 6.25 1 1 
       415 1 . . . . . 5.0 1.8 6.25 1 1 
       416 1 . . . . . 5.0 1.8 6.25 1 1 
       417 1 . . . . . 5.0 1.8 6.25 1 1 
       418 1 . . . . . 5.0 1.8 6.25 1 1 
       419 1 . . . . . 5.0 1.8 6.25 1 1 
       420 1 . . . . . 5.0 1.8 6.25 1 1 
       421 1 . . . . . 5.0 1.8 6.25 1 1 
       422 1 . . . . . 5.0 1.8 6.25 1 1 
       423 1 . . . . . 5.0 1.8 6.25 1 1 
       424 1 . . . . . 5.0 1.8 6.25 1 1 
       425 1 . . . . . 3.5 1.8 4.38 1 1 
       426 1 . . . . . 5.0 1.8 6.25 1 1 
       427 1 . . . . . 5.0 1.8 6.25 1 1 
       428 1 . . . . . 5.0 1.8 6.25 1 1 
       429 1 . . . . . 5.0 1.8 6.25 1 1 
       430 1 . . . . . 5.0 1.8 6.25 1 1 
       431 1 . . . . . 5.0 1.8 6.25 1 1 
       432 1 . . . . . 5.0 1.8 6.25 1 1 
       433 1 . . . . . 5.0 1.8 6.25 1 1 
       434 1 . . . . . 5.0 1.8 6.25 1 1 
       435 1 . . . . . 5.0 1.8 6.25 1 1 
       436 1 . . . . . 5.0 1.8 6.25 1 1 
       437 1 . . . . . 5.0 1.8 6.25 1 1 
       438 1 . . . . . 5.0 1.8 6.25 1 1 
       439 1 . . . . . 5.0 1.8 6.25 1 1 
       440 1 . . . . . 5.0 1.8 6.25 1 1 
       441 1 . . . . . 5.0 1.8 6.25 1 1 
       442 1 . . . . . 5.0 1.8 6.25 1 1 
       443 1 . . . . . 5.0 1.8 6.25 1 1 
       444 1 . . . . . 5.0 1.8 6.25 1 1 
       445 1 . . . . . 5.0 1.8 6.25 1 1 
       446 1 . . . . . 5.0 1.8 6.25 1 1 
       447 1 . . . . . 5.0 1.8 6.25 1 1 
       448 1 . . . . . 5.0 1.8 6.25 1 1 
       449 1 . . . . . 5.0 1.8 6.25 1 1 
       450 1 . . . . . 5.0 1.8 6.25 1 1 
       451 1 . . . . . 5.0 1.8 6.25 1 1 
       452 1 . . . . . 5.0 1.8 6.25 1 1 
       453 1 . . . . . 5.0 1.8 6.25 1 1 
       454 1 . . . . . 5.0 1.8 6.25 1 1 
       455 1 . . . . . 5.0 1.8 6.25 1 1 
       456 1 . . . . . 5.0 1.8 6.25 1 1 
       457 1 . . . . . 5.0 1.8 6.25 1 1 
       458 1 . . . . . 5.0 1.8 6.25 1 1 
       459 1 . . . . . 5.0 1.8 6.25 1 1 
       460 1 . . . . . 3.5 1.8 4.38 1 1 
       461 1 . . . . . 5.0 1.8 6.25 1 1 
       462 1 . . . . . 5.0 1.8 6.25 1 1 
       463 1 . . . . . 5.0 1.8 6.25 1 1 
       464 1 . . . . . 5.0 1.8 6.25 1 1 
       465 1 . . . . . 5.0 1.8 6.25 1 1 
       466 1 . . . . . 5.0 1.8 6.25 1 1 
       467 1 . . . . . 5.0 1.8 6.25 1 1 
       468 1 . . . . . 5.0 1.8 6.25 1 1 
       469 1 . . . . . 5.0 1.8 6.25 1 1 
       470 1 . . . . . 5.0 1.8 6.25 1 1 
       471 1 . . . . . 5.0 1.8 6.25 1 1 
       472 1 . . . . . 5.0 1.8 6.25 1 1 
       473 1 . . . . . 5.0 1.8 6.25 1 1 
       474 1 . . . . . 5.0 1.8 6.25 1 1 
       475 1 . . . . . 5.0 1.8 6.25 1 1 
       476 1 . . . . . 5.0 1.8 6.25 1 1 
       477 1 . . . . . 5.0 1.8 6.25 1 1 
       478 1 . . . . . 5.0 1.8 6.25 1 1 
       479 1 . . . . . 5.0 1.8 6.25 1 1 
       480 1 . . . . . 5.0 1.8 6.25 1 1 
       481 1 . . . . . 5.0 1.8 6.25 1 1 
       482 1 . . . . . 5.0 1.8 6.25 1 1 
       483 1 . . . . . 5.0 1.8 6.25 1 1 
       484 1 . . . . . 5.0 1.8 6.25 1 1 
       485 1 . . . . . 5.0 1.8 6.25 1 1 
       486 1 . . . . . 5.0 1.8 6.25 1 1 
       487 1 . . . . . 5.0 1.8 6.25 1 1 
       488 1 . . . . . 5.0 1.8 6.25 1 1 
       489 1 . . . . . 3.5 1.8 4.38 1 1 
       490 1 . . . . . 5.0 1.8 6.25 1 1 
       491 1 . . . . . 5.0 1.8 6.25 1 1 
       492 1 . . . . . 5.0 1.8 6.25 1 1 
       493 1 . . . . . 5.0 1.8 6.25 1 1 
       494 1 . . . . . 5.0 1.8 6.25 1 1 
       495 1 . . . . . 5.0 1.8 6.25 1 1 
       496 1 . . . . . 5.0 1.8 6.25 1 1 
       497 1 . . . . . 5.0 1.8 6.25 1 1 
       498 1 . . . . . 5.0 1.8 6.25 1 1 
       499 1 . . . . . 5.0 1.8 6.25 1 1 
       500 1 . . . . . 5.0 1.8 6.25 1 1 
       501 1 . . . . . 5.0 1.8 6.25 1 1 
       502 1 . . . . . 5.0 1.8 6.25 1 1 
       503 1 . . . . . 5.0 1.8 6.25 1 1 
       504 1 . . . . . 5.0 1.8 6.25 1 1 
       505 1 . . . . . 5.0 1.8 6.25 1 1 
       506 1 . . . . . 5.0 1.8 6.25 1 1 
       507 1 . . . . . 3.5 1.8 4.38 1 1 
       508 1 . . . . . 5.0 1.8 6.25 1 1 
       509 1 . . . . . 5.0 1.8 6.25 1 1 
       510 1 . . . . . 5.0 1.8 6.25 1 1 
       511 1 . . . . . 3.5 1.8 4.38 1 1 
       512 1 . . . . . 5.0 1.8 6.25 1 1 
       513 1 . . . . . 5.0 1.8 6.25 1 1 
       514 1 . . . . . 5.0 1.8 6.25 1 1 
       515 1 . . . . . 5.0 1.8 6.25 1 1 
       516 1 . . . . . 5.0 1.8 6.25 1 1 
       517 1 . . . . . 5.0 1.8 6.25 1 1 
       518 1 . . . . . 5.0 1.8 6.25 1 1 
       519 1 . . . . . 5.0 1.8 6.25 1 1 
       520 1 . . . . . 5.0 1.8 6.25 1 1 
       521 1 . . . . . 5.0 1.8 6.25 1 1 
       522 1 . . . . . 5.0 1.8 6.25 1 1 
       523 1 . . . . . 5.0 1.8 6.25 1 1 
       524 1 . . . . . 5.0 1.8 6.25 1 1 
       525 1 . . . . . 5.0 1.8 6.25 1 1 
       526 1 . . . . . 5.0 1.8 6.25 1 1 
       527 1 . . . . . 5.0 1.8 6.25 1 1 
       528 1 . . . . . 3.5 1.8 4.38 1 1 
       529 1 . . . . . 3.5 1.8 4.38 1 1 
       530 1 . . . . . 5.0 1.8 6.25 1 1 
       531 1 . . . . . 5.0 1.8 6.25 1 1 
       532 1 . . . . . 5.0 1.8 6.25 1 1 
       533 1 . . . . . 5.0 1.8 6.25 1 1 
       534 1 . . . . . 5.0 1.8 6.25 1 1 
       535 1 . . . . . 5.0 1.8 6.25 1 1 
       536 1 . . . . . 5.0 1.8 6.25 1 1 
       537 1 . . . . . 5.0 1.8 6.25 1 1 
       538 1 . . . . . 5.0 1.8 6.25 1 1 
       539 1 . . . . . 5.0 1.8 6.25 1 1 
       540 1 . . . . . 5.0 1.8 6.25 1 1 
       541 1 . . . . . 5.0 1.8 6.25 1 1 
       542 1 . . . . . 5.0 1.8 6.25 1 1 
       543 1 . . . . . 5.0 1.8 6.25 1 1 
       544 1 . . . . . 5.0 1.8 6.25 1 1 
       545 1 . . . . . 5.0 1.8 6.25 1 1 
       546 1 . . . . . 5.0 1.8 6.25 1 1 
       547 1 . . . . . 5.0 1.8 6.25 1 1 
       548 1 . . . . . 5.0 1.8 6.25 1 1 
       549 1 . . . . . 5.0 1.8 6.25 1 1 
       550 1 . . . . . 3.5 1.8 4.38 1 1 
       551 1 . . . . . 5.0 1.8 6.25 1 1 
       552 1 . . . . . 5.0 1.8 6.25 1 1 
       553 1 . . . . . 5.0 1.8 6.25 1 1 
       554 1 . . . . . 5.0 1.8 6.25 1 1 
       555 1 . . . . . 5.0 1.8 6.25 1 1 
       556 1 . . . . . 5.0 1.8 6.25 1 1 
       557 1 . . . . . 5.0 1.8 6.25 1 1 
       558 1 . . . . . 5.0 1.8 6.25 1 1 
       559 1 . . . . . 5.0 1.8 6.25 1 1 
       560 1 . . . . . 5.0 1.8 6.25 1 1 
       561 1 . . . . . 5.0 1.8 6.25 1 1 
       562 1 . . . . . 5.0 1.8 6.25 1 1 
       563 1 . . . . . 5.0 1.8 6.25 1 1 
       564 1 . . . . . 3.5 1.8 4.38 1 1 
       565 1 . . . . . 5.0 1.8 6.25 1 1 
       566 1 . . . . . 5.0 1.8 6.25 1 1 
       567 1 . . . . . 5.0 1.8 6.25 1 1 
       568 1 . . . . . 5.0 1.8 6.25 1 1 
       569 1 . . . . . 5.0 1.8 6.25 1 1 
       570 1 . . . . . 5.0 1.8 6.25 1 1 
       571 1 . . . . . 5.0 1.8 6.25 1 1 
       572 1 . . . . . 5.0 1.8 6.25 1 1 
       573 1 . . . . . 5.0 1.8 6.25 1 1 
       574 1 . . . . . 3.5 1.8 4.38 1 1 
       575 1 . . . . . 5.0 1.8 6.25 1 1 
       576 1 . . . . . 3.5 1.8 4.38 1 1 
       577 1 . . . . . 5.0 1.8 6.25 1 1 
       578 1 . . . . . 5.0 1.8 6.25 1 1 
       579 1 . . . . . 3.5 1.8 4.38 1 1 
       580 1 . . . . . 5.0 1.8 6.25 1 1 
       581 1 . . . . . 5.0 1.8 6.25 1 1 
       582 1 . . . . . 5.0 1.8 6.25 1 1 
       583 1 . . . . . 5.0 1.8 6.25 1 1 
       584 1 . . . . . 5.0 1.8 6.25 1 1 
       585 1 . . . . . 5.0 1.8 6.25 1 1 
       586 1 . . . . . 5.0 1.8 6.25 1 1 
       587 1 . . . . . 5.0 1.8 6.25 1 1 
       588 1 . . . . . 5.0 1.8 6.25 1 1 
       589 1 . . . . . 5.0 1.8 6.25 1 1 
       590 1 . . . . . 5.0 1.8 6.25 1 1 
       591 1 . . . . . 5.0 1.8 6.25 1 1 
       592 1 . . . . . 5.0 1.8 6.25 1 1 
       593 1 . . . . . 5.0 1.8 6.25 1 1 
       594 1 . . . . . 5.0 1.8 6.25 1 1 
       595 1 . . . . . 5.0 1.8 6.25 1 1 
       596 1 . . . . . 5.0 1.8 6.25 1 1 
       597 1 . . . . . 3.5 1.8 4.38 1 1 
       598 1 . . . . . 5.0 1.8 6.25 1 1 
       599 1 . . . . . 5.0 1.8 6.25 1 1 
       600 1 . . . . . 5.0 1.8 6.25 1 1 
       601 1 . . . . . 5.0 1.8 6.25 1 1 
       602 1 . . . . . 5.0 1.8 6.25 1 1 
       603 1 . . . . . 5.0 1.8 6.25 1 1 
       604 1 . . . . . 5.0 1.8 6.25 1 1 
       605 1 . . . . . 3.5 1.8 4.38 1 1 
       606 1 . . . . . 5.0 1.8 6.25 1 1 
       607 1 . . . . . 5.0 1.8 6.25 1 1 
       608 1 . . . . . 5.0 1.8 6.25 1 1 
       609 1 . . . . . 5.0 1.8 6.25 1 1 
       610 1 . . . . . 5.0 1.8 6.25 1 1 
       611 1 . . . . . 5.0 1.8 6.25 1 1 
       612 1 . . . . . 3.5 1.8 4.38 1 1 
       613 1 . . . . . 5.0 1.8 6.25 1 1 
       614 1 . . . . . 5.0 1.8 6.25 1 1 
       615 1 . . . . . 5.0 1.8 6.25 1 1 
       616 1 . . . . . 3.5 1.8 4.38 1 1 
       617 1 . . . . . 5.0 1.8 6.25 1 1 
       618 1 . . . . . 3.5 1.8 4.38 1 1 
       619 1 . . . . . 5.0 1.8 6.25 1 1 
       620 1 . . . . . 5.0 1.8 6.25 1 1 
       621 1 . . . . . 5.0 1.8 6.25 1 1 
       622 1 . . . . . 5.0 1.8 6.25 1 1 
       623 1 . . . . . 5.0 1.8 6.25 1 1 
       624 1 . . . . . 5.0 1.8 6.25 1 1 
       625 1 . . . . . 5.0 1.8 6.25 1 1 
       626 1 . . . . . 5.0 1.8 6.25 1 1 
       627 1 . . . . . 5.0 1.8 6.25 1 1 
       628 1 . . . . . 5.0 1.8 6.25 1 1 
       629 1 . . . . . 3.5 1.8 4.38 1 1 
       630 1 . . . . . 5.0 1.8 6.25 1 1 
       631 1 . . . . . 5.0 1.8 6.25 1 1 
       632 1 . . . . . 5.0 1.8 6.25 1 1 
       633 1 . . . . . 5.0 1.8 6.25 1 1 
       634 1 . . . . . 5.0 1.8 6.25 1 1 
       635 1 . . . . . 5.0 1.8 6.25 1 1 
       636 1 . . . . . 5.0 1.8 6.25 1 1 
       637 1 . . . . . 5.0 1.8 6.25 1 1 
       638 1 . . . . . 5.0 1.8 6.25 1 1 
       639 1 . . . . . 5.0 1.8 6.25 1 1 
       640 1 . . . . . 5.0 1.8 6.25 1 1 
       641 1 . . . . . 5.0 1.8 6.25 1 1 
       642 1 . . . . . 5.0 1.8 6.25 1 1 
       643 1 . . . . . 3.5 1.8 4.38 1 1 
       644 1 . . . . . 5.0 1.8 6.25 1 1 
       645 1 . . . . . 5.0 1.8 6.25 1 1 
       646 1 . . . . . 5.0 1.8 6.25 1 1 
       647 1 . . . . . 5.0 1.8 6.25 1 1 
       648 1 . . . . . 5.0 1.8 6.25 1 1 
       649 1 . . . . . 5.0 1.8 6.25 1 1 
       650 1 . . . . . 5.0 1.8 6.25 1 1 
       651 1 . . . . . 5.0 1.8 6.25 1 1 
       652 1 . . . . . 5.0 1.8 6.25 1 1 
       653 1 . . . . . 5.0 1.8 6.25 1 1 
       654 1 . . . . . 5.0 1.8 6.25 1 1 
       655 1 . . . . . 3.5 1.8 4.38 1 1 
       656 1 . . . . . 5.0 1.8 6.25 1 1 
       657 1 . . . . . 5.0 1.8 6.25 1 1 
       658 1 . . . . . 5.0 1.8 6.25 1 1 
       659 1 . . . . . 5.0 1.8 6.25 1 1 
       660 1 . . . . . 5.0 1.8 6.25 1 1 
       661 1 . . . . . 5.0 1.8 6.25 1 1 
       662 1 . . . . . 5.0 1.8 6.25 1 1 
       663 1 . . . . . 5.0 1.8 6.25 1 1 
       664 1 . . . . . 5.0 1.8 6.25 1 1 
       665 1 . . . . . 5.0 1.8 6.25 1 1 
       666 1 . . . . . 5.0 1.8 6.25 1 1 
       667 1 . . . . . 5.0 1.8 6.25 1 1 
       668 1 . . . . . 5.0 1.8 6.25 1 1 
       669 1 . . . . . 5.0 1.8 6.25 1 1 
       670 1 . . . . . 5.0 1.8 6.25 1 1 
       671 1 . . . . . 5.0 1.8 6.25 1 1 
       672 1 . . . . . 5.0 1.8 6.25 1 1 
       673 1 . . . . . 5.0 1.8 6.25 1 1 
       674 1 . . . . . 5.0 1.8 6.25 1 1 
       675 1 . . . . . 5.0 1.8 6.25 1 1 
       676 1 . . . . . 5.0 1.8 6.25 1 1 
       677 1 . . . . . 5.0 1.8 6.25 1 1 
       678 1 . . . . . 5.0 1.8 6.25 1 1 
       679 1 . . . . . 5.0 1.8 6.25 1 1 
       680 1 . . . . . 5.0 1.8 6.25 1 1 
       681 1 . . . . . 5.0 1.8 6.25 1 1 
       682 1 . . . . . 5.0 1.8 6.25 1 1 
       683 1 . . . . . 5.0 1.8 6.25 1 1 
       684 1 . . . . . 3.5 1.8 4.38 1 1 
       685 1 . . . . . 5.0 1.8 6.25 1 1 
       686 1 . . . . . 5.0 1.8 6.25 1 1 
       687 1 . . . . . 5.0 1.8 6.25 1 1 
       688 1 . . . . . 5.0 1.8 6.25 1 1 
       689 1 . . . . . 5.0 1.8 6.25 1 1 
       690 1 . . . . . 5.0 1.8 6.25 1 1 
       691 1 . . . . . 5.0 1.8 6.25 1 1 
       692 1 . . . . . 5.0 1.8 6.25 1 1 
       693 1 . . . . . 5.0 1.8 6.25 1 1 
       694 1 . . . . . 5.0 1.8 6.25 1 1 
       695 1 . . . . . 5.0 1.8 6.25 1 1 
       696 1 . . . . . 5.0 1.8 6.25 1 1 
       697 1 . . . . . 5.0 1.8 6.25 1 1 
       698 1 . . . . . 5.0 1.8 6.25 1 1 
       699 1 . . . . . 5.0 1.8 6.25 1 1 
       700 1 . . . . . 5.0 1.8 6.25 1 1 
       701 1 . . . . . 5.0 1.8 6.25 1 1 
       702 1 . . . . . 5.0 1.8 6.25 1 1 
       703 1 . . . . . 5.0 1.8 6.25 1 1 
       704 1 . . . . . 5.0 1.8 6.25 1 1 
       705 1 . . . . . 5.0 1.8 6.25 1 1 
       706 1 . . . . . 5.0 1.8 6.25 1 1 
       707 1 . . . . . 5.0 1.8 6.25 1 1 
       708 1 . . . . . 5.0 1.8 6.25 1 1 
       709 1 . . . . . 5.0 1.8 6.25 1 1 
       710 1 . . . . . 3.5 1.8 4.38 1 1 
       711 1 . . . . . 5.0 1.8 6.25 1 1 
       712 1 . . . . . 5.0 1.8 6.25 1 1 
       713 1 . . . . . 5.0 1.8 6.25 1 1 
       714 1 . . . . . 5.0 1.8 6.25 1 1 
       715 1 . . . . . 5.0 1.8 6.25 1 1 
       716 1 . . . . . 5.0 1.8 6.25 1 1 
       717 1 . . . . . 5.0 1.8 6.25 1 1 
       718 1 . . . . . 5.0 1.8 6.25 1 1 
       719 1 . . . . . 5.0 1.8 6.25 1 1 
       720 1 . . . . . 5.0 1.8 6.25 1 1 
       721 1 . . . . . 5.0 1.8 6.25 1 1 
       722 1 . . . . . 5.0 1.8 6.25 1 1 
       723 1 . . . . . 5.0 1.8 6.25 1 1 
       724 1 . . . . . 5.0 1.8 6.25 1 1 
       725 1 . . . . . 5.0 1.8 6.25 1 1 
       726 1 . . . . . 3.5 1.8 4.38 1 1 
       727 1 . . . . . 5.0 1.8 6.25 1 1 
       728 1 . . . . . 5.0 1.8 6.25 1 1 
       729 1 . . . . . 5.0 1.8 6.25 1 1 
       730 1 . . . . . 5.0 1.8 6.25 1 1 
       731 1 . . . . . 5.0 1.8 6.25 1 1 
       732 1 . . . . . 5.0 1.8 6.25 1 1 
       733 1 . . . . . 5.0 1.8 6.25 1 1 
       734 1 . . . . . 5.0 1.8 6.25 1 1 
       735 1 . . . . . 5.0 1.8 6.25 1 1 
       736 1 . . . . . 5.0 1.8 6.25 1 1 
       737 1 . . . . . 5.0 1.8 6.25 1 1 
       738 1 . . . . . 5.0 1.8 6.25 1 1 
       739 1 . . . . . 5.0 1.8 6.25 1 1 
       740 1 . . . . . 5.0 1.8 6.25 1 1 
       741 1 . . . . . 5.0 1.8 6.25 1 1 
       742 1 . . . . . 5.0 1.8 6.25 1 1 
       743 1 . . . . . 5.0 1.8 6.25 1 1 
       744 1 . . . . . 5.0 1.8 6.25 1 1 
       745 1 . . . . . 5.0 1.8 6.25 1 1 
       746 1 . . . . . 5.0 1.8 6.25 1 1 
       747 1 . . . . . 5.0 1.8 6.25 1 1 
       748 1 . . . . . 5.0 1.8 6.25 1 1 
       749 1 . . . . . 5.0 1.8 6.25 1 1 
       750 1 . . . . . 5.0 1.8 6.25 1 1 
       751 1 . . . . . 5.0 1.8 6.25 1 1 
       752 1 . . . . . 5.0 1.8 6.25 1 1 
       753 1 . . . . . 5.0 1.8 6.25 1 1 
       754 1 . . . . . 5.0 1.8 6.25 1 1 
       755 1 . . . . . 5.0 1.8 6.25 1 1 
       756 1 . . . . . 5.0 1.8 6.25 1 1 
       757 1 . . . . . 5.0 1.8 6.25 1 1 
       758 1 . . . . . 5.0 1.8 6.25 1 1 
       759 1 . . . . . 5.0 1.8 6.25 1 1 
       760 1 . . . . . 5.0 1.8 6.25 1 1 
       761 1 . . . . . 5.0 1.8 6.25 1 1 
       762 1 . . . . . 5.0 1.8 6.25 1 1 
       763 1 . . . . . 5.0 1.8 6.25 1 1 
       764 1 . . . . . 3.5 1.8 4.38 1 1 
       765 1 . . . . . 5.0 1.8 6.25 1 1 
       766 1 . . . . . 5.0 1.8 6.25 1 1 
       767 1 . . . . . 5.0 1.8 6.25 1 1 
       768 1 . . . . . 5.0 1.8 6.25 1 1 
       769 1 . . . . . 5.0 1.8 6.25 1 1 
       770 1 . . . . . 5.0 1.8 6.25 1 1 
       771 1 . . . . . 5.0 1.8 6.25 1 1 
       772 1 . . . . . 5.0 1.8 6.25 1 1 
       773 1 . . . . . 5.0 1.8 6.25 1 1 
       774 1 . . . . . 3.5 1.8 4.38 1 1 
       775 1 . . . . . 3.5 1.8 4.38 1 1 
       776 1 . . . . . 3.5 1.8 4.38 1 1 
       777 1 . . . . . 5.0 1.8 6.25 1 1 
       778 1 . . . . . 5.0 1.8 6.25 1 1 
       779 1 . . . . . 5.0 1.8 6.25 1 1 
       780 1 . . . . . 5.0 1.8 6.25 1 1 
       781 1 . . . . . 5.0 1.8 6.25 1 1 
       782 1 . . . . . 5.0 1.8 6.25 1 1 
       783 1 . . . . . 3.5 1.8 4.38 1 1 
       784 1 . . . . . 3.5 1.8 4.38 1 1 
       785 1 . . . . . 5.0 1.8 6.25 1 1 
       786 1 . . . . . 5.0 1.8 6.25 1 1 
       787 1 . . . . . 5.0 1.8 6.25 1 1 
       788 1 . . . . . 5.0 1.8 6.25 1 1 
       789 1 . . . . . 5.0 1.8 6.25 1 1 
       790 1 . . . . . 5.0 1.8 6.25 1 1 
       791 1 . . . . . 5.0 1.8 6.25 1 1 
       792 1 . . . . . 5.0 1.8 6.25 1 1 
       793 1 . . . . . 5.0 1.8 6.25 1 1 
       794 1 . . . . . 5.0 1.8 6.25 1 1 
       795 1 . . . . . 3.5 1.8 4.38 1 1 
       796 1 . . . . . 5.0 1.8 6.25 1 1 
       797 1 . . . . . 5.0 1.8 6.25 1 1 
       798 1 . . . . . 5.0 1.8 6.25 1 1 
       799 1 . . . . . 5.0 1.8 6.25 1 1 
       800 1 . . . . . 5.0 1.8 6.25 1 1 
       801 1 . . . . . 3.5 1.8 4.38 1 1 
       802 1 . . . . . 5.0 1.8 6.25 1 1 
       803 1 . . . . . 5.0 1.8 6.25 1 1 
       804 1 . . . . . 3.5 1.8 4.38 1 1 
       805 1 . . . . . 5.0 1.8 6.25 1 1 
       806 1 . . . . . 5.0 1.8 6.25 1 1 
       807 1 . . . . . 5.0 1.8 6.25 1 1 
       808 1 . . . . . 5.0 1.8 6.25 1 1 
       809 1 . . . . . 5.0 1.8 6.25 1 1 
       810 1 . . . . . 5.0 1.8 6.25 1 1 
       811 1 . . . . . 5.0 1.8 6.25 1 1 
       812 1 . . . . . 5.0 1.8 6.25 1 1 
       813 1 . . . . . 5.0 1.8 6.25 1 1 
       814 1 . . . . . 5.0 1.8 6.25 1 1 
       815 1 . . . . . 5.0 1.8 6.25 1 1 
       816 1 . . . . . 5.0 1.8 6.25 1 1 
       817 1 . . . . . 5.0 1.8 6.25 1 1 
       818 1 . . . . . 5.0 1.8 6.25 1 1 
       819 1 . . . . . 5.0 1.8 6.25 1 1 
       820 1 . . . . . 5.0 1.8 6.25 1 1 
       821 1 . . . . . 5.0 1.8 6.25 1 1 
       822 1 . . . . . 5.0 1.8 6.25 1 1 
       823 1 . . . . . 5.0 1.8 6.25 1 1 
       824 1 . . . . . 5.0 1.8 6.25 1 1 
       825 1 . . . . . 5.0 1.8 6.25 1 1 
       826 1 . . . . . 5.0 1.8 6.25 1 1 
       827 1 . . . . . 5.0 1.8 6.25 1 1 
       828 1 . . . . . 5.0 1.8 6.25 1 1 
       829 1 . . . . . 5.0 1.8 6.25 1 1 
    stop_

save_


save_CNS/XPLOR_dihedral_3
    _Torsion_angle_constraint_list.Sf_category         torsion_angle_constraints
    _Torsion_angle_constraint_list.Entry_ID            1
    _Torsion_angle_constraint_list.ID                  1
    _Torsion_angle_constraint_list.Constraint_file_ID  .
    _Torsion_angle_constraint_list.Block_ID            .

    loop_
       _Torsion_angle_constraint.ID
       _Torsion_angle_constraint.Torsion_angle_name
       _Torsion_angle_constraint.Entity_assembly_ID_1
       _Torsion_angle_constraint.Entity_ID_1
       _Torsion_angle_constraint.Comp_index_ID_1
       _Torsion_angle_constraint.Comp_ID_1
       _Torsion_angle_constraint.Atom_ID_1
       _Torsion_angle_constraint.Entity_assembly_ID_2
       _Torsion_angle_constraint.Entity_ID_2
       _Torsion_angle_constraint.Comp_index_ID_2
       _Torsion_angle_constraint.Comp_ID_2
       _Torsion_angle_constraint.Atom_ID_2
       _Torsion_angle_constraint.Entity_assembly_ID_3
       _Torsion_angle_constraint.Entity_ID_3
       _Torsion_angle_constraint.Comp_index_ID_3
       _Torsion_angle_constraint.Comp_ID_3
       _Torsion_angle_constraint.Atom_ID_3
       _Torsion_angle_constraint.Entity_assembly_ID_4
       _Torsion_angle_constraint.Entity_ID_4
       _Torsion_angle_constraint.Comp_index_ID_4
       _Torsion_angle_constraint.Comp_ID_4
       _Torsion_angle_constraint.Atom_ID_4
       _Torsion_angle_constraint.Angle_lower_bound_val
       _Torsion_angle_constraint.Angle_upper_bound_val
       _Torsion_angle_constraint.Auth_asym_ID_1
       _Torsion_angle_constraint.Auth_seq_ID_1
       _Torsion_angle_constraint.Auth_comp_ID_1
       _Torsion_angle_constraint.Auth_atom_ID_1
       _Torsion_angle_constraint.Auth_asym_ID_2
       _Torsion_angle_constraint.Auth_seq_ID_2
       _Torsion_angle_constraint.Auth_comp_ID_2
       _Torsion_angle_constraint.Auth_atom_ID_2
       _Torsion_angle_constraint.Auth_asym_ID_3
       _Torsion_angle_constraint.Auth_seq_ID_3
       _Torsion_angle_constraint.Auth_comp_ID_3
       _Torsion_angle_constraint.Auth_atom_ID_3
       _Torsion_angle_constraint.Auth_asym_ID_4
       _Torsion_angle_constraint.Auth_seq_ID_4
       _Torsion_angle_constraint.Auth_comp_ID_4
       _Torsion_angle_constraint.Auth_atom_ID_4
       _Torsion_angle_constraint.Entry_ID
       _Torsion_angle_constraint.Torsion_angle_constraint_list_ID

        1 . 1 1 10 HIS C 1 1 11 MET N  1 1 11 MET CA 1 1 11 MET C     -106.25     -26.25 . 10 . C . 11 . N  . 11 . CA . 11 . C 1 1 
        2 . 1 1 11 MET N 1 1 11 MET CA 1 1 11 MET C  1 1 12 LEU N      -88.42      11.58 . 11 . N . 11 . CA . 11 . C  . 12 . N 1 1 
        3 . 1 1 11 MET C 1 1 12 LEU N  1 1 12 LEU CA 1 1 12 LEU C      -98.06     -18.06 . 11 . C . 12 . N  . 12 . CA . 12 . C 1 1 
        4 . 1 1 12 LEU N 1 1 12 LEU CA 1 1 12 LEU C  1 1 13 PRO N      -83.53      16.47 . 12 . N . 12 . CA . 12 . C  . 13 . N 1 1 
        5 . 1 1 18 SER C 1 1 19 HIS N  1 1 19 HIS CA 1 1 19 HIS C      -99.67     -19.67 . 18 . C . 19 . N  . 19 . CA . 19 . C 1 1 
        6 . 1 1 19 HIS N 1 1 19 HIS CA 1 1 19 HIS C  1 1 20 THR N      -85.99      14.01 . 19 . N . 19 . CA . 19 . C  . 20 . N 1 1 
        7 . 1 1 19 HIS C 1 1 20 THR N  1 1 20 THR CA 1 1 20 THR C     -106.93     -26.93 . 19 . C . 20 . N  . 20 . CA . 20 . C 1 1 
        8 . 1 1 20 THR N 1 1 20 THR CA 1 1 20 THR C  1 1 21 THR N      -88.03      11.97 . 20 . N . 20 . CA . 20 . C  . 21 . N 1 1 
        9 . 1 1 20 THR C 1 1 21 THR N  1 1 21 THR CA 1 1 21 THR C  -102.48999     -22.49 . 20 . C . 21 . N  . 21 . CA . 21 . C 1 1 
       10 . 1 1 21 THR N 1 1 21 THR CA 1 1 21 THR C  1 1 22 VAL N      -93.09       6.91 . 21 . N . 21 . CA . 21 . C  . 22 . N 1 1 
       11 . 1 1 21 THR C 1 1 22 VAL N  1 1 22 VAL CA 1 1 22 VAL C     -103.61     -23.61 . 21 . C . 22 . N  . 22 . CA . 22 . C 1 1 
       12 . 1 1 22 VAL N 1 1 22 VAL CA 1 1 22 VAL C  1 1 23 ARG N      -93.28       6.72 . 22 . N . 22 . CA . 22 . C  . 23 . N 1 1 
       13 . 1 1 22 VAL C 1 1 23 ARG N  1 1 23 ARG CA 1 1 23 ARG C      -99.43     -19.43 . 22 . C . 23 . N  . 23 . CA . 23 . C 1 1 
       14 . 1 1 23 ARG N 1 1 23 ARG CA 1 1 23 ARG C  1 1 24 ASN N      -92.34       7.66 . 23 . N . 23 . CA . 23 . C  . 24 . N 1 1 
       15 . 1 1 23 ARG C 1 1 24 ASN N  1 1 24 ASN CA 1 1 24 ASN C     -101.65     -21.65 . 23 . C . 24 . N  . 24 . CA . 24 . C 1 1 
       16 . 1 1 24 ASN N 1 1 24 ASN CA 1 1 24 ASN C  1 1 25 ALA N      -86.83      13.17 . 24 . N . 24 . CA . 24 . C  . 25 . N 1 1 
       17 . 1 1 24 ASN C 1 1 25 ALA N  1 1 25 ALA CA 1 1 25 ALA C     -105.29     -25.29 . 24 . C . 25 . N  . 25 . CA . 25 . C 1 1 
       18 . 1 1 25 ALA N 1 1 25 ALA CA 1 1 25 ALA C  1 1 26 LEU N      -92.61       7.39 . 25 . N . 25 . CA . 25 . C  . 26 . N 1 1 
       19 . 1 1 25 ALA C 1 1 26 LEU N  1 1 26 LEU CA 1 1 26 LEU C     -101.23     -21.23 . 25 . C . 26 . N  . 26 . CA . 26 . C 1 1 
       20 . 1 1 26 LEU N 1 1 26 LEU CA 1 1 26 LEU C  1 1 27 LYS N      -93.62  6.3799996 . 26 . N . 26 . CA . 26 . C  . 27 . N 1 1 
       21 . 1 1 26 LEU C 1 1 27 LYS N  1 1 27 LYS CA 1 1 27 LYS C      -98.37     -18.37 . 26 . C . 27 . N  . 27 . CA . 27 . C 1 1 
       22 . 1 1 27 LYS N 1 1 27 LYS CA 1 1 27 LYS C  1 1 28 ASP N      -93.95       6.05 . 27 . N . 27 . CA . 27 . C  . 28 . N 1 1 
       23 . 1 1 27 LYS C 1 1 28 ASP N  1 1 28 ASP CA 1 1 28 ASP C     -108.92 -28.920002 . 27 . C . 28 . N  . 28 . CA . 28 . C 1 1 
       24 . 1 1 28 ASP N 1 1 28 ASP CA 1 1 28 ASP C  1 1 29 LEU N      -89.42      10.58 . 28 . N . 28 . CA . 28 . C  . 29 . N 1 1 
       25 . 1 1 28 ASP C 1 1 29 LEU N  1 1 29 LEU CA 1 1 29 LEU C      -105.2      -25.2 . 28 . C . 29 . N  . 29 . CA . 29 . C 1 1 
       26 . 1 1 29 LEU N 1 1 29 LEU CA 1 1 29 LEU C  1 1 30 LEU N      -86.88  13.119999 . 29 . N . 29 . CA . 29 . C  . 30 . N 1 1 
       27 . 1 1 29 LEU C 1 1 30 LEU N  1 1 30 LEU CA 1 1 30 LEU C      -105.1      -25.1 . 29 . C . 30 . N  . 30 . CA . 30 . C 1 1 
       28 . 1 1 30 LEU N 1 1 30 LEU CA 1 1 30 LEU C  1 1 31 LYS N       -76.4       23.6 . 30 . N . 30 . CA . 30 . C  . 31 . N 1 1 
       29 . 1 1 30 LEU C 1 1 31 LYS N  1 1 31 LYS CA 1 1 31 LYS C     -106.23     -26.23 . 30 . C . 31 . N  . 31 . CA . 31 . C 1 1 
       30 . 1 1 31 LYS N 1 1 31 LYS CA 1 1 31 LYS C  1 1 32 ASP N      -91.61       8.39 . 31 . N . 31 . CA . 31 . C  . 32 . N 1 1 
       31 . 1 1 32 ASP C 1 1 33 MET N  1 1 33 MET CA 1 1 33 MET C     -160.85  -80.84999 . 32 . C . 33 . N  . 33 . CA . 33 . C 1 1 
       32 . 1 1 33 MET N 1 1 33 MET CA 1 1 33 MET C  1 1 34 ASN N      108.12     208.12 . 33 . N . 33 . CA . 33 . C  . 34 . N 1 1 
       33 . 1 1 34 ASN C 1 1 35 GLN N  1 1 35 GLN CA 1 1 35 GLN C      -97.76     -17.76 . 34 . C . 35 . N  . 35 . CA . 35 . C 1 1 
       34 . 1 1 35 GLN N 1 1 35 GLN CA 1 1 35 GLN C  1 1 36 SER N      -89.11  10.889999 . 35 . N . 35 . CA . 35 . C  . 36 . N 1 1 
       35 . 1 1 35 GLN C 1 1 36 SER N  1 1 36 SER CA 1 1 36 SER C     -104.18     -24.18 . 35 . C . 36 . N  . 36 . CA . 36 . C 1 1 
       36 . 1 1 36 SER N 1 1 36 SER CA 1 1 36 SER C  1 1 37 SER N       -91.2        8.8 . 36 . N . 36 . CA . 36 . C  . 37 . N 1 1 
       37 . 1 1 36 SER C 1 1 37 SER N  1 1 37 SER CA 1 1 37 SER C     -102.16     -22.16 . 36 . C . 37 . N  . 37 . CA . 37 . C 1 1 
       38 . 1 1 37 SER N 1 1 37 SER CA 1 1 37 SER C  1 1 38 LEU N      -96.28  3.7199998 . 37 . N . 37 . CA . 37 . C  . 38 . N 1 1 
       39 . 1 1 37 SER C 1 1 38 LEU N  1 1 38 LEU CA 1 1 38 LEU C     -102.52 -22.519999 . 37 . C . 38 . N  . 38 . CA . 38 . C 1 1 
       40 . 1 1 38 LEU N 1 1 38 LEU CA 1 1 38 LEU C  1 1 39 ALA N      -88.97      11.03 . 38 . N . 38 . CA . 38 . C  . 39 . N 1 1 
       41 . 1 1 38 LEU C 1 1 39 ALA N  1 1 39 ALA CA 1 1 39 ALA C     -106.06     -26.06 . 38 . C . 39 . N  . 39 . CA . 39 . C 1 1 
       42 . 1 1 39 ALA N 1 1 39 ALA CA 1 1 39 ALA C  1 1 40 LYS N      -82.93      17.07 . 39 . N . 39 . CA . 39 . C  . 40 . N 1 1 
       43 . 1 1 39 ALA C 1 1 40 LYS N  1 1 40 LYS CA 1 1 40 LYS C     -114.76     -34.76 . 39 . C . 40 . N  . 40 . CA . 40 . C 1 1 
       44 . 1 1 40 LYS N 1 1 40 LYS CA 1 1 40 LYS C  1 1 41 GLU N      -87.48      12.52 . 40 . N . 40 . CA . 40 . C  . 41 . N 1 1 
       45 . 1 1 40 LYS C 1 1 41 GLU N  1 1 41 GLU CA 1 1 41 GLU C     -119.55     -39.55 . 40 . C . 41 . N  . 41 . CA . 41 . C 1 1 
       46 . 1 1 41 GLU N 1 1 41 GLU CA 1 1 41 GLU C  1 1 42 CYS N      -84.51      15.49 . 41 . N . 41 . CA . 41 . C  . 42 . N 1 1 
       47 . 1 1 41 GLU C 1 1 42 CYS N  1 1 42 CYS CA 1 1 42 CYS C     -157.25     -77.25 . 41 . C . 42 . N  . 42 . CA . 42 . C 1 1 
       48 . 1 1 42 CYS N 1 1 42 CYS CA 1 1 42 CYS C  1 1 43 PRO N       37.65     137.65 . 42 . N . 42 . CA . 42 . C  . 43 . N 1 1 
       49 . 1 1 45 SER C 1 1 46 GLN N  1 1 46 GLN CA 1 1 46 GLN C  -97.979996     -17.98 . 45 . C . 46 . N  . 46 . CA . 46 . C 1 1 
       50 . 1 1 46 GLN N 1 1 46 GLN CA 1 1 46 GLN C  1 1 47 SER N       -87.2       12.8 . 46 . N . 46 . CA . 46 . C  . 47 . N 1 1 
       51 . 1 1 46 GLN C 1 1 47 SER N  1 1 47 SER CA 1 1 47 SER C -105.799995      -25.8 . 46 . C . 47 . N  . 47 . CA . 47 . C 1 1 
       52 . 1 1 47 SER N 1 1 47 SER CA 1 1 47 SER C  1 1 48 MET N      -87.68      12.32 . 47 . N . 47 . CA . 47 . C  . 48 . N 1 1 
       53 . 1 1 47 SER C 1 1 48 MET N  1 1 48 MET CA 1 1 48 MET C     -104.53     -24.53 . 47 . C . 48 . N  . 48 . CA . 48 . C 1 1 
       54 . 1 1 48 MET N 1 1 48 MET CA 1 1 48 MET C  1 1 49 ILE N   -95.34999       4.65 . 48 . N . 48 . CA . 48 . C  . 49 . N 1 1 
       55 . 1 1 48 MET C 1 1 49 ILE N  1 1 49 ILE CA 1 1 49 ILE C     -102.02     -22.02 . 48 . C . 49 . N  . 49 . CA . 49 . C 1 1 
       56 . 1 1 49 ILE N 1 1 49 ILE CA 1 1 49 ILE C  1 1 50 SER N      -95.71       4.29 . 49 . N . 49 . CA . 49 . C  . 50 . N 1 1 
       57 . 1 1 49 ILE C 1 1 50 SER N  1 1 50 SER CA 1 1 50 SER C      -98.81     -18.81 . 49 . C . 50 . N  . 50 . CA . 50 . C 1 1 
       58 . 1 1 50 SER N 1 1 50 SER CA 1 1 50 SER C  1 1 51 SER N      -92.12       7.88 . 50 . N . 50 . CA . 50 . C  . 51 . N 1 1 
       59 . 1 1 50 SER C 1 1 51 SER N  1 1 51 SER CA 1 1 51 SER C     -102.54 -22.539999 . 50 . C . 51 . N  . 51 . CA . 51 . C 1 1 
       60 . 1 1 51 SER N 1 1 51 SER CA 1 1 51 SER C  1 1 52 ILE N      -92.22       7.78 . 51 . N . 51 . CA . 51 . C  . 52 . N 1 1 
       61 . 1 1 51 SER C 1 1 52 ILE N  1 1 52 ILE CA 1 1 52 ILE C     -104.16     -24.16 . 51 . C . 52 . N  . 52 . CA . 52 . C 1 1 
       62 . 1 1 52 ILE N 1 1 52 ILE CA 1 1 52 ILE C  1 1 53 VAL N       -98.5  1.4999999 . 52 . N . 52 . CA . 52 . C  . 53 . N 1 1 
       63 . 1 1 52 ILE C 1 1 53 VAL N  1 1 53 VAL CA 1 1 53 VAL C      -99.52     -19.52 . 52 . C . 53 . N  . 53 . CA . 53 . C 1 1 
       64 . 1 1 53 VAL N 1 1 53 VAL CA 1 1 53 VAL C  1 1 54 ASN N      -95.82       4.18 . 53 . N . 53 . CA . 53 . C  . 54 . N 1 1 
       65 . 1 1 53 VAL C 1 1 54 ASN N  1 1 54 ASN CA 1 1 54 ASN C     -121.16     -41.16 . 53 . C . 54 . N  . 54 . CA . 54 . C 1 1 
       66 . 1 1 54 ASN N 1 1 54 ASN CA 1 1 54 ASN C  1 1 55 SER N      -73.72      26.28 . 54 . N . 54 . CA . 54 . C  . 55 . N 1 1 
       67 . 1 1 61 VAL C 1 1 62 SER N  1 1 62 SER CA 1 1 62 SER C  -124.26001     -44.26 . 61 . C . 62 . N  . 62 . CA . 62 . C 1 1 
       68 . 1 1 62 SER N 1 1 62 SER CA 1 1 62 SER C  1 1 63 ALA N   111.55999     211.56 . 62 . N . 62 . CA . 62 . C  . 63 . N 1 1 
       69 . 1 1 62 SER C 1 1 63 ALA N  1 1 63 ALA CA 1 1 63 ALA C     -100.51     -20.51 . 62 . C . 63 . N  . 63 . CA . 63 . C 1 1 
       70 . 1 1 63 ALA N 1 1 63 ALA CA 1 1 63 ALA C  1 1 64 ALA N      -90.75       9.25 . 63 . N . 63 . CA . 63 . C  . 64 . N 1 1 
       71 . 1 1 63 ALA C 1 1 64 ALA N  1 1 64 ALA CA 1 1 64 ALA C  -103.81999     -23.82 . 63 . C . 64 . N  . 64 . CA . 64 . C 1 1 
       72 . 1 1 64 ALA N 1 1 64 ALA CA 1 1 64 ALA C  1 1 65 LYS N      -91.17   8.829999 . 64 . N . 64 . CA . 64 . C  . 65 . N 1 1 
       73 . 1 1 64 ALA C 1 1 65 LYS N  1 1 65 LYS CA 1 1 65 LYS C     -105.92     -25.92 . 64 . C . 65 . N  . 65 . CA . 65 . C 1 1 
       74 . 1 1 65 LYS N 1 1 65 LYS CA 1 1 65 LYS C  1 1 66 CYS N      -90.44       9.56 . 65 . N . 65 . CA . 65 . C  . 66 . N 1 1 
       75 . 1 1 65 LYS C 1 1 66 CYS N  1 1 66 CYS CA 1 1 66 CYS C  -102.02999     -22.03 . 65 . C . 66 . N  . 66 . CA . 66 . C 1 1 
       76 . 1 1 66 CYS N 1 1 66 CYS CA 1 1 66 CYS C  1 1 67 GLN N   -95.23999       4.76 . 66 . N . 66 . CA . 66 . C  . 67 . N 1 1 
       77 . 1 1 66 CYS C 1 1 67 GLN N  1 1 67 GLN CA 1 1 67 GLN C     -103.12     -23.12 . 66 . C . 67 . N  . 67 . CA . 67 . C 1 1 
       78 . 1 1 67 GLN N 1 1 67 GLN CA 1 1 67 GLN C  1 1 68 GLU N      -90.74       9.26 . 67 . N . 67 . CA . 67 . C  . 68 . N 1 1 
       79 . 1 1 67 GLN C 1 1 68 GLU N  1 1 68 GLU CA 1 1 68 GLU C     -106.85     -26.85 . 67 . C . 68 . N  . 68 . CA . 68 . C 1 1 
       80 . 1 1 68 GLU N 1 1 68 GLU CA 1 1 68 GLU C  1 1 69 PHE N      -88.54      11.46 . 68 . N . 68 . CA . 68 . C  . 69 . N 1 1 
       81 . 1 1 70 GLY C 1 1 71 ARG N  1 1 71 ARG CA 1 1 71 ARG C  -101.91999     -21.92 . 70 . C . 71 . N  . 71 . CA . 71 . C 1 1 
       82 . 1 1 71 ARG N 1 1 71 ARG CA 1 1 71 ARG C  1 1 72 TRP N      -92.37       7.63 . 71 . N . 71 . CA . 71 . C  . 72 . N 1 1 
       83 . 1 1 71 ARG C 1 1 72 TRP N  1 1 72 TRP CA 1 1 72 TRP C     -105.32     -25.32 . 71 . C . 72 . N  . 72 . CA . 72 . C 1 1 
       84 . 1 1 72 TRP N 1 1 72 TRP CA 1 1 72 TRP C  1 1 73 TYR N  -90.079994       9.92 . 72 . N . 72 . CA . 72 . C  . 73 . N 1 1 
       85 . 1 1 72 TRP C 1 1 73 TYR N  1 1 73 TYR CA 1 1 73 TYR C      -102.9      -22.9 . 72 . C . 73 . N  . 73 . CA . 73 . C 1 1 
       86 . 1 1 73 TYR N 1 1 73 TYR CA 1 1 73 TYR C  1 1 74 LYS N      -93.64       6.36 . 73 . N . 73 . CA . 73 . C  . 74 . N 1 1 
       87 . 1 1 73 TYR C 1 1 74 LYS N  1 1 74 LYS CA 1 1 74 LYS C      -98.21 -18.209997 . 73 . C . 74 . N  . 74 . CA . 74 . C 1 1 
       88 . 1 1 74 LYS N 1 1 74 LYS CA 1 1 74 LYS C  1 1 75 HIS N      -88.11      11.89 . 74 . N . 74 . CA . 74 . C  . 75 . N 1 1 
       89 . 1 1 76 PHE C 1 1 77 LYS N  1 1 77 LYS CA 1 1 77 LYS C      -113.1      -33.1 . 76 . C . 77 . N  . 77 . CA . 77 . C 1 1 
       90 . 1 1 77 LYS N 1 1 77 LYS CA 1 1 77 LYS C  1 1 78 LYS N      -77.51      22.49 . 77 . N . 77 . CA . 77 . C  . 78 . N 1 1 
    stop_

save_


save_conformer_family_coord_set_1
    _Conformer_family_coord_set.Sf_category  conformer_family_coord_set
    _Conformer_family_coord_set.Entry_ID     1
    _Conformer_family_coord_set.ID           1

    loop_
       _Atom_site.Model_ID
       _Atom_site.ID
       _Atom_site.Label_entity_assembly_ID
       _Atom_site.Label_entity_ID
       _Atom_site.Label_comp_index_ID
       _Atom_site.Label_comp_ID
       _Atom_site.Label_atom_ID
       _Atom_site.Type_symbol
       _Atom_site.Cartn_x
       _Atom_site.Cartn_y
       _Atom_site.Cartn_z
       _Atom_site.Occupancy
       _Atom_site.Uncertainty
       _Atom_site.PDBX_label_asym_ID
       _Atom_site.PDB_strand_ID
       _Atom_site.PDB_ins_code
       _Atom_site.PDB_residue_no
       _Atom_site.PDB_residue_name
       _Atom_site.PDB_atom_name
       _Atom_site.Entry_ID
       _Atom_site.Conformer_family_coord_set_ID

        1     1 1 1  1 MET C    C  18.266 -11.857  11.780 1.00 . A A .  1 MET C    1 1 
        1     2 1 1  1 MET CA   C  16.851 -11.259  11.849 1.00 . A A .  1 MET CA   1 1 
        1     3 1 1  1 MET CB   C  16.196 -11.584  13.200 1.00 . A A .  1 MET CB   1 1 
        1     4 1 1  1 MET CE   C  12.616 -10.286  14.939 1.00 . A A .  1 MET CE   1 1 
        1     5 1 1  1 MET CG   C  14.858 -10.886  13.410 1.00 . A A .  1 MET CG   1 1 
        1     6 1 1  1 MET H1   H  15.046 -11.345  10.794 1.00 . A A .  1 MET H1   1 1 
        1     7 1 1  1 MET H2   H  15.926 -12.788  10.757 1.00 . A A .  1 MET H2   1 1 
        1     8 1 1  1 MET H3   H  16.416 -11.469   9.816 1.00 . A A .  1 MET H3   1 1 
        1     9 1 1  1 MET HA   H  16.934 -10.187  11.751 1.00 . A A .  1 MET HA   1 1 
        1    10 1 1  1 MET HB2  H  16.037 -12.651  13.268 1.00 . A A .  1 MET HB2  1 1 
        1    11 1 1  1 MET HB3  H  16.863 -11.279  13.994 1.00 . A A .  1 MET HB3  1 1 
        1    12 1 1  1 MET HE1  H  12.873  -9.244  14.820 1.00 . A A .  1 MET HE1  1 1 
        1    13 1 1  1 MET HE2  H  12.059 -10.416  15.856 1.00 . A A .  1 MET HE2  1 1 
        1    14 1 1  1 MET HE3  H  12.013 -10.607  14.104 1.00 . A A .  1 MET HE3  1 1 
        1    15 1 1  1 MET HG2  H  15.010  -9.817  13.346 1.00 . A A .  1 MET HG2  1 1 
        1    16 1 1  1 MET HG3  H  14.179 -11.198  12.630 1.00 . A A .  1 MET HG3  1 1 
        1    17 1 1  1 MET N    N  16.001 -11.750  10.727 1.00 . A A .  1 MET N    1 1 
        1    18 1 1  1 MET O    O  18.585 -12.618  10.864 1.00 . A A .  1 MET O    1 1 
        1    19 1 1  1 MET SD   S  14.116 -11.266  15.009 1.00 . A A .  1 MET SD   1 1 
        1    20 1 1  2 GLY C    C  21.412 -11.125  11.894 1.00 . A A .  2 GLY C    1 1 
        1    21 1 1  2 GLY CA   C  20.493 -11.987  12.752 1.00 . A A .  2 GLY CA   1 1 
        1    22 1 1  2 GLY H    H  18.802 -10.930  13.476 1.00 . A A .  2 GLY H    1 1 
        1    23 1 1  2 GLY HA2  H  20.860 -11.983  13.768 1.00 . A A .  2 GLY HA2  1 1 
        1    24 1 1  2 GLY HA3  H  20.515 -13.002  12.379 1.00 . A A .  2 GLY HA3  1 1 
        1    25 1 1  2 GLY N    N  19.113 -11.511  12.751 1.00 . A A .  2 GLY N    1 1 
        1    26 1 1  2 GLY O    O  21.814 -10.034  12.302 1.00 . A A .  2 GLY O    1 1 
        1    27 1 1  3 HIS C    C  21.729  -9.704   9.136 1.00 . A A .  3 HIS C    1 1 
        1    28 1 1  3 HIS CA   C  22.563 -10.837   9.763 1.00 . A A .  3 HIS CA   1 1 
        1    29 1 1  3 HIS CB   C  23.145 -11.746   8.672 1.00 . A A .  3 HIS CB   1 1 
        1    30 1 1  3 HIS CD2  C  25.472 -12.903   8.561 1.00 . A A .  3 HIS CD2  1 1 
        1    31 1 1  3 HIS CE1  C  25.411 -13.943  10.487 1.00 . A A .  3 HIS CE1  1 1 
        1    32 1 1  3 HIS CG   C  24.283 -12.610   9.143 1.00 . A A .  3 HIS CG   1 1 
        1    33 1 1  3 HIS H    H  21.456 -12.514  10.458 1.00 . A A .  3 HIS H    1 1 
        1    34 1 1  3 HIS HA   H  23.379 -10.395  10.319 1.00 . A A .  3 HIS HA   1 1 
        1    35 1 1  3 HIS HB2  H  22.366 -12.398   8.302 1.00 . A A .  3 HIS HB2  1 1 
        1    36 1 1  3 HIS HB3  H  23.507 -11.133   7.857 1.00 . A A .  3 HIS HB3  1 1 
        1    37 1 1  3 HIS HD1  H  23.557 -13.266  11.015 1.00 . A A .  3 HIS HD1  1 1 
        1    38 1 1  3 HIS HD2  H  25.819 -12.549   7.600 1.00 . A A .  3 HIS HD2  1 1 
        1    39 1 1  3 HIS HE1  H  25.684 -14.553  11.335 1.00 . A A .  3 HIS HE1  1 1 
        1    40 1 1  3 HIS HE2  H  26.933 -14.276   9.170 1.00 . A A .  3 HIS HE2  1 1 
        1    41 1 1  3 HIS N    N  21.755 -11.614  10.706 1.00 . A A .  3 HIS N    1 1 
        1    42 1 1  3 HIS ND1  N  24.281 -13.280  10.349 1.00 . A A .  3 HIS ND1  1 1 
        1    43 1 1  3 HIS NE2  N  26.152 -13.735   9.418 1.00 . A A .  3 HIS NE2  1 1 
        1    44 1 1  3 HIS O    O  20.812  -9.949   8.351 1.00 . A A .  3 HIS O    1 1 
        1    45 1 1  4 HIS C    C  21.389  -7.074   7.544 1.00 . A A .  4 HIS C    1 1 
        1    46 1 1  4 HIS CA   C  21.316  -7.281   9.070 1.00 . A A .  4 HIS CA   1 1 
        1    47 1 1  4 HIS CB   C  21.861  -6.052   9.818 1.00 . A A .  4 HIS CB   1 1 
        1    48 1 1  4 HIS CD2  C  19.803  -4.464   9.839 1.00 . A A .  4 HIS CD2  1 1 
        1    49 1 1  4 HIS CE1  C  20.781  -2.668   9.056 1.00 . A A .  4 HIS CE1  1 1 
        1    50 1 1  4 HIS CG   C  21.098  -4.780   9.594 1.00 . A A .  4 HIS CG   1 1 
        1    51 1 1  4 HIS H    H  22.853  -8.346  10.071 1.00 . A A .  4 HIS H    1 1 
        1    52 1 1  4 HIS HA   H  20.282  -7.427   9.349 1.00 . A A .  4 HIS HA   1 1 
        1    53 1 1  4 HIS HB2  H  21.845  -6.254  10.877 1.00 . A A .  4 HIS HB2  1 1 
        1    54 1 1  4 HIS HB3  H  22.884  -5.881   9.511 1.00 . A A .  4 HIS HB3  1 1 
        1    55 1 1  4 HIS HD1  H  22.616  -3.530   8.827 1.00 . A A .  4 HIS HD1  1 1 
        1    56 1 1  4 HIS HD2  H  19.047  -5.124  10.236 1.00 . A A .  4 HIS HD2  1 1 
        1    57 1 1  4 HIS HE1  H  20.956  -1.655   8.716 1.00 . A A .  4 HIS HE1  1 1 
        1    58 1 1  4 HIS HE2  H  18.775  -2.676   9.447 1.00 . A A .  4 HIS HE2  1 1 
        1    59 1 1  4 HIS N    N  22.067  -8.469   9.496 1.00 . A A .  4 HIS N    1 1 
        1    60 1 1  4 HIS ND1  N  21.678  -3.629   9.101 1.00 . A A .  4 HIS ND1  1 1 
        1    61 1 1  4 HIS NE2  N  19.636  -3.146   9.495 1.00 . A A .  4 HIS NE2  1 1 
        1    62 1 1  4 HIS O    O  22.274  -6.384   7.041 1.00 . A A .  4 HIS O    1 1 
        1    63 1 1  5 HIS C    C  19.618  -6.347   4.893 1.00 . A A .  5 HIS C    1 1 
        1    64 1 1  5 HIS CA   C  20.405  -7.584   5.348 1.00 . A A .  5 HIS CA   1 1 
        1    65 1 1  5 HIS CB   C  19.753  -8.834   4.740 1.00 . A A .  5 HIS CB   1 1 
        1    66 1 1  5 HIS CD2  C  21.670 -10.584   4.818 1.00 . A A .  5 HIS CD2  1 1 
        1    67 1 1  5 HIS CE1  C  20.627 -12.137   5.951 1.00 . A A .  5 HIS CE1  1 1 
        1    68 1 1  5 HIS CG   C  20.429 -10.120   5.098 1.00 . A A .  5 HIS CG   1 1 
        1    69 1 1  5 HIS H    H  19.788  -8.242   7.275 1.00 . A A .  5 HIS H    1 1 
        1    70 1 1  5 HIS HA   H  21.421  -7.507   4.982 1.00 . A A .  5 HIS HA   1 1 
        1    71 1 1  5 HIS HB2  H  18.730  -8.896   5.082 1.00 . A A .  5 HIS HB2  1 1 
        1    72 1 1  5 HIS HB3  H  19.757  -8.745   3.661 1.00 . A A .  5 HIS HB3  1 1 
        1    73 1 1  5 HIS HD1  H  18.889 -11.091   6.158 1.00 . A A .  5 HIS HD1  1 1 
        1    74 1 1  5 HIS HD2  H  22.444 -10.061   4.271 1.00 . A A .  5 HIS HD2  1 1 
        1    75 1 1  5 HIS HE1  H  20.404 -13.058   6.471 1.00 . A A .  5 HIS HE1  1 1 
        1    76 1 1  5 HIS HE2  H  22.455 -12.503   5.126 1.00 . A A .  5 HIS HE2  1 1 
        1    77 1 1  5 HIS N    N  20.457  -7.690   6.815 1.00 . A A .  5 HIS N    1 1 
        1    78 1 1  5 HIS ND1  N  19.805 -11.121   5.808 1.00 . A A .  5 HIS ND1  1 1 
        1    79 1 1  5 HIS NE2  N  21.766 -11.843   5.359 1.00 . A A .  5 HIS NE2  1 1 
        1    80 1 1  5 HIS O    O  18.567  -6.023   5.456 1.00 . A A .  5 HIS O    1 1 
        1    81 1 1  6 HIS C    C  19.059  -4.791   1.811 1.00 . A A .  6 HIS C    1 1 
        1    82 1 1  6 HIS CA   C  19.449  -4.513   3.270 1.00 . A A .  6 HIS CA   1 1 
        1    83 1 1  6 HIS CB   C  20.357  -3.277   3.341 1.00 . A A .  6 HIS CB   1 1 
        1    84 1 1  6 HIS CD2  C  18.830  -1.178   3.324 1.00 . A A .  6 HIS CD2  1 1 
        1    85 1 1  6 HIS CE1  C  19.320  -0.439   1.323 1.00 . A A .  6 HIS CE1  1 1 
        1    86 1 1  6 HIS CG   C  19.731  -2.032   2.785 1.00 . A A .  6 HIS CG   1 1 
        1    87 1 1  6 HIS H    H  20.979  -5.969   3.479 1.00 . A A .  6 HIS H    1 1 
        1    88 1 1  6 HIS HA   H  18.549  -4.322   3.841 1.00 . A A .  6 HIS HA   1 1 
        1    89 1 1  6 HIS HB2  H  20.610  -3.085   4.373 1.00 . A A .  6 HIS HB2  1 1 
        1    90 1 1  6 HIS HB3  H  21.263  -3.472   2.786 1.00 . A A .  6 HIS HB3  1 1 
        1    91 1 1  6 HIS HD1  H  20.631  -1.940   0.879 1.00 . A A .  6 HIS HD1  1 1 
        1    92 1 1  6 HIS HD2  H  18.385  -1.251   4.306 1.00 . A A .  6 HIS HD2  1 1 
        1    93 1 1  6 HIS HE1  H  19.345   0.165   0.427 1.00 . A A .  6 HIS HE1  1 1 
        1    94 1 1  6 HIS HE2  H  17.885   0.480   2.451 1.00 . A A .  6 HIS HE2  1 1 
        1    95 1 1  6 HIS N    N  20.123  -5.675   3.861 1.00 . A A .  6 HIS N    1 1 
        1    96 1 1  6 HIS ND1  N  20.013  -1.538   1.529 1.00 . A A .  6 HIS ND1  1 1 
        1    97 1 1  6 HIS NE2  N  18.593  -0.198   2.394 1.00 . A A .  6 HIS NE2  1 1 
        1    98 1 1  6 HIS O    O  19.835  -5.374   1.051 1.00 . A A .  6 HIS O    1 1 
        1    99 1 1  7 HIS C    C  17.927  -3.476  -0.891 1.00 . A A .  7 HIS C    1 1 
        1   100 1 1  7 HIS CA   C  17.382  -4.558   0.050 1.00 . A A .  7 HIS CA   1 1 
        1   101 1 1  7 HIS CB   C  15.850  -4.551   0.009 1.00 . A A .  7 HIS CB   1 1 
        1   102 1 1  7 HIS CD2  C  15.198  -7.011   0.510 1.00 . A A .  7 HIS CD2  1 1 
        1   103 1 1  7 HIS CE1  C  14.059  -6.674   2.347 1.00 . A A .  7 HIS CE1  1 1 
        1   104 1 1  7 HIS CG   C  15.224  -5.683   0.765 1.00 . A A .  7 HIS CG   1 1 
        1   105 1 1  7 HIS H    H  17.282  -3.910   2.068 1.00 . A A .  7 HIS H    1 1 
        1   106 1 1  7 HIS HA   H  17.734  -5.523  -0.292 1.00 . A A .  7 HIS HA   1 1 
        1   107 1 1  7 HIS HB2  H  15.487  -3.627   0.438 1.00 . A A .  7 HIS HB2  1 1 
        1   108 1 1  7 HIS HB3  H  15.522  -4.617  -1.019 1.00 . A A .  7 HIS HB3  1 1 
        1   109 1 1  7 HIS HD1  H  14.331  -4.648   2.374 1.00 . A A .  7 HIS HD1  1 1 
        1   110 1 1  7 HIS HD2  H  15.668  -7.512  -0.323 1.00 . A A .  7 HIS HD2  1 1 
        1   111 1 1  7 HIS HE1  H  13.463  -6.838   3.234 1.00 . A A .  7 HIS HE1  1 1 
        1   112 1 1  7 HIS HE2  H  14.062  -8.500   1.443 1.00 . A A .  7 HIS HE2  1 1 
        1   113 1 1  7 HIS N    N  17.860  -4.367   1.421 1.00 . A A .  7 HIS N    1 1 
        1   114 1 1  7 HIS ND1  N  14.501  -5.508   1.924 1.00 . A A .  7 HIS ND1  1 1 
        1   115 1 1  7 HIS NE2  N  14.465  -7.605   1.509 1.00 . A A .  7 HIS NE2  1 1 
        1   116 1 1  7 HIS O    O  17.818  -2.282  -0.612 1.00 . A A .  7 HIS O    1 1 
        1   117 1 1  8 HIS C    C  17.860  -2.389  -3.847 1.00 . A A .  8 HIS C    1 1 
        1   118 1 1  8 HIS CA   C  19.018  -2.978  -3.018 1.00 . A A .  8 HIS CA   1 1 
        1   119 1 1  8 HIS CB   C  20.019  -3.701  -3.931 1.00 . A A .  8 HIS CB   1 1 
        1   120 1 1  8 HIS CD2  C  21.984  -2.079  -4.426 1.00 . A A .  8 HIS CD2  1 1 
        1   121 1 1  8 HIS CE1  C  21.542  -1.674  -6.529 1.00 . A A .  8 HIS CE1  1 1 
        1   122 1 1  8 HIS CG   C  20.870  -2.777  -4.750 1.00 . A A .  8 HIS CG   1 1 
        1   123 1 1  8 HIS H    H  18.603  -4.872  -2.152 1.00 . A A .  8 HIS H    1 1 
        1   124 1 1  8 HIS HA   H  19.524  -2.174  -2.506 1.00 . A A .  8 HIS HA   1 1 
        1   125 1 1  8 HIS HB2  H  20.678  -4.306  -3.325 1.00 . A A .  8 HIS HB2  1 1 
        1   126 1 1  8 HIS HB3  H  19.477  -4.345  -4.611 1.00 . A A .  8 HIS HB3  1 1 
        1   127 1 1  8 HIS HD1  H  19.875  -2.847  -6.604 1.00 . A A .  8 HIS HD1  1 1 
        1   128 1 1  8 HIS HD2  H  22.472  -2.060  -3.461 1.00 . A A .  8 HIS HD2  1 1 
        1   129 1 1  8 HIS HE1  H  21.598  -1.283  -7.533 1.00 . A A .  8 HIS HE1  1 1 
        1   130 1 1  8 HIS HE2  H  23.252  -0.971  -5.671 1.00 . A A .  8 HIS HE2  1 1 
        1   131 1 1  8 HIS N    N  18.508  -3.905  -2.006 1.00 . A A .  8 HIS N    1 1 
        1   132 1 1  8 HIS ND1  N  20.622  -2.497  -6.075 1.00 . A A .  8 HIS ND1  1 1 
        1   133 1 1  8 HIS NE2  N  22.381  -1.404  -5.552 1.00 . A A .  8 HIS NE2  1 1 
        1   134 1 1  8 HIS O    O  18.009  -1.352  -4.495 1.00 . A A .  8 HIS O    1 1 
        1   135 1 1  9 SER C    C  14.913  -1.367  -3.779 1.00 . A A .  9 SER C    1 1 
        1   136 1 1  9 SER CA   C  15.493  -2.594  -4.492 1.00 . A A .  9 SER CA   1 1 
        1   137 1 1  9 SER CB   C  14.440  -3.710  -4.546 1.00 . A A .  9 SER CB   1 1 
        1   138 1 1  9 SER H    H  16.684  -3.927  -3.340 1.00 . A A .  9 SER H    1 1 
        1   139 1 1  9 SER HA   H  15.760  -2.316  -5.503 1.00 . A A .  9 SER HA   1 1 
        1   140 1 1  9 SER HB2  H  14.173  -3.999  -3.540 1.00 . A A .  9 SER HB2  1 1 
        1   141 1 1  9 SER HB3  H  13.562  -3.352  -5.064 1.00 . A A .  9 SER HB3  1 1 
        1   142 1 1  9 SER HG   H  14.481  -5.641  -4.911 1.00 . A A .  9 SER HG   1 1 
        1   143 1 1  9 SER N    N  16.713  -3.073  -3.820 1.00 . A A .  9 SER N    1 1 
        1   144 1 1  9 SER O    O  15.253  -1.086  -2.628 1.00 . A A .  9 SER O    1 1 
        1   145 1 1  9 SER OG   O  14.938  -4.851  -5.229 1.00 . A A .  9 SER OG   1 1 
        1   146 1 1 10 HIS C    C  11.965   0.647  -3.894 1.00 . A A . 10 HIS C    1 1 
        1   147 1 1 10 HIS CA   C  13.505   0.626  -3.924 1.00 . A A . 10 HIS CA   1 1 
        1   148 1 1 10 HIS CB   C  14.032   1.785  -4.778 1.00 . A A . 10 HIS CB   1 1 
        1   149 1 1 10 HIS CD2  C  16.586   1.871  -4.304 1.00 . A A . 10 HIS CD2  1 1 
        1   150 1 1 10 HIS CE1  C  17.292   1.314  -6.300 1.00 . A A . 10 HIS CE1  1 1 
        1   151 1 1 10 HIS CG   C  15.496   1.679  -5.083 1.00 . A A . 10 HIS CG   1 1 
        1   152 1 1 10 HIS H    H  13.701  -0.963  -5.329 1.00 . A A . 10 HIS H    1 1 
        1   153 1 1 10 HIS HA   H  13.873   0.744  -2.913 1.00 . A A . 10 HIS HA   1 1 
        1   154 1 1 10 HIS HB2  H  13.498   1.810  -5.716 1.00 . A A . 10 HIS HB2  1 1 
        1   155 1 1 10 HIS HB3  H  13.869   2.716  -4.253 1.00 . A A . 10 HIS HB3  1 1 
        1   156 1 1 10 HIS HD1  H  15.431   1.118  -7.114 1.00 . A A . 10 HIS HD1  1 1 
        1   157 1 1 10 HIS HD2  H  16.587   2.154  -3.261 1.00 . A A . 10 HIS HD2  1 1 
        1   158 1 1 10 HIS HE1  H  17.938   1.076  -7.134 1.00 . A A . 10 HIS HE1  1 1 
        1   159 1 1 10 HIS HE2  H  18.612   1.857  -4.841 1.00 . A A . 10 HIS HE2  1 1 
        1   160 1 1 10 HIS N    N  14.022  -0.641  -4.454 1.00 . A A . 10 HIS N    1 1 
        1   161 1 1 10 HIS ND1  N  15.977   1.332  -6.328 1.00 . A A . 10 HIS ND1  1 1 
        1   162 1 1 10 HIS NE2  N  17.689   1.638  -5.088 1.00 . A A . 10 HIS NE2  1 1 
        1   163 1 1 10 HIS O    O  11.316   0.543  -4.932 1.00 . A A . 10 HIS O    1 1 
        1   164 1 1 11 MET C    C   9.365   2.267  -2.687 1.00 . A A . 11 MET C    1 1 
        1   165 1 1 11 MET CA   C   9.925   0.839  -2.530 1.00 . A A . 11 MET CA   1 1 
        1   166 1 1 11 MET CB   C   9.527   0.275  -1.156 1.00 . A A . 11 MET CB   1 1 
        1   167 1 1 11 MET CE   C  12.080  -3.000  -0.630 1.00 . A A . 11 MET CE   1 1 
        1   168 1 1 11 MET CG   C  10.029  -1.141  -0.906 1.00 . A A . 11 MET CG   1 1 
        1   169 1 1 11 MET H    H  11.960   0.846  -1.901 1.00 . A A . 11 MET H    1 1 
        1   170 1 1 11 MET HA   H   9.489   0.214  -3.298 1.00 . A A . 11 MET HA   1 1 
        1   171 1 1 11 MET HB2  H   9.930   0.917  -0.384 1.00 . A A . 11 MET HB2  1 1 
        1   172 1 1 11 MET HB3  H   8.448   0.270  -1.079 1.00 . A A . 11 MET HB3  1 1 
        1   173 1 1 11 MET HE1  H  13.138  -3.217  -0.623 1.00 . A A . 11 MET HE1  1 1 
        1   174 1 1 11 MET HE2  H  11.615  -3.511  -1.459 1.00 . A A . 11 MET HE2  1 1 
        1   175 1 1 11 MET HE3  H  11.639  -3.338   0.296 1.00 . A A . 11 MET HE3  1 1 
        1   176 1 1 11 MET HG2  H   9.613  -1.497   0.025 1.00 . A A . 11 MET HG2  1 1 
        1   177 1 1 11 MET HG3  H   9.693  -1.776  -1.713 1.00 . A A . 11 MET HG3  1 1 
        1   178 1 1 11 MET N    N  11.390   0.793  -2.696 1.00 . A A . 11 MET N    1 1 
        1   179 1 1 11 MET O    O   8.157   2.485  -2.573 1.00 . A A . 11 MET O    1 1 
        1   180 1 1 11 MET SD   S  11.830  -1.232  -0.806 1.00 . A A . 11 MET SD   1 1 
        1   181 1 1 12 LEU C    C   9.326   4.901  -4.559 1.00 . A A . 12 LEU C    1 1 
        1   182 1 1 12 LEU CA   C   9.827   4.636  -3.121 1.00 . A A . 12 LEU CA   1 1 
        1   183 1 1 12 LEU CB   C  10.970   5.610  -2.758 1.00 . A A . 12 LEU CB   1 1 
        1   184 1 1 12 LEU CD1  C  12.141   4.297  -0.929 1.00 . A A . 12 LEU CD1  1 1 
        1   185 1 1 12 LEU CD2  C  12.303   6.802  -0.978 1.00 . A A . 12 LEU CD2  1 1 
        1   186 1 1 12 LEU CG   C  11.417   5.596  -1.282 1.00 . A A . 12 LEU CG   1 1 
        1   187 1 1 12 LEU H    H  11.189   3.007  -3.010 1.00 . A A . 12 LEU H    1 1 
        1   188 1 1 12 LEU HA   H   9.002   4.813  -2.444 1.00 . A A . 12 LEU HA   1 1 
        1   189 1 1 12 LEU HB2  H  11.827   5.373  -3.375 1.00 . A A . 12 LEU HB2  1 1 
        1   190 1 1 12 LEU HB3  H  10.644   6.613  -3.002 1.00 . A A . 12 LEU HB3  1 1 
        1   191 1 1 12 LEU HD11 H  13.017   4.187  -1.554 1.00 . A A . 12 LEU HD11 1 1 
        1   192 1 1 12 LEU HD12 H  11.478   3.459  -1.088 1.00 . A A . 12 LEU HD12 1 1 
        1   193 1 1 12 LEU HD13 H  12.442   4.324   0.108 1.00 . A A . 12 LEU HD13 1 1 
        1   194 1 1 12 LEU HD21 H  11.765   7.711  -1.203 1.00 . A A . 12 LEU HD21 1 1 
        1   195 1 1 12 LEU HD22 H  13.199   6.756  -1.581 1.00 . A A . 12 LEU HD22 1 1 
        1   196 1 1 12 LEU HD23 H  12.573   6.794   0.068 1.00 . A A . 12 LEU HD23 1 1 
        1   197 1 1 12 LEU HG   H  10.541   5.664  -0.652 1.00 . A A . 12 LEU HG   1 1 
        1   198 1 1 12 LEU N    N  10.244   3.235  -2.941 1.00 . A A . 12 LEU N    1 1 
        1   199 1 1 12 LEU O    O   8.281   5.530  -4.746 1.00 . A A . 12 LEU O    1 1 
        1   200 1 1 13 PRO C    C   8.838   3.196  -7.366 1.00 . A A . 13 PRO C    1 1 
        1   201 1 1 13 PRO CA   C   9.573   4.497  -6.982 1.00 . A A . 13 PRO CA   1 1 
        1   202 1 1 13 PRO CB   C  10.862   4.645  -7.787 1.00 . A A . 13 PRO CB   1 1 
        1   203 1 1 13 PRO CD   C  11.455   3.955  -5.551 1.00 . A A . 13 PRO CD   1 1 
        1   204 1 1 13 PRO CG   C  11.875   3.873  -7.005 1.00 . A A . 13 PRO CG   1 1 
        1   205 1 1 13 PRO HA   H   8.931   5.347  -7.156 1.00 . A A . 13 PRO HA   1 1 
        1   206 1 1 13 PRO HB2  H  10.723   4.236  -8.779 1.00 . A A . 13 PRO HB2  1 1 
        1   207 1 1 13 PRO HB3  H  11.130   5.691  -7.857 1.00 . A A . 13 PRO HB3  1 1 
        1   208 1 1 13 PRO HD2  H  11.482   2.976  -5.094 1.00 . A A . 13 PRO HD2  1 1 
        1   209 1 1 13 PRO HD3  H  12.098   4.638  -5.011 1.00 . A A . 13 PRO HD3  1 1 
        1   210 1 1 13 PRO HG2  H  11.882   2.843  -7.334 1.00 . A A . 13 PRO HG2  1 1 
        1   211 1 1 13 PRO HG3  H  12.855   4.311  -7.139 1.00 . A A . 13 PRO HG3  1 1 
        1   212 1 1 13 PRO N    N  10.069   4.467  -5.604 1.00 . A A . 13 PRO N    1 1 
        1   213 1 1 13 PRO O    O   9.288   2.100  -7.031 1.00 . A A . 13 PRO O    1 1 
        1   214 1 1 14 PRO C    C   7.737   1.220  -9.515 1.00 . A A . 14 PRO C    1 1 
        1   215 1 1 14 PRO CA   C   6.945   2.094  -8.516 1.00 . A A . 14 PRO CA   1 1 
        1   216 1 1 14 PRO CB   C   5.682   2.685  -9.179 1.00 . A A . 14 PRO CB   1 1 
        1   217 1 1 14 PRO CD   C   7.005   4.537  -8.441 1.00 . A A . 14 PRO CD   1 1 
        1   218 1 1 14 PRO CG   C   5.586   4.080  -8.652 1.00 . A A . 14 PRO CG   1 1 
        1   219 1 1 14 PRO HA   H   6.651   1.482  -7.673 1.00 . A A . 14 PRO HA   1 1 
        1   220 1 1 14 PRO HB2  H   5.794   2.676 -10.256 1.00 . A A . 14 PRO HB2  1 1 
        1   221 1 1 14 PRO HB3  H   4.819   2.098  -8.899 1.00 . A A . 14 PRO HB3  1 1 
        1   222 1 1 14 PRO HD2  H   7.416   4.943  -9.356 1.00 . A A . 14 PRO HD2  1 1 
        1   223 1 1 14 PRO HD3  H   7.057   5.263  -7.644 1.00 . A A . 14 PRO HD3  1 1 
        1   224 1 1 14 PRO HG2  H   5.088   4.714  -9.372 1.00 . A A . 14 PRO HG2  1 1 
        1   225 1 1 14 PRO HG3  H   5.048   4.082  -7.714 1.00 . A A . 14 PRO HG3  1 1 
        1   226 1 1 14 PRO N    N   7.690   3.288  -8.065 1.00 . A A . 14 PRO N    1 1 
        1   227 1 1 14 PRO O    O   7.512   1.277 -10.727 1.00 . A A . 14 PRO O    1 1 
        1   228 1 1 15 GLU C    C   8.597  -1.733 -10.188 1.00 . A A . 15 GLU C    1 1 
        1   229 1 1 15 GLU CA   C   9.454  -0.507  -9.832 1.00 . A A . 15 GLU CA   1 1 
        1   230 1 1 15 GLU CB   C  10.744  -0.934  -9.098 1.00 . A A . 15 GLU CB   1 1 
        1   231 1 1 15 GLU CD   C  12.924  -0.147  -8.003 1.00 . A A . 15 GLU CD   1 1 
        1   232 1 1 15 GLU CG   C  11.573   0.249  -8.590 1.00 . A A . 15 GLU CG   1 1 
        1   233 1 1 15 GLU H    H   8.884   0.491  -8.041 1.00 . A A . 15 GLU H    1 1 
        1   234 1 1 15 GLU HA   H   9.723   0.006 -10.746 1.00 . A A . 15 GLU HA   1 1 
        1   235 1 1 15 GLU HB2  H  10.477  -1.551  -8.251 1.00 . A A . 15 GLU HB2  1 1 
        1   236 1 1 15 GLU HB3  H  11.357  -1.513  -9.775 1.00 . A A . 15 GLU HB3  1 1 
        1   237 1 1 15 GLU HG2  H  11.743   0.927  -9.414 1.00 . A A . 15 GLU HG2  1 1 
        1   238 1 1 15 GLU HG3  H  11.004   0.761  -7.825 1.00 . A A . 15 GLU HG3  1 1 
        1   239 1 1 15 GLU N    N   8.683   0.429  -9.001 1.00 . A A . 15 GLU N    1 1 
        1   240 1 1 15 GLU O    O   8.453  -2.091 -11.359 1.00 . A A . 15 GLU O    1 1 
        1   241 1 1 15 GLU OE1  O  13.026  -1.223  -7.372 1.00 . A A . 15 GLU OE1  1 1 
        1   242 1 1 15 GLU OE2  O  13.896   0.620  -8.176 1.00 . A A . 15 GLU OE2  1 1 
        1   243 1 1 16 GLN C    C   6.307  -3.736  -8.025 1.00 . A A . 16 GLN C    1 1 
        1   244 1 1 16 GLN CA   C   7.052  -3.445  -9.338 1.00 . A A . 16 GLN CA   1 1 
        1   245 1 1 16 GLN CB   C   7.716  -4.730  -9.862 1.00 . A A . 16 GLN CB   1 1 
        1   246 1 1 16 GLN CD   C   7.322  -7.097 -10.720 1.00 . A A . 16 GLN CD   1 1 
        1   247 1 1 16 GLN CG   C   6.749  -5.909  -9.967 1.00 . A A . 16 GLN CG   1 1 
        1   248 1 1 16 GLN H    H   8.281  -2.100  -8.251 1.00 . A A . 16 GLN H    1 1 
        1   249 1 1 16 GLN HA   H   6.331  -3.108 -10.070 1.00 . A A . 16 GLN HA   1 1 
        1   250 1 1 16 GLN HB2  H   8.128  -4.537 -10.844 1.00 . A A . 16 GLN HB2  1 1 
        1   251 1 1 16 GLN HB3  H   8.520  -5.010  -9.194 1.00 . A A . 16 GLN HB3  1 1 
        1   252 1 1 16 GLN HE21 H   5.507  -7.642 -11.287 1.00 . A A . 16 GLN HE21 1 1 
        1   253 1 1 16 GLN HE22 H   6.805  -8.641 -11.835 1.00 . A A . 16 GLN HE22 1 1 
        1   254 1 1 16 GLN HG2  H   6.487  -6.231  -8.971 1.00 . A A . 16 GLN HG2  1 1 
        1   255 1 1 16 GLN HG3  H   5.855  -5.576 -10.478 1.00 . A A . 16 GLN HG3  1 1 
        1   256 1 1 16 GLN N    N   8.031  -2.365  -9.160 1.00 . A A . 16 GLN N    1 1 
        1   257 1 1 16 GLN NE2  N   6.459  -7.871 -11.343 1.00 . A A . 16 GLN NE2  1 1 
        1   258 1 1 16 GLN O    O   6.921  -4.056  -7.002 1.00 . A A . 16 GLN O    1 1 
        1   259 1 1 16 GLN OE1  O   8.527  -7.323 -10.739 1.00 . A A . 16 GLN OE1  1 1 
        1   260 1 1 17 TRP C    C   3.679  -5.311  -6.789 1.00 . A A . 17 TRP C    1 1 
        1   261 1 1 17 TRP CA   C   4.155  -3.855  -6.871 1.00 . A A . 17 TRP CA   1 1 
        1   262 1 1 17 TRP CB   C   2.962  -2.890  -6.850 1.00 . A A . 17 TRP CB   1 1 
        1   263 1 1 17 TRP CD1  C   3.705  -0.528  -7.526 1.00 . A A . 17 TRP CD1  1 1 
        1   264 1 1 17 TRP CD2  C   3.495  -0.830  -5.318 1.00 . A A . 17 TRP CD2  1 1 
        1   265 1 1 17 TRP CE2  C   3.902   0.496  -5.553 1.00 . A A . 17 TRP CE2  1 1 
        1   266 1 1 17 TRP CE3  C   3.298  -1.249  -3.999 1.00 . A A . 17 TRP CE3  1 1 
        1   267 1 1 17 TRP CG   C   3.368  -1.468  -6.595 1.00 . A A . 17 TRP CG   1 1 
        1   268 1 1 17 TRP CH2  C   3.920   0.965  -3.240 1.00 . A A . 17 TRP CH2  1 1 
        1   269 1 1 17 TRP CZ2  C   4.118   1.403  -4.522 1.00 . A A . 17 TRP CZ2  1 1 
        1   270 1 1 17 TRP CZ3  C   3.516  -0.348  -2.974 1.00 . A A . 17 TRP CZ3  1 1 
        1   271 1 1 17 TRP H    H   4.543  -3.378  -8.905 1.00 . A A . 17 TRP H    1 1 
        1   272 1 1 17 TRP HA   H   4.769  -3.655  -6.002 1.00 . A A . 17 TRP HA   1 1 
        1   273 1 1 17 TRP HB2  H   2.456  -2.928  -7.805 1.00 . A A . 17 TRP HB2  1 1 
        1   274 1 1 17 TRP HB3  H   2.273  -3.187  -6.072 1.00 . A A . 17 TRP HB3  1 1 
        1   275 1 1 17 TRP HD1  H   3.712  -0.701  -8.592 1.00 . A A . 17 TRP HD1  1 1 
        1   276 1 1 17 TRP HE1  H   4.292   1.480  -7.357 1.00 . A A . 17 TRP HE1  1 1 
        1   277 1 1 17 TRP HE3  H   2.987  -2.260  -3.776 1.00 . A A . 17 TRP HE3  1 1 
        1   278 1 1 17 TRP HH2  H   4.078   1.635  -2.408 1.00 . A A . 17 TRP HH2  1 1 
        1   279 1 1 17 TRP HZ2  H   4.428   2.420  -4.712 1.00 . A A . 17 TRP HZ2  1 1 
        1   280 1 1 17 TRP HZ3  H   3.373  -0.654  -1.949 1.00 . A A . 17 TRP HZ3  1 1 
        1   281 1 1 17 TRP N    N   4.981  -3.620  -8.059 1.00 . A A . 17 TRP N    1 1 
        1   282 1 1 17 TRP NE1  N   4.023   0.657  -6.906 1.00 . A A . 17 TRP NE1  1 1 
        1   283 1 1 17 TRP O    O   2.562  -5.643  -7.188 1.00 . A A . 17 TRP O    1 1 
        1   284 1 1 18 SER C    C   3.454  -7.737  -4.729 1.00 . A A . 18 SER C    1 1 
        1   285 1 1 18 SER CA   C   4.199  -7.585  -6.060 1.00 . A A . 18 SER CA   1 1 
        1   286 1 1 18 SER CB   C   5.456  -8.470  -6.053 1.00 . A A . 18 SER CB   1 1 
        1   287 1 1 18 SER H    H   5.466  -5.880  -6.105 1.00 . A A . 18 SER H    1 1 
        1   288 1 1 18 SER HA   H   3.549  -7.905  -6.862 1.00 . A A . 18 SER HA   1 1 
        1   289 1 1 18 SER HB2  H   6.134  -8.124  -5.287 1.00 . A A . 18 SER HB2  1 1 
        1   290 1 1 18 SER HB3  H   5.171  -9.492  -5.844 1.00 . A A . 18 SER HB3  1 1 
        1   291 1 1 18 SER HG   H   7.031  -8.756  -7.192 1.00 . A A . 18 SER HG   1 1 
        1   292 1 1 18 SER N    N   4.555  -6.183  -6.300 1.00 . A A . 18 SER N    1 1 
        1   293 1 1 18 SER O    O   3.419  -6.805  -3.921 1.00 . A A . 18 SER O    1 1 
        1   294 1 1 18 SER OG   O   6.127  -8.431  -7.304 1.00 . A A . 18 SER OG   1 1 
        1   295 1 1 19 HIS C    C   2.900  -8.737  -2.005 1.00 . A A . 19 HIS C    1 1 
        1   296 1 1 19 HIS CA   C   2.129  -9.196  -3.259 1.00 . A A . 19 HIS CA   1 1 
        1   297 1 1 19 HIS CB   C   1.806 -10.695  -3.165 1.00 . A A . 19 HIS CB   1 1 
        1   298 1 1 19 HIS CD2  C  -0.005 -10.929  -1.308 1.00 . A A . 19 HIS CD2  1 1 
        1   299 1 1 19 HIS CE1  C   1.205 -12.001   0.170 1.00 . A A . 19 HIS CE1  1 1 
        1   300 1 1 19 HIS CG   C   1.228 -11.110  -1.842 1.00 . A A . 19 HIS CG   1 1 
        1   301 1 1 19 HIS H    H   2.934  -9.618  -5.185 1.00 . A A . 19 HIS H    1 1 
        1   302 1 1 19 HIS HA   H   1.201  -8.646  -3.310 1.00 . A A . 19 HIS HA   1 1 
        1   303 1 1 19 HIS HB2  H   1.090 -10.950  -3.934 1.00 . A A . 19 HIS HB2  1 1 
        1   304 1 1 19 HIS HB3  H   2.712 -11.262  -3.326 1.00 . A A . 19 HIS HB3  1 1 
        1   305 1 1 19 HIS HD1  H   2.892 -12.078  -0.975 1.00 . A A . 19 HIS HD1  1 1 
        1   306 1 1 19 HIS HD2  H  -0.844 -10.438  -1.780 1.00 . A A . 19 HIS HD2  1 1 
        1   307 1 1 19 HIS HE1  H   1.517 -12.505   1.075 1.00 . A A . 19 HIS HE1  1 1 
        1   308 1 1 19 HIS HE2  H  -0.727 -11.485   0.589 1.00 . A A . 19 HIS HE2  1 1 
        1   309 1 1 19 HIS N    N   2.874  -8.917  -4.497 1.00 . A A . 19 HIS N    1 1 
        1   310 1 1 19 HIS ND1  N   1.957 -11.786  -0.887 1.00 . A A . 19 HIS ND1  1 1 
        1   311 1 1 19 HIS NE2  N   0.013 -11.493  -0.057 1.00 . A A . 19 HIS NE2  1 1 
        1   312 1 1 19 HIS O    O   2.344  -8.062  -1.140 1.00 . A A . 19 HIS O    1 1 
        1   313 1 1 20 THR C    C   5.146  -7.159  -0.710 1.00 . A A . 20 THR C    1 1 
        1   314 1 1 20 THR CA   C   5.043  -8.690  -0.802 1.00 . A A . 20 THR CA   1 1 
        1   315 1 1 20 THR CB   C   6.470  -9.282  -0.935 1.00 . A A . 20 THR CB   1 1 
        1   316 1 1 20 THR CG2  C   7.337  -8.925   0.270 1.00 . A A . 20 THR CG2  1 1 
        1   317 1 1 20 THR H    H   4.550  -9.697  -2.610 1.00 . A A . 20 THR H    1 1 
        1   318 1 1 20 THR HA   H   4.606  -9.066   0.115 1.00 . A A . 20 THR HA   1 1 
        1   319 1 1 20 THR HB   H   6.931  -8.878  -1.826 1.00 . A A . 20 THR HB   1 1 
        1   320 1 1 20 THR HG1  H   7.235 -11.102  -0.786 1.00 . A A . 20 THR HG1  1 1 
        1   321 1 1 20 THR HG21 H   7.436  -7.851   0.341 1.00 . A A . 20 THR HG21 1 1 
        1   322 1 1 20 THR HG22 H   8.317  -9.368   0.153 1.00 . A A . 20 THR HG22 1 1 
        1   323 1 1 20 THR HG23 H   6.877  -9.304   1.170 1.00 . A A . 20 THR HG23 1 1 
        1   324 1 1 20 THR N    N   4.179  -9.111  -1.918 1.00 . A A . 20 THR N    1 1 
        1   325 1 1 20 THR O    O   4.917  -6.574   0.347 1.00 . A A . 20 THR O    1 1 
        1   326 1 1 20 THR OG1  O   6.395 -10.710  -1.061 1.00 . A A . 20 THR OG1  1 1 
        1   327 1 1 21 THR C    C   4.399  -4.313  -1.368 1.00 . A A . 21 THR C    1 1 
        1   328 1 1 21 THR CA   C   5.646  -5.055  -1.882 1.00 . A A . 21 THR CA   1 1 
        1   329 1 1 21 THR CB   C   5.953  -4.577  -3.327 1.00 . A A . 21 THR CB   1 1 
        1   330 1 1 21 THR CG2  C   6.302  -3.091  -3.361 1.00 . A A . 21 THR CG2  1 1 
        1   331 1 1 21 THR H    H   5.604  -7.036  -2.652 1.00 . A A . 21 THR H    1 1 
        1   332 1 1 21 THR HA   H   6.491  -4.799  -1.255 1.00 . A A . 21 THR HA   1 1 
        1   333 1 1 21 THR HB   H   5.074  -4.738  -3.939 1.00 . A A . 21 THR HB   1 1 
        1   334 1 1 21 THR HG1  H   7.419  -4.850  -4.632 1.00 . A A . 21 THR HG1  1 1 
        1   335 1 1 21 THR HG21 H   7.172  -2.908  -2.745 1.00 . A A . 21 THR HG21 1 1 
        1   336 1 1 21 THR HG22 H   5.469  -2.515  -2.986 1.00 . A A . 21 THR HG22 1 1 
        1   337 1 1 21 THR HG23 H   6.514  -2.794  -4.378 1.00 . A A . 21 THR HG23 1 1 
        1   338 1 1 21 THR N    N   5.475  -6.518  -1.832 1.00 . A A . 21 THR N    1 1 
        1   339 1 1 21 THR O    O   4.497  -3.428  -0.515 1.00 . A A . 21 THR O    1 1 
        1   340 1 1 21 THR OG1  O   7.046  -5.332  -3.881 1.00 . A A . 21 THR OG1  1 1 
        1   341 1 1 22 VAL C    C   1.601  -4.359  -0.030 1.00 . A A . 22 VAL C    1 1 
        1   342 1 1 22 VAL CA   C   1.965  -4.056  -1.495 1.00 . A A . 22 VAL CA   1 1 
        1   343 1 1 22 VAL CB   C   0.805  -4.519  -2.416 1.00 . A A . 22 VAL CB   1 1 
        1   344 1 1 22 VAL CG1  C  -0.502  -3.813  -2.053 1.00 . A A . 22 VAL CG1  1 1 
        1   345 1 1 22 VAL CG2  C   1.156  -4.284  -3.884 1.00 . A A . 22 VAL CG2  1 1 
        1   346 1 1 22 VAL H    H   3.219  -5.411  -2.550 1.00 . A A . 22 VAL H    1 1 
        1   347 1 1 22 VAL HA   H   2.079  -2.985  -1.611 1.00 . A A . 22 VAL HA   1 1 
        1   348 1 1 22 VAL HB   H   0.664  -5.583  -2.271 1.00 . A A . 22 VAL HB   1 1 
        1   349 1 1 22 VAL HG11 H  -1.290  -4.156  -2.708 1.00 . A A . 22 VAL HG11 1 1 
        1   350 1 1 22 VAL HG12 H  -0.379  -2.746  -2.166 1.00 . A A . 22 VAL HG12 1 1 
        1   351 1 1 22 VAL HG13 H  -0.762  -4.039  -1.029 1.00 . A A . 22 VAL HG13 1 1 
        1   352 1 1 22 VAL HG21 H   0.351  -4.642  -4.511 1.00 . A A . 22 VAL HG21 1 1 
        1   353 1 1 22 VAL HG22 H   2.065  -4.817  -4.128 1.00 . A A . 22 VAL HG22 1 1 
        1   354 1 1 22 VAL HG23 H   1.303  -3.228  -4.058 1.00 . A A . 22 VAL HG23 1 1 
        1   355 1 1 22 VAL N    N   3.232  -4.688  -1.886 1.00 . A A . 22 VAL N    1 1 
        1   356 1 1 22 VAL O    O   1.195  -3.468   0.718 1.00 . A A . 22 VAL O    1 1 
        1   357 1 1 23 ARG C    C   2.238  -5.304   2.794 1.00 . A A . 23 ARG C    1 1 
        1   358 1 1 23 ARG CA   C   1.404  -6.050   1.734 1.00 . A A . 23 ARG CA   1 1 
        1   359 1 1 23 ARG CB   C   1.592  -7.578   1.854 1.00 . A A . 23 ARG CB   1 1 
        1   360 1 1 23 ARG CD   C   1.579  -8.126   4.349 1.00 . A A . 23 ARG CD   1 1 
        1   361 1 1 23 ARG CG   C   0.838  -8.235   3.017 1.00 . A A . 23 ARG CG   1 1 
        1   362 1 1 23 ARG CZ   C   0.993  -9.872   5.975 1.00 . A A . 23 ARG CZ   1 1 
        1   363 1 1 23 ARG H    H   2.137  -6.273  -0.251 1.00 . A A . 23 ARG H    1 1 
        1   364 1 1 23 ARG HA   H   0.359  -5.813   1.887 1.00 . A A . 23 ARG HA   1 1 
        1   365 1 1 23 ARG HB2  H   1.249  -8.037   0.936 1.00 . A A . 23 ARG HB2  1 1 
        1   366 1 1 23 ARG HB3  H   2.647  -7.788   1.969 1.00 . A A . 23 ARG HB3  1 1 
        1   367 1 1 23 ARG HD2  H   2.516  -8.657   4.274 1.00 . A A . 23 ARG HD2  1 1 
        1   368 1 1 23 ARG HD3  H   1.774  -7.082   4.556 1.00 . A A . 23 ARG HD3  1 1 
        1   369 1 1 23 ARG HE   H   0.078  -8.133   5.819 1.00 . A A . 23 ARG HE   1 1 
        1   370 1 1 23 ARG HG2  H  -0.127  -7.760   3.120 1.00 . A A . 23 ARG HG2  1 1 
        1   371 1 1 23 ARG HG3  H   0.694  -9.282   2.786 1.00 . A A . 23 ARG HG3  1 1 
        1   372 1 1 23 ARG HH11 H   2.510 -10.347   4.776 1.00 . A A . 23 ARG HH11 1 1 
        1   373 1 1 23 ARG HH12 H   2.066 -11.545   5.937 1.00 . A A . 23 ARG HH12 1 1 
        1   374 1 1 23 ARG HH21 H  -0.479  -9.711   7.308 1.00 . A A . 23 ARG HH21 1 1 
        1   375 1 1 23 ARG HH22 H   0.401 -11.195   7.331 1.00 . A A . 23 ARG HH22 1 1 
        1   376 1 1 23 ARG N    N   1.763  -5.616   0.376 1.00 . A A . 23 ARG N    1 1 
        1   377 1 1 23 ARG NE   N   0.793  -8.688   5.449 1.00 . A A . 23 ARG NE   1 1 
        1   378 1 1 23 ARG NH1  N   1.928 -10.648   5.524 1.00 . A A . 23 ARG NH1  1 1 
        1   379 1 1 23 ARG NH2  N   0.248 -10.290   6.945 1.00 . A A . 23 ARG NH2  1 1 
        1   380 1 1 23 ARG O    O   1.705  -4.848   3.814 1.00 . A A . 23 ARG O    1 1 
        1   381 1 1 24 ASN C    C   4.144  -2.949   3.497 1.00 . A A . 24 ASN C    1 1 
        1   382 1 1 24 ASN CA   C   4.452  -4.457   3.441 1.00 . A A . 24 ASN CA   1 1 
        1   383 1 1 24 ASN CB   C   5.907  -4.684   3.012 1.00 . A A . 24 ASN CB   1 1 
        1   384 1 1 24 ASN CG   C   6.354  -6.122   3.213 1.00 . A A . 24 ASN CG   1 1 
        1   385 1 1 24 ASN H    H   3.907  -5.585   1.722 1.00 . A A . 24 ASN H    1 1 
        1   386 1 1 24 ASN HA   H   4.318  -4.867   4.432 1.00 . A A . 24 ASN HA   1 1 
        1   387 1 1 24 ASN HB2  H   6.012  -4.441   1.965 1.00 . A A . 24 ASN HB2  1 1 
        1   388 1 1 24 ASN HB3  H   6.555  -4.043   3.593 1.00 . A A . 24 ASN HB3  1 1 
        1   389 1 1 24 ASN HD21 H   8.225  -5.538   3.463 1.00 . A A . 24 ASN HD21 1 1 
        1   390 1 1 24 ASN HD22 H   7.948  -7.235   3.572 1.00 . A A . 24 ASN HD22 1 1 
        1   391 1 1 24 ASN N    N   3.541  -5.176   2.538 1.00 . A A . 24 ASN N    1 1 
        1   392 1 1 24 ASN ND2  N   7.637  -6.315   3.439 1.00 . A A . 24 ASN ND2  1 1 
        1   393 1 1 24 ASN O    O   4.484  -2.273   4.468 1.00 . A A . 24 ASN O    1 1 
        1   394 1 1 24 ASN OD1  O   5.554  -7.052   3.168 1.00 . A A . 24 ASN OD1  1 1 
        1   395 1 1 25 ALA C    C   1.783  -0.821   3.229 1.00 . A A . 25 ALA C    1 1 
        1   396 1 1 25 ALA CA   C   3.085  -1.020   2.436 1.00 . A A . 25 ALA CA   1 1 
        1   397 1 1 25 ALA CB   C   2.908  -0.542   0.997 1.00 . A A . 25 ALA CB   1 1 
        1   398 1 1 25 ALA H    H   3.321  -2.993   1.676 1.00 . A A . 25 ALA H    1 1 
        1   399 1 1 25 ALA HA   H   3.869  -0.428   2.892 1.00 . A A . 25 ALA HA   1 1 
        1   400 1 1 25 ALA HB1  H   3.848  -0.632   0.469 1.00 . A A . 25 ALA HB1  1 1 
        1   401 1 1 25 ALA HB2  H   2.593   0.491   0.994 1.00 . A A . 25 ALA HB2  1 1 
        1   402 1 1 25 ALA HB3  H   2.161  -1.148   0.503 1.00 . A A . 25 ALA HB3  1 1 
        1   403 1 1 25 ALA N    N   3.507  -2.425   2.455 1.00 . A A . 25 ALA N    1 1 
        1   404 1 1 25 ALA O    O   1.682   0.068   4.078 1.00 . A A . 25 ALA O    1 1 
        1   405 1 1 26 LEU C    C  -0.433  -1.657   5.136 1.00 . A A . 26 LEU C    1 1 
        1   406 1 1 26 LEU CA   C  -0.524  -1.595   3.602 1.00 . A A . 26 LEU CA   1 1 
        1   407 1 1 26 LEU CB   C  -1.433  -2.726   3.096 1.00 . A A . 26 LEU CB   1 1 
        1   408 1 1 26 LEU CD1  C  -2.628  -3.883   1.205 1.00 . A A . 26 LEU CD1  1 1 
        1   409 1 1 26 LEU CD2  C  -2.477  -1.373   1.243 1.00 . A A . 26 LEU CD2  1 1 
        1   410 1 1 26 LEU CG   C  -1.772  -2.681   1.598 1.00 . A A . 26 LEU CG   1 1 
        1   411 1 1 26 LEU H    H   0.953  -2.380   2.292 1.00 . A A . 26 LEU H    1 1 
        1   412 1 1 26 LEU HA   H  -0.965  -0.650   3.324 1.00 . A A . 26 LEU HA   1 1 
        1   413 1 1 26 LEU HB2  H  -0.944  -3.669   3.304 1.00 . A A . 26 LEU HB2  1 1 
        1   414 1 1 26 LEU HB3  H  -2.360  -2.694   3.654 1.00 . A A . 26 LEU HB3  1 1 
        1   415 1 1 26 LEU HD11 H  -2.861  -3.831   0.152 1.00 . A A . 26 LEU HD11 1 1 
        1   416 1 1 26 LEU HD12 H  -3.545  -3.878   1.778 1.00 . A A . 26 LEU HD12 1 1 
        1   417 1 1 26 LEU HD13 H  -2.084  -4.793   1.407 1.00 . A A . 26 LEU HD13 1 1 
        1   418 1 1 26 LEU HD21 H  -3.393  -1.286   1.811 1.00 . A A . 26 LEU HD21 1 1 
        1   419 1 1 26 LEU HD22 H  -2.708  -1.363   0.187 1.00 . A A . 26 LEU HD22 1 1 
        1   420 1 1 26 LEU HD23 H  -1.831  -0.538   1.475 1.00 . A A . 26 LEU HD23 1 1 
        1   421 1 1 26 LEU HG   H  -0.854  -2.729   1.029 1.00 . A A . 26 LEU HG   1 1 
        1   422 1 1 26 LEU N    N   0.795  -1.675   2.956 1.00 . A A . 26 LEU N    1 1 
        1   423 1 1 26 LEU O    O  -1.142  -0.929   5.833 1.00 . A A . 26 LEU O    1 1 
        1   424 1 1 27 LYS C    C   0.940  -1.462   7.891 1.00 . A A . 27 LYS C    1 1 
        1   425 1 1 27 LYS CA   C   0.529  -2.732   7.115 1.00 . A A . 27 LYS CA   1 1 
        1   426 1 1 27 LYS CB   C   1.456  -3.923   7.445 1.00 . A A . 27 LYS CB   1 1 
        1   427 1 1 27 LYS CD   C   3.774  -2.930   7.803 1.00 . A A . 27 LYS CD   1 1 
        1   428 1 1 27 LYS CE   C   5.246  -3.052   7.425 1.00 . A A . 27 LYS CE   1 1 
        1   429 1 1 27 LYS CG   C   2.893  -3.818   6.926 1.00 . A A . 27 LYS CG   1 1 
        1   430 1 1 27 LYS H    H   1.056  -3.001   5.065 1.00 . A A . 27 LYS H    1 1 
        1   431 1 1 27 LYS HA   H  -0.471  -2.995   7.438 1.00 . A A . 27 LYS HA   1 1 
        1   432 1 1 27 LYS HB2  H   1.502  -4.034   8.518 1.00 . A A . 27 LYS HB2  1 1 
        1   433 1 1 27 LYS HB3  H   1.018  -4.822   7.029 1.00 . A A . 27 LYS HB3  1 1 
        1   434 1 1 27 LYS HD2  H   3.466  -1.902   7.681 1.00 . A A . 27 LYS HD2  1 1 
        1   435 1 1 27 LYS HD3  H   3.651  -3.222   8.838 1.00 . A A . 27 LYS HD3  1 1 
        1   436 1 1 27 LYS HE2  H   5.359  -2.806   6.379 1.00 . A A . 27 LYS HE2  1 1 
        1   437 1 1 27 LYS HE3  H   5.819  -2.356   8.020 1.00 . A A . 27 LYS HE3  1 1 
        1   438 1 1 27 LYS HG2  H   3.324  -4.809   6.894 1.00 . A A . 27 LYS HG2  1 1 
        1   439 1 1 27 LYS HG3  H   2.870  -3.408   5.924 1.00 . A A . 27 LYS HG3  1 1 
        1   440 1 1 27 LYS HZ1  H   5.235  -5.108   7.076 1.00 . A A . 27 LYS HZ1  1 1 
        1   441 1 1 27 LYS HZ2  H   5.664  -4.686   8.657 1.00 . A A . 27 LYS HZ2  1 1 
        1   442 1 1 27 LYS HZ3  H   6.769  -4.481   7.392 1.00 . A A . 27 LYS HZ3  1 1 
        1   443 1 1 27 LYS N    N   0.450  -2.510   5.661 1.00 . A A . 27 LYS N    1 1 
        1   444 1 1 27 LYS NZ   N   5.764  -4.427   7.653 1.00 . A A . 27 LYS NZ   1 1 
        1   445 1 1 27 LYS O    O   0.681  -1.358   9.090 1.00 . A A . 27 LYS O    1 1 
        1   446 1 1 28 ASP C    C   0.782   1.801   7.753 1.00 . A A . 28 ASP C    1 1 
        1   447 1 1 28 ASP CA   C   1.922   0.779   7.856 1.00 . A A . 28 ASP CA   1 1 
        1   448 1 1 28 ASP CB   C   3.214   1.359   7.271 1.00 . A A . 28 ASP CB   1 1 
        1   449 1 1 28 ASP CG   C   4.442   0.742   7.910 1.00 . A A . 28 ASP CG   1 1 
        1   450 1 1 28 ASP H    H   1.819  -0.650   6.277 1.00 . A A . 28 ASP H    1 1 
        1   451 1 1 28 ASP HA   H   2.087   0.576   8.907 1.00 . A A . 28 ASP HA   1 1 
        1   452 1 1 28 ASP HB2  H   3.240   1.167   6.206 1.00 . A A . 28 ASP HB2  1 1 
        1   453 1 1 28 ASP HB3  H   3.242   2.426   7.440 1.00 . A A . 28 ASP HB3  1 1 
        1   454 1 1 28 ASP N    N   1.574  -0.499   7.216 1.00 . A A . 28 ASP N    1 1 
        1   455 1 1 28 ASP O    O   0.583   2.614   8.658 1.00 . A A . 28 ASP O    1 1 
        1   456 1 1 28 ASP OD1  O   4.582   0.855   9.147 1.00 . A A . 28 ASP OD1  1 1 
        1   457 1 1 28 ASP OD2  O   5.256   0.134   7.193 1.00 . A A . 28 ASP OD2  1 1 
        1   458 1 1 29 LEU C    C  -2.243   2.229   7.482 1.00 . A A . 29 LEU C    1 1 
        1   459 1 1 29 LEU CA   C  -1.130   2.641   6.504 1.00 . A A . 29 LEU CA   1 1 
        1   460 1 1 29 LEU CB   C  -1.645   2.587   5.056 1.00 . A A . 29 LEU CB   1 1 
        1   461 1 1 29 LEU CD1  C  -1.218   2.826   2.581 1.00 . A A . 29 LEU CD1  1 1 
        1   462 1 1 29 LEU CD2  C  -0.031   4.336   4.206 1.00 . A A . 29 LEU CD2  1 1 
        1   463 1 1 29 LEU CG   C  -0.607   2.938   3.976 1.00 . A A . 29 LEU CG   1 1 
        1   464 1 1 29 LEU H    H   0.274   1.146   5.936 1.00 . A A . 29 LEU H    1 1 
        1   465 1 1 29 LEU HA   H  -0.824   3.650   6.733 1.00 . A A . 29 LEU HA   1 1 
        1   466 1 1 29 LEU HB2  H  -2.012   1.588   4.863 1.00 . A A . 29 LEU HB2  1 1 
        1   467 1 1 29 LEU HB3  H  -2.474   3.277   4.966 1.00 . A A . 29 LEU HB3  1 1 
        1   468 1 1 29 LEU HD11 H  -1.550   1.812   2.414 1.00 . A A . 29 LEU HD11 1 1 
        1   469 1 1 29 LEU HD12 H  -0.477   3.088   1.840 1.00 . A A . 29 LEU HD12 1 1 
        1   470 1 1 29 LEU HD13 H  -2.061   3.498   2.499 1.00 . A A . 29 LEU HD13 1 1 
        1   471 1 1 29 LEU HD21 H   0.677   4.567   3.424 1.00 . A A . 29 LEU HD21 1 1 
        1   472 1 1 29 LEU HD22 H   0.472   4.363   5.163 1.00 . A A . 29 LEU HD22 1 1 
        1   473 1 1 29 LEU HD23 H  -0.829   5.064   4.199 1.00 . A A . 29 LEU HD23 1 1 
        1   474 1 1 29 LEU HG   H   0.208   2.230   4.033 1.00 . A A . 29 LEU HG   1 1 
        1   475 1 1 29 LEU N    N   0.037   1.766   6.658 1.00 . A A . 29 LEU N    1 1 
        1   476 1 1 29 LEU O    O  -2.820   3.062   8.182 1.00 . A A . 29 LEU O    1 1 
        1   477 1 1 30 LEU C    C  -3.337   0.563   9.884 1.00 . A A . 30 LEU C    1 1 
        1   478 1 1 30 LEU CA   C  -3.568   0.362   8.372 1.00 . A A . 30 LEU CA   1 1 
        1   479 1 1 30 LEU CB   C  -3.713  -1.136   8.064 1.00 . A A . 30 LEU CB   1 1 
        1   480 1 1 30 LEU CD1  C  -6.212  -1.222   8.373 1.00 . A A . 30 LEU CD1  1 1 
        1   481 1 1 30 LEU CD2  C  -4.870  -3.346   8.471 1.00 . A A . 30 LEU CD2  1 1 
        1   482 1 1 30 LEU CG   C  -4.879  -1.846   8.774 1.00 . A A . 30 LEU CG   1 1 
        1   483 1 1 30 LEU H    H  -1.931   0.313   7.029 1.00 . A A . 30 LEU H    1 1 
        1   484 1 1 30 LEU HA   H  -4.485   0.862   8.094 1.00 . A A . 30 LEU HA   1 1 
        1   485 1 1 30 LEU HB2  H  -3.845  -1.253   6.996 1.00 . A A . 30 LEU HB2  1 1 
        1   486 1 1 30 LEU HB3  H  -2.795  -1.630   8.350 1.00 . A A . 30 LEU HB3  1 1 
        1   487 1 1 30 LEU HD11 H  -7.013  -1.723   8.895 1.00 . A A . 30 LEU HD11 1 1 
        1   488 1 1 30 LEU HD12 H  -6.356  -1.327   7.307 1.00 . A A . 30 LEU HD12 1 1 
        1   489 1 1 30 LEU HD13 H  -6.214  -0.174   8.636 1.00 . A A . 30 LEU HD13 1 1 
        1   490 1 1 30 LEU HD21 H  -5.002  -3.503   7.410 1.00 . A A . 30 LEU HD21 1 1 
        1   491 1 1 30 LEU HD22 H  -5.676  -3.827   9.008 1.00 . A A . 30 LEU HD22 1 1 
        1   492 1 1 30 LEU HD23 H  -3.927  -3.773   8.782 1.00 . A A . 30 LEU HD23 1 1 
        1   493 1 1 30 LEU HG   H  -4.765  -1.723   9.842 1.00 . A A . 30 LEU HG   1 1 
        1   494 1 1 30 LEU N    N  -2.490   0.925   7.553 1.00 . A A . 30 LEU N    1 1 
        1   495 1 1 30 LEU O    O  -4.285   0.804  10.635 1.00 . A A . 30 LEU O    1 1 
        1   496 1 1 31 LYS C    C  -2.129   1.909  12.395 1.00 . A A . 31 LYS C    1 1 
        1   497 1 1 31 LYS CA   C  -1.797   0.534  11.783 1.00 . A A . 31 LYS CA   1 1 
        1   498 1 1 31 LYS CB   C  -0.343   0.107  12.087 1.00 . A A . 31 LYS CB   1 1 
        1   499 1 1 31 LYS CD   C   1.086   2.210  11.908 1.00 . A A . 31 LYS CD   1 1 
        1   500 1 1 31 LYS CE   C   2.300   2.845  11.235 1.00 . A A . 31 LYS CE   1 1 
        1   501 1 1 31 LYS CG   C   0.748   0.848  11.307 1.00 . A A . 31 LYS CG   1 1 
        1   502 1 1 31 LYS H    H  -1.349   0.341   9.703 1.00 . A A . 31 LYS H    1 1 
        1   503 1 1 31 LYS HA   H  -2.455  -0.187  12.253 1.00 . A A . 31 LYS HA   1 1 
        1   504 1 1 31 LYS HB2  H  -0.157   0.251  13.141 1.00 . A A . 31 LYS HB2  1 1 
        1   505 1 1 31 LYS HB3  H  -0.250  -0.950  11.868 1.00 . A A . 31 LYS HB3  1 1 
        1   506 1 1 31 LYS HD2  H   0.236   2.868  11.787 1.00 . A A . 31 LYS HD2  1 1 
        1   507 1 1 31 LYS HD3  H   1.295   2.086  12.961 1.00 . A A . 31 LYS HD3  1 1 
        1   508 1 1 31 LYS HE2  H   2.110   2.937  10.177 1.00 . A A . 31 LYS HE2  1 1 
        1   509 1 1 31 LYS HE3  H   2.456   3.828  11.657 1.00 . A A . 31 LYS HE3  1 1 
        1   510 1 1 31 LYS HG2  H   1.643   0.242  11.302 1.00 . A A . 31 LYS HG2  1 1 
        1   511 1 1 31 LYS HG3  H   0.411   0.989  10.288 1.00 . A A . 31 LYS HG3  1 1 
        1   512 1 1 31 LYS HZ1  H   3.755   1.963  12.448 1.00 . A A . 31 LYS HZ1  1 1 
        1   513 1 1 31 LYS HZ2  H   4.337   2.482  10.951 1.00 . A A . 31 LYS HZ2  1 1 
        1   514 1 1 31 LYS HZ3  H   3.406   1.079  11.050 1.00 . A A . 31 LYS HZ3  1 1 
        1   515 1 1 31 LYS N    N  -2.085   0.467  10.339 1.00 . A A . 31 LYS N    1 1 
        1   516 1 1 31 LYS NZ   N   3.533   2.034  11.433 1.00 . A A . 31 LYS NZ   1 1 
        1   517 1 1 31 LYS O    O  -2.275   2.024  13.613 1.00 . A A . 31 LYS O    1 1 
        1   518 1 1 32 ASP C    C  -4.000   4.751  11.376 1.00 . A A . 32 ASP C    1 1 
        1   519 1 1 32 ASP CA   C  -2.686   4.276  12.027 1.00 . A A . 32 ASP CA   1 1 
        1   520 1 1 32 ASP CB   C  -1.574   5.310  11.796 1.00 . A A . 32 ASP CB   1 1 
        1   521 1 1 32 ASP CG   C  -0.524   5.277  12.893 1.00 . A A . 32 ASP CG   1 1 
        1   522 1 1 32 ASP H    H  -2.088   2.806  10.602 1.00 . A A . 32 ASP H    1 1 
        1   523 1 1 32 ASP HA   H  -2.859   4.198  13.093 1.00 . A A . 32 ASP HA   1 1 
        1   524 1 1 32 ASP HB2  H  -1.093   5.107  10.850 1.00 . A A . 32 ASP HB2  1 1 
        1   525 1 1 32 ASP HB3  H  -2.007   6.301  11.768 1.00 . A A . 32 ASP HB3  1 1 
        1   526 1 1 32 ASP N    N  -2.269   2.941  11.555 1.00 . A A . 32 ASP N    1 1 
        1   527 1 1 32 ASP O    O  -4.652   5.665  11.884 1.00 . A A . 32 ASP O    1 1 
        1   528 1 1 32 ASP OD1  O  -0.906   5.215  14.079 1.00 . A A . 32 ASP OD1  1 1 
        1   529 1 1 32 ASP OD2  O   0.684   5.313  12.583 1.00 . A A . 32 ASP OD2  1 1 
        1   530 1 1 33 MET C    C  -6.610   3.258   9.644 1.00 . A A . 33 MET C    1 1 
        1   531 1 1 33 MET CA   C  -5.658   4.463   9.603 1.00 . A A . 33 MET CA   1 1 
        1   532 1 1 33 MET CB   C  -5.417   4.901   8.152 1.00 . A A . 33 MET CB   1 1 
        1   533 1 1 33 MET CE   C  -6.335   7.972   8.235 1.00 . A A . 33 MET CE   1 1 
        1   534 1 1 33 MET CG   C  -6.685   5.333   7.427 1.00 . A A . 33 MET CG   1 1 
        1   535 1 1 33 MET H    H  -3.806   3.460   9.861 1.00 . A A . 33 MET H    1 1 
        1   536 1 1 33 MET HA   H  -6.115   5.281  10.143 1.00 . A A . 33 MET HA   1 1 
        1   537 1 1 33 MET HB2  H  -4.728   5.734   8.150 1.00 . A A . 33 MET HB2  1 1 
        1   538 1 1 33 MET HB3  H  -4.976   4.079   7.606 1.00 . A A . 33 MET HB3  1 1 
        1   539 1 1 33 MET HE1  H  -6.740   8.857   8.705 1.00 . A A . 33 MET HE1  1 1 
        1   540 1 1 33 MET HE2  H  -6.090   8.191   7.206 1.00 . A A . 33 MET HE2  1 1 
        1   541 1 1 33 MET HE3  H  -5.444   7.662   8.760 1.00 . A A . 33 MET HE3  1 1 
        1   542 1 1 33 MET HG2  H  -6.422   5.680   6.437 1.00 . A A . 33 MET HG2  1 1 
        1   543 1 1 33 MET HG3  H  -7.348   4.484   7.343 1.00 . A A . 33 MET HG3  1 1 
        1   544 1 1 33 MET N    N  -4.385   4.140  10.259 1.00 . A A . 33 MET N    1 1 
        1   545 1 1 33 MET O    O  -6.272   2.172   9.173 1.00 . A A . 33 MET O    1 1 
        1   546 1 1 33 MET SD   S  -7.553   6.658   8.291 1.00 . A A . 33 MET SD   1 1 
        1   547 1 1 34 ASN C    C  -9.159   1.738   9.021 1.00 . A A . 34 ASN C    1 1 
        1   548 1 1 34 ASN CA   C  -8.785   2.380  10.372 1.00 . A A . 34 ASN CA   1 1 
        1   549 1 1 34 ASN CB   C -10.041   2.925  11.061 1.00 . A A . 34 ASN CB   1 1 
        1   550 1 1 34 ASN CG   C  -9.709   3.659  12.348 1.00 . A A . 34 ASN CG   1 1 
        1   551 1 1 34 ASN H    H  -8.021   4.357  10.538 1.00 . A A . 34 ASN H    1 1 
        1   552 1 1 34 ASN HA   H  -8.343   1.623  11.004 1.00 . A A . 34 ASN HA   1 1 
        1   553 1 1 34 ASN HB2  H -10.542   3.613  10.394 1.00 . A A . 34 ASN HB2  1 1 
        1   554 1 1 34 ASN HB3  H -10.705   2.106  11.292 1.00 . A A . 34 ASN HB3  1 1 
        1   555 1 1 34 ASN HD21 H  -9.815   1.978  13.390 1.00 . A A . 34 ASN HD21 1 1 
        1   556 1 1 34 ASN HD22 H  -9.430   3.402  14.287 1.00 . A A . 34 ASN HD22 1 1 
        1   557 1 1 34 ASN N    N  -7.799   3.459  10.211 1.00 . A A . 34 ASN N    1 1 
        1   558 1 1 34 ASN ND2  N  -9.647   2.941  13.451 1.00 . A A . 34 ASN ND2  1 1 
        1   559 1 1 34 ASN O    O  -9.154   2.405   7.985 1.00 . A A . 34 ASN O    1 1 
        1   560 1 1 34 ASN OD1  O  -9.494   4.866  12.349 1.00 . A A . 34 ASN OD1  1 1 
        1   561 1 1 35 GLN C    C -10.749   0.394   6.881 1.00 . A A . 35 GLN C    1 1 
        1   562 1 1 35 GLN CA   C  -9.783  -0.333   7.834 1.00 . A A . 35 GLN CA   1 1 
        1   563 1 1 35 GLN CB   C -10.362  -1.711   8.199 1.00 . A A . 35 GLN CB   1 1 
        1   564 1 1 35 GLN CD   C -10.012  -3.941   9.366 1.00 . A A . 35 GLN CD   1 1 
        1   565 1 1 35 GLN CG   C  -9.432  -2.573   9.050 1.00 . A A . 35 GLN CG   1 1 
        1   566 1 1 35 GLN H    H  -9.559  -0.002   9.925 1.00 . A A . 35 GLN H    1 1 
        1   567 1 1 35 GLN HA   H  -8.842  -0.482   7.321 1.00 . A A . 35 GLN HA   1 1 
        1   568 1 1 35 GLN HB2  H -11.286  -1.568   8.746 1.00 . A A . 35 GLN HB2  1 1 
        1   569 1 1 35 GLN HB3  H -10.581  -2.248   7.287 1.00 . A A . 35 GLN HB3  1 1 
        1   570 1 1 35 GLN HE21 H  -9.175  -4.702   7.746 1.00 . A A . 35 GLN HE21 1 1 
        1   571 1 1 35 GLN HE22 H -10.093  -5.803   8.705 1.00 . A A . 35 GLN HE22 1 1 
        1   572 1 1 35 GLN HG2  H  -8.504  -2.710   8.513 1.00 . A A . 35 GLN HG2  1 1 
        1   573 1 1 35 GLN HG3  H  -9.231  -2.059   9.980 1.00 . A A . 35 GLN HG3  1 1 
        1   574 1 1 35 GLN N    N  -9.499   0.445   9.053 1.00 . A A . 35 GLN N    1 1 
        1   575 1 1 35 GLN NE2  N  -9.733  -4.912   8.520 1.00 . A A . 35 GLN NE2  1 1 
        1   576 1 1 35 GLN O    O -10.433   0.610   5.709 1.00 . A A . 35 GLN O    1 1 
        1   577 1 1 35 GLN OE1  O -10.702  -4.127  10.362 1.00 . A A . 35 GLN OE1  1 1 
        1   578 1 1 36 SER C    C -12.452   2.846   6.116 1.00 . A A . 36 SER C    1 1 
        1   579 1 1 36 SER CA   C -12.932   1.461   6.580 1.00 . A A . 36 SER CA   1 1 
        1   580 1 1 36 SER CB   C -14.251   1.596   7.358 1.00 . A A . 36 SER CB   1 1 
        1   581 1 1 36 SER H    H -12.110   0.581   8.335 1.00 . A A . 36 SER H    1 1 
        1   582 1 1 36 SER HA   H -13.111   0.853   5.704 1.00 . A A . 36 SER HA   1 1 
        1   583 1 1 36 SER HB2  H -14.079   2.156   8.266 1.00 . A A . 36 SER HB2  1 1 
        1   584 1 1 36 SER HB3  H -14.976   2.115   6.748 1.00 . A A . 36 SER HB3  1 1 
        1   585 1 1 36 SER HG   H -15.454   0.073   7.059 1.00 . A A . 36 SER HG   1 1 
        1   586 1 1 36 SER N    N -11.917   0.774   7.393 1.00 . A A . 36 SER N    1 1 
        1   587 1 1 36 SER O    O -12.627   3.215   4.955 1.00 . A A . 36 SER O    1 1 
        1   588 1 1 36 SER OG   O -14.778   0.322   7.703 1.00 . A A . 36 SER OG   1 1 
        1   589 1 1 37 SER C    C -10.220   4.884   5.621 1.00 . A A . 37 SER C    1 1 
        1   590 1 1 37 SER CA   C -11.325   4.948   6.692 1.00 . A A . 37 SER CA   1 1 
        1   591 1 1 37 SER CB   C -10.789   5.646   7.951 1.00 . A A . 37 SER CB   1 1 
        1   592 1 1 37 SER H    H -11.745   3.269   7.941 1.00 . A A . 37 SER H    1 1 
        1   593 1 1 37 SER HA   H -12.150   5.528   6.298 1.00 . A A . 37 SER HA   1 1 
        1   594 1 1 37 SER HB2  H -11.560   5.661   8.706 1.00 . A A . 37 SER HB2  1 1 
        1   595 1 1 37 SER HB3  H  -9.931   5.103   8.325 1.00 . A A . 37 SER HB3  1 1 
        1   596 1 1 37 SER HG   H  -9.452   7.085   7.841 1.00 . A A . 37 SER HG   1 1 
        1   597 1 1 37 SER N    N -11.841   3.607   7.023 1.00 . A A . 37 SER N    1 1 
        1   598 1 1 37 SER O    O -10.037   5.824   4.843 1.00 . A A . 37 SER O    1 1 
        1   599 1 1 37 SER OG   O -10.398   6.984   7.672 1.00 . A A . 37 SER OG   1 1 
        1   600 1 1 38 LEU C    C  -9.089   3.188   3.229 1.00 . A A . 38 LEU C    1 1 
        1   601 1 1 38 LEU CA   C  -8.444   3.555   4.576 1.00 . A A . 38 LEU CA   1 1 
        1   602 1 1 38 LEU CB   C  -7.480   2.444   5.051 1.00 . A A . 38 LEU CB   1 1 
        1   603 1 1 38 LEU CD1  C  -6.402   1.560   2.913 1.00 . A A . 38 LEU CD1  1 1 
        1   604 1 1 38 LEU CD2  C  -5.469   3.608   4.051 1.00 . A A . 38 LEU CD2  1 1 
        1   605 1 1 38 LEU CG   C  -6.166   2.262   4.253 1.00 . A A . 38 LEU CG   1 1 
        1   606 1 1 38 LEU H    H  -9.637   3.083   6.269 1.00 . A A . 38 LEU H    1 1 
        1   607 1 1 38 LEU HA   H  -7.891   4.478   4.461 1.00 . A A . 38 LEU HA   1 1 
        1   608 1 1 38 LEU HB2  H  -7.218   2.652   6.079 1.00 . A A . 38 LEU HB2  1 1 
        1   609 1 1 38 LEU HB3  H  -8.018   1.505   5.028 1.00 . A A . 38 LEU HB3  1 1 
        1   610 1 1 38 LEU HD11 H  -7.076   2.148   2.306 1.00 . A A . 38 LEU HD11 1 1 
        1   611 1 1 38 LEU HD12 H  -6.834   0.586   3.087 1.00 . A A . 38 LEU HD12 1 1 
        1   612 1 1 38 LEU HD13 H  -5.460   1.444   2.393 1.00 . A A . 38 LEU HD13 1 1 
        1   613 1 1 38 LEU HD21 H  -6.089   4.251   3.443 1.00 . A A . 38 LEU HD21 1 1 
        1   614 1 1 38 LEU HD22 H  -4.519   3.453   3.559 1.00 . A A . 38 LEU HD22 1 1 
        1   615 1 1 38 LEU HD23 H  -5.301   4.074   5.011 1.00 . A A . 38 LEU HD23 1 1 
        1   616 1 1 38 LEU HG   H  -5.499   1.634   4.830 1.00 . A A . 38 LEU HG   1 1 
        1   617 1 1 38 LEU N    N  -9.483   3.774   5.590 1.00 . A A . 38 LEU N    1 1 
        1   618 1 1 38 LEU O    O  -8.825   3.825   2.206 1.00 . A A . 38 LEU O    1 1 
        1   619 1 1 39 ALA C    C -11.588   2.800   1.474 1.00 . A A . 39 ALA C    1 1 
        1   620 1 1 39 ALA CA   C -10.653   1.714   2.033 1.00 . A A . 39 ALA CA   1 1 
        1   621 1 1 39 ALA CB   C -11.438   0.440   2.324 1.00 . A A . 39 ALA CB   1 1 
        1   622 1 1 39 ALA H    H -10.111   1.696   4.090 1.00 . A A . 39 ALA H    1 1 
        1   623 1 1 39 ALA HA   H  -9.907   1.482   1.285 1.00 . A A . 39 ALA HA   1 1 
        1   624 1 1 39 ALA HB1  H -11.888   0.078   1.412 1.00 . A A . 39 ALA HB1  1 1 
        1   625 1 1 39 ALA HB2  H -12.214   0.648   3.047 1.00 . A A . 39 ALA HB2  1 1 
        1   626 1 1 39 ALA HB3  H -10.772  -0.315   2.719 1.00 . A A . 39 ALA HB3  1 1 
        1   627 1 1 39 ALA N    N  -9.947   2.165   3.244 1.00 . A A . 39 ALA N    1 1 
        1   628 1 1 39 ALA O    O -12.056   2.709   0.340 1.00 . A A . 39 ALA O    1 1 
        1   629 1 1 40 LYS C    C -11.968   5.797   0.784 1.00 . A A . 40 LYS C    1 1 
        1   630 1 1 40 LYS CA   C -12.681   4.960   1.863 1.00 . A A . 40 LYS CA   1 1 
        1   631 1 1 40 LYS CB   C -13.011   5.842   3.076 1.00 . A A . 40 LYS CB   1 1 
        1   632 1 1 40 LYS CD   C -14.207   7.875   3.992 1.00 . A A . 40 LYS CD   1 1 
        1   633 1 1 40 LYS CE   C -14.956   7.071   5.049 1.00 . A A . 40 LYS CE   1 1 
        1   634 1 1 40 LYS CG   C -13.898   7.040   2.750 1.00 . A A . 40 LYS CG   1 1 
        1   635 1 1 40 LYS H    H -11.530   3.788   3.204 1.00 . A A . 40 LYS H    1 1 
        1   636 1 1 40 LYS HA   H -13.604   4.575   1.451 1.00 . A A . 40 LYS HA   1 1 
        1   637 1 1 40 LYS HB2  H -13.513   5.240   3.819 1.00 . A A . 40 LYS HB2  1 1 
        1   638 1 1 40 LYS HB3  H -12.084   6.212   3.496 1.00 . A A . 40 LYS HB3  1 1 
        1   639 1 1 40 LYS HD2  H -13.278   8.229   4.418 1.00 . A A . 40 LYS HD2  1 1 
        1   640 1 1 40 LYS HD3  H -14.813   8.721   3.701 1.00 . A A . 40 LYS HD3  1 1 
        1   641 1 1 40 LYS HE2  H -15.895   6.741   4.634 1.00 . A A . 40 LYS HE2  1 1 
        1   642 1 1 40 LYS HE3  H -14.362   6.210   5.322 1.00 . A A . 40 LYS HE3  1 1 
        1   643 1 1 40 LYS HG2  H -13.390   7.664   2.028 1.00 . A A . 40 LYS HG2  1 1 
        1   644 1 1 40 LYS HG3  H -14.826   6.683   2.326 1.00 . A A . 40 LYS HG3  1 1 
        1   645 1 1 40 LYS HZ1  H -15.734   7.298   6.974 1.00 . A A . 40 LYS HZ1  1 1 
        1   646 1 1 40 LYS HZ2  H -15.808   8.704   6.034 1.00 . A A . 40 LYS HZ2  1 1 
        1   647 1 1 40 LYS HZ3  H -14.334   8.202   6.692 1.00 . A A . 40 LYS HZ3  1 1 
        1   648 1 1 40 LYS N    N -11.865   3.818   2.286 1.00 . A A . 40 LYS N    1 1 
        1   649 1 1 40 LYS NZ   N -15.227   7.874   6.271 1.00 . A A . 40 LYS NZ   1 1 
        1   650 1 1 40 LYS O    O -12.533   6.076  -0.277 1.00 . A A . 40 LYS O    1 1 
        1   651 1 1 41 GLU C    C  -9.161   6.144  -0.872 1.00 . A A . 41 GLU C    1 1 
        1   652 1 1 41 GLU CA   C  -9.964   7.020   0.102 1.00 . A A . 41 GLU CA   1 1 
        1   653 1 1 41 GLU CB   C  -9.031   7.995   0.832 1.00 . A A . 41 GLU CB   1 1 
        1   654 1 1 41 GLU CD   C  -6.946   8.355   2.217 1.00 . A A . 41 GLU CD   1 1 
        1   655 1 1 41 GLU CG   C  -7.862   7.335   1.559 1.00 . A A . 41 GLU CG   1 1 
        1   656 1 1 41 GLU H    H -10.318   5.959   1.916 1.00 . A A . 41 GLU H    1 1 
        1   657 1 1 41 GLU HA   H -10.676   7.594  -0.473 1.00 . A A . 41 GLU HA   1 1 
        1   658 1 1 41 GLU HB2  H  -8.626   8.692   0.110 1.00 . A A . 41 GLU HB2  1 1 
        1   659 1 1 41 GLU HB3  H  -9.611   8.549   1.558 1.00 . A A . 41 GLU HB3  1 1 
        1   660 1 1 41 GLU HG2  H  -8.254   6.671   2.318 1.00 . A A . 41 GLU HG2  1 1 
        1   661 1 1 41 GLU HG3  H  -7.285   6.761   0.846 1.00 . A A . 41 GLU HG3  1 1 
        1   662 1 1 41 GLU N    N -10.727   6.206   1.059 1.00 . A A . 41 GLU N    1 1 
        1   663 1 1 41 GLU O    O  -8.685   6.621  -1.906 1.00 . A A . 41 GLU O    1 1 
        1   664 1 1 41 GLU OE1  O  -6.589   9.354   1.553 1.00 . A A . 41 GLU OE1  1 1 
        1   665 1 1 41 GLU OE2  O  -6.581   8.170   3.396 1.00 . A A . 41 GLU OE2  1 1 
        1   666 1 1 42 CYS C    C  -9.338   3.232  -2.370 1.00 . A A . 42 CYS C    1 1 
        1   667 1 1 42 CYS CA   C  -8.336   3.897  -1.409 1.00 . A A . 42 CYS CA   1 1 
        1   668 1 1 42 CYS CB   C  -7.628   2.823  -0.570 1.00 . A A . 42 CYS CB   1 1 
        1   669 1 1 42 CYS H    H  -9.363   4.560   0.328 1.00 . A A . 42 CYS H    1 1 
        1   670 1 1 42 CYS HA   H  -7.599   4.431  -1.989 1.00 . A A . 42 CYS HA   1 1 
        1   671 1 1 42 CYS HB2  H  -6.931   3.302   0.101 1.00 . A A . 42 CYS HB2  1 1 
        1   672 1 1 42 CYS HB3  H  -8.365   2.287   0.013 1.00 . A A . 42 CYS HB3  1 1 
        1   673 1 1 42 CYS HG   H  -5.446   1.630  -1.130 1.00 . A A . 42 CYS HG   1 1 
        1   674 1 1 42 CYS N    N  -9.011   4.866  -0.535 1.00 . A A . 42 CYS N    1 1 
        1   675 1 1 42 CYS O    O -10.447   2.890  -1.974 1.00 . A A . 42 CYS O    1 1 
        1   676 1 1 42 CYS SG   S  -6.704   1.606  -1.543 1.00 . A A . 42 CYS SG   1 1 
        1   677 1 1 43 PRO C    C  -9.967   0.917  -4.590 1.00 . A A . 43 PRO C    1 1 
        1   678 1 1 43 PRO CA   C  -9.872   2.455  -4.660 1.00 . A A . 43 PRO CA   1 1 
        1   679 1 1 43 PRO CB   C  -9.222   2.895  -5.973 1.00 . A A . 43 PRO CB   1 1 
        1   680 1 1 43 PRO CD   C  -7.648   3.372  -4.226 1.00 . A A . 43 PRO CD   1 1 
        1   681 1 1 43 PRO CG   C  -7.762   2.926  -5.665 1.00 . A A . 43 PRO CG   1 1 
        1   682 1 1 43 PRO HA   H -10.866   2.876  -4.590 1.00 . A A . 43 PRO HA   1 1 
        1   683 1 1 43 PRO HB2  H  -9.451   2.183  -6.755 1.00 . A A . 43 PRO HB2  1 1 
        1   684 1 1 43 PRO HB3  H  -9.588   3.874  -6.253 1.00 . A A . 43 PRO HB3  1 1 
        1   685 1 1 43 PRO HD2  H  -6.861   2.831  -3.723 1.00 . A A . 43 PRO HD2  1 1 
        1   686 1 1 43 PRO HD3  H  -7.465   4.437  -4.174 1.00 . A A . 43 PRO HD3  1 1 
        1   687 1 1 43 PRO HG2  H  -7.339   1.937  -5.786 1.00 . A A . 43 PRO HG2  1 1 
        1   688 1 1 43 PRO HG3  H  -7.261   3.628  -6.316 1.00 . A A . 43 PRO HG3  1 1 
        1   689 1 1 43 PRO N    N  -8.967   3.038  -3.651 1.00 . A A . 43 PRO N    1 1 
        1   690 1 1 43 PRO O    O -10.487   0.279  -5.507 1.00 . A A . 43 PRO O    1 1 
        1   691 1 1 44 LEU C    C -10.704  -1.578  -2.512 1.00 . A A . 44 LEU C    1 1 
        1   692 1 1 44 LEU CA   C  -9.485  -1.128  -3.334 1.00 . A A . 44 LEU CA   1 1 
        1   693 1 1 44 LEU CB   C  -8.186  -1.605  -2.664 1.00 . A A . 44 LEU CB   1 1 
        1   694 1 1 44 LEU CD1  C  -5.672  -1.786  -2.666 1.00 . A A . 44 LEU CD1  1 1 
        1   695 1 1 44 LEU CD2  C  -6.930  -1.821  -4.841 1.00 . A A . 44 LEU CD2  1 1 
        1   696 1 1 44 LEU CG   C  -6.892  -1.263  -3.421 1.00 . A A . 44 LEU CG   1 1 
        1   697 1 1 44 LEU H    H  -9.065   0.887  -2.806 1.00 . A A . 44 LEU H    1 1 
        1   698 1 1 44 LEU HA   H  -9.553  -1.576  -4.316 1.00 . A A . 44 LEU HA   1 1 
        1   699 1 1 44 LEU HB2  H  -8.130  -1.159  -1.680 1.00 . A A . 44 LEU HB2  1 1 
        1   700 1 1 44 LEU HB3  H  -8.237  -2.678  -2.552 1.00 . A A . 44 LEU HB3  1 1 
        1   701 1 1 44 LEU HD11 H  -4.774  -1.526  -3.208 1.00 . A A . 44 LEU HD11 1 1 
        1   702 1 1 44 LEU HD12 H  -5.735  -2.861  -2.573 1.00 . A A . 44 LEU HD12 1 1 
        1   703 1 1 44 LEU HD13 H  -5.638  -1.343  -1.680 1.00 . A A . 44 LEU HD13 1 1 
        1   704 1 1 44 LEU HD21 H  -7.023  -2.898  -4.804 1.00 . A A . 44 LEU HD21 1 1 
        1   705 1 1 44 LEU HD22 H  -6.021  -1.556  -5.361 1.00 . A A . 44 LEU HD22 1 1 
        1   706 1 1 44 LEU HD23 H  -7.776  -1.406  -5.368 1.00 . A A . 44 LEU HD23 1 1 
        1   707 1 1 44 LEU HG   H  -6.801  -0.187  -3.489 1.00 . A A . 44 LEU HG   1 1 
        1   708 1 1 44 LEU N    N  -9.460   0.328  -3.509 1.00 . A A . 44 LEU N    1 1 
        1   709 1 1 44 LEU O    O -11.376  -0.768  -1.871 1.00 . A A . 44 LEU O    1 1 
        1   710 1 1 45 SER C    C -11.778  -3.718  -0.341 1.00 . A A . 45 SER C    1 1 
        1   711 1 1 45 SER CA   C -12.132  -3.444  -1.811 1.00 . A A . 45 SER CA   1 1 
        1   712 1 1 45 SER CB   C -12.600  -4.735  -2.493 1.00 . A A . 45 SER CB   1 1 
        1   713 1 1 45 SER H    H -10.413  -3.477  -3.061 1.00 . A A . 45 SER H    1 1 
        1   714 1 1 45 SER HA   H -12.935  -2.721  -1.846 1.00 . A A . 45 SER HA   1 1 
        1   715 1 1 45 SER HB2  H -11.817  -5.475  -2.433 1.00 . A A . 45 SER HB2  1 1 
        1   716 1 1 45 SER HB3  H -13.485  -5.105  -1.996 1.00 . A A . 45 SER HB3  1 1 
        1   717 1 1 45 SER HG   H -13.845  -4.692  -4.013 1.00 . A A . 45 SER HG   1 1 
        1   718 1 1 45 SER N    N -10.985  -2.878  -2.536 1.00 . A A . 45 SER N    1 1 
        1   719 1 1 45 SER O    O -10.791  -4.398  -0.047 1.00 . A A . 45 SER O    1 1 
        1   720 1 1 45 SER OG   O -12.908  -4.508  -3.863 1.00 . A A . 45 SER OG   1 1 
        1   721 1 1 46 GLN C    C -12.003  -4.659   2.526 1.00 . A A . 46 GLN C    1 1 
        1   722 1 1 46 GLN CA   C -12.336  -3.246   2.014 1.00 . A A . 46 GLN CA   1 1 
        1   723 1 1 46 GLN CB   C -13.545  -2.692   2.781 1.00 . A A . 46 GLN CB   1 1 
        1   724 1 1 46 GLN CD   C -14.571  -2.119   5.025 1.00 . A A . 46 GLN CD   1 1 
        1   725 1 1 46 GLN CG   C -13.332  -2.600   4.291 1.00 . A A . 46 GLN CG   1 1 
        1   726 1 1 46 GLN H    H -13.436  -2.780   0.259 1.00 . A A . 46 GLN H    1 1 
        1   727 1 1 46 GLN HA   H -11.487  -2.604   2.201 1.00 . A A . 46 GLN HA   1 1 
        1   728 1 1 46 GLN HB2  H -13.766  -1.700   2.410 1.00 . A A . 46 GLN HB2  1 1 
        1   729 1 1 46 GLN HB3  H -14.396  -3.331   2.598 1.00 . A A . 46 GLN HB3  1 1 
        1   730 1 1 46 GLN HE21 H -15.207  -3.979   5.248 1.00 . A A . 46 GLN HE21 1 1 
        1   731 1 1 46 GLN HE22 H -16.226  -2.745   5.900 1.00 . A A . 46 GLN HE22 1 1 
        1   732 1 1 46 GLN HG2  H -13.068  -3.579   4.665 1.00 . A A . 46 GLN HG2  1 1 
        1   733 1 1 46 GLN HG3  H -12.520  -1.912   4.489 1.00 . A A . 46 GLN HG3  1 1 
        1   734 1 1 46 GLN N    N -12.609  -3.206   0.568 1.00 . A A . 46 GLN N    1 1 
        1   735 1 1 46 GLN NE2  N -15.417  -3.040   5.435 1.00 . A A . 46 GLN NE2  1 1 
        1   736 1 1 46 GLN O    O -10.924  -4.892   3.080 1.00 . A A . 46 GLN O    1 1 
        1   737 1 1 46 GLN OE1  O -14.767  -0.927   5.224 1.00 . A A . 46 GLN OE1  1 1 
        1   738 1 1 47 SER C    C -11.564  -7.671   2.199 1.00 . A A . 47 SER C    1 1 
        1   739 1 1 47 SER CA   C -12.756  -6.962   2.860 1.00 . A A . 47 SER CA   1 1 
        1   740 1 1 47 SER CB   C -14.039  -7.779   2.674 1.00 . A A . 47 SER CB   1 1 
        1   741 1 1 47 SER H    H -13.747  -5.373   1.852 1.00 . A A . 47 SER H    1 1 
        1   742 1 1 47 SER HA   H -12.553  -6.880   3.920 1.00 . A A . 47 SER HA   1 1 
        1   743 1 1 47 SER HB2  H -14.273  -7.847   1.624 1.00 . A A . 47 SER HB2  1 1 
        1   744 1 1 47 SER HB3  H -13.896  -8.773   3.077 1.00 . A A . 47 SER HB3  1 1 
        1   745 1 1 47 SER HG   H -15.950  -7.356   2.864 1.00 . A A . 47 SER HG   1 1 
        1   746 1 1 47 SER N    N -12.929  -5.597   2.344 1.00 . A A . 47 SER N    1 1 
        1   747 1 1 47 SER O    O -10.887  -8.475   2.835 1.00 . A A . 47 SER O    1 1 
        1   748 1 1 47 SER OG   O -15.133  -7.168   3.346 1.00 . A A . 47 SER OG   1 1 
        1   749 1 1 48 MET C    C  -8.824  -7.443   0.934 1.00 . A A . 48 MET C    1 1 
        1   750 1 1 48 MET CA   C -10.114  -7.901   0.238 1.00 . A A . 48 MET CA   1 1 
        1   751 1 1 48 MET CB   C -10.092  -7.482  -1.238 1.00 . A A . 48 MET CB   1 1 
        1   752 1 1 48 MET CE   C  -9.623  -8.492  -4.289 1.00 . A A . 48 MET CE   1 1 
        1   753 1 1 48 MET CG   C -11.233  -8.063  -2.061 1.00 . A A . 48 MET CG   1 1 
        1   754 1 1 48 MET H    H -11.918  -6.781   0.437 1.00 . A A . 48 MET H    1 1 
        1   755 1 1 48 MET HA   H -10.167  -8.981   0.292 1.00 . A A . 48 MET HA   1 1 
        1   756 1 1 48 MET HB2  H -10.151  -6.404  -1.296 1.00 . A A . 48 MET HB2  1 1 
        1   757 1 1 48 MET HB3  H  -9.159  -7.805  -1.680 1.00 . A A . 48 MET HB3  1 1 
        1   758 1 1 48 MET HE1  H  -9.448  -8.353  -5.346 1.00 . A A . 48 MET HE1  1 1 
        1   759 1 1 48 MET HE2  H  -9.728  -9.546  -4.076 1.00 . A A . 48 MET HE2  1 1 
        1   760 1 1 48 MET HE3  H  -8.787  -8.094  -3.731 1.00 . A A . 48 MET HE3  1 1 
        1   761 1 1 48 MET HG2  H -11.215  -9.141  -1.971 1.00 . A A . 48 MET HG2  1 1 
        1   762 1 1 48 MET HG3  H -12.168  -7.688  -1.673 1.00 . A A . 48 MET HG3  1 1 
        1   763 1 1 48 MET N    N -11.300  -7.366   0.926 1.00 . A A . 48 MET N    1 1 
        1   764 1 1 48 MET O    O  -7.943  -8.257   1.220 1.00 . A A . 48 MET O    1 1 
        1   765 1 1 48 MET SD   S -11.122  -7.630  -3.813 1.00 . A A . 48 MET SD   1 1 
        1   766 1 1 49 ILE C    C  -7.431  -6.306   3.313 1.00 . A A . 49 ILE C    1 1 
        1   767 1 1 49 ILE CA   C  -7.575  -5.599   1.957 1.00 . A A . 49 ILE CA   1 1 
        1   768 1 1 49 ILE CB   C  -7.720  -4.074   2.197 1.00 . A A . 49 ILE CB   1 1 
        1   769 1 1 49 ILE CD1  C  -8.107  -1.835   1.017 1.00 . A A . 49 ILE CD1  1 1 
        1   770 1 1 49 ILE CG1  C  -7.858  -3.324   0.860 1.00 . A A . 49 ILE CG1  1 1 
        1   771 1 1 49 ILE CG2  C  -6.534  -3.535   3.002 1.00 . A A . 49 ILE CG2  1 1 
        1   772 1 1 49 ILE H    H  -9.438  -5.533   0.925 1.00 . A A . 49 ILE H    1 1 
        1   773 1 1 49 ILE HA   H  -6.683  -5.773   1.369 1.00 . A A . 49 ILE HA   1 1 
        1   774 1 1 49 ILE HB   H  -8.616  -3.912   2.779 1.00 . A A . 49 ILE HB   1 1 
        1   775 1 1 49 ILE HD11 H  -7.280  -1.383   1.544 1.00 . A A . 49 ILE HD11 1 1 
        1   776 1 1 49 ILE HD12 H  -9.018  -1.678   1.577 1.00 . A A . 49 ILE HD12 1 1 
        1   777 1 1 49 ILE HD13 H  -8.203  -1.382   0.041 1.00 . A A . 49 ILE HD13 1 1 
        1   778 1 1 49 ILE HG12 H  -6.950  -3.449   0.287 1.00 . A A . 49 ILE HG12 1 1 
        1   779 1 1 49 ILE HG13 H  -8.685  -3.741   0.306 1.00 . A A . 49 ILE HG13 1 1 
        1   780 1 1 49 ILE HG21 H  -6.500  -4.024   3.964 1.00 . A A . 49 ILE HG21 1 1 
        1   781 1 1 49 ILE HG22 H  -6.646  -2.470   3.145 1.00 . A A . 49 ILE HG22 1 1 
        1   782 1 1 49 ILE HG23 H  -5.614  -3.730   2.468 1.00 . A A . 49 ILE HG23 1 1 
        1   783 1 1 49 ILE N    N  -8.723  -6.141   1.215 1.00 . A A . 49 ILE N    1 1 
        1   784 1 1 49 ILE O    O  -6.349  -6.768   3.682 1.00 . A A . 49 ILE O    1 1 
        1   785 1 1 50 SER C    C  -8.129  -8.552   5.210 1.00 . A A . 50 SER C    1 1 
        1   786 1 1 50 SER CA   C  -8.593  -7.090   5.331 1.00 . A A . 50 SER CA   1 1 
        1   787 1 1 50 SER CB   C -10.021  -7.045   5.894 1.00 . A A . 50 SER CB   1 1 
        1   788 1 1 50 SER H    H  -9.366  -5.982   3.686 1.00 . A A . 50 SER H    1 1 
        1   789 1 1 50 SER HA   H  -7.932  -6.569   6.009 1.00 . A A . 50 SER HA   1 1 
        1   790 1 1 50 SER HB2  H -10.330  -6.014   6.001 1.00 . A A . 50 SER HB2  1 1 
        1   791 1 1 50 SER HB3  H -10.691  -7.550   5.212 1.00 . A A . 50 SER HB3  1 1 
        1   792 1 1 50 SER HG   H -10.920  -8.184   7.216 1.00 . A A . 50 SER HG   1 1 
        1   793 1 1 50 SER N    N  -8.545  -6.398   4.033 1.00 . A A . 50 SER N    1 1 
        1   794 1 1 50 SER O    O  -7.422  -9.068   6.078 1.00 . A A . 50 SER O    1 1 
        1   795 1 1 50 SER OG   O -10.101  -7.673   7.163 1.00 . A A . 50 SER OG   1 1 
        1   796 1 1 51 SER C    C  -6.649 -10.752   3.564 1.00 . A A . 51 SER C    1 1 
        1   797 1 1 51 SER CA   C  -8.145 -10.610   3.871 1.00 . A A . 51 SER CA   1 1 
        1   798 1 1 51 SER CB   C  -8.961 -11.194   2.709 1.00 . A A . 51 SER CB   1 1 
        1   799 1 1 51 SER H    H  -9.081  -8.742   3.462 1.00 . A A . 51 SER H    1 1 
        1   800 1 1 51 SER HA   H  -8.369 -11.172   4.768 1.00 . A A . 51 SER HA   1 1 
        1   801 1 1 51 SER HB2  H  -8.833 -10.573   1.835 1.00 . A A . 51 SER HB2  1 1 
        1   802 1 1 51 SER HB3  H  -8.613 -12.195   2.492 1.00 . A A . 51 SER HB3  1 1 
        1   803 1 1 51 SER HG   H -10.732 -10.373   2.946 1.00 . A A . 51 SER HG   1 1 
        1   804 1 1 51 SER N    N  -8.522  -9.209   4.119 1.00 . A A . 51 SER N    1 1 
        1   805 1 1 51 SER O    O  -6.020 -11.725   3.967 1.00 . A A . 51 SER O    1 1 
        1   806 1 1 51 SER OG   O -10.345 -11.251   3.023 1.00 . A A . 51 SER OG   1 1 
        1   807 1 1 52 ILE C    C  -3.769  -9.682   3.744 1.00 . A A . 52 ILE C    1 1 
        1   808 1 1 52 ILE CA   C  -4.655  -9.812   2.495 1.00 . A A . 52 ILE CA   1 1 
        1   809 1 1 52 ILE CB   C  -4.296  -8.684   1.492 1.00 . A A . 52 ILE CB   1 1 
        1   810 1 1 52 ILE CD1  C  -4.908  -7.721  -0.796 1.00 . A A . 52 ILE CD1  1 1 
        1   811 1 1 52 ILE CG1  C  -5.092  -8.857   0.186 1.00 . A A . 52 ILE CG1  1 1 
        1   812 1 1 52 ILE CG2  C  -2.790  -8.669   1.205 1.00 . A A . 52 ILE CG2  1 1 
        1   813 1 1 52 ILE H    H  -6.641  -9.040   2.526 1.00 . A A . 52 ILE H    1 1 
        1   814 1 1 52 ILE HA   H  -4.448 -10.763   2.021 1.00 . A A . 52 ILE HA   1 1 
        1   815 1 1 52 ILE HB   H  -4.560  -7.736   1.943 1.00 . A A . 52 ILE HB   1 1 
        1   816 1 1 52 ILE HD11 H  -5.241  -6.797  -0.347 1.00 . A A . 52 ILE HD11 1 1 
        1   817 1 1 52 ILE HD12 H  -5.490  -7.919  -1.683 1.00 . A A . 52 ILE HD12 1 1 
        1   818 1 1 52 ILE HD13 H  -3.864  -7.637  -1.061 1.00 . A A . 52 ILE HD13 1 1 
        1   819 1 1 52 ILE HG12 H  -4.777  -9.767  -0.303 1.00 . A A . 52 ILE HG12 1 1 
        1   820 1 1 52 ILE HG13 H  -6.145  -8.926   0.417 1.00 . A A . 52 ILE HG13 1 1 
        1   821 1 1 52 ILE HG21 H  -2.559  -7.859   0.530 1.00 . A A . 52 ILE HG21 1 1 
        1   822 1 1 52 ILE HG22 H  -2.498  -9.606   0.752 1.00 . A A . 52 ILE HG22 1 1 
        1   823 1 1 52 ILE HG23 H  -2.245  -8.532   2.129 1.00 . A A . 52 ILE HG23 1 1 
        1   824 1 1 52 ILE N    N  -6.084  -9.786   2.840 1.00 . A A . 52 ILE N    1 1 
        1   825 1 1 52 ILE O    O  -2.813 -10.444   3.925 1.00 . A A . 52 ILE O    1 1 
        1   826 1 1 53 VAL C    C  -3.334  -9.723   6.754 1.00 . A A . 53 VAL C    1 1 
        1   827 1 1 53 VAL CA   C  -3.324  -8.488   5.835 1.00 . A A . 53 VAL CA   1 1 
        1   828 1 1 53 VAL CB   C  -3.867  -7.264   6.619 1.00 . A A . 53 VAL CB   1 1 
        1   829 1 1 53 VAL CG1  C  -3.015  -6.985   7.857 1.00 . A A . 53 VAL CG1  1 1 
        1   830 1 1 53 VAL CG2  C  -3.939  -6.029   5.717 1.00 . A A . 53 VAL CG2  1 1 
        1   831 1 1 53 VAL H    H  -4.877  -8.158   4.417 1.00 . A A . 53 VAL H    1 1 
        1   832 1 1 53 VAL HA   H  -2.302  -8.277   5.547 1.00 . A A . 53 VAL HA   1 1 
        1   833 1 1 53 VAL HB   H  -4.873  -7.496   6.951 1.00 . A A . 53 VAL HB   1 1 
        1   834 1 1 53 VAL HG11 H  -1.996  -6.780   7.560 1.00 . A A . 53 VAL HG11 1 1 
        1   835 1 1 53 VAL HG12 H  -3.032  -7.848   8.508 1.00 . A A . 53 VAL HG12 1 1 
        1   836 1 1 53 VAL HG13 H  -3.414  -6.132   8.386 1.00 . A A . 53 VAL HG13 1 1 
        1   837 1 1 53 VAL HG21 H  -4.585  -6.233   4.876 1.00 . A A . 53 VAL HG21 1 1 
        1   838 1 1 53 VAL HG22 H  -2.950  -5.781   5.359 1.00 . A A . 53 VAL HG22 1 1 
        1   839 1 1 53 VAL HG23 H  -4.337  -5.195   6.279 1.00 . A A . 53 VAL HG23 1 1 
        1   840 1 1 53 VAL N    N  -4.095  -8.722   4.608 1.00 . A A . 53 VAL N    1 1 
        1   841 1 1 53 VAL O    O  -2.319 -10.068   7.360 1.00 . A A . 53 VAL O    1 1 
        1   842 1 1 54 ASN C    C  -4.700 -12.869   6.839 1.00 . A A . 54 ASN C    1 1 
        1   843 1 1 54 ASN CA   C  -4.638 -11.584   7.683 1.00 . A A . 54 ASN CA   1 1 
        1   844 1 1 54 ASN CB   C  -5.904 -11.458   8.538 1.00 . A A . 54 ASN CB   1 1 
        1   845 1 1 54 ASN CG   C  -5.874 -10.229   9.429 1.00 . A A . 54 ASN CG   1 1 
        1   846 1 1 54 ASN H    H  -5.256 -10.069   6.325 1.00 . A A . 54 ASN H    1 1 
        1   847 1 1 54 ASN HA   H  -3.780 -11.644   8.338 1.00 . A A . 54 ASN HA   1 1 
        1   848 1 1 54 ASN HB2  H  -6.764 -11.390   7.889 1.00 . A A . 54 ASN HB2  1 1 
        1   849 1 1 54 ASN HB3  H  -6.000 -12.334   9.163 1.00 . A A . 54 ASN HB3  1 1 
        1   850 1 1 54 ASN HD21 H  -4.908 -11.229  10.835 1.00 . A A . 54 ASN HD21 1 1 
        1   851 1 1 54 ASN HD22 H  -5.263  -9.579  11.194 1.00 . A A . 54 ASN HD22 1 1 
        1   852 1 1 54 ASN N    N  -4.485 -10.390   6.840 1.00 . A A . 54 ASN N    1 1 
        1   853 1 1 54 ASN ND2  N  -5.290 -10.361  10.602 1.00 . A A . 54 ASN ND2  1 1 
        1   854 1 1 54 ASN O    O  -5.268 -13.876   7.262 1.00 . A A . 54 ASN O    1 1 
        1   855 1 1 54 ASN OD1  O  -6.364  -9.166   9.063 1.00 . A A . 54 ASN OD1  1 1 
        1   856 1 1 55 SER C    C  -3.413 -15.217   5.323 1.00 . A A . 55 SER C    1 1 
        1   857 1 1 55 SER CA   C  -4.108 -13.981   4.731 1.00 . A A . 55 SER CA   1 1 
        1   858 1 1 55 SER CB   C  -3.453 -13.615   3.391 1.00 . A A . 55 SER CB   1 1 
        1   859 1 1 55 SER H    H  -3.631 -12.010   5.386 1.00 . A A . 55 SER H    1 1 
        1   860 1 1 55 SER HA   H  -5.144 -14.230   4.546 1.00 . A A . 55 SER HA   1 1 
        1   861 1 1 55 SER HB2  H  -4.053 -12.868   2.894 1.00 . A A . 55 SER HB2  1 1 
        1   862 1 1 55 SER HB3  H  -2.465 -13.218   3.572 1.00 . A A . 55 SER HB3  1 1 
        1   863 1 1 55 SER HG   H  -2.502 -15.192   2.711 1.00 . A A . 55 SER HG   1 1 
        1   864 1 1 55 SER N    N  -4.094 -12.831   5.653 1.00 . A A . 55 SER N    1 1 
        1   865 1 1 55 SER O    O  -2.195 -15.381   5.205 1.00 . A A . 55 SER O    1 1 
        1   866 1 1 55 SER OG   O  -3.342 -14.749   2.540 1.00 . A A . 55 SER OG   1 1 
        1   867 1 1 56 THR C    C  -3.818 -18.459   5.463 1.00 . A A . 56 THR C    1 1 
        1   868 1 1 56 THR CA   C  -3.705 -17.346   6.513 1.00 . A A . 56 THR CA   1 1 
        1   869 1 1 56 THR CB   C  -4.491 -17.774   7.781 1.00 . A A . 56 THR CB   1 1 
        1   870 1 1 56 THR CG2  C  -4.298 -16.768   8.912 1.00 . A A . 56 THR CG2  1 1 
        1   871 1 1 56 THR H    H  -5.141 -15.830   6.112 1.00 . A A . 56 THR H    1 1 
        1   872 1 1 56 THR HA   H  -2.664 -17.219   6.783 1.00 . A A . 56 THR HA   1 1 
        1   873 1 1 56 THR HB   H  -4.119 -18.734   8.111 1.00 . A A . 56 THR HB   1 1 
        1   874 1 1 56 THR HG1  H  -6.318 -18.457   8.141 1.00 . A A . 56 THR HG1  1 1 
        1   875 1 1 56 THR HG21 H  -4.818 -17.113   9.795 1.00 . A A . 56 THR HG21 1 1 
        1   876 1 1 56 THR HG22 H  -4.698 -15.810   8.614 1.00 . A A . 56 THR HG22 1 1 
        1   877 1 1 56 THR HG23 H  -3.245 -16.665   9.133 1.00 . A A . 56 THR HG23 1 1 
        1   878 1 1 56 THR N    N  -4.199 -16.070   5.977 1.00 . A A . 56 THR N    1 1 
        1   879 1 1 56 THR O    O  -2.814 -19.015   5.015 1.00 . A A . 56 THR O    1 1 
        1   880 1 1 56 THR OG1  O  -5.894 -17.896   7.479 1.00 . A A . 56 THR OG1  1 1 
        1   881 1 1 57 TYR C    C  -5.734 -19.112   2.718 1.00 . A A . 57 TYR C    1 1 
        1   882 1 1 57 TYR CA   C  -5.308 -19.782   4.035 1.00 . A A . 57 TYR CA   1 1 
        1   883 1 1 57 TYR CB   C  -6.390 -20.771   4.498 1.00 . A A . 57 TYR CB   1 1 
        1   884 1 1 57 TYR CD1  C  -8.164 -19.506   5.801 1.00 . A A . 57 TYR CD1  1 1 
        1   885 1 1 57 TYR CD2  C  -8.694 -20.237   3.592 1.00 . A A . 57 TYR CD2  1 1 
        1   886 1 1 57 TYR CE1  C  -9.423 -18.948   5.920 1.00 . A A . 57 TYR CE1  1 1 
        1   887 1 1 57 TYR CE2  C  -9.951 -19.681   3.704 1.00 . A A . 57 TYR CE2  1 1 
        1   888 1 1 57 TYR CG   C  -7.775 -20.160   4.635 1.00 . A A . 57 TYR CG   1 1 
        1   889 1 1 57 TYR CZ   C -10.312 -19.039   4.868 1.00 . A A . 57 TYR CZ   1 1 
        1   890 1 1 57 TYR H    H  -5.811 -18.337   5.511 1.00 . A A . 57 TYR H    1 1 
        1   891 1 1 57 TYR HA   H  -4.390 -20.327   3.862 1.00 . A A . 57 TYR HA   1 1 
        1   892 1 1 57 TYR HB2  H  -6.453 -21.581   3.785 1.00 . A A . 57 TYR HB2  1 1 
        1   893 1 1 57 TYR HB3  H  -6.107 -21.176   5.460 1.00 . A A . 57 TYR HB3  1 1 
        1   894 1 1 57 TYR HD1  H  -7.466 -19.438   6.623 1.00 . A A . 57 TYR HD1  1 1 
        1   895 1 1 57 TYR HD2  H  -8.411 -20.743   2.676 1.00 . A A . 57 TYR HD2  1 1 
        1   896 1 1 57 TYR HE1  H  -9.705 -18.444   6.832 1.00 . A A . 57 TYR HE1  1 1 
        1   897 1 1 57 TYR HE2  H -10.647 -19.752   2.882 1.00 . A A . 57 TYR HE2  1 1 
        1   898 1 1 57 TYR HH   H -11.501 -17.631   5.434 1.00 . A A . 57 TYR HH   1 1 
        1   899 1 1 57 TYR N    N  -5.050 -18.781   5.077 1.00 . A A . 57 TYR N    1 1 
        1   900 1 1 57 TYR O    O  -5.848 -19.769   1.682 1.00 . A A . 57 TYR O    1 1 
        1   901 1 1 57 TYR OH   O -11.567 -18.481   4.979 1.00 . A A . 57 TYR OH   1 1 
        1   902 1 1 58 TYR C    C  -5.405 -17.181   0.435 1.00 . A A . 58 TYR C    1 1 
        1   903 1 1 58 TYR CA   C  -6.396 -17.020   1.602 1.00 . A A . 58 TYR CA   1 1 
        1   904 1 1 58 TYR CB   C  -6.538 -15.541   1.996 1.00 . A A . 58 TYR CB   1 1 
        1   905 1 1 58 TYR CD1  C  -8.330 -14.645   0.449 1.00 . A A . 58 TYR CD1  1 1 
        1   906 1 1 58 TYR CD2  C  -6.130 -13.741   0.255 1.00 . A A . 58 TYR CD2  1 1 
        1   907 1 1 58 TYR CE1  C  -8.765 -13.808  -0.561 1.00 . A A . 58 TYR CE1  1 1 
        1   908 1 1 58 TYR CE2  C  -6.559 -12.902  -0.756 1.00 . A A . 58 TYR CE2  1 1 
        1   909 1 1 58 TYR CG   C  -7.007 -14.628   0.875 1.00 . A A . 58 TYR CG   1 1 
        1   910 1 1 58 TYR CZ   C  -7.876 -12.939  -1.159 1.00 . A A . 58 TYR CZ   1 1 
        1   911 1 1 58 TYR H    H  -5.883 -17.342   3.637 1.00 . A A . 58 TYR H    1 1 
        1   912 1 1 58 TYR HA   H  -7.361 -17.390   1.289 1.00 . A A . 58 TYR HA   1 1 
        1   913 1 1 58 TYR HB2  H  -7.253 -15.464   2.800 1.00 . A A . 58 TYR HB2  1 1 
        1   914 1 1 58 TYR HB3  H  -5.580 -15.177   2.344 1.00 . A A . 58 TYR HB3  1 1 
        1   915 1 1 58 TYR HD1  H  -9.026 -15.324   0.918 1.00 . A A . 58 TYR HD1  1 1 
        1   916 1 1 58 TYR HD2  H  -5.098 -13.716   0.571 1.00 . A A . 58 TYR HD2  1 1 
        1   917 1 1 58 TYR HE1  H  -9.797 -13.837  -0.879 1.00 . A A . 58 TYR HE1  1 1 
        1   918 1 1 58 TYR HE2  H  -5.864 -12.221  -1.223 1.00 . A A . 58 TYR HE2  1 1 
        1   919 1 1 58 TYR HH   H  -9.187 -11.773  -1.944 1.00 . A A . 58 TYR HH   1 1 
        1   920 1 1 58 TYR N    N  -5.977 -17.800   2.776 1.00 . A A . 58 TYR N    1 1 
        1   921 1 1 58 TYR O    O  -5.697 -17.880  -0.537 1.00 . A A . 58 TYR O    1 1 
        1   922 1 1 58 TYR OH   O  -8.310 -12.101  -2.163 1.00 . A A . 58 TYR OH   1 1 
        1   923 1 1 59 ALA C    C  -3.527 -16.131  -1.834 1.00 . A A . 59 ALA C    1 1 
        1   924 1 1 59 ALA CA   C  -3.148 -16.655  -0.435 1.00 . A A . 59 ALA CA   1 1 
        1   925 1 1 59 ALA CB   C  -2.665 -18.103  -0.521 1.00 . A A . 59 ALA CB   1 1 
        1   926 1 1 59 ALA H    H  -4.113 -15.935   1.315 1.00 . A A . 59 ALA H    1 1 
        1   927 1 1 59 ALA HA   H  -2.323 -16.061  -0.066 1.00 . A A . 59 ALA HA   1 1 
        1   928 1 1 59 ALA HB1  H  -3.438 -18.715  -0.966 1.00 . A A . 59 ALA HB1  1 1 
        1   929 1 1 59 ALA HB2  H  -2.444 -18.469   0.470 1.00 . A A . 59 ALA HB2  1 1 
        1   930 1 1 59 ALA HB3  H  -1.773 -18.151  -1.129 1.00 . A A . 59 ALA HB3  1 1 
        1   931 1 1 59 ALA N    N  -4.242 -16.529   0.547 1.00 . A A . 59 ALA N    1 1 
        1   932 1 1 59 ALA O    O  -2.977 -15.132  -2.300 1.00 . A A . 59 ALA O    1 1 
        1   933 1 1 60 ASN C    C  -5.398 -15.015  -3.951 1.00 . A A . 60 ASN C    1 1 
        1   934 1 1 60 ASN CA   C  -4.899 -16.469  -3.853 1.00 . A A . 60 ASN CA   1 1 
        1   935 1 1 60 ASN CB   C  -6.012 -17.428  -4.295 1.00 . A A . 60 ASN CB   1 1 
        1   936 1 1 60 ASN CG   C  -5.562 -18.875  -4.282 1.00 . A A . 60 ASN CG   1 1 
        1   937 1 1 60 ASN H    H  -4.832 -17.617  -2.073 1.00 . A A . 60 ASN H    1 1 
        1   938 1 1 60 ASN HA   H  -4.056 -16.590  -4.520 1.00 . A A . 60 ASN HA   1 1 
        1   939 1 1 60 ASN HB2  H  -6.857 -17.326  -3.627 1.00 . A A . 60 ASN HB2  1 1 
        1   940 1 1 60 ASN HB3  H  -6.323 -17.176  -5.299 1.00 . A A . 60 ASN HB3  1 1 
        1   941 1 1 60 ASN HD21 H  -6.174 -19.093  -2.407 1.00 . A A . 60 ASN HD21 1 1 
        1   942 1 1 60 ASN HD22 H  -5.467 -20.489  -3.144 1.00 . A A . 60 ASN HD22 1 1 
        1   943 1 1 60 ASN N    N  -4.447 -16.826  -2.501 1.00 . A A . 60 ASN N    1 1 
        1   944 1 1 60 ASN ND2  N  -5.753 -19.551  -3.166 1.00 . A A . 60 ASN ND2  1 1 
        1   945 1 1 60 ASN O    O  -6.577 -14.730  -3.717 1.00 . A A . 60 ASN O    1 1 
        1   946 1 1 60 ASN OD1  O  -5.045 -19.383  -5.272 1.00 . A A . 60 ASN OD1  1 1 
        1   947 1 1 61 VAL C    C  -4.584 -12.215  -5.914 1.00 . A A . 61 VAL C    1 1 
        1   948 1 1 61 VAL CA   C  -4.826 -12.686  -4.466 1.00 . A A . 61 VAL CA   1 1 
        1   949 1 1 61 VAL CB   C  -4.012 -11.798  -3.488 1.00 . A A . 61 VAL CB   1 1 
        1   950 1 1 61 VAL CG1  C  -2.511 -11.925  -3.746 1.00 . A A . 61 VAL CG1  1 1 
        1   951 1 1 61 VAL CG2  C  -4.465 -10.339  -3.570 1.00 . A A . 61 VAL CG2  1 1 
        1   952 1 1 61 VAL H    H  -3.570 -14.392  -4.454 1.00 . A A . 61 VAL H    1 1 
        1   953 1 1 61 VAL HA   H  -5.878 -12.562  -4.236 1.00 . A A . 61 VAL HA   1 1 
        1   954 1 1 61 VAL HB   H  -4.204 -12.151  -2.481 1.00 . A A . 61 VAL HB   1 1 
        1   955 1 1 61 VAL HG11 H  -1.971 -11.283  -3.066 1.00 . A A . 61 VAL HG11 1 1 
        1   956 1 1 61 VAL HG12 H  -2.291 -11.634  -4.764 1.00 . A A . 61 VAL HG12 1 1 
        1   957 1 1 61 VAL HG13 H  -2.204 -12.950  -3.593 1.00 . A A . 61 VAL HG13 1 1 
        1   958 1 1 61 VAL HG21 H  -5.517 -10.276  -3.331 1.00 . A A . 61 VAL HG21 1 1 
        1   959 1 1 61 VAL HG22 H  -4.301  -9.964  -4.570 1.00 . A A . 61 VAL HG22 1 1 
        1   960 1 1 61 VAL HG23 H  -3.901  -9.746  -2.865 1.00 . A A . 61 VAL HG23 1 1 
        1   961 1 1 61 VAL N    N  -4.492 -14.104  -4.304 1.00 . A A . 61 VAL N    1 1 
        1   962 1 1 61 VAL O    O  -3.634 -12.649  -6.574 1.00 . A A . 61 VAL O    1 1 
        1   963 1 1 62 SER C    C  -4.163  -9.824  -7.908 1.00 . A A . 62 SER C    1 1 
        1   964 1 1 62 SER CA   C  -5.356 -10.782  -7.758 1.00 . A A . 62 SER CA   1 1 
        1   965 1 1 62 SER CB   C  -6.649 -10.042  -8.123 1.00 . A A . 62 SER CB   1 1 
        1   966 1 1 62 SER H    H  -6.205 -11.053  -5.825 1.00 . A A . 62 SER H    1 1 
        1   967 1 1 62 SER HA   H  -5.224 -11.609  -8.442 1.00 . A A . 62 SER HA   1 1 
        1   968 1 1 62 SER HB2  H  -7.471 -10.741  -8.129 1.00 . A A . 62 SER HB2  1 1 
        1   969 1 1 62 SER HB3  H  -6.840  -9.273  -7.387 1.00 . A A . 62 SER HB3  1 1 
        1   970 1 1 62 SER HG   H  -7.003  -9.995 -10.055 1.00 . A A . 62 SER HG   1 1 
        1   971 1 1 62 SER N    N  -5.458 -11.335  -6.397 1.00 . A A . 62 SER N    1 1 
        1   972 1 1 62 SER O    O  -3.773  -9.140  -6.960 1.00 . A A . 62 SER O    1 1 
        1   973 1 1 62 SER OG   O  -6.560  -9.433  -9.404 1.00 . A A . 62 SER OG   1 1 
        1   974 1 1 63 ALA C    C  -2.941  -7.485  -9.845 1.00 . A A . 63 ALA C    1 1 
        1   975 1 1 63 ALA CA   C  -2.468  -8.882  -9.405 1.00 . A A . 63 ALA CA   1 1 
        1   976 1 1 63 ALA CB   C  -1.577  -9.500 -10.474 1.00 . A A . 63 ALA CB   1 1 
        1   977 1 1 63 ALA H    H  -3.945 -10.349  -9.824 1.00 . A A . 63 ALA H    1 1 
        1   978 1 1 63 ALA HA   H  -1.882  -8.780  -8.501 1.00 . A A . 63 ALA HA   1 1 
        1   979 1 1 63 ALA HB1  H  -0.683  -8.904 -10.589 1.00 . A A . 63 ALA HB1  1 1 
        1   980 1 1 63 ALA HB2  H  -2.108  -9.534 -11.414 1.00 . A A . 63 ALA HB2  1 1 
        1   981 1 1 63 ALA HB3  H  -1.304 -10.504 -10.180 1.00 . A A . 63 ALA HB3  1 1 
        1   982 1 1 63 ALA N    N  -3.598  -9.771  -9.113 1.00 . A A . 63 ALA N    1 1 
        1   983 1 1 63 ALA O    O  -2.249  -6.488  -9.628 1.00 . A A . 63 ALA O    1 1 
        1   984 1 1 64 ALA C    C  -4.777  -5.100  -9.814 1.00 . A A . 64 ALA C    1 1 
        1   985 1 1 64 ALA CA   C  -4.682  -6.148 -10.935 1.00 . A A . 64 ALA CA   1 1 
        1   986 1 1 64 ALA CB   C  -6.051  -6.382 -11.563 1.00 . A A . 64 ALA CB   1 1 
        1   987 1 1 64 ALA H    H  -4.637  -8.248 -10.589 1.00 . A A . 64 ALA H    1 1 
        1   988 1 1 64 ALA HA   H  -4.023  -5.773 -11.707 1.00 . A A . 64 ALA HA   1 1 
        1   989 1 1 64 ALA HB1  H  -5.967  -7.124 -12.345 1.00 . A A . 64 ALA HB1  1 1 
        1   990 1 1 64 ALA HB2  H  -6.419  -5.458 -11.983 1.00 . A A . 64 ALA HB2  1 1 
        1   991 1 1 64 ALA HB3  H  -6.741  -6.734 -10.809 1.00 . A A . 64 ALA HB3  1 1 
        1   992 1 1 64 ALA N    N  -4.124  -7.419 -10.454 1.00 . A A . 64 ALA N    1 1 
        1   993 1 1 64 ALA O    O  -4.252  -3.992  -9.940 1.00 . A A . 64 ALA O    1 1 
        1   994 1 1 65 LYS C    C  -4.204  -4.144  -6.945 1.00 . A A . 65 LYS C    1 1 
        1   995 1 1 65 LYS CA   C  -5.564  -4.552  -7.556 1.00 . A A . 65 LYS CA   1 1 
        1   996 1 1 65 LYS CB   C  -6.481  -5.177  -6.478 1.00 . A A . 65 LYS CB   1 1 
        1   997 1 1 65 LYS CD   C  -4.831  -6.769  -5.306 1.00 . A A . 65 LYS CD   1 1 
        1   998 1 1 65 LYS CE   C  -4.890  -6.162  -3.904 1.00 . A A . 65 LYS CE   1 1 
        1   999 1 1 65 LYS CG   C  -6.146  -6.624  -6.084 1.00 . A A . 65 LYS CG   1 1 
        1  1000 1 1 65 LYS H    H  -5.829  -6.354  -8.661 1.00 . A A . 65 LYS H    1 1 
        1  1001 1 1 65 LYS HA   H  -6.042  -3.655  -7.923 1.00 . A A . 65 LYS HA   1 1 
        1  1002 1 1 65 LYS HB2  H  -6.434  -4.567  -5.587 1.00 . A A . 65 LYS HB2  1 1 
        1  1003 1 1 65 LYS HB3  H  -7.499  -5.161  -6.847 1.00 . A A . 65 LYS HB3  1 1 
        1  1004 1 1 65 LYS HD2  H  -4.601  -7.820  -5.212 1.00 . A A . 65 LYS HD2  1 1 
        1  1005 1 1 65 LYS HD3  H  -4.042  -6.285  -5.863 1.00 . A A . 65 LYS HD3  1 1 
        1  1006 1 1 65 LYS HE2  H  -5.765  -6.540  -3.399 1.00 . A A . 65 LYS HE2  1 1 
        1  1007 1 1 65 LYS HE3  H  -4.007  -6.465  -3.359 1.00 . A A . 65 LYS HE3  1 1 
        1  1008 1 1 65 LYS HG2  H  -6.947  -7.007  -5.468 1.00 . A A . 65 LYS HG2  1 1 
        1  1009 1 1 65 LYS HG3  H  -6.082  -7.217  -6.986 1.00 . A A . 65 LYS HG3  1 1 
        1  1010 1 1 65 LYS HZ1  H  -4.159  -4.288  -4.474 1.00 . A A . 65 LYS HZ1  1 1 
        1  1011 1 1 65 LYS HZ2  H  -4.906  -4.302  -2.955 1.00 . A A . 65 LYS HZ2  1 1 
        1  1012 1 1 65 LYS HZ3  H  -5.844  -4.362  -4.357 1.00 . A A . 65 LYS HZ3  1 1 
        1  1013 1 1 65 LYS N    N  -5.423  -5.462  -8.703 1.00 . A A . 65 LYS N    1 1 
        1  1014 1 1 65 LYS NZ   N  -4.955  -4.675  -3.924 1.00 . A A . 65 LYS NZ   1 1 
        1  1015 1 1 65 LYS O    O  -4.154  -3.335  -6.015 1.00 . A A . 65 LYS O    1 1 
        1  1016 1 1 66 CYS C    C  -1.129  -3.350  -7.955 1.00 . A A . 66 CYS C    1 1 
        1  1017 1 1 66 CYS CA   C  -1.763  -4.365  -6.992 1.00 . A A . 66 CYS CA   1 1 
        1  1018 1 1 66 CYS CB   C  -0.877  -5.612  -6.881 1.00 . A A . 66 CYS CB   1 1 
        1  1019 1 1 66 CYS H    H  -3.221  -5.448  -8.097 1.00 . A A . 66 CYS H    1 1 
        1  1020 1 1 66 CYS HA   H  -1.847  -3.908  -6.015 1.00 . A A . 66 CYS HA   1 1 
        1  1021 1 1 66 CYS HB2  H  -0.800  -6.080  -7.850 1.00 . A A . 66 CYS HB2  1 1 
        1  1022 1 1 66 CYS HB3  H   0.109  -5.316  -6.549 1.00 . A A . 66 CYS HB3  1 1 
        1  1023 1 1 66 CYS HG   H  -1.610  -8.004  -6.377 1.00 . A A . 66 CYS HG   1 1 
        1  1024 1 1 66 CYS N    N  -3.117  -4.737  -7.430 1.00 . A A . 66 CYS N    1 1 
        1  1025 1 1 66 CYS O    O  -0.563  -2.342  -7.529 1.00 . A A . 66 CYS O    1 1 
        1  1026 1 1 66 CYS SG   S  -1.497  -6.855  -5.720 1.00 . A A . 66 CYS SG   1 1 
        1  1027 1 1 67 GLN C    C  -1.471  -1.349 -10.253 1.00 . A A . 67 GLN C    1 1 
        1  1028 1 1 67 GLN CA   C  -0.723  -2.692 -10.281 1.00 . A A . 67 GLN CA   1 1 
        1  1029 1 1 67 GLN CB   C  -0.833  -3.325 -11.673 1.00 . A A . 67 GLN CB   1 1 
        1  1030 1 1 67 GLN CD   C  -0.073  -5.173 -13.240 1.00 . A A . 67 GLN CD   1 1 
        1  1031 1 1 67 GLN CG   C  -0.036  -4.616 -11.826 1.00 . A A . 67 GLN CG   1 1 
        1  1032 1 1 67 GLN H    H  -1.684  -4.439  -9.542 1.00 . A A . 67 GLN H    1 1 
        1  1033 1 1 67 GLN HA   H   0.322  -2.511 -10.062 1.00 . A A . 67 GLN HA   1 1 
        1  1034 1 1 67 GLN HB2  H  -1.873  -3.544 -11.874 1.00 . A A . 67 GLN HB2  1 1 
        1  1035 1 1 67 GLN HB3  H  -0.475  -2.617 -12.407 1.00 . A A . 67 GLN HB3  1 1 
        1  1036 1 1 67 GLN HE21 H   0.127  -7.015 -12.551 1.00 . A A . 67 GLN HE21 1 1 
        1  1037 1 1 67 GLN HE22 H   0.027  -6.854 -14.268 1.00 . A A . 67 GLN HE22 1 1 
        1  1038 1 1 67 GLN HG2  H   0.994  -4.424 -11.564 1.00 . A A . 67 GLN HG2  1 1 
        1  1039 1 1 67 GLN HG3  H  -0.444  -5.358 -11.153 1.00 . A A . 67 GLN HG3  1 1 
        1  1040 1 1 67 GLN N    N  -1.243  -3.610  -9.259 1.00 . A A . 67 GLN N    1 1 
        1  1041 1 1 67 GLN NE2  N   0.035  -6.478 -13.366 1.00 . A A . 67 GLN NE2  1 1 
        1  1042 1 1 67 GLN O    O  -0.861  -0.279 -10.327 1.00 . A A . 67 GLN O    1 1 
        1  1043 1 1 67 GLN OE1  O  -0.186  -4.435 -14.216 1.00 . A A . 67 GLN OE1  1 1 
        1  1044 1 1 68 GLU C    C  -3.322   0.537  -8.699 1.00 . A A . 68 GLU C    1 1 
        1  1045 1 1 68 GLU CA   C  -3.617  -0.195 -10.015 1.00 . A A . 68 GLU CA   1 1 
        1  1046 1 1 68 GLU CB   C  -5.114  -0.530 -10.129 1.00 . A A . 68 GLU CB   1 1 
        1  1047 1 1 68 GLU CD   C  -4.832  -1.552 -12.450 1.00 . A A . 68 GLU CD   1 1 
        1  1048 1 1 68 GLU CG   C  -5.627  -0.596 -11.570 1.00 . A A . 68 GLU CG   1 1 
        1  1049 1 1 68 GLU H    H  -3.242  -2.286 -10.184 1.00 . A A . 68 GLU H    1 1 
        1  1050 1 1 68 GLU HA   H  -3.352   0.464 -10.831 1.00 . A A . 68 GLU HA   1 1 
        1  1051 1 1 68 GLU HB2  H  -5.293  -1.487  -9.660 1.00 . A A . 68 GLU HB2  1 1 
        1  1052 1 1 68 GLU HB3  H  -5.683   0.226  -9.604 1.00 . A A . 68 GLU HB3  1 1 
        1  1053 1 1 68 GLU HG2  H  -6.658  -0.920 -11.554 1.00 . A A . 68 GLU HG2  1 1 
        1  1054 1 1 68 GLU HG3  H  -5.578   0.395 -12.002 1.00 . A A . 68 GLU HG3  1 1 
        1  1055 1 1 68 GLU N    N  -2.799  -1.409 -10.153 1.00 . A A . 68 GLU N    1 1 
        1  1056 1 1 68 GLU O    O  -3.468   1.754  -8.613 1.00 . A A . 68 GLU O    1 1 
        1  1057 1 1 68 GLU OE1  O  -5.118  -2.766 -12.424 1.00 . A A . 68 GLU OE1  1 1 
        1  1058 1 1 68 GLU OE2  O  -3.930  -1.089 -13.191 1.00 . A A . 68 GLU OE2  1 1 
        1  1059 1 1 69 PHE C    C  -1.185   1.227  -6.624 1.00 . A A . 69 PHE C    1 1 
        1  1060 1 1 69 PHE CA   C  -2.463   0.394  -6.412 1.00 . A A . 69 PHE CA   1 1 
        1  1061 1 1 69 PHE CB   C  -2.226  -0.691  -5.349 1.00 . A A . 69 PHE CB   1 1 
        1  1062 1 1 69 PHE CD1  C  -2.738   0.388  -3.133 1.00 . A A . 69 PHE CD1  1 1 
        1  1063 1 1 69 PHE CD2  C  -0.470  -0.179  -3.615 1.00 . A A . 69 PHE CD2  1 1 
        1  1064 1 1 69 PHE CE1  C  -2.354   0.885  -1.903 1.00 . A A . 69 PHE CE1  1 1 
        1  1065 1 1 69 PHE CE2  C  -0.082   0.318  -2.385 1.00 . A A . 69 PHE CE2  1 1 
        1  1066 1 1 69 PHE CG   C  -1.802  -0.150  -4.005 1.00 . A A . 69 PHE CG   1 1 
        1  1067 1 1 69 PHE CZ   C  -1.026   0.850  -1.528 1.00 . A A . 69 PHE CZ   1 1 
        1  1068 1 1 69 PHE H    H  -2.867  -1.183  -7.779 1.00 . A A . 69 PHE H    1 1 
        1  1069 1 1 69 PHE HA   H  -3.253   1.051  -6.074 1.00 . A A . 69 PHE HA   1 1 
        1  1070 1 1 69 PHE HB2  H  -3.140  -1.252  -5.208 1.00 . A A . 69 PHE HB2  1 1 
        1  1071 1 1 69 PHE HB3  H  -1.454  -1.363  -5.697 1.00 . A A . 69 PHE HB3  1 1 
        1  1072 1 1 69 PHE HD1  H  -3.779   0.417  -3.423 1.00 . A A . 69 PHE HD1  1 1 
        1  1073 1 1 69 PHE HD2  H   0.270  -0.593  -4.285 1.00 . A A . 69 PHE HD2  1 1 
        1  1074 1 1 69 PHE HE1  H  -3.094   1.301  -1.234 1.00 . A A . 69 PHE HE1  1 1 
        1  1075 1 1 69 PHE HE2  H   0.958   0.290  -2.093 1.00 . A A . 69 PHE HE2  1 1 
        1  1076 1 1 69 PHE HZ   H  -0.725   1.237  -0.565 1.00 . A A . 69 PHE HZ   1 1 
        1  1077 1 1 69 PHE N    N  -2.895  -0.210  -7.679 1.00 . A A . 69 PHE N    1 1 
        1  1078 1 1 69 PHE O    O  -1.048   2.323  -6.084 1.00 . A A . 69 PHE O    1 1 
        1  1079 1 1 70 GLY C    C   0.664   2.671  -8.629 1.00 . A A . 70 GLY C    1 1 
        1  1080 1 1 70 GLY CA   C   0.950   1.430  -7.783 1.00 . A A . 70 GLY CA   1 1 
        1  1081 1 1 70 GLY H    H  -0.392  -0.217  -7.764 1.00 . A A . 70 GLY H    1 1 
        1  1082 1 1 70 GLY HA2  H   1.461   1.733  -6.879 1.00 . A A . 70 GLY HA2  1 1 
        1  1083 1 1 70 GLY HA3  H   1.600   0.773  -8.343 1.00 . A A . 70 GLY HA3  1 1 
        1  1084 1 1 70 GLY N    N  -0.259   0.692  -7.423 1.00 . A A . 70 GLY N    1 1 
        1  1085 1 1 70 GLY O    O   1.431   3.638  -8.619 1.00 . A A . 70 GLY O    1 1 
        1  1086 1 1 71 ARG C    C  -1.512   4.839  -9.203 1.00 . A A . 71 ARG C    1 1 
        1  1087 1 1 71 ARG CA   C  -0.895   3.794 -10.145 1.00 . A A . 71 ARG CA   1 1 
        1  1088 1 1 71 ARG CB   C  -1.917   3.350 -11.202 1.00 . A A . 71 ARG CB   1 1 
        1  1089 1 1 71 ARG CD   C  -1.012   4.882 -13.002 1.00 . A A . 71 ARG CD   1 1 
        1  1090 1 1 71 ARG CG   C  -2.255   4.418 -12.241 1.00 . A A . 71 ARG CG   1 1 
        1  1091 1 1 71 ARG CZ   C   0.145   3.567 -14.723 1.00 . A A . 71 ARG CZ   1 1 
        1  1092 1 1 71 ARG H    H  -0.949   1.796  -9.422 1.00 . A A . 71 ARG H    1 1 
        1  1093 1 1 71 ARG HA   H  -0.036   4.229 -10.639 1.00 . A A . 71 ARG HA   1 1 
        1  1094 1 1 71 ARG HB2  H  -1.521   2.489 -11.721 1.00 . A A . 71 ARG HB2  1 1 
        1  1095 1 1 71 ARG HB3  H  -2.832   3.062 -10.702 1.00 . A A . 71 ARG HB3  1 1 
        1  1096 1 1 71 ARG HD2  H  -1.326   5.480 -13.848 1.00 . A A . 71 ARG HD2  1 1 
        1  1097 1 1 71 ARG HD3  H  -0.407   5.487 -12.343 1.00 . A A . 71 ARG HD3  1 1 
        1  1098 1 1 71 ARG HE   H   0.089   3.100 -12.819 1.00 . A A . 71 ARG HE   1 1 
        1  1099 1 1 71 ARG HG2  H  -2.964   4.007 -12.946 1.00 . A A . 71 ARG HG2  1 1 
        1  1100 1 1 71 ARG HG3  H  -2.698   5.268 -11.739 1.00 . A A . 71 ARG HG3  1 1 
        1  1101 1 1 71 ARG HH11 H  -0.771   5.183 -15.421 1.00 . A A . 71 ARG HH11 1 1 
        1  1102 1 1 71 ARG HH12 H   0.064   4.229 -16.592 1.00 . A A . 71 ARG HH12 1 1 
        1  1103 1 1 71 ARG HH21 H   1.157   1.911 -14.313 1.00 . A A . 71 ARG HH21 1 1 
        1  1104 1 1 71 ARG HH22 H   1.133   2.390 -15.976 1.00 . A A . 71 ARG HH22 1 1 
        1  1105 1 1 71 ARG N    N  -0.436   2.632  -9.378 1.00 . A A . 71 ARG N    1 1 
        1  1106 1 1 71 ARG NE   N  -0.210   3.754 -13.481 1.00 . A A . 71 ARG NE   1 1 
        1  1107 1 1 71 ARG NH1  N  -0.216   4.389 -15.648 1.00 . A A . 71 ARG NH1  1 1 
        1  1108 1 1 71 ARG NH2  N   0.867   2.547 -15.027 1.00 . A A . 71 ARG NH2  1 1 
        1  1109 1 1 71 ARG O    O  -1.220   6.034  -9.293 1.00 . A A . 71 ARG O    1 1 
        1  1110 1 1 72 TRP C    C  -1.876   5.854  -6.376 1.00 . A A . 72 TRP C    1 1 
        1  1111 1 1 72 TRP CA   C  -2.961   5.207  -7.255 1.00 . A A . 72 TRP CA   1 1 
        1  1112 1 1 72 TRP CB   C  -3.909   4.358  -6.396 1.00 . A A . 72 TRP CB   1 1 
        1  1113 1 1 72 TRP CD1  C  -5.617   6.003  -5.416 1.00 . A A . 72 TRP CD1  1 1 
        1  1114 1 1 72 TRP CD2  C  -4.279   5.051  -3.892 1.00 . A A . 72 TRP CD2  1 1 
        1  1115 1 1 72 TRP CE2  C  -5.169   5.916  -3.230 1.00 . A A . 72 TRP CE2  1 1 
        1  1116 1 1 72 TRP CE3  C  -3.343   4.340  -3.135 1.00 . A A . 72 TRP CE3  1 1 
        1  1117 1 1 72 TRP CG   C  -4.582   5.120  -5.292 1.00 . A A . 72 TRP CG   1 1 
        1  1118 1 1 72 TRP CH2  C  -4.225   5.379  -1.131 1.00 . A A . 72 TRP CH2  1 1 
        1  1119 1 1 72 TRP CZ2  C  -5.151   6.088  -1.847 1.00 . A A . 72 TRP CZ2  1 1 
        1  1120 1 1 72 TRP CZ3  C  -3.326   4.511  -1.764 1.00 . A A . 72 TRP CZ3  1 1 
        1  1121 1 1 72 TRP H    H  -2.603   3.415  -8.325 1.00 . A A . 72 TRP H    1 1 
        1  1122 1 1 72 TRP HA   H  -3.529   5.987  -7.743 1.00 . A A . 72 TRP HA   1 1 
        1  1123 1 1 72 TRP HB2  H  -4.678   3.944  -7.031 1.00 . A A . 72 TRP HB2  1 1 
        1  1124 1 1 72 TRP HB3  H  -3.347   3.548  -5.952 1.00 . A A . 72 TRP HB3  1 1 
        1  1125 1 1 72 TRP HD1  H  -6.076   6.273  -6.356 1.00 . A A . 72 TRP HD1  1 1 
        1  1126 1 1 72 TRP HE1  H  -6.694   7.135  -4.011 1.00 . A A . 72 TRP HE1  1 1 
        1  1127 1 1 72 TRP HE3  H  -2.640   3.668  -3.605 1.00 . A A . 72 TRP HE3  1 1 
        1  1128 1 1 72 TRP HH2  H  -4.177   5.483  -0.056 1.00 . A A . 72 TRP HH2  1 1 
        1  1129 1 1 72 TRP HZ2  H  -5.838   6.754  -1.345 1.00 . A A . 72 TRP HZ2  1 1 
        1  1130 1 1 72 TRP HZ3  H  -2.609   3.968  -1.162 1.00 . A A . 72 TRP HZ3  1 1 
        1  1131 1 1 72 TRP N    N  -2.363   4.365  -8.295 1.00 . A A . 72 TRP N    1 1 
        1  1132 1 1 72 TRP NE1  N  -5.973   6.486  -4.182 1.00 . A A . 72 TRP NE1  1 1 
        1  1133 1 1 72 TRP O    O  -1.990   7.014  -5.982 1.00 . A A . 72 TRP O    1 1 
        1  1134 1 1 73 TYR C    C   0.865   6.896  -5.871 1.00 . A A . 73 TYR C    1 1 
        1  1135 1 1 73 TYR CA   C   0.334   5.560  -5.320 1.00 . A A . 73 TYR CA   1 1 
        1  1136 1 1 73 TYR CB   C   1.434   4.487  -5.368 1.00 . A A . 73 TYR CB   1 1 
        1  1137 1 1 73 TYR CD1  C   2.660   4.389  -3.155 1.00 . A A . 73 TYR CD1  1 1 
        1  1138 1 1 73 TYR CD2  C   3.781   5.381  -5.012 1.00 . A A . 73 TYR CD2  1 1 
        1  1139 1 1 73 TYR CE1  C   3.764   4.620  -2.358 1.00 . A A . 73 TYR CE1  1 1 
        1  1140 1 1 73 TYR CE2  C   4.890   5.614  -4.220 1.00 . A A . 73 TYR CE2  1 1 
        1  1141 1 1 73 TYR CG   C   2.646   4.763  -4.494 1.00 . A A . 73 TYR CG   1 1 
        1  1142 1 1 73 TYR CZ   C   4.877   5.232  -2.894 1.00 . A A . 73 TYR CZ   1 1 
        1  1143 1 1 73 TYR H    H  -0.827   4.158  -6.407 1.00 . A A . 73 TYR H    1 1 
        1  1144 1 1 73 TYR HA   H   0.020   5.700  -4.295 1.00 . A A . 73 TYR HA   1 1 
        1  1145 1 1 73 TYR HB2  H   1.013   3.544  -5.051 1.00 . A A . 73 TYR HB2  1 1 
        1  1146 1 1 73 TYR HB3  H   1.778   4.386  -6.390 1.00 . A A . 73 TYR HB3  1 1 
        1  1147 1 1 73 TYR HD1  H   1.787   3.908  -2.737 1.00 . A A . 73 TYR HD1  1 1 
        1  1148 1 1 73 TYR HD2  H   3.789   5.680  -6.052 1.00 . A A . 73 TYR HD2  1 1 
        1  1149 1 1 73 TYR HE1  H   3.753   4.321  -1.319 1.00 . A A . 73 TYR HE1  1 1 
        1  1150 1 1 73 TYR HE2  H   5.761   6.094  -4.642 1.00 . A A . 73 TYR HE2  1 1 
        1  1151 1 1 73 TYR HH   H   6.298   4.623  -1.744 1.00 . A A . 73 TYR HH   1 1 
        1  1152 1 1 73 TYR N    N  -0.823   5.086  -6.092 1.00 . A A . 73 TYR N    1 1 
        1  1153 1 1 73 TYR O    O   1.158   7.828  -5.116 1.00 . A A . 73 TYR O    1 1 
        1  1154 1 1 73 TYR OH   O   5.981   5.463  -2.101 1.00 . A A . 73 TYR OH   1 1 
        1  1155 1 1 74 LYS C    C   0.460   9.373  -7.627 1.00 . A A . 74 LYS C    1 1 
        1  1156 1 1 74 LYS CA   C   1.419   8.196  -7.881 1.00 . A A . 74 LYS CA   1 1 
        1  1157 1 1 74 LYS CB   C   1.536   7.941  -9.393 1.00 . A A . 74 LYS CB   1 1 
        1  1158 1 1 74 LYS CD   C   1.938   8.891 -11.705 1.00 . A A . 74 LYS CD   1 1 
        1  1159 1 1 74 LYS CE   C   2.923   7.794 -12.102 1.00 . A A . 74 LYS CE   1 1 
        1  1160 1 1 74 LYS CG   C   1.960   9.167 -10.203 1.00 . A A . 74 LYS CG   1 1 
        1  1161 1 1 74 LYS H    H   0.723   6.195  -7.739 1.00 . A A . 74 LYS H    1 1 
        1  1162 1 1 74 LYS HA   H   2.395   8.449  -7.493 1.00 . A A . 74 LYS HA   1 1 
        1  1163 1 1 74 LYS HB2  H   2.264   7.159  -9.558 1.00 . A A . 74 LYS HB2  1 1 
        1  1164 1 1 74 LYS HB3  H   0.576   7.607  -9.763 1.00 . A A . 74 LYS HB3  1 1 
        1  1165 1 1 74 LYS HD2  H   0.941   8.583 -11.990 1.00 . A A . 74 LYS HD2  1 1 
        1  1166 1 1 74 LYS HD3  H   2.196   9.802 -12.231 1.00 . A A . 74 LYS HD3  1 1 
        1  1167 1 1 74 LYS HE2  H   2.744   6.921 -11.491 1.00 . A A . 74 LYS HE2  1 1 
        1  1168 1 1 74 LYS HE3  H   2.762   7.542 -13.141 1.00 . A A . 74 LYS HE3  1 1 
        1  1169 1 1 74 LYS HG2  H   1.280   9.981  -9.989 1.00 . A A . 74 LYS HG2  1 1 
        1  1170 1 1 74 LYS HG3  H   2.962   9.452  -9.910 1.00 . A A . 74 LYS HG3  1 1 
        1  1171 1 1 74 LYS HZ1  H   4.499   8.538 -10.948 1.00 . A A . 74 LYS HZ1  1 1 
        1  1172 1 1 74 LYS HZ2  H   4.556   9.008 -12.571 1.00 . A A . 74 LYS HZ2  1 1 
        1  1173 1 1 74 LYS HZ3  H   4.978   7.433 -12.135 1.00 . A A . 74 LYS HZ3  1 1 
        1  1174 1 1 74 LYS N    N   0.965   6.978  -7.201 1.00 . A A . 74 LYS N    1 1 
        1  1175 1 1 74 LYS NZ   N   4.336   8.221 -11.926 1.00 . A A . 74 LYS NZ   1 1 
        1  1176 1 1 74 LYS O    O   0.888  10.468  -7.274 1.00 . A A . 74 LYS O    1 1 
        1  1177 1 1 75 HIS C    C  -2.018  10.561  -6.132 1.00 . A A . 75 HIS C    1 1 
        1  1178 1 1 75 HIS CA   C  -1.856  10.179  -7.615 1.00 . A A . 75 HIS CA   1 1 
        1  1179 1 1 75 HIS CB   C  -3.201   9.708  -8.186 1.00 . A A . 75 HIS CB   1 1 
        1  1180 1 1 75 HIS CD2  C  -4.484  11.879  -8.814 1.00 . A A . 75 HIS CD2  1 1 
        1  1181 1 1 75 HIS CE1  C  -6.149  11.682  -7.408 1.00 . A A . 75 HIS CE1  1 1 
        1  1182 1 1 75 HIS CG   C  -4.290  10.739  -8.110 1.00 . A A . 75 HIS CG   1 1 
        1  1183 1 1 75 HIS H    H  -1.125   8.231  -8.066 1.00 . A A . 75 HIS H    1 1 
        1  1184 1 1 75 HIS HA   H  -1.533  11.053  -8.163 1.00 . A A . 75 HIS HA   1 1 
        1  1185 1 1 75 HIS HB2  H  -3.067   9.443  -9.225 1.00 . A A . 75 HIS HB2  1 1 
        1  1186 1 1 75 HIS HB3  H  -3.528   8.835  -7.639 1.00 . A A . 75 HIS HB3  1 1 
        1  1187 1 1 75 HIS HD1  H  -5.508   9.926  -6.591 1.00 . A A . 75 HIS HD1  1 1 
        1  1188 1 1 75 HIS HD2  H  -3.841  12.271  -9.590 1.00 . A A . 75 HIS HD2  1 1 
        1  1189 1 1 75 HIS HE1  H  -7.062  11.871  -6.862 1.00 . A A . 75 HIS HE1  1 1 
        1  1190 1 1 75 HIS HE2  H  -5.929  13.369  -8.535 1.00 . A A . 75 HIS HE2  1 1 
        1  1191 1 1 75 HIS N    N  -0.839   9.133  -7.802 1.00 . A A . 75 HIS N    1 1 
        1  1192 1 1 75 HIS ND1  N  -5.353  10.650  -7.238 1.00 . A A . 75 HIS ND1  1 1 
        1  1193 1 1 75 HIS NE2  N  -5.647  12.446  -8.356 1.00 . A A . 75 HIS NE2  1 1 
        1  1194 1 1 75 HIS O    O  -2.418  11.680  -5.808 1.00 . A A . 75 HIS O    1 1 
        1  1195 1 1 76 PHE C    C  -0.691  10.717  -3.249 1.00 . A A . 76 PHE C    1 1 
        1  1196 1 1 76 PHE CA   C  -1.829   9.836  -3.798 1.00 . A A . 76 PHE CA   1 1 
        1  1197 1 1 76 PHE CB   C  -1.846   8.475  -3.081 1.00 . A A . 76 PHE CB   1 1 
        1  1198 1 1 76 PHE CD1  C  -3.241   8.895  -1.027 1.00 . A A . 76 PHE CD1  1 1 
        1  1199 1 1 76 PHE CD2  C  -0.940   8.321  -0.736 1.00 . A A . 76 PHE CD2  1 1 
        1  1200 1 1 76 PHE CE1  C  -3.396   8.977   0.343 1.00 . A A . 76 PHE CE1  1 1 
        1  1201 1 1 76 PHE CE2  C  -1.094   8.401   0.634 1.00 . A A . 76 PHE CE2  1 1 
        1  1202 1 1 76 PHE CG   C  -2.011   8.566  -1.585 1.00 . A A . 76 PHE CG   1 1 
        1  1203 1 1 76 PHE CZ   C  -2.322   8.730   1.174 1.00 . A A . 76 PHE CZ   1 1 
        1  1204 1 1 76 PHE H    H  -1.387   8.755  -5.567 1.00 . A A . 76 PHE H    1 1 
        1  1205 1 1 76 PHE HA   H  -2.772  10.333  -3.617 1.00 . A A . 76 PHE HA   1 1 
        1  1206 1 1 76 PHE HB2  H  -2.664   7.884  -3.467 1.00 . A A . 76 PHE HB2  1 1 
        1  1207 1 1 76 PHE HB3  H  -0.916   7.959  -3.285 1.00 . A A . 76 PHE HB3  1 1 
        1  1208 1 1 76 PHE HD1  H  -4.083   9.088  -1.676 1.00 . A A . 76 PHE HD1  1 1 
        1  1209 1 1 76 PHE HD2  H   0.022   8.065  -1.154 1.00 . A A . 76 PHE HD2  1 1 
        1  1210 1 1 76 PHE HE1  H  -4.358   9.235   0.764 1.00 . A A . 76 PHE HE1  1 1 
        1  1211 1 1 76 PHE HE2  H  -0.254   8.206   1.285 1.00 . A A . 76 PHE HE2  1 1 
        1  1212 1 1 76 PHE HZ   H  -2.442   8.793   2.246 1.00 . A A . 76 PHE HZ   1 1 
        1  1213 1 1 76 PHE N    N  -1.703   9.623  -5.243 1.00 . A A . 76 PHE N    1 1 
        1  1214 1 1 76 PHE O    O  -0.934  11.710  -2.562 1.00 . A A . 76 PHE O    1 1 
        1  1215 1 1 77 LYS C    C   2.215  12.175  -3.992 1.00 . A A . 77 LYS C    1 1 
        1  1216 1 1 77 LYS CA   C   1.726  11.069  -3.038 1.00 . A A . 77 LYS CA   1 1 
        1  1217 1 1 77 LYS CB   C   2.869  10.084  -2.761 1.00 . A A . 77 LYS CB   1 1 
        1  1218 1 1 77 LYS CD   C   3.727   8.100  -1.445 1.00 . A A . 77 LYS CD   1 1 
        1  1219 1 1 77 LYS CE   C   5.048   8.798  -1.132 1.00 . A A . 77 LYS CE   1 1 
        1  1220 1 1 77 LYS CG   C   2.578   9.089  -1.639 1.00 . A A . 77 LYS CG   1 1 
        1  1221 1 1 77 LYS H    H   0.686   9.565  -4.135 1.00 . A A . 77 LYS H    1 1 
        1  1222 1 1 77 LYS HA   H   1.441  11.533  -2.103 1.00 . A A . 77 LYS HA   1 1 
        1  1223 1 1 77 LYS HB2  H   3.073   9.524  -3.665 1.00 . A A . 77 LYS HB2  1 1 
        1  1224 1 1 77 LYS HB3  H   3.753  10.645  -2.493 1.00 . A A . 77 LYS HB3  1 1 
        1  1225 1 1 77 LYS HD2  H   3.484   7.433  -0.630 1.00 . A A . 77 LYS HD2  1 1 
        1  1226 1 1 77 LYS HD3  H   3.845   7.522  -2.353 1.00 . A A . 77 LYS HD3  1 1 
        1  1227 1 1 77 LYS HE2  H   5.305   9.446  -1.955 1.00 . A A . 77 LYS HE2  1 1 
        1  1228 1 1 77 LYS HE3  H   4.931   9.387  -0.234 1.00 . A A . 77 LYS HE3  1 1 
        1  1229 1 1 77 LYS HG2  H   2.427   9.634  -0.717 1.00 . A A . 77 LYS HG2  1 1 
        1  1230 1 1 77 LYS HG3  H   1.679   8.540  -1.883 1.00 . A A . 77 LYS HG3  1 1 
        1  1231 1 1 77 LYS HZ1  H   6.260   7.215  -1.768 1.00 . A A . 77 LYS HZ1  1 1 
        1  1232 1 1 77 LYS HZ2  H   5.950   7.220  -0.104 1.00 . A A . 77 LYS HZ2  1 1 
        1  1233 1 1 77 LYS HZ3  H   7.047   8.323  -0.763 1.00 . A A . 77 LYS HZ3  1 1 
        1  1234 1 1 77 LYS N    N   0.552  10.347  -3.555 1.00 . A A . 77 LYS N    1 1 
        1  1235 1 1 77 LYS NZ   N   6.151   7.822  -0.927 1.00 . A A . 77 LYS NZ   1 1 
        1  1236 1 1 77 LYS O    O   2.805  13.162  -3.548 1.00 . A A . 77 LYS O    1 1 
        1  1237 1 1 78 LYS C    C   3.981  13.095  -6.258 1.00 . A A . 78 LYS C    1 1 
        1  1238 1 1 78 LYS CA   C   2.443  12.958  -6.315 1.00 . A A . 78 LYS CA   1 1 
        1  1239 1 1 78 LYS CB   C   1.743  14.324  -6.115 1.00 . A A . 78 LYS CB   1 1 
        1  1240 1 1 78 LYS CD   C   2.464  15.425  -8.292 1.00 . A A . 78 LYS CD   1 1 
        1  1241 1 1 78 LYS CE   C   1.996  16.191  -9.524 1.00 . A A . 78 LYS CE   1 1 
        1  1242 1 1 78 LYS CG   C   1.292  15.009  -7.408 1.00 . A A . 78 LYS CG   1 1 
        1  1243 1 1 78 LYS H    H   1.465  11.219  -5.579 1.00 . A A . 78 LYS H    1 1 
        1  1244 1 1 78 LYS HA   H   2.170  12.558  -7.283 1.00 . A A . 78 LYS HA   1 1 
        1  1245 1 1 78 LYS HB2  H   0.870  14.175  -5.497 1.00 . A A . 78 LYS HB2  1 1 
        1  1246 1 1 78 LYS HB3  H   2.420  14.990  -5.600 1.00 . A A . 78 LYS HB3  1 1 
        1  1247 1 1 78 LYS HD2  H   3.127  16.059  -7.719 1.00 . A A . 78 LYS HD2  1 1 
        1  1248 1 1 78 LYS HD3  H   2.998  14.540  -8.610 1.00 . A A . 78 LYS HD3  1 1 
        1  1249 1 1 78 LYS HE2  H   2.859  16.462 -10.115 1.00 . A A . 78 LYS HE2  1 1 
        1  1250 1 1 78 LYS HE3  H   1.348  15.553 -10.107 1.00 . A A . 78 LYS HE3  1 1 
        1  1251 1 1 78 LYS HG2  H   0.663  14.326  -7.963 1.00 . A A . 78 LYS HG2  1 1 
        1  1252 1 1 78 LYS HG3  H   0.719  15.888  -7.148 1.00 . A A . 78 LYS HG3  1 1 
        1  1253 1 1 78 LYS HZ1  H   0.408  17.192  -8.604 1.00 . A A . 78 LYS HZ1  1 1 
        1  1254 1 1 78 LYS HZ2  H   0.959  17.935 -10.017 1.00 . A A . 78 LYS HZ2  1 1 
        1  1255 1 1 78 LYS HZ3  H   1.859  18.057  -8.594 1.00 . A A . 78 LYS HZ3  1 1 
        1  1256 1 1 78 LYS N    N   1.977  12.002  -5.294 1.00 . A A . 78 LYS N    1 1 
        1  1257 1 1 78 LYS NZ   N   1.256  17.429  -9.160 1.00 . A A . 78 LYS NZ   1 1 
        1  1258 1 1 78 LYS O    O   4.528  14.198  -6.179 1.00 . A A . 78 LYS O    1 1 
        1  1259 1 1 79 THR C    C   6.936  12.293  -7.366 1.00 . A A . 79 THR C    1 1 
        1  1260 1 1 79 THR CA   C   6.126  11.880  -6.128 1.00 . A A . 79 THR CA   1 1 
        1  1261 1 1 79 THR CB   C   6.547  10.438  -5.753 1.00 . A A . 79 THR CB   1 1 
        1  1262 1 1 79 THR CG2  C   5.900  10.003  -4.447 1.00 . A A . 79 THR CG2  1 1 
        1  1263 1 1 79 THR H    H   4.179  11.127  -6.526 1.00 . A A . 79 THR H    1 1 
        1  1264 1 1 79 THR HA   H   6.385  12.530  -5.305 1.00 . A A . 79 THR HA   1 1 
        1  1265 1 1 79 THR HB   H   7.623  10.411  -5.631 1.00 . A A . 79 THR HB   1 1 
        1  1266 1 1 79 THR HG1  H   6.834   8.823  -6.863 1.00 . A A . 79 THR HG1  1 1 
        1  1267 1 1 79 THR HG21 H   6.219   9.000  -4.203 1.00 . A A . 79 THR HG21 1 1 
        1  1268 1 1 79 THR HG22 H   4.825  10.021  -4.555 1.00 . A A . 79 THR HG22 1 1 
        1  1269 1 1 79 THR HG23 H   6.193  10.677  -3.656 1.00 . A A . 79 THR HG23 1 1 
        1  1270 1 1 79 THR N    N   4.666  11.954  -6.330 1.00 . A A . 79 THR N    1 1 
        1  1271 1 1 79 THR O    O   8.033  11.770  -7.584 1.00 . A A . 79 THR O    1 1 
        1  1272 1 1 79 THR OG1  O   6.170   9.523  -6.800 1.00 . A A . 79 THR OG1  1 1 
        1  1273 1 1 80 LYS C    C   6.971  12.475 -10.436 1.00 . A A . 80 LYS C    1 1 
        1  1274 1 1 80 LYS CA   C   7.059  13.637  -9.422 1.00 . A A . 80 LYS CA   1 1 
        1  1275 1 1 80 LYS CB   C   8.517  14.086  -9.182 1.00 . A A . 80 LYS CB   1 1 
        1  1276 1 1 80 LYS CD   C  10.602  15.219 -10.047 1.00 . A A . 80 LYS CD   1 1 
        1  1277 1 1 80 LYS CE   C  11.397  15.649 -11.277 1.00 . A A . 80 LYS CE   1 1 
        1  1278 1 1 80 LYS CG   C   9.256  14.594 -10.418 1.00 . A A . 80 LYS CG   1 1 
        1  1279 1 1 80 LYS H    H   5.611  13.708  -7.861 1.00 . A A . 80 LYS H    1 1 
        1  1280 1 1 80 LYS HA   H   6.495  14.473  -9.817 1.00 . A A . 80 LYS HA   1 1 
        1  1281 1 1 80 LYS HB2  H   8.512  14.882  -8.450 1.00 . A A . 80 LYS HB2  1 1 
        1  1282 1 1 80 LYS HB3  H   9.074  13.251  -8.778 1.00 . A A . 80 LYS HB3  1 1 
        1  1283 1 1 80 LYS HD2  H  10.424  16.088  -9.429 1.00 . A A . 80 LYS HD2  1 1 
        1  1284 1 1 80 LYS HD3  H  11.181  14.495  -9.490 1.00 . A A . 80 LYS HD3  1 1 
        1  1285 1 1 80 LYS HE2  H  10.769  16.267 -11.902 1.00 . A A . 80 LYS HE2  1 1 
        1  1286 1 1 80 LYS HE3  H  12.254  16.221 -10.953 1.00 . A A . 80 LYS HE3  1 1 
        1  1287 1 1 80 LYS HG2  H   9.428  13.765 -11.090 1.00 . A A . 80 LYS HG2  1 1 
        1  1288 1 1 80 LYS HG3  H   8.645  15.339 -10.911 1.00 . A A . 80 LYS HG3  1 1 
        1  1289 1 1 80 LYS HZ1  H  11.060  13.904 -12.374 1.00 . A A . 80 LYS HZ1  1 1 
        1  1290 1 1 80 LYS HZ2  H  12.503  13.894 -11.493 1.00 . A A . 80 LYS HZ2  1 1 
        1  1291 1 1 80 LYS HZ3  H  12.385  14.807 -12.913 1.00 . A A . 80 LYS HZ3  1 1 
        1  1292 1 1 80 LYS N    N   6.425  13.249  -8.147 1.00 . A A . 80 LYS N    1 1 
        1  1293 1 1 80 LYS NZ   N  11.868  14.483 -12.070 1.00 . A A . 80 LYS NZ   1 1 
        1  1294 1 1 80 LYS O    O   6.748  11.325 -10.047 1.00 . A A . 80 LYS O    1 1 
        1  1295 1 1 81 ASP C    C   5.362  11.546 -12.916 1.00 . A A . 81 ASP C    1 1 
        1  1296 1 1 81 ASP CA   C   6.874  11.812 -12.806 1.00 . A A . 81 ASP CA   1 1 
        1  1297 1 1 81 ASP CB   C   7.649  10.498 -12.579 1.00 . A A . 81 ASP CB   1 1 
        1  1298 1 1 81 ASP CG   C   7.434   9.487 -13.694 1.00 . A A . 81 ASP CG   1 1 
        1  1299 1 1 81 ASP H    H   7.432  13.684 -11.966 1.00 . A A . 81 ASP H    1 1 
        1  1300 1 1 81 ASP HA   H   7.210  12.261 -13.730 1.00 . A A . 81 ASP HA   1 1 
        1  1301 1 1 81 ASP HB2  H   8.705  10.718 -12.513 1.00 . A A . 81 ASP HB2  1 1 
        1  1302 1 1 81 ASP HB3  H   7.325  10.055 -11.647 1.00 . A A . 81 ASP HB3  1 1 
        1  1303 1 1 81 ASP N    N   7.133  12.781 -11.727 1.00 . A A . 81 ASP N    1 1 
        1  1304 1 1 81 ASP O    O   4.801  10.751 -12.159 1.00 . A A . 81 ASP O    1 1 
        1  1305 1 1 81 ASP OD1  O   8.155   9.558 -14.710 1.00 . A A . 81 ASP OD1  1 1 
        1  1306 1 1 81 ASP OD2  O   6.542   8.618 -13.565 1.00 . A A . 81 ASP OD2  1 1 
        1  1307 1 1 82 MET C    C   2.765  12.133 -15.420 1.00 . A A . 82 MET C    1 1 
        1  1308 1 1 82 MET CA   C   3.238  12.162 -13.956 1.00 . A A . 82 MET CA   1 1 
        1  1309 1 1 82 MET CB   C   2.611  13.352 -13.209 1.00 . A A . 82 MET CB   1 1 
        1  1310 1 1 82 MET CE   C   3.384  17.460 -13.356 1.00 . A A . 82 MET CE   1 1 
        1  1311 1 1 82 MET CG   C   3.211  14.700 -13.590 1.00 . A A . 82 MET CG   1 1 
        1  1312 1 1 82 MET H    H   5.201  12.785 -14.477 1.00 . A A . 82 MET H    1 1 
        1  1313 1 1 82 MET HA   H   2.913  11.247 -13.477 1.00 . A A . 82 MET HA   1 1 
        1  1314 1 1 82 MET HB2  H   1.551  13.381 -13.418 1.00 . A A . 82 MET HB2  1 1 
        1  1315 1 1 82 MET HB3  H   2.751  13.212 -12.147 1.00 . A A . 82 MET HB3  1 1 
        1  1316 1 1 82 MET HE1  H   4.400  17.337 -13.010 1.00 . A A . 82 MET HE1  1 1 
        1  1317 1 1 82 MET HE2  H   2.983  18.384 -12.967 1.00 . A A . 82 MET HE2  1 1 
        1  1318 1 1 82 MET HE3  H   3.374  17.490 -14.437 1.00 . A A . 82 MET HE3  1 1 
        1  1319 1 1 82 MET HG2  H   4.256  14.709 -13.312 1.00 . A A . 82 MET HG2  1 1 
        1  1320 1 1 82 MET HG3  H   3.127  14.825 -14.661 1.00 . A A . 82 MET HG3  1 1 
        1  1321 1 1 82 MET N    N   4.699  12.229 -13.848 1.00 . A A . 82 MET N    1 1 
        1  1322 1 1 82 MET O    O   2.674  13.171 -16.075 1.00 . A A . 82 MET O    1 1 
        1  1323 1 1 82 MET SD   S   2.384  16.086 -12.783 1.00 . A A . 82 MET SD   1 1 
        1  1324 1 1 83 MET C    C   2.728  11.368 -18.389 1.00 . A A . 83 MET C    1 1 
        1  1325 1 1 83 MET CA   C   1.885  10.734 -17.256 1.00 . A A . 83 MET CA   1 1 
        1  1326 1 1 83 MET CB   C   0.451  11.294 -17.264 1.00 . A A . 83 MET CB   1 1 
        1  1327 1 1 83 MET CE   C  -2.796  10.589 -14.724 1.00 . A A . 83 MET CE   1 1 
        1  1328 1 1 83 MET CG   C  -0.433  10.709 -16.171 1.00 . A A . 83 MET CG   1 1 
        1  1329 1 1 83 MET H    H   2.703  10.137 -15.387 1.00 . A A . 83 MET H    1 1 
        1  1330 1 1 83 MET HA   H   1.833   9.668 -17.429 1.00 . A A . 83 MET HA   1 1 
        1  1331 1 1 83 MET HB2  H   0.493  12.364 -17.129 1.00 . A A . 83 MET HB2  1 1 
        1  1332 1 1 83 MET HB3  H  -0.005  11.077 -18.220 1.00 . A A . 83 MET HB3  1 1 
        1  1333 1 1 83 MET HE1  H  -3.797  10.954 -14.553 1.00 . A A . 83 MET HE1  1 1 
        1  1334 1 1 83 MET HE2  H  -2.196  10.755 -13.842 1.00 . A A . 83 MET HE2  1 1 
        1  1335 1 1 83 MET HE3  H  -2.831   9.531 -14.941 1.00 . A A . 83 MET HE3  1 1 
        1  1336 1 1 83 MET HG2  H  -0.547   9.649 -16.347 1.00 . A A . 83 MET HG2  1 1 
        1  1337 1 1 83 MET HG3  H   0.049  10.863 -15.216 1.00 . A A . 83 MET HG3  1 1 
        1  1338 1 1 83 MET N    N   2.485  10.929 -15.922 1.00 . A A . 83 MET N    1 1 
        1  1339 1 1 83 MET O    O   3.808  10.819 -18.710 1.00 . A A . 83 MET O    1 1 
        1  1340 1 1 83 MET OXT  O   2.293  12.384 -18.984 1.00 . A A . 83 MET OXT  1 1 
        1  1341 1 1 83 MET SD   S  -2.072  11.461 -16.114 1.00 . A A . 83 MET SD   1 1 
        2  1342 1 1  1 MET C    C  12.664 -11.001   7.109 1.00 . A A .  1 MET C    1 1 
        2  1343 1 1  1 MET CA   C  12.061 -12.036   8.069 1.00 . A A .  1 MET CA   1 1 
        2  1344 1 1  1 MET CB   C  10.848 -11.427   8.787 1.00 . A A .  1 MET CB   1 1 
        2  1345 1 1  1 MET CE   C   8.117 -12.993  11.536 1.00 . A A .  1 MET CE   1 1 
        2  1346 1 1  1 MET CG   C  10.141 -12.385   9.734 1.00 . A A .  1 MET CG   1 1 
        2  1347 1 1  1 MET H1   H  13.889 -12.913   8.576 1.00 . A A .  1 MET H1   1 1 
        2  1348 1 1  1 MET H2   H  12.652 -13.231   9.680 1.00 . A A .  1 MET H2   1 1 
        2  1349 1 1  1 MET H3   H  13.389 -11.710   9.652 1.00 . A A .  1 MET H3   1 1 
        2  1350 1 1  1 MET HA   H  11.737 -12.893   7.496 1.00 . A A .  1 MET HA   1 1 
        2  1351 1 1  1 MET HB2  H  11.176 -10.571   9.357 1.00 . A A .  1 MET HB2  1 1 
        2  1352 1 1  1 MET HB3  H  10.132 -11.098   8.047 1.00 . A A .  1 MET HB3  1 1 
        2  1353 1 1  1 MET HE1  H   7.208 -12.700  12.039 1.00 . A A .  1 MET HE1  1 1 
        2  1354 1 1  1 MET HE2  H   8.877 -13.221  12.267 1.00 . A A .  1 MET HE2  1 1 
        2  1355 1 1  1 MET HE3  H   7.926 -13.867  10.930 1.00 . A A .  1 MET HE3  1 1 
        2  1356 1 1  1 MET HG2  H   9.838 -13.262   9.182 1.00 . A A .  1 MET HG2  1 1 
        2  1357 1 1  1 MET HG3  H  10.829 -12.672  10.518 1.00 . A A .  1 MET HG3  1 1 
        2  1358 1 1  1 MET N    N  13.068 -12.503   9.062 1.00 . A A .  1 MET N    1 1 
        2  1359 1 1  1 MET O    O  13.067  -9.920   7.530 1.00 . A A .  1 MET O    1 1 
        2  1360 1 1  1 MET SD   S   8.678 -11.649  10.490 1.00 . A A .  1 MET SD   1 1 
        2  1361 1 1  2 GLY C    C  14.773 -10.190   4.944 1.00 . A A .  2 GLY C    1 1 
        2  1362 1 1  2 GLY CA   C  13.263 -10.413   4.825 1.00 . A A .  2 GLY CA   1 1 
        2  1363 1 1  2 GLY H    H  12.387 -12.214   5.538 1.00 . A A .  2 GLY H    1 1 
        2  1364 1 1  2 GLY HA2  H  13.051 -10.809   3.842 1.00 . A A .  2 GLY HA2  1 1 
        2  1365 1 1  2 GLY HA3  H  12.761  -9.462   4.927 1.00 . A A .  2 GLY HA3  1 1 
        2  1366 1 1  2 GLY N    N  12.724 -11.336   5.821 1.00 . A A .  2 GLY N    1 1 
        2  1367 1 1  2 GLY O    O  15.455 -10.844   5.738 1.00 . A A .  2 GLY O    1 1 
        2  1368 1 1  3 HIS C    C  16.965  -7.425   4.217 1.00 . A A .  3 HIS C    1 1 
        2  1369 1 1  3 HIS CA   C  16.737  -8.945   4.151 1.00 . A A .  3 HIS CA   1 1 
        2  1370 1 1  3 HIS CB   C  17.405  -9.539   2.901 1.00 . A A .  3 HIS CB   1 1 
        2  1371 1 1  3 HIS CD2  C  18.041 -12.044   3.207 1.00 . A A .  3 HIS CD2  1 1 
        2  1372 1 1  3 HIS CE1  C  16.239 -12.926   2.329 1.00 . A A .  3 HIS CE1  1 1 
        2  1373 1 1  3 HIS CG   C  17.241 -11.026   2.803 1.00 . A A .  3 HIS CG   1 1 
        2  1374 1 1  3 HIS H    H  14.707  -8.774   3.532 1.00 . A A .  3 HIS H    1 1 
        2  1375 1 1  3 HIS HA   H  17.176  -9.395   5.031 1.00 . A A .  3 HIS HA   1 1 
        2  1376 1 1  3 HIS HB2  H  16.967  -9.097   2.018 1.00 . A A .  3 HIS HB2  1 1 
        2  1377 1 1  3 HIS HB3  H  18.464  -9.319   2.922 1.00 . A A .  3 HIS HB3  1 1 
        2  1378 1 1  3 HIS HD1  H  15.366 -11.144   1.857 1.00 . A A .  3 HIS HD1  1 1 
        2  1379 1 1  3 HIS HD2  H  19.008 -11.951   3.683 1.00 . A A .  3 HIS HD2  1 1 
        2  1380 1 1  3 HIS HE1  H  15.510 -13.644   1.979 1.00 . A A .  3 HIS HE1  1 1 
        2  1381 1 1  3 HIS HE2  H  17.807 -14.102   2.883 1.00 . A A .  3 HIS HE2  1 1 
        2  1382 1 1  3 HIS N    N  15.300  -9.264   4.145 1.00 . A A .  3 HIS N    1 1 
        2  1383 1 1  3 HIS ND1  N  16.126 -11.617   2.253 1.00 . A A .  3 HIS ND1  1 1 
        2  1384 1 1  3 HIS NE2  N  17.390 -13.216   2.899 1.00 . A A .  3 HIS NE2  1 1 
        2  1385 1 1  3 HIS O    O  16.049  -6.644   3.954 1.00 . A A .  3 HIS O    1 1 
        2  1386 1 1  4 HIS C    C  17.946  -5.000   6.054 1.00 . A A .  4 HIS C    1 1 
        2  1387 1 1  4 HIS CA   C  18.552  -5.595   4.763 1.00 . A A .  4 HIS CA   1 1 
        2  1388 1 1  4 HIS CB   C  18.161  -4.742   3.543 1.00 . A A .  4 HIS CB   1 1 
        2  1389 1 1  4 HIS CD2  C  20.205  -4.801   1.942 1.00 . A A .  4 HIS CD2  1 1 
        2  1390 1 1  4 HIS CE1  C  19.282  -5.903   0.289 1.00 . A A .  4 HIS CE1  1 1 
        2  1391 1 1  4 HIS CG   C  18.927  -5.078   2.299 1.00 . A A .  4 HIS CG   1 1 
        2  1392 1 1  4 HIS H    H  18.876  -7.699   4.747 1.00 . A A .  4 HIS H    1 1 
        2  1393 1 1  4 HIS HA   H  19.629  -5.565   4.866 1.00 . A A .  4 HIS HA   1 1 
        2  1394 1 1  4 HIS HB2  H  17.112  -4.880   3.331 1.00 . A A .  4 HIS HB2  1 1 
        2  1395 1 1  4 HIS HB3  H  18.339  -3.699   3.769 1.00 . A A .  4 HIS HB3  1 1 
        2  1396 1 1  4 HIS HD1  H  17.460  -6.104   1.189 1.00 . A A .  4 HIS HD1  1 1 
        2  1397 1 1  4 HIS HD2  H  20.936  -4.268   2.533 1.00 . A A .  4 HIS HD2  1 1 
        2  1398 1 1  4 HIS HE1  H  19.131  -6.400  -0.656 1.00 . A A .  4 HIS HE1  1 1 
        2  1399 1 1  4 HIS HE2  H  21.264  -5.415   0.235 1.00 . A A .  4 HIS HE2  1 1 
        2  1400 1 1  4 HIS N    N  18.187  -7.018   4.582 1.00 . A A .  4 HIS N    1 1 
        2  1401 1 1  4 HIS ND1  N  18.380  -5.769   1.241 1.00 . A A .  4 HIS ND1  1 1 
        2  1402 1 1  4 HIS NE2  N  20.395  -5.325   0.687 1.00 . A A .  4 HIS NE2  1 1 
        2  1403 1 1  4 HIS O    O  18.599  -4.215   6.746 1.00 . A A .  4 HIS O    1 1 
        2  1404 1 1  5 HIS C    C  15.723  -3.433   7.625 1.00 . A A .  5 HIS C    1 1 
        2  1405 1 1  5 HIS CA   C  16.019  -4.951   7.604 1.00 . A A .  5 HIS CA   1 1 
        2  1406 1 1  5 HIS CB   C  16.862  -5.368   8.829 1.00 . A A .  5 HIS CB   1 1 
        2  1407 1 1  5 HIS CD2  C  15.906  -4.453  11.071 1.00 . A A .  5 HIS CD2  1 1 
        2  1408 1 1  5 HIS CE1  C  14.844  -6.255  11.713 1.00 . A A .  5 HIS CE1  1 1 
        2  1409 1 1  5 HIS CG   C  16.097  -5.400  10.120 1.00 . A A .  5 HIS CG   1 1 
        2  1410 1 1  5 HIS H    H  16.202  -5.927   5.728 1.00 . A A .  5 HIS H    1 1 
        2  1411 1 1  5 HIS HA   H  15.075  -5.476   7.642 1.00 . A A .  5 HIS HA   1 1 
        2  1412 1 1  5 HIS HB2  H  17.261  -6.357   8.661 1.00 . A A .  5 HIS HB2  1 1 
        2  1413 1 1  5 HIS HB3  H  17.682  -4.674   8.946 1.00 . A A .  5 HIS HB3  1 1 
        2  1414 1 1  5 HIS HD1  H  15.366  -7.376  10.088 1.00 . A A .  5 HIS HD1  1 1 
        2  1415 1 1  5 HIS HD2  H  16.304  -3.446  11.063 1.00 . A A .  5 HIS HD2  1 1 
        2  1416 1 1  5 HIS HE1  H  14.250  -6.945  12.290 1.00 . A A .  5 HIS HE1  1 1 
        2  1417 1 1  5 HIS HE2  H  14.970  -4.628  12.938 1.00 . A A .  5 HIS HE2  1 1 
        2  1418 1 1  5 HIS N    N  16.695  -5.362   6.359 1.00 . A A .  5 HIS N    1 1 
        2  1419 1 1  5 HIS ND1  N  15.417  -6.513  10.557 1.00 . A A .  5 HIS ND1  1 1 
        2  1420 1 1  5 HIS NE2  N  15.123  -5.011  12.048 1.00 . A A .  5 HIS NE2  1 1 
        2  1421 1 1  5 HIS O    O  15.427  -2.858   8.674 1.00 . A A .  5 HIS O    1 1 
        2  1422 1 1  6 HIS C    C  14.673  -1.062   5.075 1.00 . A A .  6 HIS C    1 1 
        2  1423 1 1  6 HIS CA   C  15.501  -1.355   6.333 1.00 . A A .  6 HIS CA   1 1 
        2  1424 1 1  6 HIS CB   C  16.806  -0.546   6.289 1.00 . A A .  6 HIS CB   1 1 
        2  1425 1 1  6 HIS CD2  C  17.662  -0.122   8.708 1.00 . A A .  6 HIS CD2  1 1 
        2  1426 1 1  6 HIS CE1  C  19.306  -1.564   8.708 1.00 . A A .  6 HIS CE1  1 1 
        2  1427 1 1  6 HIS CG   C  17.675  -0.729   7.496 1.00 . A A .  6 HIS CG   1 1 
        2  1428 1 1  6 HIS H    H  16.030  -3.300   5.653 1.00 . A A .  6 HIS H    1 1 
        2  1429 1 1  6 HIS HA   H  14.929  -1.053   7.199 1.00 . A A .  6 HIS HA   1 1 
        2  1430 1 1  6 HIS HB2  H  17.379  -0.844   5.423 1.00 . A A .  6 HIS HB2  1 1 
        2  1431 1 1  6 HIS HB3  H  16.566   0.505   6.208 1.00 . A A .  6 HIS HB3  1 1 
        2  1432 1 1  6 HIS HD1  H  18.988  -2.220   6.804 1.00 . A A .  6 HIS HD1  1 1 
        2  1433 1 1  6 HIS HD2  H  16.971   0.640   9.037 1.00 . A A .  6 HIS HD2  1 1 
        2  1434 1 1  6 HIS HE1  H  20.153  -2.155   9.019 1.00 . A A .  6 HIS HE1  1 1 
        2  1435 1 1  6 HIS HE2  H  18.807  -0.554  10.409 1.00 . A A .  6 HIS HE2  1 1 
        2  1436 1 1  6 HIS N    N  15.790  -2.794   6.457 1.00 . A A .  6 HIS N    1 1 
        2  1437 1 1  6 HIS ND1  N  18.718  -1.623   7.535 1.00 . A A .  6 HIS ND1  1 1 
        2  1438 1 1  6 HIS NE2  N  18.688  -0.662   9.439 1.00 . A A .  6 HIS NE2  1 1 
        2  1439 1 1  6 HIS O    O  14.614  -1.878   4.157 1.00 . A A .  6 HIS O    1 1 
        2  1440 1 1  7 HIS C    C  14.049   1.293   2.842 1.00 . A A .  7 HIS C    1 1 
        2  1441 1 1  7 HIS CA   C  13.221   0.507   3.878 1.00 . A A .  7 HIS CA   1 1 
        2  1442 1 1  7 HIS CB   C  12.015   1.343   4.343 1.00 . A A .  7 HIS CB   1 1 
        2  1443 1 1  7 HIS CD2  C  11.332   0.020   6.479 1.00 . A A .  7 HIS CD2  1 1 
        2  1444 1 1  7 HIS CE1  C   9.201  -0.220   6.038 1.00 . A A .  7 HIS CE1  1 1 
        2  1445 1 1  7 HIS CG   C  11.095   0.614   5.283 1.00 . A A .  7 HIS CG   1 1 
        2  1446 1 1  7 HIS H    H  14.136   0.735   5.788 1.00 . A A .  7 HIS H    1 1 
        2  1447 1 1  7 HIS HA   H  12.855  -0.397   3.408 1.00 . A A .  7 HIS HA   1 1 
        2  1448 1 1  7 HIS HB2  H  12.371   2.228   4.849 1.00 . A A .  7 HIS HB2  1 1 
        2  1449 1 1  7 HIS HB3  H  11.437   1.639   3.479 1.00 . A A .  7 HIS HB3  1 1 
        2  1450 1 1  7 HIS HD1  H   9.260   0.778   4.260 1.00 . A A .  7 HIS HD1  1 1 
        2  1451 1 1  7 HIS HD2  H  12.283  -0.036   6.991 1.00 . A A .  7 HIS HD2  1 1 
        2  1452 1 1  7 HIS HE1  H   8.159  -0.494   6.118 1.00 . A A .  7 HIS HE1  1 1 
        2  1453 1 1  7 HIS HE2  H   9.972  -0.843   7.826 1.00 . A A .  7 HIS HE2  1 1 
        2  1454 1 1  7 HIS N    N  14.043   0.113   5.031 1.00 . A A .  7 HIS N    1 1 
        2  1455 1 1  7 HIS ND1  N   9.749   0.444   5.041 1.00 . A A .  7 HIS ND1  1 1 
        2  1456 1 1  7 HIS NE2  N  10.137  -0.492   6.921 1.00 . A A .  7 HIS NE2  1 1 
        2  1457 1 1  7 HIS O    O  14.181   0.870   1.691 1.00 . A A .  7 HIS O    1 1 
        2  1458 1 1  8 HIS C    C  14.671   3.787   1.148 1.00 . A A .  8 HIS C    1 1 
        2  1459 1 1  8 HIS CA   C  15.430   3.295   2.399 1.00 . A A .  8 HIS CA   1 1 
        2  1460 1 1  8 HIS CB   C  16.719   2.561   1.989 1.00 . A A .  8 HIS CB   1 1 
        2  1461 1 1  8 HIS CD2  C  17.876   2.912   4.293 1.00 . A A .  8 HIS CD2  1 1 
        2  1462 1 1  8 HIS CE1  C  19.102   1.097   4.312 1.00 . A A .  8 HIS CE1  1 1 
        2  1463 1 1  8 HIS CG   C  17.620   2.237   3.144 1.00 . A A .  8 HIS CG   1 1 
        2  1464 1 1  8 HIS H    H  14.444   2.717   4.192 1.00 . A A .  8 HIS H    1 1 
        2  1465 1 1  8 HIS HA   H  15.702   4.161   2.984 1.00 . A A .  8 HIS HA   1 1 
        2  1466 1 1  8 HIS HB2  H  16.457   1.632   1.502 1.00 . A A .  8 HIS HB2  1 1 
        2  1467 1 1  8 HIS HB3  H  17.274   3.179   1.297 1.00 . A A .  8 HIS HB3  1 1 
        2  1468 1 1  8 HIS HD1  H  18.454   0.409   2.500 1.00 . A A .  8 HIS HD1  1 1 
        2  1469 1 1  8 HIS HD2  H  17.434   3.852   4.599 1.00 . A A .  8 HIS HD2  1 1 
        2  1470 1 1  8 HIS HE1  H  19.804   0.335   4.617 1.00 . A A .  8 HIS HE1  1 1 
        2  1471 1 1  8 HIS HE2  H  19.208   2.438   5.848 1.00 . A A .  8 HIS HE2  1 1 
        2  1472 1 1  8 HIS N    N  14.600   2.436   3.265 1.00 . A A .  8 HIS N    1 1 
        2  1473 1 1  8 HIS ND1  N  18.406   1.105   3.192 1.00 . A A .  8 HIS ND1  1 1 
        2  1474 1 1  8 HIS NE2  N  18.799   2.178   4.995 1.00 . A A .  8 HIS NE2  1 1 
        2  1475 1 1  8 HIS O    O  13.460   3.591   1.019 1.00 . A A .  8 HIS O    1 1 
        2  1476 1 1  9 SER C    C  14.465   3.918  -2.035 1.00 . A A .  9 SER C    1 1 
        2  1477 1 1  9 SER CA   C  14.777   5.000  -0.986 1.00 . A A .  9 SER CA   1 1 
        2  1478 1 1  9 SER CB   C  15.688   6.077  -1.600 1.00 . A A .  9 SER CB   1 1 
        2  1479 1 1  9 SER H    H  16.358   4.540   0.368 1.00 . A A .  9 SER H    1 1 
        2  1480 1 1  9 SER HA   H  13.848   5.466  -0.693 1.00 . A A .  9 SER HA   1 1 
        2  1481 1 1  9 SER HB2  H  16.647   5.642  -1.843 1.00 . A A .  9 SER HB2  1 1 
        2  1482 1 1  9 SER HB3  H  15.229   6.460  -2.502 1.00 . A A .  9 SER HB3  1 1 
        2  1483 1 1  9 SER HG   H  16.405   6.846   0.061 1.00 . A A .  9 SER HG   1 1 
        2  1484 1 1  9 SER N    N  15.390   4.433   0.230 1.00 . A A .  9 SER N    1 1 
        2  1485 1 1  9 SER O    O  14.962   3.957  -3.160 1.00 . A A .  9 SER O    1 1 
        2  1486 1 1  9 SER OG   O  15.893   7.157  -0.698 1.00 . A A .  9 SER OG   1 1 
        2  1487 1 1 10 HIS C    C  11.649   1.723  -2.475 1.00 . A A . 10 HIS C    1 1 
        2  1488 1 1 10 HIS CA   C  13.175   1.895  -2.566 1.00 . A A . 10 HIS CA   1 1 
        2  1489 1 1 10 HIS CB   C  13.881   0.567  -2.255 1.00 . A A . 10 HIS CB   1 1 
        2  1490 1 1 10 HIS CD2  C  16.399   1.013  -1.786 1.00 . A A . 10 HIS CD2  1 1 
        2  1491 1 1 10 HIS CE1  C  17.208   0.290  -3.689 1.00 . A A . 10 HIS CE1  1 1 
        2  1492 1 1 10 HIS CG   C  15.354   0.592  -2.540 1.00 . A A . 10 HIS CG   1 1 
        2  1493 1 1 10 HIS H    H  13.327   2.941  -0.723 1.00 . A A . 10 HIS H    1 1 
        2  1494 1 1 10 HIS HA   H  13.426   2.199  -3.573 1.00 . A A . 10 HIS HA   1 1 
        2  1495 1 1 10 HIS HB2  H  13.750   0.332  -1.208 1.00 . A A . 10 HIS HB2  1 1 
        2  1496 1 1 10 HIS HB3  H  13.439  -0.218  -2.852 1.00 . A A . 10 HIS HB3  1 1 
        2  1497 1 1 10 HIS HD1  H  15.395  -0.213  -4.491 1.00 . A A . 10 HIS HD1  1 1 
        2  1498 1 1 10 HIS HD2  H  16.345   1.434  -0.793 1.00 . A A . 10 HIS HD2  1 1 
        2  1499 1 1 10 HIS HE1  H  17.894   0.022  -4.478 1.00 . A A . 10 HIS HE1  1 1 
        2  1500 1 1 10 HIS HE2  H  18.435   1.133  -2.287 1.00 . A A . 10 HIS HE2  1 1 
        2  1501 1 1 10 HIS N    N  13.636   2.950  -1.651 1.00 . A A . 10 HIS N    1 1 
        2  1502 1 1 10 HIS ND1  N  15.899   0.149  -3.725 1.00 . A A . 10 HIS ND1  1 1 
        2  1503 1 1 10 HIS NE2  N  17.538   0.813  -2.527 1.00 . A A . 10 HIS NE2  1 1 
        2  1504 1 1 10 HIS O    O  10.980   1.490  -3.478 1.00 . A A . 10 HIS O    1 1 
        2  1505 1 1 11 MET C    C   8.999   3.160  -1.098 1.00 . A A . 11 MET C    1 1 
        2  1506 1 1 11 MET CA   C   9.647   1.764  -1.055 1.00 . A A . 11 MET CA   1 1 
        2  1507 1 1 11 MET CB   C   9.333   1.078   0.279 1.00 . A A . 11 MET CB   1 1 
        2  1508 1 1 11 MET CE   C  10.060  -2.943  -0.608 1.00 . A A . 11 MET CE   1 1 
        2  1509 1 1 11 MET CG   C   9.862  -0.347   0.365 1.00 . A A . 11 MET CG   1 1 
        2  1510 1 1 11 MET H    H  11.688   1.963  -0.488 1.00 . A A . 11 MET H    1 1 
        2  1511 1 1 11 MET HA   H   9.231   1.168  -1.858 1.00 . A A . 11 MET HA   1 1 
        2  1512 1 1 11 MET HB2  H   9.772   1.655   1.082 1.00 . A A . 11 MET HB2  1 1 
        2  1513 1 1 11 MET HB3  H   8.260   1.050   0.414 1.00 . A A . 11 MET HB3  1 1 
        2  1514 1 1 11 MET HE1  H  11.119  -2.776  -0.722 1.00 . A A . 11 MET HE1  1 1 
        2  1515 1 1 11 MET HE2  H   9.736  -3.694  -1.313 1.00 . A A . 11 MET HE2  1 1 
        2  1516 1 1 11 MET HE3  H   9.854  -3.280   0.397 1.00 . A A . 11 MET HE3  1 1 
        2  1517 1 1 11 MET HG2  H  10.939  -0.326   0.260 1.00 . A A . 11 MET HG2  1 1 
        2  1518 1 1 11 MET HG3  H   9.604  -0.759   1.331 1.00 . A A . 11 MET HG3  1 1 
        2  1519 1 1 11 MET N    N  11.104   1.839  -1.261 1.00 . A A . 11 MET N    1 1 
        2  1520 1 1 11 MET O    O   7.778   3.288  -1.196 1.00 . A A . 11 MET O    1 1 
        2  1521 1 1 11 MET SD   S   9.178  -1.415  -0.919 1.00 . A A . 11 MET SD   1 1 
        2  1522 1 1 12 LEU C    C   9.107   5.983  -2.591 1.00 . A A . 12 LEU C    1 1 
        2  1523 1 1 12 LEU CA   C   9.345   5.591  -1.111 1.00 . A A . 12 LEU CA   1 1 
        2  1524 1 1 12 LEU CB   C  10.324   6.572  -0.431 1.00 . A A . 12 LEU CB   1 1 
        2  1525 1 1 12 LEU CD1  C  10.779   5.135   1.615 1.00 . A A . 12 LEU CD1  1 1 
        2  1526 1 1 12 LEU CD2  C  11.328   7.581   1.651 1.00 . A A . 12 LEU CD2  1 1 
        2  1527 1 1 12 LEU CG   C  10.373   6.518   1.110 1.00 . A A . 12 LEU CG   1 1 
        2  1528 1 1 12 LEU H    H  10.778   4.040  -0.869 1.00 . A A . 12 LEU H    1 1 
        2  1529 1 1 12 LEU HA   H   8.394   5.640  -0.595 1.00 . A A . 12 LEU HA   1 1 
        2  1530 1 1 12 LEU HB2  H  11.318   6.369  -0.807 1.00 . A A . 12 LEU HB2  1 1 
        2  1531 1 1 12 LEU HB3  H  10.050   7.575  -0.723 1.00 . A A . 12 LEU HB3  1 1 
        2  1532 1 1 12 LEU HD11 H  11.753   4.879   1.226 1.00 . A A . 12 LEU HD11 1 1 
        2  1533 1 1 12 LEU HD12 H  10.056   4.405   1.283 1.00 . A A . 12 LEU HD12 1 1 
        2  1534 1 1 12 LEU HD13 H  10.812   5.140   2.695 1.00 . A A . 12 LEU HD13 1 1 
        2  1535 1 1 12 LEU HD21 H  11.383   7.502   2.728 1.00 . A A . 12 LEU HD21 1 1 
        2  1536 1 1 12 LEU HD22 H  10.966   8.563   1.383 1.00 . A A . 12 LEU HD22 1 1 
        2  1537 1 1 12 LEU HD23 H  12.312   7.433   1.230 1.00 . A A . 12 LEU HD23 1 1 
        2  1538 1 1 12 LEU HG   H   9.388   6.733   1.497 1.00 . A A . 12 LEU HG   1 1 
        2  1539 1 1 12 LEU N    N   9.826   4.204  -1.008 1.00 . A A . 12 LEU N    1 1 
        2  1540 1 1 12 LEU O    O   8.051   6.522  -2.929 1.00 . A A . 12 LEU O    1 1 
        2  1541 1 1 13 PRO C    C   9.513   4.477  -5.558 1.00 . A A . 13 PRO C    1 1 
        2  1542 1 1 13 PRO CA   C   9.876   5.845  -4.936 1.00 . A A . 13 PRO CA   1 1 
        2  1543 1 1 13 PRO CB   C  11.238   6.340  -5.443 1.00 . A A . 13 PRO CB   1 1 
        2  1544 1 1 13 PRO CD   C  11.484   5.379  -3.212 1.00 . A A . 13 PRO CD   1 1 
        2  1545 1 1 13 PRO CG   C  12.246   5.892  -4.418 1.00 . A A . 13 PRO CG   1 1 
        2  1546 1 1 13 PRO HA   H   9.108   6.569  -5.171 1.00 . A A . 13 PRO HA   1 1 
        2  1547 1 1 13 PRO HB2  H  11.444   5.908  -6.412 1.00 . A A . 13 PRO HB2  1 1 
        2  1548 1 1 13 PRO HB3  H  11.220   7.419  -5.528 1.00 . A A . 13 PRO HB3  1 1 
        2  1549 1 1 13 PRO HD2  H  11.593   4.308  -3.123 1.00 . A A . 13 PRO HD2  1 1 
        2  1550 1 1 13 PRO HD3  H  11.832   5.867  -2.311 1.00 . A A . 13 PRO HD3  1 1 
        2  1551 1 1 13 PRO HG2  H  12.859   5.104  -4.831 1.00 . A A . 13 PRO HG2  1 1 
        2  1552 1 1 13 PRO HG3  H  12.869   6.730  -4.135 1.00 . A A . 13 PRO HG3  1 1 
        2  1553 1 1 13 PRO N    N  10.088   5.739  -3.496 1.00 . A A . 13 PRO N    1 1 
        2  1554 1 1 13 PRO O    O  10.241   3.501  -5.376 1.00 . A A . 13 PRO O    1 1 
        2  1555 1 1 14 PRO C    C   8.924   2.173  -7.422 1.00 . A A . 14 PRO C    1 1 
        2  1556 1 1 14 PRO CA   C   7.856   3.125  -6.843 1.00 . A A . 14 PRO CA   1 1 
        2  1557 1 1 14 PRO CB   C   6.902   3.601  -7.943 1.00 . A A . 14 PRO CB   1 1 
        2  1558 1 1 14 PRO CD   C   7.539   5.546  -6.690 1.00 . A A . 14 PRO CD   1 1 
        2  1559 1 1 14 PRO CG   C   6.394   4.912  -7.442 1.00 . A A . 14 PRO CG   1 1 
        2  1560 1 1 14 PRO HA   H   7.287   2.595  -6.089 1.00 . A A . 14 PRO HA   1 1 
        2  1561 1 1 14 PRO HB2  H   7.442   3.709  -8.875 1.00 . A A . 14 PRO HB2  1 1 
        2  1562 1 1 14 PRO HB3  H   6.100   2.886  -8.068 1.00 . A A . 14 PRO HB3  1 1 
        2  1563 1 1 14 PRO HD2  H   8.084   6.226  -7.331 1.00 . A A . 14 PRO HD2  1 1 
        2  1564 1 1 14 PRO HD3  H   7.173   6.065  -5.815 1.00 . A A . 14 PRO HD3  1 1 
        2  1565 1 1 14 PRO HG2  H   6.100   5.536  -8.275 1.00 . A A . 14 PRO HG2  1 1 
        2  1566 1 1 14 PRO HG3  H   5.556   4.752  -6.781 1.00 . A A . 14 PRO HG3  1 1 
        2  1567 1 1 14 PRO N    N   8.387   4.397  -6.303 1.00 . A A . 14 PRO N    1 1 
        2  1568 1 1 14 PRO O    O   9.534   2.456  -8.453 1.00 . A A . 14 PRO O    1 1 
        2  1569 1 1 15 GLU C    C   9.573  -1.399  -6.861 1.00 . A A . 15 GLU C    1 1 
        2  1570 1 1 15 GLU CA   C  10.086   0.016  -7.191 1.00 . A A . 15 GLU CA   1 1 
        2  1571 1 1 15 GLU CB   C  11.464   0.217  -6.545 1.00 . A A . 15 GLU CB   1 1 
        2  1572 1 1 15 GLU CD   C  13.779  -0.756  -6.148 1.00 . A A . 15 GLU CD   1 1 
        2  1573 1 1 15 GLU CG   C  12.467  -0.879  -6.904 1.00 . A A . 15 GLU CG   1 1 
        2  1574 1 1 15 GLU H    H   8.681   0.914  -5.885 1.00 . A A . 15 GLU H    1 1 
        2  1575 1 1 15 GLU HA   H  10.187   0.108  -8.265 1.00 . A A . 15 GLU HA   1 1 
        2  1576 1 1 15 GLU HB2  H  11.867   1.166  -6.866 1.00 . A A . 15 GLU HB2  1 1 
        2  1577 1 1 15 GLU HB3  H  11.349   0.231  -5.468 1.00 . A A . 15 GLU HB3  1 1 
        2  1578 1 1 15 GLU HG2  H  12.027  -1.840  -6.676 1.00 . A A . 15 GLU HG2  1 1 
        2  1579 1 1 15 GLU HG3  H  12.672  -0.826  -7.965 1.00 . A A . 15 GLU HG3  1 1 
        2  1580 1 1 15 GLU N    N   9.147   1.048  -6.735 1.00 . A A . 15 GLU N    1 1 
        2  1581 1 1 15 GLU O    O   9.352  -1.734  -5.696 1.00 . A A . 15 GLU O    1 1 
        2  1582 1 1 15 GLU OE1  O  13.895  -1.330  -5.047 1.00 . A A . 15 GLU OE1  1 1 
        2  1583 1 1 15 GLU OE2  O  14.711  -0.098  -6.656 1.00 . A A . 15 GLU OE2  1 1 
        2  1584 1 1 16 GLN C    C   7.782  -3.837  -6.846 1.00 . A A . 16 GLN C    1 1 
        2  1585 1 1 16 GLN CA   C   9.025  -3.636  -7.743 1.00 . A A . 16 GLN CA   1 1 
        2  1586 1 1 16 GLN CB   C  10.239  -4.405  -7.188 1.00 . A A . 16 GLN CB   1 1 
        2  1587 1 1 16 GLN CD   C  11.338  -6.646  -6.719 1.00 . A A . 16 GLN CD   1 1 
        2  1588 1 1 16 GLN CG   C  10.110  -5.925  -7.256 1.00 . A A . 16 GLN CG   1 1 
        2  1589 1 1 16 GLN H    H   9.474  -1.851  -8.805 1.00 . A A . 16 GLN H    1 1 
        2  1590 1 1 16 GLN HA   H   8.795  -4.021  -8.726 1.00 . A A . 16 GLN HA   1 1 
        2  1591 1 1 16 GLN HB2  H  11.116  -4.117  -7.753 1.00 . A A . 16 GLN HB2  1 1 
        2  1592 1 1 16 GLN HB3  H  10.386  -4.123  -6.155 1.00 . A A . 16 GLN HB3  1 1 
        2  1593 1 1 16 GLN HE21 H  12.160  -6.682  -8.521 1.00 . A A . 16 GLN HE21 1 1 
        2  1594 1 1 16 GLN HE22 H  13.089  -7.391  -7.253 1.00 . A A . 16 GLN HE22 1 1 
        2  1595 1 1 16 GLN HG2  H   9.252  -6.226  -6.671 1.00 . A A . 16 GLN HG2  1 1 
        2  1596 1 1 16 GLN HG3  H   9.959  -6.216  -8.286 1.00 . A A . 16 GLN HG3  1 1 
        2  1597 1 1 16 GLN N    N   9.376  -2.214  -7.900 1.00 . A A . 16 GLN N    1 1 
        2  1598 1 1 16 GLN NE2  N  12.290  -6.935  -7.585 1.00 . A A . 16 GLN NE2  1 1 
        2  1599 1 1 16 GLN O    O   7.750  -4.712  -5.972 1.00 . A A . 16 GLN O    1 1 
        2  1600 1 1 16 GLN OE1  O  11.431  -6.942  -5.535 1.00 . A A . 16 GLN OE1  1 1 
        2  1601 1 1 17 TRP C    C   4.682  -4.371  -6.823 1.00 . A A . 17 TRP C    1 1 
        2  1602 1 1 17 TRP CA   C   5.494  -3.162  -6.337 1.00 . A A . 17 TRP CA   1 1 
        2  1603 1 1 17 TRP CB   C   4.665  -1.874  -6.439 1.00 . A A . 17 TRP CB   1 1 
        2  1604 1 1 17 TRP CD1  C   6.276   0.023  -5.808 1.00 . A A . 17 TRP CD1  1 1 
        2  1605 1 1 17 TRP CD2  C   4.652  -0.340  -4.314 1.00 . A A . 17 TRP CD2  1 1 
        2  1606 1 1 17 TRP CE2  C   5.463   0.710  -3.848 1.00 . A A . 17 TRP CE2  1 1 
        2  1607 1 1 17 TRP CE3  C   3.561  -0.745  -3.539 1.00 . A A . 17 TRP CE3  1 1 
        2  1608 1 1 17 TRP CG   C   5.191  -0.769  -5.570 1.00 . A A . 17 TRP CG   1 1 
        2  1609 1 1 17 TRP CH2  C   4.146   0.946  -1.904 1.00 . A A . 17 TRP CH2  1 1 
        2  1610 1 1 17 TRP CZ2  C   5.220   1.363  -2.644 1.00 . A A . 17 TRP CZ2  1 1 
        2  1611 1 1 17 TRP CZ3  C   3.320  -0.097  -2.343 1.00 . A A . 17 TRP CZ3  1 1 
        2  1612 1 1 17 TRP H    H   6.834  -2.334  -7.763 1.00 . A A . 17 TRP H    1 1 
        2  1613 1 1 17 TRP HA   H   5.750  -3.323  -5.297 1.00 . A A . 17 TRP HA   1 1 
        2  1614 1 1 17 TRP HB2  H   4.668  -1.527  -7.463 1.00 . A A . 17 TRP HB2  1 1 
        2  1615 1 1 17 TRP HB3  H   3.646  -2.082  -6.139 1.00 . A A . 17 TRP HB3  1 1 
        2  1616 1 1 17 TRP HD1  H   6.904  -0.052  -6.684 1.00 . A A . 17 TRP HD1  1 1 
        2  1617 1 1 17 TRP HE1  H   7.158   1.581  -4.709 1.00 . A A . 17 TRP HE1  1 1 
        2  1618 1 1 17 TRP HE3  H   2.914  -1.549  -3.859 1.00 . A A . 17 TRP HE3  1 1 
        2  1619 1 1 17 TRP HH2  H   3.921   1.424  -0.961 1.00 . A A . 17 TRP HH2  1 1 
        2  1620 1 1 17 TRP HZ2  H   5.848   2.169  -2.294 1.00 . A A . 17 TRP HZ2  1 1 
        2  1621 1 1 17 TRP HZ3  H   2.481  -0.398  -1.728 1.00 . A A . 17 TRP HZ3  1 1 
        2  1622 1 1 17 TRP N    N   6.751  -3.032  -7.078 1.00 . A A . 17 TRP N    1 1 
        2  1623 1 1 17 TRP NE1  N   6.447   0.913  -4.774 1.00 . A A . 17 TRP NE1  1 1 
        2  1624 1 1 17 TRP O    O   4.016  -4.321  -7.857 1.00 . A A . 17 TRP O    1 1 
        2  1625 1 1 18 SER C    C   3.111  -7.048  -5.165 1.00 . A A . 18 SER C    1 1 
        2  1626 1 1 18 SER CA   C   4.016  -6.692  -6.357 1.00 . A A . 18 SER CA   1 1 
        2  1627 1 1 18 SER CB   C   4.975  -7.857  -6.659 1.00 . A A . 18 SER CB   1 1 
        2  1628 1 1 18 SER H    H   5.391  -5.457  -5.311 1.00 . A A . 18 SER H    1 1 
        2  1629 1 1 18 SER HA   H   3.394  -6.510  -7.223 1.00 . A A . 18 SER HA   1 1 
        2  1630 1 1 18 SER HB2  H   5.540  -7.634  -7.553 1.00 . A A . 18 SER HB2  1 1 
        2  1631 1 1 18 SER HB3  H   5.655  -7.984  -5.831 1.00 . A A . 18 SER HB3  1 1 
        2  1632 1 1 18 SER HG   H   4.902  -9.807  -6.895 1.00 . A A . 18 SER HG   1 1 
        2  1633 1 1 18 SER N    N   4.780  -5.466  -6.075 1.00 . A A . 18 SER N    1 1 
        2  1634 1 1 18 SER O    O   3.053  -6.302  -4.183 1.00 . A A . 18 SER O    1 1 
        2  1635 1 1 18 SER OG   O   4.273  -9.075  -6.865 1.00 . A A . 18 SER OG   1 1 
        2  1636 1 1 19 HIS C    C   2.132  -8.496  -2.780 1.00 . A A . 19 HIS C    1 1 
        2  1637 1 1 19 HIS CA   C   1.509  -8.649  -4.183 1.00 . A A . 19 HIS CA   1 1 
        2  1638 1 1 19 HIS CB   C   1.118 -10.119  -4.413 1.00 . A A . 19 HIS CB   1 1 
        2  1639 1 1 19 HIS CD2  C  -0.961 -10.202  -5.970 1.00 . A A . 19 HIS CD2  1 1 
        2  1640 1 1 19 HIS CE1  C   0.010 -11.009  -7.756 1.00 . A A . 19 HIS CE1  1 1 
        2  1641 1 1 19 HIS CG   C   0.353 -10.363  -5.681 1.00 . A A . 19 HIS CG   1 1 
        2  1642 1 1 19 HIS H    H   2.527  -8.742  -6.054 1.00 . A A . 19 HIS H    1 1 
        2  1643 1 1 19 HIS HA   H   0.615  -8.041  -4.231 1.00 . A A . 19 HIS HA   1 1 
        2  1644 1 1 19 HIS HB2  H   2.015 -10.718  -4.454 1.00 . A A . 19 HIS HB2  1 1 
        2  1645 1 1 19 HIS HB3  H   0.508 -10.459  -3.588 1.00 . A A . 19 HIS HB3  1 1 
        2  1646 1 1 19 HIS HD1  H   1.879 -11.089  -6.942 1.00 . A A . 19 HIS HD1  1 1 
        2  1647 1 1 19 HIS HD2  H  -1.721  -9.818  -5.305 1.00 . A A . 19 HIS HD2  1 1 
        2  1648 1 1 19 HIS HE1  H   0.176 -11.385  -8.754 1.00 . A A . 19 HIS HE1  1 1 
        2  1649 1 1 19 HIS HE2  H  -2.017 -10.812  -7.672 1.00 . A A . 19 HIS HE2  1 1 
        2  1650 1 1 19 HIS N    N   2.421  -8.190  -5.248 1.00 . A A . 19 HIS N    1 1 
        2  1651 1 1 19 HIS ND1  N   0.929 -10.871  -6.824 1.00 . A A . 19 HIS ND1  1 1 
        2  1652 1 1 19 HIS NE2  N  -1.147 -10.613  -7.266 1.00 . A A . 19 HIS NE2  1 1 
        2  1653 1 1 19 HIS O    O   1.541  -7.882  -1.889 1.00 . A A . 19 HIS O    1 1 
        2  1654 1 1 20 THR C    C   4.335  -7.536  -0.896 1.00 . A A . 20 THR C    1 1 
        2  1655 1 1 20 THR CA   C   4.038  -8.986  -1.314 1.00 . A A . 20 THR CA   1 1 
        2  1656 1 1 20 THR CB   C   5.365  -9.787  -1.356 1.00 . A A . 20 THR CB   1 1 
        2  1657 1 1 20 THR CG2  C   6.121  -9.681  -0.034 1.00 . A A . 20 THR CG2  1 1 
        2  1658 1 1 20 THR H    H   3.750  -9.528  -3.350 1.00 . A A . 20 THR H    1 1 
        2  1659 1 1 20 THR HA   H   3.400  -9.437  -0.566 1.00 . A A . 20 THR HA   1 1 
        2  1660 1 1 20 THR HB   H   5.988  -9.382  -2.143 1.00 . A A . 20 THR HB   1 1 
        2  1661 1 1 20 THR HG1  H   5.556 -11.724  -0.999 1.00 . A A . 20 THR HG1  1 1 
        2  1662 1 1 20 THR HG21 H   6.389  -8.649   0.150 1.00 . A A . 20 THR HG21 1 1 
        2  1663 1 1 20 THR HG22 H   7.019 -10.280  -0.082 1.00 . A A . 20 THR HG22 1 1 
        2  1664 1 1 20 THR HG23 H   5.493 -10.038   0.769 1.00 . A A . 20 THR HG23 1 1 
        2  1665 1 1 20 THR N    N   3.330  -9.052  -2.601 1.00 . A A . 20 THR N    1 1 
        2  1666 1 1 20 THR O    O   4.094  -7.150   0.252 1.00 . A A . 20 THR O    1 1 
        2  1667 1 1 20 THR OG1  O   5.096 -11.170  -1.643 1.00 . A A . 20 THR OG1  1 1 
        2  1668 1 1 21 THR C    C   3.953  -4.557  -1.049 1.00 . A A . 21 THR C    1 1 
        2  1669 1 1 21 THR CA   C   5.181  -5.327  -1.550 1.00 . A A . 21 THR CA   1 1 
        2  1670 1 1 21 THR CB   C   5.739  -4.595  -2.801 1.00 . A A . 21 THR CB   1 1 
        2  1671 1 1 21 THR CG2  C   6.157  -3.167  -2.460 1.00 . A A . 21 THR CG2  1 1 
        2  1672 1 1 21 THR H    H   5.026  -7.100  -2.723 1.00 . A A . 21 THR H    1 1 
        2  1673 1 1 21 THR HA   H   5.941  -5.311  -0.782 1.00 . A A . 21 THR HA   1 1 
        2  1674 1 1 21 THR HB   H   4.962  -4.555  -3.550 1.00 . A A . 21 THR HB   1 1 
        2  1675 1 1 21 THR HG1  H   7.268  -4.773  -4.051 1.00 . A A . 21 THR HG1  1 1 
        2  1676 1 1 21 THR HG21 H   5.297  -2.613  -2.109 1.00 . A A . 21 THR HG21 1 1 
        2  1677 1 1 21 THR HG22 H   6.558  -2.687  -3.342 1.00 . A A . 21 THR HG22 1 1 
        2  1678 1 1 21 THR HG23 H   6.912  -3.185  -1.687 1.00 . A A . 21 THR HG23 1 1 
        2  1679 1 1 21 THR N    N   4.855  -6.735  -1.829 1.00 . A A . 21 THR N    1 1 
        2  1680 1 1 21 THR O    O   4.005  -3.891  -0.017 1.00 . A A . 21 THR O    1 1 
        2  1681 1 1 21 THR OG1  O   6.870  -5.302  -3.343 1.00 . A A . 21 THR OG1  1 1 
        2  1682 1 1 22 VAL C    C   1.149  -4.337  -0.002 1.00 . A A . 22 VAL C    1 1 
        2  1683 1 1 22 VAL CA   C   1.599  -3.982  -1.425 1.00 . A A . 22 VAL CA   1 1 
        2  1684 1 1 22 VAL CB   C   0.465  -4.326  -2.424 1.00 . A A . 22 VAL CB   1 1 
        2  1685 1 1 22 VAL CG1  C  -0.870  -3.726  -1.976 1.00 . A A . 22 VAL CG1  1 1 
        2  1686 1 1 22 VAL CG2  C   0.826  -3.846  -3.828 1.00 . A A . 22 VAL CG2  1 1 
        2  1687 1 1 22 VAL H    H   2.869  -5.217  -2.596 1.00 . A A . 22 VAL H    1 1 
        2  1688 1 1 22 VAL HA   H   1.780  -2.915  -1.474 1.00 . A A . 22 VAL HA   1 1 
        2  1689 1 1 22 VAL HB   H   0.358  -5.401  -2.453 1.00 . A A . 22 VAL HB   1 1 
        2  1690 1 1 22 VAL HG11 H  -0.776  -2.653  -1.896 1.00 . A A . 22 VAL HG11 1 1 
        2  1691 1 1 22 VAL HG12 H  -1.147  -4.134  -1.014 1.00 . A A . 22 VAL HG12 1 1 
        2  1692 1 1 22 VAL HG13 H  -1.636  -3.967  -2.701 1.00 . A A . 22 VAL HG13 1 1 
        2  1693 1 1 22 VAL HG21 H   1.741  -4.323  -4.148 1.00 . A A . 22 VAL HG21 1 1 
        2  1694 1 1 22 VAL HG22 H   0.964  -2.774  -3.821 1.00 . A A . 22 VAL HG22 1 1 
        2  1695 1 1 22 VAL HG23 H   0.030  -4.102  -4.512 1.00 . A A . 22 VAL HG23 1 1 
        2  1696 1 1 22 VAL N    N   2.848  -4.663  -1.786 1.00 . A A . 22 VAL N    1 1 
        2  1697 1 1 22 VAL O    O   0.905  -3.449   0.819 1.00 . A A . 22 VAL O    1 1 
        2  1698 1 1 23 ARG C    C   1.518  -5.558   2.735 1.00 . A A . 23 ARG C    1 1 
        2  1699 1 1 23 ARG CA   C   0.618  -6.101   1.612 1.00 . A A . 23 ARG CA   1 1 
        2  1700 1 1 23 ARG CB   C   0.565  -7.643   1.650 1.00 . A A . 23 ARG CB   1 1 
        2  1701 1 1 23 ARG CD   C   1.084  -8.365   4.046 1.00 . A A . 23 ARG CD   1 1 
        2  1702 1 1 23 ARG CG   C   0.012  -8.227   2.961 1.00 . A A . 23 ARG CG   1 1 
        2  1703 1 1 23 ARG CZ   C   1.250  -7.972   6.454 1.00 . A A . 23 ARG CZ   1 1 
        2  1704 1 1 23 ARG H    H   1.293  -6.297  -0.397 1.00 . A A . 23 ARG H    1 1 
        2  1705 1 1 23 ARG HA   H  -0.383  -5.720   1.767 1.00 . A A . 23 ARG HA   1 1 
        2  1706 1 1 23 ARG HB2  H  -0.063  -7.984   0.839 1.00 . A A . 23 ARG HB2  1 1 
        2  1707 1 1 23 ARG HB3  H   1.563  -8.028   1.501 1.00 . A A . 23 ARG HB3  1 1 
        2  1708 1 1 23 ARG HD2  H   1.548  -9.338   3.952 1.00 . A A . 23 ARG HD2  1 1 
        2  1709 1 1 23 ARG HD3  H   1.832  -7.599   3.899 1.00 . A A . 23 ARG HD3  1 1 
        2  1710 1 1 23 ARG HE   H  -0.432  -8.341   5.497 1.00 . A A . 23 ARG HE   1 1 
        2  1711 1 1 23 ARG HG2  H  -0.770  -7.579   3.328 1.00 . A A . 23 ARG HG2  1 1 
        2  1712 1 1 23 ARG HG3  H  -0.406  -9.205   2.756 1.00 . A A . 23 ARG HG3  1 1 
        2  1713 1 1 23 ARG HH11 H   2.991  -7.951   5.484 1.00 . A A . 23 ARG HH11 1 1 
        2  1714 1 1 23 ARG HH12 H   3.076  -7.655   7.186 1.00 . A A . 23 ARG HH12 1 1 
        2  1715 1 1 23 ARG HH21 H  -0.309  -7.901   7.688 1.00 . A A . 23 ARG HH21 1 1 
        2  1716 1 1 23 ARG HH22 H   1.234  -7.608   8.410 1.00 . A A . 23 ARG HH22 1 1 
        2  1717 1 1 23 ARG N    N   1.061  -5.635   0.291 1.00 . A A . 23 ARG N    1 1 
        2  1718 1 1 23 ARG NE   N   0.531  -8.238   5.393 1.00 . A A . 23 ARG NE   1 1 
        2  1719 1 1 23 ARG NH1  N   2.537  -7.847   6.368 1.00 . A A . 23 ARG NH1  1 1 
        2  1720 1 1 23 ARG NH2  N   0.680  -7.819   7.604 1.00 . A A . 23 ARG NH2  1 1 
        2  1721 1 1 23 ARG O    O   1.028  -5.165   3.790 1.00 . A A . 23 ARG O    1 1 
        2  1722 1 1 24 ASN C    C   3.978  -3.541   3.470 1.00 . A A . 24 ASN C    1 1 
        2  1723 1 1 24 ASN CA   C   3.784  -5.067   3.521 1.00 . A A . 24 ASN CA   1 1 
        2  1724 1 1 24 ASN CB   C   5.134  -5.776   3.346 1.00 . A A . 24 ASN CB   1 1 
        2  1725 1 1 24 ASN CG   C   5.026  -7.283   3.503 1.00 . A A . 24 ASN CG   1 1 
        2  1726 1 1 24 ASN H    H   3.167  -5.847   1.635 1.00 . A A . 24 ASN H    1 1 
        2  1727 1 1 24 ASN HA   H   3.384  -5.323   4.492 1.00 . A A . 24 ASN HA   1 1 
        2  1728 1 1 24 ASN HB2  H   5.518  -5.563   2.359 1.00 . A A . 24 ASN HB2  1 1 
        2  1729 1 1 24 ASN HB3  H   5.830  -5.403   4.085 1.00 . A A . 24 ASN HB3  1 1 
        2  1730 1 1 24 ASN HD21 H   6.581  -7.558   2.316 1.00 . A A . 24 ASN HD21 1 1 
        2  1731 1 1 24 ASN HD22 H   5.853  -8.990   2.945 1.00 . A A . 24 ASN HD22 1 1 
        2  1732 1 1 24 ASN N    N   2.830  -5.539   2.505 1.00 . A A . 24 ASN N    1 1 
        2  1733 1 1 24 ASN ND2  N   5.910  -8.016   2.857 1.00 . A A . 24 ASN ND2  1 1 
        2  1734 1 1 24 ASN O    O   4.830  -2.991   4.170 1.00 . A A . 24 ASN O    1 1 
        2  1735 1 1 24 ASN OD1  O   4.161  -7.788   4.208 1.00 . A A . 24 ASN OD1  1 1 
        2  1736 1 1 25 ALA C    C   2.090  -0.690   3.222 1.00 . A A . 25 ALA C    1 1 
        2  1737 1 1 25 ALA CA   C   3.260  -1.401   2.519 1.00 . A A . 25 ALA CA   1 1 
        2  1738 1 1 25 ALA CB   C   3.308  -1.008   1.046 1.00 . A A . 25 ALA CB   1 1 
        2  1739 1 1 25 ALA H    H   2.537  -3.355   2.098 1.00 . A A . 25 ALA H    1 1 
        2  1740 1 1 25 ALA HA   H   4.187  -1.078   2.978 1.00 . A A . 25 ALA HA   1 1 
        2  1741 1 1 25 ALA HB1  H   2.385  -1.299   0.565 1.00 . A A . 25 ALA HB1  1 1 
        2  1742 1 1 25 ALA HB2  H   4.135  -1.507   0.564 1.00 . A A . 25 ALA HB2  1 1 
        2  1743 1 1 25 ALA HB3  H   3.434   0.062   0.961 1.00 . A A . 25 ALA HB3  1 1 
        2  1744 1 1 25 ALA N    N   3.181  -2.862   2.648 1.00 . A A . 25 ALA N    1 1 
        2  1745 1 1 25 ALA O    O   2.290   0.053   4.187 1.00 . A A . 25 ALA O    1 1 
        2  1746 1 1 26 LEU C    C  -0.508  -0.336   4.762 1.00 . A A . 26 LEU C    1 1 
        2  1747 1 1 26 LEU CA   C  -0.316  -0.191   3.240 1.00 . A A . 26 LEU CA   1 1 
        2  1748 1 1 26 LEU CB   C  -1.598  -0.629   2.498 1.00 . A A . 26 LEU CB   1 1 
        2  1749 1 1 26 LEU CD1  C  -3.554  -2.195   2.195 1.00 . A A . 26 LEU CD1  1 1 
        2  1750 1 1 26 LEU CD2  C  -1.316  -3.131   2.821 1.00 . A A . 26 LEU CD2  1 1 
        2  1751 1 1 26 LEU CG   C  -2.261  -1.943   2.968 1.00 . A A . 26 LEU CG   1 1 
        2  1752 1 1 26 LEU H    H   0.747  -1.610   2.051 1.00 . A A . 26 LEU H    1 1 
        2  1753 1 1 26 LEU HA   H  -0.142   0.855   3.025 1.00 . A A . 26 LEU HA   1 1 
        2  1754 1 1 26 LEU HB2  H  -2.327   0.167   2.596 1.00 . A A . 26 LEU HB2  1 1 
        2  1755 1 1 26 LEU HB3  H  -1.355  -0.733   1.449 1.00 . A A . 26 LEU HB3  1 1 
        2  1756 1 1 26 LEU HD11 H  -3.999  -3.122   2.528 1.00 . A A . 26 LEU HD11 1 1 
        2  1757 1 1 26 LEU HD12 H  -3.337  -2.259   1.138 1.00 . A A . 26 LEU HD12 1 1 
        2  1758 1 1 26 LEU HD13 H  -4.243  -1.382   2.373 1.00 . A A . 26 LEU HD13 1 1 
        2  1759 1 1 26 LEU HD21 H  -1.806  -4.029   3.171 1.00 . A A . 26 LEU HD21 1 1 
        2  1760 1 1 26 LEU HD22 H  -0.424  -2.960   3.406 1.00 . A A . 26 LEU HD22 1 1 
        2  1761 1 1 26 LEU HD23 H  -1.045  -3.253   1.781 1.00 . A A . 26 LEU HD23 1 1 
        2  1762 1 1 26 LEU HG   H  -2.519  -1.850   4.016 1.00 . A A . 26 LEU HG   1 1 
        2  1763 1 1 26 LEU N    N   0.863  -0.928   2.748 1.00 . A A . 26 LEU N    1 1 
        2  1764 1 1 26 LEU O    O  -1.054   0.552   5.415 1.00 . A A . 26 LEU O    1 1 
        2  1765 1 1 27 LYS C    C   0.643  -0.727   7.626 1.00 . A A . 27 LYS C    1 1 
        2  1766 1 1 27 LYS CA   C  -0.179  -1.708   6.764 1.00 . A A . 27 LYS CA   1 1 
        2  1767 1 1 27 LYS CB   C   0.172  -3.177   7.089 1.00 . A A . 27 LYS CB   1 1 
        2  1768 1 1 27 LYS CD   C   2.718  -3.120   6.877 1.00 . A A . 27 LYS CD   1 1 
        2  1769 1 1 27 LYS CE   C   2.986  -3.464   8.338 1.00 . A A . 27 LYS CE   1 1 
        2  1770 1 1 27 LYS CG   C   1.411  -3.726   6.373 1.00 . A A . 27 LYS CG   1 1 
        2  1771 1 1 27 LYS H    H   0.404  -2.115   4.758 1.00 . A A . 27 LYS H    1 1 
        2  1772 1 1 27 LYS HA   H  -1.223  -1.554   7.005 1.00 . A A . 27 LYS HA   1 1 
        2  1773 1 1 27 LYS HB2  H   0.332  -3.268   8.154 1.00 . A A . 27 LYS HB2  1 1 
        2  1774 1 1 27 LYS HB3  H  -0.673  -3.796   6.816 1.00 . A A . 27 LYS HB3  1 1 
        2  1775 1 1 27 LYS HD2  H   3.534  -3.501   6.277 1.00 . A A . 27 LYS HD2  1 1 
        2  1776 1 1 27 LYS HD3  H   2.669  -2.045   6.771 1.00 . A A . 27 LYS HD3  1 1 
        2  1777 1 1 27 LYS HE2  H   2.184  -3.071   8.945 1.00 . A A . 27 LYS HE2  1 1 
        2  1778 1 1 27 LYS HE3  H   3.024  -4.539   8.442 1.00 . A A . 27 LYS HE3  1 1 
        2  1779 1 1 27 LYS HG2  H   1.449  -4.794   6.519 1.00 . A A . 27 LYS HG2  1 1 
        2  1780 1 1 27 LYS HG3  H   1.318  -3.518   5.314 1.00 . A A . 27 LYS HG3  1 1 
        2  1781 1 1 27 LYS HZ1  H   4.484  -3.226   9.767 1.00 . A A . 27 LYS HZ1  1 1 
        2  1782 1 1 27 LYS HZ2  H   4.220  -1.852   8.819 1.00 . A A . 27 LYS HZ2  1 1 
        2  1783 1 1 27 LYS HZ3  H   5.042  -3.176   8.175 1.00 . A A . 27 LYS HZ3  1 1 
        2  1784 1 1 27 LYS N    N  -0.039  -1.450   5.325 1.00 . A A . 27 LYS N    1 1 
        2  1785 1 1 27 LYS NZ   N   4.271  -2.889   8.808 1.00 . A A . 27 LYS NZ   1 1 
        2  1786 1 1 27 LYS O    O   0.359  -0.549   8.811 1.00 . A A . 27 LYS O    1 1 
        2  1787 1 1 28 ASP C    C   1.710   2.289   7.708 1.00 . A A . 28 ASP C    1 1 
        2  1788 1 1 28 ASP CA   C   2.434   0.937   7.742 1.00 . A A . 28 ASP CA   1 1 
        2  1789 1 1 28 ASP CB   C   3.845   1.075   7.155 1.00 . A A . 28 ASP CB   1 1 
        2  1790 1 1 28 ASP CG   C   4.730  -0.097   7.530 1.00 . A A . 28 ASP CG   1 1 
        2  1791 1 1 28 ASP H    H   1.896  -0.324   6.111 1.00 . A A . 28 ASP H    1 1 
        2  1792 1 1 28 ASP HA   H   2.519   0.626   8.776 1.00 . A A . 28 ASP HA   1 1 
        2  1793 1 1 28 ASP HB2  H   3.777   1.131   6.078 1.00 . A A . 28 ASP HB2  1 1 
        2  1794 1 1 28 ASP HB3  H   4.299   1.982   7.531 1.00 . A A . 28 ASP HB3  1 1 
        2  1795 1 1 28 ASP N    N   1.660  -0.095   7.036 1.00 . A A . 28 ASP N    1 1 
        2  1796 1 1 28 ASP O    O   1.863   3.107   8.612 1.00 . A A . 28 ASP O    1 1 
        2  1797 1 1 28 ASP OD1  O   5.031  -0.256   8.733 1.00 . A A . 28 ASP OD1  1 1 
        2  1798 1 1 28 ASP OD2  O   5.111  -0.878   6.644 1.00 . A A . 28 ASP OD2  1 1 
        2  1799 1 1 29 LEU C    C  -1.156   3.592   7.434 1.00 . A A . 29 LEU C    1 1 
        2  1800 1 1 29 LEU CA   C   0.103   3.731   6.567 1.00 . A A . 29 LEU CA   1 1 
        2  1801 1 1 29 LEU CB   C  -0.291   4.020   5.105 1.00 . A A . 29 LEU CB   1 1 
        2  1802 1 1 29 LEU CD1  C   1.633   5.620   4.727 1.00 . A A . 29 LEU CD1  1 1 
        2  1803 1 1 29 LEU CD2  C   1.798   3.254   3.882 1.00 . A A . 29 LEU CD2  1 1 
        2  1804 1 1 29 LEU CG   C   0.861   4.430   4.161 1.00 . A A . 29 LEU CG   1 1 
        2  1805 1 1 29 LEU H    H   0.892   1.861   5.937 1.00 . A A . 29 LEU H    1 1 
        2  1806 1 1 29 LEU HA   H   0.691   4.557   6.944 1.00 . A A . 29 LEU HA   1 1 
        2  1807 1 1 29 LEU HB2  H  -0.761   3.135   4.701 1.00 . A A . 29 LEU HB2  1 1 
        2  1808 1 1 29 LEU HB3  H  -1.021   4.819   5.106 1.00 . A A . 29 LEU HB3  1 1 
        2  1809 1 1 29 LEU HD11 H   0.962   6.456   4.858 1.00 . A A . 29 LEU HD11 1 1 
        2  1810 1 1 29 LEU HD12 H   2.421   5.898   4.042 1.00 . A A . 29 LEU HD12 1 1 
        2  1811 1 1 29 LEU HD13 H   2.064   5.353   5.682 1.00 . A A . 29 LEU HD13 1 1 
        2  1812 1 1 29 LEU HD21 H   2.235   2.910   4.809 1.00 . A A . 29 LEU HD21 1 1 
        2  1813 1 1 29 LEU HD22 H   2.582   3.568   3.209 1.00 . A A . 29 LEU HD22 1 1 
        2  1814 1 1 29 LEU HD23 H   1.239   2.448   3.429 1.00 . A A . 29 LEU HD23 1 1 
        2  1815 1 1 29 LEU HG   H   0.436   4.741   3.215 1.00 . A A . 29 LEU HG   1 1 
        2  1816 1 1 29 LEU N    N   0.923   2.519   6.662 1.00 . A A . 29 LEU N    1 1 
        2  1817 1 1 29 LEU O    O  -1.589   4.544   8.081 1.00 . A A . 29 LEU O    1 1 
        2  1818 1 1 30 LEU C    C  -2.682   1.976   9.747 1.00 . A A . 30 LEU C    1 1 
        2  1819 1 1 30 LEU CA   C  -2.942   2.092   8.225 1.00 . A A . 30 LEU CA   1 1 
        2  1820 1 1 30 LEU CB   C  -3.571   0.793   7.688 1.00 . A A . 30 LEU CB   1 1 
        2  1821 1 1 30 LEU CD1  C  -5.962   1.592   7.720 1.00 . A A . 30 LEU CD1  1 1 
        2  1822 1 1 30 LEU CD2  C  -5.465  -0.872   7.666 1.00 . A A . 30 LEU CD2  1 1 
        2  1823 1 1 30 LEU CG   C  -5.003   0.493   8.170 1.00 . A A . 30 LEU CG   1 1 
        2  1824 1 1 30 LEU H    H  -1.283   1.654   6.973 1.00 . A A . 30 LEU H    1 1 
        2  1825 1 1 30 LEU HA   H  -3.629   2.906   8.056 1.00 . A A . 30 LEU HA   1 1 
        2  1826 1 1 30 LEU HB2  H  -3.584   0.848   6.607 1.00 . A A . 30 LEU HB2  1 1 
        2  1827 1 1 30 LEU HB3  H  -2.937  -0.034   7.977 1.00 . A A . 30 LEU HB3  1 1 
        2  1828 1 1 30 LEU HD11 H  -5.652   2.535   8.146 1.00 . A A . 30 LEU HD11 1 1 
        2  1829 1 1 30 LEU HD12 H  -6.961   1.358   8.055 1.00 . A A . 30 LEU HD12 1 1 
        2  1830 1 1 30 LEU HD13 H  -5.950   1.662   6.642 1.00 . A A . 30 LEU HD13 1 1 
        2  1831 1 1 30 LEU HD21 H  -4.784  -1.635   8.017 1.00 . A A . 30 LEU HD21 1 1 
        2  1832 1 1 30 LEU HD22 H  -5.482  -0.873   6.586 1.00 . A A . 30 LEU HD22 1 1 
        2  1833 1 1 30 LEU HD23 H  -6.458  -1.078   8.042 1.00 . A A . 30 LEU HD23 1 1 
        2  1834 1 1 30 LEU HG   H  -5.013   0.469   9.251 1.00 . A A . 30 LEU HG   1 1 
        2  1835 1 1 30 LEU N    N  -1.710   2.381   7.473 1.00 . A A . 30 LEU N    1 1 
        2  1836 1 1 30 LEU O    O  -3.445   1.341  10.475 1.00 . A A . 30 LEU O    1 1 
        2  1837 1 1 31 LYS C    C  -2.078   3.715  12.393 1.00 . A A . 31 LYS C    1 1 
        2  1838 1 1 31 LYS CA   C  -1.301   2.605  11.665 1.00 . A A . 31 LYS CA   1 1 
        2  1839 1 1 31 LYS CB   C   0.206   2.794  11.885 1.00 . A A . 31 LYS CB   1 1 
        2  1840 1 1 31 LYS CD   C   2.547   1.942  11.451 1.00 . A A . 31 LYS CD   1 1 
        2  1841 1 1 31 LYS CE   C   3.031   2.310  12.850 1.00 . A A . 31 LYS CE   1 1 
        2  1842 1 1 31 LYS CG   C   1.056   1.612  11.422 1.00 . A A . 31 LYS CG   1 1 
        2  1843 1 1 31 LYS H    H  -1.008   3.056   9.609 1.00 . A A . 31 LYS H    1 1 
        2  1844 1 1 31 LYS HA   H  -1.599   1.650  12.074 1.00 . A A . 31 LYS HA   1 1 
        2  1845 1 1 31 LYS HB2  H   0.527   3.673  11.345 1.00 . A A . 31 LYS HB2  1 1 
        2  1846 1 1 31 LYS HB3  H   0.387   2.945  12.940 1.00 . A A . 31 LYS HB3  1 1 
        2  1847 1 1 31 LYS HD2  H   3.100   1.079  11.109 1.00 . A A . 31 LYS HD2  1 1 
        2  1848 1 1 31 LYS HD3  H   2.733   2.773  10.785 1.00 . A A . 31 LYS HD3  1 1 
        2  1849 1 1 31 LYS HE2  H   2.408   3.100  13.240 1.00 . A A . 31 LYS HE2  1 1 
        2  1850 1 1 31 LYS HE3  H   2.950   1.441  13.487 1.00 . A A . 31 LYS HE3  1 1 
        2  1851 1 1 31 LYS HG2  H   0.870   0.769  12.073 1.00 . A A . 31 LYS HG2  1 1 
        2  1852 1 1 31 LYS HG3  H   0.772   1.354  10.410 1.00 . A A . 31 LYS HG3  1 1 
        2  1853 1 1 31 LYS HZ1  H   5.064   2.039  12.441 1.00 . A A . 31 LYS HZ1  1 1 
        2  1854 1 1 31 LYS HZ2  H   4.756   2.983  13.813 1.00 . A A . 31 LYS HZ2  1 1 
        2  1855 1 1 31 LYS HZ3  H   4.535   3.637  12.273 1.00 . A A . 31 LYS HZ3  1 1 
        2  1856 1 1 31 LYS N    N  -1.607   2.595  10.228 1.00 . A A . 31 LYS N    1 1 
        2  1857 1 1 31 LYS NZ   N   4.443   2.773  12.843 1.00 . A A . 31 LYS NZ   1 1 
        2  1858 1 1 31 LYS O    O  -2.522   3.534  13.529 1.00 . A A . 31 LYS O    1 1 
        2  1859 1 1 32 ASP C    C  -4.456   5.893  12.196 1.00 . A A . 32 ASP C    1 1 
        2  1860 1 1 32 ASP CA   C  -2.925   6.015  12.325 1.00 . A A . 32 ASP CA   1 1 
        2  1861 1 1 32 ASP CB   C  -2.442   7.304  11.656 1.00 . A A . 32 ASP CB   1 1 
        2  1862 1 1 32 ASP CG   C  -0.934   7.468  11.745 1.00 . A A . 32 ASP CG   1 1 
        2  1863 1 1 32 ASP H    H  -1.886   4.936  10.819 1.00 . A A . 32 ASP H    1 1 
        2  1864 1 1 32 ASP HA   H  -2.668   6.051  13.376 1.00 . A A . 32 ASP HA   1 1 
        2  1865 1 1 32 ASP HB2  H  -2.725   7.290  10.612 1.00 . A A . 32 ASP HB2  1 1 
        2  1866 1 1 32 ASP HB3  H  -2.910   8.152  12.137 1.00 . A A . 32 ASP HB3  1 1 
        2  1867 1 1 32 ASP N    N  -2.238   4.861  11.733 1.00 . A A . 32 ASP N    1 1 
        2  1868 1 1 32 ASP O    O  -5.179   5.862  13.198 1.00 . A A . 32 ASP O    1 1 
        2  1869 1 1 32 ASP OD1  O  -0.445   7.974  12.777 1.00 . A A . 32 ASP OD1  1 1 
        2  1870 1 1 32 ASP OD2  O  -0.227   7.088  10.787 1.00 . A A . 32 ASP OD2  1 1 
        2  1871 1 1 33 MET C    C  -6.874   4.261  10.824 1.00 . A A . 33 MET C    1 1 
        2  1872 1 1 33 MET CA   C  -6.381   5.710  10.691 1.00 . A A . 33 MET CA   1 1 
        2  1873 1 1 33 MET CB   C  -6.715   6.259   9.293 1.00 . A A . 33 MET CB   1 1 
        2  1874 1 1 33 MET CE   C  -4.058   7.561   8.013 1.00 . A A . 33 MET CE   1 1 
        2  1875 1 1 33 MET CG   C  -5.986   5.555   8.153 1.00 . A A . 33 MET CG   1 1 
        2  1876 1 1 33 MET H    H  -4.315   5.822  10.205 1.00 . A A . 33 MET H    1 1 
        2  1877 1 1 33 MET HA   H  -6.895   6.312  11.428 1.00 . A A . 33 MET HA   1 1 
        2  1878 1 1 33 MET HB2  H  -7.778   6.158   9.125 1.00 . A A . 33 MET HB2  1 1 
        2  1879 1 1 33 MET HB3  H  -6.457   7.307   9.260 1.00 . A A . 33 MET HB3  1 1 
        2  1880 1 1 33 MET HE1  H  -4.599   8.059   8.805 1.00 . A A . 33 MET HE1  1 1 
        2  1881 1 1 33 MET HE2  H  -4.474   7.845   7.057 1.00 . A A . 33 MET HE2  1 1 
        2  1882 1 1 33 MET HE3  H  -3.018   7.848   8.054 1.00 . A A . 33 MET HE3  1 1 
        2  1883 1 1 33 MET HG2  H  -6.197   4.498   8.207 1.00 . A A . 33 MET HG2  1 1 
        2  1884 1 1 33 MET HG3  H  -6.349   5.945   7.213 1.00 . A A . 33 MET HG3  1 1 
        2  1885 1 1 33 MET N    N  -4.940   5.816  10.958 1.00 . A A . 33 MET N    1 1 
        2  1886 1 1 33 MET O    O  -6.079   3.328  10.936 1.00 . A A . 33 MET O    1 1 
        2  1887 1 1 33 MET SD   S  -4.198   5.784   8.220 1.00 . A A . 33 MET SD   1 1 
        2  1888 1 1 34 ASN C    C  -9.005   2.090   9.559 1.00 . A A . 34 ASN C    1 1 
        2  1889 1 1 34 ASN CA   C  -8.784   2.736  10.937 1.00 . A A . 34 ASN CA   1 1 
        2  1890 1 1 34 ASN CB   C -10.104   2.805  11.711 1.00 . A A . 34 ASN CB   1 1 
        2  1891 1 1 34 ASN CG   C  -9.909   3.329  13.123 1.00 . A A . 34 ASN CG   1 1 
        2  1892 1 1 34 ASN H    H  -8.783   4.851  10.713 1.00 . A A . 34 ASN H    1 1 
        2  1893 1 1 34 ASN HA   H  -8.088   2.121  11.492 1.00 . A A . 34 ASN HA   1 1 
        2  1894 1 1 34 ASN HB2  H -10.788   3.462  11.192 1.00 . A A . 34 ASN HB2  1 1 
        2  1895 1 1 34 ASN HB3  H -10.536   1.817  11.768 1.00 . A A . 34 ASN HB3  1 1 
        2  1896 1 1 34 ASN HD21 H -10.361   5.163  12.543 1.00 . A A . 34 ASN HD21 1 1 
        2  1897 1 1 34 ASN HD22 H  -9.979   4.972  14.213 1.00 . A A . 34 ASN HD22 1 1 
        2  1898 1 1 34 ASN N    N  -8.194   4.075  10.814 1.00 . A A . 34 ASN N    1 1 
        2  1899 1 1 34 ASN ND2  N -10.103   4.617  13.311 1.00 . A A . 34 ASN ND2  1 1 
        2  1900 1 1 34 ASN O    O  -8.942   2.761   8.526 1.00 . A A . 34 ASN O    1 1 
        2  1901 1 1 34 ASN OD1  O  -9.599   2.579  14.042 1.00 . A A . 34 ASN OD1  1 1 
        2  1902 1 1 35 GLN C    C -10.447   0.595   7.354 1.00 . A A . 35 GLN C    1 1 
        2  1903 1 1 35 GLN CA   C  -9.401   0.006   8.319 1.00 . A A . 35 GLN CA   1 1 
        2  1904 1 1 35 GLN CB   C  -9.740  -1.456   8.656 1.00 . A A . 35 GLN CB   1 1 
        2  1905 1 1 35 GLN CD   C  -9.065  -3.563   9.931 1.00 . A A . 35 GLN CD   1 1 
        2  1906 1 1 35 GLN CG   C  -8.682  -2.146   9.516 1.00 . A A . 35 GLN CG   1 1 
        2  1907 1 1 35 GLN H    H  -9.425   0.334  10.419 1.00 . A A . 35 GLN H    1 1 
        2  1908 1 1 35 GLN HA   H  -8.437   0.030   7.830 1.00 . A A . 35 GLN HA   1 1 
        2  1909 1 1 35 GLN HB2  H -10.681  -1.482   9.189 1.00 . A A . 35 GLN HB2  1 1 
        2  1910 1 1 35 GLN HB3  H  -9.844  -2.013   7.734 1.00 . A A . 35 GLN HB3  1 1 
        2  1911 1 1 35 GLN HE21 H -10.094  -3.836   8.262 1.00 . A A . 35 GLN HE21 1 1 
        2  1912 1 1 35 GLN HE22 H -10.078  -5.164   9.360 1.00 . A A . 35 GLN HE22 1 1 
        2  1913 1 1 35 GLN HG2  H  -7.759  -2.194   8.958 1.00 . A A . 35 GLN HG2  1 1 
        2  1914 1 1 35 GLN HG3  H  -8.527  -1.555  10.410 1.00 . A A . 35 GLN HG3  1 1 
        2  1915 1 1 35 GLN N    N  -9.283   0.787   9.559 1.00 . A A . 35 GLN N    1 1 
        2  1916 1 1 35 GLN NE2  N  -9.819  -4.256   9.097 1.00 . A A . 35 GLN NE2  1 1 
        2  1917 1 1 35 GLN O    O -10.190   0.735   6.156 1.00 . A A . 35 GLN O    1 1 
        2  1918 1 1 35 GLN OE1  O  -8.677  -4.035  10.996 1.00 . A A . 35 GLN OE1  1 1 
        2  1919 1 1 36 SER C    C -12.252   2.878   6.408 1.00 . A A . 36 SER C    1 1 
        2  1920 1 1 36 SER CA   C -12.690   1.550   7.059 1.00 . A A . 36 SER CA   1 1 
        2  1921 1 1 36 SER CB   C -13.951   1.786   7.907 1.00 . A A . 36 SER CB   1 1 
        2  1922 1 1 36 SER H    H -11.779   0.803   8.837 1.00 . A A . 36 SER H    1 1 
        2  1923 1 1 36 SER HA   H -12.930   0.845   6.273 1.00 . A A . 36 SER HA   1 1 
        2  1924 1 1 36 SER HB2  H -14.278   0.849   8.331 1.00 . A A . 36 SER HB2  1 1 
        2  1925 1 1 36 SER HB3  H -13.721   2.479   8.705 1.00 . A A . 36 SER HB3  1 1 
        2  1926 1 1 36 SER HG   H -14.645   2.857   6.410 1.00 . A A . 36 SER HG   1 1 
        2  1927 1 1 36 SER N    N -11.619   0.955   7.880 1.00 . A A . 36 SER N    1 1 
        2  1928 1 1 36 SER O    O -12.813   3.298   5.398 1.00 . A A . 36 SER O    1 1 
        2  1929 1 1 36 SER OG   O -15.011   2.326   7.128 1.00 . A A . 36 SER OG   1 1 
        2  1930 1 1 37 SER C    C  -9.804   4.623   5.270 1.00 . A A . 37 SER C    1 1 
        2  1931 1 1 37 SER CA   C -10.743   4.817   6.470 1.00 . A A . 37 SER CA   1 1 
        2  1932 1 1 37 SER CB   C -10.011   5.591   7.573 1.00 . A A . 37 SER CB   1 1 
        2  1933 1 1 37 SER H    H -10.826   3.148   7.789 1.00 . A A . 37 SER H    1 1 
        2  1934 1 1 37 SER HA   H -11.596   5.399   6.149 1.00 . A A . 37 SER HA   1 1 
        2  1935 1 1 37 SER HB2  H -10.693   5.782   8.388 1.00 . A A . 37 SER HB2  1 1 
        2  1936 1 1 37 SER HB3  H  -9.182   5.000   7.934 1.00 . A A . 37 SER HB3  1 1 
        2  1937 1 1 37 SER HG   H  -9.354   6.791   6.153 1.00 . A A . 37 SER HG   1 1 
        2  1938 1 1 37 SER N    N -11.245   3.532   6.989 1.00 . A A . 37 SER N    1 1 
        2  1939 1 1 37 SER O    O  -9.580   5.552   4.494 1.00 . A A . 37 SER O    1 1 
        2  1940 1 1 37 SER OG   O  -9.509   6.838   7.106 1.00 . A A . 37 SER OG   1 1 
        2  1941 1 1 38 LEU C    C  -9.119   3.039   2.683 1.00 . A A . 38 LEU C    1 1 
        2  1942 1 1 38 LEU CA   C  -8.345   3.110   4.011 1.00 . A A . 38 LEU CA   1 1 
        2  1943 1 1 38 LEU CB   C  -7.610   1.781   4.295 1.00 . A A . 38 LEU CB   1 1 
        2  1944 1 1 38 LEU CD1  C  -5.514   0.397   4.019 1.00 . A A . 38 LEU CD1  1 1 
        2  1945 1 1 38 LEU CD2  C  -6.928   0.883   2.015 1.00 . A A . 38 LEU CD2  1 1 
        2  1946 1 1 38 LEU CG   C  -6.433   1.424   3.356 1.00 . A A . 38 LEU CG   1 1 
        2  1947 1 1 38 LEU H    H  -9.461   2.719   5.781 1.00 . A A . 38 LEU H    1 1 
        2  1948 1 1 38 LEU HA   H  -7.616   3.908   3.950 1.00 . A A . 38 LEU HA   1 1 
        2  1949 1 1 38 LEU HB2  H  -7.227   1.824   5.307 1.00 . A A . 38 LEU HB2  1 1 
        2  1950 1 1 38 LEU HB3  H  -8.333   0.981   4.246 1.00 . A A . 38 LEU HB3  1 1 
        2  1951 1 1 38 LEU HD11 H  -5.157   0.786   4.961 1.00 . A A . 38 LEU HD11 1 1 
        2  1952 1 1 38 LEU HD12 H  -4.673   0.196   3.372 1.00 . A A . 38 LEU HD12 1 1 
        2  1953 1 1 38 LEU HD13 H  -6.060  -0.520   4.193 1.00 . A A . 38 LEU HD13 1 1 
        2  1954 1 1 38 LEU HD21 H  -6.081   0.629   1.394 1.00 . A A . 38 LEU HD21 1 1 
        2  1955 1 1 38 LEU HD22 H  -7.522   1.637   1.519 1.00 . A A . 38 LEU HD22 1 1 
        2  1956 1 1 38 LEU HD23 H  -7.531   0.002   2.179 1.00 . A A . 38 LEU HD23 1 1 
        2  1957 1 1 38 LEU HG   H  -5.849   2.315   3.163 1.00 . A A . 38 LEU HG   1 1 
        2  1958 1 1 38 LEU N    N  -9.255   3.419   5.125 1.00 . A A . 38 LEU N    1 1 
        2  1959 1 1 38 LEU O    O  -8.731   3.654   1.687 1.00 . A A . 38 LEU O    1 1 
        2  1960 1 1 39 ALA C    C -11.707   3.440   1.011 1.00 . A A . 39 ALA C    1 1 
        2  1961 1 1 39 ALA CA   C -11.056   2.124   1.484 1.00 . A A . 39 ALA CA   1 1 
        2  1962 1 1 39 ALA CB   C -12.121   1.062   1.742 1.00 . A A . 39 ALA CB   1 1 
        2  1963 1 1 39 ALA H    H -10.503   1.862   3.518 1.00 . A A . 39 ALA H    1 1 
        2  1964 1 1 39 ALA HA   H -10.411   1.760   0.696 1.00 . A A . 39 ALA HA   1 1 
        2  1965 1 1 39 ALA HB1  H -12.791   1.403   2.518 1.00 . A A . 39 ALA HB1  1 1 
        2  1966 1 1 39 ALA HB2  H -11.645   0.144   2.057 1.00 . A A . 39 ALA HB2  1 1 
        2  1967 1 1 39 ALA HB3  H -12.681   0.883   0.836 1.00 . A A . 39 ALA HB3  1 1 
        2  1968 1 1 39 ALA N    N -10.230   2.303   2.687 1.00 . A A . 39 ALA N    1 1 
        2  1969 1 1 39 ALA O    O -12.343   3.483  -0.045 1.00 . A A . 39 ALA O    1 1 
        2  1970 1 1 40 LYS C    C -11.473   6.323   0.109 1.00 . A A . 40 LYS C    1 1 
        2  1971 1 1 40 LYS CA   C -12.078   5.826   1.427 1.00 . A A . 40 LYS CA   1 1 
        2  1972 1 1 40 LYS CB   C -11.797   6.847   2.541 1.00 . A A . 40 LYS CB   1 1 
        2  1973 1 1 40 LYS CD   C -14.129   7.009   3.536 1.00 . A A . 40 LYS CD   1 1 
        2  1974 1 1 40 LYS CE   C -14.374   8.518   3.464 1.00 . A A . 40 LYS CE   1 1 
        2  1975 1 1 40 LYS CG   C -12.659   6.658   3.786 1.00 . A A . 40 LYS CG   1 1 
        2  1976 1 1 40 LYS H    H -11.084   4.401   2.652 1.00 . A A . 40 LYS H    1 1 
        2  1977 1 1 40 LYS HA   H -13.148   5.731   1.304 1.00 . A A . 40 LYS HA   1 1 
        2  1978 1 1 40 LYS HB2  H -10.759   6.764   2.834 1.00 . A A . 40 LYS HB2  1 1 
        2  1979 1 1 40 LYS HB3  H -11.970   7.843   2.156 1.00 . A A . 40 LYS HB3  1 1 
        2  1980 1 1 40 LYS HD2  H -14.441   6.566   2.602 1.00 . A A . 40 LYS HD2  1 1 
        2  1981 1 1 40 LYS HD3  H -14.725   6.597   4.341 1.00 . A A . 40 LYS HD3  1 1 
        2  1982 1 1 40 LYS HE2  H -15.436   8.693   3.379 1.00 . A A . 40 LYS HE2  1 1 
        2  1983 1 1 40 LYS HE3  H -14.014   8.973   4.376 1.00 . A A . 40 LYS HE3  1 1 
        2  1984 1 1 40 LYS HG2  H -12.599   5.625   4.096 1.00 . A A . 40 LYS HG2  1 1 
        2  1985 1 1 40 LYS HG3  H -12.276   7.292   4.576 1.00 . A A . 40 LYS HG3  1 1 
        2  1986 1 1 40 LYS HZ1  H -12.662   9.152   2.443 1.00 . A A . 40 LYS HZ1  1 1 
        2  1987 1 1 40 LYS HZ2  H -14.009  10.147   2.211 1.00 . A A . 40 LYS HZ2  1 1 
        2  1988 1 1 40 LYS HZ3  H -13.921   8.653   1.430 1.00 . A A . 40 LYS HZ3  1 1 
        2  1989 1 1 40 LYS N    N -11.556   4.505   1.799 1.00 . A A . 40 LYS N    1 1 
        2  1990 1 1 40 LYS NZ   N -13.695   9.160   2.307 1.00 . A A . 40 LYS NZ   1 1 
        2  1991 1 1 40 LYS O    O -12.191   6.581  -0.858 1.00 . A A . 40 LYS O    1 1 
        2  1992 1 1 41 GLU C    C  -8.843   5.899  -1.963 1.00 . A A . 41 GLU C    1 1 
        2  1993 1 1 41 GLU CA   C  -9.459   7.005  -1.095 1.00 . A A . 41 GLU CA   1 1 
        2  1994 1 1 41 GLU CB   C  -8.371   7.996  -0.651 1.00 . A A . 41 GLU CB   1 1 
        2  1995 1 1 41 GLU CD   C -10.051   9.888  -0.375 1.00 . A A . 41 GLU CD   1 1 
        2  1996 1 1 41 GLU CG   C  -8.887   9.123   0.244 1.00 . A A . 41 GLU CG   1 1 
        2  1997 1 1 41 GLU H    H  -9.625   6.190   0.863 1.00 . A A . 41 GLU H    1 1 
        2  1998 1 1 41 GLU HA   H -10.187   7.538  -1.690 1.00 . A A . 41 GLU HA   1 1 
        2  1999 1 1 41 GLU HB2  H  -7.609   7.455  -0.105 1.00 . A A . 41 GLU HB2  1 1 
        2  2000 1 1 41 GLU HB3  H  -7.922   8.439  -1.530 1.00 . A A . 41 GLU HB3  1 1 
        2  2001 1 1 41 GLU HG2  H  -9.212   8.697   1.182 1.00 . A A . 41 GLU HG2  1 1 
        2  2002 1 1 41 GLU HG3  H  -8.078   9.816   0.430 1.00 . A A . 41 GLU HG3  1 1 
        2  2003 1 1 41 GLU N    N -10.150   6.460   0.080 1.00 . A A . 41 GLU N    1 1 
        2  2004 1 1 41 GLU O    O  -8.683   6.066  -3.171 1.00 . A A . 41 GLU O    1 1 
        2  2005 1 1 41 GLU OE1  O  -9.828  10.648  -1.338 1.00 . A A . 41 GLU OE1  1 1 
        2  2006 1 1 41 GLU OE2  O -11.198   9.736   0.103 1.00 . A A . 41 GLU OE2  1 1 
        2  2007 1 1 42 CYS C    C  -8.934   2.821  -2.817 1.00 . A A . 42 CYS C    1 1 
        2  2008 1 1 42 CYS CA   C  -7.881   3.654  -2.069 1.00 . A A . 42 CYS CA   1 1 
        2  2009 1 1 42 CYS CB   C  -7.101   2.755  -1.105 1.00 . A A . 42 CYS CB   1 1 
        2  2010 1 1 42 CYS H    H  -8.647   4.692  -0.379 1.00 . A A . 42 CYS H    1 1 
        2  2011 1 1 42 CYS HA   H  -7.192   4.068  -2.790 1.00 . A A . 42 CYS HA   1 1 
        2  2012 1 1 42 CYS HB2  H  -6.311   3.332  -0.647 1.00 . A A . 42 CYS HB2  1 1 
        2  2013 1 1 42 CYS HB3  H  -7.770   2.398  -0.333 1.00 . A A . 42 CYS HB3  1 1 
        2  2014 1 1 42 CYS HG   H  -5.501   0.768  -1.027 1.00 . A A . 42 CYS HG   1 1 
        2  2015 1 1 42 CYS N    N  -8.491   4.775  -1.344 1.00 . A A . 42 CYS N    1 1 
        2  2016 1 1 42 CYS O    O -10.010   2.541  -2.283 1.00 . A A . 42 CYS O    1 1 
        2  2017 1 1 42 CYS SG   S  -6.343   1.311  -1.894 1.00 . A A . 42 CYS SG   1 1 
        2  2018 1 1 43 PRO C    C  -9.739   0.164  -4.344 1.00 . A A . 43 PRO C    1 1 
        2  2019 1 1 43 PRO CA   C  -9.572   1.598  -4.878 1.00 . A A . 43 PRO CA   1 1 
        2  2020 1 1 43 PRO CB   C  -8.914   1.586  -6.266 1.00 . A A . 43 PRO CB   1 1 
        2  2021 1 1 43 PRO CD   C  -7.387   2.695  -4.799 1.00 . A A . 43 PRO CD   1 1 
        2  2022 1 1 43 PRO CG   C  -7.460   1.780  -5.993 1.00 . A A . 43 PRO CG   1 1 
        2  2023 1 1 43 PRO HA   H -10.543   2.068  -4.940 1.00 . A A . 43 PRO HA   1 1 
        2  2024 1 1 43 PRO HB2  H  -9.106   0.642  -6.757 1.00 . A A . 43 PRO HB2  1 1 
        2  2025 1 1 43 PRO HB3  H  -9.313   2.394  -6.863 1.00 . A A . 43 PRO HB3  1 1 
        2  2026 1 1 43 PRO HD2  H  -6.523   2.458  -4.193 1.00 . A A . 43 PRO HD2  1 1 
        2  2027 1 1 43 PRO HD3  H  -7.356   3.729  -5.114 1.00 . A A . 43 PRO HD3  1 1 
        2  2028 1 1 43 PRO HG2  H  -6.997   0.828  -5.770 1.00 . A A . 43 PRO HG2  1 1 
        2  2029 1 1 43 PRO HG3  H  -6.981   2.237  -6.848 1.00 . A A . 43 PRO HG3  1 1 
        2  2030 1 1 43 PRO N    N  -8.639   2.406  -4.069 1.00 . A A . 43 PRO N    1 1 
        2  2031 1 1 43 PRO O    O -10.640  -0.568  -4.764 1.00 . A A . 43 PRO O    1 1 
        2  2032 1 1 44 LEU C    C  -9.964  -1.640  -1.702 1.00 . A A . 44 LEU C    1 1 
        2  2033 1 1 44 LEU CA   C  -8.926  -1.575  -2.831 1.00 . A A . 44 LEU CA   1 1 
        2  2034 1 1 44 LEU CB   C  -7.553  -1.991  -2.290 1.00 . A A . 44 LEU CB   1 1 
        2  2035 1 1 44 LEU CD1  C  -5.117  -2.501  -2.666 1.00 . A A . 44 LEU CD1  1 1 
        2  2036 1 1 44 LEU CD2  C  -6.745  -2.729  -4.572 1.00 . A A . 44 LEU CD2  1 1 
        2  2037 1 1 44 LEU CG   C  -6.395  -1.954  -3.300 1.00 . A A . 44 LEU CG   1 1 
        2  2038 1 1 44 LEU H    H  -8.172   0.387  -3.120 1.00 . A A . 44 LEU H    1 1 
        2  2039 1 1 44 LEU HA   H  -9.216  -2.267  -3.611 1.00 . A A . 44 LEU HA   1 1 
        2  2040 1 1 44 LEU HB2  H  -7.304  -1.334  -1.467 1.00 . A A . 44 LEU HB2  1 1 
        2  2041 1 1 44 LEU HB3  H  -7.634  -3.000  -1.906 1.00 . A A . 44 LEU HB3  1 1 
        2  2042 1 1 44 LEU HD11 H  -4.316  -2.478  -3.390 1.00 . A A . 44 LEU HD11 1 1 
        2  2043 1 1 44 LEU HD12 H  -5.279  -3.518  -2.341 1.00 . A A . 44 LEU HD12 1 1 
        2  2044 1 1 44 LEU HD13 H  -4.848  -1.891  -1.814 1.00 . A A . 44 LEU HD13 1 1 
        2  2045 1 1 44 LEU HD21 H  -7.624  -2.298  -5.028 1.00 . A A . 44 LEU HD21 1 1 
        2  2046 1 1 44 LEU HD22 H  -6.939  -3.763  -4.325 1.00 . A A . 44 LEU HD22 1 1 
        2  2047 1 1 44 LEU HD23 H  -5.917  -2.675  -5.266 1.00 . A A . 44 LEU HD23 1 1 
        2  2048 1 1 44 LEU HG   H  -6.208  -0.926  -3.579 1.00 . A A . 44 LEU HG   1 1 
        2  2049 1 1 44 LEU N    N  -8.867  -0.237  -3.420 1.00 . A A . 44 LEU N    1 1 
        2  2050 1 1 44 LEU O    O  -9.847  -0.937  -0.696 1.00 . A A . 44 LEU O    1 1 
        2  2051 1 1 45 SER C    C -11.395  -3.311   0.422 1.00 . A A . 45 SER C    1 1 
        2  2052 1 1 45 SER CA   C -12.003  -2.685  -0.842 1.00 . A A . 45 SER CA   1 1 
        2  2053 1 1 45 SER CB   C -13.137  -3.577  -1.371 1.00 . A A . 45 SER CB   1 1 
        2  2054 1 1 45 SER H    H -11.049  -2.977  -2.720 1.00 . A A . 45 SER H    1 1 
        2  2055 1 1 45 SER HA   H -12.411  -1.716  -0.589 1.00 . A A . 45 SER HA   1 1 
        2  2056 1 1 45 SER HB2  H -13.620  -3.089  -2.204 1.00 . A A . 45 SER HB2  1 1 
        2  2057 1 1 45 SER HB3  H -12.725  -4.522  -1.700 1.00 . A A . 45 SER HB3  1 1 
        2  2058 1 1 45 SER HG   H -14.963  -4.021  -0.779 1.00 . A A . 45 SER HG   1 1 
        2  2059 1 1 45 SER N    N -10.980  -2.483  -1.876 1.00 . A A . 45 SER N    1 1 
        2  2060 1 1 45 SER O    O -10.639  -4.283   0.341 1.00 . A A . 45 SER O    1 1 
        2  2061 1 1 45 SER OG   O -14.108  -3.829  -0.365 1.00 . A A . 45 SER OG   1 1 
        2  2062 1 1 46 GLN C    C -11.305  -4.722   3.050 1.00 . A A . 46 GLN C    1 1 
        2  2063 1 1 46 GLN CA   C -11.181  -3.198   2.872 1.00 . A A . 46 GLN CA   1 1 
        2  2064 1 1 46 GLN CB   C -11.880  -2.444   4.023 1.00 . A A . 46 GLN CB   1 1 
        2  2065 1 1 46 GLN CD   C -11.507  -3.792   6.171 1.00 . A A . 46 GLN CD   1 1 
        2  2066 1 1 46 GLN CG   C -11.179  -2.530   5.385 1.00 . A A . 46 GLN CG   1 1 
        2  2067 1 1 46 GLN H    H -12.406  -2.036   1.581 1.00 . A A . 46 GLN H    1 1 
        2  2068 1 1 46 GLN HA   H -10.132  -2.938   2.873 1.00 . A A . 46 GLN HA   1 1 
        2  2069 1 1 46 GLN HB2  H -11.948  -1.400   3.753 1.00 . A A . 46 GLN HB2  1 1 
        2  2070 1 1 46 GLN HB3  H -12.882  -2.837   4.134 1.00 . A A . 46 GLN HB3  1 1 
        2  2071 1 1 46 GLN HE21 H  -9.940  -4.742   5.420 1.00 . A A . 46 GLN HE21 1 1 
        2  2072 1 1 46 GLN HE22 H -10.909  -5.640   6.534 1.00 . A A . 46 GLN HE22 1 1 
        2  2073 1 1 46 GLN HG2  H -10.110  -2.495   5.228 1.00 . A A . 46 GLN HG2  1 1 
        2  2074 1 1 46 GLN HG3  H -11.474  -1.674   5.975 1.00 . A A . 46 GLN HG3  1 1 
        2  2075 1 1 46 GLN N    N -11.745  -2.761   1.586 1.00 . A A . 46 GLN N    1 1 
        2  2076 1 1 46 GLN NE2  N -10.704  -4.826   6.027 1.00 . A A . 46 GLN NE2  1 1 
        2  2077 1 1 46 GLN O    O -10.351  -5.391   3.455 1.00 . A A . 46 GLN O    1 1 
        2  2078 1 1 46 GLN OE1  O -12.472  -3.830   6.925 1.00 . A A . 46 GLN OE1  1 1 
        2  2079 1 1 47 SER C    C -11.762  -7.481   1.849 1.00 . A A . 47 SER C    1 1 
        2  2080 1 1 47 SER CA   C -12.695  -6.717   2.805 1.00 . A A . 47 SER CA   1 1 
        2  2081 1 1 47 SER CB   C -14.156  -7.056   2.488 1.00 . A A . 47 SER CB   1 1 
        2  2082 1 1 47 SER H    H -13.205  -4.683   2.430 1.00 . A A . 47 SER H    1 1 
        2  2083 1 1 47 SER HA   H -12.477  -7.023   3.820 1.00 . A A . 47 SER HA   1 1 
        2  2084 1 1 47 SER HB2  H -14.320  -8.112   2.647 1.00 . A A . 47 SER HB2  1 1 
        2  2085 1 1 47 SER HB3  H -14.803  -6.492   3.145 1.00 . A A . 47 SER HB3  1 1 
        2  2086 1 1 47 SER HG   H -15.280  -7.248   0.900 1.00 . A A . 47 SER HG   1 1 
        2  2087 1 1 47 SER N    N -12.473  -5.266   2.725 1.00 . A A . 47 SER N    1 1 
        2  2088 1 1 47 SER O    O -11.193  -8.513   2.211 1.00 . A A . 47 SER O    1 1 
        2  2089 1 1 47 SER OG   O -14.492  -6.746   1.145 1.00 . A A . 47 SER OG   1 1 
        2  2090 1 1 48 MET C    C  -9.233  -7.379  -0.048 1.00 . A A . 48 MET C    1 1 
        2  2091 1 1 48 MET CA   C -10.727  -7.563  -0.378 1.00 . A A . 48 MET CA   1 1 
        2  2092 1 1 48 MET CB   C -11.049  -6.969  -1.755 1.00 . A A . 48 MET CB   1 1 
        2  2093 1 1 48 MET CE   C -11.979  -7.415  -4.868 1.00 . A A . 48 MET CE   1 1 
        2  2094 1 1 48 MET CG   C -12.512  -7.116  -2.155 1.00 . A A . 48 MET CG   1 1 
        2  2095 1 1 48 MET H    H -12.049  -6.108   0.428 1.00 . A A . 48 MET H    1 1 
        2  2096 1 1 48 MET HA   H -10.945  -8.622  -0.397 1.00 . A A . 48 MET HA   1 1 
        2  2097 1 1 48 MET HB2  H -10.806  -5.915  -1.748 1.00 . A A . 48 MET HB2  1 1 
        2  2098 1 1 48 MET HB3  H -10.443  -7.463  -2.501 1.00 . A A . 48 MET HB3  1 1 
        2  2099 1 1 48 MET HE1  H -12.335  -8.430  -4.767 1.00 . A A . 48 MET HE1  1 1 
        2  2100 1 1 48 MET HE2  H -10.926  -7.376  -4.632 1.00 . A A . 48 MET HE2  1 1 
        2  2101 1 1 48 MET HE3  H -12.133  -7.080  -5.882 1.00 . A A . 48 MET HE3  1 1 
        2  2102 1 1 48 MET HG2  H -12.753  -8.168  -2.214 1.00 . A A . 48 MET HG2  1 1 
        2  2103 1 1 48 MET HG3  H -13.128  -6.651  -1.397 1.00 . A A . 48 MET HG3  1 1 
        2  2104 1 1 48 MET N    N -11.587  -6.945   0.641 1.00 . A A . 48 MET N    1 1 
        2  2105 1 1 48 MET O    O  -8.355  -7.807  -0.805 1.00 . A A . 48 MET O    1 1 
        2  2106 1 1 48 MET SD   S -12.883  -6.350  -3.746 1.00 . A A . 48 MET SD   1 1 
        2  2107 1 1 49 ILE C    C  -7.486  -7.564   2.846 1.00 . A A . 49 ILE C    1 1 
        2  2108 1 1 49 ILE CA   C  -7.610  -6.622   1.636 1.00 . A A . 49 ILE CA   1 1 
        2  2109 1 1 49 ILE CB   C  -7.275  -5.179   2.090 1.00 . A A . 49 ILE CB   1 1 
        2  2110 1 1 49 ILE CD1  C  -7.225  -2.744   1.310 1.00 . A A . 49 ILE CD1  1 1 
        2  2111 1 1 49 ILE CG1  C  -7.423  -4.195   0.918 1.00 . A A . 49 ILE CG1  1 1 
        2  2112 1 1 49 ILE CG2  C  -5.866  -5.107   2.685 1.00 . A A . 49 ILE CG2  1 1 
        2  2113 1 1 49 ILE H    H  -9.687  -6.216   1.510 1.00 . A A . 49 ILE H    1 1 
        2  2114 1 1 49 ILE HA   H  -6.899  -6.920   0.876 1.00 . A A . 49 ILE HA   1 1 
        2  2115 1 1 49 ILE HB   H  -7.978  -4.903   2.867 1.00 . A A . 49 ILE HB   1 1 
        2  2116 1 1 49 ILE HD11 H  -7.359  -2.115   0.441 1.00 . A A . 49 ILE HD11 1 1 
        2  2117 1 1 49 ILE HD12 H  -6.229  -2.608   1.702 1.00 . A A . 49 ILE HD12 1 1 
        2  2118 1 1 49 ILE HD13 H  -7.949  -2.471   2.065 1.00 . A A . 49 ILE HD13 1 1 
        2  2119 1 1 49 ILE HG12 H  -6.695  -4.434   0.157 1.00 . A A . 49 ILE HG12 1 1 
        2  2120 1 1 49 ILE HG13 H  -8.415  -4.292   0.500 1.00 . A A . 49 ILE HG13 1 1 
        2  2121 1 1 49 ILE HG21 H  -5.798  -5.771   3.535 1.00 . A A . 49 ILE HG21 1 1 
        2  2122 1 1 49 ILE HG22 H  -5.661  -4.094   3.005 1.00 . A A . 49 ILE HG22 1 1 
        2  2123 1 1 49 ILE HG23 H  -5.141  -5.403   1.940 1.00 . A A . 49 ILE HG23 1 1 
        2  2124 1 1 49 ILE N    N  -8.960  -6.700   1.066 1.00 . A A . 49 ILE N    1 1 
        2  2125 1 1 49 ILE O    O  -6.452  -8.205   3.054 1.00 . A A . 49 ILE O    1 1 
        2  2126 1 1 50 SER C    C  -8.203  -9.910   4.621 1.00 . A A . 50 SER C    1 1 
        2  2127 1 1 50 SER CA   C  -8.595  -8.446   4.871 1.00 . A A . 50 SER CA   1 1 
        2  2128 1 1 50 SER CB   C  -9.992  -8.388   5.507 1.00 . A A . 50 SER CB   1 1 
        2  2129 1 1 50 SER H    H  -9.369  -7.147   3.374 1.00 . A A . 50 SER H    1 1 
        2  2130 1 1 50 SER HA   H  -7.885  -8.012   5.559 1.00 . A A . 50 SER HA   1 1 
        2  2131 1 1 50 SER HB2  H -10.249  -7.360   5.713 1.00 . A A . 50 SER HB2  1 1 
        2  2132 1 1 50 SER HB3  H -10.717  -8.808   4.822 1.00 . A A . 50 SER HB3  1 1 
        2  2133 1 1 50 SER HG   H -10.567  -8.629   7.369 1.00 . A A . 50 SER HG   1 1 
        2  2134 1 1 50 SER N    N  -8.564  -7.643   3.632 1.00 . A A . 50 SER N    1 1 
        2  2135 1 1 50 SER O    O  -7.284 -10.433   5.255 1.00 . A A . 50 SER O    1 1 
        2  2136 1 1 50 SER OG   O -10.042  -9.117   6.722 1.00 . A A . 50 SER OG   1 1 
        2  2137 1 1 51 SER C    C  -7.163 -12.202   2.908 1.00 . A A . 51 SER C    1 1 
        2  2138 1 1 51 SER CA   C  -8.616 -11.970   3.352 1.00 . A A . 51 SER CA   1 1 
        2  2139 1 1 51 SER CB   C  -9.574 -12.456   2.258 1.00 . A A . 51 SER CB   1 1 
        2  2140 1 1 51 SER H    H  -9.601 -10.087   3.204 1.00 . A A . 51 SER H    1 1 
        2  2141 1 1 51 SER HA   H  -8.795 -12.550   4.248 1.00 . A A . 51 SER HA   1 1 
        2  2142 1 1 51 SER HB2  H  -9.486 -11.817   1.392 1.00 . A A . 51 SER HB2  1 1 
        2  2143 1 1 51 SER HB3  H  -9.320 -13.471   1.984 1.00 . A A . 51 SER HB3  1 1 
        2  2144 1 1 51 SER HG   H -10.997 -12.954   3.518 1.00 . A A . 51 SER HG   1 1 
        2  2145 1 1 51 SER N    N  -8.887 -10.559   3.682 1.00 . A A . 51 SER N    1 1 
        2  2146 1 1 51 SER O    O  -6.665 -13.329   2.955 1.00 . A A . 51 SER O    1 1 
        2  2147 1 1 51 SER OG   O -10.922 -12.431   2.708 1.00 . A A . 51 SER OG   1 1 
        2  2148 1 1 52 ILE C    C  -4.142 -11.166   3.291 1.00 . A A . 52 ILE C    1 1 
        2  2149 1 1 52 ILE CA   C  -5.078 -11.223   2.070 1.00 . A A . 52 ILE CA   1 1 
        2  2150 1 1 52 ILE CB   C  -4.706 -10.088   1.078 1.00 . A A . 52 ILE CB   1 1 
        2  2151 1 1 52 ILE CD1  C  -5.340  -9.051  -1.181 1.00 . A A . 52 ILE CD1  1 1 
        2  2152 1 1 52 ILE CG1  C  -5.607 -10.150  -0.169 1.00 . A A . 52 ILE CG1  1 1 
        2  2153 1 1 52 ILE CG2  C  -3.230 -10.175   0.687 1.00 . A A . 52 ILE CG2  1 1 
        2  2154 1 1 52 ILE H    H  -6.942 -10.271   2.431 1.00 . A A . 52 ILE H    1 1 
        2  2155 1 1 52 ILE HA   H  -4.935 -12.171   1.567 1.00 . A A . 52 ILE HA   1 1 
        2  2156 1 1 52 ILE HB   H  -4.863  -9.140   1.576 1.00 . A A . 52 ILE HB   1 1 
        2  2157 1 1 52 ILE HD11 H  -4.329  -9.139  -1.558 1.00 . A A . 52 ILE HD11 1 1 
        2  2158 1 1 52 ILE HD12 H  -5.464  -8.087  -0.709 1.00 . A A . 52 ILE HD12 1 1 
        2  2159 1 1 52 ILE HD13 H  -6.037  -9.142  -2.001 1.00 . A A . 52 ILE HD13 1 1 
        2  2160 1 1 52 ILE HG12 H  -5.458 -11.097  -0.669 1.00 . A A . 52 ILE HG12 1 1 
        2  2161 1 1 52 ILE HG13 H  -6.641 -10.073   0.138 1.00 . A A . 52 ILE HG13 1 1 
        2  2162 1 1 52 ILE HG21 H  -3.042 -11.116   0.190 1.00 . A A . 52 ILE HG21 1 1 
        2  2163 1 1 52 ILE HG22 H  -2.617 -10.109   1.575 1.00 . A A . 52 ILE HG22 1 1 
        2  2164 1 1 52 ILE HG23 H  -2.983  -9.360   0.021 1.00 . A A . 52 ILE HG23 1 1 
        2  2165 1 1 52 ILE N    N  -6.486 -11.137   2.477 1.00 . A A . 52 ILE N    1 1 
        2  2166 1 1 52 ILE O    O  -3.320 -12.063   3.502 1.00 . A A . 52 ILE O    1 1 
        2  2167 1 1 53 VAL C    C  -3.738 -11.038   6.350 1.00 . A A . 53 VAL C    1 1 
        2  2168 1 1 53 VAL CA   C  -3.448  -9.945   5.305 1.00 . A A . 53 VAL CA   1 1 
        2  2169 1 1 53 VAL CB   C  -3.653  -8.548   5.948 1.00 . A A . 53 VAL CB   1 1 
        2  2170 1 1 53 VAL CG1  C  -3.290  -7.440   4.960 1.00 . A A . 53 VAL CG1  1 1 
        2  2171 1 1 53 VAL CG2  C  -5.087  -8.377   6.454 1.00 . A A . 53 VAL CG2  1 1 
        2  2172 1 1 53 VAL H    H  -4.957  -9.436   3.890 1.00 . A A . 53 VAL H    1 1 
        2  2173 1 1 53 VAL HA   H  -2.412 -10.028   4.999 1.00 . A A . 53 VAL HA   1 1 
        2  2174 1 1 53 VAL HB   H  -2.986  -8.467   6.796 1.00 . A A . 53 VAL HB   1 1 
        2  2175 1 1 53 VAL HG11 H  -3.914  -7.521   4.082 1.00 . A A . 53 VAL HG11 1 1 
        2  2176 1 1 53 VAL HG12 H  -2.252  -7.535   4.672 1.00 . A A . 53 VAL HG12 1 1 
        2  2177 1 1 53 VAL HG13 H  -3.446  -6.478   5.424 1.00 . A A . 53 VAL HG13 1 1 
        2  2178 1 1 53 VAL HG21 H  -5.307  -9.139   7.187 1.00 . A A . 53 VAL HG21 1 1 
        2  2179 1 1 53 VAL HG22 H  -5.775  -8.465   5.627 1.00 . A A . 53 VAL HG22 1 1 
        2  2180 1 1 53 VAL HG23 H  -5.195  -7.402   6.908 1.00 . A A . 53 VAL HG23 1 1 
        2  2181 1 1 53 VAL N    N  -4.280 -10.113   4.102 1.00 . A A . 53 VAL N    1 1 
        2  2182 1 1 53 VAL O    O  -2.897 -11.338   7.203 1.00 . A A . 53 VAL O    1 1 
        2  2183 1 1 54 ASN C    C  -4.286 -13.877   7.118 1.00 . A A . 54 ASN C    1 1 
        2  2184 1 1 54 ASN CA   C  -5.336 -12.743   7.131 1.00 . A A . 54 ASN CA   1 1 
        2  2185 1 1 54 ASN CB   C  -6.696 -13.267   6.657 1.00 . A A . 54 ASN CB   1 1 
        2  2186 1 1 54 ASN CG   C  -7.071 -14.582   7.298 1.00 . A A . 54 ASN CG   1 1 
        2  2187 1 1 54 ASN H    H  -5.585 -11.268   5.626 1.00 . A A . 54 ASN H    1 1 
        2  2188 1 1 54 ASN HA   H  -5.436 -12.369   8.140 1.00 . A A . 54 ASN HA   1 1 
        2  2189 1 1 54 ASN HB2  H  -7.458 -12.540   6.898 1.00 . A A . 54 ASN HB2  1 1 
        2  2190 1 1 54 ASN HB3  H  -6.667 -13.405   5.585 1.00 . A A . 54 ASN HB3  1 1 
        2  2191 1 1 54 ASN HD21 H  -7.930 -13.644   8.809 1.00 . A A . 54 ASN HD21 1 1 
        2  2192 1 1 54 ASN HD22 H  -7.973 -15.369   8.867 1.00 . A A . 54 ASN HD22 1 1 
        2  2193 1 1 54 ASN N    N  -4.936 -11.617   6.274 1.00 . A A . 54 ASN N    1 1 
        2  2194 1 1 54 ASN ND2  N  -7.722 -14.526   8.437 1.00 . A A . 54 ASN ND2  1 1 
        2  2195 1 1 54 ASN O    O  -3.984 -14.476   8.154 1.00 . A A . 54 ASN O    1 1 
        2  2196 1 1 54 ASN OD1  O  -6.765 -15.643   6.772 1.00 . A A . 54 ASN OD1  1 1 
        2  2197 1 1 55 SER C    C  -2.913 -16.566   6.068 1.00 . A A . 55 SER C    1 1 
        2  2198 1 1 55 SER CA   C  -2.609 -15.086   5.759 1.00 . A A . 55 SER CA   1 1 
        2  2199 1 1 55 SER CB   C  -1.422 -14.616   6.617 1.00 . A A . 55 SER CB   1 1 
        2  2200 1 1 55 SER H    H  -4.155 -13.766   5.129 1.00 . A A . 55 SER H    1 1 
        2  2201 1 1 55 SER HA   H  -2.313 -15.022   4.722 1.00 . A A . 55 SER HA   1 1 
        2  2202 1 1 55 SER HB2  H  -1.698 -14.653   7.663 1.00 . A A . 55 SER HB2  1 1 
        2  2203 1 1 55 SER HB3  H  -0.575 -15.267   6.447 1.00 . A A . 55 SER HB3  1 1 
        2  2204 1 1 55 SER HG   H  -1.482 -12.673   6.903 1.00 . A A . 55 SER HG   1 1 
        2  2205 1 1 55 SER N    N  -3.763 -14.177   5.927 1.00 . A A . 55 SER N    1 1 
        2  2206 1 1 55 SER O    O  -2.000 -17.393   6.055 1.00 . A A . 55 SER O    1 1 
        2  2207 1 1 55 SER OG   O  -1.048 -13.284   6.292 1.00 . A A . 55 SER OG   1 1 
        2  2208 1 1 56 THR C    C  -5.019 -19.012   5.281 1.00 . A A . 56 THR C    1 1 
        2  2209 1 1 56 THR CA   C  -4.523 -18.338   6.567 1.00 . A A . 56 THR CA   1 1 
        2  2210 1 1 56 THR CB   C  -5.600 -18.529   7.664 1.00 . A A . 56 THR CB   1 1 
        2  2211 1 1 56 THR CG2  C  -5.260 -17.724   8.912 1.00 . A A . 56 THR CG2  1 1 
        2  2212 1 1 56 THR H    H  -4.866 -16.228   6.406 1.00 . A A . 56 THR H    1 1 
        2  2213 1 1 56 THR HA   H  -3.625 -18.849   6.892 1.00 . A A . 56 THR HA   1 1 
        2  2214 1 1 56 THR HB   H  -5.632 -19.577   7.931 1.00 . A A . 56 THR HB   1 1 
        2  2215 1 1 56 THR HG1  H  -7.208 -17.371   7.675 1.00 . A A . 56 THR HG1  1 1 
        2  2216 1 1 56 THR HG21 H  -6.017 -17.889   9.665 1.00 . A A . 56 THR HG21 1 1 
        2  2217 1 1 56 THR HG22 H  -5.221 -16.674   8.666 1.00 . A A . 56 THR HG22 1 1 
        2  2218 1 1 56 THR HG23 H  -4.298 -18.040   9.293 1.00 . A A . 56 THR HG23 1 1 
        2  2219 1 1 56 THR N    N  -4.171 -16.919   6.337 1.00 . A A . 56 THR N    1 1 
        2  2220 1 1 56 THR O    O  -4.726 -20.181   5.029 1.00 . A A . 56 THR O    1 1 
        2  2221 1 1 56 THR OG1  O  -6.893 -18.139   7.177 1.00 . A A . 56 THR OG1  1 1 
        2  2222 1 1 57 TYR C    C  -6.069 -17.795   2.039 1.00 . A A . 57 TYR C    1 1 
        2  2223 1 1 57 TYR CA   C  -6.289 -18.792   3.194 1.00 . A A . 57 TYR CA   1 1 
        2  2224 1 1 57 TYR CB   C  -7.785 -19.128   3.325 1.00 . A A . 57 TYR CB   1 1 
        2  2225 1 1 57 TYR CD1  C  -8.834 -17.457   4.919 1.00 . A A . 57 TYR CD1  1 1 
        2  2226 1 1 57 TYR CD2  C  -9.389 -17.295   2.606 1.00 . A A . 57 TYR CD2  1 1 
        2  2227 1 1 57 TYR CE1  C  -9.653 -16.380   5.196 1.00 . A A . 57 TYR CE1  1 1 
        2  2228 1 1 57 TYR CE2  C -10.212 -16.218   2.875 1.00 . A A . 57 TYR CE2  1 1 
        2  2229 1 1 57 TYR CG   C  -8.684 -17.935   3.622 1.00 . A A . 57 TYR CG   1 1 
        2  2230 1 1 57 TYR CZ   C -10.341 -15.764   4.171 1.00 . A A . 57 TYR CZ   1 1 
        2  2231 1 1 57 TYR H    H  -6.021 -17.365   4.752 1.00 . A A . 57 TYR H    1 1 
        2  2232 1 1 57 TYR HA   H  -5.750 -19.701   2.966 1.00 . A A . 57 TYR HA   1 1 
        2  2233 1 1 57 TYR HB2  H  -8.126 -19.572   2.400 1.00 . A A . 57 TYR HB2  1 1 
        2  2234 1 1 57 TYR HB3  H  -7.913 -19.845   4.123 1.00 . A A . 57 TYR HB3  1 1 
        2  2235 1 1 57 TYR HD1  H  -8.295 -17.940   5.720 1.00 . A A . 57 TYR HD1  1 1 
        2  2236 1 1 57 TYR HD2  H  -9.285 -17.649   1.591 1.00 . A A . 57 TYR HD2  1 1 
        2  2237 1 1 57 TYR HE1  H  -9.753 -16.024   6.213 1.00 . A A . 57 TYR HE1  1 1 
        2  2238 1 1 57 TYR HE2  H -10.751 -15.736   2.072 1.00 . A A . 57 TYR HE2  1 1 
        2  2239 1 1 57 TYR HH   H -12.021 -14.837   4.015 1.00 . A A . 57 TYR HH   1 1 
        2  2240 1 1 57 TYR N    N  -5.776 -18.271   4.472 1.00 . A A . 57 TYR N    1 1 
        2  2241 1 1 57 TYR O    O  -6.751 -17.861   1.015 1.00 . A A . 57 TYR O    1 1 
        2  2242 1 1 57 TYR OH   O -11.167 -14.693   4.443 1.00 . A A . 57 TYR OH   1 1 
        2  2243 1 1 58 TYR C    C  -4.517 -16.458  -0.190 1.00 . A A . 58 TYR C    1 1 
        2  2244 1 1 58 TYR CA   C  -4.845 -15.849   1.188 1.00 . A A . 58 TYR CA   1 1 
        2  2245 1 1 58 TYR CB   C  -3.716 -14.906   1.650 1.00 . A A . 58 TYR CB   1 1 
        2  2246 1 1 58 TYR CD1  C  -1.941 -16.478   2.570 1.00 . A A . 58 TYR CD1  1 1 
        2  2247 1 1 58 TYR CD2  C  -1.379 -15.129   0.682 1.00 . A A . 58 TYR CD2  1 1 
        2  2248 1 1 58 TYR CE1  C  -0.671 -17.028   2.555 1.00 . A A . 58 TYR CE1  1 1 
        2  2249 1 1 58 TYR CE2  C  -0.110 -15.676   0.663 1.00 . A A . 58 TYR CE2  1 1 
        2  2250 1 1 58 TYR CG   C  -2.319 -15.518   1.635 1.00 . A A . 58 TYR CG   1 1 
        2  2251 1 1 58 TYR CZ   C   0.240 -16.624   1.599 1.00 . A A . 58 TYR CZ   1 1 
        2  2252 1 1 58 TYR H    H  -4.535 -16.930   2.993 1.00 . A A . 58 TYR H    1 1 
        2  2253 1 1 58 TYR HA   H  -5.755 -15.272   1.094 1.00 . A A . 58 TYR HA   1 1 
        2  2254 1 1 58 TYR HB2  H  -3.701 -14.037   1.008 1.00 . A A . 58 TYR HB2  1 1 
        2  2255 1 1 58 TYR HB3  H  -3.925 -14.584   2.662 1.00 . A A . 58 TYR HB3  1 1 
        2  2256 1 1 58 TYR HD1  H  -2.654 -16.792   3.318 1.00 . A A . 58 TYR HD1  1 1 
        2  2257 1 1 58 TYR HD2  H  -1.653 -14.385  -0.052 1.00 . A A . 58 TYR HD2  1 1 
        2  2258 1 1 58 TYR HE1  H  -0.398 -17.772   3.288 1.00 . A A . 58 TYR HE1  1 1 
        2  2259 1 1 58 TYR HE2  H   0.603 -15.359  -0.085 1.00 . A A . 58 TYR HE2  1 1 
        2  2260 1 1 58 TYR HH   H   1.437 -18.129   1.695 1.00 . A A . 58 TYR HH   1 1 
        2  2261 1 1 58 TYR N    N  -5.097 -16.893   2.194 1.00 . A A . 58 TYR N    1 1 
        2  2262 1 1 58 TYR O    O  -3.534 -17.181  -0.351 1.00 . A A . 58 TYR O    1 1 
        2  2263 1 1 58 TYR OH   O   1.504 -17.174   1.578 1.00 . A A . 58 TYR OH   1 1 
        2  2264 1 1 59 ALA C    C  -4.336 -15.726  -3.390 1.00 . A A . 59 ALA C    1 1 
        2  2265 1 1 59 ALA CA   C  -5.168 -16.692  -2.537 1.00 . A A . 59 ALA CA   1 1 
        2  2266 1 1 59 ALA CB   C  -6.520 -16.953  -3.198 1.00 . A A . 59 ALA CB   1 1 
        2  2267 1 1 59 ALA H    H  -6.130 -15.602  -0.991 1.00 . A A . 59 ALA H    1 1 
        2  2268 1 1 59 ALA HA   H  -4.643 -17.636  -2.465 1.00 . A A . 59 ALA HA   1 1 
        2  2269 1 1 59 ALA HB1  H  -7.038 -16.016  -3.345 1.00 . A A . 59 ALA HB1  1 1 
        2  2270 1 1 59 ALA HB2  H  -7.113 -17.596  -2.565 1.00 . A A . 59 ALA HB2  1 1 
        2  2271 1 1 59 ALA HB3  H  -6.367 -17.433  -4.155 1.00 . A A . 59 ALA HB3  1 1 
        2  2272 1 1 59 ALA N    N  -5.360 -16.175  -1.178 1.00 . A A . 59 ALA N    1 1 
        2  2273 1 1 59 ALA O    O  -4.360 -14.511  -3.174 1.00 . A A . 59 ALA O    1 1 
        2  2274 1 1 60 ASN C    C  -3.687 -14.751  -6.316 1.00 . A A . 60 ASN C    1 1 
        2  2275 1 1 60 ASN CA   C  -2.795 -15.429  -5.258 1.00 . A A . 60 ASN CA   1 1 
        2  2276 1 1 60 ASN CB   C  -1.699 -16.269  -5.930 1.00 . A A . 60 ASN CB   1 1 
        2  2277 1 1 60 ASN CG   C  -0.649 -15.411  -6.612 1.00 . A A . 60 ASN CG   1 1 
        2  2278 1 1 60 ASN H    H  -3.623 -17.233  -4.504 1.00 . A A . 60 ASN H    1 1 
        2  2279 1 1 60 ASN HA   H  -2.327 -14.659  -4.657 1.00 . A A . 60 ASN HA   1 1 
        2  2280 1 1 60 ASN HB2  H  -1.212 -16.879  -5.184 1.00 . A A . 60 ASN HB2  1 1 
        2  2281 1 1 60 ASN HB3  H  -2.151 -16.912  -6.672 1.00 . A A . 60 ASN HB3  1 1 
        2  2282 1 1 60 ASN HD21 H   0.444 -15.377  -4.964 1.00 . A A . 60 ASN HD21 1 1 
        2  2283 1 1 60 ASN HD22 H   1.087 -14.512  -6.313 1.00 . A A . 60 ASN HD22 1 1 
        2  2284 1 1 60 ASN N    N  -3.607 -16.260  -4.368 1.00 . A A . 60 ASN N    1 1 
        2  2285 1 1 60 ASN ND2  N   0.397 -15.066  -5.889 1.00 . A A . 60 ASN ND2  1 1 
        2  2286 1 1 60 ASN O    O  -3.683 -15.120  -7.491 1.00 . A A . 60 ASN O    1 1 
        2  2287 1 1 60 ASN OD1  O  -0.771 -15.059  -7.780 1.00 . A A . 60 ASN OD1  1 1 
        2  2288 1 1 61 VAL C    C  -4.691 -12.266  -7.843 1.00 . A A . 61 VAL C    1 1 
        2  2289 1 1 61 VAL CA   C  -5.412 -13.062  -6.742 1.00 . A A . 61 VAL CA   1 1 
        2  2290 1 1 61 VAL CB   C  -6.311 -12.107  -5.916 1.00 . A A . 61 VAL CB   1 1 
        2  2291 1 1 61 VAL CG1  C  -7.250 -12.899  -5.006 1.00 . A A . 61 VAL CG1  1 1 
        2  2292 1 1 61 VAL CG2  C  -5.460 -11.137  -5.097 1.00 . A A . 61 VAL CG2  1 1 
        2  2293 1 1 61 VAL H    H  -4.456 -13.558  -4.912 1.00 . A A . 61 VAL H    1 1 
        2  2294 1 1 61 VAL HA   H  -6.052 -13.795  -7.214 1.00 . A A . 61 VAL HA   1 1 
        2  2295 1 1 61 VAL HB   H  -6.917 -11.529  -6.603 1.00 . A A . 61 VAL HB   1 1 
        2  2296 1 1 61 VAL HG11 H  -6.668 -13.498  -4.320 1.00 . A A . 61 VAL HG11 1 1 
        2  2297 1 1 61 VAL HG12 H  -7.875 -13.546  -5.606 1.00 . A A . 61 VAL HG12 1 1 
        2  2298 1 1 61 VAL HG13 H  -7.873 -12.215  -4.449 1.00 . A A . 61 VAL HG13 1 1 
        2  2299 1 1 61 VAL HG21 H  -6.105 -10.476  -4.537 1.00 . A A . 61 VAL HG21 1 1 
        2  2300 1 1 61 VAL HG22 H  -4.836 -10.553  -5.759 1.00 . A A . 61 VAL HG22 1 1 
        2  2301 1 1 61 VAL HG23 H  -4.834 -11.694  -4.412 1.00 . A A . 61 VAL HG23 1 1 
        2  2302 1 1 61 VAL N    N  -4.482 -13.784  -5.868 1.00 . A A . 61 VAL N    1 1 
        2  2303 1 1 61 VAL O    O  -3.482 -12.016  -7.764 1.00 . A A . 61 VAL O    1 1 
        2  2304 1 1 62 SER C    C  -4.031  -9.957  -9.653 1.00 . A A . 62 SER C    1 1 
        2  2305 1 1 62 SER CA   C  -4.907 -11.161 -10.036 1.00 . A A . 62 SER CA   1 1 
        2  2306 1 1 62 SER CB   C  -6.047 -10.694 -10.955 1.00 . A A . 62 SER CB   1 1 
        2  2307 1 1 62 SER H    H  -6.414 -12.054  -8.835 1.00 . A A . 62 SER H    1 1 
        2  2308 1 1 62 SER HA   H  -4.296 -11.868 -10.581 1.00 . A A . 62 SER HA   1 1 
        2  2309 1 1 62 SER HB2  H  -6.705 -10.035 -10.406 1.00 . A A . 62 SER HB2  1 1 
        2  2310 1 1 62 SER HB3  H  -5.633 -10.164 -11.801 1.00 . A A . 62 SER HB3  1 1 
        2  2311 1 1 62 SER HG   H  -7.001 -11.663 -12.373 1.00 . A A . 62 SER HG   1 1 
        2  2312 1 1 62 SER N    N  -5.452 -11.864  -8.864 1.00 . A A . 62 SER N    1 1 
        2  2313 1 1 62 SER O    O  -4.273  -9.285  -8.646 1.00 . A A . 62 SER O    1 1 
        2  2314 1 1 62 SER OG   O  -6.807 -11.794 -11.435 1.00 . A A . 62 SER OG   1 1 
        2  2315 1 1 63 ALA C    C  -2.825  -7.219 -10.193 1.00 . A A . 63 ALA C    1 1 
        2  2316 1 1 63 ALA CA   C  -2.093  -8.568 -10.251 1.00 . A A . 63 ALA CA   1 1 
        2  2317 1 1 63 ALA CB   C  -1.024  -8.537 -11.338 1.00 . A A . 63 ALA CB   1 1 
        2  2318 1 1 63 ALA H    H  -2.871 -10.272 -11.253 1.00 . A A . 63 ALA H    1 1 
        2  2319 1 1 63 ALA HA   H  -1.598  -8.734  -9.304 1.00 . A A . 63 ALA HA   1 1 
        2  2320 1 1 63 ALA HB1  H  -0.319  -7.744 -11.132 1.00 . A A . 63 ALA HB1  1 1 
        2  2321 1 1 63 ALA HB2  H  -1.490  -8.363 -12.298 1.00 . A A . 63 ALA HB2  1 1 
        2  2322 1 1 63 ALA HB3  H  -0.505  -9.483 -11.359 1.00 . A A . 63 ALA HB3  1 1 
        2  2323 1 1 63 ALA N    N  -3.014  -9.690 -10.475 1.00 . A A . 63 ALA N    1 1 
        2  2324 1 1 63 ALA O    O  -2.311  -6.254  -9.633 1.00 . A A . 63 ALA O    1 1 
        2  2325 1 1 64 ALA C    C  -5.024  -5.398  -9.312 1.00 . A A . 64 ALA C    1 1 
        2  2326 1 1 64 ALA CA   C  -4.850  -5.944 -10.741 1.00 . A A . 64 ALA CA   1 1 
        2  2327 1 1 64 ALA CB   C  -6.211  -6.215 -11.369 1.00 . A A . 64 ALA CB   1 1 
        2  2328 1 1 64 ALA H    H  -4.359  -7.951 -11.248 1.00 . A A . 64 ALA H    1 1 
        2  2329 1 1 64 ALA HA   H  -4.350  -5.196 -11.341 1.00 . A A . 64 ALA HA   1 1 
        2  2330 1 1 64 ALA HB1  H  -6.079  -6.581 -12.376 1.00 . A A . 64 ALA HB1  1 1 
        2  2331 1 1 64 ALA HB2  H  -6.785  -5.299 -11.395 1.00 . A A . 64 ALA HB2  1 1 
        2  2332 1 1 64 ALA HB3  H  -6.741  -6.954 -10.784 1.00 . A A . 64 ALA HB3  1 1 
        2  2333 1 1 64 ALA N    N  -4.024  -7.161 -10.772 1.00 . A A . 64 ALA N    1 1 
        2  2334 1 1 64 ALA O    O  -5.011  -4.187  -9.098 1.00 . A A . 64 ALA O    1 1 
        2  2335 1 1 65 LYS C    C  -4.083  -5.116  -6.441 1.00 . A A . 65 LYS C    1 1 
        2  2336 1 1 65 LYS CA   C  -5.306  -5.919  -6.924 1.00 . A A . 65 LYS CA   1 1 
        2  2337 1 1 65 LYS CB   C  -5.468  -7.177  -6.055 1.00 . A A . 65 LYS CB   1 1 
        2  2338 1 1 65 LYS CD   C  -8.004  -7.504  -5.991 1.00 . A A . 65 LYS CD   1 1 
        2  2339 1 1 65 LYS CE   C  -8.305  -7.825  -4.523 1.00 . A A . 65 LYS CE   1 1 
        2  2340 1 1 65 LYS CG   C  -6.652  -8.063  -6.452 1.00 . A A . 65 LYS CG   1 1 
        2  2341 1 1 65 LYS H    H  -5.188  -7.254  -8.580 1.00 . A A . 65 LYS H    1 1 
        2  2342 1 1 65 LYS HA   H  -6.190  -5.304  -6.826 1.00 . A A . 65 LYS HA   1 1 
        2  2343 1 1 65 LYS HB2  H  -4.567  -7.769  -6.131 1.00 . A A . 65 LYS HB2  1 1 
        2  2344 1 1 65 LYS HB3  H  -5.602  -6.876  -5.024 1.00 . A A . 65 LYS HB3  1 1 
        2  2345 1 1 65 LYS HD2  H  -8.001  -6.430  -6.115 1.00 . A A . 65 LYS HD2  1 1 
        2  2346 1 1 65 LYS HD3  H  -8.783  -7.932  -6.608 1.00 . A A . 65 LYS HD3  1 1 
        2  2347 1 1 65 LYS HE2  H  -9.359  -7.667  -4.346 1.00 . A A . 65 LYS HE2  1 1 
        2  2348 1 1 65 LYS HE3  H  -8.068  -8.863  -4.338 1.00 . A A . 65 LYS HE3  1 1 
        2  2349 1 1 65 LYS HG2  H  -6.667  -8.157  -7.530 1.00 . A A . 65 LYS HG2  1 1 
        2  2350 1 1 65 LYS HG3  H  -6.511  -9.043  -6.014 1.00 . A A . 65 LYS HG3  1 1 
        2  2351 1 1 65 LYS HZ1  H  -6.519  -7.066  -3.751 1.00 . A A . 65 LYS HZ1  1 1 
        2  2352 1 1 65 LYS HZ2  H  -7.736  -7.270  -2.592 1.00 . A A . 65 LYS HZ2  1 1 
        2  2353 1 1 65 LYS HZ3  H  -7.814  -5.979  -3.684 1.00 . A A . 65 LYS HZ3  1 1 
        2  2354 1 1 65 LYS N    N  -5.171  -6.302  -8.340 1.00 . A A . 65 LYS N    1 1 
        2  2355 1 1 65 LYS NZ   N  -7.536  -6.977  -3.572 1.00 . A A . 65 LYS NZ   1 1 
        2  2356 1 1 65 LYS O    O  -4.172  -4.332  -5.497 1.00 . A A . 65 LYS O    1 1 
        2  2357 1 1 66 CYS C    C  -1.492  -3.400  -7.665 1.00 . A A . 66 CYS C    1 1 
        2  2358 1 1 66 CYS CA   C  -1.697  -4.630  -6.768 1.00 . A A . 66 CYS CA   1 1 
        2  2359 1 1 66 CYS CB   C  -0.504  -5.579  -6.926 1.00 . A A . 66 CYS CB   1 1 
        2  2360 1 1 66 CYS H    H  -2.942  -5.990  -7.821 1.00 . A A . 66 CYS H    1 1 
        2  2361 1 1 66 CYS HA   H  -1.753  -4.307  -5.738 1.00 . A A . 66 CYS HA   1 1 
        2  2362 1 1 66 CYS HB2  H  -0.550  -6.333  -6.154 1.00 . A A . 66 CYS HB2  1 1 
        2  2363 1 1 66 CYS HB3  H  -0.561  -6.059  -7.892 1.00 . A A . 66 CYS HB3  1 1 
        2  2364 1 1 66 CYS HG   H   0.921  -3.466  -6.710 1.00 . A A . 66 CYS HG   1 1 
        2  2365 1 1 66 CYS N    N  -2.945  -5.335  -7.094 1.00 . A A . 66 CYS N    1 1 
        2  2366 1 1 66 CYS O    O  -1.071  -2.337  -7.200 1.00 . A A . 66 CYS O    1 1 
        2  2367 1 1 66 CYS SG   S   1.114  -4.776  -6.808 1.00 . A A . 66 CYS SG   1 1 
        2  2368 1 1 67 GLN C    C  -2.490  -1.262  -9.624 1.00 . A A . 67 GLN C    1 1 
        2  2369 1 1 67 GLN CA   C  -1.610  -2.483  -9.941 1.00 . A A . 67 GLN CA   1 1 
        2  2370 1 1 67 GLN CB   C  -1.919  -3.012 -11.349 1.00 . A A . 67 GLN CB   1 1 
        2  2371 1 1 67 GLN CD   C  -1.409  -4.755 -13.125 1.00 . A A . 67 GLN CD   1 1 
        2  2372 1 1 67 GLN CG   C  -1.045  -4.193 -11.761 1.00 . A A . 67 GLN CG   1 1 
        2  2373 1 1 67 GLN H    H  -2.131  -4.422  -9.255 1.00 . A A . 67 GLN H    1 1 
        2  2374 1 1 67 GLN HA   H  -0.574  -2.176  -9.907 1.00 . A A . 67 GLN HA   1 1 
        2  2375 1 1 67 GLN HB2  H  -2.953  -3.327 -11.387 1.00 . A A . 67 GLN HB2  1 1 
        2  2376 1 1 67 GLN HB3  H  -1.769  -2.214 -12.065 1.00 . A A . 67 GLN HB3  1 1 
        2  2377 1 1 67 GLN HE21 H   0.447  -5.381 -13.401 1.00 . A A . 67 GLN HE21 1 1 
        2  2378 1 1 67 GLN HE22 H  -0.661  -5.706 -14.685 1.00 . A A . 67 GLN HE22 1 1 
        2  2379 1 1 67 GLN HG2  H  -0.014  -3.868 -11.787 1.00 . A A . 67 GLN HG2  1 1 
        2  2380 1 1 67 GLN HG3  H  -1.151  -4.979 -11.026 1.00 . A A . 67 GLN HG3  1 1 
        2  2381 1 1 67 GLN N    N  -1.787  -3.557  -8.954 1.00 . A A . 67 GLN N    1 1 
        2  2382 1 1 67 GLN NE2  N  -0.445  -5.338 -13.805 1.00 . A A . 67 GLN NE2  1 1 
        2  2383 1 1 67 GLN O    O  -2.041  -0.116  -9.732 1.00 . A A . 67 GLN O    1 1 
        2  2384 1 1 67 GLN OE1  O  -2.553  -4.677 -13.558 1.00 . A A . 67 GLN OE1  1 1 
        2  2385 1 1 68 GLU C    C  -4.098   0.337  -7.615 1.00 . A A . 68 GLU C    1 1 
        2  2386 1 1 68 GLU CA   C  -4.655  -0.436  -8.824 1.00 . A A . 68 GLU CA   1 1 
        2  2387 1 1 68 GLU CB   C  -6.041  -1.012  -8.493 1.00 . A A . 68 GLU CB   1 1 
        2  2388 1 1 68 GLU CD   C  -7.167  -0.588 -10.738 1.00 . A A . 68 GLU CD   1 1 
        2  2389 1 1 68 GLU CG   C  -6.767  -1.620  -9.692 1.00 . A A . 68 GLU CG   1 1 
        2  2390 1 1 68 GLU H    H  -4.062  -2.438  -9.225 1.00 . A A . 68 GLU H    1 1 
        2  2391 1 1 68 GLU HA   H  -4.748   0.248  -9.655 1.00 . A A . 68 GLU HA   1 1 
        2  2392 1 1 68 GLU HB2  H  -5.927  -1.782  -7.744 1.00 . A A . 68 GLU HB2  1 1 
        2  2393 1 1 68 GLU HB3  H  -6.660  -0.223  -8.089 1.00 . A A . 68 GLU HB3  1 1 
        2  2394 1 1 68 GLU HG2  H  -6.118  -2.348 -10.158 1.00 . A A . 68 GLU HG2  1 1 
        2  2395 1 1 68 GLU HG3  H  -7.662  -2.119  -9.339 1.00 . A A . 68 GLU HG3  1 1 
        2  2396 1 1 68 GLU N    N  -3.741  -1.511  -9.233 1.00 . A A . 68 GLU N    1 1 
        2  2397 1 1 68 GLU O    O  -4.198   1.564  -7.545 1.00 . A A . 68 GLU O    1 1 
        2  2398 1 1 68 GLU OE1  O  -6.342  -0.272 -11.623 1.00 . A A . 68 GLU OE1  1 1 
        2  2399 1 1 68 GLU OE2  O  -8.314  -0.089 -10.681 1.00 . A A . 68 GLU OE2  1 1 
        2  2400 1 1 69 PHE C    C  -1.667   1.092  -5.915 1.00 . A A . 69 PHE C    1 1 
        2  2401 1 1 69 PHE CA   C  -2.876   0.237  -5.500 1.00 . A A . 69 PHE CA   1 1 
        2  2402 1 1 69 PHE CB   C  -2.445  -0.828  -4.484 1.00 . A A . 69 PHE CB   1 1 
        2  2403 1 1 69 PHE CD1  C  -2.806   0.232  -2.230 1.00 . A A . 69 PHE CD1  1 1 
        2  2404 1 1 69 PHE CD2  C  -0.562  -0.176  -2.939 1.00 . A A . 69 PHE CD2  1 1 
        2  2405 1 1 69 PHE CE1  C  -2.337   0.770  -1.048 1.00 . A A . 69 PHE CE1  1 1 
        2  2406 1 1 69 PHE CE2  C  -0.090   0.365  -1.757 1.00 . A A . 69 PHE CE2  1 1 
        2  2407 1 1 69 PHE CG   C  -1.926  -0.249  -3.191 1.00 . A A . 69 PHE CG   1 1 
        2  2408 1 1 69 PHE CZ   C  -0.979   0.838  -0.811 1.00 . A A . 69 PHE CZ   1 1 
        2  2409 1 1 69 PHE H    H  -3.467  -1.363  -6.765 1.00 . A A . 69 PHE H    1 1 
        2  2410 1 1 69 PHE HA   H  -3.615   0.883  -5.041 1.00 . A A . 69 PHE HA   1 1 
        2  2411 1 1 69 PHE HB2  H  -3.293  -1.457  -4.252 1.00 . A A . 69 PHE HB2  1 1 
        2  2412 1 1 69 PHE HB3  H  -1.664  -1.438  -4.919 1.00 . A A . 69 PHE HB3  1 1 
        2  2413 1 1 69 PHE HD1  H  -3.869   0.180  -2.411 1.00 . A A . 69 PHE HD1  1 1 
        2  2414 1 1 69 PHE HD2  H   0.136  -0.545  -3.679 1.00 . A A . 69 PHE HD2  1 1 
        2  2415 1 1 69 PHE HE1  H  -3.035   1.141  -0.308 1.00 . A A . 69 PHE HE1  1 1 
        2  2416 1 1 69 PHE HE2  H   0.973   0.416  -1.572 1.00 . A A . 69 PHE HE2  1 1 
        2  2417 1 1 69 PHE HZ   H  -0.610   1.261   0.113 1.00 . A A . 69 PHE HZ   1 1 
        2  2418 1 1 69 PHE N    N  -3.496  -0.388  -6.671 1.00 . A A . 69 PHE N    1 1 
        2  2419 1 1 69 PHE O    O  -1.484   2.201  -5.419 1.00 . A A . 69 PHE O    1 1 
        2  2420 1 1 70 GLY C    C  -0.151   2.621  -8.042 1.00 . A A . 70 GLY C    1 1 
        2  2421 1 1 70 GLY CA   C   0.284   1.327  -7.354 1.00 . A A . 70 GLY CA   1 1 
        2  2422 1 1 70 GLY H    H  -1.015  -0.348  -7.149 1.00 . A A . 70 GLY H    1 1 
        2  2423 1 1 70 GLY HA2  H   0.952   1.567  -6.539 1.00 . A A . 70 GLY HA2  1 1 
        2  2424 1 1 70 GLY HA3  H   0.815   0.714  -8.069 1.00 . A A . 70 GLY HA3  1 1 
        2  2425 1 1 70 GLY N    N  -0.851   0.566  -6.829 1.00 . A A . 70 GLY N    1 1 
        2  2426 1 1 70 GLY O    O   0.489   3.666  -7.894 1.00 . A A . 70 GLY O    1 1 
        2  2427 1 1 71 ARG C    C  -2.264   4.755  -8.358 1.00 . A A . 71 ARG C    1 1 
        2  2428 1 1 71 ARG CA   C  -1.857   3.719  -9.420 1.00 . A A . 71 ARG CA   1 1 
        2  2429 1 1 71 ARG CB   C  -3.083   3.294 -10.244 1.00 . A A . 71 ARG CB   1 1 
        2  2430 1 1 71 ARG CD   C  -5.067   3.979 -11.651 1.00 . A A . 71 ARG CD   1 1 
        2  2431 1 1 71 ARG CG   C  -3.861   4.459 -10.851 1.00 . A A . 71 ARG CG   1 1 
        2  2432 1 1 71 ARG CZ   C  -5.882   5.526 -13.367 1.00 . A A . 71 ARG CZ   1 1 
        2  2433 1 1 71 ARG H    H  -1.661   1.663  -8.934 1.00 . A A . 71 ARG H    1 1 
        2  2434 1 1 71 ARG HA   H  -1.124   4.162 -10.081 1.00 . A A . 71 ARG HA   1 1 
        2  2435 1 1 71 ARG HB2  H  -2.755   2.654 -11.051 1.00 . A A . 71 ARG HB2  1 1 
        2  2436 1 1 71 ARG HB3  H  -3.754   2.735  -9.605 1.00 . A A . 71 ARG HB3  1 1 
        2  2437 1 1 71 ARG HD2  H  -4.719   3.398 -12.493 1.00 . A A . 71 ARG HD2  1 1 
        2  2438 1 1 71 ARG HD3  H  -5.681   3.355 -11.016 1.00 . A A . 71 ARG HD3  1 1 
        2  2439 1 1 71 ARG HE   H  -6.451   5.549 -11.488 1.00 . A A . 71 ARG HE   1 1 
        2  2440 1 1 71 ARG HG2  H  -4.206   5.104 -10.054 1.00 . A A . 71 ARG HG2  1 1 
        2  2441 1 1 71 ARG HG3  H  -3.205   5.014 -11.507 1.00 . A A . 71 ARG HG3  1 1 
        2  2442 1 1 71 ARG HH11 H  -4.590   4.166 -14.042 1.00 . A A . 71 ARG HH11 1 1 
        2  2443 1 1 71 ARG HH12 H  -5.177   5.292 -15.211 1.00 . A A . 71 ARG HH12 1 1 
        2  2444 1 1 71 ARG HH21 H  -7.197   6.965 -12.984 1.00 . A A . 71 ARG HH21 1 1 
        2  2445 1 1 71 ARG HH22 H  -6.642   6.870 -14.619 1.00 . A A . 71 ARG HH22 1 1 
        2  2446 1 1 71 ARG N    N  -1.248   2.541  -8.794 1.00 . A A . 71 ARG N    1 1 
        2  2447 1 1 71 ARG NE   N  -5.875   5.096 -12.135 1.00 . A A . 71 ARG NE   1 1 
        2  2448 1 1 71 ARG NH1  N  -5.161   4.951 -14.279 1.00 . A A . 71 ARG NH1  1 1 
        2  2449 1 1 71 ARG NH2  N  -6.630   6.529 -13.683 1.00 . A A . 71 ARG NH2  1 1 
        2  2450 1 1 71 ARG O    O  -1.970   5.947  -8.485 1.00 . A A . 71 ARG O    1 1 
        2  2451 1 1 72 TRP C    C  -2.136   5.754  -5.469 1.00 . A A . 72 TRP C    1 1 
        2  2452 1 1 72 TRP CA   C  -3.350   5.158  -6.199 1.00 . A A . 72 TRP CA   1 1 
        2  2453 1 1 72 TRP CB   C  -4.223   4.378  -5.209 1.00 . A A . 72 TRP CB   1 1 
        2  2454 1 1 72 TRP CD1  C  -5.650   6.164  -4.049 1.00 . A A . 72 TRP CD1  1 1 
        2  2455 1 1 72 TRP CD2  C  -4.184   5.141  -2.700 1.00 . A A . 72 TRP CD2  1 1 
        2  2456 1 1 72 TRP CE2  C  -4.905   6.089  -1.949 1.00 . A A . 72 TRP CE2  1 1 
        2  2457 1 1 72 TRP CE3  C  -3.207   4.375  -2.059 1.00 . A A . 72 TRP CE3  1 1 
        2  2458 1 1 72 TRP CG   C  -4.682   5.202  -4.043 1.00 . A A . 72 TRP CG   1 1 
        2  2459 1 1 72 TRP CH2  C  -3.715   5.531   0.010 1.00 . A A . 72 TRP CH2  1 1 
        2  2460 1 1 72 TRP CZ2  C  -4.677   6.293  -0.594 1.00 . A A . 72 TRP CZ2  1 1 
        2  2461 1 1 72 TRP CZ3  C  -2.980   4.579  -0.712 1.00 . A A . 72 TRP CZ3  1 1 
        2  2462 1 1 72 TRP H    H  -3.168   3.333  -7.275 1.00 . A A . 72 TRP H    1 1 
        2  2463 1 1 72 TRP HA   H  -3.934   5.965  -6.617 1.00 . A A . 72 TRP HA   1 1 
        2  2464 1 1 72 TRP HB2  H  -5.099   4.013  -5.723 1.00 . A A . 72 TRP HB2  1 1 
        2  2465 1 1 72 TRP HB3  H  -3.660   3.539  -4.827 1.00 . A A . 72 TRP HB3  1 1 
        2  2466 1 1 72 TRP HD1  H  -6.218   6.452  -4.921 1.00 . A A . 72 TRP HD1  1 1 
        2  2467 1 1 72 TRP HE1  H  -6.428   7.400  -2.546 1.00 . A A . 72 TRP HE1  1 1 
        2  2468 1 1 72 TRP HE3  H  -2.632   3.638  -2.598 1.00 . A A . 72 TRP HE3  1 1 
        2  2469 1 1 72 TRP HH2  H  -3.506   5.656   1.062 1.00 . A A . 72 TRP HH2  1 1 
        2  2470 1 1 72 TRP HZ2  H  -5.239   7.020  -0.025 1.00 . A A . 72 TRP HZ2  1 1 
        2  2471 1 1 72 TRP HZ3  H  -2.228   3.998  -0.198 1.00 . A A . 72 TRP HZ3  1 1 
        2  2472 1 1 72 TRP N    N  -2.936   4.288  -7.307 1.00 . A A . 72 TRP N    1 1 
        2  2473 1 1 72 TRP NE1  N  -5.792   6.696  -2.795 1.00 . A A . 72 TRP NE1  1 1 
        2  2474 1 1 72 TRP O    O  -2.116   6.942  -5.155 1.00 . A A . 72 TRP O    1 1 
        2  2475 1 1 73 TYR C    C   0.694   6.606  -5.177 1.00 . A A . 73 TYR C    1 1 
        2  2476 1 1 73 TYR CA   C   0.100   5.341  -4.532 1.00 . A A . 73 TYR CA   1 1 
        2  2477 1 1 73 TYR CB   C   1.128   4.197  -4.556 1.00 . A A . 73 TYR CB   1 1 
        2  2478 1 1 73 TYR CD1  C   2.476   4.318  -2.414 1.00 . A A . 73 TYR CD1  1 1 
        2  2479 1 1 73 TYR CD2  C   3.551   4.936  -4.453 1.00 . A A . 73 TYR CD2  1 1 
        2  2480 1 1 73 TYR CE1  C   3.638   4.583  -1.715 1.00 . A A . 73 TYR CE1  1 1 
        2  2481 1 1 73 TYR CE2  C   4.717   5.200  -3.760 1.00 . A A . 73 TYR CE2  1 1 
        2  2482 1 1 73 TYR CG   C   2.410   4.489  -3.794 1.00 . A A . 73 TYR CG   1 1 
        2  2483 1 1 73 TYR CZ   C   4.754   5.024  -2.391 1.00 . A A . 73 TYR CZ   1 1 
        2  2484 1 1 73 TYR H    H  -1.213   3.984  -5.495 1.00 . A A . 73 TYR H    1 1 
        2  2485 1 1 73 TYR HA   H  -0.152   5.561  -3.504 1.00 . A A . 73 TYR HA   1 1 
        2  2486 1 1 73 TYR HB2  H   0.679   3.316  -4.117 1.00 . A A . 73 TYR HB2  1 1 
        2  2487 1 1 73 TYR HB3  H   1.390   3.982  -5.583 1.00 . A A . 73 TYR HB3  1 1 
        2  2488 1 1 73 TYR HD1  H   1.598   3.975  -1.885 1.00 . A A . 73 TYR HD1  1 1 
        2  2489 1 1 73 TYR HD2  H   3.520   5.074  -5.526 1.00 . A A . 73 TYR HD2  1 1 
        2  2490 1 1 73 TYR HE1  H   3.666   4.442  -0.644 1.00 . A A . 73 TYR HE1  1 1 
        2  2491 1 1 73 TYR HE2  H   5.592   5.545  -4.290 1.00 . A A . 73 TYR HE2  1 1 
        2  2492 1 1 73 TYR HH   H   6.226   4.495  -1.266 1.00 . A A . 73 TYR HH   1 1 
        2  2493 1 1 73 TYR N    N  -1.127   4.918  -5.216 1.00 . A A . 73 TYR N    1 1 
        2  2494 1 1 73 TYR O    O   1.085   7.551  -4.481 1.00 . A A . 73 TYR O    1 1 
        2  2495 1 1 73 TYR OH   O   5.910   5.302  -1.696 1.00 . A A . 73 TYR OH   1 1 
        2  2496 1 1 74 LYS C    C   0.219   8.941  -7.229 1.00 . A A . 74 LYS C    1 1 
        2  2497 1 1 74 LYS CA   C   1.247   7.796  -7.233 1.00 . A A . 74 LYS CA   1 1 
        2  2498 1 1 74 LYS CB   C   1.639   7.430  -8.672 1.00 . A A . 74 LYS CB   1 1 
        2  2499 1 1 74 LYS CD   C   2.799   8.227 -10.789 1.00 . A A . 74 LYS CD   1 1 
        2  2500 1 1 74 LYS CE   C   4.084   7.449 -10.523 1.00 . A A . 74 LYS CE   1 1 
        2  2501 1 1 74 LYS CG   C   2.104   8.633  -9.493 1.00 . A A . 74 LYS CG   1 1 
        2  2502 1 1 74 LYS H    H   0.457   5.833  -7.010 1.00 . A A . 74 LYS H    1 1 
        2  2503 1 1 74 LYS HA   H   2.134   8.139  -6.715 1.00 . A A . 74 LYS HA   1 1 
        2  2504 1 1 74 LYS HB2  H   2.441   6.703  -8.641 1.00 . A A . 74 LYS HB2  1 1 
        2  2505 1 1 74 LYS HB3  H   0.785   6.989  -9.166 1.00 . A A . 74 LYS HB3  1 1 
        2  2506 1 1 74 LYS HD2  H   2.129   7.608 -11.367 1.00 . A A . 74 LYS HD2  1 1 
        2  2507 1 1 74 LYS HD3  H   3.038   9.120 -11.351 1.00 . A A . 74 LYS HD3  1 1 
        2  2508 1 1 74 LYS HE2  H   4.671   7.981  -9.789 1.00 . A A . 74 LYS HE2  1 1 
        2  2509 1 1 74 LYS HE3  H   3.827   6.472 -10.139 1.00 . A A . 74 LYS HE3  1 1 
        2  2510 1 1 74 LYS HG2  H   1.246   9.240  -9.738 1.00 . A A . 74 LYS HG2  1 1 
        2  2511 1 1 74 LYS HG3  H   2.794   9.217  -8.897 1.00 . A A . 74 LYS HG3  1 1 
        2  2512 1 1 74 LYS HZ1  H   5.714   6.675 -11.567 1.00 . A A . 74 LYS HZ1  1 1 
        2  2513 1 1 74 LYS HZ2  H   5.234   8.212 -12.087 1.00 . A A . 74 LYS HZ2  1 1 
        2  2514 1 1 74 LYS HZ3  H   4.322   6.850 -12.506 1.00 . A A . 74 LYS HZ3  1 1 
        2  2515 1 1 74 LYS N    N   0.751   6.625  -6.508 1.00 . A A . 74 LYS N    1 1 
        2  2516 1 1 74 LYS NZ   N   4.895   7.284 -11.756 1.00 . A A . 74 LYS NZ   1 1 
        2  2517 1 1 74 LYS O    O   0.585  10.103  -7.090 1.00 . A A . 74 LYS O    1 1 
        2  2518 1 1 75 HIS C    C  -2.268  10.236  -5.905 1.00 . A A . 75 HIS C    1 1 
        2  2519 1 1 75 HIS CA   C  -2.127   9.633  -7.315 1.00 . A A . 75 HIS CA   1 1 
        2  2520 1 1 75 HIS CB   C  -3.468   9.052  -7.792 1.00 . A A . 75 HIS CB   1 1 
        2  2521 1 1 75 HIS CD2  C  -2.866   8.279 -10.203 1.00 . A A . 75 HIS CD2  1 1 
        2  2522 1 1 75 HIS CE1  C  -4.403   9.400 -11.284 1.00 . A A . 75 HIS CE1  1 1 
        2  2523 1 1 75 HIS CG   C  -3.587   8.969  -9.287 1.00 . A A . 75 HIS CG   1 1 
        2  2524 1 1 75 HIS H    H  -1.309   7.669  -7.494 1.00 . A A . 75 HIS H    1 1 
        2  2525 1 1 75 HIS HA   H  -1.839  10.429  -7.989 1.00 . A A . 75 HIS HA   1 1 
        2  2526 1 1 75 HIS HB2  H  -3.585   8.053  -7.395 1.00 . A A . 75 HIS HB2  1 1 
        2  2527 1 1 75 HIS HB3  H  -4.276   9.673  -7.430 1.00 . A A . 75 HIS HB3  1 1 
        2  2528 1 1 75 HIS HD1  H  -5.227  10.247  -9.620 1.00 . A A . 75 HIS HD1  1 1 
        2  2529 1 1 75 HIS HD2  H  -2.034   7.618  -9.998 1.00 . A A . 75 HIS HD2  1 1 
        2  2530 1 1 75 HIS HE1  H  -5.018   9.799 -12.078 1.00 . A A . 75 HIS HE1  1 1 
        2  2531 1 1 75 HIS HE2  H  -2.937   8.403 -12.295 1.00 . A A . 75 HIS HE2  1 1 
        2  2532 1 1 75 HIS N    N  -1.067   8.611  -7.367 1.00 . A A . 75 HIS N    1 1 
        2  2533 1 1 75 HIS ND1  N  -4.541   9.657 -10.001 1.00 . A A . 75 HIS ND1  1 1 
        2  2534 1 1 75 HIS NE2  N  -3.394   8.567 -11.438 1.00 . A A . 75 HIS NE2  1 1 
        2  2535 1 1 75 HIS O    O  -2.882  11.289  -5.729 1.00 . A A . 75 HIS O    1 1 
        2  2536 1 1 76 PHE C    C  -0.532  11.078  -3.331 1.00 . A A . 76 PHE C    1 1 
        2  2537 1 1 76 PHE CA   C  -1.682  10.071  -3.535 1.00 . A A . 76 PHE CA   1 1 
        2  2538 1 1 76 PHE CB   C  -1.551   8.903  -2.544 1.00 . A A . 76 PHE CB   1 1 
        2  2539 1 1 76 PHE CD1  C  -2.835   9.623  -0.503 1.00 . A A . 76 PHE CD1  1 1 
        2  2540 1 1 76 PHE CD2  C  -0.466   9.394  -0.322 1.00 . A A . 76 PHE CD2  1 1 
        2  2541 1 1 76 PHE CE1  C  -2.904   9.999   0.825 1.00 . A A . 76 PHE CE1  1 1 
        2  2542 1 1 76 PHE CE2  C  -0.529   9.770   1.007 1.00 . A A . 76 PHE CE2  1 1 
        2  2543 1 1 76 PHE CG   C  -1.618   9.317  -1.093 1.00 . A A . 76 PHE CG   1 1 
        2  2544 1 1 76 PHE CZ   C  -1.749  10.073   1.581 1.00 . A A . 76 PHE CZ   1 1 
        2  2545 1 1 76 PHE H    H  -1.286   8.696  -5.100 1.00 . A A . 76 PHE H    1 1 
        2  2546 1 1 76 PHE HA   H  -2.624  10.578  -3.357 1.00 . A A . 76 PHE HA   1 1 
        2  2547 1 1 76 PHE HB2  H  -2.352   8.197  -2.723 1.00 . A A . 76 PHE HB2  1 1 
        2  2548 1 1 76 PHE HB3  H  -0.604   8.407  -2.707 1.00 . A A . 76 PHE HB3  1 1 
        2  2549 1 1 76 PHE HD1  H  -3.739   9.567  -1.093 1.00 . A A . 76 PHE HD1  1 1 
        2  2550 1 1 76 PHE HD2  H   0.489   9.158  -0.772 1.00 . A A . 76 PHE HD2  1 1 
        2  2551 1 1 76 PHE HE1  H  -3.860  10.236   1.271 1.00 . A A . 76 PHE HE1  1 1 
        2  2552 1 1 76 PHE HE2  H   0.375   9.826   1.593 1.00 . A A . 76 PHE HE2  1 1 
        2  2553 1 1 76 PHE HZ   H  -1.800  10.367   2.619 1.00 . A A . 76 PHE HZ   1 1 
        2  2554 1 1 76 PHE N    N  -1.696   9.564  -4.909 1.00 . A A . 76 PHE N    1 1 
        2  2555 1 1 76 PHE O    O  -0.757  12.219  -2.918 1.00 . A A . 76 PHE O    1 1 
        2  2556 1 1 77 LYS C    C   2.244  12.289  -4.715 1.00 . A A . 77 LYS C    1 1 
        2  2557 1 1 77 LYS CA   C   1.879  11.511  -3.438 1.00 . A A . 77 LYS CA   1 1 
        2  2558 1 1 77 LYS CB   C   3.092  10.683  -2.990 1.00 . A A . 77 LYS CB   1 1 
        2  2559 1 1 77 LYS CD   C   4.242   9.427  -1.121 1.00 . A A . 77 LYS CD   1 1 
        2  2560 1 1 77 LYS CE   C   4.863   8.410  -2.076 1.00 . A A . 77 LYS CE   1 1 
        2  2561 1 1 77 LYS CG   C   2.915   9.986  -1.644 1.00 . A A . 77 LYS CG   1 1 
        2  2562 1 1 77 LYS H    H   0.820   9.737  -3.957 1.00 . A A . 77 LYS H    1 1 
        2  2563 1 1 77 LYS HA   H   1.646  12.225  -2.661 1.00 . A A . 77 LYS HA   1 1 
        2  2564 1 1 77 LYS HB2  H   3.289   9.926  -3.735 1.00 . A A . 77 LYS HB2  1 1 
        2  2565 1 1 77 LYS HB3  H   3.952  11.335  -2.921 1.00 . A A . 77 LYS HB3  1 1 
        2  2566 1 1 77 LYS HD2  H   4.935  10.246  -0.989 1.00 . A A . 77 LYS HD2  1 1 
        2  2567 1 1 77 LYS HD3  H   4.067   8.952  -0.167 1.00 . A A . 77 LYS HD3  1 1 
        2  2568 1 1 77 LYS HE2  H   4.214   7.548  -2.139 1.00 . A A . 77 LYS HE2  1 1 
        2  2569 1 1 77 LYS HE3  H   4.956   8.858  -3.054 1.00 . A A . 77 LYS HE3  1 1 
        2  2570 1 1 77 LYS HG2  H   2.530  10.701  -0.929 1.00 . A A . 77 LYS HG2  1 1 
        2  2571 1 1 77 LYS HG3  H   2.208   9.174  -1.757 1.00 . A A . 77 LYS HG3  1 1 
        2  2572 1 1 77 LYS HZ1  H   6.184   7.729  -0.606 1.00 . A A . 77 LYS HZ1  1 1 
        2  2573 1 1 77 LYS HZ2  H   6.907   8.724  -1.763 1.00 . A A . 77 LYS HZ2  1 1 
        2  2574 1 1 77 LYS HZ3  H   6.513   7.122  -2.148 1.00 . A A . 77 LYS HZ3  1 1 
        2  2575 1 1 77 LYS N    N   0.700  10.650  -3.621 1.00 . A A . 77 LYS N    1 1 
        2  2576 1 1 77 LYS NZ   N   6.209   7.965  -1.618 1.00 . A A . 77 LYS NZ   1 1 
        2  2577 1 1 77 LYS O    O   2.404  13.511  -4.680 1.00 . A A . 77 LYS O    1 1 
        2  2578 1 1 78 LYS C    C   4.283  12.751  -6.873 1.00 . A A . 78 LYS C    1 1 
        2  2579 1 1 78 LYS CA   C   2.887  12.143  -7.089 1.00 . A A . 78 LYS CA   1 1 
        2  2580 1 1 78 LYS CB   C   1.914  13.186  -7.672 1.00 . A A . 78 LYS CB   1 1 
        2  2581 1 1 78 LYS CD   C   1.292  14.659  -9.647 1.00 . A A . 78 LYS CD   1 1 
        2  2582 1 1 78 LYS CE   C   0.944  15.870  -8.785 1.00 . A A . 78 LYS CE   1 1 
        2  2583 1 1 78 LYS CG   C   2.368  13.775  -9.008 1.00 . A A . 78 LYS CG   1 1 
        2  2584 1 1 78 LYS H    H   2.077  10.639  -5.830 1.00 . A A . 78 LYS H    1 1 
        2  2585 1 1 78 LYS HA   H   2.980  11.327  -7.794 1.00 . A A . 78 LYS HA   1 1 
        2  2586 1 1 78 LYS HB2  H   0.950  12.718  -7.817 1.00 . A A . 78 LYS HB2  1 1 
        2  2587 1 1 78 LYS HB3  H   1.806  13.994  -6.963 1.00 . A A . 78 LYS HB3  1 1 
        2  2588 1 1 78 LYS HD2  H   1.653  15.007 -10.604 1.00 . A A . 78 LYS HD2  1 1 
        2  2589 1 1 78 LYS HD3  H   0.399  14.068  -9.796 1.00 . A A . 78 LYS HD3  1 1 
        2  2590 1 1 78 LYS HE2  H   0.127  16.405  -9.250 1.00 . A A . 78 LYS HE2  1 1 
        2  2591 1 1 78 LYS HE3  H   0.632  15.524  -7.811 1.00 . A A . 78 LYS HE3  1 1 
        2  2592 1 1 78 LYS HG2  H   3.256  14.371  -8.844 1.00 . A A . 78 LYS HG2  1 1 
        2  2593 1 1 78 LYS HG3  H   2.602  12.965  -9.684 1.00 . A A . 78 LYS HG3  1 1 
        2  2594 1 1 78 LYS HZ1  H   2.869  16.328  -8.121 1.00 . A A . 78 LYS HZ1  1 1 
        2  2595 1 1 78 LYS HZ2  H   1.799  17.635  -8.072 1.00 . A A . 78 LYS HZ2  1 1 
        2  2596 1 1 78 LYS HZ3  H   2.436  17.117  -9.549 1.00 . A A . 78 LYS HZ3  1 1 
        2  2597 1 1 78 LYS N    N   2.367  11.573  -5.835 1.00 . A A . 78 LYS N    1 1 
        2  2598 1 1 78 LYS NZ   N   2.091  16.801  -8.622 1.00 . A A . 78 LYS NZ   1 1 
        2  2599 1 1 78 LYS O    O   4.420  13.919  -6.499 1.00 . A A . 78 LYS O    1 1 
        2  2600 1 1 79 THR C    C   7.354  13.019  -8.009 1.00 . A A . 79 THR C    1 1 
        2  2601 1 1 79 THR CA   C   6.694  12.351  -6.798 1.00 . A A . 79 THR CA   1 1 
        2  2602 1 1 79 THR CB   C   7.547  11.137  -6.340 1.00 . A A . 79 THR CB   1 1 
        2  2603 1 1 79 THR CG2  C   8.942  11.574  -5.891 1.00 . A A . 79 THR CG2  1 1 
        2  2604 1 1 79 THR H    H   5.157  11.065  -7.498 1.00 . A A . 79 THR H    1 1 
        2  2605 1 1 79 THR HA   H   6.660  13.065  -5.984 1.00 . A A . 79 THR HA   1 1 
        2  2606 1 1 79 THR HB   H   7.648  10.451  -7.172 1.00 . A A . 79 THR HB   1 1 
        2  2607 1 1 79 THR HG1  H   6.716  11.083  -4.539 1.00 . A A . 79 THR HG1  1 1 
        2  2608 1 1 79 THR HG21 H   9.439  12.086  -6.702 1.00 . A A . 79 THR HG21 1 1 
        2  2609 1 1 79 THR HG22 H   9.519  10.705  -5.608 1.00 . A A . 79 THR HG22 1 1 
        2  2610 1 1 79 THR HG23 H   8.857  12.241  -5.044 1.00 . A A . 79 THR HG23 1 1 
        2  2611 1 1 79 THR N    N   5.316  11.947  -7.099 1.00 . A A . 79 THR N    1 1 
        2  2612 1 1 79 THR O    O   8.036  12.364  -8.799 1.00 . A A . 79 THR O    1 1 
        2  2613 1 1 79 THR OG1  O   6.889  10.458  -5.253 1.00 . A A . 79 THR OG1  1 1 
        2  2614 1 1 80 LYS C    C   7.134  14.684 -10.651 1.00 . A A . 80 LYS C    1 1 
        2  2615 1 1 80 LYS CA   C   7.687  15.109  -9.268 1.00 . A A . 80 LYS CA   1 1 
        2  2616 1 1 80 LYS CB   C   9.226  14.993  -9.227 1.00 . A A . 80 LYS CB   1 1 
        2  2617 1 1 80 LYS CD   C  11.464  15.774 -10.084 1.00 . A A . 80 LYS CD   1 1 
        2  2618 1 1 80 LYS CE   C  12.190  16.610 -11.126 1.00 . A A . 80 LYS CE   1 1 
        2  2619 1 1 80 LYS CG   C   9.952  15.850 -10.255 1.00 . A A . 80 LYS CG   1 1 
        2  2620 1 1 80 LYS H    H   6.497  14.767  -7.539 1.00 . A A . 80 LYS H    1 1 
        2  2621 1 1 80 LYS HA   H   7.416  16.141  -9.097 1.00 . A A . 80 LYS HA   1 1 
        2  2622 1 1 80 LYS HB2  H   9.569  15.288  -8.245 1.00 . A A . 80 LYS HB2  1 1 
        2  2623 1 1 80 LYS HB3  H   9.501  13.961  -9.394 1.00 . A A . 80 LYS HB3  1 1 
        2  2624 1 1 80 LYS HD2  H  11.726  16.139  -9.101 1.00 . A A . 80 LYS HD2  1 1 
        2  2625 1 1 80 LYS HD3  H  11.776  14.743 -10.181 1.00 . A A . 80 LYS HD3  1 1 
        2  2626 1 1 80 LYS HE2  H  13.253  16.541 -10.950 1.00 . A A . 80 LYS HE2  1 1 
        2  2627 1 1 80 LYS HE3  H  11.964  16.214 -12.108 1.00 . A A . 80 LYS HE3  1 1 
        2  2628 1 1 80 LYS HG2  H   9.696  15.501 -11.245 1.00 . A A . 80 LYS HG2  1 1 
        2  2629 1 1 80 LYS HG3  H   9.636  16.878 -10.142 1.00 . A A . 80 LYS HG3  1 1 
        2  2630 1 1 80 LYS HZ1  H  10.780  18.138 -11.320 1.00 . A A . 80 LYS HZ1  1 1 
        2  2631 1 1 80 LYS HZ2  H  12.349  18.589 -11.759 1.00 . A A . 80 LYS HZ2  1 1 
        2  2632 1 1 80 LYS HZ3  H  11.942  18.427 -10.130 1.00 . A A . 80 LYS HZ3  1 1 
        2  2633 1 1 80 LYS N    N   7.101  14.320  -8.172 1.00 . A A . 80 LYS N    1 1 
        2  2634 1 1 80 LYS NZ   N  11.787  18.040 -11.079 1.00 . A A . 80 LYS NZ   1 1 
        2  2635 1 1 80 LYS O    O   7.456  15.294 -11.675 1.00 . A A . 80 LYS O    1 1 
        2  2636 1 1 81 ASP C    C   4.932  14.218 -12.701 1.00 . A A . 81 ASP C    1 1 
        2  2637 1 1 81 ASP CA   C   5.696  13.136 -11.913 1.00 . A A . 81 ASP CA   1 1 
        2  2638 1 1 81 ASP CB   C   4.749  11.970 -11.600 1.00 . A A . 81 ASP CB   1 1 
        2  2639 1 1 81 ASP CG   C   5.460  10.793 -10.952 1.00 . A A . 81 ASP CG   1 1 
        2  2640 1 1 81 ASP H    H   6.034  13.232  -9.823 1.00 . A A . 81 ASP H    1 1 
        2  2641 1 1 81 ASP HA   H   6.507  12.769 -12.526 1.00 . A A . 81 ASP HA   1 1 
        2  2642 1 1 81 ASP HB2  H   3.976  12.315 -10.926 1.00 . A A . 81 ASP HB2  1 1 
        2  2643 1 1 81 ASP HB3  H   4.287  11.630 -12.518 1.00 . A A . 81 ASP HB3  1 1 
        2  2644 1 1 81 ASP N    N   6.278  13.658 -10.670 1.00 . A A . 81 ASP N    1 1 
        2  2645 1 1 81 ASP O    O   4.034  14.878 -12.172 1.00 . A A . 81 ASP O    1 1 
        2  2646 1 1 81 ASP OD1  O   5.563  10.762  -9.709 1.00 . A A . 81 ASP OD1  1 1 
        2  2647 1 1 81 ASP OD2  O   5.913   9.889 -11.690 1.00 . A A . 81 ASP OD2  1 1 
        2  2648 1 1 82 MET C    C   4.033  14.497 -16.072 1.00 . A A . 82 MET C    1 1 
        2  2649 1 1 82 MET CA   C   4.587  15.293 -14.880 1.00 . A A . 82 MET CA   1 1 
        2  2650 1 1 82 MET CB   C   5.505  16.426 -15.371 1.00 . A A . 82 MET CB   1 1 
        2  2651 1 1 82 MET CE   C   5.913  19.581 -15.821 1.00 . A A . 82 MET CE   1 1 
        2  2652 1 1 82 MET CG   C   6.062  17.289 -14.248 1.00 . A A . 82 MET CG   1 1 
        2  2653 1 1 82 MET H    H   6.112  13.937 -14.289 1.00 . A A . 82 MET H    1 1 
        2  2654 1 1 82 MET HA   H   3.755  15.726 -14.338 1.00 . A A . 82 MET HA   1 1 
        2  2655 1 1 82 MET HB2  H   6.335  15.996 -15.912 1.00 . A A . 82 MET HB2  1 1 
        2  2656 1 1 82 MET HB3  H   4.945  17.064 -16.039 1.00 . A A . 82 MET HB3  1 1 
        2  2657 1 1 82 MET HE1  H   5.523  18.963 -16.617 1.00 . A A . 82 MET HE1  1 1 
        2  2658 1 1 82 MET HE2  H   6.403  20.446 -16.246 1.00 . A A . 82 MET HE2  1 1 
        2  2659 1 1 82 MET HE3  H   5.102  19.905 -15.187 1.00 . A A . 82 MET HE3  1 1 
        2  2660 1 1 82 MET HG2  H   5.237  17.707 -13.688 1.00 . A A . 82 MET HG2  1 1 
        2  2661 1 1 82 MET HG3  H   6.656  16.666 -13.594 1.00 . A A . 82 MET HG3  1 1 
        2  2662 1 1 82 MET N    N   5.313  14.404 -13.964 1.00 . A A . 82 MET N    1 1 
        2  2663 1 1 82 MET O    O   4.762  14.173 -17.012 1.00 . A A . 82 MET O    1 1 
        2  2664 1 1 82 MET SD   S   7.095  18.644 -14.851 1.00 . A A . 82 MET SD   1 1 
        2  2665 1 1 83 MET C    C   1.795  14.157 -18.338 1.00 . A A . 83 MET C    1 1 
        2  2666 1 1 83 MET CA   C   2.105  13.343 -17.056 1.00 . A A . 83 MET CA   1 1 
        2  2667 1 1 83 MET CB   C   0.836  12.654 -16.503 1.00 . A A . 83 MET CB   1 1 
        2  2668 1 1 83 MET CE   C  -0.989  15.322 -13.824 1.00 . A A . 83 MET CE   1 1 
        2  2669 1 1 83 MET CG   C  -0.179  13.588 -15.841 1.00 . A A . 83 MET CG   1 1 
        2  2670 1 1 83 MET H    H   2.213  14.462 -15.250 1.00 . A A . 83 MET H    1 1 
        2  2671 1 1 83 MET HA   H   2.814  12.569 -17.324 1.00 . A A . 83 MET HA   1 1 
        2  2672 1 1 83 MET HB2  H   0.338  12.145 -17.315 1.00 . A A . 83 MET HB2  1 1 
        2  2673 1 1 83 MET HB3  H   1.139  11.918 -15.771 1.00 . A A . 83 MET HB3  1 1 
        2  2674 1 1 83 MET HE1  H  -0.742  15.909 -12.951 1.00 . A A . 83 MET HE1  1 1 
        2  2675 1 1 83 MET HE2  H  -1.786  14.634 -13.583 1.00 . A A . 83 MET HE2  1 1 
        2  2676 1 1 83 MET HE3  H  -1.311  15.980 -14.618 1.00 . A A . 83 MET HE3  1 1 
        2  2677 1 1 83 MET HG2  H  -0.461  14.349 -16.553 1.00 . A A . 83 MET HG2  1 1 
        2  2678 1 1 83 MET HG3  H  -1.055  13.013 -15.573 1.00 . A A . 83 MET HG3  1 1 
        2  2679 1 1 83 MET N    N   2.745  14.160 -16.013 1.00 . A A . 83 MET N    1 1 
        2  2680 1 1 83 MET O    O   0.754  14.848 -18.391 1.00 . A A . 83 MET O    1 1 
        2  2681 1 1 83 MET OXT  O   2.602  14.092 -19.296 1.00 . A A . 83 MET OXT  1 1 
        2  2682 1 1 83 MET SD   S   0.456  14.402 -14.357 1.00 . A A . 83 MET SD   1 1 
        3  2683 1 1  1 MET C    C  22.973 -12.899   7.621 1.00 . A A .  1 MET C    1 1 
        3  2684 1 1  1 MET CA   C  23.263 -12.160   8.938 1.00 . A A .  1 MET CA   1 1 
        3  2685 1 1  1 MET CB   C  24.282 -11.035   8.697 1.00 . A A .  1 MET CB   1 1 
        3  2686 1 1  1 MET CE   C  25.620 -10.117  12.553 1.00 . A A .  1 MET CE   1 1 
        3  2687 1 1  1 MET CG   C  24.644 -10.254   9.955 1.00 . A A .  1 MET CG   1 1 
        3  2688 1 1  1 MET H1   H  23.964 -12.600  10.861 1.00 . A A .  1 MET H1   1 1 
        3  2689 1 1  1 MET H2   H  24.663 -13.546   9.645 1.00 . A A .  1 MET H2   1 1 
        3  2690 1 1  1 MET H3   H  23.080 -13.854  10.153 1.00 . A A .  1 MET H3   1 1 
        3  2691 1 1  1 MET HA   H  22.342 -11.730   9.309 1.00 . A A .  1 MET HA   1 1 
        3  2692 1 1  1 MET HB2  H  25.188 -11.466   8.295 1.00 . A A .  1 MET HB2  1 1 
        3  2693 1 1  1 MET HB3  H  23.873 -10.342   7.974 1.00 . A A .  1 MET HB3  1 1 
        3  2694 1 1  1 MET HE1  H  24.668  -9.691  12.834 1.00 . A A .  1 MET HE1  1 1 
        3  2695 1 1  1 MET HE2  H  26.280  -9.330  12.219 1.00 . A A .  1 MET HE2  1 1 
        3  2696 1 1  1 MET HE3  H  26.059 -10.616  13.405 1.00 . A A .  1 MET HE3  1 1 
        3  2697 1 1  1 MET HG2  H  25.351  -9.479   9.692 1.00 . A A .  1 MET HG2  1 1 
        3  2698 1 1  1 MET HG3  H  23.746  -9.800  10.354 1.00 . A A .  1 MET HG3  1 1 
        3  2699 1 1  1 MET N    N  23.779 -13.105   9.969 1.00 . A A .  1 MET N    1 1 
        3  2700 1 1  1 MET O    O  23.893 -13.382   6.958 1.00 . A A .  1 MET O    1 1 
        3  2701 1 1  1 MET SD   S  25.376 -11.300  11.229 1.00 . A A .  1 MET SD   1 1 
        3  2702 1 1  2 GLY C    C  20.248 -13.108   5.186 1.00 . A A .  2 GLY C    1 1 
        3  2703 1 1  2 GLY CA   C  21.332 -13.758   6.043 1.00 . A A .  2 GLY CA   1 1 
        3  2704 1 1  2 GLY H    H  20.996 -12.570   7.784 1.00 . A A .  2 GLY H    1 1 
        3  2705 1 1  2 GLY HA2  H  22.213 -13.889   5.432 1.00 . A A .  2 GLY HA2  1 1 
        3  2706 1 1  2 GLY HA3  H  20.983 -14.733   6.353 1.00 . A A .  2 GLY HA3  1 1 
        3  2707 1 1  2 GLY N    N  21.696 -12.997   7.242 1.00 . A A .  2 GLY N    1 1 
        3  2708 1 1  2 GLY O    O  19.693 -13.752   4.297 1.00 . A A .  2 GLY O    1 1 
        3  2709 1 1  3 HIS C    C  19.352 -11.025   3.157 1.00 . A A .  3 HIS C    1 1 
        3  2710 1 1  3 HIS CA   C  18.932 -11.125   4.638 1.00 . A A .  3 HIS CA   1 1 
        3  2711 1 1  3 HIS CB   C  18.660  -9.726   5.223 1.00 . A A .  3 HIS CB   1 1 
        3  2712 1 1  3 HIS CD2  C  20.784  -8.794   6.403 1.00 . A A .  3 HIS CD2  1 1 
        3  2713 1 1  3 HIS CE1  C  21.374  -7.319   4.899 1.00 . A A .  3 HIS CE1  1 1 
        3  2714 1 1  3 HIS CG   C  19.884  -8.865   5.393 1.00 . A A .  3 HIS CG   1 1 
        3  2715 1 1  3 HIS H    H  20.368 -11.382   6.189 1.00 . A A .  3 HIS H    1 1 
        3  2716 1 1  3 HIS HA   H  18.016 -11.700   4.689 1.00 . A A .  3 HIS HA   1 1 
        3  2717 1 1  3 HIS HB2  H  17.977  -9.199   4.574 1.00 . A A .  3 HIS HB2  1 1 
        3  2718 1 1  3 HIS HB3  H  18.200  -9.840   6.196 1.00 . A A .  3 HIS HB3  1 1 
        3  2719 1 1  3 HIS HD1  H  19.843  -7.729   3.613 1.00 . A A .  3 HIS HD1  1 1 
        3  2720 1 1  3 HIS HD2  H  20.780  -9.385   7.306 1.00 . A A .  3 HIS HD2  1 1 
        3  2721 1 1  3 HIS HE1  H  21.906  -6.533   4.383 1.00 . A A .  3 HIS HE1  1 1 
        3  2722 1 1  3 HIS HE2  H  22.550  -7.670   6.528 1.00 . A A .  3 HIS HE2  1 1 
        3  2723 1 1  3 HIS N    N  19.935 -11.839   5.439 1.00 . A A .  3 HIS N    1 1 
        3  2724 1 1  3 HIS ND1  N  20.287  -7.926   4.466 1.00 . A A .  3 HIS ND1  1 1 
        3  2725 1 1  3 HIS NE2  N  21.697  -7.826   6.069 1.00 . A A .  3 HIS NE2  1 1 
        3  2726 1 1  3 HIS O    O  20.125 -10.147   2.774 1.00 . A A .  3 HIS O    1 1 
        3  2727 1 1  4 HIS C    C  17.907 -11.712   0.044 1.00 . A A .  4 HIS C    1 1 
        3  2728 1 1  4 HIS CA   C  19.166 -11.968   0.892 1.00 . A A .  4 HIS CA   1 1 
        3  2729 1 1  4 HIS CB   C  19.779 -13.316   0.485 1.00 . A A .  4 HIS CB   1 1 
        3  2730 1 1  4 HIS CD2  C  22.176 -13.090   1.471 1.00 . A A .  4 HIS CD2  1 1 
        3  2731 1 1  4 HIS CE1  C  22.240 -14.981   2.572 1.00 . A A .  4 HIS CE1  1 1 
        3  2732 1 1  4 HIS CG   C  20.986 -13.712   1.283 1.00 . A A .  4 HIS CG   1 1 
        3  2733 1 1  4 HIS H    H  18.279 -12.656   2.700 1.00 . A A .  4 HIS H    1 1 
        3  2734 1 1  4 HIS HA   H  19.887 -11.184   0.693 1.00 . A A .  4 HIS HA   1 1 
        3  2735 1 1  4 HIS HB2  H  19.036 -14.091   0.608 1.00 . A A .  4 HIS HB2  1 1 
        3  2736 1 1  4 HIS HB3  H  20.071 -13.271  -0.555 1.00 . A A .  4 HIS HB3  1 1 
        3  2737 1 1  4 HIS HD1  H  20.357 -15.574   2.048 1.00 . A A .  4 HIS HD1  1 1 
        3  2738 1 1  4 HIS HD2  H  22.471 -12.132   1.065 1.00 . A A .  4 HIS HD2  1 1 
        3  2739 1 1  4 HIS HE1  H  22.579 -15.799   3.190 1.00 . A A .  4 HIS HE1  1 1 
        3  2740 1 1  4 HIS HE2  H  23.894 -13.790   2.450 1.00 . A A .  4 HIS HE2  1 1 
        3  2741 1 1  4 HIS N    N  18.859 -11.954   2.332 1.00 . A A .  4 HIS N    1 1 
        3  2742 1 1  4 HIS ND1  N  21.064 -14.894   1.988 1.00 . A A .  4 HIS ND1  1 1 
        3  2743 1 1  4 HIS NE2  N  22.934 -13.903   2.275 1.00 . A A .  4 HIS NE2  1 1 
        3  2744 1 1  4 HIS O    O  17.008 -12.553  -0.014 1.00 . A A .  4 HIS O    1 1 
        3  2745 1 1  5 HIS C    C  17.169  -9.610  -2.822 1.00 . A A .  5 HIS C    1 1 
        3  2746 1 1  5 HIS CA   C  16.707 -10.213  -1.487 1.00 . A A .  5 HIS CA   1 1 
        3  2747 1 1  5 HIS CB   C  15.749  -9.241  -0.786 1.00 . A A .  5 HIS CB   1 1 
        3  2748 1 1  5 HIS CD2  C  15.130  -9.805   1.675 1.00 . A A .  5 HIS CD2  1 1 
        3  2749 1 1  5 HIS CE1  C  13.378 -11.054   1.272 1.00 . A A .  5 HIS CE1  1 1 
        3  2750 1 1  5 HIS CG   C  14.970  -9.864   0.331 1.00 . A A .  5 HIS CG   1 1 
        3  2751 1 1  5 HIS H    H  18.576  -9.908  -0.510 1.00 . A A .  5 HIS H    1 1 
        3  2752 1 1  5 HIS HA   H  16.173 -11.129  -1.699 1.00 . A A .  5 HIS HA   1 1 
        3  2753 1 1  5 HIS HB2  H  16.316  -8.416  -0.377 1.00 . A A .  5 HIS HB2  1 1 
        3  2754 1 1  5 HIS HB3  H  15.042  -8.859  -1.509 1.00 . A A .  5 HIS HB3  1 1 
        3  2755 1 1  5 HIS HD1  H  13.493 -10.897  -0.760 1.00 . A A .  5 HIS HD1  1 1 
        3  2756 1 1  5 HIS HD2  H  15.906  -9.272   2.207 1.00 . A A .  5 HIS HD2  1 1 
        3  2757 1 1  5 HIS HE1  H  12.514 -11.688   1.406 1.00 . A A .  5 HIS HE1  1 1 
        3  2758 1 1  5 HIS HE2  H  13.841 -10.494   3.176 1.00 . A A .  5 HIS HE2  1 1 
        3  2759 1 1  5 HIS N    N  17.842 -10.553  -0.612 1.00 . A A .  5 HIS N    1 1 
        3  2760 1 1  5 HIS ND1  N  13.865 -10.655   0.117 1.00 . A A .  5 HIS ND1  1 1 
        3  2761 1 1  5 HIS NE2  N  14.125 -10.554   2.236 1.00 . A A .  5 HIS NE2  1 1 
        3  2762 1 1  5 HIS O    O  16.502  -9.777  -3.847 1.00 . A A .  5 HIS O    1 1 
        3  2763 1 1  6 HIS C    C  17.891  -7.118  -4.475 1.00 . A A .  6 HIS C    1 1 
        3  2764 1 1  6 HIS CA   C  18.842  -8.233  -3.989 1.00 . A A .  6 HIS CA   1 1 
        3  2765 1 1  6 HIS CB   C  19.123  -9.237  -5.117 1.00 . A A .  6 HIS CB   1 1 
        3  2766 1 1  6 HIS CD2  C  19.981 -11.581  -4.386 1.00 . A A .  6 HIS CD2  1 1 
        3  2767 1 1  6 HIS CE1  C  22.128 -11.146  -4.385 1.00 . A A .  6 HIS CE1  1 1 
        3  2768 1 1  6 HIS CG   C  20.134 -10.284  -4.749 1.00 . A A .  6 HIS CG   1 1 
        3  2769 1 1  6 HIS H    H  18.821  -8.876  -1.969 1.00 . A A .  6 HIS H    1 1 
        3  2770 1 1  6 HIS HA   H  19.776  -7.773  -3.696 1.00 . A A .  6 HIS HA   1 1 
        3  2771 1 1  6 HIS HB2  H  18.203  -9.740  -5.379 1.00 . A A .  6 HIS HB2  1 1 
        3  2772 1 1  6 HIS HB3  H  19.493  -8.706  -5.982 1.00 . A A .  6 HIS HB3  1 1 
        3  2773 1 1  6 HIS HD1  H  21.928  -9.191  -4.940 1.00 . A A .  6 HIS HD1  1 1 
        3  2774 1 1  6 HIS HD2  H  19.047 -12.115  -4.289 1.00 . A A .  6 HIS HD2  1 1 
        3  2775 1 1  6 HIS HE1  H  23.201 -11.255  -4.293 1.00 . A A .  6 HIS HE1  1 1 
        3  2776 1 1  6 HIS HE2  H  21.437 -12.975  -3.789 1.00 . A A .  6 HIS HE2  1 1 
        3  2777 1 1  6 HIS N    N  18.312  -8.923  -2.804 1.00 . A A .  6 HIS N    1 1 
        3  2778 1 1  6 HIS ND1  N  21.493 -10.047  -4.733 1.00 . A A .  6 HIS ND1  1 1 
        3  2779 1 1  6 HIS NE2  N  21.238 -12.089  -4.167 1.00 . A A .  6 HIS NE2  1 1 
        3  2780 1 1  6 HIS O    O  16.878  -6.830  -3.833 1.00 . A A .  6 HIS O    1 1 
        3  2781 1 1  7 HIS C    C  17.604  -4.117  -5.287 1.00 . A A .  7 HIS C    1 1 
        3  2782 1 1  7 HIS CA   C  17.466  -5.371  -6.173 1.00 . A A .  7 HIS CA   1 1 
        3  2783 1 1  7 HIS CB   C  15.986  -5.745  -6.366 1.00 . A A .  7 HIS CB   1 1 
        3  2784 1 1  7 HIS CD2  C  15.409  -8.257  -6.729 1.00 . A A .  7 HIS CD2  1 1 
        3  2785 1 1  7 HIS CE1  C  15.758  -8.357  -8.888 1.00 . A A .  7 HIS CE1  1 1 
        3  2786 1 1  7 HIS CG   C  15.789  -7.020  -7.137 1.00 . A A .  7 HIS CG   1 1 
        3  2787 1 1  7 HIS H    H  19.023  -6.813  -6.099 1.00 . A A .  7 HIS H    1 1 
        3  2788 1 1  7 HIS HA   H  17.893  -5.149  -7.143 1.00 . A A .  7 HIS HA   1 1 
        3  2789 1 1  7 HIS HB2  H  15.521  -5.865  -5.397 1.00 . A A .  7 HIS HB2  1 1 
        3  2790 1 1  7 HIS HB3  H  15.488  -4.950  -6.902 1.00 . A A .  7 HIS HB3  1 1 
        3  2791 1 1  7 HIS HD1  H  16.287  -6.393  -9.088 1.00 . A A .  7 HIS HD1  1 1 
        3  2792 1 1  7 HIS HD2  H  15.164  -8.552  -5.718 1.00 . A A .  7 HIS HD2  1 1 
        3  2793 1 1  7 HIS HE1  H  15.844  -8.726  -9.899 1.00 . A A .  7 HIS HE1  1 1 
        3  2794 1 1  7 HIS HE2  H  14.984  -9.955  -7.885 1.00 . A A .  7 HIS HE2  1 1 
        3  2795 1 1  7 HIS N    N  18.230  -6.501  -5.615 1.00 . A A .  7 HIS N    1 1 
        3  2796 1 1  7 HIS ND1  N  15.999  -7.122  -8.495 1.00 . A A .  7 HIS ND1  1 1 
        3  2797 1 1  7 HIS NE2  N  15.399  -9.066  -7.840 1.00 . A A .  7 HIS NE2  1 1 
        3  2798 1 1  7 HIS O    O  17.610  -4.206  -4.061 1.00 . A A .  7 HIS O    1 1 
        3  2799 1 1  8 HIS C    C  17.062  -0.551  -5.472 1.00 . A A .  8 HIS C    1 1 
        3  2800 1 1  8 HIS CA   C  18.027  -1.714  -5.163 1.00 . A A .  8 HIS CA   1 1 
        3  2801 1 1  8 HIS CB   C  19.463  -1.268  -5.471 1.00 . A A .  8 HIS CB   1 1 
        3  2802 1 1  8 HIS CD2  C  21.213  -2.544  -4.039 1.00 . A A .  8 HIS CD2  1 1 
        3  2803 1 1  8 HIS CE1  C  21.801  -4.050  -5.514 1.00 . A A .  8 HIS CE1  1 1 
        3  2804 1 1  8 HIS CG   C  20.497  -2.310  -5.162 1.00 . A A .  8 HIS CG   1 1 
        3  2805 1 1  8 HIS H    H  17.623  -2.906  -6.883 1.00 . A A .  8 HIS H    1 1 
        3  2806 1 1  8 HIS HA   H  17.962  -1.942  -4.108 1.00 . A A .  8 HIS HA   1 1 
        3  2807 1 1  8 HIS HB2  H  19.541  -1.025  -6.521 1.00 . A A .  8 HIS HB2  1 1 
        3  2808 1 1  8 HIS HB3  H  19.693  -0.388  -4.886 1.00 . A A .  8 HIS HB3  1 1 
        3  2809 1 1  8 HIS HD1  H  20.558  -3.367  -6.986 1.00 . A A .  8 HIS HD1  1 1 
        3  2810 1 1  8 HIS HD2  H  21.164  -1.979  -3.117 1.00 . A A .  8 HIS HD2  1 1 
        3  2811 1 1  8 HIS HE1  H  22.287  -4.889  -5.986 1.00 . A A .  8 HIS HE1  1 1 
        3  2812 1 1  8 HIS HE2  H  22.723  -3.960  -3.693 1.00 . A A .  8 HIS HE2  1 1 
        3  2813 1 1  8 HIS N    N  17.725  -2.945  -5.909 1.00 . A A .  8 HIS N    1 1 
        3  2814 1 1  8 HIS ND1  N  20.893  -3.272  -6.068 1.00 . A A .  8 HIS ND1  1 1 
        3  2815 1 1  8 HIS NE2  N  22.012  -3.629  -4.286 1.00 . A A .  8 HIS NE2  1 1 
        3  2816 1 1  8 HIS O    O  16.731  -0.300  -6.631 1.00 . A A .  8 HIS O    1 1 
        3  2817 1 1  9 SER C    C  14.606   1.551  -5.141 1.00 . A A .  9 SER C    1 1 
        3  2818 1 1  9 SER CA   C  15.969   1.454  -4.423 1.00 . A A .  9 SER CA   1 1 
        3  2819 1 1  9 SER CB   C  16.937   2.508  -4.995 1.00 . A A .  9 SER CB   1 1 
        3  2820 1 1  9 SER H    H  16.668  -0.345  -3.527 1.00 . A A .  9 SER H    1 1 
        3  2821 1 1  9 SER HA   H  15.796   1.713  -3.388 1.00 . A A .  9 SER HA   1 1 
        3  2822 1 1  9 SER HB2  H  16.470   3.481  -4.951 1.00 . A A .  9 SER HB2  1 1 
        3  2823 1 1  9 SER HB3  H  17.839   2.521  -4.399 1.00 . A A .  9 SER HB3  1 1 
        3  2824 1 1  9 SER HG   H  18.062   2.767  -6.576 1.00 . A A .  9 SER HG   1 1 
        3  2825 1 1  9 SER N    N  16.598   0.105  -4.396 1.00 . A A .  9 SER N    1 1 
        3  2826 1 1  9 SER O    O  13.629   1.996  -4.535 1.00 . A A .  9 SER O    1 1 
        3  2827 1 1  9 SER OG   O  17.289   2.239  -6.341 1.00 . A A .  9 SER OG   1 1 
        3  2828 1 1 10 HIS C    C  12.103   0.505  -6.840 1.00 . A A . 10 HIS C    1 1 
        3  2829 1 1 10 HIS CA   C  13.312   1.393  -7.231 1.00 . A A . 10 HIS CA   1 1 
        3  2830 1 1 10 HIS CB   C  13.631   1.232  -8.727 1.00 . A A . 10 HIS CB   1 1 
        3  2831 1 1 10 HIS CD2  C  13.637  -1.312  -9.270 1.00 . A A . 10 HIS CD2  1 1 
        3  2832 1 1 10 HIS CE1  C  15.770  -1.534  -9.691 1.00 . A A . 10 HIS CE1  1 1 
        3  2833 1 1 10 HIS CG   C  14.215  -0.099  -9.099 1.00 . A A . 10 HIS CG   1 1 
        3  2834 1 1 10 HIS H    H  15.308   0.747  -6.831 1.00 . A A . 10 HIS H    1 1 
        3  2835 1 1 10 HIS HA   H  13.021   2.422  -7.069 1.00 . A A . 10 HIS HA   1 1 
        3  2836 1 1 10 HIS HB2  H  12.723   1.363  -9.297 1.00 . A A . 10 HIS HB2  1 1 
        3  2837 1 1 10 HIS HB3  H  14.339   1.996  -9.017 1.00 . A A . 10 HIS HB3  1 1 
        3  2838 1 1 10 HIS HD1  H  16.240   0.422  -9.342 1.00 . A A . 10 HIS HD1  1 1 
        3  2839 1 1 10 HIS HD2  H  12.592  -1.548  -9.140 1.00 . A A . 10 HIS HD2  1 1 
        3  2840 1 1 10 HIS HE1  H  16.727  -1.960  -9.953 1.00 . A A . 10 HIS HE1  1 1 
        3  2841 1 1 10 HIS HE2  H  14.469  -3.052 -10.074 1.00 . A A . 10 HIS HE2  1 1 
        3  2842 1 1 10 HIS N    N  14.528   1.168  -6.417 1.00 . A A . 10 HIS N    1 1 
        3  2843 1 1 10 HIS ND1  N  15.551  -0.278  -9.371 1.00 . A A . 10 HIS ND1  1 1 
        3  2844 1 1 10 HIS NE2  N  14.628  -2.187  -9.638 1.00 . A A . 10 HIS NE2  1 1 
        3  2845 1 1 10 HIS O    O  11.390   0.000  -7.708 1.00 . A A . 10 HIS O    1 1 
        3  2846 1 1 11 MET C    C   9.684   0.818  -4.513 1.00 . A A . 11 MET C    1 1 
        3  2847 1 1 11 MET CA   C  10.631  -0.272  -5.038 1.00 . A A . 11 MET CA   1 1 
        3  2848 1 1 11 MET CB   C  10.941  -1.281  -3.926 1.00 . A A . 11 MET CB   1 1 
        3  2849 1 1 11 MET CE   C  12.989  -4.922  -3.937 1.00 . A A . 11 MET CE   1 1 
        3  2850 1 1 11 MET CG   C  11.713  -2.502  -4.404 1.00 . A A . 11 MET CG   1 1 
        3  2851 1 1 11 MET H    H  12.553   0.605  -4.900 1.00 . A A . 11 MET H    1 1 
        3  2852 1 1 11 MET HA   H  10.149  -0.785  -5.858 1.00 . A A . 11 MET HA   1 1 
        3  2853 1 1 11 MET HB2  H  11.524  -0.790  -3.162 1.00 . A A . 11 MET HB2  1 1 
        3  2854 1 1 11 MET HB3  H  10.008  -1.621  -3.491 1.00 . A A . 11 MET HB3  1 1 
        3  2855 1 1 11 MET HE1  H  13.816  -4.549  -4.523 1.00 . A A . 11 MET HE1  1 1 
        3  2856 1 1 11 MET HE2  H  12.260  -5.373  -4.593 1.00 . A A . 11 MET HE2  1 1 
        3  2857 1 1 11 MET HE3  H  13.348  -5.661  -3.236 1.00 . A A . 11 MET HE3  1 1 
        3  2858 1 1 11 MET HG2  H  11.082  -3.074  -5.069 1.00 . A A . 11 MET HG2  1 1 
        3  2859 1 1 11 MET HG3  H  12.594  -2.171  -4.939 1.00 . A A . 11 MET HG3  1 1 
        3  2860 1 1 11 MET N    N  11.872   0.331  -5.541 1.00 . A A . 11 MET N    1 1 
        3  2861 1 1 11 MET O    O   8.463   0.685  -4.582 1.00 . A A . 11 MET O    1 1 
        3  2862 1 1 11 MET SD   S  12.233  -3.565  -3.043 1.00 . A A . 11 MET SD   1 1 
        3  2863 1 1 12 LEU C    C   9.085   3.962  -4.702 1.00 . A A . 12 LEU C    1 1 
        3  2864 1 1 12 LEU CA   C   9.485   3.054  -3.515 1.00 . A A . 12 LEU CA   1 1 
        3  2865 1 1 12 LEU CB   C  10.272   3.832  -2.432 1.00 . A A . 12 LEU CB   1 1 
        3  2866 1 1 12 LEU CD1  C  10.082   5.279  -0.368 1.00 . A A . 12 LEU CD1  1 1 
        3  2867 1 1 12 LEU CD2  C   9.664   6.296  -2.614 1.00 . A A . 12 LEU CD2  1 1 
        3  2868 1 1 12 LEU CG   C   9.537   5.024  -1.771 1.00 . A A . 12 LEU CG   1 1 
        3  2869 1 1 12 LEU H    H  11.240   1.916  -3.899 1.00 . A A . 12 LEU H    1 1 
        3  2870 1 1 12 LEU HA   H   8.578   2.670  -3.068 1.00 . A A . 12 LEU HA   1 1 
        3  2871 1 1 12 LEU HB2  H  10.543   3.130  -1.654 1.00 . A A . 12 LEU HB2  1 1 
        3  2872 1 1 12 LEU HB3  H  11.183   4.203  -2.879 1.00 . A A . 12 LEU HB3  1 1 
        3  2873 1 1 12 LEU HD11 H  11.141   5.491  -0.423 1.00 . A A . 12 LEU HD11 1 1 
        3  2874 1 1 12 LEU HD12 H   9.922   4.406   0.246 1.00 . A A . 12 LEU HD12 1 1 
        3  2875 1 1 12 LEU HD13 H   9.570   6.123   0.071 1.00 . A A . 12 LEU HD13 1 1 
        3  2876 1 1 12 LEU HD21 H   9.152   7.111  -2.121 1.00 . A A . 12 LEU HD21 1 1 
        3  2877 1 1 12 LEU HD22 H   9.222   6.132  -3.586 1.00 . A A . 12 LEU HD22 1 1 
        3  2878 1 1 12 LEU HD23 H  10.707   6.548  -2.734 1.00 . A A . 12 LEU HD23 1 1 
        3  2879 1 1 12 LEU HG   H   8.486   4.787  -1.681 1.00 . A A . 12 LEU HG   1 1 
        3  2880 1 1 12 LEU N    N  10.264   1.896  -3.980 1.00 . A A . 12 LEU N    1 1 
        3  2881 1 1 12 LEU O    O   7.936   4.415  -4.777 1.00 . A A . 12 LEU O    1 1 
        3  2882 1 1 13 PRO C    C   8.841   3.992  -7.805 1.00 . A A . 13 PRO C    1 1 
        3  2883 1 1 13 PRO CA   C   9.687   4.922  -6.913 1.00 . A A . 13 PRO CA   1 1 
        3  2884 1 1 13 PRO CB   C  11.057   5.209  -7.563 1.00 . A A . 13 PRO CB   1 1 
        3  2885 1 1 13 PRO CD   C  11.484   4.092  -5.496 1.00 . A A . 13 PRO CD   1 1 
        3  2886 1 1 13 PRO CG   C  12.042   5.114  -6.445 1.00 . A A . 13 PRO CG   1 1 
        3  2887 1 1 13 PRO HA   H   9.155   5.852  -6.757 1.00 . A A . 13 PRO HA   1 1 
        3  2888 1 1 13 PRO HB2  H  11.260   4.475  -8.332 1.00 . A A . 13 PRO HB2  1 1 
        3  2889 1 1 13 PRO HB3  H  11.052   6.198  -8.000 1.00 . A A . 13 PRO HB3  1 1 
        3  2890 1 1 13 PRO HD2  H  11.774   3.094  -5.794 1.00 . A A . 13 PRO HD2  1 1 
        3  2891 1 1 13 PRO HD3  H  11.811   4.295  -4.486 1.00 . A A . 13 PRO HD3  1 1 
        3  2892 1 1 13 PRO HG2  H  13.001   4.793  -6.826 1.00 . A A . 13 PRO HG2  1 1 
        3  2893 1 1 13 PRO HG3  H  12.134   6.073  -5.954 1.00 . A A . 13 PRO HG3  1 1 
        3  2894 1 1 13 PRO N    N  10.028   4.281  -5.628 1.00 . A A . 13 PRO N    1 1 
        3  2895 1 1 13 PRO O    O   9.173   2.818  -7.981 1.00 . A A . 13 PRO O    1 1 
        3  2896 1 1 14 PRO C    C   7.430   3.043 -10.422 1.00 . A A . 14 PRO C    1 1 
        3  2897 1 1 14 PRO CA   C   6.800   3.671  -9.162 1.00 . A A . 14 PRO CA   1 1 
        3  2898 1 1 14 PRO CB   C   5.677   4.656  -9.544 1.00 . A A . 14 PRO CB   1 1 
        3  2899 1 1 14 PRO CD   C   7.309   5.908  -8.335 1.00 . A A . 14 PRO CD   1 1 
        3  2900 1 1 14 PRO CG   C   5.836   5.808  -8.607 1.00 . A A . 14 PRO CG   1 1 
        3  2901 1 1 14 PRO HA   H   6.384   2.882  -8.548 1.00 . A A . 14 PRO HA   1 1 
        3  2902 1 1 14 PRO HB2  H   5.797   4.966 -10.574 1.00 . A A . 14 PRO HB2  1 1 
        3  2903 1 1 14 PRO HB3  H   4.715   4.176  -9.421 1.00 . A A . 14 PRO HB3  1 1 
        3  2904 1 1 14 PRO HD2  H   7.799   6.493  -9.103 1.00 . A A . 14 PRO HD2  1 1 
        3  2905 1 1 14 PRO HD3  H   7.487   6.335  -7.359 1.00 . A A . 14 PRO HD3  1 1 
        3  2906 1 1 14 PRO HG2  H   5.475   6.717  -9.073 1.00 . A A . 14 PRO HG2  1 1 
        3  2907 1 1 14 PRO HG3  H   5.295   5.619  -7.689 1.00 . A A . 14 PRO HG3  1 1 
        3  2908 1 1 14 PRO N    N   7.736   4.500  -8.384 1.00 . A A . 14 PRO N    1 1 
        3  2909 1 1 14 PRO O    O   7.582   3.704 -11.453 1.00 . A A . 14 PRO O    1 1 
        3  2910 1 1 15 GLU C    C   7.812  -0.440 -11.461 1.00 . A A . 15 GLU C    1 1 
        3  2911 1 1 15 GLU CA   C   8.319   1.011 -11.478 1.00 . A A . 15 GLU CA   1 1 
        3  2912 1 1 15 GLU CB   C   9.855   1.030 -11.527 1.00 . A A . 15 GLU CB   1 1 
        3  2913 1 1 15 GLU CD   C  11.938   0.386 -12.845 1.00 . A A . 15 GLU CD   1 1 
        3  2914 1 1 15 GLU CG   C  10.432   0.237 -12.699 1.00 . A A . 15 GLU CG   1 1 
        3  2915 1 1 15 GLU H    H   7.785   1.332  -9.443 1.00 . A A . 15 GLU H    1 1 
        3  2916 1 1 15 GLU HA   H   7.941   1.492 -12.372 1.00 . A A . 15 GLU HA   1 1 
        3  2917 1 1 15 GLU HB2  H  10.186   2.054 -11.611 1.00 . A A . 15 GLU HB2  1 1 
        3  2918 1 1 15 GLU HB3  H  10.240   0.608 -10.610 1.00 . A A . 15 GLU HB3  1 1 
        3  2919 1 1 15 GLU HG2  H  10.201  -0.809 -12.554 1.00 . A A . 15 GLU HG2  1 1 
        3  2920 1 1 15 GLU HG3  H   9.962   0.579 -13.611 1.00 . A A . 15 GLU HG3  1 1 
        3  2921 1 1 15 GLU N    N   7.818   1.768 -10.321 1.00 . A A . 15 GLU N    1 1 
        3  2922 1 1 15 GLU O    O   7.170  -0.895 -12.409 1.00 . A A . 15 GLU O    1 1 
        3  2923 1 1 15 GLU OE1  O  12.687  -0.384 -12.205 1.00 . A A . 15 GLU OE1  1 1 
        3  2924 1 1 15 GLU OE2  O  12.375   1.268 -13.618 1.00 . A A . 15 GLU OE2  1 1 
        3  2925 1 1 16 GLN C    C   7.307  -2.903  -8.795 1.00 . A A . 16 GLN C    1 1 
        3  2926 1 1 16 GLN CA   C   7.662  -2.561 -10.252 1.00 . A A . 16 GLN CA   1 1 
        3  2927 1 1 16 GLN CB   C   8.747  -3.517 -10.775 1.00 . A A . 16 GLN CB   1 1 
        3  2928 1 1 16 GLN CD   C   9.423  -5.911 -11.291 1.00 . A A . 16 GLN CD   1 1 
        3  2929 1 1 16 GLN CG   C   8.350  -4.991 -10.730 1.00 . A A . 16 GLN CG   1 1 
        3  2930 1 1 16 GLN H    H   8.637  -0.764  -9.667 1.00 . A A . 16 GLN H    1 1 
        3  2931 1 1 16 GLN HA   H   6.773  -2.682 -10.858 1.00 . A A . 16 GLN HA   1 1 
        3  2932 1 1 16 GLN HB2  H   8.973  -3.259 -11.801 1.00 . A A . 16 GLN HB2  1 1 
        3  2933 1 1 16 GLN HB3  H   9.640  -3.389 -10.177 1.00 . A A . 16 GLN HB3  1 1 
        3  2934 1 1 16 GLN HE21 H   8.051  -7.212 -11.890 1.00 . A A . 16 GLN HE21 1 1 
        3  2935 1 1 16 GLN HE22 H   9.696  -7.626 -12.237 1.00 . A A . 16 GLN HE22 1 1 
        3  2936 1 1 16 GLN HG2  H   8.163  -5.269  -9.701 1.00 . A A . 16 GLN HG2  1 1 
        3  2937 1 1 16 GLN HG3  H   7.443  -5.124 -11.305 1.00 . A A . 16 GLN HG3  1 1 
        3  2938 1 1 16 GLN N    N   8.105  -1.167 -10.385 1.00 . A A . 16 GLN N    1 1 
        3  2939 1 1 16 GLN NE2  N   9.016  -7.030 -11.859 1.00 . A A . 16 GLN NE2  1 1 
        3  2940 1 1 16 GLN O    O   8.184  -3.173  -7.975 1.00 . A A . 16 GLN O    1 1 
        3  2941 1 1 16 GLN OE1  O  10.613  -5.619 -11.216 1.00 . A A . 16 GLN OE1  1 1 
        3  2942 1 1 17 TRP C    C   5.202  -4.706  -7.010 1.00 . A A . 17 TRP C    1 1 
        3  2943 1 1 17 TRP CA   C   5.535  -3.212  -7.135 1.00 . A A . 17 TRP CA   1 1 
        3  2944 1 1 17 TRP CB   C   4.301  -2.367  -6.781 1.00 . A A . 17 TRP CB   1 1 
        3  2945 1 1 17 TRP CD1  C   4.636   0.028  -7.653 1.00 . A A . 17 TRP CD1  1 1 
        3  2946 1 1 17 TRP CD2  C   4.881  -0.190  -5.437 1.00 . A A . 17 TRP CD2  1 1 
        3  2947 1 1 17 TRP CE2  C   5.087   1.160  -5.780 1.00 . A A . 17 TRP CE2  1 1 
        3  2948 1 1 17 TRP CE3  C   4.987  -0.568  -4.095 1.00 . A A . 17 TRP CE3  1 1 
        3  2949 1 1 17 TRP CG   C   4.593  -0.900  -6.649 1.00 . A A . 17 TRP CG   1 1 
        3  2950 1 1 17 TRP CH2  C   5.483   1.734  -3.522 1.00 . A A . 17 TRP CH2  1 1 
        3  2951 1 1 17 TRP CZ2  C   5.386   2.133  -4.829 1.00 . A A . 17 TRP CZ2  1 1 
        3  2952 1 1 17 TRP CZ3  C   5.283   0.398  -3.152 1.00 . A A . 17 TRP CZ3  1 1 
        3  2953 1 1 17 TRP H    H   5.363  -2.644  -9.171 1.00 . A A . 17 TRP H    1 1 
        3  2954 1 1 17 TRP HA   H   6.328  -2.977  -6.437 1.00 . A A . 17 TRP HA   1 1 
        3  2955 1 1 17 TRP HB2  H   3.554  -2.492  -7.552 1.00 . A A . 17 TRP HB2  1 1 
        3  2956 1 1 17 TRP HB3  H   3.894  -2.712  -5.839 1.00 . A A . 17 TRP HB3  1 1 
        3  2957 1 1 17 TRP HD1  H   4.462  -0.194  -8.697 1.00 . A A . 17 TRP HD1  1 1 
        3  2958 1 1 17 TRP HE1  H   5.015   2.092  -7.654 1.00 . A A . 17 TRP HE1  1 1 
        3  2959 1 1 17 TRP HE3  H   4.838  -1.593  -3.790 1.00 . A A . 17 TRP HE3  1 1 
        3  2960 1 1 17 TRP HH2  H   5.714   2.456  -2.752 1.00 . A A . 17 TRP HH2  1 1 
        3  2961 1 1 17 TRP HZ2  H   5.540   3.166  -5.098 1.00 . A A . 17 TRP HZ2  1 1 
        3  2962 1 1 17 TRP HZ3  H   5.369   0.123  -2.109 1.00 . A A . 17 TRP HZ3  1 1 
        3  2963 1 1 17 TRP N    N   6.014  -2.883  -8.482 1.00 . A A . 17 TRP N    1 1 
        3  2964 1 1 17 TRP NE1  N   4.930   1.268  -7.138 1.00 . A A . 17 TRP NE1  1 1 
        3  2965 1 1 17 TRP O    O   4.157  -5.163  -7.480 1.00 . A A . 17 TRP O    1 1 
        3  2966 1 1 18 SER C    C   4.706  -7.096  -5.154 1.00 . A A . 18 SER C    1 1 
        3  2967 1 1 18 SER CA   C   5.863  -6.896  -6.147 1.00 . A A . 18 SER CA   1 1 
        3  2968 1 1 18 SER CB   C   7.137  -7.570  -5.610 1.00 . A A . 18 SER CB   1 1 
        3  2969 1 1 18 SER H    H   6.945  -5.064  -6.094 1.00 . A A . 18 SER H    1 1 
        3  2970 1 1 18 SER HA   H   5.595  -7.353  -7.091 1.00 . A A . 18 SER HA   1 1 
        3  2971 1 1 18 SER HB2  H   7.424  -7.102  -4.680 1.00 . A A . 18 SER HB2  1 1 
        3  2972 1 1 18 SER HB3  H   6.941  -8.618  -5.438 1.00 . A A . 18 SER HB3  1 1 
        3  2973 1 1 18 SER HG   H   7.889  -7.568  -7.428 1.00 . A A . 18 SER HG   1 1 
        3  2974 1 1 18 SER N    N   6.100  -5.468  -6.390 1.00 . A A . 18 SER N    1 1 
        3  2975 1 1 18 SER O    O   4.577  -6.346  -4.186 1.00 . A A . 18 SER O    1 1 
        3  2976 1 1 18 SER OG   O   8.217  -7.452  -6.528 1.00 . A A . 18 SER OG   1 1 
        3  2977 1 1 19 HIS C    C   2.994  -8.327  -3.052 1.00 . A A . 19 HIS C    1 1 
        3  2978 1 1 19 HIS CA   C   2.688  -8.390  -4.562 1.00 . A A . 19 HIS CA   1 1 
        3  2979 1 1 19 HIS CB   C   2.084  -9.759  -4.922 1.00 . A A . 19 HIS CB   1 1 
        3  2980 1 1 19 HIS CD2  C   3.637 -11.652  -5.797 1.00 . A A . 19 HIS CD2  1 1 
        3  2981 1 1 19 HIS CE1  C   4.354 -12.401  -3.868 1.00 . A A . 19 HIS CE1  1 1 
        3  2982 1 1 19 HIS CG   C   3.050 -10.905  -4.830 1.00 . A A . 19 HIS CG   1 1 
        3  2983 1 1 19 HIS H    H   4.052  -8.692  -6.173 1.00 . A A . 19 HIS H    1 1 
        3  2984 1 1 19 HIS HA   H   1.958  -7.626  -4.791 1.00 . A A . 19 HIS HA   1 1 
        3  2985 1 1 19 HIS HB2  H   1.263  -9.969  -4.254 1.00 . A A . 19 HIS HB2  1 1 
        3  2986 1 1 19 HIS HB3  H   1.710  -9.721  -5.936 1.00 . A A . 19 HIS HB3  1 1 
        3  2987 1 1 19 HIS HD1  H   3.280 -11.084  -2.740 1.00 . A A . 19 HIS HD1  1 1 
        3  2988 1 1 19 HIS HD2  H   3.500 -11.543  -6.864 1.00 . A A . 19 HIS HD2  1 1 
        3  2989 1 1 19 HIS HE1  H   4.875 -12.980  -3.121 1.00 . A A . 19 HIS HE1  1 1 
        3  2990 1 1 19 HIS HE2  H   4.865 -13.343  -5.607 1.00 . A A . 19 HIS HE2  1 1 
        3  2991 1 1 19 HIS N    N   3.876  -8.116  -5.397 1.00 . A A . 19 HIS N    1 1 
        3  2992 1 1 19 HIS ND1  N   3.524 -11.405  -3.632 1.00 . A A . 19 HIS ND1  1 1 
        3  2993 1 1 19 HIS NE2  N   4.438 -12.572  -5.169 1.00 . A A . 19 HIS NE2  1 1 
        3  2994 1 1 19 HIS O    O   2.179  -7.853  -2.261 1.00 . A A . 19 HIS O    1 1 
        3  2995 1 1 20 THR C    C   4.796  -7.337  -0.764 1.00 . A A . 20 THR C    1 1 
        3  2996 1 1 20 THR CA   C   4.597  -8.780  -1.254 1.00 . A A . 20 THR CA   1 1 
        3  2997 1 1 20 THR CB   C   5.910  -9.573  -1.050 1.00 . A A . 20 THR CB   1 1 
        3  2998 1 1 20 THR CG2  C   6.288  -9.654   0.429 1.00 . A A . 20 THR CG2  1 1 
        3  2999 1 1 20 THR H    H   4.773  -9.198  -3.330 1.00 . A A . 20 THR H    1 1 
        3  3000 1 1 20 THR HA   H   3.820  -9.248  -0.662 1.00 . A A . 20 THR HA   1 1 
        3  3001 1 1 20 THR HB   H   6.704  -9.071  -1.587 1.00 . A A . 20 THR HB   1 1 
        3  3002 1 1 20 THR HG1  H   6.616 -11.341  -1.599 1.00 . A A . 20 THR HG1  1 1 
        3  3003 1 1 20 THR HG21 H   6.452  -8.659   0.817 1.00 . A A . 20 THR HG21 1 1 
        3  3004 1 1 20 THR HG22 H   7.192 -10.236   0.539 1.00 . A A . 20 THR HG22 1 1 
        3  3005 1 1 20 THR HG23 H   5.489 -10.127   0.982 1.00 . A A . 20 THR HG23 1 1 
        3  3006 1 1 20 THR N    N   4.171  -8.810  -2.661 1.00 . A A . 20 THR N    1 1 
        3  3007 1 1 20 THR O    O   4.369  -6.974   0.335 1.00 . A A . 20 THR O    1 1 
        3  3008 1 1 20 THR OG1  O   5.757 -10.897  -1.582 1.00 . A A . 20 THR OG1  1 1 
        3  3009 1 1 21 THR C    C   4.371  -4.335  -1.113 1.00 . A A . 21 THR C    1 1 
        3  3010 1 1 21 THR CA   C   5.688  -5.105  -1.276 1.00 . A A . 21 THR CA   1 1 
        3  3011 1 1 21 THR CB   C   6.545  -4.423  -2.372 1.00 . A A . 21 THR CB   1 1 
        3  3012 1 1 21 THR CG2  C   6.921  -2.996  -1.979 1.00 . A A . 21 THR CG2  1 1 
        3  3013 1 1 21 THR H    H   5.759  -6.866  -2.455 1.00 . A A . 21 THR H    1 1 
        3  3014 1 1 21 THR HA   H   6.234  -5.066  -0.344 1.00 . A A . 21 THR HA   1 1 
        3  3015 1 1 21 THR HB   H   5.972  -4.389  -3.290 1.00 . A A . 21 THR HB   1 1 
        3  3016 1 1 21 THR HG1  H   8.496  -4.726  -2.226 1.00 . A A . 21 THR HG1  1 1 
        3  3017 1 1 21 THR HG21 H   7.497  -3.012  -1.065 1.00 . A A . 21 THR HG21 1 1 
        3  3018 1 1 21 THR HG22 H   6.023  -2.412  -1.831 1.00 . A A . 21 THR HG22 1 1 
        3  3019 1 1 21 THR HG23 H   7.512  -2.549  -2.766 1.00 . A A . 21 THR HG23 1 1 
        3  3020 1 1 21 THR N    N   5.442  -6.518  -1.596 1.00 . A A . 21 THR N    1 1 
        3  3021 1 1 21 THR O    O   4.232  -3.500  -0.218 1.00 . A A . 21 THR O    1 1 
        3  3022 1 1 21 THR OG1  O   7.740  -5.188  -2.605 1.00 . A A . 21 THR OG1  1 1 
        3  3023 1 1 22 VAL C    C   1.420  -4.280  -0.526 1.00 . A A . 22 VAL C    1 1 
        3  3024 1 1 22 VAL CA   C   2.070  -4.022  -1.898 1.00 . A A . 22 VAL CA   1 1 
        3  3025 1 1 22 VAL CB   C   1.135  -4.560  -3.013 1.00 . A A . 22 VAL CB   1 1 
        3  3026 1 1 22 VAL CG1  C  -0.266  -3.953  -2.905 1.00 . A A . 22 VAL CG1  1 1 
        3  3027 1 1 22 VAL CG2  C   1.734  -4.294  -4.393 1.00 . A A . 22 VAL CG2  1 1 
        3  3028 1 1 22 VAL H    H   3.590  -5.275  -2.698 1.00 . A A . 22 VAL H    1 1 
        3  3029 1 1 22 VAL HA   H   2.186  -2.955  -2.035 1.00 . A A . 22 VAL HA   1 1 
        3  3030 1 1 22 VAL HB   H   1.046  -5.631  -2.888 1.00 . A A . 22 VAL HB   1 1 
        3  3031 1 1 22 VAL HG11 H  -0.890  -4.337  -3.700 1.00 . A A . 22 VAL HG11 1 1 
        3  3032 1 1 22 VAL HG12 H  -0.205  -2.877  -2.985 1.00 . A A . 22 VAL HG12 1 1 
        3  3033 1 1 22 VAL HG13 H  -0.702  -4.217  -1.951 1.00 . A A . 22 VAL HG13 1 1 
        3  3034 1 1 22 VAL HG21 H   1.056  -4.649  -5.157 1.00 . A A . 22 VAL HG21 1 1 
        3  3035 1 1 22 VAL HG22 H   2.679  -4.811  -4.482 1.00 . A A . 22 VAL HG22 1 1 
        3  3036 1 1 22 VAL HG23 H   1.894  -3.233  -4.521 1.00 . A A . 22 VAL HG23 1 1 
        3  3037 1 1 22 VAL N    N   3.403  -4.632  -1.981 1.00 . A A . 22 VAL N    1 1 
        3  3038 1 1 22 VAL O    O   0.944  -3.353   0.132 1.00 . A A . 22 VAL O    1 1 
        3  3039 1 1 23 ARG C    C   1.638  -5.204   2.348 1.00 . A A . 23 ARG C    1 1 
        3  3040 1 1 23 ARG CA   C   0.875  -5.918   1.219 1.00 . A A . 23 ARG CA   1 1 
        3  3041 1 1 23 ARG CB   C   0.964  -7.441   1.413 1.00 . A A . 23 ARG CB   1 1 
        3  3042 1 1 23 ARG CD   C   0.613  -9.428   2.940 1.00 . A A . 23 ARG CD   1 1 
        3  3043 1 1 23 ARG CG   C   0.393  -7.931   2.742 1.00 . A A . 23 ARG CG   1 1 
        3  3044 1 1 23 ARG CZ   C   0.675 -10.763   4.994 1.00 . A A . 23 ARG CZ   1 1 
        3  3045 1 1 23 ARG H    H   1.769  -6.250  -0.683 1.00 . A A . 23 ARG H    1 1 
        3  3046 1 1 23 ARG HA   H  -0.162  -5.617   1.255 1.00 . A A . 23 ARG HA   1 1 
        3  3047 1 1 23 ARG HB2  H   0.418  -7.923   0.614 1.00 . A A . 23 ARG HB2  1 1 
        3  3048 1 1 23 ARG HB3  H   2.003  -7.739   1.358 1.00 . A A . 23 ARG HB3  1 1 
        3  3049 1 1 23 ARG HD2  H   0.122  -9.961   2.138 1.00 . A A . 23 ARG HD2  1 1 
        3  3050 1 1 23 ARG HD3  H   1.676  -9.632   2.906 1.00 . A A . 23 ARG HD3  1 1 
        3  3051 1 1 23 ARG HE   H  -0.787  -9.543   4.498 1.00 . A A . 23 ARG HE   1 1 
        3  3052 1 1 23 ARG HG2  H   0.876  -7.399   3.551 1.00 . A A . 23 ARG HG2  1 1 
        3  3053 1 1 23 ARG HG3  H  -0.670  -7.726   2.761 1.00 . A A . 23 ARG HG3  1 1 
        3  3054 1 1 23 ARG HH11 H   2.247 -11.001   3.796 1.00 . A A . 23 ARG HH11 1 1 
        3  3055 1 1 23 ARG HH12 H   2.274 -11.914   5.265 1.00 . A A . 23 ARG HH12 1 1 
        3  3056 1 1 23 ARG HH21 H  -0.760 -10.768   6.370 1.00 . A A . 23 ARG HH21 1 1 
        3  3057 1 1 23 ARG HH22 H   0.575 -11.816   6.683 1.00 . A A . 23 ARG HH22 1 1 
        3  3058 1 1 23 ARG N    N   1.411  -5.547  -0.098 1.00 . A A . 23 ARG N    1 1 
        3  3059 1 1 23 ARG NE   N   0.077  -9.895   4.218 1.00 . A A . 23 ARG NE   1 1 
        3  3060 1 1 23 ARG NH1  N   1.819 -11.265   4.658 1.00 . A A . 23 ARG NH1  1 1 
        3  3061 1 1 23 ARG NH2  N   0.124 -11.136   6.104 1.00 . A A . 23 ARG NH2  1 1 
        3  3062 1 1 23 ARG O    O   1.037  -4.689   3.297 1.00 . A A . 23 ARG O    1 1 
        3  3063 1 1 24 ASN C    C   3.506  -3.029   3.346 1.00 . A A . 24 ASN C    1 1 
        3  3064 1 1 24 ASN CA   C   3.830  -4.534   3.226 1.00 . A A . 24 ASN CA   1 1 
        3  3065 1 1 24 ASN CB   C   5.309  -4.739   2.835 1.00 . A A . 24 ASN CB   1 1 
        3  3066 1 1 24 ASN CG   C   6.284  -4.623   4.002 1.00 . A A . 24 ASN CG   1 1 
        3  3067 1 1 24 ASN H    H   3.379  -5.601   1.446 1.00 . A A . 24 ASN H    1 1 
        3  3068 1 1 24 ASN HA   H   3.645  -5.008   4.179 1.00 . A A . 24 ASN HA   1 1 
        3  3069 1 1 24 ASN HB2  H   5.422  -5.724   2.406 1.00 . A A . 24 ASN HB2  1 1 
        3  3070 1 1 24 ASN HB3  H   5.582  -4.003   2.092 1.00 . A A . 24 ASN HB3  1 1 
        3  3071 1 1 24 ASN HD21 H   5.119  -3.343   4.962 1.00 . A A . 24 ASN HD21 1 1 
        3  3072 1 1 24 ASN HD22 H   6.594  -3.753   5.748 1.00 . A A . 24 ASN HD22 1 1 
        3  3073 1 1 24 ASN N    N   2.965  -5.175   2.228 1.00 . A A . 24 ASN N    1 1 
        3  3074 1 1 24 ASN ND2  N   5.964  -3.826   5.001 1.00 . A A . 24 ASN ND2  1 1 
        3  3075 1 1 24 ASN O    O   3.505  -2.467   4.446 1.00 . A A . 24 ASN O    1 1 
        3  3076 1 1 24 ASN OD1  O   7.332  -5.257   4.003 1.00 . A A . 24 ASN OD1  1 1 
        3  3077 1 1 25 ALA C    C   1.505  -0.703   2.823 1.00 . A A . 25 ALA C    1 1 
        3  3078 1 1 25 ALA CA   C   2.877  -0.964   2.180 1.00 . A A . 25 ALA CA   1 1 
        3  3079 1 1 25 ALA CB   C   2.900  -0.447   0.745 1.00 . A A . 25 ALA CB   1 1 
        3  3080 1 1 25 ALA H    H   3.262  -2.889   1.365 1.00 . A A . 25 ALA H    1 1 
        3  3081 1 1 25 ALA HA   H   3.631  -0.427   2.742 1.00 . A A . 25 ALA HA   1 1 
        3  3082 1 1 25 ALA HB1  H   2.682   0.612   0.738 1.00 . A A . 25 ALA HB1  1 1 
        3  3083 1 1 25 ALA HB2  H   2.159  -0.971   0.157 1.00 . A A . 25 ALA HB2  1 1 
        3  3084 1 1 25 ALA HB3  H   3.879  -0.613   0.316 1.00 . A A . 25 ALA HB3  1 1 
        3  3085 1 1 25 ALA N    N   3.228  -2.390   2.210 1.00 . A A . 25 ALA N    1 1 
        3  3086 1 1 25 ALA O    O   1.373   0.148   3.704 1.00 . A A . 25 ALA O    1 1 
        3  3087 1 1 26 LEU C    C  -0.916  -1.393   4.448 1.00 . A A . 26 LEU C    1 1 
        3  3088 1 1 26 LEU CA   C  -0.879  -1.311   2.913 1.00 . A A . 26 LEU CA   1 1 
        3  3089 1 1 26 LEU CB   C  -1.789  -2.397   2.322 1.00 . A A . 26 LEU CB   1 1 
        3  3090 1 1 26 LEU CD1  C  -2.859  -3.491   0.318 1.00 . A A . 26 LEU CD1  1 1 
        3  3091 1 1 26 LEU CD2  C  -2.706  -0.983   0.442 1.00 . A A . 26 LEU CD2  1 1 
        3  3092 1 1 26 LEU CG   C  -2.027  -2.307   0.805 1.00 . A A . 26 LEU CG   1 1 
        3  3093 1 1 26 LEU H    H   0.660  -2.118   1.685 1.00 . A A . 26 LEU H    1 1 
        3  3094 1 1 26 LEU HA   H  -1.249  -0.343   2.610 1.00 . A A . 26 LEU HA   1 1 
        3  3095 1 1 26 LEU HB2  H  -1.347  -3.359   2.540 1.00 . A A . 26 LEU HB2  1 1 
        3  3096 1 1 26 LEU HB3  H  -2.749  -2.343   2.818 1.00 . A A . 26 LEU HB3  1 1 
        3  3097 1 1 26 LEU HD11 H  -2.972  -3.435  -0.756 1.00 . A A . 26 LEU HD11 1 1 
        3  3098 1 1 26 LEU HD12 H  -3.833  -3.466   0.784 1.00 . A A . 26 LEU HD12 1 1 
        3  3099 1 1 26 LEU HD13 H  -2.361  -4.415   0.578 1.00 . A A . 26 LEU HD13 1 1 
        3  3100 1 1 26 LEU HD21 H  -3.656  -0.912   0.951 1.00 . A A . 26 LEU HD21 1 1 
        3  3101 1 1 26 LEU HD22 H  -2.865  -0.941  -0.625 1.00 . A A . 26 LEU HD22 1 1 
        3  3102 1 1 26 LEU HD23 H  -2.075  -0.158   0.743 1.00 . A A . 26 LEU HD23 1 1 
        3  3103 1 1 26 LEU HG   H  -1.074  -2.343   0.297 1.00 . A A . 26 LEU HG   1 1 
        3  3104 1 1 26 LEU N    N   0.489  -1.452   2.385 1.00 . A A . 26 LEU N    1 1 
        3  3105 1 1 26 LEU O    O  -1.684  -0.681   5.099 1.00 . A A . 26 LEU O    1 1 
        3  3106 1 1 27 LYS C    C   0.346  -1.118   7.177 1.00 . A A . 27 LYS C    1 1 
        3  3107 1 1 27 LYS CA   C  -0.013  -2.444   6.470 1.00 . A A . 27 LYS CA   1 1 
        3  3108 1 1 27 LYS CB   C   1.023  -3.538   6.809 1.00 . A A . 27 LYS CB   1 1 
        3  3109 1 1 27 LYS CD   C   0.633  -3.550   9.326 1.00 . A A . 27 LYS CD   1 1 
        3  3110 1 1 27 LYS CE   C   0.303  -4.405  10.544 1.00 . A A . 27 LYS CE   1 1 
        3  3111 1 1 27 LYS CG   C   0.689  -4.379   8.046 1.00 . A A . 27 LYS CG   1 1 
        3  3112 1 1 27 LYS H    H   0.498  -2.807   4.438 1.00 . A A . 27 LYS H    1 1 
        3  3113 1 1 27 LYS HA   H  -0.987  -2.767   6.807 1.00 . A A . 27 LYS HA   1 1 
        3  3114 1 1 27 LYS HB2  H   1.104  -4.209   5.964 1.00 . A A . 27 LYS HB2  1 1 
        3  3115 1 1 27 LYS HB3  H   1.986  -3.070   6.969 1.00 . A A . 27 LYS HB3  1 1 
        3  3116 1 1 27 LYS HD2  H   1.593  -3.077   9.482 1.00 . A A . 27 LYS HD2  1 1 
        3  3117 1 1 27 LYS HD3  H  -0.129  -2.789   9.217 1.00 . A A . 27 LYS HD3  1 1 
        3  3118 1 1 27 LYS HE2  H  -0.627  -4.925  10.365 1.00 . A A . 27 LYS HE2  1 1 
        3  3119 1 1 27 LYS HE3  H   1.095  -5.127  10.688 1.00 . A A . 27 LYS HE3  1 1 
        3  3120 1 1 27 LYS HG2  H  -0.273  -4.849   7.897 1.00 . A A . 27 LYS HG2  1 1 
        3  3121 1 1 27 LYS HG3  H   1.445  -5.144   8.156 1.00 . A A . 27 LYS HG3  1 1 
        3  3122 1 1 27 LYS HZ1  H  -0.545  -2.844  11.634 1.00 . A A . 27 LYS HZ1  1 1 
        3  3123 1 1 27 LYS HZ2  H   1.076  -3.137  12.011 1.00 . A A . 27 LYS HZ2  1 1 
        3  3124 1 1 27 LYS HZ3  H  -0.128  -4.182  12.574 1.00 . A A . 27 LYS HZ3  1 1 
        3  3125 1 1 27 LYS N    N  -0.082  -2.263   5.015 1.00 . A A . 27 LYS N    1 1 
        3  3126 1 1 27 LYS NZ   N   0.168  -3.587  11.776 1.00 . A A . 27 LYS NZ   1 1 
        3  3127 1 1 27 LYS O    O  -0.166  -0.816   8.257 1.00 . A A . 27 LYS O    1 1 
        3  3128 1 1 28 ASP C    C   0.524   1.964   7.227 1.00 . A A . 28 ASP C    1 1 
        3  3129 1 1 28 ASP CA   C   1.669   0.939   7.141 1.00 . A A . 28 ASP CA   1 1 
        3  3130 1 1 28 ASP CB   C   2.845   1.503   6.332 1.00 . A A . 28 ASP CB   1 1 
        3  3131 1 1 28 ASP CG   C   3.579   2.615   7.066 1.00 . A A . 28 ASP CG   1 1 
        3  3132 1 1 28 ASP H    H   1.533  -0.577   5.659 1.00 . A A . 28 ASP H    1 1 
        3  3133 1 1 28 ASP HA   H   2.010   0.721   8.144 1.00 . A A . 28 ASP HA   1 1 
        3  3134 1 1 28 ASP HB2  H   3.548   0.708   6.132 1.00 . A A . 28 ASP HB2  1 1 
        3  3135 1 1 28 ASP HB3  H   2.475   1.894   5.393 1.00 . A A . 28 ASP HB3  1 1 
        3  3136 1 1 28 ASP N    N   1.209  -0.320   6.547 1.00 . A A . 28 ASP N    1 1 
        3  3137 1 1 28 ASP O    O   0.348   2.627   8.249 1.00 . A A . 28 ASP O    1 1 
        3  3138 1 1 28 ASP OD1  O   3.885   2.436   8.265 1.00 . A A . 28 ASP OD1  1 1 
        3  3139 1 1 28 ASP OD2  O   3.866   3.665   6.449 1.00 . A A . 28 ASP OD2  1 1 
        3  3140 1 1 29 LEU C    C  -2.500   2.459   7.134 1.00 . A A . 29 LEU C    1 1 
        3  3141 1 1 29 LEU CA   C  -1.437   2.957   6.139 1.00 . A A . 29 LEU CA   1 1 
        3  3142 1 1 29 LEU CB   C  -2.041   3.044   4.723 1.00 . A A . 29 LEU CB   1 1 
        3  3143 1 1 29 LEU CD1  C  -0.974   5.261   4.140 1.00 . A A . 29 LEU CD1  1 1 
        3  3144 1 1 29 LEU CD2  C   0.101   3.119   3.370 1.00 . A A . 29 LEU CD2  1 1 
        3  3145 1 1 29 LEU CG   C  -1.218   3.826   3.678 1.00 . A A . 29 LEU CG   1 1 
        3  3146 1 1 29 LEU H    H  -0.045   1.552   5.354 1.00 . A A . 29 LEU H    1 1 
        3  3147 1 1 29 LEU HA   H  -1.112   3.944   6.445 1.00 . A A . 29 LEU HA   1 1 
        3  3148 1 1 29 LEU HB2  H  -2.177   2.036   4.355 1.00 . A A . 29 LEU HB2  1 1 
        3  3149 1 1 29 LEU HB3  H  -3.013   3.510   4.799 1.00 . A A . 29 LEU HB3  1 1 
        3  3150 1 1 29 LEU HD11 H  -0.444   5.254   5.082 1.00 . A A . 29 LEU HD11 1 1 
        3  3151 1 1 29 LEU HD12 H  -1.923   5.763   4.267 1.00 . A A . 29 LEU HD12 1 1 
        3  3152 1 1 29 LEU HD13 H  -0.388   5.785   3.400 1.00 . A A . 29 LEU HD13 1 1 
        3  3153 1 1 29 LEU HD21 H   0.696   3.054   4.270 1.00 . A A . 29 LEU HD21 1 1 
        3  3154 1 1 29 LEU HD22 H   0.643   3.676   2.619 1.00 . A A . 29 LEU HD22 1 1 
        3  3155 1 1 29 LEU HD23 H  -0.102   2.125   3.000 1.00 . A A . 29 LEU HD23 1 1 
        3  3156 1 1 29 LEU HG   H  -1.785   3.877   2.757 1.00 . A A . 29 LEU HG   1 1 
        3  3157 1 1 29 LEU N    N  -0.260   2.076   6.153 1.00 . A A . 29 LEU N    1 1 
        3  3158 1 1 29 LEU O    O  -3.109   3.246   7.861 1.00 . A A . 29 LEU O    1 1 
        3  3159 1 1 30 LEU C    C  -3.326   0.846   9.554 1.00 . A A . 30 LEU C    1 1 
        3  3160 1 1 30 LEU CA   C  -3.646   0.504   8.085 1.00 . A A . 30 LEU CA   1 1 
        3  3161 1 1 30 LEU CB   C  -3.609  -1.019   7.878 1.00 . A A . 30 LEU CB   1 1 
        3  3162 1 1 30 LEU CD1  C  -6.046  -1.427   8.350 1.00 . A A . 30 LEU CD1  1 1 
        3  3163 1 1 30 LEU CD2  C  -4.407  -3.327   8.502 1.00 . A A . 30 LEU CD2  1 1 
        3  3164 1 1 30 LEU CG   C  -4.620  -1.828   8.706 1.00 . A A . 30 LEU CG   1 1 
        3  3165 1 1 30 LEU H    H  -2.195   0.577   6.537 1.00 . A A . 30 LEU H    1 1 
        3  3166 1 1 30 LEU HA   H  -4.635   0.866   7.848 1.00 . A A . 30 LEU HA   1 1 
        3  3167 1 1 30 LEU HB2  H  -3.789  -1.220   6.831 1.00 . A A . 30 LEU HB2  1 1 
        3  3168 1 1 30 LEU HB3  H  -2.616  -1.367   8.124 1.00 . A A . 30 LEU HB3  1 1 
        3  3169 1 1 30 LEU HD11 H  -6.185  -0.374   8.549 1.00 . A A . 30 LEU HD11 1 1 
        3  3170 1 1 30 LEU HD12 H  -6.741  -1.998   8.946 1.00 . A A . 30 LEU HD12 1 1 
        3  3171 1 1 30 LEU HD13 H  -6.227  -1.623   7.302 1.00 . A A . 30 LEU HD13 1 1 
        3  3172 1 1 30 LEU HD21 H  -3.405  -3.594   8.808 1.00 . A A . 30 LEU HD21 1 1 
        3  3173 1 1 30 LEU HD22 H  -4.542  -3.576   7.458 1.00 . A A . 30 LEU HD22 1 1 
        3  3174 1 1 30 LEU HD23 H  -5.120  -3.877   9.097 1.00 . A A . 30 LEU HD23 1 1 
        3  3175 1 1 30 LEU HG   H  -4.470  -1.611   9.754 1.00 . A A . 30 LEU HG   1 1 
        3  3176 1 1 30 LEU N    N  -2.698   1.142   7.162 1.00 . A A . 30 LEU N    1 1 
        3  3177 1 1 30 LEU O    O  -4.214   0.879  10.410 1.00 . A A . 30 LEU O    1 1 
        3  3178 1 1 31 LYS C    C  -2.106   2.874  11.577 1.00 . A A . 31 LYS C    1 1 
        3  3179 1 1 31 LYS CA   C  -1.590   1.476  11.171 1.00 . A A . 31 LYS CA   1 1 
        3  3180 1 1 31 LYS CB   C  -0.045   1.408  11.217 1.00 . A A . 31 LYS CB   1 1 
        3  3181 1 1 31 LYS CD   C   1.004   3.438  12.347 1.00 . A A . 31 LYS CD   1 1 
        3  3182 1 1 31 LYS CE   C   2.049   3.637  11.249 1.00 . A A . 31 LYS CE   1 1 
        3  3183 1 1 31 LYS CG   C   0.602   1.967  12.494 1.00 . A A . 31 LYS CG   1 1 
        3  3184 1 1 31 LYS H    H  -1.386   1.005   9.112 1.00 . A A . 31 LYS H    1 1 
        3  3185 1 1 31 LYS HA   H  -1.986   0.752  11.869 1.00 . A A . 31 LYS HA   1 1 
        3  3186 1 1 31 LYS HB2  H   0.253   0.372  11.121 1.00 . A A . 31 LYS HB2  1 1 
        3  3187 1 1 31 LYS HB3  H   0.348   1.954  10.371 1.00 . A A . 31 LYS HB3  1 1 
        3  3188 1 1 31 LYS HD2  H   0.125   4.019  12.102 1.00 . A A . 31 LYS HD2  1 1 
        3  3189 1 1 31 LYS HD3  H   1.412   3.784  13.288 1.00 . A A . 31 LYS HD3  1 1 
        3  3190 1 1 31 LYS HE2  H   2.946   3.100  11.519 1.00 . A A . 31 LYS HE2  1 1 
        3  3191 1 1 31 LYS HE3  H   1.660   3.237  10.322 1.00 . A A . 31 LYS HE3  1 1 
        3  3192 1 1 31 LYS HG2  H  -0.103   1.880  13.307 1.00 . A A . 31 LYS HG2  1 1 
        3  3193 1 1 31 LYS HG3  H   1.484   1.384  12.723 1.00 . A A . 31 LYS HG3  1 1 
        3  3194 1 1 31 LYS HZ1  H   2.690   5.499  11.946 1.00 . A A . 31 LYS HZ1  1 1 
        3  3195 1 1 31 LYS HZ2  H   1.563   5.591  10.686 1.00 . A A . 31 LYS HZ2  1 1 
        3  3196 1 1 31 LYS HZ3  H   3.166   5.161  10.358 1.00 . A A . 31 LYS HZ3  1 1 
        3  3197 1 1 31 LYS N    N  -2.048   1.091   9.831 1.00 . A A . 31 LYS N    1 1 
        3  3198 1 1 31 LYS NZ   N   2.392   5.071  11.047 1.00 . A A . 31 LYS NZ   1 1 
        3  3199 1 1 31 LYS O    O  -2.415   3.116  12.748 1.00 . A A . 31 LYS O    1 1 
        3  3200 1 1 32 ASP C    C  -4.179   5.315  10.826 1.00 . A A . 32 ASP C    1 1 
        3  3201 1 1 32 ASP CA   C  -2.649   5.161  10.891 1.00 . A A . 32 ASP CA   1 1 
        3  3202 1 1 32 ASP CB   C  -1.972   6.142   9.931 1.00 . A A . 32 ASP CB   1 1 
        3  3203 1 1 32 ASP CG   C  -0.467   6.167  10.125 1.00 . A A . 32 ASP CG   1 1 
        3  3204 1 1 32 ASP H    H  -2.000   3.528   9.687 1.00 . A A . 32 ASP H    1 1 
        3  3205 1 1 32 ASP HA   H  -2.332   5.399  11.898 1.00 . A A . 32 ASP HA   1 1 
        3  3206 1 1 32 ASP HB2  H  -2.187   5.849   8.911 1.00 . A A . 32 ASP HB2  1 1 
        3  3207 1 1 32 ASP HB3  H  -2.359   7.136  10.103 1.00 . A A . 32 ASP HB3  1 1 
        3  3208 1 1 32 ASP N    N  -2.214   3.786  10.610 1.00 . A A . 32 ASP N    1 1 
        3  3209 1 1 32 ASP O    O  -4.805   5.722  11.808 1.00 . A A . 32 ASP O    1 1 
        3  3210 1 1 32 ASP OD1  O   0.003   6.770  11.115 1.00 . A A . 32 ASP OD1  1 1 
        3  3211 1 1 32 ASP OD2  O   0.256   5.578   9.304 1.00 . A A . 32 ASP OD2  1 1 
        3  3212 1 1 33 MET C    C  -6.939   3.754   9.567 1.00 . A A . 33 MET C    1 1 
        3  3213 1 1 33 MET CA   C  -6.246   5.125   9.523 1.00 . A A . 33 MET CA   1 1 
        3  3214 1 1 33 MET CB   C  -6.606   5.868   8.223 1.00 . A A . 33 MET CB   1 1 
        3  3215 1 1 33 MET CE   C  -4.163   7.518   7.130 1.00 . A A . 33 MET CE   1 1 
        3  3216 1 1 33 MET CG   C  -5.897   5.353   6.976 1.00 . A A . 33 MET CG   1 1 
        3  3217 1 1 33 MET H    H  -4.244   4.677   8.925 1.00 . A A . 33 MET H    1 1 
        3  3218 1 1 33 MET HA   H  -6.612   5.709  10.359 1.00 . A A . 33 MET HA   1 1 
        3  3219 1 1 33 MET HB2  H  -7.673   5.786   8.059 1.00 . A A . 33 MET HB2  1 1 
        3  3220 1 1 33 MET HB3  H  -6.357   6.914   8.344 1.00 . A A . 33 MET HB3  1 1 
        3  3221 1 1 33 MET HE1  H  -4.639   7.785   8.063 1.00 . A A . 33 MET HE1  1 1 
        3  3222 1 1 33 MET HE2  H  -4.716   7.949   6.309 1.00 . A A . 33 MET HE2  1 1 
        3  3223 1 1 33 MET HE3  H  -3.151   7.898   7.121 1.00 . A A . 33 MET HE3  1 1 
        3  3224 1 1 33 MET HG2  H  -6.016   4.280   6.927 1.00 . A A . 33 MET HG2  1 1 
        3  3225 1 1 33 MET HG3  H  -6.354   5.803   6.106 1.00 . A A . 33 MET HG3  1 1 
        3  3226 1 1 33 MET N    N  -4.784   5.006   9.680 1.00 . A A . 33 MET N    1 1 
        3  3227 1 1 33 MET O    O  -6.416   2.760   9.062 1.00 . A A . 33 MET O    1 1 
        3  3228 1 1 33 MET SD   S  -4.132   5.735   6.963 1.00 . A A . 33 MET SD   1 1 
        3  3229 1 1 34 ASN C    C  -9.313   1.836   9.012 1.00 . A A . 34 ASN C    1 1 
        3  3230 1 1 34 ASN CA   C  -8.874   2.460  10.353 1.00 . A A . 34 ASN CA   1 1 
        3  3231 1 1 34 ASN CB   C -10.096   2.690  11.258 1.00 . A A . 34 ASN CB   1 1 
        3  3232 1 1 34 ASN CG   C  -9.717   2.891  12.718 1.00 . A A . 34 ASN CG   1 1 
        3  3233 1 1 34 ASN H    H  -8.505   4.548  10.526 1.00 . A A . 34 ASN H    1 1 
        3  3234 1 1 34 ASN HA   H  -8.210   1.762  10.845 1.00 . A A . 34 ASN HA   1 1 
        3  3235 1 1 34 ASN HB2  H -10.628   3.569  10.921 1.00 . A A . 34 ASN HB2  1 1 
        3  3236 1 1 34 ASN HB3  H -10.753   1.834  11.192 1.00 . A A . 34 ASN HB3  1 1 
        3  3237 1 1 34 ASN HD21 H  -9.617   4.850  12.476 1.00 . A A . 34 ASN HD21 1 1 
        3  3238 1 1 34 ASN HD22 H  -9.260   4.269  14.058 1.00 . A A . 34 ASN HD22 1 1 
        3  3239 1 1 34 ASN N    N  -8.125   3.714  10.178 1.00 . A A . 34 ASN N    1 1 
        3  3240 1 1 34 ASN ND2  N  -9.514   4.127  13.123 1.00 . A A . 34 ASN ND2  1 1 
        3  3241 1 1 34 ASN O    O  -9.457   2.526   7.999 1.00 . A A . 34 ASN O    1 1 
        3  3242 1 1 34 ASN OD1  O  -9.618   1.937  13.484 1.00 . A A . 34 ASN OD1  1 1 
        3  3243 1 1 35 GLN C    C -10.966   0.393   6.970 1.00 . A A . 35 GLN C    1 1 
        3  3244 1 1 35 GLN CA   C  -9.887  -0.273   7.848 1.00 . A A . 35 GLN CA   1 1 
        3  3245 1 1 35 GLN CB   C -10.355  -1.674   8.285 1.00 . A A . 35 GLN CB   1 1 
        3  3246 1 1 35 GLN CD   C  -9.803  -3.762   9.671 1.00 . A A . 35 GLN CD   1 1 
        3  3247 1 1 35 GLN CG   C  -9.304  -2.445   9.084 1.00 . A A . 35 GLN CG   1 1 
        3  3248 1 1 35 GLN H    H  -9.495   0.059   9.907 1.00 . A A . 35 GLN H    1 1 
        3  3249 1 1 35 GLN HA   H  -8.984  -0.380   7.264 1.00 . A A . 35 GLN HA   1 1 
        3  3250 1 1 35 GLN HB2  H -11.239  -1.571   8.899 1.00 . A A . 35 GLN HB2  1 1 
        3  3251 1 1 35 GLN HB3  H -10.604  -2.250   7.406 1.00 . A A . 35 GLN HB3  1 1 
        3  3252 1 1 35 GLN HE21 H -11.087  -4.018   8.185 1.00 . A A . 35 GLN HE21 1 1 
        3  3253 1 1 35 GLN HE22 H -11.069  -5.250   9.393 1.00 . A A . 35 GLN HE22 1 1 
        3  3254 1 1 35 GLN HG2  H  -8.472  -2.664   8.432 1.00 . A A . 35 GLN HG2  1 1 
        3  3255 1 1 35 GLN HG3  H  -8.961  -1.817   9.895 1.00 . A A . 35 GLN HG3  1 1 
        3  3256 1 1 35 GLN N    N  -9.551   0.521   9.044 1.00 . A A . 35 GLN N    1 1 
        3  3257 1 1 35 GLN NE2  N -10.748  -4.405   9.015 1.00 . A A . 35 GLN NE2  1 1 
        3  3258 1 1 35 GLN O    O -10.739   0.662   5.788 1.00 . A A . 35 GLN O    1 1 
        3  3259 1 1 35 GLN OE1  O  -9.333  -4.201  10.716 1.00 . A A . 35 GLN OE1  1 1 
        3  3260 1 1 36 SER C    C -12.877   2.630   6.215 1.00 . A A . 36 SER C    1 1 
        3  3261 1 1 36 SER CA   C -13.253   1.270   6.823 1.00 . A A . 36 SER CA   1 1 
        3  3262 1 1 36 SER CB   C -14.470   1.441   7.742 1.00 . A A . 36 SER CB   1 1 
        3  3263 1 1 36 SER H    H -12.245   0.441   8.507 1.00 . A A . 36 SER H    1 1 
        3  3264 1 1 36 SER HA   H -13.518   0.597   6.020 1.00 . A A . 36 SER HA   1 1 
        3  3265 1 1 36 SER HB2  H -14.789   0.473   8.099 1.00 . A A . 36 SER HB2  1 1 
        3  3266 1 1 36 SER HB3  H -14.201   2.064   8.584 1.00 . A A . 36 SER HB3  1 1 
        3  3267 1 1 36 SER HG   H -16.382   1.785   7.459 1.00 . A A . 36 SER HG   1 1 
        3  3268 1 1 36 SER N    N -12.131   0.661   7.558 1.00 . A A . 36 SER N    1 1 
        3  3269 1 1 36 SER O    O -13.269   2.952   5.092 1.00 . A A . 36 SER O    1 1 
        3  3270 1 1 36 SER OG   O -15.551   2.049   7.051 1.00 . A A . 36 SER OG   1 1 
        3  3271 1 1 37 SER C    C -10.766   4.708   5.295 1.00 . A A . 37 SER C    1 1 
        3  3272 1 1 37 SER CA   C -11.702   4.766   6.511 1.00 . A A . 37 SER CA   1 1 
        3  3273 1 1 37 SER CB   C -11.017   5.532   7.652 1.00 . A A . 37 SER CB   1 1 
        3  3274 1 1 37 SER H    H -11.781   3.089   7.823 1.00 . A A . 37 SER H    1 1 
        3  3275 1 1 37 SER HA   H -12.602   5.295   6.228 1.00 . A A . 37 SER HA   1 1 
        3  3276 1 1 37 SER HB2  H -11.692   5.602   8.492 1.00 . A A . 37 SER HB2  1 1 
        3  3277 1 1 37 SER HB3  H -10.126   5.000   7.954 1.00 . A A . 37 SER HB3  1 1 
        3  3278 1 1 37 SER HG   H -10.969   7.032   6.368 1.00 . A A . 37 SER HG   1 1 
        3  3279 1 1 37 SER N    N -12.100   3.419   6.958 1.00 . A A . 37 SER N    1 1 
        3  3280 1 1 37 SER O    O -10.960   5.427   4.311 1.00 . A A . 37 SER O    1 1 
        3  3281 1 1 37 SER OG   O -10.648   6.850   7.261 1.00 . A A . 37 SER OG   1 1 
        3  3282 1 1 38 LEU C    C  -9.458   3.200   2.994 1.00 . A A . 38 LEU C    1 1 
        3  3283 1 1 38 LEU CA   C  -8.779   3.699   4.282 1.00 . A A . 38 LEU CA   1 1 
        3  3284 1 1 38 LEU CB   C  -7.668   2.727   4.711 1.00 . A A . 38 LEU CB   1 1 
        3  3285 1 1 38 LEU CD1  C  -5.820   3.813   3.370 1.00 . A A . 38 LEU CD1  1 1 
        3  3286 1 1 38 LEU CD2  C  -5.560   1.444   4.182 1.00 . A A . 38 LEU CD2  1 1 
        3  3287 1 1 38 LEU CG   C  -6.545   2.502   3.683 1.00 . A A . 38 LEU CG   1 1 
        3  3288 1 1 38 LEU H    H  -9.646   3.312   6.184 1.00 . A A . 38 LEU H    1 1 
        3  3289 1 1 38 LEU HA   H  -8.339   4.670   4.091 1.00 . A A . 38 LEU HA   1 1 
        3  3290 1 1 38 LEU HB2  H  -7.223   3.107   5.622 1.00 . A A . 38 LEU HB2  1 1 
        3  3291 1 1 38 LEU HB3  H  -8.124   1.771   4.929 1.00 . A A . 38 LEU HB3  1 1 
        3  3292 1 1 38 LEU HD11 H  -5.374   4.205   4.274 1.00 . A A . 38 LEU HD11 1 1 
        3  3293 1 1 38 LEU HD12 H  -6.525   4.531   2.979 1.00 . A A . 38 LEU HD12 1 1 
        3  3294 1 1 38 LEU HD13 H  -5.049   3.631   2.636 1.00 . A A . 38 LEU HD13 1 1 
        3  3295 1 1 38 LEU HD21 H  -5.117   1.771   5.113 1.00 . A A . 38 LEU HD21 1 1 
        3  3296 1 1 38 LEU HD22 H  -4.783   1.296   3.445 1.00 . A A . 38 LEU HD22 1 1 
        3  3297 1 1 38 LEU HD23 H  -6.083   0.512   4.341 1.00 . A A . 38 LEU HD23 1 1 
        3  3298 1 1 38 LEU HG   H  -6.982   2.141   2.762 1.00 . A A . 38 LEU HG   1 1 
        3  3299 1 1 38 LEU N    N  -9.749   3.855   5.372 1.00 . A A . 38 LEU N    1 1 
        3  3300 1 1 38 LEU O    O  -9.152   3.670   1.893 1.00 . A A . 38 LEU O    1 1 
        3  3301 1 1 39 ALA C    C -11.854   2.691   1.138 1.00 . A A . 39 ALA C    1 1 
        3  3302 1 1 39 ALA CA   C -11.116   1.662   2.014 1.00 . A A . 39 ALA CA   1 1 
        3  3303 1 1 39 ALA CB   C -12.096   0.610   2.520 1.00 . A A . 39 ALA CB   1 1 
        3  3304 1 1 39 ALA H    H -10.629   1.978   4.058 1.00 . A A . 39 ALA H    1 1 
        3  3305 1 1 39 ALA HA   H -10.380   1.157   1.404 1.00 . A A . 39 ALA HA   1 1 
        3  3306 1 1 39 ALA HB1  H -12.548   0.100   1.679 1.00 . A A . 39 ALA HB1  1 1 
        3  3307 1 1 39 ALA HB2  H -12.867   1.087   3.108 1.00 . A A . 39 ALA HB2  1 1 
        3  3308 1 1 39 ALA HB3  H -11.572  -0.108   3.133 1.00 . A A . 39 ALA HB3  1 1 
        3  3309 1 1 39 ALA N    N -10.405   2.273   3.150 1.00 . A A . 39 ALA N    1 1 
        3  3310 1 1 39 ALA O    O -12.250   2.383   0.014 1.00 . A A . 39 ALA O    1 1 
        3  3311 1 1 40 LYS C    C -11.734   5.873   0.151 1.00 . A A . 40 LYS C    1 1 
        3  3312 1 1 40 LYS CA   C -12.733   4.965   0.893 1.00 . A A . 40 LYS CA   1 1 
        3  3313 1 1 40 LYS CB   C -13.625   5.803   1.821 1.00 . A A . 40 LYS CB   1 1 
        3  3314 1 1 40 LYS CD   C -15.727   5.931   3.217 1.00 . A A . 40 LYS CD   1 1 
        3  3315 1 1 40 LYS CE   C -16.979   5.193   3.683 1.00 . A A . 40 LYS CE   1 1 
        3  3316 1 1 40 LYS CG   C -14.797   5.025   2.417 1.00 . A A . 40 LYS CG   1 1 
        3  3317 1 1 40 LYS H    H -11.754   4.087   2.569 1.00 . A A . 40 LYS H    1 1 
        3  3318 1 1 40 LYS HA   H -13.362   4.484   0.155 1.00 . A A . 40 LYS HA   1 1 
        3  3319 1 1 40 LYS HB2  H -13.023   6.186   2.634 1.00 . A A . 40 LYS HB2  1 1 
        3  3320 1 1 40 LYS HB3  H -14.024   6.637   1.260 1.00 . A A . 40 LYS HB3  1 1 
        3  3321 1 1 40 LYS HD2  H -15.196   6.301   4.084 1.00 . A A . 40 LYS HD2  1 1 
        3  3322 1 1 40 LYS HD3  H -16.025   6.765   2.595 1.00 . A A . 40 LYS HD3  1 1 
        3  3323 1 1 40 LYS HE2  H -17.458   4.741   2.826 1.00 . A A . 40 LYS HE2  1 1 
        3  3324 1 1 40 LYS HE3  H -16.691   4.420   4.383 1.00 . A A . 40 LYS HE3  1 1 
        3  3325 1 1 40 LYS HG2  H -15.360   4.566   1.615 1.00 . A A . 40 LYS HG2  1 1 
        3  3326 1 1 40 LYS HG3  H -14.408   4.255   3.069 1.00 . A A . 40 LYS HG3  1 1 
        3  3327 1 1 40 LYS HZ1  H -17.568   6.433   5.258 1.00 . A A . 40 LYS HZ1  1 1 
        3  3328 1 1 40 LYS HZ2  H -18.850   5.621   4.516 1.00 . A A . 40 LYS HZ2  1 1 
        3  3329 1 1 40 LYS HZ3  H -18.127   6.940   3.745 1.00 . A A . 40 LYS HZ3  1 1 
        3  3330 1 1 40 LYS N    N -12.056   3.902   1.655 1.00 . A A . 40 LYS N    1 1 
        3  3331 1 1 40 LYS NZ   N -17.947   6.110   4.346 1.00 . A A . 40 LYS NZ   1 1 
        3  3332 1 1 40 LYS O    O -12.077   6.497  -0.857 1.00 . A A . 40 LYS O    1 1 
        3  3333 1 1 41 GLU C    C  -8.806   6.016  -1.159 1.00 . A A . 41 GLU C    1 1 
        3  3334 1 1 41 GLU CA   C  -9.459   6.766   0.015 1.00 . A A . 41 GLU CA   1 1 
        3  3335 1 1 41 GLU CB   C  -8.398   7.155   1.054 1.00 . A A . 41 GLU CB   1 1 
        3  3336 1 1 41 GLU CD   C  -9.695   9.174   1.894 1.00 . A A . 41 GLU CD   1 1 
        3  3337 1 1 41 GLU CG   C  -8.959   7.894   2.268 1.00 . A A . 41 GLU CG   1 1 
        3  3338 1 1 41 GLU H    H -10.283   5.434   1.454 1.00 . A A . 41 GLU H    1 1 
        3  3339 1 1 41 GLU HA   H  -9.928   7.667  -0.364 1.00 . A A . 41 GLU HA   1 1 
        3  3340 1 1 41 GLU HB2  H  -7.909   6.255   1.404 1.00 . A A . 41 GLU HB2  1 1 
        3  3341 1 1 41 GLU HB3  H  -7.664   7.791   0.582 1.00 . A A . 41 GLU HB3  1 1 
        3  3342 1 1 41 GLU HG2  H  -9.645   7.239   2.788 1.00 . A A . 41 GLU HG2  1 1 
        3  3343 1 1 41 GLU HG3  H  -8.141   8.146   2.928 1.00 . A A . 41 GLU HG3  1 1 
        3  3344 1 1 41 GLU N    N -10.501   5.945   0.646 1.00 . A A . 41 GLU N    1 1 
        3  3345 1 1 41 GLU O    O  -8.460   6.610  -2.186 1.00 . A A . 41 GLU O    1 1 
        3  3346 1 1 41 GLU OE1  O  -9.030  10.151   1.500 1.00 . A A . 41 GLU OE1  1 1 
        3  3347 1 1 41 GLU OE2  O -10.944   9.214   1.994 1.00 . A A . 41 GLU OE2  1 1 
        3  3348 1 1 42 CYS C    C  -9.245   3.131  -2.790 1.00 . A A . 42 CYS C    1 1 
        3  3349 1 1 42 CYS CA   C  -8.103   3.834  -2.041 1.00 . A A . 42 CYS CA   1 1 
        3  3350 1 1 42 CYS CB   C  -7.161   2.782  -1.436 1.00 . A A . 42 CYS CB   1 1 
        3  3351 1 1 42 CYS H    H  -8.889   4.312  -0.127 1.00 . A A . 42 CYS H    1 1 
        3  3352 1 1 42 CYS HA   H  -7.546   4.447  -2.738 1.00 . A A . 42 CYS HA   1 1 
        3  3353 1 1 42 CYS HB2  H  -6.735   2.190  -2.234 1.00 . A A . 42 CYS HB2  1 1 
        3  3354 1 1 42 CYS HB3  H  -6.365   3.282  -0.904 1.00 . A A . 42 CYS HB3  1 1 
        3  3355 1 1 42 CYS HG   H  -9.273   1.706  -0.492 1.00 . A A . 42 CYS HG   1 1 
        3  3356 1 1 42 CYS N    N  -8.639   4.709  -0.990 1.00 . A A . 42 CYS N    1 1 
        3  3357 1 1 42 CYS O    O -10.231   2.729  -2.175 1.00 . A A . 42 CYS O    1 1 
        3  3358 1 1 42 CYS SG   S  -7.965   1.643  -0.281 1.00 . A A . 42 CYS SG   1 1 
        3  3359 1 1 43 PRO C    C -10.162   0.728  -4.669 1.00 . A A . 43 PRO C    1 1 
        3  3360 1 1 43 PRO CA   C -10.170   2.253  -4.924 1.00 . A A . 43 PRO CA   1 1 
        3  3361 1 1 43 PRO CB   C  -9.758   2.567  -6.372 1.00 . A A . 43 PRO CB   1 1 
        3  3362 1 1 43 PRO CD   C  -8.032   3.454  -4.970 1.00 . A A . 43 PRO CD   1 1 
        3  3363 1 1 43 PRO CG   C  -8.286   2.795  -6.303 1.00 . A A . 43 PRO CG   1 1 
        3  3364 1 1 43 PRO HA   H -11.162   2.640  -4.734 1.00 . A A . 43 PRO HA   1 1 
        3  3365 1 1 43 PRO HB2  H -10.003   1.732  -7.016 1.00 . A A . 43 PRO HB2  1 1 
        3  3366 1 1 43 PRO HB3  H -10.279   3.452  -6.715 1.00 . A A . 43 PRO HB3  1 1 
        3  3367 1 1 43 PRO HD2  H  -7.080   3.138  -4.568 1.00 . A A . 43 PRO HD2  1 1 
        3  3368 1 1 43 PRO HD3  H  -8.063   4.528  -5.068 1.00 . A A . 43 PRO HD3  1 1 
        3  3369 1 1 43 PRO HG2  H  -7.761   1.849  -6.364 1.00 . A A . 43 PRO HG2  1 1 
        3  3370 1 1 43 PRO HG3  H  -7.975   3.445  -7.110 1.00 . A A . 43 PRO HG3  1 1 
        3  3371 1 1 43 PRO N    N  -9.145   2.970  -4.128 1.00 . A A . 43 PRO N    1 1 
        3  3372 1 1 43 PRO O    O -10.482  -0.072  -5.553 1.00 . A A . 43 PRO O    1 1 
        3  3373 1 1 44 LEU C    C -10.537  -1.438  -1.877 1.00 . A A . 44 LEU C    1 1 
        3  3374 1 1 44 LEU CA   C  -9.644  -1.066  -3.074 1.00 . A A . 44 LEU CA   1 1 
        3  3375 1 1 44 LEU CB   C  -8.168  -1.302  -2.724 1.00 . A A . 44 LEU CB   1 1 
        3  3376 1 1 44 LEU CD1  C  -5.736  -0.871  -3.248 1.00 . A A . 44 LEU CD1  1 1 
        3  3377 1 1 44 LEU CD2  C  -7.288  -1.670  -5.064 1.00 . A A . 44 LEU CD2  1 1 
        3  3378 1 1 44 LEU CG   C  -7.161  -0.832  -3.792 1.00 . A A . 44 LEU CG   1 1 
        3  3379 1 1 44 LEU H    H  -9.713   1.014  -2.748 1.00 . A A . 44 LEU H    1 1 
        3  3380 1 1 44 LEU HA   H  -9.913  -1.681  -3.922 1.00 . A A . 44 LEU HA   1 1 
        3  3381 1 1 44 LEU HB2  H  -7.952  -0.781  -1.800 1.00 . A A . 44 LEU HB2  1 1 
        3  3382 1 1 44 LEU HB3  H  -8.022  -2.361  -2.561 1.00 . A A . 44 LEU HB3  1 1 
        3  3383 1 1 44 LEU HD11 H  -5.049  -0.535  -4.011 1.00 . A A . 44 LEU HD11 1 1 
        3  3384 1 1 44 LEU HD12 H  -5.485  -1.880  -2.957 1.00 . A A . 44 LEU HD12 1 1 
        3  3385 1 1 44 LEU HD13 H  -5.662  -0.221  -2.388 1.00 . A A . 44 LEU HD13 1 1 
        3  3386 1 1 44 LEU HD21 H  -7.093  -2.709  -4.838 1.00 . A A . 44 LEU HD21 1 1 
        3  3387 1 1 44 LEU HD22 H  -6.575  -1.322  -5.798 1.00 . A A . 44 LEU HD22 1 1 
        3  3388 1 1 44 LEU HD23 H  -8.288  -1.570  -5.462 1.00 . A A . 44 LEU HD23 1 1 
        3  3389 1 1 44 LEU HG   H  -7.383   0.194  -4.050 1.00 . A A . 44 LEU HG   1 1 
        3  3390 1 1 44 LEU N    N  -9.827   0.337  -3.439 1.00 . A A . 44 LEU N    1 1 
        3  3391 1 1 44 LEU O    O -10.365  -0.909  -0.778 1.00 . A A . 44 LEU O    1 1 
        3  3392 1 1 45 SER C    C -11.678  -3.294   0.196 1.00 . A A . 45 SER C    1 1 
        3  3393 1 1 45 SER CA   C -12.420  -2.777  -1.047 1.00 . A A . 45 SER CA   1 1 
        3  3394 1 1 45 SER CB   C -13.359  -3.870  -1.583 1.00 . A A . 45 SER CB   1 1 
        3  3395 1 1 45 SER H    H -11.586  -2.715  -3.003 1.00 . A A . 45 SER H    1 1 
        3  3396 1 1 45 SER HA   H -13.016  -1.921  -0.761 1.00 . A A . 45 SER HA   1 1 
        3  3397 1 1 45 SER HB2  H -12.775  -4.707  -1.933 1.00 . A A . 45 SER HB2  1 1 
        3  3398 1 1 45 SER HB3  H -14.020  -4.198  -0.790 1.00 . A A . 45 SER HB3  1 1 
        3  3399 1 1 45 SER HG   H -13.723  -3.615  -3.497 1.00 . A A . 45 SER HG   1 1 
        3  3400 1 1 45 SER N    N -11.491  -2.339  -2.101 1.00 . A A . 45 SER N    1 1 
        3  3401 1 1 45 SER O    O -10.698  -4.037   0.085 1.00 . A A . 45 SER O    1 1 
        3  3402 1 1 45 SER OG   O -14.148  -3.385  -2.660 1.00 . A A . 45 SER OG   1 1 
        3  3403 1 1 46 GLN C    C -11.278  -4.786   2.780 1.00 . A A . 46 GLN C    1 1 
        3  3404 1 1 46 GLN CA   C -11.530  -3.273   2.658 1.00 . A A . 46 GLN CA   1 1 
        3  3405 1 1 46 GLN CB   C -12.398  -2.785   3.833 1.00 . A A . 46 GLN CB   1 1 
        3  3406 1 1 46 GLN CD   C -12.763  -4.133   5.978 1.00 . A A . 46 GLN CD   1 1 
        3  3407 1 1 46 GLN CG   C -11.860  -3.166   5.217 1.00 . A A . 46 GLN CG   1 1 
        3  3408 1 1 46 GLN H    H -12.982  -2.365   1.395 1.00 . A A . 46 GLN H    1 1 
        3  3409 1 1 46 GLN HA   H -10.576  -2.761   2.698 1.00 . A A . 46 GLN HA   1 1 
        3  3410 1 1 46 GLN HB2  H -12.472  -1.707   3.785 1.00 . A A . 46 GLN HB2  1 1 
        3  3411 1 1 46 GLN HB3  H -13.389  -3.203   3.727 1.00 . A A . 46 GLN HB3  1 1 
        3  3412 1 1 46 GLN HE21 H -13.443  -4.930   4.293 1.00 . A A . 46 GLN HE21 1 1 
        3  3413 1 1 46 GLN HE22 H -14.081  -5.593   5.752 1.00 . A A . 46 GLN HE22 1 1 
        3  3414 1 1 46 GLN HG2  H -10.890  -3.627   5.102 1.00 . A A . 46 GLN HG2  1 1 
        3  3415 1 1 46 GLN HG3  H -11.751  -2.261   5.804 1.00 . A A . 46 GLN HG3  1 1 
        3  3416 1 1 46 GLN N    N -12.168  -2.912   1.379 1.00 . A A . 46 GLN N    1 1 
        3  3417 1 1 46 GLN NE2  N -13.501  -4.967   5.269 1.00 . A A . 46 GLN NE2  1 1 
        3  3418 1 1 46 GLN O    O -10.253  -5.213   3.314 1.00 . A A . 46 GLN O    1 1 
        3  3419 1 1 46 GLN OE1  O -12.808  -4.121   7.203 1.00 . A A . 46 GLN OE1  1 1 
        3  3420 1 1 47 SER C    C -10.827  -7.514   1.543 1.00 . A A . 47 SER C    1 1 
        3  3421 1 1 47 SER CA   C -12.084  -7.054   2.300 1.00 . A A . 47 SER CA   1 1 
        3  3422 1 1 47 SER CB   C -13.334  -7.710   1.687 1.00 . A A . 47 SER CB   1 1 
        3  3423 1 1 47 SER H    H -13.024  -5.189   1.894 1.00 . A A . 47 SER H    1 1 
        3  3424 1 1 47 SER HA   H -11.999  -7.363   3.333 1.00 . A A . 47 SER HA   1 1 
        3  3425 1 1 47 SER HB2  H -13.403  -7.443   0.644 1.00 . A A . 47 SER HB2  1 1 
        3  3426 1 1 47 SER HB3  H -13.255  -8.784   1.777 1.00 . A A . 47 SER HB3  1 1 
        3  3427 1 1 47 SER HG   H -15.249  -7.877   2.102 1.00 . A A . 47 SER HG   1 1 
        3  3428 1 1 47 SER N    N -12.214  -5.589   2.279 1.00 . A A . 47 SER N    1 1 
        3  3429 1 1 47 SER O    O -10.196  -8.505   1.907 1.00 . A A . 47 SER O    1 1 
        3  3430 1 1 47 SER OG   O -14.522  -7.283   2.340 1.00 . A A . 47 SER OG   1 1 
        3  3431 1 1 48 MET C    C  -7.972  -6.734   0.513 1.00 . A A . 48 MET C    1 1 
        3  3432 1 1 48 MET CA   C  -9.244  -7.059  -0.285 1.00 . A A . 48 MET CA   1 1 
        3  3433 1 1 48 MET CB   C  -9.240  -6.253  -1.589 1.00 . A A . 48 MET CB   1 1 
        3  3434 1 1 48 MET CE   C -11.800  -6.130  -4.879 1.00 . A A . 48 MET CE   1 1 
        3  3435 1 1 48 MET CG   C -10.400  -6.559  -2.522 1.00 . A A . 48 MET CG   1 1 
        3  3436 1 1 48 MET H    H -11.009  -5.997   0.247 1.00 . A A . 48 MET H    1 1 
        3  3437 1 1 48 MET HA   H  -9.245  -8.112  -0.522 1.00 . A A . 48 MET HA   1 1 
        3  3438 1 1 48 MET HB2  H  -9.276  -5.200  -1.346 1.00 . A A . 48 MET HB2  1 1 
        3  3439 1 1 48 MET HB3  H  -8.319  -6.455  -2.120 1.00 . A A . 48 MET HB3  1 1 
        3  3440 1 1 48 MET HE1  H -11.736  -7.195  -5.050 1.00 . A A . 48 MET HE1  1 1 
        3  3441 1 1 48 MET HE2  H -11.883  -5.616  -5.826 1.00 . A A . 48 MET HE2  1 1 
        3  3442 1 1 48 MET HE3  H -12.667  -5.913  -4.275 1.00 . A A . 48 MET HE3  1 1 
        3  3443 1 1 48 MET HG2  H -10.367  -7.606  -2.791 1.00 . A A . 48 MET HG2  1 1 
        3  3444 1 1 48 MET HG3  H -11.329  -6.346  -2.011 1.00 . A A . 48 MET HG3  1 1 
        3  3445 1 1 48 MET N    N -10.456  -6.769   0.497 1.00 . A A . 48 MET N    1 1 
        3  3446 1 1 48 MET O    O  -6.859  -7.010   0.068 1.00 . A A . 48 MET O    1 1 
        3  3447 1 1 48 MET SD   S -10.327  -5.572  -4.027 1.00 . A A . 48 MET SD   1 1 
        3  3448 1 1 49 ILE C    C  -6.988  -6.800   3.729 1.00 . A A . 49 ILE C    1 1 
        3  3449 1 1 49 ILE CA   C  -7.019  -5.798   2.565 1.00 . A A . 49 ILE CA   1 1 
        3  3450 1 1 49 ILE CB   C  -7.113  -4.355   3.129 1.00 . A A . 49 ILE CB   1 1 
        3  3451 1 1 49 ILE CD1  C  -7.340  -1.898   2.436 1.00 . A A . 49 ILE CD1  1 1 
        3  3452 1 1 49 ILE CG1  C  -7.179  -3.335   1.977 1.00 . A A . 49 ILE CG1  1 1 
        3  3453 1 1 49 ILE CG2  C  -5.928  -4.051   4.052 1.00 . A A . 49 ILE CG2  1 1 
        3  3454 1 1 49 ILE H    H  -9.040  -5.805   1.918 1.00 . A A . 49 ILE H    1 1 
        3  3455 1 1 49 ILE HA   H  -6.099  -5.886   2.003 1.00 . A A . 49 ILE HA   1 1 
        3  3456 1 1 49 ILE HB   H  -8.018  -4.281   3.714 1.00 . A A . 49 ILE HB   1 1 
        3  3457 1 1 49 ILE HD11 H  -6.475  -1.604   3.014 1.00 . A A . 49 ILE HD11 1 1 
        3  3458 1 1 49 ILE HD12 H  -8.227  -1.812   3.044 1.00 . A A . 49 ILE HD12 1 1 
        3  3459 1 1 49 ILE HD13 H  -7.430  -1.255   1.573 1.00 . A A . 49 ILE HD13 1 1 
        3  3460 1 1 49 ILE HG12 H  -6.268  -3.394   1.397 1.00 . A A . 49 ILE HG12 1 1 
        3  3461 1 1 49 ILE HG13 H  -8.020  -3.574   1.340 1.00 . A A . 49 ILE HG13 1 1 
        3  3462 1 1 49 ILE HG21 H  -5.930  -4.740   4.885 1.00 . A A . 49 ILE HG21 1 1 
        3  3463 1 1 49 ILE HG22 H  -6.011  -3.040   4.424 1.00 . A A . 49 ILE HG22 1 1 
        3  3464 1 1 49 ILE HG23 H  -5.003  -4.155   3.502 1.00 . A A . 49 ILE HG23 1 1 
        3  3465 1 1 49 ILE N    N  -8.138  -6.092   1.664 1.00 . A A . 49 ILE N    1 1 
        3  3466 1 1 49 ILE O    O  -5.996  -7.504   3.932 1.00 . A A . 49 ILE O    1 1 
        3  3467 1 1 50 SER C    C  -7.908  -9.228   5.256 1.00 . A A . 50 SER C    1 1 
        3  3468 1 1 50 SER CA   C  -8.229  -7.771   5.621 1.00 . A A . 50 SER CA   1 1 
        3  3469 1 1 50 SER CB   C  -9.654  -7.690   6.184 1.00 . A A . 50 SER CB   1 1 
        3  3470 1 1 50 SER H    H  -8.861  -6.307   4.220 1.00 . A A . 50 SER H    1 1 
        3  3471 1 1 50 SER HA   H  -7.533  -7.438   6.378 1.00 . A A . 50 SER HA   1 1 
        3  3472 1 1 50 SER HB2  H  -9.742  -8.343   7.041 1.00 . A A . 50 SER HB2  1 1 
        3  3473 1 1 50 SER HB3  H  -9.865  -6.673   6.484 1.00 . A A . 50 SER HB3  1 1 
        3  3474 1 1 50 SER HG   H -11.491  -8.040   5.585 1.00 . A A . 50 SER HG   1 1 
        3  3475 1 1 50 SER N    N  -8.098  -6.873   4.463 1.00 . A A . 50 SER N    1 1 
        3  3476 1 1 50 SER O    O  -7.119  -9.891   5.937 1.00 . A A . 50 SER O    1 1 
        3  3477 1 1 50 SER OG   O -10.603  -8.085   5.206 1.00 . A A . 50 SER OG   1 1 
        3  3478 1 1 51 SER C    C  -6.849 -11.437   3.467 1.00 . A A . 51 SER C    1 1 
        3  3479 1 1 51 SER CA   C  -8.327 -11.107   3.727 1.00 . A A . 51 SER CA   1 1 
        3  3480 1 1 51 SER CB   C  -9.147 -11.381   2.454 1.00 . A A . 51 SER CB   1 1 
        3  3481 1 1 51 SER H    H  -9.116  -9.128   3.667 1.00 . A A . 51 SER H    1 1 
        3  3482 1 1 51 SER HA   H  -8.689 -11.753   4.514 1.00 . A A . 51 SER HA   1 1 
        3  3483 1 1 51 SER HB2  H  -8.807 -10.731   1.661 1.00 . A A . 51 SER HB2  1 1 
        3  3484 1 1 51 SER HB3  H  -9.010 -12.412   2.155 1.00 . A A . 51 SER HB3  1 1 
        3  3485 1 1 51 SER HG   H -10.676 -10.218   2.878 1.00 . A A . 51 SER HG   1 1 
        3  3486 1 1 51 SER N    N  -8.514  -9.716   4.174 1.00 . A A . 51 SER N    1 1 
        3  3487 1 1 51 SER O    O  -6.345 -12.461   3.921 1.00 . A A . 51 SER O    1 1 
        3  3488 1 1 51 SER OG   O -10.535 -11.149   2.665 1.00 . A A . 51 SER OG   1 1 
        3  3489 1 1 52 ILE C    C  -3.815 -10.744   3.609 1.00 . A A . 52 ILE C    1 1 
        3  3490 1 1 52 ILE CA   C  -4.748 -10.789   2.383 1.00 . A A . 52 ILE CA   1 1 
        3  3491 1 1 52 ILE CB   C  -4.269  -9.759   1.325 1.00 . A A . 52 ILE CB   1 1 
        3  3492 1 1 52 ILE CD1  C  -4.676  -8.948  -1.074 1.00 . A A . 52 ILE CD1  1 1 
        3  3493 1 1 52 ILE CG1  C  -5.103  -9.890   0.037 1.00 . A A . 52 ILE CG1  1 1 
        3  3494 1 1 52 ILE CG2  C  -2.777  -9.930   1.025 1.00 . A A . 52 ILE CG2  1 1 
        3  3495 1 1 52 ILE H    H  -6.589  -9.726   2.468 1.00 . A A . 52 ILE H    1 1 
        3  3496 1 1 52 ILE HA   H  -4.688 -11.774   1.940 1.00 . A A . 52 ILE HA   1 1 
        3  3497 1 1 52 ILE HB   H  -4.415  -8.768   1.735 1.00 . A A . 52 ILE HB   1 1 
        3  3498 1 1 52 ILE HD11 H  -5.309  -9.100  -1.935 1.00 . A A . 52 ILE HD11 1 1 
        3  3499 1 1 52 ILE HD12 H  -3.648  -9.148  -1.344 1.00 . A A . 52 ILE HD12 1 1 
        3  3500 1 1 52 ILE HD13 H  -4.768  -7.926  -0.736 1.00 . A A . 52 ILE HD13 1 1 
        3  3501 1 1 52 ILE HG12 H  -5.019 -10.899  -0.337 1.00 . A A . 52 ILE HG12 1 1 
        3  3502 1 1 52 ILE HG13 H  -6.140  -9.683   0.265 1.00 . A A . 52 ILE HG13 1 1 
        3  3503 1 1 52 ILE HG21 H  -2.461  -9.170   0.323 1.00 . A A . 52 ILE HG21 1 1 
        3  3504 1 1 52 ILE HG22 H  -2.601 -10.907   0.598 1.00 . A A . 52 ILE HG22 1 1 
        3  3505 1 1 52 ILE HG23 H  -2.212  -9.829   1.940 1.00 . A A . 52 ILE HG23 1 1 
        3  3506 1 1 52 ILE N    N  -6.153 -10.556   2.751 1.00 . A A . 52 ILE N    1 1 
        3  3507 1 1 52 ILE O    O  -2.842 -11.494   3.692 1.00 . A A . 52 ILE O    1 1 
        3  3508 1 1 53 VAL C    C  -3.560 -10.885   6.766 1.00 . A A . 53 VAL C    1 1 
        3  3509 1 1 53 VAL CA   C  -3.306  -9.732   5.777 1.00 . A A . 53 VAL CA   1 1 
        3  3510 1 1 53 VAL CB   C  -3.572  -8.379   6.487 1.00 . A A . 53 VAL CB   1 1 
        3  3511 1 1 53 VAL CG1  C  -2.737  -8.248   7.764 1.00 . A A . 53 VAL CG1  1 1 
        3  3512 1 1 53 VAL CG2  C  -3.291  -7.214   5.537 1.00 . A A . 53 VAL CG2  1 1 
        3  3513 1 1 53 VAL H    H  -4.897  -9.277   4.439 1.00 . A A . 53 VAL H    1 1 
        3  3514 1 1 53 VAL HA   H  -2.265  -9.753   5.481 1.00 . A A . 53 VAL HA   1 1 
        3  3515 1 1 53 VAL HB   H  -4.617  -8.341   6.764 1.00 . A A . 53 VAL HB   1 1 
        3  3516 1 1 53 VAL HG11 H  -1.686  -8.303   7.515 1.00 . A A . 53 VAL HG11 1 1 
        3  3517 1 1 53 VAL HG12 H  -2.986  -9.049   8.444 1.00 . A A . 53 VAL HG12 1 1 
        3  3518 1 1 53 VAL HG13 H  -2.945  -7.299   8.238 1.00 . A A . 53 VAL HG13 1 1 
        3  3519 1 1 53 VAL HG21 H  -3.492  -6.280   6.042 1.00 . A A . 53 VAL HG21 1 1 
        3  3520 1 1 53 VAL HG22 H  -3.928  -7.298   4.668 1.00 . A A . 53 VAL HG22 1 1 
        3  3521 1 1 53 VAL HG23 H  -2.256  -7.240   5.228 1.00 . A A . 53 VAL HG23 1 1 
        3  3522 1 1 53 VAL N    N  -4.117  -9.861   4.559 1.00 . A A . 53 VAL N    1 1 
        3  3523 1 1 53 VAL O    O  -2.629 -11.385   7.403 1.00 . A A . 53 VAL O    1 1 
        3  3524 1 1 54 ASN C    C  -5.507 -13.699   7.231 1.00 . A A . 54 ASN C    1 1 
        3  3525 1 1 54 ASN CA   C  -5.225 -12.323   7.864 1.00 . A A . 54 ASN CA   1 1 
        3  3526 1 1 54 ASN CB   C  -6.470 -11.832   8.613 1.00 . A A . 54 ASN CB   1 1 
        3  3527 1 1 54 ASN CG   C  -6.214 -10.544   9.375 1.00 . A A . 54 ASN CG   1 1 
        3  3528 1 1 54 ASN H    H  -5.498 -10.943   6.266 1.00 . A A . 54 ASN H    1 1 
        3  3529 1 1 54 ASN HA   H  -4.419 -12.436   8.575 1.00 . A A . 54 ASN HA   1 1 
        3  3530 1 1 54 ASN HB2  H  -7.267 -11.655   7.905 1.00 . A A . 54 ASN HB2  1 1 
        3  3531 1 1 54 ASN HB3  H  -6.784 -12.589   9.319 1.00 . A A . 54 ASN HB3  1 1 
        3  3532 1 1 54 ASN HD21 H  -6.737  -9.471   7.799 1.00 . A A . 54 ASN HD21 1 1 
        3  3533 1 1 54 ASN HD22 H  -6.270  -8.577   9.202 1.00 . A A . 54 ASN HD22 1 1 
        3  3534 1 1 54 ASN N    N  -4.819 -11.314   6.871 1.00 . A A . 54 ASN N    1 1 
        3  3535 1 1 54 ASN ND2  N  -6.428  -9.419   8.726 1.00 . A A . 54 ASN ND2  1 1 
        3  3536 1 1 54 ASN O    O  -6.153 -14.551   7.843 1.00 . A A . 54 ASN O    1 1 
        3  3537 1 1 54 ASN OD1  O  -5.820 -10.559  10.536 1.00 . A A . 54 ASN OD1  1 1 
        3  3538 1 1 55 SER C    C  -4.482 -16.360   6.044 1.00 . A A . 55 SER C    1 1 
        3  3539 1 1 55 SER CA   C  -5.208 -15.209   5.323 1.00 . A A . 55 SER CA   1 1 
        3  3540 1 1 55 SER CB   C  -4.717 -15.125   3.873 1.00 . A A . 55 SER CB   1 1 
        3  3541 1 1 55 SER H    H  -4.505 -13.212   5.572 1.00 . A A . 55 SER H    1 1 
        3  3542 1 1 55 SER HA   H  -6.270 -15.418   5.320 1.00 . A A . 55 SER HA   1 1 
        3  3543 1 1 55 SER HB2  H  -5.247 -14.336   3.359 1.00 . A A . 55 SER HB2  1 1 
        3  3544 1 1 55 SER HB3  H  -3.659 -14.911   3.866 1.00 . A A . 55 SER HB3  1 1 
        3  3545 1 1 55 SER HG   H  -5.864 -16.611   3.282 1.00 . A A . 55 SER HG   1 1 
        3  3546 1 1 55 SER N    N  -5.010 -13.923   6.016 1.00 . A A . 55 SER N    1 1 
        3  3547 1 1 55 SER O    O  -3.380 -16.181   6.569 1.00 . A A . 55 SER O    1 1 
        3  3548 1 1 55 SER OG   O  -4.939 -16.348   3.181 1.00 . A A . 55 SER OG   1 1 
        3  3549 1 1 56 THR C    C  -3.198 -19.162   6.143 1.00 . A A . 56 THR C    1 1 
        3  3550 1 1 56 THR CA   C  -4.535 -18.715   6.753 1.00 . A A . 56 THR CA   1 1 
        3  3551 1 1 56 THR CB   C  -5.517 -19.915   6.744 1.00 . A A . 56 THR CB   1 1 
        3  3552 1 1 56 THR CG2  C  -6.819 -19.560   7.453 1.00 . A A . 56 THR CG2  1 1 
        3  3553 1 1 56 THR H    H  -5.950 -17.640   5.575 1.00 . A A . 56 THR H    1 1 
        3  3554 1 1 56 THR HA   H  -4.366 -18.429   7.784 1.00 . A A . 56 THR HA   1 1 
        3  3555 1 1 56 THR HB   H  -5.056 -20.743   7.266 1.00 . A A . 56 THR HB   1 1 
        3  3556 1 1 56 THR HG1  H  -6.328 -21.128   5.403 1.00 . A A . 56 THR HG1  1 1 
        3  3557 1 1 56 THR HG21 H  -6.608 -19.276   8.474 1.00 . A A . 56 THR HG21 1 1 
        3  3558 1 1 56 THR HG22 H  -7.479 -20.415   7.446 1.00 . A A . 56 THR HG22 1 1 
        3  3559 1 1 56 THR HG23 H  -7.294 -18.736   6.940 1.00 . A A . 56 THR HG23 1 1 
        3  3560 1 1 56 THR N    N  -5.097 -17.546   6.052 1.00 . A A . 56 THR N    1 1 
        3  3561 1 1 56 THR O    O  -2.138 -19.000   6.753 1.00 . A A . 56 THR O    1 1 
        3  3562 1 1 56 THR OG1  O  -5.797 -20.320   5.393 1.00 . A A . 56 THR OG1  1 1 
        3  3563 1 1 57 TYR C    C  -1.683 -19.176   3.102 1.00 . A A . 57 TYR C    1 1 
        3  3564 1 1 57 TYR CA   C  -2.040 -20.166   4.224 1.00 . A A . 57 TYR CA   1 1 
        3  3565 1 1 57 TYR CB   C  -2.229 -21.587   3.650 1.00 . A A . 57 TYR CB   1 1 
        3  3566 1 1 57 TYR CD1  C  -4.466 -21.426   2.449 1.00 . A A . 57 TYR CD1  1 1 
        3  3567 1 1 57 TYR CD2  C  -2.532 -21.987   1.166 1.00 . A A . 57 TYR CD2  1 1 
        3  3568 1 1 57 TYR CE1  C  -5.245 -21.502   1.306 1.00 . A A . 57 TYR CE1  1 1 
        3  3569 1 1 57 TYR CE2  C  -3.305 -22.063   0.025 1.00 . A A . 57 TYR CE2  1 1 
        3  3570 1 1 57 TYR CG   C  -3.095 -21.666   2.399 1.00 . A A . 57 TYR CG   1 1 
        3  3571 1 1 57 TYR CZ   C  -4.658 -21.820   0.098 1.00 . A A . 57 TYR CZ   1 1 
        3  3572 1 1 57 TYR H    H  -4.132 -19.887   4.528 1.00 . A A . 57 TYR H    1 1 
        3  3573 1 1 57 TYR HA   H  -1.225 -20.183   4.935 1.00 . A A . 57 TYR HA   1 1 
        3  3574 1 1 57 TYR HB2  H  -1.259 -21.993   3.405 1.00 . A A . 57 TYR HB2  1 1 
        3  3575 1 1 57 TYR HB3  H  -2.685 -22.210   4.407 1.00 . A A . 57 TYR HB3  1 1 
        3  3576 1 1 57 TYR HD1  H  -4.922 -21.179   3.396 1.00 . A A . 57 TYR HD1  1 1 
        3  3577 1 1 57 TYR HD2  H  -1.470 -22.176   1.106 1.00 . A A . 57 TYR HD2  1 1 
        3  3578 1 1 57 TYR HE1  H  -6.307 -21.310   1.365 1.00 . A A . 57 TYR HE1  1 1 
        3  3579 1 1 57 TYR HE2  H  -2.847 -22.314  -0.920 1.00 . A A . 57 TYR HE2  1 1 
        3  3580 1 1 57 TYR HH   H  -5.999 -21.123  -1.101 1.00 . A A . 57 TYR HH   1 1 
        3  3581 1 1 57 TYR N    N  -3.253 -19.735   4.939 1.00 . A A . 57 TYR N    1 1 
        3  3582 1 1 57 TYR O    O  -0.821 -19.450   2.263 1.00 . A A . 57 TYR O    1 1 
        3  3583 1 1 57 TYR OH   O  -5.429 -21.900  -1.043 1.00 . A A . 57 TYR OH   1 1 
        3  3584 1 1 58 TYR C    C  -2.679 -17.406   0.725 1.00 . A A . 58 TYR C    1 1 
        3  3585 1 1 58 TYR CA   C  -2.168 -16.968   2.104 1.00 . A A . 58 TYR CA   1 1 
        3  3586 1 1 58 TYR CB   C  -0.705 -16.507   2.040 1.00 . A A . 58 TYR CB   1 1 
        3  3587 1 1 58 TYR CD1  C  -0.788 -14.527   3.602 1.00 . A A . 58 TYR CD1  1 1 
        3  3588 1 1 58 TYR CD2  C   0.658 -16.336   4.175 1.00 . A A . 58 TYR CD2  1 1 
        3  3589 1 1 58 TYR CE1  C  -0.401 -13.852   4.742 1.00 . A A . 58 TYR CE1  1 1 
        3  3590 1 1 58 TYR CE2  C   1.049 -15.664   5.319 1.00 . A A . 58 TYR CE2  1 1 
        3  3591 1 1 58 TYR CG   C  -0.265 -15.778   3.296 1.00 . A A . 58 TYR CG   1 1 
        3  3592 1 1 58 TYR CZ   C   0.516 -14.424   5.598 1.00 . A A . 58 TYR CZ   1 1 
        3  3593 1 1 58 TYR H    H  -2.988 -17.855   3.842 1.00 . A A . 58 TYR H    1 1 
        3  3594 1 1 58 TYR HA   H  -2.770 -16.126   2.421 1.00 . A A . 58 TYR HA   1 1 
        3  3595 1 1 58 TYR HB2  H  -0.066 -17.367   1.907 1.00 . A A . 58 TYR HB2  1 1 
        3  3596 1 1 58 TYR HB3  H  -0.577 -15.835   1.203 1.00 . A A . 58 TYR HB3  1 1 
        3  3597 1 1 58 TYR HD1  H  -1.505 -14.079   2.931 1.00 . A A . 58 TYR HD1  1 1 
        3  3598 1 1 58 TYR HD2  H   1.073 -17.310   3.956 1.00 . A A . 58 TYR HD2  1 1 
        3  3599 1 1 58 TYR HE1  H  -0.821 -12.881   4.961 1.00 . A A . 58 TYR HE1  1 1 
        3  3600 1 1 58 TYR HE2  H   1.768 -16.113   5.988 1.00 . A A . 58 TYR HE2  1 1 
        3  3601 1 1 58 TYR HH   H   1.863 -13.817   6.835 1.00 . A A . 58 TYR HH   1 1 
        3  3602 1 1 58 TYR N    N  -2.350 -18.016   3.117 1.00 . A A . 58 TYR N    1 1 
        3  3603 1 1 58 TYR O    O  -1.996 -18.112  -0.018 1.00 . A A . 58 TYR O    1 1 
        3  3604 1 1 58 TYR OH   O   0.907 -13.747   6.735 1.00 . A A . 58 TYR OH   1 1 
        3  3605 1 1 59 ALA C    C  -3.987 -16.428  -2.050 1.00 . A A . 59 ALA C    1 1 
        3  3606 1 1 59 ALA CA   C  -4.524 -17.298  -0.893 1.00 . A A . 59 ALA CA   1 1 
        3  3607 1 1 59 ALA CB   C  -6.037 -17.138  -0.761 1.00 . A A . 59 ALA CB   1 1 
        3  3608 1 1 59 ALA H    H  -4.385 -16.415   1.033 1.00 . A A . 59 ALA H    1 1 
        3  3609 1 1 59 ALA HA   H  -4.317 -18.336  -1.111 1.00 . A A . 59 ALA HA   1 1 
        3  3610 1 1 59 ALA HB1  H  -6.394 -17.755   0.052 1.00 . A A . 59 ALA HB1  1 1 
        3  3611 1 1 59 ALA HB2  H  -6.515 -17.443  -1.680 1.00 . A A . 59 ALA HB2  1 1 
        3  3612 1 1 59 ALA HB3  H  -6.276 -16.104  -0.557 1.00 . A A . 59 ALA HB3  1 1 
        3  3613 1 1 59 ALA N    N  -3.890 -16.968   0.391 1.00 . A A . 59 ALA N    1 1 
        3  3614 1 1 59 ALA O    O  -4.709 -16.150  -3.007 1.00 . A A . 59 ALA O    1 1 
        3  3615 1 1 60 ASN C    C  -2.577 -13.740  -2.946 1.00 . A A . 60 ASN C    1 1 
        3  3616 1 1 60 ASN CA   C  -2.047 -15.189  -2.970 1.00 . A A . 60 ASN CA   1 1 
        3  3617 1 1 60 ASN CB   C  -2.206 -15.792  -4.378 1.00 . A A . 60 ASN CB   1 1 
        3  3618 1 1 60 ASN CG   C  -1.546 -14.952  -5.457 1.00 . A A . 60 ASN CG   1 1 
        3  3619 1 1 60 ASN H    H  -2.185 -16.330  -1.189 1.00 . A A . 60 ASN H    1 1 
        3  3620 1 1 60 ASN HA   H  -0.994 -15.167  -2.723 1.00 . A A . 60 ASN HA   1 1 
        3  3621 1 1 60 ASN HB2  H  -1.759 -16.777  -4.393 1.00 . A A . 60 ASN HB2  1 1 
        3  3622 1 1 60 ASN HB3  H  -3.258 -15.879  -4.607 1.00 . A A . 60 ASN HB3  1 1 
        3  3623 1 1 60 ASN HD21 H  -2.923 -15.499  -6.767 1.00 . A A . 60 ASN HD21 1 1 
        3  3624 1 1 60 ASN HD22 H  -1.711 -14.422  -7.355 1.00 . A A . 60 ASN HD22 1 1 
        3  3625 1 1 60 ASN N    N  -2.706 -16.037  -1.959 1.00 . A A . 60 ASN N    1 1 
        3  3626 1 1 60 ASN ND2  N  -2.116 -14.960  -6.644 1.00 . A A . 60 ASN ND2  1 1 
        3  3627 1 1 60 ASN O    O  -3.783 -13.501  -2.887 1.00 . A A . 60 ASN O    1 1 
        3  3628 1 1 60 ASN OD1  O  -0.534 -14.296  -5.225 1.00 . A A . 60 ASN OD1  1 1 
        3  3629 1 1 61 VAL C    C  -2.666 -11.070  -4.453 1.00 . A A . 61 VAL C    1 1 
        3  3630 1 1 61 VAL CA   C  -2.034 -11.361  -3.080 1.00 . A A . 61 VAL CA   1 1 
        3  3631 1 1 61 VAL CB   C  -0.812 -10.431  -2.862 1.00 . A A . 61 VAL CB   1 1 
        3  3632 1 1 61 VAL CG1  C  -1.225  -8.959  -2.904 1.00 . A A . 61 VAL CG1  1 1 
        3  3633 1 1 61 VAL CG2  C  -0.110 -10.760  -1.545 1.00 . A A . 61 VAL CG2  1 1 
        3  3634 1 1 61 VAL H    H  -0.711 -13.014  -2.948 1.00 . A A . 61 VAL H    1 1 
        3  3635 1 1 61 VAL HA   H  -2.764 -11.154  -2.307 1.00 . A A . 61 VAL HA   1 1 
        3  3636 1 1 61 VAL HB   H  -0.111 -10.604  -3.668 1.00 . A A . 61 VAL HB   1 1 
        3  3637 1 1 61 VAL HG11 H  -1.653  -8.731  -3.869 1.00 . A A . 61 VAL HG11 1 1 
        3  3638 1 1 61 VAL HG12 H  -0.359  -8.335  -2.740 1.00 . A A . 61 VAL HG12 1 1 
        3  3639 1 1 61 VAL HG13 H  -1.958  -8.766  -2.132 1.00 . A A . 61 VAL HG13 1 1 
        3  3640 1 1 61 VAL HG21 H  -0.802 -10.630  -0.725 1.00 . A A . 61 VAL HG21 1 1 
        3  3641 1 1 61 VAL HG22 H   0.736 -10.101  -1.410 1.00 . A A . 61 VAL HG22 1 1 
        3  3642 1 1 61 VAL HG23 H   0.233 -11.785  -1.565 1.00 . A A . 61 VAL HG23 1 1 
        3  3643 1 1 61 VAL N    N  -1.660 -12.773  -2.985 1.00 . A A . 61 VAL N    1 1 
        3  3644 1 1 61 VAL O    O  -1.962 -10.966  -5.463 1.00 . A A . 61 VAL O    1 1 
        3  3645 1 1 62 SER C    C  -4.209  -9.674  -6.604 1.00 . A A . 62 SER C    1 1 
        3  3646 1 1 62 SER CA   C  -4.772 -10.792  -5.710 1.00 . A A . 62 SER CA   1 1 
        3  3647 1 1 62 SER CB   C  -6.239 -10.490  -5.369 1.00 . A A . 62 SER CB   1 1 
        3  3648 1 1 62 SER H    H  -4.479 -11.036  -3.622 1.00 . A A . 62 SER H    1 1 
        3  3649 1 1 62 SER HA   H  -4.732 -11.725  -6.255 1.00 . A A . 62 SER HA   1 1 
        3  3650 1 1 62 SER HB2  H  -6.634 -11.283  -4.751 1.00 . A A . 62 SER HB2  1 1 
        3  3651 1 1 62 SER HB3  H  -6.295  -9.556  -4.828 1.00 . A A . 62 SER HB3  1 1 
        3  3652 1 1 62 SER HG   H  -7.926 -10.080  -6.290 1.00 . A A . 62 SER HG   1 1 
        3  3653 1 1 62 SER N    N  -3.996 -10.971  -4.471 1.00 . A A . 62 SER N    1 1 
        3  3654 1 1 62 SER O    O  -4.248  -8.492  -6.247 1.00 . A A . 62 SER O    1 1 
        3  3655 1 1 62 SER OG   O  -7.041 -10.388  -6.536 1.00 . A A . 62 SER OG   1 1 
        3  3656 1 1 63 ALA C    C  -4.119  -8.016  -9.160 1.00 . A A . 63 ALA C    1 1 
        3  3657 1 1 63 ALA CA   C  -3.113  -9.103  -8.731 1.00 . A A . 63 ALA CA   1 1 
        3  3658 1 1 63 ALA CB   C  -2.594  -9.846  -9.953 1.00 . A A . 63 ALA CB   1 1 
        3  3659 1 1 63 ALA H    H  -3.677 -11.015  -7.995 1.00 . A A . 63 ALA H    1 1 
        3  3660 1 1 63 ALA HA   H  -2.270  -8.623  -8.251 1.00 . A A . 63 ALA HA   1 1 
        3  3661 1 1 63 ALA HB1  H  -1.880 -10.596  -9.643 1.00 . A A . 63 ALA HB1  1 1 
        3  3662 1 1 63 ALA HB2  H  -2.115  -9.148 -10.625 1.00 . A A . 63 ALA HB2  1 1 
        3  3663 1 1 63 ALA HB3  H  -3.419 -10.325 -10.460 1.00 . A A . 63 ALA HB3  1 1 
        3  3664 1 1 63 ALA N    N  -3.688 -10.058  -7.773 1.00 . A A . 63 ALA N    1 1 
        3  3665 1 1 63 ALA O    O  -3.727  -6.957  -9.660 1.00 . A A . 63 ALA O    1 1 
        3  3666 1 1 64 ALA C    C  -6.268  -5.966  -8.562 1.00 . A A . 64 ALA C    1 1 
        3  3667 1 1 64 ALA CA   C  -6.478  -7.314  -9.277 1.00 . A A . 64 ALA CA   1 1 
        3  3668 1 1 64 ALA CB   C  -7.840  -7.898  -8.906 1.00 . A A . 64 ALA CB   1 1 
        3  3669 1 1 64 ALA H    H  -5.667  -9.163  -8.612 1.00 . A A . 64 ALA H    1 1 
        3  3670 1 1 64 ALA HA   H  -6.468  -7.145 -10.345 1.00 . A A . 64 ALA HA   1 1 
        3  3671 1 1 64 ALA HB1  H  -7.975  -8.844  -9.409 1.00 . A A . 64 ALA HB1  1 1 
        3  3672 1 1 64 ALA HB2  H  -8.623  -7.216  -9.210 1.00 . A A . 64 ALA HB2  1 1 
        3  3673 1 1 64 ALA HB3  H  -7.890  -8.051  -7.839 1.00 . A A . 64 ALA HB3  1 1 
        3  3674 1 1 64 ALA N    N  -5.414  -8.282  -8.964 1.00 . A A . 64 ALA N    1 1 
        3  3675 1 1 64 ALA O    O  -6.810  -4.943  -8.975 1.00 . A A . 64 ALA O    1 1 
        3  3676 1 1 65 LYS C    C  -3.980  -3.990  -7.278 1.00 . A A . 65 LYS C    1 1 
        3  3677 1 1 65 LYS CA   C  -5.189  -4.768  -6.715 1.00 . A A . 65 LYS CA   1 1 
        3  3678 1 1 65 LYS CB   C  -4.945  -5.153  -5.245 1.00 . A A . 65 LYS CB   1 1 
        3  3679 1 1 65 LYS CD   C  -4.424  -4.376  -2.891 1.00 . A A . 65 LYS CD   1 1 
        3  3680 1 1 65 LYS CE   C  -5.828  -4.568  -2.330 1.00 . A A . 65 LYS CE   1 1 
        3  3681 1 1 65 LYS CG   C  -4.454  -4.002  -4.371 1.00 . A A . 65 LYS CG   1 1 
        3  3682 1 1 65 LYS H    H  -5.085  -6.831  -7.207 1.00 . A A . 65 LYS H    1 1 
        3  3683 1 1 65 LYS HA   H  -6.061  -4.130  -6.765 1.00 . A A . 65 LYS HA   1 1 
        3  3684 1 1 65 LYS HB2  H  -5.870  -5.526  -4.826 1.00 . A A . 65 LYS HB2  1 1 
        3  3685 1 1 65 LYS HB3  H  -4.206  -5.941  -5.212 1.00 . A A . 65 LYS HB3  1 1 
        3  3686 1 1 65 LYS HD2  H  -3.870  -5.295  -2.768 1.00 . A A . 65 LYS HD2  1 1 
        3  3687 1 1 65 LYS HD3  H  -3.934  -3.585  -2.340 1.00 . A A . 65 LYS HD3  1 1 
        3  3688 1 1 65 LYS HE2  H  -6.394  -3.662  -2.489 1.00 . A A . 65 LYS HE2  1 1 
        3  3689 1 1 65 LYS HE3  H  -6.306  -5.386  -2.854 1.00 . A A . 65 LYS HE3  1 1 
        3  3690 1 1 65 LYS HG2  H  -3.455  -3.732  -4.680 1.00 . A A . 65 LYS HG2  1 1 
        3  3691 1 1 65 LYS HG3  H  -5.112  -3.154  -4.505 1.00 . A A . 65 LYS HG3  1 1 
        3  3692 1 1 65 LYS HZ1  H  -5.212  -4.188  -0.371 1.00 . A A . 65 LYS HZ1  1 1 
        3  3693 1 1 65 LYS HZ2  H  -5.430  -5.831  -0.714 1.00 . A A . 65 LYS HZ2  1 1 
        3  3694 1 1 65 LYS HZ3  H  -6.771  -4.827  -0.488 1.00 . A A . 65 LYS HZ3  1 1 
        3  3695 1 1 65 LYS N    N  -5.480  -5.980  -7.491 1.00 . A A . 65 LYS N    1 1 
        3  3696 1 1 65 LYS NZ   N  -5.809  -4.874  -0.875 1.00 . A A . 65 LYS NZ   1 1 
        3  3697 1 1 65 LYS O    O  -3.889  -2.772  -7.117 1.00 . A A . 65 LYS O    1 1 
        3  3698 1 1 66 CYS C    C  -1.986  -2.862  -9.297 1.00 . A A . 66 CYS C    1 1 
        3  3699 1 1 66 CYS CA   C  -1.798  -4.108  -8.412 1.00 . A A . 66 CYS CA   1 1 
        3  3700 1 1 66 CYS CB   C  -0.971  -5.152  -9.173 1.00 . A A . 66 CYS CB   1 1 
        3  3701 1 1 66 CYS H    H  -3.270  -5.632  -8.168 1.00 . A A . 66 CYS H    1 1 
        3  3702 1 1 66 CYS HA   H  -1.248  -3.816  -7.529 1.00 . A A . 66 CYS HA   1 1 
        3  3703 1 1 66 CYS HB2  H  -0.812  -6.010  -8.538 1.00 . A A . 66 CYS HB2  1 1 
        3  3704 1 1 66 CYS HB3  H  -1.512  -5.459 -10.057 1.00 . A A . 66 CYS HB3  1 1 
        3  3705 1 1 66 CYS HG   H   1.480  -4.686  -8.672 1.00 . A A . 66 CYS HG   1 1 
        3  3706 1 1 66 CYS N    N  -3.076  -4.694  -7.958 1.00 . A A . 66 CYS N    1 1 
        3  3707 1 1 66 CYS O    O  -1.333  -1.837  -9.086 1.00 . A A . 66 CYS O    1 1 
        3  3708 1 1 66 CYS SG   S   0.654  -4.560  -9.703 1.00 . A A . 66 CYS SG   1 1 
        3  3709 1 1 67 GLN C    C  -3.567  -0.558 -10.567 1.00 . A A . 67 GLN C    1 1 
        3  3710 1 1 67 GLN CA   C  -3.079  -1.853 -11.243 1.00 . A A . 67 GLN CA   1 1 
        3  3711 1 1 67 GLN CB   C  -4.065  -2.287 -12.339 1.00 . A A . 67 GLN CB   1 1 
        3  3712 1 1 67 GLN CD   C  -2.353  -3.158 -14.021 1.00 . A A . 67 GLN CD   1 1 
        3  3713 1 1 67 GLN CG   C  -3.579  -3.472 -13.175 1.00 . A A . 67 GLN CG   1 1 
        3  3714 1 1 67 GLN H    H  -3.413  -3.766 -10.369 1.00 . A A . 67 GLN H    1 1 
        3  3715 1 1 67 GLN HA   H  -2.122  -1.652 -11.703 1.00 . A A . 67 GLN HA   1 1 
        3  3716 1 1 67 GLN HB2  H  -5.001  -2.561 -11.875 1.00 . A A . 67 GLN HB2  1 1 
        3  3717 1 1 67 GLN HB3  H  -4.236  -1.452 -13.005 1.00 . A A . 67 GLN HB3  1 1 
        3  3718 1 1 67 GLN HE21 H  -2.883  -4.520 -15.352 1.00 . A A . 67 GLN HE21 1 1 
        3  3719 1 1 67 GLN HE22 H  -1.423  -3.664 -15.687 1.00 . A A . 67 GLN HE22 1 1 
        3  3720 1 1 67 GLN HG2  H  -3.334  -4.289 -12.510 1.00 . A A . 67 GLN HG2  1 1 
        3  3721 1 1 67 GLN HG3  H  -4.381  -3.780 -13.832 1.00 . A A . 67 GLN HG3  1 1 
        3  3722 1 1 67 GLN N    N  -2.880  -2.949 -10.281 1.00 . A A . 67 GLN N    1 1 
        3  3723 1 1 67 GLN NE2  N  -2.206  -3.849 -15.132 1.00 . A A . 67 GLN NE2  1 1 
        3  3724 1 1 67 GLN O    O  -2.972   0.510 -10.753 1.00 . A A . 67 GLN O    1 1 
        3  3725 1 1 67 GLN OE1  O  -1.535  -2.307 -13.681 1.00 . A A . 67 GLN OE1  1 1 
        3  3726 1 1 68 GLU C    C  -4.169   1.030  -8.024 1.00 . A A . 68 GLU C    1 1 
        3  3727 1 1 68 GLU CA   C  -5.173   0.514  -9.067 1.00 . A A . 68 GLU CA   1 1 
        3  3728 1 1 68 GLU CB   C  -6.505   0.170  -8.386 1.00 . A A . 68 GLU CB   1 1 
        3  3729 1 1 68 GLU CD   C  -7.528  -0.950 -10.438 1.00 . A A . 68 GLU CD   1 1 
        3  3730 1 1 68 GLU CG   C  -7.696   0.091  -9.341 1.00 . A A . 68 GLU CG   1 1 
        3  3731 1 1 68 GLU H    H  -5.116  -1.508  -9.726 1.00 . A A . 68 GLU H    1 1 
        3  3732 1 1 68 GLU HA   H  -5.347   1.301  -9.789 1.00 . A A . 68 GLU HA   1 1 
        3  3733 1 1 68 GLU HB2  H  -6.404  -0.788  -7.893 1.00 . A A . 68 GLU HB2  1 1 
        3  3734 1 1 68 GLU HB3  H  -6.720   0.922  -7.642 1.00 . A A . 68 GLU HB3  1 1 
        3  3735 1 1 68 GLU HG2  H  -8.580  -0.156  -8.770 1.00 . A A . 68 GLU HG2  1 1 
        3  3736 1 1 68 GLU HG3  H  -7.831   1.061  -9.800 1.00 . A A . 68 GLU HG3  1 1 
        3  3737 1 1 68 GLU N    N  -4.648  -0.647  -9.798 1.00 . A A . 68 GLU N    1 1 
        3  3738 1 1 68 GLU O    O  -4.068   2.235  -7.792 1.00 . A A . 68 GLU O    1 1 
        3  3739 1 1 68 GLU OE1  O  -7.221  -2.113 -10.115 1.00 . A A . 68 GLU OE1  1 1 
        3  3740 1 1 68 GLU OE2  O  -7.701  -0.609 -11.629 1.00 . A A . 68 GLU OE2  1 1 
        3  3741 1 1 69 PHE C    C  -1.293   1.317  -7.056 1.00 . A A . 69 PHE C    1 1 
        3  3742 1 1 69 PHE CA   C  -2.413   0.480  -6.411 1.00 . A A . 69 PHE CA   1 1 
        3  3743 1 1 69 PHE CB   C  -1.831  -0.784  -5.764 1.00 . A A . 69 PHE CB   1 1 
        3  3744 1 1 69 PHE CD1  C  -1.332  -0.213  -3.364 1.00 . A A . 69 PHE CD1  1 1 
        3  3745 1 1 69 PHE CD2  C   0.506  -0.561  -4.844 1.00 . A A . 69 PHE CD2  1 1 
        3  3746 1 1 69 PHE CE1  C  -0.453   0.032  -2.327 1.00 . A A . 69 PHE CE1  1 1 
        3  3747 1 1 69 PHE CE2  C   1.388  -0.318  -3.808 1.00 . A A . 69 PHE CE2  1 1 
        3  3748 1 1 69 PHE CG   C  -0.865  -0.512  -4.635 1.00 . A A . 69 PHE CG   1 1 
        3  3749 1 1 69 PHE CZ   C   0.907  -0.022  -2.548 1.00 . A A . 69 PHE CZ   1 1 
        3  3750 1 1 69 PHE H    H  -3.572  -0.834  -7.612 1.00 . A A . 69 PHE H    1 1 
        3  3751 1 1 69 PHE HA   H  -2.897   1.073  -5.648 1.00 . A A . 69 PHE HA   1 1 
        3  3752 1 1 69 PHE HB2  H  -2.640  -1.380  -5.368 1.00 . A A . 69 PHE HB2  1 1 
        3  3753 1 1 69 PHE HB3  H  -1.310  -1.357  -6.519 1.00 . A A . 69 PHE HB3  1 1 
        3  3754 1 1 69 PHE HD1  H  -2.397  -0.171  -3.187 1.00 . A A . 69 PHE HD1  1 1 
        3  3755 1 1 69 PHE HD2  H   0.885  -0.793  -5.830 1.00 . A A . 69 PHE HD2  1 1 
        3  3756 1 1 69 PHE HE1  H  -0.832   0.263  -1.341 1.00 . A A . 69 PHE HE1  1 1 
        3  3757 1 1 69 PHE HE2  H   2.453  -0.359  -3.984 1.00 . A A . 69 PHE HE2  1 1 
        3  3758 1 1 69 PHE HZ   H   1.596   0.167  -1.737 1.00 . A A . 69 PHE HZ   1 1 
        3  3759 1 1 69 PHE N    N  -3.430   0.114  -7.402 1.00 . A A . 69 PHE N    1 1 
        3  3760 1 1 69 PHE O    O  -1.018   2.436  -6.626 1.00 . A A . 69 PHE O    1 1 
        3  3761 1 1 70 GLY C    C  -0.033   2.801  -9.429 1.00 . A A . 70 GLY C    1 1 
        3  3762 1 1 70 GLY CA   C   0.412   1.483  -8.790 1.00 . A A . 70 GLY CA   1 1 
        3  3763 1 1 70 GLY H    H  -0.939  -0.119  -8.410 1.00 . A A . 70 GLY H    1 1 
        3  3764 1 1 70 GLY HA2  H   1.198   1.692  -8.079 1.00 . A A . 70 GLY HA2  1 1 
        3  3765 1 1 70 GLY HA3  H   0.809   0.841  -9.563 1.00 . A A . 70 GLY HA3  1 1 
        3  3766 1 1 70 GLY N    N  -0.668   0.774  -8.101 1.00 . A A . 70 GLY N    1 1 
        3  3767 1 1 70 GLY O    O   0.757   3.733  -9.565 1.00 . A A . 70 GLY O    1 1 
        3  3768 1 1 71 ARG C    C  -2.139   5.158  -9.355 1.00 . A A . 71 ARG C    1 1 
        3  3769 1 1 71 ARG CA   C  -1.870   4.085 -10.429 1.00 . A A . 71 ARG CA   1 1 
        3  3770 1 1 71 ARG CB   C  -3.169   3.709 -11.179 1.00 . A A . 71 ARG CB   1 1 
        3  3771 1 1 71 ARG CD   C  -4.418   5.924 -11.441 1.00 . A A . 71 ARG CD   1 1 
        3  3772 1 1 71 ARG CG   C  -3.709   4.768 -12.147 1.00 . A A . 71 ARG CG   1 1 
        3  3773 1 1 71 ARG CZ   C  -6.602   4.967 -10.849 1.00 . A A . 71 ARG CZ   1 1 
        3  3774 1 1 71 ARG H    H  -1.875   2.081  -9.714 1.00 . A A . 71 ARG H    1 1 
        3  3775 1 1 71 ARG HA   H  -1.151   4.472 -11.138 1.00 . A A . 71 ARG HA   1 1 
        3  3776 1 1 71 ARG HB2  H  -2.982   2.810 -11.748 1.00 . A A . 71 ARG HB2  1 1 
        3  3777 1 1 71 ARG HB3  H  -3.941   3.496 -10.449 1.00 . A A . 71 ARG HB3  1 1 
        3  3778 1 1 71 ARG HD2  H  -3.685   6.501 -10.898 1.00 . A A . 71 ARG HD2  1 1 
        3  3779 1 1 71 ARG HD3  H  -4.884   6.552 -12.187 1.00 . A A . 71 ARG HD3  1 1 
        3  3780 1 1 71 ARG HE   H  -5.253   5.561  -9.548 1.00 . A A . 71 ARG HE   1 1 
        3  3781 1 1 71 ARG HG2  H  -2.882   5.168 -12.715 1.00 . A A . 71 ARG HG2  1 1 
        3  3782 1 1 71 ARG HG3  H  -4.407   4.294 -12.823 1.00 . A A . 71 ARG HG3  1 1 
        3  3783 1 1 71 ARG HH11 H  -6.284   5.095 -12.812 1.00 . A A . 71 ARG HH11 1 1 
        3  3784 1 1 71 ARG HH12 H  -7.813   4.445 -12.335 1.00 . A A . 71 ARG HH12 1 1 
        3  3785 1 1 71 ARG HH21 H  -7.228   4.740  -8.976 1.00 . A A . 71 ARG HH21 1 1 
        3  3786 1 1 71 ARG HH22 H  -8.338   4.246 -10.207 1.00 . A A . 71 ARG HH22 1 1 
        3  3787 1 1 71 ARG N    N  -1.302   2.872  -9.823 1.00 . A A . 71 ARG N    1 1 
        3  3788 1 1 71 ARG NE   N  -5.444   5.466 -10.501 1.00 . A A . 71 ARG NE   1 1 
        3  3789 1 1 71 ARG NH1  N  -6.922   4.824 -12.094 1.00 . A A . 71 ARG NH1  1 1 
        3  3790 1 1 71 ARG NH2  N  -7.452   4.623  -9.940 1.00 . A A . 71 ARG NH2  1 1 
        3  3791 1 1 71 ARG O    O  -1.705   6.307  -9.473 1.00 . A A . 71 ARG O    1 1 
        3  3792 1 1 72 TRP C    C  -2.064   6.021  -6.300 1.00 . A A . 72 TRP C    1 1 
        3  3793 1 1 72 TRP CA   C  -3.247   5.665  -7.218 1.00 . A A . 72 TRP CA   1 1 
        3  3794 1 1 72 TRP CB   C  -4.378   5.014  -6.403 1.00 . A A . 72 TRP CB   1 1 
        3  3795 1 1 72 TRP CD1  C  -5.346   6.911  -4.963 1.00 . A A . 72 TRP CD1  1 1 
        3  3796 1 1 72 TRP CD2  C  -4.416   5.248  -3.791 1.00 . A A . 72 TRP CD2  1 1 
        3  3797 1 1 72 TRP CE2  C  -4.905   6.212  -2.890 1.00 . A A . 72 TRP CE2  1 1 
        3  3798 1 1 72 TRP CE3  C  -3.789   4.109  -3.282 1.00 . A A . 72 TRP CE3  1 1 
        3  3799 1 1 72 TRP CG   C  -4.705   5.715  -5.114 1.00 . A A . 72 TRP CG   1 1 
        3  3800 1 1 72 TRP CH2  C  -4.173   4.944  -1.040 1.00 . A A . 72 TRP CH2  1 1 
        3  3801 1 1 72 TRP CZ2  C  -4.789   6.070  -1.510 1.00 . A A . 72 TRP CZ2  1 1 
        3  3802 1 1 72 TRP CZ3  C  -3.673   3.969  -1.913 1.00 . A A . 72 TRP CZ3  1 1 
        3  3803 1 1 72 TRP H    H  -3.126   3.820  -8.256 1.00 . A A . 72 TRP H    1 1 
        3  3804 1 1 72 TRP HA   H  -3.622   6.574  -7.667 1.00 . A A . 72 TRP HA   1 1 
        3  3805 1 1 72 TRP HB2  H  -5.275   4.997  -7.003 1.00 . A A . 72 TRP HB2  1 1 
        3  3806 1 1 72 TRP HB3  H  -4.096   3.997  -6.166 1.00 . A A . 72 TRP HB3  1 1 
        3  3807 1 1 72 TRP HD1  H  -5.697   7.521  -5.783 1.00 . A A . 72 TRP HD1  1 1 
        3  3808 1 1 72 TRP HE1  H  -5.888   8.026  -3.267 1.00 . A A . 72 TRP HE1  1 1 
        3  3809 1 1 72 TRP HE3  H  -3.397   3.346  -3.940 1.00 . A A . 72 TRP HE3  1 1 
        3  3810 1 1 72 TRP HH2  H  -4.060   4.794   0.023 1.00 . A A . 72 TRP HH2  1 1 
        3  3811 1 1 72 TRP HZ2  H  -5.169   6.813  -0.825 1.00 . A A . 72 TRP HZ2  1 1 
        3  3812 1 1 72 TRP HZ3  H  -3.193   3.094  -1.500 1.00 . A A . 72 TRP HZ3  1 1 
        3  3813 1 1 72 TRP N    N  -2.854   4.760  -8.307 1.00 . A A . 72 TRP N    1 1 
        3  3814 1 1 72 TRP NE1  N  -5.467   7.217  -3.631 1.00 . A A . 72 TRP NE1  1 1 
        3  3815 1 1 72 TRP O    O  -1.696   7.193  -6.169 1.00 . A A . 72 TRP O    1 1 
        3  3816 1 1 73 TYR C    C   0.779   6.013  -5.254 1.00 . A A . 73 TYR C    1 1 
        3  3817 1 1 73 TYR CA   C  -0.401   5.200  -4.682 1.00 . A A . 73 TYR CA   1 1 
        3  3818 1 1 73 TYR CB   C   0.079   3.835  -4.157 1.00 . A A . 73 TYR CB   1 1 
        3  3819 1 1 73 TYR CD1  C   0.017   4.487  -1.711 1.00 . A A . 73 TYR CD1  1 1 
        3  3820 1 1 73 TYR CD2  C   1.929   3.294  -2.500 1.00 . A A . 73 TYR CD2  1 1 
        3  3821 1 1 73 TYR CE1  C   0.553   4.512  -0.437 1.00 . A A . 73 TYR CE1  1 1 
        3  3822 1 1 73 TYR CE2  C   2.473   3.317  -1.227 1.00 . A A . 73 TYR CE2  1 1 
        3  3823 1 1 73 TYR CG   C   0.693   3.878  -2.767 1.00 . A A . 73 TYR CG   1 1 
        3  3824 1 1 73 TYR CZ   C   1.781   3.929  -0.199 1.00 . A A . 73 TYR CZ   1 1 
        3  3825 1 1 73 TYR H    H  -1.738   4.087  -5.904 1.00 . A A . 73 TYR H    1 1 
        3  3826 1 1 73 TYR HA   H  -0.831   5.755  -3.859 1.00 . A A . 73 TYR HA   1 1 
        3  3827 1 1 73 TYR HB2  H  -0.763   3.158  -4.119 1.00 . A A . 73 TYR HB2  1 1 
        3  3828 1 1 73 TYR HB3  H   0.818   3.433  -4.838 1.00 . A A . 73 TYR HB3  1 1 
        3  3829 1 1 73 TYR HD1  H  -0.944   4.946  -1.896 1.00 . A A . 73 TYR HD1  1 1 
        3  3830 1 1 73 TYR HD2  H   2.470   2.817  -3.307 1.00 . A A . 73 TYR HD2  1 1 
        3  3831 1 1 73 TYR HE1  H   0.011   4.989   0.367 1.00 . A A . 73 TYR HE1  1 1 
        3  3832 1 1 73 TYR HE2  H   3.434   2.861  -1.043 1.00 . A A . 73 TYR HE2  1 1 
        3  3833 1 1 73 TYR HH   H   3.262   4.099   1.025 1.00 . A A . 73 TYR HH   1 1 
        3  3834 1 1 73 TYR N    N  -1.462   5.003  -5.681 1.00 . A A . 73 TYR N    1 1 
        3  3835 1 1 73 TYR O    O   1.488   6.700  -4.517 1.00 . A A . 73 TYR O    1 1 
        3  3836 1 1 73 TYR OH   O   2.311   3.952   1.071 1.00 . A A . 73 TYR OH   1 1 
        3  3837 1 1 74 LYS C    C   1.841   8.232  -7.046 1.00 . A A . 74 LYS C    1 1 
        3  3838 1 1 74 LYS CA   C   1.996   6.715  -7.277 1.00 . A A . 74 LYS CA   1 1 
        3  3839 1 1 74 LYS CB   C   1.940   6.399  -8.783 1.00 . A A . 74 LYS CB   1 1 
        3  3840 1 1 74 LYS CD   C   2.892   6.819 -11.103 1.00 . A A . 74 LYS CD   1 1 
        3  3841 1 1 74 LYS CE   C   1.522   6.682 -11.764 1.00 . A A . 74 LYS CE   1 1 
        3  3842 1 1 74 LYS CG   C   2.798   7.316  -9.657 1.00 . A A . 74 LYS CG   1 1 
        3  3843 1 1 74 LYS H    H   0.383   5.343  -7.095 1.00 . A A . 74 LYS H    1 1 
        3  3844 1 1 74 LYS HA   H   2.959   6.404  -6.894 1.00 . A A . 74 LYS HA   1 1 
        3  3845 1 1 74 LYS HB2  H   2.272   5.383  -8.934 1.00 . A A . 74 LYS HB2  1 1 
        3  3846 1 1 74 LYS HB3  H   0.913   6.480  -9.115 1.00 . A A . 74 LYS HB3  1 1 
        3  3847 1 1 74 LYS HD2  H   3.482   7.523 -11.672 1.00 . A A . 74 LYS HD2  1 1 
        3  3848 1 1 74 LYS HD3  H   3.383   5.856 -11.109 1.00 . A A . 74 LYS HD3  1 1 
        3  3849 1 1 74 LYS HE2  H   0.954   5.925 -11.244 1.00 . A A . 74 LYS HE2  1 1 
        3  3850 1 1 74 LYS HE3  H   1.007   7.629 -11.694 1.00 . A A . 74 LYS HE3  1 1 
        3  3851 1 1 74 LYS HG2  H   2.362   8.305  -9.658 1.00 . A A . 74 LYS HG2  1 1 
        3  3852 1 1 74 LYS HG3  H   3.793   7.364  -9.240 1.00 . A A . 74 LYS HG3  1 1 
        3  3853 1 1 74 LYS HZ1  H   2.191   5.422 -13.293 1.00 . A A . 74 LYS HZ1  1 1 
        3  3854 1 1 74 LYS HZ2  H   2.114   7.053 -13.734 1.00 . A A . 74 LYS HZ2  1 1 
        3  3855 1 1 74 LYS HZ3  H   0.693   6.142 -13.607 1.00 . A A . 74 LYS HZ3  1 1 
        3  3856 1 1 74 LYS N    N   0.962   5.940  -6.574 1.00 . A A . 74 LYS N    1 1 
        3  3857 1 1 74 LYS NZ   N   1.637   6.299 -13.198 1.00 . A A . 74 LYS NZ   1 1 
        3  3858 1 1 74 LYS O    O   2.821   8.936  -6.778 1.00 . A A . 74 LYS O    1 1 
        3  3859 1 1 75 HIS C    C  -0.060  10.513  -5.540 1.00 . A A . 75 HIS C    1 1 
        3  3860 1 1 75 HIS CA   C   0.331  10.162  -6.984 1.00 . A A . 75 HIS CA   1 1 
        3  3861 1 1 75 HIS CB   C  -0.781  10.601  -7.943 1.00 . A A . 75 HIS CB   1 1 
        3  3862 1 1 75 HIS CD2  C  -0.460   9.455 -10.250 1.00 . A A . 75 HIS CD2  1 1 
        3  3863 1 1 75 HIS CE1  C   0.329  11.175 -11.352 1.00 . A A . 75 HIS CE1  1 1 
        3  3864 1 1 75 HIS CG   C  -0.402  10.498  -9.389 1.00 . A A . 75 HIS CG   1 1 
        3  3865 1 1 75 HIS H    H  -0.141   8.110  -7.309 1.00 . A A . 75 HIS H    1 1 
        3  3866 1 1 75 HIS HA   H   1.236  10.702  -7.232 1.00 . A A . 75 HIS HA   1 1 
        3  3867 1 1 75 HIS HB2  H  -1.653   9.982  -7.785 1.00 . A A . 75 HIS HB2  1 1 
        3  3868 1 1 75 HIS HB3  H  -1.038  11.632  -7.741 1.00 . A A . 75 HIS HB3  1 1 
        3  3869 1 1 75 HIS HD1  H   0.259  12.463  -9.769 1.00 . A A . 75 HIS HD1  1 1 
        3  3870 1 1 75 HIS HD2  H  -0.802   8.454 -10.022 1.00 . A A . 75 HIS HD2  1 1 
        3  3871 1 1 75 HIS HE1  H   0.722  11.798 -12.144 1.00 . A A . 75 HIS HE1  1 1 
        3  3872 1 1 75 HIS HE2  H  -0.111   9.434 -12.320 1.00 . A A . 75 HIS HE2  1 1 
        3  3873 1 1 75 HIS N    N   0.607   8.726  -7.141 1.00 . A A . 75 HIS N    1 1 
        3  3874 1 1 75 HIS ND1  N   0.099  11.557 -10.113 1.00 . A A . 75 HIS ND1  1 1 
        3  3875 1 1 75 HIS NE2  N   0.001   9.905 -11.464 1.00 . A A . 75 HIS NE2  1 1 
        3  3876 1 1 75 HIS O    O   0.244  11.604  -5.056 1.00 . A A . 75 HIS O    1 1 
        3  3877 1 1 76 PHE C    C  -0.008  10.167  -2.544 1.00 . A A . 76 PHE C    1 1 
        3  3878 1 1 76 PHE CA   C  -1.177   9.797  -3.477 1.00 . A A . 76 PHE CA   1 1 
        3  3879 1 1 76 PHE CB   C  -1.898   8.547  -2.954 1.00 . A A . 76 PHE CB   1 1 
        3  3880 1 1 76 PHE CD1  C  -3.627   9.449  -1.362 1.00 . A A . 76 PHE CD1  1 1 
        3  3881 1 1 76 PHE CD2  C  -1.839   8.143  -0.468 1.00 . A A . 76 PHE CD2  1 1 
        3  3882 1 1 76 PHE CE1  C  -4.151   9.606  -0.094 1.00 . A A . 76 PHE CE1  1 1 
        3  3883 1 1 76 PHE CE2  C  -2.360   8.298   0.802 1.00 . A A . 76 PHE CE2  1 1 
        3  3884 1 1 76 PHE CG   C  -2.466   8.715  -1.566 1.00 . A A . 76 PHE CG   1 1 
        3  3885 1 1 76 PHE CZ   C  -3.516   9.030   0.989 1.00 . A A . 76 PHE CZ   1 1 
        3  3886 1 1 76 PHE H    H  -0.931   8.726  -5.298 1.00 . A A . 76 PHE H    1 1 
        3  3887 1 1 76 PHE HA   H  -1.879  10.620  -3.490 1.00 . A A . 76 PHE HA   1 1 
        3  3888 1 1 76 PHE HB2  H  -2.714   8.307  -3.620 1.00 . A A . 76 PHE HB2  1 1 
        3  3889 1 1 76 PHE HB3  H  -1.202   7.718  -2.937 1.00 . A A . 76 PHE HB3  1 1 
        3  3890 1 1 76 PHE HD1  H  -4.125   9.901  -2.210 1.00 . A A . 76 PHE HD1  1 1 
        3  3891 1 1 76 PHE HD2  H  -0.934   7.570  -0.612 1.00 . A A . 76 PHE HD2  1 1 
        3  3892 1 1 76 PHE HE1  H  -5.056  10.179   0.051 1.00 . A A . 76 PHE HE1  1 1 
        3  3893 1 1 76 PHE HE2  H  -1.862   7.847   1.649 1.00 . A A . 76 PHE HE2  1 1 
        3  3894 1 1 76 PHE HZ   H  -3.925   9.153   1.982 1.00 . A A . 76 PHE HZ   1 1 
        3  3895 1 1 76 PHE N    N  -0.725   9.580  -4.859 1.00 . A A . 76 PHE N    1 1 
        3  3896 1 1 76 PHE O    O  -0.110  11.103  -1.749 1.00 . A A . 76 PHE O    1 1 
        3  3897 1 1 77 LYS C    C   3.268  10.640  -2.579 1.00 . A A . 77 LYS C    1 1 
        3  3898 1 1 77 LYS CA   C   2.293   9.721  -1.827 1.00 . A A . 77 LYS CA   1 1 
        3  3899 1 1 77 LYS CB   C   2.994   8.415  -1.425 1.00 . A A . 77 LYS CB   1 1 
        3  3900 1 1 77 LYS CD   C   4.051   6.256  -2.202 1.00 . A A . 77 LYS CD   1 1 
        3  3901 1 1 77 LYS CE   C   4.868   5.559  -3.285 1.00 . A A . 77 LYS CE   1 1 
        3  3902 1 1 77 LYS CG   C   3.687   7.691  -2.578 1.00 . A A . 77 LYS CG   1 1 
        3  3903 1 1 77 LYS H    H   1.120   8.676  -3.270 1.00 . A A . 77 LYS H    1 1 
        3  3904 1 1 77 LYS HA   H   1.966  10.230  -0.930 1.00 . A A . 77 LYS HA   1 1 
        3  3905 1 1 77 LYS HB2  H   3.737   8.639  -0.673 1.00 . A A . 77 LYS HB2  1 1 
        3  3906 1 1 77 LYS HB3  H   2.260   7.746  -0.998 1.00 . A A . 77 LYS HB3  1 1 
        3  3907 1 1 77 LYS HD2  H   4.627   6.270  -1.288 1.00 . A A . 77 LYS HD2  1 1 
        3  3908 1 1 77 LYS HD3  H   3.139   5.698  -2.039 1.00 . A A . 77 LYS HD3  1 1 
        3  3909 1 1 77 LYS HE2  H   4.851   4.495  -3.103 1.00 . A A . 77 LYS HE2  1 1 
        3  3910 1 1 77 LYS HE3  H   4.421   5.766  -4.248 1.00 . A A . 77 LYS HE3  1 1 
        3  3911 1 1 77 LYS HG2  H   3.022   7.672  -3.429 1.00 . A A . 77 LYS HG2  1 1 
        3  3912 1 1 77 LYS HG3  H   4.589   8.227  -2.837 1.00 . A A . 77 LYS HG3  1 1 
        3  3913 1 1 77 LYS HZ1  H   6.320   7.044  -3.473 1.00 . A A . 77 LYS HZ1  1 1 
        3  3914 1 1 77 LYS HZ2  H   6.811   5.528  -4.046 1.00 . A A . 77 LYS HZ2  1 1 
        3  3915 1 1 77 LYS HZ3  H   6.725   5.815  -2.381 1.00 . A A . 77 LYS HZ3  1 1 
        3  3916 1 1 77 LYS N    N   1.100   9.431  -2.641 1.00 . A A . 77 LYS N    1 1 
        3  3917 1 1 77 LYS NZ   N   6.278   6.019  -3.299 1.00 . A A . 77 LYS NZ   1 1 
        3  3918 1 1 77 LYS O    O   4.334  10.982  -2.067 1.00 . A A . 77 LYS O    1 1 
        3  3919 1 1 78 LYS C    C   5.121  11.423  -4.825 1.00 . A A . 78 LYS C    1 1 
        3  3920 1 1 78 LYS CA   C   3.673  11.927  -4.648 1.00 . A A . 78 LYS CA   1 1 
        3  3921 1 1 78 LYS CB   C   3.650  13.360  -4.073 1.00 . A A . 78 LYS CB   1 1 
        3  3922 1 1 78 LYS CD   C   5.032  14.461  -5.914 1.00 . A A . 78 LYS CD   1 1 
        3  3923 1 1 78 LYS CE   C   5.097  15.597  -6.933 1.00 . A A . 78 LYS CE   1 1 
        3  3924 1 1 78 LYS CG   C   3.725  14.479  -5.120 1.00 . A A . 78 LYS CG   1 1 
        3  3925 1 1 78 LYS H    H   2.019  10.710  -4.131 1.00 . A A . 78 LYS H    1 1 
        3  3926 1 1 78 LYS HA   H   3.200  11.941  -5.622 1.00 . A A . 78 LYS HA   1 1 
        3  3927 1 1 78 LYS HB2  H   2.734  13.491  -3.514 1.00 . A A . 78 LYS HB2  1 1 
        3  3928 1 1 78 LYS HB3  H   4.485  13.476  -3.395 1.00 . A A . 78 LYS HB3  1 1 
        3  3929 1 1 78 LYS HD2  H   5.860  14.561  -5.228 1.00 . A A . 78 LYS HD2  1 1 
        3  3930 1 1 78 LYS HD3  H   5.109  13.519  -6.437 1.00 . A A . 78 LYS HD3  1 1 
        3  3931 1 1 78 LYS HE2  H   6.008  15.496  -7.506 1.00 . A A . 78 LYS HE2  1 1 
        3  3932 1 1 78 LYS HE3  H   4.248  15.514  -7.598 1.00 . A A . 78 LYS HE3  1 1 
        3  3933 1 1 78 LYS HG2  H   2.900  14.366  -5.808 1.00 . A A . 78 LYS HG2  1 1 
        3  3934 1 1 78 LYS HG3  H   3.636  15.431  -4.615 1.00 . A A . 78 LYS HG3  1 1 
        3  3935 1 1 78 LYS HZ1  H   4.178  17.094  -5.796 1.00 . A A . 78 LYS HZ1  1 1 
        3  3936 1 1 78 LYS HZ2  H   5.190  17.682  -7.013 1.00 . A A . 78 LYS HZ2  1 1 
        3  3937 1 1 78 LYS HZ3  H   5.857  17.026  -5.605 1.00 . A A . 78 LYS HZ3  1 1 
        3  3938 1 1 78 LYS N    N   2.882  11.027  -3.797 1.00 . A A . 78 LYS N    1 1 
        3  3939 1 1 78 LYS NZ   N   5.079  16.941  -6.291 1.00 . A A . 78 LYS NZ   1 1 
        3  3940 1 1 78 LYS O    O   6.026  11.802  -4.078 1.00 . A A . 78 LYS O    1 1 
        3  3941 1 1 79 THR C    C   6.888  10.028  -7.648 1.00 . A A . 79 THR C    1 1 
        3  3942 1 1 79 THR CA   C   6.675  10.044  -6.126 1.00 . A A . 79 THR CA   1 1 
        3  3943 1 1 79 THR CB   C   6.907   8.623  -5.540 1.00 . A A . 79 THR CB   1 1 
        3  3944 1 1 79 THR CG2  C   8.388   8.240  -5.566 1.00 . A A . 79 THR CG2  1 1 
        3  3945 1 1 79 THR H    H   4.555  10.200  -6.305 1.00 . A A . 79 THR H    1 1 
        3  3946 1 1 79 THR HA   H   7.397  10.717  -5.683 1.00 . A A . 79 THR HA   1 1 
        3  3947 1 1 79 THR HB   H   6.351   7.906  -6.130 1.00 . A A . 79 THR HB   1 1 
        3  3948 1 1 79 THR HG1  H   6.455   9.468  -3.806 1.00 . A A . 79 THR HG1  1 1 
        3  3949 1 1 79 THR HG21 H   8.518   7.270  -5.107 1.00 . A A . 79 THR HG21 1 1 
        3  3950 1 1 79 THR HG22 H   8.959   8.976  -5.018 1.00 . A A . 79 THR HG22 1 1 
        3  3951 1 1 79 THR HG23 H   8.737   8.204  -6.589 1.00 . A A . 79 THR HG23 1 1 
        3  3952 1 1 79 THR N    N   5.327  10.543  -5.800 1.00 . A A . 79 THR N    1 1 
        3  3953 1 1 79 THR O    O   7.731   9.303  -8.175 1.00 . A A . 79 THR O    1 1 
        3  3954 1 1 79 THR OG1  O   6.442   8.574  -4.181 1.00 . A A . 79 THR OG1  1 1 
        3  3955 1 1 80 LYS C    C   5.415  12.192 -10.300 1.00 . A A . 80 LYS C    1 1 
        3  3956 1 1 80 LYS CA   C   6.186  10.957  -9.807 1.00 . A A . 80 LYS CA   1 1 
        3  3957 1 1 80 LYS CB   C   5.622   9.680 -10.449 1.00 . A A . 80 LYS CB   1 1 
        3  3958 1 1 80 LYS CD   C   7.099   9.862 -12.504 1.00 . A A . 80 LYS CD   1 1 
        3  3959 1 1 80 LYS CE   C   7.171   9.686 -14.017 1.00 . A A . 80 LYS CE   1 1 
        3  3960 1 1 80 LYS CG   C   5.678   9.657 -11.976 1.00 . A A . 80 LYS CG   1 1 
        3  3961 1 1 80 LYS H    H   5.484  11.427  -7.863 1.00 . A A . 80 LYS H    1 1 
        3  3962 1 1 80 LYS HA   H   7.227  11.062 -10.082 1.00 . A A . 80 LYS HA   1 1 
        3  3963 1 1 80 LYS HB2  H   6.179   8.829 -10.080 1.00 . A A . 80 LYS HB2  1 1 
        3  3964 1 1 80 LYS HB3  H   4.589   9.572 -10.149 1.00 . A A . 80 LYS HB3  1 1 
        3  3965 1 1 80 LYS HD2  H   7.420  10.864 -12.256 1.00 . A A . 80 LYS HD2  1 1 
        3  3966 1 1 80 LYS HD3  H   7.756   9.145 -12.033 1.00 . A A . 80 LYS HD3  1 1 
        3  3967 1 1 80 LYS HE2  H   7.035   8.641 -14.257 1.00 . A A . 80 LYS HE2  1 1 
        3  3968 1 1 80 LYS HE3  H   6.380  10.265 -14.474 1.00 . A A . 80 LYS HE3  1 1 
        3  3969 1 1 80 LYS HG2  H   5.310   8.702 -12.322 1.00 . A A . 80 LYS HG2  1 1 
        3  3970 1 1 80 LYS HG3  H   5.043  10.446 -12.359 1.00 . A A . 80 LYS HG3  1 1 
        3  3971 1 1 80 LYS HZ1  H   9.256   9.590 -14.158 1.00 . A A . 80 LYS HZ1  1 1 
        3  3972 1 1 80 LYS HZ2  H   8.623  11.147 -14.355 1.00 . A A . 80 LYS HZ2  1 1 
        3  3973 1 1 80 LYS HZ3  H   8.490  10.020 -15.602 1.00 . A A . 80 LYS HZ3  1 1 
        3  3974 1 1 80 LYS N    N   6.115  10.857  -8.345 1.00 . A A . 80 LYS N    1 1 
        3  3975 1 1 80 LYS NZ   N   8.477  10.140 -14.570 1.00 . A A . 80 LYS NZ   1 1 
        3  3976 1 1 80 LYS O    O   4.182  12.186 -10.354 1.00 . A A . 80 LYS O    1 1 
        3  3977 1 1 81 ASP C    C   5.432  14.601 -12.602 1.00 . A A . 81 ASP C    1 1 
        3  3978 1 1 81 ASP CA   C   5.509  14.513 -11.066 1.00 . A A . 81 ASP CA   1 1 
        3  3979 1 1 81 ASP CB   C   6.278  15.707 -10.486 1.00 . A A . 81 ASP CB   1 1 
        3  3980 1 1 81 ASP CG   C   5.502  17.009 -10.595 1.00 . A A . 81 ASP CG   1 1 
        3  3981 1 1 81 ASP H    H   7.120  13.200 -10.602 1.00 . A A . 81 ASP H    1 1 
        3  3982 1 1 81 ASP HA   H   4.502  14.524 -10.672 1.00 . A A . 81 ASP HA   1 1 
        3  3983 1 1 81 ASP HB2  H   6.482  15.520  -9.440 1.00 . A A . 81 ASP HB2  1 1 
        3  3984 1 1 81 ASP HB3  H   7.214  15.817 -11.013 1.00 . A A . 81 ASP HB3  1 1 
        3  3985 1 1 81 ASP N    N   6.140  13.257 -10.639 1.00 . A A . 81 ASP N    1 1 
        3  3986 1 1 81 ASP O    O   4.360  14.426 -13.191 1.00 . A A . 81 ASP O    1 1 
        3  3987 1 1 81 ASP OD1  O   4.520  17.180  -9.842 1.00 . A A . 81 ASP OD1  1 1 
        3  3988 1 1 81 ASP OD2  O   5.876  17.869 -11.415 1.00 . A A . 81 ASP OD2  1 1 
        3  3989 1 1 82 MET C    C   6.695  13.424 -15.243 1.00 . A A . 82 MET C    1 1 
        3  3990 1 1 82 MET CA   C   6.647  14.868 -14.713 1.00 . A A . 82 MET CA   1 1 
        3  3991 1 1 82 MET CB   C   7.886  15.649 -15.177 1.00 . A A . 82 MET CB   1 1 
        3  3992 1 1 82 MET CE   C   9.084  18.329 -16.513 1.00 . A A . 82 MET CE   1 1 
        3  3993 1 1 82 MET CG   C   8.010  15.770 -16.692 1.00 . A A . 82 MET CG   1 1 
        3  3994 1 1 82 MET H    H   7.375  15.080 -12.725 1.00 . A A . 82 MET H    1 1 
        3  3995 1 1 82 MET HA   H   5.758  15.355 -15.092 1.00 . A A . 82 MET HA   1 1 
        3  3996 1 1 82 MET HB2  H   7.843  16.646 -14.762 1.00 . A A . 82 MET HB2  1 1 
        3  3997 1 1 82 MET HB3  H   8.771  15.155 -14.804 1.00 . A A . 82 MET HB3  1 1 
        3  3998 1 1 82 MET HE1  H   9.864  19.025 -16.783 1.00 . A A . 82 MET HE1  1 1 
        3  3999 1 1 82 MET HE2  H   9.021  18.258 -15.436 1.00 . A A . 82 MET HE2  1 1 
        3  4000 1 1 82 MET HE3  H   8.140  18.676 -16.906 1.00 . A A . 82 MET HE3  1 1 
        3  4001 1 1 82 MET HG2  H   8.078  14.779 -17.117 1.00 . A A . 82 MET HG2  1 1 
        3  4002 1 1 82 MET HG3  H   7.126  16.261 -17.073 1.00 . A A . 82 MET HG3  1 1 
        3  4003 1 1 82 MET N    N   6.570  14.871 -13.245 1.00 . A A . 82 MET N    1 1 
        3  4004 1 1 82 MET O    O   7.364  12.569 -14.664 1.00 . A A . 82 MET O    1 1 
        3  4005 1 1 82 MET SD   S   9.461  16.716 -17.201 1.00 . A A . 82 MET SD   1 1 
        3  4006 1 1 83 MET C    C   7.100  11.282 -17.655 1.00 . A A . 83 MET C    1 1 
        3  4007 1 1 83 MET CA   C   5.851  11.785 -16.876 1.00 . A A . 83 MET CA   1 1 
        3  4008 1 1 83 MET CB   C   4.578  11.694 -17.747 1.00 . A A . 83 MET CB   1 1 
        3  4009 1 1 83 MET CE   C   5.095  14.599 -20.731 1.00 . A A . 83 MET CE   1 1 
        3  4010 1 1 83 MET CG   C   4.350  12.892 -18.669 1.00 . A A . 83 MET CG   1 1 
        3  4011 1 1 83 MET H    H   5.555  13.899 -16.818 1.00 . A A . 83 MET H    1 1 
        3  4012 1 1 83 MET HA   H   5.717  11.134 -16.023 1.00 . A A . 83 MET HA   1 1 
        3  4013 1 1 83 MET HB2  H   4.640  10.808 -18.361 1.00 . A A . 83 MET HB2  1 1 
        3  4014 1 1 83 MET HB3  H   3.720  11.604 -17.095 1.00 . A A . 83 MET HB3  1 1 
        3  4015 1 1 83 MET HE1  H   4.172  14.332 -21.226 1.00 . A A . 83 MET HE1  1 1 
        3  4016 1 1 83 MET HE2  H   5.826  14.898 -21.469 1.00 . A A . 83 MET HE2  1 1 
        3  4017 1 1 83 MET HE3  H   4.915  15.419 -20.052 1.00 . A A . 83 MET HE3  1 1 
        3  4018 1 1 83 MET HG2  H   3.453  12.719 -19.244 1.00 . A A . 83 MET HG2  1 1 
        3  4019 1 1 83 MET HG3  H   4.215  13.774 -18.059 1.00 . A A . 83 MET HG3  1 1 
        3  4020 1 1 83 MET N    N   5.991  13.159 -16.348 1.00 . A A . 83 MET N    1 1 
        3  4021 1 1 83 MET O    O   8.203  11.235 -17.064 1.00 . A A . 83 MET O    1 1 
        3  4022 1 1 83 MET OXT  O   6.962  10.864 -18.827 1.00 . A A . 83 MET OXT  1 1 
        3  4023 1 1 83 MET SD   S   5.714  13.189 -19.815 1.00 . A A . 83 MET SD   1 1 
        4  4024 1 1  1 MET C    C  13.038  -5.532  15.613 1.00 . A A .  1 MET C    1 1 
        4  4025 1 1  1 MET CA   C  11.889  -5.369  16.619 1.00 . A A .  1 MET CA   1 1 
        4  4026 1 1  1 MET CB   C  11.160  -6.710  16.783 1.00 . A A .  1 MET CB   1 1 
        4  4027 1 1  1 MET CE   C   8.110  -7.969  19.352 1.00 . A A .  1 MET CE   1 1 
        4  4028 1 1  1 MET CG   C  10.099  -6.717  17.876 1.00 . A A .  1 MET CG   1 1 
        4  4029 1 1  1 MET H1   H  10.138  -4.246  16.853 1.00 . A A .  1 MET H1   1 1 
        4  4030 1 1  1 MET H2   H  10.560  -4.523  15.238 1.00 . A A .  1 MET H2   1 1 
        4  4031 1 1  1 MET H3   H  11.417  -3.391  16.153 1.00 . A A .  1 MET H3   1 1 
        4  4032 1 1  1 MET HA   H  12.304  -5.073  17.573 1.00 . A A .  1 MET HA   1 1 
        4  4033 1 1  1 MET HB2  H  10.681  -6.963  15.847 1.00 . A A .  1 MET HB2  1 1 
        4  4034 1 1  1 MET HB3  H  11.888  -7.474  17.018 1.00 . A A .  1 MET HB3  1 1 
        4  4035 1 1  1 MET HE1  H   8.643  -7.674  20.244 1.00 . A A .  1 MET HE1  1 1 
        4  4036 1 1  1 MET HE2  H   7.526  -8.855  19.556 1.00 . A A .  1 MET HE2  1 1 
        4  4037 1 1  1 MET HE3  H   7.453  -7.171  19.042 1.00 . A A .  1 MET HE3  1 1 
        4  4038 1 1  1 MET HG2  H  10.568  -6.472  18.818 1.00 . A A .  1 MET HG2  1 1 
        4  4039 1 1  1 MET HG3  H   9.351  -5.971  17.643 1.00 . A A .  1 MET HG3  1 1 
        4  4040 1 1  1 MET N    N  10.935  -4.311  16.186 1.00 . A A .  1 MET N    1 1 
        4  4041 1 1  1 MET O    O  12.981  -5.005  14.503 1.00 . A A .  1 MET O    1 1 
        4  4042 1 1  1 MET SD   S   9.283  -8.317  18.041 1.00 . A A .  1 MET SD   1 1 
        4  4043 1 1  2 GLY C    C  16.257  -5.474  15.072 1.00 . A A .  2 GLY C    1 1 
        4  4044 1 1  2 GLY CA   C  15.185  -6.560  15.109 1.00 . A A .  2 GLY CA   1 1 
        4  4045 1 1  2 GLY H    H  14.094  -6.613  16.927 1.00 . A A .  2 GLY H    1 1 
        4  4046 1 1  2 GLY HA2  H  15.647  -7.483  15.424 1.00 . A A .  2 GLY HA2  1 1 
        4  4047 1 1  2 GLY HA3  H  14.794  -6.695  14.110 1.00 . A A .  2 GLY HA3  1 1 
        4  4048 1 1  2 GLY N    N  14.076  -6.267  16.011 1.00 . A A .  2 GLY N    1 1 
        4  4049 1 1  2 GLY O    O  16.191  -4.484  15.802 1.00 . A A .  2 GLY O    1 1 
        4  4050 1 1  3 HIS C    C  18.027  -3.675  12.946 1.00 . A A .  3 HIS C    1 1 
        4  4051 1 1  3 HIS CA   C  18.348  -4.705  14.044 1.00 . A A .  3 HIS CA   1 1 
        4  4052 1 1  3 HIS CB   C  19.644  -5.446  13.685 1.00 . A A .  3 HIS CB   1 1 
        4  4053 1 1  3 HIS CD2  C  19.676  -6.767  15.921 1.00 . A A .  3 HIS CD2  1 1 
        4  4054 1 1  3 HIS CE1  C  20.956  -8.423  15.289 1.00 . A A .  3 HIS CE1  1 1 
        4  4055 1 1  3 HIS CG   C  20.002  -6.555  14.625 1.00 . A A .  3 HIS CG   1 1 
        4  4056 1 1  3 HIS H    H  17.245  -6.481  13.656 1.00 . A A .  3 HIS H    1 1 
        4  4057 1 1  3 HIS HA   H  18.486  -4.187  14.981 1.00 . A A .  3 HIS HA   1 1 
        4  4058 1 1  3 HIS HB2  H  19.547  -5.874  12.700 1.00 . A A .  3 HIS HB2  1 1 
        4  4059 1 1  3 HIS HB3  H  20.462  -4.740  13.682 1.00 . A A .  3 HIS HB3  1 1 
        4  4060 1 1  3 HIS HD1  H  21.218  -7.744  13.380 1.00 . A A .  3 HIS HD1  1 1 
        4  4061 1 1  3 HIS HD2  H  19.058  -6.131  16.538 1.00 . A A .  3 HIS HD2  1 1 
        4  4062 1 1  3 HIS HE1  H  21.534  -9.335  15.292 1.00 . A A .  3 HIS HE1  1 1 
        4  4063 1 1  3 HIS HE2  H  20.072  -8.436  17.129 1.00 . A A .  3 HIS HE2  1 1 
        4  4064 1 1  3 HIS N    N  17.250  -5.665  14.207 1.00 . A A .  3 HIS N    1 1 
        4  4065 1 1  3 HIS ND1  N  20.807  -7.611  14.262 1.00 . A A .  3 HIS ND1  1 1 
        4  4066 1 1  3 HIS NE2  N  20.282  -7.936  16.309 1.00 . A A .  3 HIS NE2  1 1 
        4  4067 1 1  3 HIS O    O  18.931  -3.155  12.287 1.00 . A A .  3 HIS O    1 1 
        4  4068 1 1  4 HIS C    C  16.826  -1.058  11.793 1.00 . A A .  4 HIS C    1 1 
        4  4069 1 1  4 HIS CA   C  16.275  -2.496  11.687 1.00 . A A .  4 HIS CA   1 1 
        4  4070 1 1  4 HIS CB   C  14.736  -2.480  11.652 1.00 . A A .  4 HIS CB   1 1 
        4  4071 1 1  4 HIS CD2  C  13.972  -0.487  10.163 1.00 . A A .  4 HIS CD2  1 1 
        4  4072 1 1  4 HIS CE1  C  13.210  -1.629   8.462 1.00 . A A .  4 HIS CE1  1 1 
        4  4073 1 1  4 HIS CG   C  14.155  -1.800  10.443 1.00 . A A .  4 HIS CG   1 1 
        4  4074 1 1  4 HIS H    H  16.086  -3.716  13.416 1.00 . A A .  4 HIS H    1 1 
        4  4075 1 1  4 HIS HA   H  16.632  -2.929  10.762 1.00 . A A .  4 HIS HA   1 1 
        4  4076 1 1  4 HIS HB2  H  14.371  -3.497  11.665 1.00 . A A .  4 HIS HB2  1 1 
        4  4077 1 1  4 HIS HB3  H  14.370  -1.965  12.529 1.00 . A A .  4 HIS HB3  1 1 
        4  4078 1 1  4 HIS HD1  H  13.635  -3.461   9.250 1.00 . A A .  4 HIS HD1  1 1 
        4  4079 1 1  4 HIS HD2  H  14.237   0.347  10.798 1.00 . A A .  4 HIS HD2  1 1 
        4  4080 1 1  4 HIS HE1  H  12.769  -1.886   7.509 1.00 . A A .  4 HIS HE1  1 1 
        4  4081 1 1  4 HIS HE2  H  12.935   0.384   8.566 1.00 . A A .  4 HIS HE2  1 1 
        4  4082 1 1  4 HIS N    N  16.741  -3.360  12.781 1.00 . A A .  4 HIS N    1 1 
        4  4083 1 1  4 HIS ND1  N  13.663  -2.484   9.352 1.00 . A A .  4 HIS ND1  1 1 
        4  4084 1 1  4 HIS NE2  N  13.382  -0.410   8.924 1.00 . A A .  4 HIS NE2  1 1 
        4  4085 1 1  4 HIS O    O  16.188  -0.172  12.364 1.00 . A A .  4 HIS O    1 1 
        4  4086 1 1  5 HIS C    C  18.545   0.997   9.710 1.00 . A A .  5 HIS C    1 1 
        4  4087 1 1  5 HIS CA   C  18.610   0.500  11.159 1.00 . A A .  5 HIS CA   1 1 
        4  4088 1 1  5 HIS CB   C  20.061   0.482  11.654 1.00 . A A .  5 HIS CB   1 1 
        4  4089 1 1  5 HIS CD2  C  20.191   0.830  14.225 1.00 . A A .  5 HIS CD2  1 1 
        4  4090 1 1  5 HIS CE1  C  20.431  -1.260  14.818 1.00 . A A .  5 HIS CE1  1 1 
        4  4091 1 1  5 HIS CG   C  20.196   0.086  13.093 1.00 . A A .  5 HIS CG   1 1 
        4  4092 1 1  5 HIS H    H  18.528  -1.610  10.900 1.00 . A A .  5 HIS H    1 1 
        4  4093 1 1  5 HIS HA   H  18.031   1.166  11.785 1.00 . A A .  5 HIS HA   1 1 
        4  4094 1 1  5 HIS HB2  H  20.628  -0.221  11.061 1.00 . A A .  5 HIS HB2  1 1 
        4  4095 1 1  5 HIS HB3  H  20.488   1.469  11.537 1.00 . A A .  5 HIS HB3  1 1 
        4  4096 1 1  5 HIS HD1  H  20.405  -2.002  12.915 1.00 . A A .  5 HIS HD1  1 1 
        4  4097 1 1  5 HIS HD2  H  20.085   1.905  14.285 1.00 . A A .  5 HIS HD2  1 1 
        4  4098 1 1  5 HIS HE1  H  20.551  -2.151  15.414 1.00 . A A .  5 HIS HE1  1 1 
        4  4099 1 1  5 HIS HE2  H  20.622   0.234  16.186 1.00 . A A .  5 HIS HE2  1 1 
        4  4100 1 1  5 HIS N    N  18.022  -0.842  11.251 1.00 . A A .  5 HIS N    1 1 
        4  4101 1 1  5 HIS ND1  N  20.351  -1.218  13.504 1.00 . A A .  5 HIS ND1  1 1 
        4  4102 1 1  5 HIS NE2  N  20.339  -0.032  15.284 1.00 . A A .  5 HIS NE2  1 1 
        4  4103 1 1  5 HIS O    O  19.244   0.481   8.839 1.00 . A A .  5 HIS O    1 1 
        4  4104 1 1  6 HIS C    C  16.837   1.304   7.231 1.00 . A A .  6 HIS C    1 1 
        4  4105 1 1  6 HIS CA   C  17.399   2.451   8.092 1.00 . A A .  6 HIS CA   1 1 
        4  4106 1 1  6 HIS CB   C  18.655   3.034   7.420 1.00 . A A .  6 HIS CB   1 1 
        4  4107 1 1  6 HIS CD2  C  20.241   4.501   8.867 1.00 . A A .  6 HIS CD2  1 1 
        4  4108 1 1  6 HIS CE1  C  19.247   6.426   8.560 1.00 . A A .  6 HIS CE1  1 1 
        4  4109 1 1  6 HIS CG   C  19.173   4.285   8.060 1.00 . A A .  6 HIS CG   1 1 
        4  4110 1 1  6 HIS H    H  17.252   2.439  10.214 1.00 . A A .  6 HIS H    1 1 
        4  4111 1 1  6 HIS HA   H  16.647   3.224   8.162 1.00 . A A .  6 HIS HA   1 1 
        4  4112 1 1  6 HIS HB2  H  19.445   2.296   7.451 1.00 . A A .  6 HIS HB2  1 1 
        4  4113 1 1  6 HIS HB3  H  18.427   3.261   6.386 1.00 . A A .  6 HIS HB3  1 1 
        4  4114 1 1  6 HIS HD1  H  17.774   5.693   7.354 1.00 . A A .  6 HIS HD1  1 1 
        4  4115 1 1  6 HIS HD2  H  20.945   3.757   9.216 1.00 . A A .  6 HIS HD2  1 1 
        4  4116 1 1  6 HIS HE1  H  19.004   7.476   8.611 1.00 . A A .  6 HIS HE1  1 1 
        4  4117 1 1  6 HIS HE2  H  21.017   6.321   9.570 1.00 . A A .  6 HIS HE2  1 1 
        4  4118 1 1  6 HIS N    N  17.692   1.994   9.460 1.00 . A A .  6 HIS N    1 1 
        4  4119 1 1  6 HIS ND1  N  18.574   5.514   7.891 1.00 . A A .  6 HIS ND1  1 1 
        4  4120 1 1  6 HIS NE2  N  20.263   5.843   9.159 1.00 . A A .  6 HIS NE2  1 1 
        4  4121 1 1  6 HIS O    O  16.510   0.230   7.741 1.00 . A A .  6 HIS O    1 1 
        4  4122 1 1  7 HIS C    C  16.406   1.030   3.537 1.00 . A A .  7 HIS C    1 1 
        4  4123 1 1  7 HIS CA   C  16.318   0.509   4.978 1.00 . A A .  7 HIS CA   1 1 
        4  4124 1 1  7 HIS CB   C  14.900  -0.008   5.271 1.00 . A A .  7 HIS CB   1 1 
        4  4125 1 1  7 HIS CD2  C  14.039  -1.509   3.320 1.00 . A A .  7 HIS CD2  1 1 
        4  4126 1 1  7 HIS CE1  C  14.386  -3.458   4.253 1.00 . A A .  7 HIS CE1  1 1 
        4  4127 1 1  7 HIS CG   C  14.562  -1.284   4.552 1.00 . A A .  7 HIS CG   1 1 
        4  4128 1 1  7 HIS H    H  16.876   2.457   5.601 1.00 . A A .  7 HIS H    1 1 
        4  4129 1 1  7 HIS HA   H  17.018  -0.308   5.089 1.00 . A A .  7 HIS HA   1 1 
        4  4130 1 1  7 HIS HB2  H  14.805  -0.191   6.331 1.00 . A A .  7 HIS HB2  1 1 
        4  4131 1 1  7 HIS HB3  H  14.180   0.744   4.977 1.00 . A A .  7 HIS HB3  1 1 
        4  4132 1 1  7 HIS HD1  H  15.133  -2.710   5.997 1.00 . A A .  7 HIS HD1  1 1 
        4  4133 1 1  7 HIS HD2  H  13.756  -0.757   2.596 1.00 . A A .  7 HIS HD2  1 1 
        4  4134 1 1  7 HIS HE1  H  14.432  -4.524   4.420 1.00 . A A .  7 HIS HE1  1 1 
        4  4135 1 1  7 HIS HE2  H  13.764  -3.331   2.314 1.00 . A A .  7 HIS HE2  1 1 
        4  4136 1 1  7 HIS N    N  16.708   1.551   5.930 1.00 . A A .  7 HIS N    1 1 
        4  4137 1 1  7 HIS ND1  N  14.764  -2.529   5.105 1.00 . A A .  7 HIS ND1  1 1 
        4  4138 1 1  7 HIS NE2  N  13.943  -2.870   3.163 1.00 . A A .  7 HIS NE2  1 1 
        4  4139 1 1  7 HIS O    O  15.437   1.572   3.001 1.00 . A A .  7 HIS O    1 1 
        4  4140 1 1  8 HIS C    C  17.154   0.350   0.534 1.00 . A A .  8 HIS C    1 1 
        4  4141 1 1  8 HIS CA   C  17.777   1.331   1.538 1.00 . A A .  8 HIS CA   1 1 
        4  4142 1 1  8 HIS CB   C  19.272   1.536   1.240 1.00 . A A .  8 HIS CB   1 1 
        4  4143 1 1  8 HIS CD2  C  19.866   4.054   1.003 1.00 . A A .  8 HIS CD2  1 1 
        4  4144 1 1  8 HIS CE1  C  20.647   4.391   3.018 1.00 . A A .  8 HIS CE1  1 1 
        4  4145 1 1  8 HIS CG   C  19.787   2.877   1.672 1.00 . A A .  8 HIS CG   1 1 
        4  4146 1 1  8 HIS H    H  18.322   0.474   3.408 1.00 . A A .  8 HIS H    1 1 
        4  4147 1 1  8 HIS HA   H  17.276   2.284   1.432 1.00 . A A .  8 HIS HA   1 1 
        4  4148 1 1  8 HIS HB2  H  19.844   0.778   1.757 1.00 . A A .  8 HIS HB2  1 1 
        4  4149 1 1  8 HIS HB3  H  19.442   1.441   0.176 1.00 . A A .  8 HIS HB3  1 1 
        4  4150 1 1  8 HIS HD1  H  20.365   2.474   3.658 1.00 . A A .  8 HIS HD1  1 1 
        4  4151 1 1  8 HIS HD2  H  19.558   4.235  -0.018 1.00 . A A .  8 HIS HD2  1 1 
        4  4152 1 1  8 HIS HE1  H  21.070   4.869   3.889 1.00 . A A .  8 HIS HE1  1 1 
        4  4153 1 1  8 HIS HE2  H  20.424   5.944   1.718 1.00 . A A .  8 HIS HE2  1 1 
        4  4154 1 1  8 HIS N    N  17.576   0.888   2.922 1.00 . A A .  8 HIS N    1 1 
        4  4155 1 1  8 HIS ND1  N  20.287   3.127   2.931 1.00 . A A .  8 HIS ND1  1 1 
        4  4156 1 1  8 HIS NE2  N  20.404   4.975   1.866 1.00 . A A .  8 HIS NE2  1 1 
        4  4157 1 1  8 HIS O    O  17.609  -0.784   0.387 1.00 . A A .  8 HIS O    1 1 
        4  4158 1 1  9 SER C    C  14.355   0.850  -1.883 1.00 . A A .  9 SER C    1 1 
        4  4159 1 1  9 SER CA   C  15.397  -0.009  -1.146 1.00 . A A .  9 SER CA   1 1 
        4  4160 1 1  9 SER CB   C  14.716  -1.218  -0.483 1.00 . A A .  9 SER CB   1 1 
        4  4161 1 1  9 SER H    H  15.797   1.722   0.023 1.00 . A A .  9 SER H    1 1 
        4  4162 1 1  9 SER HA   H  16.129  -0.361  -1.862 1.00 . A A .  9 SER HA   1 1 
        4  4163 1 1  9 SER HB2  H  15.413  -1.697   0.191 1.00 . A A .  9 SER HB2  1 1 
        4  4164 1 1  9 SER HB3  H  13.854  -0.883   0.077 1.00 . A A .  9 SER HB3  1 1 
        4  4165 1 1  9 SER HG   H  15.066  -2.575  -1.861 1.00 . A A .  9 SER HG   1 1 
        4  4166 1 1  9 SER N    N  16.104   0.804  -0.145 1.00 . A A .  9 SER N    1 1 
        4  4167 1 1  9 SER O    O  13.466   1.436  -1.258 1.00 . A A .  9 SER O    1 1 
        4  4168 1 1  9 SER OG   O  14.293  -2.171  -1.445 1.00 . A A .  9 SER OG   1 1 
        4  4169 1 1 10 HIS C    C  12.202   1.288  -4.253 1.00 . A A . 10 HIS C    1 1 
        4  4170 1 1 10 HIS CA   C  13.629   1.835  -4.014 1.00 . A A . 10 HIS CA   1 1 
        4  4171 1 1 10 HIS CB   C  14.318   2.139  -5.355 1.00 . A A . 10 HIS CB   1 1 
        4  4172 1 1 10 HIS CD2  C  15.983   0.401  -6.333 1.00 . A A . 10 HIS CD2  1 1 
        4  4173 1 1 10 HIS CE1  C  14.535  -0.900  -7.336 1.00 . A A . 10 HIS CE1  1 1 
        4  4174 1 1 10 HIS CG   C  14.752   0.918  -6.111 1.00 . A A . 10 HIS CG   1 1 
        4  4175 1 1 10 HIS H    H  15.157   0.391  -3.655 1.00 . A A . 10 HIS H    1 1 
        4  4176 1 1 10 HIS HA   H  13.540   2.763  -3.463 1.00 . A A . 10 HIS HA   1 1 
        4  4177 1 1 10 HIS HB2  H  13.637   2.692  -5.984 1.00 . A A . 10 HIS HB2  1 1 
        4  4178 1 1 10 HIS HB3  H  15.194   2.745  -5.169 1.00 . A A . 10 HIS HB3  1 1 
        4  4179 1 1 10 HIS HD1  H  12.894   0.179  -6.773 1.00 . A A . 10 HIS HD1  1 1 
        4  4180 1 1 10 HIS HD2  H  16.923   0.800  -5.974 1.00 . A A . 10 HIS HD2  1 1 
        4  4181 1 1 10 HIS HE1  H  14.104  -1.701  -7.917 1.00 . A A . 10 HIS HE1  1 1 
        4  4182 1 1 10 HIS HE2  H  16.530  -1.348  -7.358 1.00 . A A . 10 HIS HE2  1 1 
        4  4183 1 1 10 HIS N    N  14.474   0.935  -3.207 1.00 . A A . 10 HIS N    1 1 
        4  4184 1 1 10 HIS ND1  N  13.869   0.075  -6.752 1.00 . A A . 10 HIS ND1  1 1 
        4  4185 1 1 10 HIS NE2  N  15.816  -0.725  -7.096 1.00 . A A . 10 HIS NE2  1 1 
        4  4186 1 1 10 HIS O    O  11.776   1.102  -5.394 1.00 . A A . 10 HIS O    1 1 
        4  4187 1 1 11 MET C    C   9.138   1.791  -2.769 1.00 . A A . 11 MET C    1 1 
        4  4188 1 1 11 MET CA   C  10.055   0.645  -3.245 1.00 . A A . 11 MET CA   1 1 
        4  4189 1 1 11 MET CB   C   9.795  -0.622  -2.419 1.00 . A A . 11 MET CB   1 1 
        4  4190 1 1 11 MET CE   C  12.387  -3.421  -4.146 1.00 . A A . 11 MET CE   1 1 
        4  4191 1 1 11 MET CG   C  10.338  -1.895  -3.059 1.00 . A A . 11 MET CG   1 1 
        4  4192 1 1 11 MET H    H  11.905   1.071  -2.288 1.00 . A A . 11 MET H    1 1 
        4  4193 1 1 11 MET HA   H   9.826   0.437  -4.283 1.00 . A A . 11 MET HA   1 1 
        4  4194 1 1 11 MET HB2  H  10.256  -0.506  -1.448 1.00 . A A . 11 MET HB2  1 1 
        4  4195 1 1 11 MET HB3  H   8.728  -0.741  -2.287 1.00 . A A . 11 MET HB3  1 1 
        4  4196 1 1 11 MET HE1  H  12.155  -4.174  -3.406 1.00 . A A . 11 MET HE1  1 1 
        4  4197 1 1 11 MET HE2  H  13.424  -3.508  -4.435 1.00 . A A . 11 MET HE2  1 1 
        4  4198 1 1 11 MET HE3  H  11.759  -3.563  -5.014 1.00 . A A . 11 MET HE3  1 1 
        4  4199 1 1 11 MET HG2  H  10.188  -2.720  -2.376 1.00 . A A . 11 MET HG2  1 1 
        4  4200 1 1 11 MET HG3  H   9.790  -2.084  -3.972 1.00 . A A . 11 MET HG3  1 1 
        4  4201 1 1 11 MET N    N  11.475   1.026  -3.167 1.00 . A A . 11 MET N    1 1 
        4  4202 1 1 11 MET O    O   7.914   1.715  -2.891 1.00 . A A . 11 MET O    1 1 
        4  4203 1 1 11 MET SD   S  12.096  -1.792  -3.456 1.00 . A A . 11 MET SD   1 1 
        4  4204 1 1 12 LEU C    C   8.682   4.990  -2.941 1.00 . A A . 12 LEU C    1 1 
        4  4205 1 1 12 LEU CA   C   8.994   4.032  -1.766 1.00 . A A . 12 LEU CA   1 1 
        4  4206 1 1 12 LEU CB   C   9.753   4.784  -0.654 1.00 . A A . 12 LEU CB   1 1 
        4  4207 1 1 12 LEU CD1  C  10.588   2.764   0.643 1.00 . A A . 12 LEU CD1  1 1 
        4  4208 1 1 12 LEU CD2  C  10.430   5.002   1.775 1.00 . A A . 12 LEU CD2  1 1 
        4  4209 1 1 12 LEU CG   C   9.816   4.080   0.720 1.00 . A A . 12 LEU CG   1 1 
        4  4210 1 1 12 LEU H    H  10.711   2.820  -2.088 1.00 . A A . 12 LEU H    1 1 
        4  4211 1 1 12 LEU HA   H   8.052   3.684  -1.357 1.00 . A A . 12 LEU HA   1 1 
        4  4212 1 1 12 LEU HB2  H  10.765   4.953  -0.996 1.00 . A A . 12 LEU HB2  1 1 
        4  4213 1 1 12 LEU HB3  H   9.278   5.746  -0.516 1.00 . A A . 12 LEU HB3  1 1 
        4  4214 1 1 12 LEU HD11 H  10.634   2.313   1.624 1.00 . A A . 12 LEU HD11 1 1 
        4  4215 1 1 12 LEU HD12 H  11.591   2.953   0.287 1.00 . A A . 12 LEU HD12 1 1 
        4  4216 1 1 12 LEU HD13 H  10.088   2.090  -0.038 1.00 . A A . 12 LEU HD13 1 1 
        4  4217 1 1 12 LEU HD21 H  10.480   4.484   2.722 1.00 . A A . 12 LEU HD21 1 1 
        4  4218 1 1 12 LEU HD22 H   9.819   5.887   1.883 1.00 . A A . 12 LEU HD22 1 1 
        4  4219 1 1 12 LEU HD23 H  11.428   5.287   1.471 1.00 . A A . 12 LEU HD23 1 1 
        4  4220 1 1 12 LEU HG   H   8.808   3.848   1.036 1.00 . A A . 12 LEU HG   1 1 
        4  4221 1 1 12 LEU N    N   9.741   2.843  -2.209 1.00 . A A . 12 LEU N    1 1 
        4  4222 1 1 12 LEU O    O   7.572   5.520  -3.030 1.00 . A A . 12 LEU O    1 1 
        4  4223 1 1 13 PRO C    C   8.650   5.147  -6.129 1.00 . A A . 13 PRO C    1 1 
        4  4224 1 1 13 PRO CA   C   9.383   6.016  -5.083 1.00 . A A . 13 PRO CA   1 1 
        4  4225 1 1 13 PRO CB   C  10.787   6.399  -5.573 1.00 . A A . 13 PRO CB   1 1 
        4  4226 1 1 13 PRO CD   C  11.090   4.902  -3.735 1.00 . A A . 13 PRO CD   1 1 
        4  4227 1 1 13 PRO CG   C  11.667   5.312  -5.066 1.00 . A A . 13 PRO CG   1 1 
        4  4228 1 1 13 PRO HA   H   8.806   6.909  -4.888 1.00 . A A . 13 PRO HA   1 1 
        4  4229 1 1 13 PRO HB2  H  10.797   6.451  -6.653 1.00 . A A . 13 PRO HB2  1 1 
        4  4230 1 1 13 PRO HB3  H  11.067   7.359  -5.160 1.00 . A A . 13 PRO HB3  1 1 
        4  4231 1 1 13 PRO HD2  H  11.205   3.837  -3.584 1.00 . A A . 13 PRO HD2  1 1 
        4  4232 1 1 13 PRO HD3  H  11.564   5.449  -2.932 1.00 . A A . 13 PRO HD3  1 1 
        4  4233 1 1 13 PRO HG2  H  11.657   4.478  -5.755 1.00 . A A . 13 PRO HG2  1 1 
        4  4234 1 1 13 PRO HG3  H  12.675   5.682  -4.941 1.00 . A A . 13 PRO HG3  1 1 
        4  4235 1 1 13 PRO N    N   9.658   5.266  -3.844 1.00 . A A . 13 PRO N    1 1 
        4  4236 1 1 13 PRO O    O   8.657   3.918  -6.034 1.00 . A A . 13 PRO O    1 1 
        4  4237 1 1 14 PRO C    C   8.227   4.227  -9.121 1.00 . A A . 14 PRO C    1 1 
        4  4238 1 1 14 PRO CA   C   7.281   5.014  -8.189 1.00 . A A . 14 PRO CA   1 1 
        4  4239 1 1 14 PRO CB   C   6.529   6.114  -8.955 1.00 . A A . 14 PRO CB   1 1 
        4  4240 1 1 14 PRO CD   C   7.936   7.222  -7.362 1.00 . A A . 14 PRO CD   1 1 
        4  4241 1 1 14 PRO CG   C   7.348   7.343  -8.746 1.00 . A A . 14 PRO CG   1 1 
        4  4242 1 1 14 PRO HA   H   6.570   4.326  -7.752 1.00 . A A . 14 PRO HA   1 1 
        4  4243 1 1 14 PRO HB2  H   6.460   5.855 -10.003 1.00 . A A . 14 PRO HB2  1 1 
        4  4244 1 1 14 PRO HB3  H   5.534   6.228  -8.543 1.00 . A A . 14 PRO HB3  1 1 
        4  4245 1 1 14 PRO HD2  H   8.921   7.666  -7.330 1.00 . A A . 14 PRO HD2  1 1 
        4  4246 1 1 14 PRO HD3  H   7.288   7.686  -6.632 1.00 . A A . 14 PRO HD3  1 1 
        4  4247 1 1 14 PRO HG2  H   8.135   7.389  -9.485 1.00 . A A . 14 PRO HG2  1 1 
        4  4248 1 1 14 PRO HG3  H   6.721   8.221  -8.811 1.00 . A A . 14 PRO HG3  1 1 
        4  4249 1 1 14 PRO N    N   8.007   5.763  -7.146 1.00 . A A . 14 PRO N    1 1 
        4  4250 1 1 14 PRO O    O   8.402   4.568 -10.295 1.00 . A A . 14 PRO O    1 1 
        4  4251 1 1 15 GLU C    C   9.201   0.994  -9.712 1.00 . A A . 15 GLU C    1 1 
        4  4252 1 1 15 GLU CA   C   9.803   2.355  -9.313 1.00 . A A . 15 GLU CA   1 1 
        4  4253 1 1 15 GLU CB   C  11.058   2.154  -8.446 1.00 . A A . 15 GLU CB   1 1 
        4  4254 1 1 15 GLU CD   C  12.721   1.963 -10.371 1.00 . A A . 15 GLU CD   1 1 
        4  4255 1 1 15 GLU CG   C  12.161   1.330  -9.106 1.00 . A A . 15 GLU CG   1 1 
        4  4256 1 1 15 GLU H    H   8.623   2.940  -7.648 1.00 . A A . 15 GLU H    1 1 
        4  4257 1 1 15 GLU HA   H  10.081   2.890 -10.211 1.00 . A A . 15 GLU HA   1 1 
        4  4258 1 1 15 GLU HB2  H  11.466   3.125  -8.199 1.00 . A A . 15 GLU HB2  1 1 
        4  4259 1 1 15 GLU HB3  H  10.770   1.658  -7.529 1.00 . A A . 15 GLU HB3  1 1 
        4  4260 1 1 15 GLU HG2  H  12.971   1.209  -8.400 1.00 . A A . 15 GLU HG2  1 1 
        4  4261 1 1 15 GLU HG3  H  11.759   0.356  -9.353 1.00 . A A . 15 GLU HG3  1 1 
        4  4262 1 1 15 GLU N    N   8.832   3.173  -8.578 1.00 . A A . 15 GLU N    1 1 
        4  4263 1 1 15 GLU O    O   8.906   0.757 -10.883 1.00 . A A . 15 GLU O    1 1 
        4  4264 1 1 15 GLU OE1  O  13.042   3.173 -10.349 1.00 . A A . 15 GLU OE1  1 1 
        4  4265 1 1 15 GLU OE2  O  12.860   1.249 -11.386 1.00 . A A . 15 GLU OE2  1 1 
        4  4266 1 1 16 GLN C    C   7.743  -1.794  -7.756 1.00 . A A . 16 GLN C    1 1 
        4  4267 1 1 16 GLN CA   C   8.456  -1.228  -8.996 1.00 . A A . 16 GLN CA   1 1 
        4  4268 1 1 16 GLN CB   C   9.568  -2.191  -9.454 1.00 . A A . 16 GLN CB   1 1 
        4  4269 1 1 16 GLN CD   C  11.810  -3.277  -8.951 1.00 . A A . 16 GLN CD   1 1 
        4  4270 1 1 16 GLN CG   C  10.664  -2.429  -8.416 1.00 . A A . 16 GLN CG   1 1 
        4  4271 1 1 16 GLN H    H   9.243   0.356  -7.814 1.00 . A A . 16 GLN H    1 1 
        4  4272 1 1 16 GLN HA   H   7.730  -1.130  -9.791 1.00 . A A . 16 GLN HA   1 1 
        4  4273 1 1 16 GLN HB2  H   9.122  -3.147  -9.699 1.00 . A A . 16 GLN HB2  1 1 
        4  4274 1 1 16 GLN HB3  H  10.030  -1.787 -10.345 1.00 . A A . 16 GLN HB3  1 1 
        4  4275 1 1 16 GLN HE21 H  10.903  -4.944  -8.388 1.00 . A A . 16 GLN HE21 1 1 
        4  4276 1 1 16 GLN HE22 H  12.425  -5.144  -9.177 1.00 . A A . 16 GLN HE22 1 1 
        4  4277 1 1 16 GLN HG2  H  11.061  -1.473  -8.104 1.00 . A A . 16 GLN HG2  1 1 
        4  4278 1 1 16 GLN HG3  H  10.231  -2.932  -7.561 1.00 . A A . 16 GLN HG3  1 1 
        4  4279 1 1 16 GLN N    N   9.011   0.108  -8.734 1.00 . A A . 16 GLN N    1 1 
        4  4280 1 1 16 GLN NE2  N  11.703  -4.586  -8.821 1.00 . A A . 16 GLN NE2  1 1 
        4  4281 1 1 16 GLN O    O   8.209  -1.629  -6.630 1.00 . A A . 16 GLN O    1 1 
        4  4282 1 1 16 GLN OE1  O  12.785  -2.758  -9.483 1.00 . A A . 16 GLN OE1  1 1 
        4  4283 1 1 17 TRP C    C   5.729  -4.586  -7.017 1.00 . A A . 17 TRP C    1 1 
        4  4284 1 1 17 TRP CA   C   5.834  -3.059  -6.881 1.00 . A A . 17 TRP CA   1 1 
        4  4285 1 1 17 TRP CB   C   4.428  -2.436  -6.822 1.00 . A A . 17 TRP CB   1 1 
        4  4286 1 1 17 TRP CD1  C   4.886   0.048  -6.357 1.00 . A A . 17 TRP CD1  1 1 
        4  4287 1 1 17 TRP CD2  C   3.754  -1.007  -4.736 1.00 . A A . 17 TRP CD2  1 1 
        4  4288 1 1 17 TRP CE2  C   3.938   0.334  -4.355 1.00 . A A . 17 TRP CE2  1 1 
        4  4289 1 1 17 TRP CE3  C   3.062  -1.866  -3.874 1.00 . A A . 17 TRP CE3  1 1 
        4  4290 1 1 17 TRP CG   C   4.368  -1.171  -6.021 1.00 . A A . 17 TRP CG   1 1 
        4  4291 1 1 17 TRP CH2  C   2.792  -0.026  -2.323 1.00 . A A . 17 TRP CH2  1 1 
        4  4292 1 1 17 TRP CZ2  C   3.464   0.834  -3.147 1.00 . A A . 17 TRP CZ2  1 1 
        4  4293 1 1 17 TRP CZ3  C   2.591  -1.368  -2.674 1.00 . A A . 17 TRP CZ3  1 1 
        4  4294 1 1 17 TRP H    H   6.288  -2.558  -8.892 1.00 . A A . 17 TRP H    1 1 
        4  4295 1 1 17 TRP HA   H   6.348  -2.839  -5.955 1.00 . A A . 17 TRP HA   1 1 
        4  4296 1 1 17 TRP HB2  H   4.097  -2.210  -7.825 1.00 . A A . 17 TRP HB2  1 1 
        4  4297 1 1 17 TRP HB3  H   3.743  -3.144  -6.376 1.00 . A A . 17 TRP HB3  1 1 
        4  4298 1 1 17 TRP HD1  H   5.419   0.253  -7.275 1.00 . A A . 17 TRP HD1  1 1 
        4  4299 1 1 17 TRP HE1  H   4.906   1.898  -5.364 1.00 . A A . 17 TRP HE1  1 1 
        4  4300 1 1 17 TRP HE3  H   2.898  -2.901  -4.132 1.00 . A A . 17 TRP HE3  1 1 
        4  4301 1 1 17 TRP HH2  H   2.408   0.325  -1.374 1.00 . A A . 17 TRP HH2  1 1 
        4  4302 1 1 17 TRP HZ2  H   3.610   1.864  -2.860 1.00 . A A . 17 TRP HZ2  1 1 
        4  4303 1 1 17 TRP HZ3  H   2.057  -2.014  -1.995 1.00 . A A . 17 TRP HZ3  1 1 
        4  4304 1 1 17 TRP N    N   6.612  -2.461  -7.974 1.00 . A A . 17 TRP N    1 1 
        4  4305 1 1 17 TRP NE1  N   4.633   0.957  -5.360 1.00 . A A . 17 TRP NE1  1 1 
        4  4306 1 1 17 TRP O    O   6.183  -5.178  -8.000 1.00 . A A . 17 TRP O    1 1 
        4  4307 1 1 18 SER C    C   3.658  -7.031  -5.217 1.00 . A A . 18 SER C    1 1 
        4  4308 1 1 18 SER CA   C   4.926  -6.667  -5.996 1.00 . A A . 18 SER CA   1 1 
        4  4309 1 1 18 SER CB   C   6.142  -7.389  -5.392 1.00 . A A . 18 SER CB   1 1 
        4  4310 1 1 18 SER H    H   4.824  -4.686  -5.244 1.00 . A A . 18 SER H    1 1 
        4  4311 1 1 18 SER HA   H   4.800  -6.991  -7.020 1.00 . A A . 18 SER HA   1 1 
        4  4312 1 1 18 SER HB2  H   6.404  -6.923  -4.454 1.00 . A A . 18 SER HB2  1 1 
        4  4313 1 1 18 SER HB3  H   5.894  -8.426  -5.218 1.00 . A A . 18 SER HB3  1 1 
        4  4314 1 1 18 SER HG   H   7.190  -6.559  -6.834 1.00 . A A . 18 SER HG   1 1 
        4  4315 1 1 18 SER N    N   5.135  -5.214  -6.009 1.00 . A A . 18 SER N    1 1 
        4  4316 1 1 18 SER O    O   3.088  -6.198  -4.511 1.00 . A A . 18 SER O    1 1 
        4  4317 1 1 18 SER OG   O   7.267  -7.330  -6.261 1.00 . A A . 18 SER OG   1 1 
        4  4318 1 1 19 HIS C    C   2.000  -8.672  -3.201 1.00 . A A . 19 HIS C    1 1 
        4  4319 1 1 19 HIS CA   C   1.966  -8.734  -4.740 1.00 . A A . 19 HIS CA   1 1 
        4  4320 1 1 19 HIS CB   C   1.653 -10.163  -5.202 1.00 . A A . 19 HIS CB   1 1 
        4  4321 1 1 19 HIS CD2  C   2.656 -10.736  -7.532 1.00 . A A . 19 HIS CD2  1 1 
        4  4322 1 1 19 HIS CE1  C   0.900 -10.280  -8.755 1.00 . A A . 19 HIS CE1  1 1 
        4  4323 1 1 19 HIS CG   C   1.671 -10.324  -6.693 1.00 . A A . 19 HIS CG   1 1 
        4  4324 1 1 19 HIS H    H   3.794  -8.933  -5.810 1.00 . A A . 19 HIS H    1 1 
        4  4325 1 1 19 HIS HA   H   1.187  -8.074  -5.095 1.00 . A A . 19 HIS HA   1 1 
        4  4326 1 1 19 HIS HB2  H   2.386 -10.839  -4.785 1.00 . A A . 19 HIS HB2  1 1 
        4  4327 1 1 19 HIS HB3  H   0.672 -10.441  -4.847 1.00 . A A . 19 HIS HB3  1 1 
        4  4328 1 1 19 HIS HD1  H  -0.295  -9.745  -7.187 1.00 . A A . 19 HIS HD1  1 1 
        4  4329 1 1 19 HIS HD2  H   3.656 -11.037  -7.251 1.00 . A A . 19 HIS HD2  1 1 
        4  4330 1 1 19 HIS HE1  H   0.245 -10.150  -9.603 1.00 . A A . 19 HIS HE1  1 1 
        4  4331 1 1 19 HIS HE2  H   2.575 -11.079  -9.598 1.00 . A A . 19 HIS HE2  1 1 
        4  4332 1 1 19 HIS N    N   3.234  -8.286  -5.331 1.00 . A A . 19 HIS N    1 1 
        4  4333 1 1 19 HIS ND1  N   0.586 -10.047  -7.497 1.00 . A A . 19 HIS ND1  1 1 
        4  4334 1 1 19 HIS NE2  N   2.146 -10.697  -8.804 1.00 . A A . 19 HIS NE2  1 1 
        4  4335 1 1 19 HIS O    O   1.112  -8.095  -2.571 1.00 . A A . 19 HIS O    1 1 
        4  4336 1 1 20 THR C    C   3.499  -7.854  -0.614 1.00 . A A . 20 THR C    1 1 
        4  4337 1 1 20 THR CA   C   3.196  -9.267  -1.145 1.00 . A A . 20 THR CA   1 1 
        4  4338 1 1 20 THR CB   C   4.321 -10.240  -0.705 1.00 . A A . 20 THR CB   1 1 
        4  4339 1 1 20 THR CG2  C   4.472 -10.274   0.816 1.00 . A A . 20 THR CG2  1 1 
        4  4340 1 1 20 THR H    H   3.702  -9.719  -3.162 1.00 . A A . 20 THR H    1 1 
        4  4341 1 1 20 THR HA   H   2.265  -9.608  -0.709 1.00 . A A . 20 THR HA   1 1 
        4  4342 1 1 20 THR HB   H   5.253  -9.909  -1.137 1.00 . A A . 20 THR HB   1 1 
        4  4343 1 1 20 THR HG1  H   4.723 -11.840  -1.799 1.00 . A A . 20 THR HG1  1 1 
        4  4344 1 1 20 THR HG21 H   4.706  -9.284   1.182 1.00 . A A . 20 THR HG21 1 1 
        4  4345 1 1 20 THR HG22 H   5.268 -10.954   1.083 1.00 . A A . 20 THR HG22 1 1 
        4  4346 1 1 20 THR HG23 H   3.548 -10.612   1.262 1.00 . A A . 20 THR HG23 1 1 
        4  4347 1 1 20 THR N    N   3.032  -9.265  -2.606 1.00 . A A . 20 THR N    1 1 
        4  4348 1 1 20 THR O    O   3.171  -7.524   0.528 1.00 . A A . 20 THR O    1 1 
        4  4349 1 1 20 THR OG1  O   4.033 -11.565  -1.180 1.00 . A A . 20 THR OG1  1 1 
        4  4350 1 1 21 THR C    C   3.180  -4.851  -0.688 1.00 . A A . 21 THR C    1 1 
        4  4351 1 1 21 THR CA   C   4.437  -5.636  -1.088 1.00 . A A . 21 THR CA   1 1 
        4  4352 1 1 21 THR CB   C   5.150  -4.890  -2.243 1.00 . A A . 21 THR CB   1 1 
        4  4353 1 1 21 THR CG2  C   5.609  -3.501  -1.810 1.00 . A A . 21 THR CG2  1 1 
        4  4354 1 1 21 THR H    H   4.355  -7.346  -2.350 1.00 . A A . 21 THR H    1 1 
        4  4355 1 1 21 THR HA   H   5.111  -5.671  -0.242 1.00 . A A . 21 THR HA   1 1 
        4  4356 1 1 21 THR HB   H   4.456  -4.785  -3.068 1.00 . A A . 21 THR HB   1 1 
        4  4357 1 1 21 THR HG1  H   7.091  -5.265  -2.324 1.00 . A A . 21 THR HG1  1 1 
        4  4358 1 1 21 THR HG21 H   4.751  -2.905  -1.534 1.00 . A A . 21 THR HG21 1 1 
        4  4359 1 1 21 THR HG22 H   6.132  -3.025  -2.625 1.00 . A A . 21 THR HG22 1 1 
        4  4360 1 1 21 THR HG23 H   6.273  -3.588  -0.961 1.00 . A A . 21 THR HG23 1 1 
        4  4361 1 1 21 THR N    N   4.112  -7.023  -1.457 1.00 . A A . 21 THR N    1 1 
        4  4362 1 1 21 THR O    O   3.213  -4.042   0.241 1.00 . A A . 21 THR O    1 1 
        4  4363 1 1 21 THR OG1  O   6.285  -5.648  -2.687 1.00 . A A . 21 THR OG1  1 1 
        4  4364 1 1 22 VAL C    C   0.365  -4.794   0.383 1.00 . A A . 22 VAL C    1 1 
        4  4365 1 1 22 VAL CA   C   0.786  -4.474  -1.063 1.00 . A A . 22 VAL CA   1 1 
        4  4366 1 1 22 VAL CB   C  -0.333  -4.934  -2.037 1.00 . A A . 22 VAL CB   1 1 
        4  4367 1 1 22 VAL CG1  C  -1.658  -4.242  -1.716 1.00 . A A . 22 VAL CG1  1 1 
        4  4368 1 1 22 VAL CG2  C   0.078  -4.679  -3.488 1.00 . A A . 22 VAL CG2  1 1 
        4  4369 1 1 22 VAL H    H   2.121  -5.726  -2.147 1.00 . A A . 22 VAL H    1 1 
        4  4370 1 1 22 VAL HA   H   0.906  -3.403  -1.162 1.00 . A A . 22 VAL HA   1 1 
        4  4371 1 1 22 VAL HB   H  -0.474  -6.000  -1.911 1.00 . A A . 22 VAL HB   1 1 
        4  4372 1 1 22 VAL HG11 H  -2.424  -4.594  -2.391 1.00 . A A . 22 VAL HG11 1 1 
        4  4373 1 1 22 VAL HG12 H  -1.544  -3.173  -1.829 1.00 . A A . 22 VAL HG12 1 1 
        4  4374 1 1 22 VAL HG13 H  -1.946  -4.465  -0.698 1.00 . A A . 22 VAL HG13 1 1 
        4  4375 1 1 22 VAL HG21 H  -0.704  -5.021  -4.151 1.00 . A A . 22 VAL HG21 1 1 
        4  4376 1 1 22 VAL HG22 H   0.991  -5.213  -3.704 1.00 . A A . 22 VAL HG22 1 1 
        4  4377 1 1 22 VAL HG23 H   0.239  -3.620  -3.638 1.00 . A A . 22 VAL HG23 1 1 
        4  4378 1 1 22 VAL N    N   2.073  -5.103  -1.388 1.00 . A A . 22 VAL N    1 1 
        4  4379 1 1 22 VAL O    O  -0.069  -3.912   1.127 1.00 . A A . 22 VAL O    1 1 
        4  4380 1 1 23 ARG C    C   1.083  -5.724   3.165 1.00 . A A . 23 ARG C    1 1 
        4  4381 1 1 23 ARG CA   C   0.212  -6.488   2.152 1.00 . A A . 23 ARG CA   1 1 
        4  4382 1 1 23 ARG CB   C   0.459  -7.995   2.310 1.00 . A A . 23 ARG CB   1 1 
        4  4383 1 1 23 ARG CD   C   0.915  -9.798   4.023 1.00 . A A . 23 ARG CD   1 1 
        4  4384 1 1 23 ARG CG   C   0.139  -8.527   3.709 1.00 . A A . 23 ARG CG   1 1 
        4  4385 1 1 23 ARG CZ   C   3.219 -10.091   4.812 1.00 . A A . 23 ARG CZ   1 1 
        4  4386 1 1 23 ARG H    H   0.822  -6.725   0.128 1.00 . A A . 23 ARG H    1 1 
        4  4387 1 1 23 ARG HA   H  -0.831  -6.276   2.351 1.00 . A A . 23 ARG HA   1 1 
        4  4388 1 1 23 ARG HB2  H  -0.156  -8.527   1.596 1.00 . A A . 23 ARG HB2  1 1 
        4  4389 1 1 23 ARG HB3  H   1.500  -8.200   2.097 1.00 . A A . 23 ARG HB3  1 1 
        4  4390 1 1 23 ARG HD2  H   0.637 -10.141   5.011 1.00 . A A . 23 ARG HD2  1 1 
        4  4391 1 1 23 ARG HD3  H   0.657 -10.555   3.296 1.00 . A A . 23 ARG HD3  1 1 
        4  4392 1 1 23 ARG HE   H   2.707  -8.988   3.275 1.00 . A A . 23 ARG HE   1 1 
        4  4393 1 1 23 ARG HG2  H   0.398  -7.775   4.440 1.00 . A A . 23 ARG HG2  1 1 
        4  4394 1 1 23 ARG HG3  H  -0.921  -8.739   3.772 1.00 . A A . 23 ARG HG3  1 1 
        4  4395 1 1 23 ARG HH11 H   1.843 -10.968   5.950 1.00 . A A . 23 ARG HH11 1 1 
        4  4396 1 1 23 ARG HH12 H   3.488 -11.221   6.427 1.00 . A A . 23 ARG HH12 1 1 
        4  4397 1 1 23 ARG HH21 H   4.794  -9.262   3.933 1.00 . A A . 23 ARG HH21 1 1 
        4  4398 1 1 23 ARG HH22 H   5.136 -10.252   5.312 1.00 . A A . 23 ARG HH22 1 1 
        4  4399 1 1 23 ARG N    N   0.508  -6.061   0.777 1.00 . A A . 23 ARG N    1 1 
        4  4400 1 1 23 ARG NE   N   2.364  -9.568   3.980 1.00 . A A . 23 ARG NE   1 1 
        4  4401 1 1 23 ARG NH1  N   2.818 -10.814   5.808 1.00 . A A . 23 ARG NH1  1 1 
        4  4402 1 1 23 ARG NH2  N   4.481  -9.851   4.674 1.00 . A A . 23 ARG NH2  1 1 
        4  4403 1 1 23 ARG O    O   0.585  -5.186   4.155 1.00 . A A . 23 ARG O    1 1 
        4  4404 1 1 24 ASN C    C   2.932  -3.472   3.871 1.00 . A A . 24 ASN C    1 1 
        4  4405 1 1 24 ASN CA   C   3.337  -4.952   3.754 1.00 . A A . 24 ASN CA   1 1 
        4  4406 1 1 24 ASN CB   C   4.761  -5.069   3.187 1.00 . A A . 24 ASN CB   1 1 
        4  4407 1 1 24 ASN CG   C   5.303  -6.491   3.224 1.00 . A A . 24 ASN CG   1 1 
        4  4408 1 1 24 ASN H    H   2.735  -6.176   2.123 1.00 . A A . 24 ASN H    1 1 
        4  4409 1 1 24 ASN HA   H   3.313  -5.397   4.740 1.00 . A A . 24 ASN HA   1 1 
        4  4410 1 1 24 ASN HB2  H   4.760  -4.734   2.160 1.00 . A A . 24 ASN HB2  1 1 
        4  4411 1 1 24 ASN HB3  H   5.422  -4.435   3.764 1.00 . A A . 24 ASN HB3  1 1 
        4  4412 1 1 24 ASN HD21 H   7.157  -5.811   3.375 1.00 . A A . 24 ASN HD21 1 1 
        4  4413 1 1 24 ASN HD22 H   6.982  -7.526   3.354 1.00 . A A . 24 ASN HD22 1 1 
        4  4414 1 1 24 ASN N    N   2.393  -5.692   2.906 1.00 . A A . 24 ASN N    1 1 
        4  4415 1 1 24 ASN ND2  N   6.611  -6.622   3.328 1.00 . A A . 24 ASN ND2  1 1 
        4  4416 1 1 24 ASN O    O   3.043  -2.866   4.940 1.00 . A A . 24 ASN O    1 1 
        4  4417 1 1 24 ASN OD1  O   4.557  -7.465   3.158 1.00 . A A . 24 ASN OD1  1 1 
        4  4418 1 1 25 ALA C    C   0.749  -1.366   3.705 1.00 . A A . 25 ALA C    1 1 
        4  4419 1 1 25 ALA CA   C   1.950  -1.525   2.760 1.00 . A A . 25 ALA CA   1 1 
        4  4420 1 1 25 ALA CB   C   1.576  -1.100   1.344 1.00 . A A . 25 ALA CB   1 1 
        4  4421 1 1 25 ALA H    H   2.436  -3.419   1.931 1.00 . A A . 25 ALA H    1 1 
        4  4422 1 1 25 ALA HA   H   2.748  -0.882   3.103 1.00 . A A . 25 ALA HA   1 1 
        4  4423 1 1 25 ALA HB1  H   0.763  -1.716   0.985 1.00 . A A . 25 ALA HB1  1 1 
        4  4424 1 1 25 ALA HB2  H   2.430  -1.218   0.694 1.00 . A A . 25 ALA HB2  1 1 
        4  4425 1 1 25 ALA HB3  H   1.267  -0.064   1.346 1.00 . A A . 25 ALA HB3  1 1 
        4  4426 1 1 25 ALA N    N   2.451  -2.901   2.765 1.00 . A A . 25 ALA N    1 1 
        4  4427 1 1 25 ALA O    O   0.631  -0.368   4.414 1.00 . A A . 25 ALA O    1 1 
        4  4428 1 1 26 LEU C    C  -0.918  -2.448   6.090 1.00 . A A . 26 LEU C    1 1 
        4  4429 1 1 26 LEU CA   C  -1.306  -2.346   4.601 1.00 . A A . 26 LEU CA   1 1 
        4  4430 1 1 26 LEU CB   C  -2.257  -3.493   4.234 1.00 . A A . 26 LEU CB   1 1 
        4  4431 1 1 26 LEU CD1  C  -3.706  -4.671   2.537 1.00 . A A . 26 LEU CD1  1 1 
        4  4432 1 1 26 LEU CD2  C  -3.512  -2.165   2.497 1.00 . A A . 26 LEU CD2  1 1 
        4  4433 1 1 26 LEU CG   C  -2.788  -3.477   2.790 1.00 . A A . 26 LEU CG   1 1 
        4  4434 1 1 26 LEU H    H   0.014  -3.138   3.135 1.00 . A A . 26 LEU H    1 1 
        4  4435 1 1 26 LEU HA   H  -1.817  -1.407   4.441 1.00 . A A . 26 LEU HA   1 1 
        4  4436 1 1 26 LEU HB2  H  -1.733  -4.426   4.391 1.00 . A A . 26 LEU HB2  1 1 
        4  4437 1 1 26 LEU HB3  H  -3.104  -3.460   4.905 1.00 . A A . 26 LEU HB3  1 1 
        4  4438 1 1 26 LEU HD11 H  -4.555  -4.625   3.206 1.00 . A A . 26 LEU HD11 1 1 
        4  4439 1 1 26 LEU HD12 H  -3.159  -5.587   2.712 1.00 . A A . 26 LEU HD12 1 1 
        4  4440 1 1 26 LEU HD13 H  -4.051  -4.650   1.514 1.00 . A A . 26 LEU HD13 1 1 
        4  4441 1 1 26 LEU HD21 H  -3.884  -2.177   1.483 1.00 . A A . 26 LEU HD21 1 1 
        4  4442 1 1 26 LEU HD22 H  -2.824  -1.339   2.616 1.00 . A A . 26 LEU HD22 1 1 
        4  4443 1 1 26 LEU HD23 H  -4.339  -2.044   3.183 1.00 . A A . 26 LEU HD23 1 1 
        4  4444 1 1 26 LEU HG   H  -1.953  -3.554   2.107 1.00 . A A . 26 LEU HG   1 1 
        4  4445 1 1 26 LEU N    N  -0.128  -2.366   3.726 1.00 . A A . 26 LEU N    1 1 
        4  4446 1 1 26 LEU O    O  -1.723  -2.155   6.970 1.00 . A A . 26 LEU O    1 1 
        4  4447 1 1 27 LYS C    C   1.642  -1.754   8.170 1.00 . A A . 27 LYS C    1 1 
        4  4448 1 1 27 LYS CA   C   0.794  -2.972   7.752 1.00 . A A . 27 LYS CA   1 1 
        4  4449 1 1 27 LYS CB   C   1.587  -4.274   7.955 1.00 . A A . 27 LYS CB   1 1 
        4  4450 1 1 27 LYS CD   C  -0.291  -5.475   9.156 1.00 . A A . 27 LYS CD   1 1 
        4  4451 1 1 27 LYS CE   C  -1.124  -6.749   9.253 1.00 . A A . 27 LYS CE   1 1 
        4  4452 1 1 27 LYS CG   C   0.708  -5.525   7.998 1.00 . A A . 27 LYS CG   1 1 
        4  4453 1 1 27 LYS H    H   0.899  -3.153   5.633 1.00 . A A . 27 LYS H    1 1 
        4  4454 1 1 27 LYS HA   H  -0.076  -3.004   8.395 1.00 . A A . 27 LYS HA   1 1 
        4  4455 1 1 27 LYS HB2  H   2.292  -4.384   7.142 1.00 . A A . 27 LYS HB2  1 1 
        4  4456 1 1 27 LYS HB3  H   2.135  -4.212   8.886 1.00 . A A . 27 LYS HB3  1 1 
        4  4457 1 1 27 LYS HD2  H   0.251  -5.345  10.082 1.00 . A A . 27 LYS HD2  1 1 
        4  4458 1 1 27 LYS HD3  H  -0.954  -4.634   9.009 1.00 . A A . 27 LYS HD3  1 1 
        4  4459 1 1 27 LYS HE2  H  -1.663  -6.887   8.325 1.00 . A A . 27 LYS HE2  1 1 
        4  4460 1 1 27 LYS HE3  H  -0.462  -7.589   9.407 1.00 . A A . 27 LYS HE3  1 1 
        4  4461 1 1 27 LYS HG2  H   0.161  -5.600   7.069 1.00 . A A . 27 LYS HG2  1 1 
        4  4462 1 1 27 LYS HG3  H   1.340  -6.394   8.115 1.00 . A A . 27 LYS HG3  1 1 
        4  4463 1 1 27 LYS HZ1  H  -1.604  -6.590  11.281 1.00 . A A . 27 LYS HZ1  1 1 
        4  4464 1 1 27 LYS HZ2  H  -2.667  -7.563  10.401 1.00 . A A . 27 LYS HZ2  1 1 
        4  4465 1 1 27 LYS HZ3  H  -2.746  -5.884  10.251 1.00 . A A . 27 LYS HZ3  1 1 
        4  4466 1 1 27 LYS N    N   0.310  -2.877   6.368 1.00 . A A . 27 LYS N    1 1 
        4  4467 1 1 27 LYS NZ   N  -2.101  -6.692  10.373 1.00 . A A . 27 LYS NZ   1 1 
        4  4468 1 1 27 LYS O    O   1.904  -1.560   9.359 1.00 . A A . 27 LYS O    1 1 
        4  4469 1 1 28 ASP C    C   2.059   1.561   7.256 1.00 . A A . 28 ASP C    1 1 
        4  4470 1 1 28 ASP CA   C   2.861   0.271   7.522 1.00 . A A . 28 ASP CA   1 1 
        4  4471 1 1 28 ASP CB   C   4.174   0.288   6.735 1.00 . A A . 28 ASP CB   1 1 
        4  4472 1 1 28 ASP CG   C   5.070   1.444   7.149 1.00 . A A . 28 ASP CG   1 1 
        4  4473 1 1 28 ASP H    H   1.895  -1.163   6.270 1.00 . A A . 28 ASP H    1 1 
        4  4474 1 1 28 ASP HA   H   3.098   0.238   8.579 1.00 . A A . 28 ASP HA   1 1 
        4  4475 1 1 28 ASP HB2  H   4.704  -0.636   6.911 1.00 . A A . 28 ASP HB2  1 1 
        4  4476 1 1 28 ASP HB3  H   3.954   0.378   5.677 1.00 . A A . 28 ASP HB3  1 1 
        4  4477 1 1 28 ASP N    N   2.082  -0.941   7.206 1.00 . A A . 28 ASP N    1 1 
        4  4478 1 1 28 ASP O    O   2.074   2.485   8.067 1.00 . A A . 28 ASP O    1 1 
        4  4479 1 1 28 ASP OD1  O   5.489   1.484   8.328 1.00 . A A . 28 ASP OD1  1 1 
        4  4480 1 1 28 ASP OD2  O   5.347   2.326   6.309 1.00 . A A . 28 ASP OD2  1 1 
        4  4481 1 1 29 LEU C    C  -0.783   2.752   6.606 1.00 . A A . 29 LEU C    1 1 
        4  4482 1 1 29 LEU CA   C   0.525   2.790   5.796 1.00 . A A . 29 LEU CA   1 1 
        4  4483 1 1 29 LEU CB   C   0.214   2.849   4.286 1.00 . A A . 29 LEU CB   1 1 
        4  4484 1 1 29 LEU CD1  C   1.982   4.584   3.773 1.00 . A A . 29 LEU CD1  1 1 
        4  4485 1 1 29 LEU CD2  C   2.472   2.150   3.364 1.00 . A A . 29 LEU CD2  1 1 
        4  4486 1 1 29 LEU CG   C   1.393   3.233   3.368 1.00 . A A . 29 LEU CG   1 1 
        4  4487 1 1 29 LEU H    H   1.443   0.897   5.473 1.00 . A A . 29 LEU H    1 1 
        4  4488 1 1 29 LEU HA   H   1.073   3.683   6.071 1.00 . A A . 29 LEU HA   1 1 
        4  4489 1 1 29 LEU HB2  H  -0.150   1.877   3.980 1.00 . A A . 29 LEU HB2  1 1 
        4  4490 1 1 29 LEU HB3  H  -0.577   3.570   4.133 1.00 . A A . 29 LEU HB3  1 1 
        4  4491 1 1 29 LEU HD11 H   1.224   5.348   3.678 1.00 . A A . 29 LEU HD11 1 1 
        4  4492 1 1 29 LEU HD12 H   2.813   4.825   3.126 1.00 . A A . 29 LEU HD12 1 1 
        4  4493 1 1 29 LEU HD13 H   2.324   4.540   4.797 1.00 . A A . 29 LEU HD13 1 1 
        4  4494 1 1 29 LEU HD21 H   2.044   1.219   3.022 1.00 . A A . 29 LEU HD21 1 1 
        4  4495 1 1 29 LEU HD22 H   2.862   2.022   4.363 1.00 . A A . 29 LEU HD22 1 1 
        4  4496 1 1 29 LEU HD23 H   3.274   2.441   2.700 1.00 . A A . 29 LEU HD23 1 1 
        4  4497 1 1 29 LEU HG   H   1.023   3.333   2.357 1.00 . A A . 29 LEU HG   1 1 
        4  4498 1 1 29 LEU N    N   1.375   1.630   6.116 1.00 . A A . 29 LEU N    1 1 
        4  4499 1 1 29 LEU O    O  -1.162   3.733   7.241 1.00 . A A . 29 LEU O    1 1 
        4  4500 1 1 30 LEU C    C  -2.345   0.978   8.829 1.00 . A A . 30 LEU C    1 1 
        4  4501 1 1 30 LEU CA   C  -2.682   1.378   7.369 1.00 . A A . 30 LEU CA   1 1 
        4  4502 1 1 30 LEU CB   C  -3.509   0.284   6.673 1.00 . A A . 30 LEU CB   1 1 
        4  4503 1 1 30 LEU CD1  C  -5.819   1.265   6.942 1.00 . A A . 30 LEU CD1  1 1 
        4  4504 1 1 30 LEU CD2  C  -5.532  -1.208   6.592 1.00 . A A . 30 LEU CD2  1 1 
        4  4505 1 1 30 LEU CG   C  -4.933   0.053   7.208 1.00 . A A . 30 LEU CG   1 1 
        4  4506 1 1 30 LEU H    H  -1.098   0.862   6.051 1.00 . A A . 30 LEU H    1 1 
        4  4507 1 1 30 LEU HA   H  -3.247   2.302   7.380 1.00 . A A . 30 LEU HA   1 1 
        4  4508 1 1 30 LEU HB2  H  -3.583   0.539   5.624 1.00 . A A . 30 LEU HB2  1 1 
        4  4509 1 1 30 LEU HB3  H  -2.966  -0.646   6.753 1.00 . A A . 30 LEU HB3  1 1 
        4  4510 1 1 30 LEU HD11 H  -5.415   2.125   7.455 1.00 . A A . 30 LEU HD11 1 1 
        4  4511 1 1 30 LEU HD12 H  -6.819   1.069   7.305 1.00 . A A . 30 LEU HD12 1 1 
        4  4512 1 1 30 LEU HD13 H  -5.855   1.463   5.881 1.00 . A A . 30 LEU HD13 1 1 
        4  4513 1 1 30 LEU HD21 H  -4.921  -2.062   6.852 1.00 . A A . 30 LEU HD21 1 1 
        4  4514 1 1 30 LEU HD22 H  -5.569  -1.105   5.517 1.00 . A A . 30 LEU HD22 1 1 
        4  4515 1 1 30 LEU HD23 H  -6.531  -1.355   6.975 1.00 . A A . 30 LEU HD23 1 1 
        4  4516 1 1 30 LEU HG   H  -4.885  -0.091   8.278 1.00 . A A . 30 LEU HG   1 1 
        4  4517 1 1 30 LEU N    N  -1.447   1.598   6.596 1.00 . A A . 30 LEU N    1 1 
        4  4518 1 1 30 LEU O    O  -3.133   0.340   9.527 1.00 . A A . 30 LEU O    1 1 
        4  4519 1 1 31 LYS C    C  -1.364   1.612  11.769 1.00 . A A . 31 LYS C    1 1 
        4  4520 1 1 31 LYS CA   C  -0.605   0.991  10.578 1.00 . A A . 31 LYS CA   1 1 
        4  4521 1 1 31 LYS CB   C   0.874   1.397  10.600 1.00 . A A . 31 LYS CB   1 1 
        4  4522 1 1 31 LYS CD   C   3.137   1.279  11.695 1.00 . A A . 31 LYS CD   1 1 
        4  4523 1 1 31 LYS CE   C   3.469   2.688  11.209 1.00 . A A . 31 LYS CE   1 1 
        4  4524 1 1 31 LYS CG   C   1.632   1.077  11.884 1.00 . A A . 31 LYS CG   1 1 
        4  4525 1 1 31 LYS H    H  -0.636   1.990   8.715 1.00 . A A . 31 LYS H    1 1 
        4  4526 1 1 31 LYS HA   H  -0.667  -0.086  10.651 1.00 . A A . 31 LYS HA   1 1 
        4  4527 1 1 31 LYS HB2  H   1.376   0.891   9.787 1.00 . A A . 31 LYS HB2  1 1 
        4  4528 1 1 31 LYS HB3  H   0.938   2.463  10.429 1.00 . A A . 31 LYS HB3  1 1 
        4  4529 1 1 31 LYS HD2  H   3.633   1.111  12.639 1.00 . A A . 31 LYS HD2  1 1 
        4  4530 1 1 31 LYS HD3  H   3.498   0.563  10.968 1.00 . A A . 31 LYS HD3  1 1 
        4  4531 1 1 31 LYS HE2  H   2.820   2.935  10.383 1.00 . A A . 31 LYS HE2  1 1 
        4  4532 1 1 31 LYS HE3  H   3.300   3.383  12.017 1.00 . A A . 31 LYS HE3  1 1 
        4  4533 1 1 31 LYS HG2  H   1.284   1.731  12.671 1.00 . A A . 31 LYS HG2  1 1 
        4  4534 1 1 31 LYS HG3  H   1.446   0.048  12.157 1.00 . A A . 31 LYS HG3  1 1 
        4  4535 1 1 31 LYS HZ1  H   5.529   2.507  11.511 1.00 . A A . 31 LYS HZ1  1 1 
        4  4536 1 1 31 LYS HZ2  H   5.091   3.798  10.509 1.00 . A A . 31 LYS HZ2  1 1 
        4  4537 1 1 31 LYS HZ3  H   5.042   2.216   9.917 1.00 . A A . 31 LYS HZ3  1 1 
        4  4538 1 1 31 LYS N    N  -1.161   1.386   9.278 1.00 . A A . 31 LYS N    1 1 
        4  4539 1 1 31 LYS NZ   N   4.880   2.809  10.757 1.00 . A A . 31 LYS NZ   1 1 
        4  4540 1 1 31 LYS O    O  -1.637   0.932  12.761 1.00 . A A . 31 LYS O    1 1 
        4  4541 1 1 32 ASP C    C  -3.911   3.606  12.594 1.00 . A A . 32 ASP C    1 1 
        4  4542 1 1 32 ASP CA   C  -2.380   3.611  12.758 1.00 . A A . 32 ASP CA   1 1 
        4  4543 1 1 32 ASP CB   C  -1.872   5.052  12.830 1.00 . A A . 32 ASP CB   1 1 
        4  4544 1 1 32 ASP CG   C  -0.416   5.126  13.251 1.00 . A A . 32 ASP CG   1 1 
        4  4545 1 1 32 ASP H    H  -1.470   3.384  10.850 1.00 . A A . 32 ASP H    1 1 
        4  4546 1 1 32 ASP HA   H  -2.133   3.111  13.684 1.00 . A A . 32 ASP HA   1 1 
        4  4547 1 1 32 ASP HB2  H  -1.973   5.512  11.857 1.00 . A A . 32 ASP HB2  1 1 
        4  4548 1 1 32 ASP HB3  H  -2.466   5.601  13.547 1.00 . A A . 32 ASP HB3  1 1 
        4  4549 1 1 32 ASP N    N  -1.697   2.897  11.669 1.00 . A A . 32 ASP N    1 1 
        4  4550 1 1 32 ASP O    O  -4.648   3.319  13.544 1.00 . A A . 32 ASP O    1 1 
        4  4551 1 1 32 ASP OD1  O   0.472   4.955  12.392 1.00 . A A . 32 ASP OD1  1 1 
        4  4552 1 1 32 ASP OD2  O  -0.154   5.355  14.451 1.00 . A A . 32 ASP OD2  1 1 
        4  4553 1 1 33 MET C    C  -6.463   2.645  10.900 1.00 . A A . 33 MET C    1 1 
        4  4554 1 1 33 MET CA   C  -5.821   4.025  11.120 1.00 . A A . 33 MET CA   1 1 
        4  4555 1 1 33 MET CB   C  -6.072   4.930   9.903 1.00 . A A . 33 MET CB   1 1 
        4  4556 1 1 33 MET CE   C  -3.286   6.303   8.964 1.00 . A A . 33 MET CE   1 1 
        4  4557 1 1 33 MET CG   C  -5.361   4.479   8.631 1.00 . A A . 33 MET CG   1 1 
        4  4558 1 1 33 MET H    H  -3.749   4.081  10.665 1.00 . A A . 33 MET H    1 1 
        4  4559 1 1 33 MET HA   H  -6.283   4.479  11.986 1.00 . A A . 33 MET HA   1 1 
        4  4560 1 1 33 MET HB2  H  -7.136   4.957   9.705 1.00 . A A . 33 MET HB2  1 1 
        4  4561 1 1 33 MET HB3  H  -5.739   5.929  10.140 1.00 . A A . 33 MET HB3  1 1 
        4  4562 1 1 33 MET HE1  H  -3.668   6.827   8.100 1.00 . A A . 33 MET HE1  1 1 
        4  4563 1 1 33 MET HE2  H  -2.228   6.493   9.060 1.00 . A A . 33 MET HE2  1 1 
        4  4564 1 1 33 MET HE3  H  -3.798   6.650   9.850 1.00 . A A . 33 MET HE3  1 1 
        4  4565 1 1 33 MET HG2  H  -5.653   3.462   8.413 1.00 . A A . 33 MET HG2  1 1 
        4  4566 1 1 33 MET HG3  H  -5.668   5.119   7.816 1.00 . A A . 33 MET HG3  1 1 
        4  4567 1 1 33 MET N    N  -4.382   3.922  11.393 1.00 . A A . 33 MET N    1 1 
        4  4568 1 1 33 MET O    O  -5.773   1.634  10.758 1.00 . A A . 33 MET O    1 1 
        4  4569 1 1 33 MET SD   S  -3.560   4.543   8.768 1.00 . A A . 33 MET SD   1 1 
        4  4570 1 1 34 ASN C    C  -8.767   0.929   9.305 1.00 . A A . 34 ASN C    1 1 
        4  4571 1 1 34 ASN CA   C  -8.537   1.354  10.767 1.00 . A A . 34 ASN CA   1 1 
        4  4572 1 1 34 ASN CB   C  -9.871   1.487  11.503 1.00 . A A . 34 ASN CB   1 1 
        4  4573 1 1 34 ASN CG   C  -9.678   1.785  12.978 1.00 . A A . 34 ASN CG   1 1 
        4  4574 1 1 34 ASN H    H  -8.286   3.456  10.918 1.00 . A A . 34 ASN H    1 1 
        4  4575 1 1 34 ASN HA   H  -7.951   0.586  11.257 1.00 . A A . 34 ASN HA   1 1 
        4  4576 1 1 34 ASN HB2  H -10.442   2.292  11.062 1.00 . A A . 34 ASN HB2  1 1 
        4  4577 1 1 34 ASN HB3  H -10.425   0.564  11.409 1.00 . A A . 34 ASN HB3  1 1 
        4  4578 1 1 34 ASN HD21 H -11.313   2.899  13.007 1.00 . A A . 34 ASN HD21 1 1 
        4  4579 1 1 34 ASN HD22 H -10.462   2.760  14.502 1.00 . A A . 34 ASN HD22 1 1 
        4  4580 1 1 34 ASN N    N  -7.791   2.613  10.871 1.00 . A A . 34 ASN N    1 1 
        4  4581 1 1 34 ASN ND2  N -10.574   2.557  13.551 1.00 . A A . 34 ASN ND2  1 1 
        4  4582 1 1 34 ASN O    O  -8.793   1.761   8.395 1.00 . A A . 34 ASN O    1 1 
        4  4583 1 1 34 ASN OD1  O  -8.720   1.330  13.599 1.00 . A A . 34 ASN OD1  1 1 
        4  4584 1 1 35 GLN C    C -10.108  -0.331   6.864 1.00 . A A . 35 GLN C    1 1 
        4  4585 1 1 35 GLN CA   C  -9.048  -0.986   7.770 1.00 . A A . 35 GLN CA   1 1 
        4  4586 1 1 35 GLN CB   C  -9.344  -2.486   7.919 1.00 . A A . 35 GLN CB   1 1 
        4  4587 1 1 35 GLN CD   C  -8.768  -4.641   9.130 1.00 . A A . 35 GLN CD   1 1 
        4  4588 1 1 35 GLN CG   C  -8.343  -3.217   8.810 1.00 . A A . 35 GLN CG   1 1 
        4  4589 1 1 35 GLN H    H  -9.072  -0.953   9.895 1.00 . A A . 35 GLN H    1 1 
        4  4590 1 1 35 GLN HA   H  -8.081  -0.873   7.304 1.00 . A A . 35 GLN HA   1 1 
        4  4591 1 1 35 GLN HB2  H -10.330  -2.603   8.347 1.00 . A A . 35 GLN HB2  1 1 
        4  4592 1 1 35 GLN HB3  H  -9.330  -2.946   6.941 1.00 . A A . 35 GLN HB3  1 1 
        4  4593 1 1 35 GLN HE21 H  -7.766  -5.329   7.568 1.00 . A A . 35 GLN HE21 1 1 
        4  4594 1 1 35 GLN HE22 H  -8.597  -6.513   8.517 1.00 . A A . 35 GLN HE22 1 1 
        4  4595 1 1 35 GLN HG2  H  -7.386  -3.245   8.307 1.00 . A A . 35 GLN HG2  1 1 
        4  4596 1 1 35 GLN HG3  H  -8.241  -2.671   9.738 1.00 . A A . 35 GLN HG3  1 1 
        4  4597 1 1 35 GLN N    N  -8.971  -0.374   9.108 1.00 . A A . 35 GLN N    1 1 
        4  4598 1 1 35 GLN NE2  N  -8.333  -5.587   8.326 1.00 . A A . 35 GLN NE2  1 1 
        4  4599 1 1 35 GLN O    O  -9.799   0.128   5.763 1.00 . A A . 35 GLN O    1 1 
        4  4600 1 1 35 GLN OE1  O  -9.480  -4.887  10.100 1.00 . A A . 35 GLN OE1  1 1 
        4  4601 1 1 36 SER C    C -12.247   1.661   6.036 1.00 . A A . 36 SER C    1 1 
        4  4602 1 1 36 SER CA   C -12.478   0.219   6.525 1.00 . A A . 36 SER CA   1 1 
        4  4603 1 1 36 SER CB   C -13.785   0.143   7.329 1.00 . A A . 36 SER CB   1 1 
        4  4604 1 1 36 SER H    H -11.524  -0.599   8.248 1.00 . A A . 36 SER H    1 1 
        4  4605 1 1 36 SER HA   H -12.569  -0.421   5.659 1.00 . A A . 36 SER HA   1 1 
        4  4606 1 1 36 SER HB2  H -13.975  -0.886   7.602 1.00 . A A . 36 SER HB2  1 1 
        4  4607 1 1 36 SER HB3  H -13.690   0.738   8.225 1.00 . A A . 36 SER HB3  1 1 
        4  4608 1 1 36 SER HG   H -15.480   1.119   7.156 1.00 . A A . 36 SER HG   1 1 
        4  4609 1 1 36 SER N    N -11.352  -0.287   7.333 1.00 . A A . 36 SER N    1 1 
        4  4610 1 1 36 SER O    O -12.702   2.040   4.956 1.00 . A A . 36 SER O    1 1 
        4  4611 1 1 36 SER OG   O -14.888   0.623   6.576 1.00 . A A . 36 SER OG   1 1 
        4  4612 1 1 37 SER C    C -10.462   3.974   5.137 1.00 . A A . 37 SER C    1 1 
        4  4613 1 1 37 SER CA   C -11.233   3.858   6.464 1.00 . A A . 37 SER CA   1 1 
        4  4614 1 1 37 SER CB   C -10.434   4.550   7.579 1.00 . A A . 37 SER CB   1 1 
        4  4615 1 1 37 SER H    H -11.170   2.096   7.665 1.00 . A A . 37 SER H    1 1 
        4  4616 1 1 37 SER HA   H -12.182   4.364   6.355 1.00 . A A . 37 SER HA   1 1 
        4  4617 1 1 37 SER HB2  H -11.004   4.521   8.495 1.00 . A A . 37 SER HB2  1 1 
        4  4618 1 1 37 SER HB3  H  -9.497   4.033   7.724 1.00 . A A . 37 SER HB3  1 1 
        4  4619 1 1 37 SER HG   H  -9.241   5.992   6.970 1.00 . A A . 37 SER HG   1 1 
        4  4620 1 1 37 SER N    N -11.519   2.456   6.821 1.00 . A A . 37 SER N    1 1 
        4  4621 1 1 37 SER O    O -10.571   4.976   4.424 1.00 . A A . 37 SER O    1 1 
        4  4622 1 1 37 SER OG   O -10.161   5.907   7.257 1.00 . A A . 37 SER OG   1 1 
        4  4623 1 1 38 LEU C    C  -9.695   2.734   2.314 1.00 . A A . 38 LEU C    1 1 
        4  4624 1 1 38 LEU CA   C  -8.859   2.934   3.596 1.00 . A A . 38 LEU CA   1 1 
        4  4625 1 1 38 LEU CB   C  -7.790   1.835   3.714 1.00 . A A . 38 LEU CB   1 1 
        4  4626 1 1 38 LEU CD1  C  -5.891   3.110   2.646 1.00 . A A . 38 LEU CD1  1 1 
        4  4627 1 1 38 LEU CD2  C  -5.815   0.600   2.750 1.00 . A A . 38 LEU CD2  1 1 
        4  4628 1 1 38 LEU CG   C  -6.715   1.825   2.613 1.00 . A A . 38 LEU CG   1 1 
        4  4629 1 1 38 LEU H    H  -9.694   2.144   5.385 1.00 . A A . 38 LEU H    1 1 
        4  4630 1 1 38 LEU HA   H  -8.366   3.893   3.537 1.00 . A A . 38 LEU HA   1 1 
        4  4631 1 1 38 LEU HB2  H  -7.294   1.949   4.668 1.00 . A A . 38 LEU HB2  1 1 
        4  4632 1 1 38 LEU HB3  H  -8.291   0.875   3.706 1.00 . A A . 38 LEU HB3  1 1 
        4  4633 1 1 38 LEU HD11 H  -5.396   3.200   3.603 1.00 . A A . 38 LEU HD11 1 1 
        4  4634 1 1 38 LEU HD12 H  -6.542   3.960   2.498 1.00 . A A . 38 LEU HD12 1 1 
        4  4635 1 1 38 LEU HD13 H  -5.151   3.087   1.859 1.00 . A A . 38 LEU HD13 1 1 
        4  4636 1 1 38 LEU HD21 H  -5.297   0.634   3.699 1.00 . A A . 38 LEU HD21 1 1 
        4  4637 1 1 38 LEU HD22 H  -5.091   0.589   1.946 1.00 . A A . 38 LEU HD22 1 1 
        4  4638 1 1 38 LEU HD23 H  -6.416  -0.297   2.702 1.00 . A A . 38 LEU HD23 1 1 
        4  4639 1 1 38 LEU HG   H  -7.203   1.772   1.648 1.00 . A A . 38 LEU HG   1 1 
        4  4640 1 1 38 LEU N    N  -9.698   2.935   4.803 1.00 . A A . 38 LEU N    1 1 
        4  4641 1 1 38 LEU O    O  -9.214   2.978   1.203 1.00 . A A . 38 LEU O    1 1 
        4  4642 1 1 39 ALA C    C -12.066   3.313   0.464 1.00 . A A . 39 ALA C    1 1 
        4  4643 1 1 39 ALA CA   C -11.849   2.060   1.334 1.00 . A A . 39 ALA CA   1 1 
        4  4644 1 1 39 ALA CB   C -13.189   1.524   1.830 1.00 . A A . 39 ALA CB   1 1 
        4  4645 1 1 39 ALA H    H -11.294   2.172   3.387 1.00 . A A . 39 ALA H    1 1 
        4  4646 1 1 39 ALA HA   H -11.391   1.291   0.724 1.00 . A A . 39 ALA HA   1 1 
        4  4647 1 1 39 ALA HB1  H -13.829   1.307   0.986 1.00 . A A . 39 ALA HB1  1 1 
        4  4648 1 1 39 ALA HB2  H -13.662   2.264   2.459 1.00 . A A . 39 ALA HB2  1 1 
        4  4649 1 1 39 ALA HB3  H -13.026   0.620   2.399 1.00 . A A . 39 ALA HB3  1 1 
        4  4650 1 1 39 ALA N    N -10.954   2.316   2.476 1.00 . A A . 39 ALA N    1 1 
        4  4651 1 1 39 ALA O    O -12.441   3.212  -0.705 1.00 . A A . 39 ALA O    1 1 
        4  4652 1 1 40 LYS C    C -10.673   6.059  -0.490 1.00 . A A . 40 LYS C    1 1 
        4  4653 1 1 40 LYS CA   C -11.956   5.755   0.300 1.00 . A A . 40 LYS CA   1 1 
        4  4654 1 1 40 LYS CB   C -12.261   6.920   1.251 1.00 . A A . 40 LYS CB   1 1 
        4  4655 1 1 40 LYS CD   C -14.759   6.953   0.826 1.00 . A A . 40 LYS CD   1 1 
        4  4656 1 1 40 LYS CE   C -16.142   7.003   1.463 1.00 . A A . 40 LYS CE   1 1 
        4  4657 1 1 40 LYS CG   C -13.652   6.868   1.877 1.00 . A A . 40 LYS CG   1 1 
        4  4658 1 1 40 LYS H    H -11.613   4.515   1.997 1.00 . A A . 40 LYS H    1 1 
        4  4659 1 1 40 LYS HA   H -12.773   5.654  -0.400 1.00 . A A . 40 LYS HA   1 1 
        4  4660 1 1 40 LYS HB2  H -11.533   6.916   2.049 1.00 . A A . 40 LYS HB2  1 1 
        4  4661 1 1 40 LYS HB3  H -12.172   7.850   0.703 1.00 . A A . 40 LYS HB3  1 1 
        4  4662 1 1 40 LYS HD2  H -14.614   7.847   0.235 1.00 . A A . 40 LYS HD2  1 1 
        4  4663 1 1 40 LYS HD3  H -14.700   6.085   0.184 1.00 . A A . 40 LYS HD3  1 1 
        4  4664 1 1 40 LYS HE2  H -16.279   6.119   2.068 1.00 . A A . 40 LYS HE2  1 1 
        4  4665 1 1 40 LYS HE3  H -16.208   7.881   2.091 1.00 . A A . 40 LYS HE3  1 1 
        4  4666 1 1 40 LYS HG2  H -13.756   5.939   2.420 1.00 . A A . 40 LYS HG2  1 1 
        4  4667 1 1 40 LYS HG3  H -13.757   7.699   2.564 1.00 . A A . 40 LYS HG3  1 1 
        4  4668 1 1 40 LYS HZ1  H -17.201   6.204  -0.151 1.00 . A A . 40 LYS HZ1  1 1 
        4  4669 1 1 40 LYS HZ2  H -17.105   7.892  -0.167 1.00 . A A . 40 LYS HZ2  1 1 
        4  4670 1 1 40 LYS HZ3  H -18.155   7.115   0.909 1.00 . A A . 40 LYS HZ3  1 1 
        4  4671 1 1 40 LYS N    N -11.847   4.493   1.045 1.00 . A A . 40 LYS N    1 1 
        4  4672 1 1 40 LYS NZ   N -17.225   7.057   0.443 1.00 . A A . 40 LYS NZ   1 1 
        4  4673 1 1 40 LYS O    O -10.730   6.457  -1.657 1.00 . A A . 40 LYS O    1 1 
        4  4674 1 1 41 GLU C    C  -7.936   5.310  -1.677 1.00 . A A . 41 GLU C    1 1 
        4  4675 1 1 41 GLU CA   C  -8.221   6.188  -0.450 1.00 . A A . 41 GLU CA   1 1 
        4  4676 1 1 41 GLU CB   C  -7.096   6.000   0.580 1.00 . A A . 41 GLU CB   1 1 
        4  4677 1 1 41 GLU CD   C  -7.680   8.151   1.803 1.00 . A A . 41 GLU CD   1 1 
        4  4678 1 1 41 GLU CG   C  -7.351   6.672   1.926 1.00 . A A . 41 GLU CG   1 1 
        4  4679 1 1 41 GLU H    H  -9.544   5.482   1.054 1.00 . A A . 41 GLU H    1 1 
        4  4680 1 1 41 GLU HA   H  -8.248   7.223  -0.760 1.00 . A A . 41 GLU HA   1 1 
        4  4681 1 1 41 GLU HB2  H  -6.962   4.941   0.756 1.00 . A A . 41 GLU HB2  1 1 
        4  4682 1 1 41 GLU HB3  H  -6.178   6.401   0.170 1.00 . A A . 41 GLU HB3  1 1 
        4  4683 1 1 41 GLU HG2  H  -8.179   6.173   2.410 1.00 . A A . 41 GLU HG2  1 1 
        4  4684 1 1 41 GLU HG3  H  -6.465   6.564   2.538 1.00 . A A . 41 GLU HG3  1 1 
        4  4685 1 1 41 GLU N    N  -9.521   5.861   0.152 1.00 . A A . 41 GLU N    1 1 
        4  4686 1 1 41 GLU O    O  -7.823   5.801  -2.803 1.00 . A A . 41 GLU O    1 1 
        4  4687 1 1 41 GLU OE1  O  -6.836   8.915   1.288 1.00 . A A . 41 GLU OE1  1 1 
        4  4688 1 1 41 GLU OE2  O  -8.775   8.562   2.250 1.00 . A A . 41 GLU OE2  1 1 
        4  4689 1 1 42 CYS C    C  -8.854   2.645  -3.243 1.00 . A A . 42 CYS C    1 1 
        4  4690 1 1 42 CYS CA   C  -7.557   3.049  -2.527 1.00 . A A . 42 CYS CA   1 1 
        4  4691 1 1 42 CYS CB   C  -6.869   1.797  -1.971 1.00 . A A . 42 CYS CB   1 1 
        4  4692 1 1 42 CYS H    H  -7.942   3.672  -0.534 1.00 . A A . 42 CYS H    1 1 
        4  4693 1 1 42 CYS HA   H  -6.897   3.527  -3.234 1.00 . A A . 42 CYS HA   1 1 
        4  4694 1 1 42 CYS HB2  H  -6.606   1.145  -2.792 1.00 . A A . 42 CYS HB2  1 1 
        4  4695 1 1 42 CYS HB3  H  -5.968   2.090  -1.450 1.00 . A A . 42 CYS HB3  1 1 
        4  4696 1 1 42 CYS HG   H  -8.844   1.636  -0.359 1.00 . A A . 42 CYS HG   1 1 
        4  4697 1 1 42 CYS N    N  -7.830   4.004  -1.449 1.00 . A A . 42 CYS N    1 1 
        4  4698 1 1 42 CYS O    O  -9.881   2.427  -2.599 1.00 . A A . 42 CYS O    1 1 
        4  4699 1 1 42 CYS SG   S  -7.884   0.842  -0.817 1.00 . A A . 42 CYS SG   1 1 
        4  4700 1 1 43 PRO C    C -10.349   0.613  -5.216 1.00 . A A . 43 PRO C    1 1 
        4  4701 1 1 43 PRO CA   C -10.017   2.115  -5.374 1.00 . A A . 43 PRO CA   1 1 
        4  4702 1 1 43 PRO CB   C  -9.611   2.432  -6.834 1.00 . A A . 43 PRO CB   1 1 
        4  4703 1 1 43 PRO CD   C  -7.696   2.854  -5.461 1.00 . A A . 43 PRO CD   1 1 
        4  4704 1 1 43 PRO CG   C  -8.373   3.267  -6.738 1.00 . A A . 43 PRO CG   1 1 
        4  4705 1 1 43 PRO HA   H -10.892   2.696  -5.110 1.00 . A A . 43 PRO HA   1 1 
        4  4706 1 1 43 PRO HB2  H  -9.420   1.511  -7.367 1.00 . A A . 43 PRO HB2  1 1 
        4  4707 1 1 43 PRO HB3  H -10.412   2.971  -7.324 1.00 . A A . 43 PRO HB3  1 1 
        4  4708 1 1 43 PRO HD2  H  -7.079   1.981  -5.622 1.00 . A A . 43 PRO HD2  1 1 
        4  4709 1 1 43 PRO HD3  H  -7.110   3.668  -5.058 1.00 . A A . 43 PRO HD3  1 1 
        4  4710 1 1 43 PRO HG2  H  -7.730   3.072  -7.586 1.00 . A A . 43 PRO HG2  1 1 
        4  4711 1 1 43 PRO HG3  H  -8.637   4.313  -6.700 1.00 . A A . 43 PRO HG3  1 1 
        4  4712 1 1 43 PRO N    N  -8.838   2.541  -4.588 1.00 . A A . 43 PRO N    1 1 
        4  4713 1 1 43 PRO O    O -10.972   0.009  -6.092 1.00 . A A . 43 PRO O    1 1 
        4  4714 1 1 44 LEU C    C -11.361  -1.638  -2.892 1.00 . A A . 44 LEU C    1 1 
        4  4715 1 1 44 LEU CA   C -10.165  -1.405  -3.829 1.00 . A A . 44 LEU CA   1 1 
        4  4716 1 1 44 LEU CB   C  -8.893  -2.010  -3.214 1.00 . A A . 44 LEU CB   1 1 
        4  4717 1 1 44 LEU CD1  C  -6.397  -2.386  -3.295 1.00 . A A . 44 LEU CD1  1 1 
        4  4718 1 1 44 LEU CD2  C  -7.742  -2.488  -5.415 1.00 . A A . 44 LEU CD2  1 1 
        4  4719 1 1 44 LEU CG   C  -7.606  -1.828  -4.043 1.00 . A A . 44 LEU CG   1 1 
        4  4720 1 1 44 LEU H    H  -9.536   0.566  -3.393 1.00 . A A . 44 LEU H    1 1 
        4  4721 1 1 44 LEU HA   H -10.364  -1.892  -4.774 1.00 . A A . 44 LEU HA   1 1 
        4  4722 1 1 44 LEU HB2  H  -8.739  -1.555  -2.243 1.00 . A A . 44 LEU HB2  1 1 
        4  4723 1 1 44 LEU HB3  H  -9.057  -3.069  -3.072 1.00 . A A . 44 LEU HB3  1 1 
        4  4724 1 1 44 LEU HD11 H  -5.510  -2.258  -3.896 1.00 . A A . 44 LEU HD11 1 1 
        4  4725 1 1 44 LEU HD12 H  -6.547  -3.437  -3.093 1.00 . A A . 44 LEU HD12 1 1 
        4  4726 1 1 44 LEU HD13 H  -6.276  -1.855  -2.361 1.00 . A A . 44 LEU HD13 1 1 
        4  4727 1 1 44 LEU HD21 H  -8.543  -2.016  -5.965 1.00 . A A . 44 LEU HD21 1 1 
        4  4728 1 1 44 LEU HD22 H  -7.960  -3.540  -5.292 1.00 . A A . 44 LEU HD22 1 1 
        4  4729 1 1 44 LEU HD23 H  -6.817  -2.375  -5.960 1.00 . A A . 44 LEU HD23 1 1 
        4  4730 1 1 44 LEU HG   H  -7.437  -0.773  -4.198 1.00 . A A . 44 LEU HG   1 1 
        4  4731 1 1 44 LEU N    N  -9.959   0.025  -4.086 1.00 . A A . 44 LEU N    1 1 
        4  4732 1 1 44 LEU O    O -12.009  -0.692  -2.436 1.00 . A A . 44 LEU O    1 1 
        4  4733 1 1 45 SER C    C -12.268  -3.487  -0.270 1.00 . A A . 45 SER C    1 1 
        4  4734 1 1 45 SER CA   C -12.756  -3.265  -1.708 1.00 . A A . 45 SER CA   1 1 
        4  4735 1 1 45 SER CB   C -13.461  -4.533  -2.205 1.00 . A A . 45 SER CB   1 1 
        4  4736 1 1 45 SER H    H -11.115  -3.618  -3.008 1.00 . A A . 45 SER H    1 1 
        4  4737 1 1 45 SER HA   H -13.466  -2.450  -1.709 1.00 . A A . 45 SER HA   1 1 
        4  4738 1 1 45 SER HB2  H -14.311  -4.745  -1.573 1.00 . A A . 45 SER HB2  1 1 
        4  4739 1 1 45 SER HB3  H -13.800  -4.377  -3.219 1.00 . A A . 45 SER HB3  1 1 
        4  4740 1 1 45 SER HG   H -13.038  -6.411  -2.588 1.00 . A A . 45 SER HG   1 1 
        4  4741 1 1 45 SER N    N -11.650  -2.904  -2.605 1.00 . A A . 45 SER N    1 1 
        4  4742 1 1 45 SER O    O -11.154  -3.974  -0.044 1.00 . A A . 45 SER O    1 1 
        4  4743 1 1 45 SER OG   O -12.591  -5.655  -2.184 1.00 . A A . 45 SER OG   1 1 
        4  4744 1 1 46 GLN C    C -12.600  -4.865   2.393 1.00 . A A . 46 GLN C    1 1 
        4  4745 1 1 46 GLN CA   C -12.804  -3.368   2.117 1.00 . A A . 46 GLN CA   1 1 
        4  4746 1 1 46 GLN CB   C -13.922  -2.792   3.011 1.00 . A A . 46 GLN CB   1 1 
        4  4747 1 1 46 GLN CD   C -14.673  -4.110   5.064 1.00 . A A . 46 GLN CD   1 1 
        4  4748 1 1 46 GLN CG   C -13.734  -3.042   4.514 1.00 . A A . 46 GLN CG   1 1 
        4  4749 1 1 46 GLN H    H -13.970  -2.722   0.460 1.00 . A A . 46 GLN H    1 1 
        4  4750 1 1 46 GLN HA   H -11.880  -2.850   2.334 1.00 . A A . 46 GLN HA   1 1 
        4  4751 1 1 46 GLN HB2  H -13.969  -1.723   2.851 1.00 . A A . 46 GLN HB2  1 1 
        4  4752 1 1 46 GLN HB3  H -14.865  -3.225   2.707 1.00 . A A . 46 GLN HB3  1 1 
        4  4753 1 1 46 GLN HE21 H -13.389  -5.543   4.609 1.00 . A A . 46 GLN HE21 1 1 
        4  4754 1 1 46 GLN HE22 H -14.863  -6.058   5.342 1.00 . A A . 46 GLN HE22 1 1 
        4  4755 1 1 46 GLN HG2  H -12.716  -3.358   4.694 1.00 . A A . 46 GLN HG2  1 1 
        4  4756 1 1 46 GLN HG3  H -13.918  -2.119   5.046 1.00 . A A . 46 GLN HG3  1 1 
        4  4757 1 1 46 GLN N    N -13.116  -3.140   0.701 1.00 . A A . 46 GLN N    1 1 
        4  4758 1 1 46 GLN NE2  N -14.264  -5.360   5.001 1.00 . A A . 46 GLN NE2  1 1 
        4  4759 1 1 46 GLN O    O -11.905  -5.242   3.338 1.00 . A A . 46 GLN O    1 1 
        4  4760 1 1 46 GLN OE1  O -15.765  -3.811   5.533 1.00 . A A . 46 GLN OE1  1 1 
        4  4761 1 1 47 SER C    C -11.522  -7.535   1.619 1.00 . A A . 47 SER C    1 1 
        4  4762 1 1 47 SER CA   C -13.017  -7.167   1.639 1.00 . A A . 47 SER CA   1 1 
        4  4763 1 1 47 SER CB   C -13.742  -7.861   0.476 1.00 . A A . 47 SER CB   1 1 
        4  4764 1 1 47 SER H    H -13.818  -5.345   0.880 1.00 . A A . 47 SER H    1 1 
        4  4765 1 1 47 SER HA   H -13.446  -7.505   2.572 1.00 . A A . 47 SER HA   1 1 
        4  4766 1 1 47 SER HB2  H -14.793  -7.616   0.515 1.00 . A A . 47 SER HB2  1 1 
        4  4767 1 1 47 SER HB3  H -13.329  -7.515  -0.462 1.00 . A A . 47 SER HB3  1 1 
        4  4768 1 1 47 SER HG   H -14.197  -9.620   1.222 1.00 . A A . 47 SER HG   1 1 
        4  4769 1 1 47 SER N    N -13.208  -5.709   1.560 1.00 . A A . 47 SER N    1 1 
        4  4770 1 1 47 SER O    O -11.025  -8.226   2.517 1.00 . A A . 47 SER O    1 1 
        4  4771 1 1 47 SER OG   O -13.607  -9.271   0.541 1.00 . A A . 47 SER OG   1 1 
        4  4772 1 1 48 MET C    C  -8.604  -6.698   1.699 1.00 . A A . 48 MET C    1 1 
        4  4773 1 1 48 MET CA   C  -9.355  -7.277   0.491 1.00 . A A . 48 MET CA   1 1 
        4  4774 1 1 48 MET CB   C  -8.806  -6.633  -0.794 1.00 . A A . 48 MET CB   1 1 
        4  4775 1 1 48 MET CE   C  -9.927  -6.841  -4.810 1.00 . A A . 48 MET CE   1 1 
        4  4776 1 1 48 MET CG   C  -9.509  -7.068  -2.072 1.00 . A A . 48 MET CG   1 1 
        4  4777 1 1 48 MET H    H -11.254  -6.499  -0.074 1.00 . A A . 48 MET H    1 1 
        4  4778 1 1 48 MET HA   H  -9.191  -8.346   0.449 1.00 . A A . 48 MET HA   1 1 
        4  4779 1 1 48 MET HB2  H  -8.899  -5.558  -0.711 1.00 . A A . 48 MET HB2  1 1 
        4  4780 1 1 48 MET HB3  H  -7.757  -6.882  -0.888 1.00 . A A . 48 MET HB3  1 1 
        4  4781 1 1 48 MET HE1  H  -9.958  -7.920  -4.838 1.00 . A A . 48 MET HE1  1 1 
        4  4782 1 1 48 MET HE2  H  -9.600  -6.464  -5.768 1.00 . A A . 48 MET HE2  1 1 
        4  4783 1 1 48 MET HE3  H -10.912  -6.458  -4.589 1.00 . A A . 48 MET HE3  1 1 
        4  4784 1 1 48 MET HG2  H  -9.431  -8.143  -2.166 1.00 . A A . 48 MET HG2  1 1 
        4  4785 1 1 48 MET HG3  H -10.551  -6.787  -2.013 1.00 . A A . 48 MET HG3  1 1 
        4  4786 1 1 48 MET N    N -10.802  -7.040   0.608 1.00 . A A . 48 MET N    1 1 
        4  4787 1 1 48 MET O    O  -7.738  -7.350   2.286 1.00 . A A . 48 MET O    1 1 
        4  4788 1 1 48 MET SD   S  -8.779  -6.304  -3.540 1.00 . A A . 48 MET SD   1 1 
        4  4789 1 1 49 ILE C    C  -8.547  -5.355   4.526 1.00 . A A . 49 ILE C    1 1 
        4  4790 1 1 49 ILE CA   C  -8.282  -4.731   3.141 1.00 . A A . 49 ILE CA   1 1 
        4  4791 1 1 49 ILE CB   C  -8.739  -3.245   3.151 1.00 . A A . 49 ILE CB   1 1 
        4  4792 1 1 49 ILE CD1  C  -9.103  -1.212   1.636 1.00 . A A . 49 ILE CD1  1 1 
        4  4793 1 1 49 ILE CG1  C  -8.573  -2.628   1.752 1.00 . A A . 49 ILE CG1  1 1 
        4  4794 1 1 49 ILE CG2  C  -7.953  -2.438   4.186 1.00 . A A . 49 ILE CG2  1 1 
        4  4795 1 1 49 ILE H    H  -9.701  -5.033   1.588 1.00 . A A . 49 ILE H    1 1 
        4  4796 1 1 49 ILE HA   H  -7.219  -4.756   2.943 1.00 . A A . 49 ILE HA   1 1 
        4  4797 1 1 49 ILE HB   H  -9.785  -3.215   3.426 1.00 . A A . 49 ILE HB   1 1 
        4  4798 1 1 49 ILE HD11 H -10.160  -1.203   1.858 1.00 . A A . 49 ILE HD11 1 1 
        4  4799 1 1 49 ILE HD12 H  -8.946  -0.851   0.629 1.00 . A A . 49 ILE HD12 1 1 
        4  4800 1 1 49 ILE HD13 H  -8.583  -0.572   2.333 1.00 . A A . 49 ILE HD13 1 1 
        4  4801 1 1 49 ILE HG12 H  -7.525  -2.607   1.496 1.00 . A A . 49 ILE HG12 1 1 
        4  4802 1 1 49 ILE HG13 H  -9.100  -3.240   1.032 1.00 . A A . 49 ILE HG13 1 1 
        4  4803 1 1 49 ILE HG21 H  -8.106  -2.863   5.168 1.00 . A A . 49 ILE HG21 1 1 
        4  4804 1 1 49 ILE HG22 H  -8.296  -1.413   4.183 1.00 . A A . 49 ILE HG22 1 1 
        4  4805 1 1 49 ILE HG23 H  -6.900  -2.465   3.944 1.00 . A A . 49 ILE HG23 1 1 
        4  4806 1 1 49 ILE N    N  -8.958  -5.467   2.062 1.00 . A A . 49 ILE N    1 1 
        4  4807 1 1 49 ILE O    O  -7.748  -5.207   5.450 1.00 . A A . 49 ILE O    1 1 
        4  4808 1 1 50 SER C    C  -9.375  -7.975   6.233 1.00 . A A . 50 SER C    1 1 
        4  4809 1 1 50 SER CA   C -10.064  -6.632   5.959 1.00 . A A . 50 SER CA   1 1 
        4  4810 1 1 50 SER CB   C -11.584  -6.816   6.037 1.00 . A A . 50 SER CB   1 1 
        4  4811 1 1 50 SER H    H -10.251  -6.184   3.886 1.00 . A A . 50 SER H    1 1 
        4  4812 1 1 50 SER HA   H  -9.766  -5.933   6.729 1.00 . A A . 50 SER HA   1 1 
        4  4813 1 1 50 SER HB2  H -12.069  -5.857   5.919 1.00 . A A . 50 SER HB2  1 1 
        4  4814 1 1 50 SER HB3  H -11.906  -7.480   5.245 1.00 . A A . 50 SER HB3  1 1 
        4  4815 1 1 50 SER HG   H -12.397  -6.692   7.827 1.00 . A A . 50 SER HG   1 1 
        4  4816 1 1 50 SER N    N  -9.671  -6.055   4.666 1.00 . A A . 50 SER N    1 1 
        4  4817 1 1 50 SER O    O  -8.806  -8.179   7.306 1.00 . A A . 50 SER O    1 1 
        4  4818 1 1 50 SER OG   O -11.976  -7.372   7.286 1.00 . A A . 50 SER OG   1 1 
        4  4819 1 1 51 SER C    C  -7.470 -10.457   5.045 1.00 . A A . 51 SER C    1 1 
        4  4820 1 1 51 SER CA   C  -8.934 -10.262   5.473 1.00 . A A . 51 SER CA   1 1 
        4  4821 1 1 51 SER CB   C  -9.824 -11.256   4.717 1.00 . A A . 51 SER CB   1 1 
        4  4822 1 1 51 SER H    H  -9.785  -8.634   4.386 1.00 . A A . 51 SER H    1 1 
        4  4823 1 1 51 SER HA   H  -9.010 -10.477   6.530 1.00 . A A . 51 SER HA   1 1 
        4  4824 1 1 51 SER HB2  H -10.844 -11.159   5.062 1.00 . A A . 51 SER HB2  1 1 
        4  4825 1 1 51 SER HB3  H  -9.783 -11.042   3.657 1.00 . A A . 51 SER HB3  1 1 
        4  4826 1 1 51 SER HG   H  -9.547 -13.110   4.127 1.00 . A A . 51 SER HG   1 1 
        4  4827 1 1 51 SER N    N  -9.420  -8.886   5.262 1.00 . A A . 51 SER N    1 1 
        4  4828 1 1 51 SER O    O  -6.616 -10.812   5.862 1.00 . A A . 51 SER O    1 1 
        4  4829 1 1 51 SER OG   O  -9.396 -12.594   4.931 1.00 . A A . 51 SER OG   1 1 
        4  4830 1 1 52 ILE C    C  -4.699  -9.880   3.965 1.00 . A A . 52 ILE C    1 1 
        4  4831 1 1 52 ILE CA   C  -5.861 -10.522   3.179 1.00 . A A . 52 ILE CA   1 1 
        4  4832 1 1 52 ILE CB   C  -5.786 -10.068   1.695 1.00 . A A . 52 ILE CB   1 1 
        4  4833 1 1 52 ILE CD1  C  -6.934 -10.314  -0.580 1.00 . A A . 52 ILE CD1  1 1 
        4  4834 1 1 52 ILE CG1  C  -6.913 -10.726   0.879 1.00 . A A . 52 ILE CG1  1 1 
        4  4835 1 1 52 ILE CG2  C  -4.419 -10.400   1.087 1.00 . A A . 52 ILE CG2  1 1 
        4  4836 1 1 52 ILE H    H  -7.874  -9.825   3.189 1.00 . A A . 52 ILE H    1 1 
        4  4837 1 1 52 ILE HA   H  -5.736 -11.596   3.204 1.00 . A A . 52 ILE HA   1 1 
        4  4838 1 1 52 ILE HB   H  -5.913  -8.994   1.663 1.00 . A A . 52 ILE HB   1 1 
        4  4839 1 1 52 ILE HD11 H  -6.019 -10.633  -1.060 1.00 . A A . 52 ILE HD11 1 1 
        4  4840 1 1 52 ILE HD12 H  -7.025  -9.241  -0.650 1.00 . A A . 52 ILE HD12 1 1 
        4  4841 1 1 52 ILE HD13 H  -7.777 -10.780  -1.069 1.00 . A A . 52 ILE HD13 1 1 
        4  4842 1 1 52 ILE HG12 H  -6.799 -11.800   0.916 1.00 . A A . 52 ILE HG12 1 1 
        4  4843 1 1 52 ILE HG13 H  -7.866 -10.457   1.312 1.00 . A A . 52 ILE HG13 1 1 
        4  4844 1 1 52 ILE HG21 H  -4.382 -10.049   0.066 1.00 . A A . 52 ILE HG21 1 1 
        4  4845 1 1 52 ILE HG22 H  -4.262 -11.470   1.105 1.00 . A A . 52 ILE HG22 1 1 
        4  4846 1 1 52 ILE HG23 H  -3.640  -9.915   1.659 1.00 . A A . 52 ILE HG23 1 1 
        4  4847 1 1 52 ILE N    N  -7.184 -10.218   3.762 1.00 . A A . 52 ILE N    1 1 
        4  4848 1 1 52 ILE O    O  -3.607 -10.446   4.048 1.00 . A A . 52 ILE O    1 1 
        4  4849 1 1 53 VAL C    C  -3.277  -8.818   6.429 1.00 . A A . 53 VAL C    1 1 
        4  4850 1 1 53 VAL CA   C  -3.924  -7.973   5.308 1.00 . A A . 53 VAL CA   1 1 
        4  4851 1 1 53 VAL CB   C  -4.530  -6.686   5.922 1.00 . A A . 53 VAL CB   1 1 
        4  4852 1 1 53 VAL CG1  C  -5.654  -7.025   6.904 1.00 . A A . 53 VAL CG1  1 1 
        4  4853 1 1 53 VAL CG2  C  -3.454  -5.836   6.597 1.00 . A A . 53 VAL CG2  1 1 
        4  4854 1 1 53 VAL H    H  -5.846  -8.329   4.477 1.00 . A A . 53 VAL H    1 1 
        4  4855 1 1 53 VAL HA   H  -3.153  -7.677   4.610 1.00 . A A . 53 VAL HA   1 1 
        4  4856 1 1 53 VAL HB   H  -4.960  -6.105   5.115 1.00 . A A . 53 VAL HB   1 1 
        4  4857 1 1 53 VAL HG11 H  -6.425  -7.583   6.391 1.00 . A A . 53 VAL HG11 1 1 
        4  4858 1 1 53 VAL HG12 H  -6.075  -6.113   7.301 1.00 . A A . 53 VAL HG12 1 1 
        4  4859 1 1 53 VAL HG13 H  -5.259  -7.621   7.715 1.00 . A A . 53 VAL HG13 1 1 
        4  4860 1 1 53 VAL HG21 H  -3.900  -4.935   6.993 1.00 . A A . 53 VAL HG21 1 1 
        4  4861 1 1 53 VAL HG22 H  -2.696  -5.574   5.873 1.00 . A A . 53 VAL HG22 1 1 
        4  4862 1 1 53 VAL HG23 H  -3.002  -6.397   7.403 1.00 . A A . 53 VAL HG23 1 1 
        4  4863 1 1 53 VAL N    N  -4.948  -8.712   4.554 1.00 . A A . 53 VAL N    1 1 
        4  4864 1 1 53 VAL O    O  -2.092  -8.653   6.746 1.00 . A A . 53 VAL O    1 1 
        4  4865 1 1 54 ASN C    C  -3.143 -11.940   7.730 1.00 . A A . 54 ASN C    1 1 
        4  4866 1 1 54 ASN CA   C  -3.564 -10.528   8.151 1.00 . A A . 54 ASN CA   1 1 
        4  4867 1 1 54 ASN CB   C  -4.644 -10.602   9.233 1.00 . A A . 54 ASN CB   1 1 
        4  4868 1 1 54 ASN CG   C  -4.949  -9.241   9.828 1.00 . A A . 54 ASN CG   1 1 
        4  4869 1 1 54 ASN H    H  -4.962  -9.867   6.687 1.00 . A A . 54 ASN H    1 1 
        4  4870 1 1 54 ASN HA   H  -2.699 -10.027   8.563 1.00 . A A . 54 ASN HA   1 1 
        4  4871 1 1 54 ASN HB2  H  -5.552 -11.000   8.802 1.00 . A A . 54 ASN HB2  1 1 
        4  4872 1 1 54 ASN HB3  H  -4.311 -11.256  10.026 1.00 . A A . 54 ASN HB3  1 1 
        4  4873 1 1 54 ASN HD21 H  -6.828  -9.763  10.151 1.00 . A A . 54 ASN HD21 1 1 
        4  4874 1 1 54 ASN HD22 H  -6.391  -8.165  10.637 1.00 . A A . 54 ASN HD22 1 1 
        4  4875 1 1 54 ASN N    N  -4.048  -9.727   7.019 1.00 . A A . 54 ASN N    1 1 
        4  4876 1 1 54 ASN ND2  N  -6.178  -9.036  10.246 1.00 . A A . 54 ASN ND2  1 1 
        4  4877 1 1 54 ASN O    O  -2.804 -12.772   8.575 1.00 . A A . 54 ASN O    1 1 
        4  4878 1 1 54 ASN OD1  O  -4.081  -8.379   9.912 1.00 . A A . 54 ASN OD1  1 1 
        4  4879 1 1 55 SER C    C  -1.237 -13.534   5.568 1.00 . A A . 55 SER C    1 1 
        4  4880 1 1 55 SER CA   C  -2.729 -13.529   5.922 1.00 . A A . 55 SER CA   1 1 
        4  4881 1 1 55 SER CB   C  -3.560 -13.947   4.701 1.00 . A A . 55 SER CB   1 1 
        4  4882 1 1 55 SER H    H  -3.434 -11.521   5.792 1.00 . A A . 55 SER H    1 1 
        4  4883 1 1 55 SER HA   H  -2.895 -14.251   6.714 1.00 . A A . 55 SER HA   1 1 
        4  4884 1 1 55 SER HB2  H  -4.609 -13.960   4.967 1.00 . A A . 55 SER HB2  1 1 
        4  4885 1 1 55 SER HB3  H  -3.401 -13.241   3.899 1.00 . A A . 55 SER HB3  1 1 
        4  4886 1 1 55 SER HG   H  -3.980 -15.749   4.039 1.00 . A A . 55 SER HG   1 1 
        4  4887 1 1 55 SER N    N  -3.149 -12.214   6.427 1.00 . A A . 55 SER N    1 1 
        4  4888 1 1 55 SER O    O  -0.838 -13.138   4.471 1.00 . A A . 55 SER O    1 1 
        4  4889 1 1 55 SER OG   O  -3.188 -15.243   4.248 1.00 . A A . 55 SER OG   1 1 
        4  4890 1 1 56 THR C    C   1.528 -15.171   5.454 1.00 . A A . 56 THR C    1 1 
        4  4891 1 1 56 THR CA   C   1.049 -14.003   6.330 1.00 . A A . 56 THR CA   1 1 
        4  4892 1 1 56 THR CB   C   1.769 -14.084   7.698 1.00 . A A . 56 THR CB   1 1 
        4  4893 1 1 56 THR CG2  C   1.421 -12.886   8.578 1.00 . A A . 56 THR CG2  1 1 
        4  4894 1 1 56 THR H    H  -0.790 -14.340   7.343 1.00 . A A . 56 THR H    1 1 
        4  4895 1 1 56 THR HA   H   1.335 -13.074   5.854 1.00 . A A . 56 THR HA   1 1 
        4  4896 1 1 56 THR HB   H   2.838 -14.089   7.528 1.00 . A A . 56 THR HB   1 1 
        4  4897 1 1 56 THR HG1  H   2.195 -15.800   8.581 1.00 . A A . 56 THR HG1  1 1 
        4  4898 1 1 56 THR HG21 H   1.946 -12.966   9.520 1.00 . A A . 56 THR HG21 1 1 
        4  4899 1 1 56 THR HG22 H   0.355 -12.868   8.760 1.00 . A A . 56 THR HG22 1 1 
        4  4900 1 1 56 THR HG23 H   1.716 -11.973   8.080 1.00 . A A . 56 THR HG23 1 1 
        4  4901 1 1 56 THR N    N  -0.412 -13.995   6.504 1.00 . A A . 56 THR N    1 1 
        4  4902 1 1 56 THR O    O   2.713 -15.511   5.456 1.00 . A A . 56 THR O    1 1 
        4  4903 1 1 56 THR OG1  O   1.400 -15.296   8.372 1.00 . A A . 56 THR OG1  1 1 
        4  4904 1 1 57 TYR C    C  -0.002 -17.036   2.636 1.00 . A A . 57 TYR C    1 1 
        4  4905 1 1 57 TYR CA   C   0.965 -16.909   3.827 1.00 . A A . 57 TYR CA   1 1 
        4  4906 1 1 57 TYR CB   C   0.987 -18.220   4.636 1.00 . A A . 57 TYR CB   1 1 
        4  4907 1 1 57 TYR CD1  C  -0.824 -18.051   6.407 1.00 . A A . 57 TYR CD1  1 1 
        4  4908 1 1 57 TYR CD2  C  -1.165 -19.567   4.596 1.00 . A A . 57 TYR CD2  1 1 
        4  4909 1 1 57 TYR CE1  C  -2.046 -18.414   6.942 1.00 . A A . 57 TYR CE1  1 1 
        4  4910 1 1 57 TYR CE2  C  -2.386 -19.934   5.128 1.00 . A A . 57 TYR CE2  1 1 
        4  4911 1 1 57 TYR CG   C  -0.361 -18.619   5.224 1.00 . A A . 57 TYR CG   1 1 
        4  4912 1 1 57 TYR CZ   C  -2.822 -19.354   6.299 1.00 . A A . 57 TYR CZ   1 1 
        4  4913 1 1 57 TYR H    H  -0.315 -15.479   4.743 1.00 . A A . 57 TYR H    1 1 
        4  4914 1 1 57 TYR HA   H   1.957 -16.725   3.439 1.00 . A A . 57 TYR HA   1 1 
        4  4915 1 1 57 TYR HB2  H   1.319 -19.023   3.996 1.00 . A A . 57 TYR HB2  1 1 
        4  4916 1 1 57 TYR HB3  H   1.686 -18.113   5.455 1.00 . A A . 57 TYR HB3  1 1 
        4  4917 1 1 57 TYR HD1  H  -0.215 -17.314   6.911 1.00 . A A . 57 TYR HD1  1 1 
        4  4918 1 1 57 TYR HD2  H  -0.823 -20.020   3.676 1.00 . A A . 57 TYR HD2  1 1 
        4  4919 1 1 57 TYR HE1  H  -2.389 -17.956   7.859 1.00 . A A . 57 TYR HE1  1 1 
        4  4920 1 1 57 TYR HE2  H  -2.995 -20.673   4.625 1.00 . A A . 57 TYR HE2  1 1 
        4  4921 1 1 57 TYR HH   H  -4.147 -20.679   6.743 1.00 . A A . 57 TYR HH   1 1 
        4  4922 1 1 57 TYR N    N   0.614 -15.784   4.703 1.00 . A A . 57 TYR N    1 1 
        4  4923 1 1 57 TYR O    O  -0.088 -18.095   2.010 1.00 . A A . 57 TYR O    1 1 
        4  4924 1 1 57 TYR OH   O  -4.038 -19.721   6.831 1.00 . A A . 57 TYR OH   1 1 
        4  4925 1 1 58 TYR C    C  -1.097 -16.294  -0.131 1.00 . A A . 58 TYR C    1 1 
        4  4926 1 1 58 TYR CA   C  -1.724 -16.006   1.245 1.00 . A A . 58 TYR CA   1 1 
        4  4927 1 1 58 TYR CB   C  -2.542 -14.704   1.194 1.00 . A A . 58 TYR CB   1 1 
        4  4928 1 1 58 TYR CD1  C  -4.776 -15.760   0.667 1.00 . A A . 58 TYR CD1  1 1 
        4  4929 1 1 58 TYR CD2  C  -4.002 -14.019  -0.769 1.00 . A A . 58 TYR CD2  1 1 
        4  4930 1 1 58 TYR CE1  C  -5.917 -15.893  -0.098 1.00 . A A . 58 TYR CE1  1 1 
        4  4931 1 1 58 TYR CE2  C  -5.141 -14.150  -1.543 1.00 . A A . 58 TYR CE2  1 1 
        4  4932 1 1 58 TYR CG   C  -3.799 -14.822   0.349 1.00 . A A . 58 TYR CG   1 1 
        4  4933 1 1 58 TYR CZ   C  -6.094 -15.089  -1.203 1.00 . A A . 58 TYR CZ   1 1 
        4  4934 1 1 58 TYR H    H  -0.545 -15.109   2.777 1.00 . A A . 58 TYR H    1 1 
        4  4935 1 1 58 TYR HA   H  -2.393 -16.821   1.486 1.00 . A A . 58 TYR HA   1 1 
        4  4936 1 1 58 TYR HB2  H  -2.842 -14.435   2.197 1.00 . A A . 58 TYR HB2  1 1 
        4  4937 1 1 58 TYR HB3  H  -1.932 -13.914   0.782 1.00 . A A . 58 TYR HB3  1 1 
        4  4938 1 1 58 TYR HD1  H  -4.637 -16.390   1.534 1.00 . A A . 58 TYR HD1  1 1 
        4  4939 1 1 58 TYR HD2  H  -3.254 -13.284  -1.032 1.00 . A A . 58 TYR HD2  1 1 
        4  4940 1 1 58 TYR HE1  H  -6.663 -16.627   0.168 1.00 . A A . 58 TYR HE1  1 1 
        4  4941 1 1 58 TYR HE2  H  -5.280 -13.518  -2.408 1.00 . A A . 58 TYR HE2  1 1 
        4  4942 1 1 58 TYR HH   H  -6.972 -15.218  -2.911 1.00 . A A . 58 TYR HH   1 1 
        4  4943 1 1 58 TYR N    N  -0.708 -15.953   2.304 1.00 . A A . 58 TYR N    1 1 
        4  4944 1 1 58 TYR O    O  -1.429 -17.293  -0.770 1.00 . A A . 58 TYR O    1 1 
        4  4945 1 1 58 TYR OH   O  -7.221 -15.235  -1.979 1.00 . A A . 58 TYR OH   1 1 
        4  4946 1 1 59 ALA C    C  -0.352 -15.417  -3.121 1.00 . A A . 59 ALA C    1 1 
        4  4947 1 1 59 ALA CA   C   0.528 -15.578  -1.858 1.00 . A A . 59 ALA CA   1 1 
        4  4948 1 1 59 ALA CB   C   1.245 -16.928  -1.875 1.00 . A A . 59 ALA CB   1 1 
        4  4949 1 1 59 ALA H    H  -0.036 -14.602  -0.055 1.00 . A A . 59 ALA H    1 1 
        4  4950 1 1 59 ALA HA   H   1.290 -14.810  -1.885 1.00 . A A . 59 ALA HA   1 1 
        4  4951 1 1 59 ALA HB1  H   1.859 -17.000  -2.761 1.00 . A A . 59 ALA HB1  1 1 
        4  4952 1 1 59 ALA HB2  H   0.515 -17.725  -1.875 1.00 . A A . 59 ALA HB2  1 1 
        4  4953 1 1 59 ALA HB3  H   1.870 -17.016  -0.998 1.00 . A A . 59 ALA HB3  1 1 
        4  4954 1 1 59 ALA N    N  -0.212 -15.401  -0.590 1.00 . A A . 59 ALA N    1 1 
        4  4955 1 1 59 ALA O    O   0.137 -14.992  -4.170 1.00 . A A . 59 ALA O    1 1 
        4  4956 1 1 60 ASN C    C  -2.915 -14.212  -4.539 1.00 . A A . 60 ASN C    1 1 
        4  4957 1 1 60 ASN CA   C  -2.578 -15.672  -4.153 1.00 . A A . 60 ASN CA   1 1 
        4  4958 1 1 60 ASN CB   C  -3.862 -16.442  -3.796 1.00 . A A . 60 ASN CB   1 1 
        4  4959 1 1 60 ASN CG   C  -4.914 -16.440  -4.897 1.00 . A A . 60 ASN CG   1 1 
        4  4960 1 1 60 ASN H    H  -1.969 -16.091  -2.165 1.00 . A A . 60 ASN H    1 1 
        4  4961 1 1 60 ASN HA   H  -2.111 -16.151  -5.002 1.00 . A A . 60 ASN HA   1 1 
        4  4962 1 1 60 ASN HB2  H  -3.604 -17.469  -3.585 1.00 . A A . 60 ASN HB2  1 1 
        4  4963 1 1 60 ASN HB3  H  -4.296 -16.002  -2.910 1.00 . A A . 60 ASN HB3  1 1 
        4  4964 1 1 60 ASN HD21 H  -3.535 -16.671  -6.301 1.00 . A A . 60 ASN HD21 1 1 
        4  4965 1 1 60 ASN HD22 H  -5.168 -16.559  -6.853 1.00 . A A . 60 ASN HD22 1 1 
        4  4966 1 1 60 ASN N    N  -1.639 -15.753  -3.020 1.00 . A A . 60 ASN N    1 1 
        4  4967 1 1 60 ASN ND2  N  -4.496 -16.573  -6.139 1.00 . A A . 60 ASN ND2  1 1 
        4  4968 1 1 60 ASN O    O  -3.709 -13.967  -5.450 1.00 . A A . 60 ASN O    1 1 
        4  4969 1 1 60 ASN OD1  O  -6.106 -16.352  -4.623 1.00 . A A . 60 ASN OD1  1 1 
        4  4970 1 1 61 VAL C    C  -2.200 -11.579  -5.673 1.00 . A A . 61 VAL C    1 1 
        4  4971 1 1 61 VAL CA   C  -2.503 -11.825  -4.184 1.00 . A A . 61 VAL CA   1 1 
        4  4972 1 1 61 VAL CB   C  -1.601 -10.907  -3.317 1.00 . A A . 61 VAL CB   1 1 
        4  4973 1 1 61 VAL CG1  C  -1.856  -9.433  -3.634 1.00 . A A . 61 VAL CG1  1 1 
        4  4974 1 1 61 VAL CG2  C  -1.804 -11.189  -1.830 1.00 . A A . 61 VAL CG2  1 1 
        4  4975 1 1 61 VAL H    H  -1.733 -13.482  -3.098 1.00 . A A . 61 VAL H    1 1 
        4  4976 1 1 61 VAL HA   H  -3.537 -11.573  -3.989 1.00 . A A . 61 VAL HA   1 1 
        4  4977 1 1 61 VAL HB   H  -0.569 -11.126  -3.562 1.00 . A A . 61 VAL HB   1 1 
        4  4978 1 1 61 VAL HG11 H  -1.624  -9.241  -4.672 1.00 . A A . 61 VAL HG11 1 1 
        4  4979 1 1 61 VAL HG12 H  -1.229  -8.814  -3.008 1.00 . A A . 61 VAL HG12 1 1 
        4  4980 1 1 61 VAL HG13 H  -2.894  -9.195  -3.449 1.00 . A A . 61 VAL HG13 1 1 
        4  4981 1 1 61 VAL HG21 H  -2.837 -11.018  -1.565 1.00 . A A . 61 VAL HG21 1 1 
        4  4982 1 1 61 VAL HG22 H  -1.171 -10.531  -1.250 1.00 . A A . 61 VAL HG22 1 1 
        4  4983 1 1 61 VAL HG23 H  -1.542 -12.217  -1.618 1.00 . A A . 61 VAL HG23 1 1 
        4  4984 1 1 61 VAL N    N  -2.314 -13.242  -3.847 1.00 . A A . 61 VAL N    1 1 
        4  4985 1 1 61 VAL O    O  -1.045 -11.611  -6.096 1.00 . A A . 61 VAL O    1 1 
        4  4986 1 1 62 SER C    C  -2.636  -9.869  -8.403 1.00 . A A . 62 SER C    1 1 
        4  4987 1 1 62 SER CA   C  -3.113 -11.257  -7.929 1.00 . A A . 62 SER CA   1 1 
        4  4988 1 1 62 SER CB   C  -4.444 -11.634  -8.590 1.00 . A A . 62 SER CB   1 1 
        4  4989 1 1 62 SER H    H  -4.129 -11.231  -6.057 1.00 . A A . 62 SER H    1 1 
        4  4990 1 1 62 SER HA   H  -2.371 -11.983  -8.228 1.00 . A A . 62 SER HA   1 1 
        4  4991 1 1 62 SER HB2  H  -5.220 -10.961  -8.252 1.00 . A A . 62 SER HB2  1 1 
        4  4992 1 1 62 SER HB3  H  -4.345 -11.562  -9.662 1.00 . A A . 62 SER HB3  1 1 
        4  4993 1 1 62 SER HG   H  -4.589 -13.142  -7.330 1.00 . A A . 62 SER HG   1 1 
        4  4994 1 1 62 SER N    N  -3.245 -11.345  -6.463 1.00 . A A . 62 SER N    1 1 
        4  4995 1 1 62 SER O    O  -2.256  -9.021  -7.594 1.00 . A A . 62 SER O    1 1 
        4  4996 1 1 62 SER OG   O  -4.815 -12.965  -8.254 1.00 . A A . 62 SER OG   1 1 
        4  4997 1 1 63 ALA C    C  -3.011  -7.249 -10.376 1.00 . A A . 63 ALA C    1 1 
        4  4998 1 1 63 ALA CA   C  -2.046  -8.452 -10.327 1.00 . A A . 63 ALA CA   1 1 
        4  4999 1 1 63 ALA CB   C  -1.552  -8.776 -11.732 1.00 . A A . 63 ALA CB   1 1 
        4  5000 1 1 63 ALA H    H  -3.036 -10.335 -10.311 1.00 . A A . 63 ALA H    1 1 
        4  5001 1 1 63 ALA HA   H  -1.183  -8.176  -9.735 1.00 . A A . 63 ALA HA   1 1 
        4  5002 1 1 63 ALA HB1  H  -1.007  -7.930 -12.131 1.00 . A A . 63 ALA HB1  1 1 
        4  5003 1 1 63 ALA HB2  H  -2.396  -8.991 -12.370 1.00 . A A . 63 ALA HB2  1 1 
        4  5004 1 1 63 ALA HB3  H  -0.901  -9.637 -11.698 1.00 . A A . 63 ALA HB3  1 1 
        4  5005 1 1 63 ALA N    N  -2.635  -9.658  -9.721 1.00 . A A . 63 ALA N    1 1 
        4  5006 1 1 63 ALA O    O  -2.650  -6.141  -9.970 1.00 . A A . 63 ALA O    1 1 
        4  5007 1 1 64 ALA C    C  -5.385  -5.511  -9.831 1.00 . A A . 64 ALA C    1 1 
        4  5008 1 1 64 ALA CA   C  -5.207  -6.382 -11.085 1.00 . A A . 64 ALA CA   1 1 
        4  5009 1 1 64 ALA CB   C  -6.552  -6.958 -11.515 1.00 . A A . 64 ALA CB   1 1 
        4  5010 1 1 64 ALA H    H  -4.475  -8.381 -11.142 1.00 . A A . 64 ALA H    1 1 
        4  5011 1 1 64 ALA HA   H  -4.843  -5.757 -11.889 1.00 . A A . 64 ALA HA   1 1 
        4  5012 1 1 64 ALA HB1  H  -6.417  -7.576 -12.392 1.00 . A A . 64 ALA HB1  1 1 
        4  5013 1 1 64 ALA HB2  H  -7.234  -6.152 -11.747 1.00 . A A . 64 ALA HB2  1 1 
        4  5014 1 1 64 ALA HB3  H  -6.963  -7.556 -10.714 1.00 . A A . 64 ALA HB3  1 1 
        4  5015 1 1 64 ALA N    N  -4.226  -7.467 -10.886 1.00 . A A . 64 ALA N    1 1 
        4  5016 1 1 64 ALA O    O  -5.139  -4.301  -9.857 1.00 . A A . 64 ALA O    1 1 
        4  5017 1 1 65 LYS C    C  -4.746  -4.800  -6.873 1.00 . A A . 65 LYS C    1 1 
        4  5018 1 1 65 LYS CA   C  -6.026  -5.424  -7.467 1.00 . A A . 65 LYS CA   1 1 
        4  5019 1 1 65 LYS CB   C  -6.714  -6.361  -6.451 1.00 . A A . 65 LYS CB   1 1 
        4  5020 1 1 65 LYS CD   C  -4.802  -7.364  -5.048 1.00 . A A . 65 LYS CD   1 1 
        4  5021 1 1 65 LYS CE   C  -5.334  -6.952  -3.669 1.00 . A A . 65 LYS CE   1 1 
        4  5022 1 1 65 LYS CG   C  -5.921  -7.623  -6.070 1.00 . A A . 65 LYS CG   1 1 
        4  5023 1 1 65 LYS H    H  -5.907  -7.114  -8.755 1.00 . A A . 65 LYS H    1 1 
        4  5024 1 1 65 LYS HA   H  -6.710  -4.618  -7.696 1.00 . A A . 65 LYS HA   1 1 
        4  5025 1 1 65 LYS HB2  H  -6.911  -5.804  -5.548 1.00 . A A . 65 LYS HB2  1 1 
        4  5026 1 1 65 LYS HB3  H  -7.661  -6.676  -6.868 1.00 . A A . 65 LYS HB3  1 1 
        4  5027 1 1 65 LYS HD2  H  -4.224  -8.269  -4.936 1.00 . A A . 65 LYS HD2  1 1 
        4  5028 1 1 65 LYS HD3  H  -4.161  -6.579  -5.424 1.00 . A A . 65 LYS HD3  1 1 
        4  5029 1 1 65 LYS HE2  H  -6.023  -7.709  -3.325 1.00 . A A . 65 LYS HE2  1 1 
        4  5030 1 1 65 LYS HE3  H  -4.503  -6.890  -2.980 1.00 . A A . 65 LYS HE3  1 1 
        4  5031 1 1 65 LYS HG2  H  -6.606  -8.346  -5.649 1.00 . A A . 65 LYS HG2  1 1 
        4  5032 1 1 65 LYS HG3  H  -5.484  -8.036  -6.969 1.00 . A A . 65 LYS HG3  1 1 
        4  5033 1 1 65 LYS HZ1  H  -6.223  -5.312  -2.720 1.00 . A A . 65 LYS HZ1  1 1 
        4  5034 1 1 65 LYS HZ2  H  -6.949  -5.728  -4.188 1.00 . A A . 65 LYS HZ2  1 1 
        4  5035 1 1 65 LYS HZ3  H  -5.460  -4.924  -4.180 1.00 . A A . 65 LYS HZ3  1 1 
        4  5036 1 1 65 LYS N    N  -5.773  -6.142  -8.723 1.00 . A A . 65 LYS N    1 1 
        4  5037 1 1 65 LYS NZ   N  -6.041  -5.638  -3.689 1.00 . A A . 65 LYS NZ   1 1 
        4  5038 1 1 65 LYS O    O  -4.784  -4.201  -5.793 1.00 . A A . 65 LYS O    1 1 
        4  5039 1 1 66 CYS C    C  -2.047  -3.147  -8.119 1.00 . A A . 66 CYS C    1 1 
        4  5040 1 1 66 CYS CA   C  -2.347  -4.337  -7.191 1.00 . A A . 66 CYS CA   1 1 
        4  5041 1 1 66 CYS CB   C  -1.192  -5.346  -7.260 1.00 . A A . 66 CYS CB   1 1 
        4  5042 1 1 66 CYS H    H  -3.630  -5.584  -8.334 1.00 . A A . 66 CYS H    1 1 
        4  5043 1 1 66 CYS HA   H  -2.435  -3.972  -6.176 1.00 . A A . 66 CYS HA   1 1 
        4  5044 1 1 66 CYS HB2  H  -1.359  -6.120  -6.526 1.00 . A A . 66 CYS HB2  1 1 
        4  5045 1 1 66 CYS HB3  H  -1.173  -5.794  -8.244 1.00 . A A . 66 CYS HB3  1 1 
        4  5046 1 1 66 CYS HG   H   0.891  -4.131  -8.083 1.00 . A A . 66 CYS HG   1 1 
        4  5047 1 1 66 CYS N    N  -3.616  -4.985  -7.558 1.00 . A A . 66 CYS N    1 1 
        4  5048 1 1 66 CYS O    O  -1.425  -2.161  -7.710 1.00 . A A . 66 CYS O    1 1 
        4  5049 1 1 66 CYS SG   S   0.442  -4.632  -6.943 1.00 . A A . 66 CYS SG   1 1 
        4  5050 1 1 67 GLN C    C  -3.152  -0.947 -10.073 1.00 . A A . 67 GLN C    1 1 
        4  5051 1 1 67 GLN CA   C  -2.271  -2.175 -10.356 1.00 . A A . 67 GLN CA   1 1 
        4  5052 1 1 67 GLN CB   C  -2.515  -2.689 -11.781 1.00 . A A . 67 GLN CB   1 1 
        4  5053 1 1 67 GLN CD   C  -1.623  -4.062 -13.725 1.00 . A A . 67 GLN CD   1 1 
        4  5054 1 1 67 GLN CG   C  -1.510  -3.746 -12.241 1.00 . A A . 67 GLN CG   1 1 
        4  5055 1 1 67 GLN H    H  -2.986  -4.047  -9.644 1.00 . A A . 67 GLN H    1 1 
        4  5056 1 1 67 GLN HA   H  -1.235  -1.874 -10.274 1.00 . A A . 67 GLN HA   1 1 
        4  5057 1 1 67 GLN HB2  H  -3.505  -3.120 -11.830 1.00 . A A . 67 GLN HB2  1 1 
        4  5058 1 1 67 GLN HB3  H  -2.464  -1.854 -12.464 1.00 . A A . 67 GLN HB3  1 1 
        4  5059 1 1 67 GLN HE21 H  -0.952  -5.902 -13.432 1.00 . A A . 67 GLN HE21 1 1 
        4  5060 1 1 67 GLN HE22 H  -1.344  -5.488 -15.061 1.00 . A A . 67 GLN HE22 1 1 
        4  5061 1 1 67 GLN HG2  H  -0.510  -3.388 -12.041 1.00 . A A . 67 GLN HG2  1 1 
        4  5062 1 1 67 GLN HG3  H  -1.683  -4.653 -11.680 1.00 . A A . 67 GLN HG3  1 1 
        4  5063 1 1 67 GLN N    N  -2.494  -3.242  -9.372 1.00 . A A . 67 GLN N    1 1 
        4  5064 1 1 67 GLN NE2  N  -1.269  -5.271 -14.111 1.00 . A A . 67 GLN NE2  1 1 
        4  5065 1 1 67 GLN O    O  -2.666   0.185 -10.098 1.00 . A A . 67 GLN O    1 1 
        4  5066 1 1 67 GLN OE1  O  -2.006  -3.213 -14.525 1.00 . A A . 67 GLN OE1  1 1 
        4  5067 1 1 68 GLU C    C  -4.869   0.623  -8.138 1.00 . A A . 68 GLU C    1 1 
        4  5068 1 1 68 GLU CA   C  -5.349  -0.071  -9.426 1.00 . A A . 68 GLU CA   1 1 
        4  5069 1 1 68 GLU CB   C  -6.791  -0.581  -9.250 1.00 . A A . 68 GLU CB   1 1 
        4  5070 1 1 68 GLU CD   C  -7.022  -1.951 -11.403 1.00 . A A . 68 GLU CD   1 1 
        4  5071 1 1 68 GLU CG   C  -7.553  -0.795 -10.562 1.00 . A A . 68 GLU CG   1 1 
        4  5072 1 1 68 GLU H    H  -4.802  -2.080  -9.896 1.00 . A A . 68 GLU H    1 1 
        4  5073 1 1 68 GLU HA   H  -5.333   0.655 -10.228 1.00 . A A . 68 GLU HA   1 1 
        4  5074 1 1 68 GLU HB2  H  -6.764  -1.523  -8.720 1.00 . A A . 68 GLU HB2  1 1 
        4  5075 1 1 68 GLU HB3  H  -7.343   0.135  -8.657 1.00 . A A . 68 GLU HB3  1 1 
        4  5076 1 1 68 GLU HG2  H  -8.590  -0.992 -10.331 1.00 . A A . 68 GLU HG2  1 1 
        4  5077 1 1 68 GLU HG3  H  -7.489   0.113 -11.146 1.00 . A A . 68 GLU HG3  1 1 
        4  5078 1 1 68 GLU N    N  -4.443  -1.169  -9.812 1.00 . A A . 68 GLU N    1 1 
        4  5079 1 1 68 GLU O    O  -5.003   1.839  -7.984 1.00 . A A . 68 GLU O    1 1 
        4  5080 1 1 68 GLU OE1  O  -6.058  -1.743 -12.177 1.00 . A A . 68 GLU OE1  1 1 
        4  5081 1 1 68 GLU OE2  O  -7.577  -3.066 -11.304 1.00 . A A . 68 GLU OE2  1 1 
        4  5082 1 1 69 PHE C    C  -2.502   1.267  -6.301 1.00 . A A . 69 PHE C    1 1 
        4  5083 1 1 69 PHE CA   C  -3.732   0.398  -5.985 1.00 . A A . 69 PHE CA   1 1 
        4  5084 1 1 69 PHE CB   C  -3.350  -0.736  -5.022 1.00 . A A . 69 PHE CB   1 1 
        4  5085 1 1 69 PHE CD1  C  -3.629   0.202  -2.701 1.00 . A A . 69 PHE CD1  1 1 
        4  5086 1 1 69 PHE CD2  C  -1.418  -0.272  -3.467 1.00 . A A . 69 PHE CD2  1 1 
        4  5087 1 1 69 PHE CE1  C  -3.119   0.638  -1.492 1.00 . A A . 69 PHE CE1  1 1 
        4  5088 1 1 69 PHE CE2  C  -0.905   0.164  -2.261 1.00 . A A . 69 PHE CE2  1 1 
        4  5089 1 1 69 PHE CG   C  -2.787  -0.260  -3.704 1.00 . A A . 69 PHE CG   1 1 
        4  5090 1 1 69 PHE CZ   C  -1.755   0.621  -1.273 1.00 . A A . 69 PHE CZ   1 1 
        4  5091 1 1 69 PHE H    H  -4.279  -1.123  -7.366 1.00 . A A . 69 PHE H    1 1 
        4  5092 1 1 69 PHE HA   H  -4.484   1.018  -5.519 1.00 . A A . 69 PHE HA   1 1 
        4  5093 1 1 69 PHE HB2  H  -4.231  -1.326  -4.812 1.00 . A A . 69 PHE HB2  1 1 
        4  5094 1 1 69 PHE HB3  H  -2.610  -1.367  -5.495 1.00 . A A . 69 PHE HB3  1 1 
        4  5095 1 1 69 PHE HD1  H  -4.697   0.217  -2.872 1.00 . A A . 69 PHE HD1  1 1 
        4  5096 1 1 69 PHE HD2  H  -0.750  -0.631  -4.237 1.00 . A A . 69 PHE HD2  1 1 
        4  5097 1 1 69 PHE HE1  H  -3.785   0.993  -0.721 1.00 . A A . 69 PHE HE1  1 1 
        4  5098 1 1 69 PHE HE2  H   0.160   0.150  -2.091 1.00 . A A . 69 PHE HE2  1 1 
        4  5099 1 1 69 PHE HZ   H  -1.354   0.962  -0.330 1.00 . A A . 69 PHE HZ   1 1 
        4  5100 1 1 69 PHE N    N  -4.306  -0.155  -7.216 1.00 . A A . 69 PHE N    1 1 
        4  5101 1 1 69 PHE O    O  -2.404   2.418  -5.866 1.00 . A A . 69 PHE O    1 1 
        4  5102 1 1 70 GLY C    C  -0.708   2.696  -8.286 1.00 . A A . 70 GLY C    1 1 
        4  5103 1 1 70 GLY CA   C  -0.384   1.435  -7.489 1.00 . A A . 70 GLY CA   1 1 
        4  5104 1 1 70 GLY H    H  -1.701  -0.222  -7.370 1.00 . A A . 70 GLY H    1 1 
        4  5105 1 1 70 GLY HA2  H   0.181   1.711  -6.610 1.00 . A A . 70 GLY HA2  1 1 
        4  5106 1 1 70 GLY HA3  H   0.223   0.785  -8.102 1.00 . A A . 70 GLY HA3  1 1 
        4  5107 1 1 70 GLY N    N  -1.575   0.703  -7.076 1.00 . A A . 70 GLY N    1 1 
        4  5108 1 1 70 GLY O    O   0.005   3.695  -8.192 1.00 . A A . 70 GLY O    1 1 
        4  5109 1 1 71 ARG C    C  -2.433   5.023  -8.937 1.00 . A A . 71 ARG C    1 1 
        4  5110 1 1 71 ARG CA   C  -2.259   3.799  -9.855 1.00 . A A . 71 ARG CA   1 1 
        4  5111 1 1 71 ARG CB   C  -3.599   3.440 -10.542 1.00 . A A . 71 ARG CB   1 1 
        4  5112 1 1 71 ARG CD   C  -4.051   5.652 -11.765 1.00 . A A . 71 ARG CD   1 1 
        4  5113 1 1 71 ARG CG   C  -3.874   4.137 -11.884 1.00 . A A . 71 ARG CG   1 1 
        4  5114 1 1 71 ARG CZ   C  -2.657   7.624 -12.155 1.00 . A A . 71 ARG CZ   1 1 
        4  5115 1 1 71 ARG H    H  -2.281   1.797  -9.138 1.00 . A A . 71 ARG H    1 1 
        4  5116 1 1 71 ARG HA   H  -1.517   4.022 -10.608 1.00 . A A . 71 ARG HA   1 1 
        4  5117 1 1 71 ARG HB2  H  -3.615   2.376 -10.720 1.00 . A A . 71 ARG HB2  1 1 
        4  5118 1 1 71 ARG HB3  H  -4.409   3.684  -9.867 1.00 . A A . 71 ARG HB3  1 1 
        4  5119 1 1 71 ARG HD2  H  -4.675   5.991 -12.581 1.00 . A A . 71 ARG HD2  1 1 
        4  5120 1 1 71 ARG HD3  H  -4.543   5.871 -10.828 1.00 . A A . 71 ARG HD3  1 1 
        4  5121 1 1 71 ARG HE   H  -1.969   5.876 -11.579 1.00 . A A . 71 ARG HE   1 1 
        4  5122 1 1 71 ARG HG2  H  -3.046   3.941 -12.548 1.00 . A A . 71 ARG HG2  1 1 
        4  5123 1 1 71 ARG HG3  H  -4.774   3.714 -12.310 1.00 . A A . 71 ARG HG3  1 1 
        4  5124 1 1 71 ARG HH11 H  -4.606   7.907 -12.453 1.00 . A A . 71 ARG HH11 1 1 
        4  5125 1 1 71 ARG HH12 H  -3.599   9.283 -12.724 1.00 . A A . 71 ARG HH12 1 1 
        4  5126 1 1 71 ARG HH21 H  -0.678   7.642 -11.960 1.00 . A A . 71 ARG HH21 1 1 
        4  5127 1 1 71 ARG HH22 H  -1.400   9.133 -12.464 1.00 . A A . 71 ARG HH22 1 1 
        4  5128 1 1 71 ARG N    N  -1.788   2.643  -9.073 1.00 . A A . 71 ARG N    1 1 
        4  5129 1 1 71 ARG NE   N  -2.777   6.371 -11.811 1.00 . A A . 71 ARG NE   1 1 
        4  5130 1 1 71 ARG NH1  N  -3.700   8.325 -12.470 1.00 . A A . 71 ARG NH1  1 1 
        4  5131 1 1 71 ARG NH2  N  -1.490   8.176 -12.193 1.00 . A A . 71 ARG NH2  1 1 
        4  5132 1 1 71 ARG O    O  -1.890   6.098  -9.197 1.00 . A A . 71 ARG O    1 1 
        4  5133 1 1 72 TRP C    C  -2.044   6.260  -6.185 1.00 . A A . 72 TRP C    1 1 
        4  5134 1 1 72 TRP CA   C  -3.382   5.854  -6.831 1.00 . A A . 72 TRP CA   1 1 
        4  5135 1 1 72 TRP CB   C  -4.359   5.315  -5.768 1.00 . A A . 72 TRP CB   1 1 
        4  5136 1 1 72 TRP CD1  C  -5.012   7.329  -4.303 1.00 . A A . 72 TRP CD1  1 1 
        4  5137 1 1 72 TRP CD2  C  -3.843   5.745  -3.232 1.00 . A A . 72 TRP CD2  1 1 
        4  5138 1 1 72 TRP CE2  C  -4.135   6.778  -2.324 1.00 . A A . 72 TRP CE2  1 1 
        4  5139 1 1 72 TRP CE3  C  -3.117   4.635  -2.783 1.00 . A A . 72 TRP CE3  1 1 
        4  5140 1 1 72 TRP CG   C  -4.410   6.118  -4.495 1.00 . A A . 72 TRP CG   1 1 
        4  5141 1 1 72 TRP CH2  C  -3.017   5.640  -0.581 1.00 . A A . 72 TRP CH2  1 1 
        4  5142 1 1 72 TRP CZ2  C  -3.724   6.736  -0.992 1.00 . A A . 72 TRP CZ2  1 1 
        4  5143 1 1 72 TRP CZ3  C  -2.711   4.595  -1.462 1.00 . A A . 72 TRP CZ3  1 1 
        4  5144 1 1 72 TRP H    H  -3.630   3.960  -7.747 1.00 . A A . 72 TRP H    1 1 
        4  5145 1 1 72 TRP HA   H  -3.820   6.721  -7.304 1.00 . A A . 72 TRP HA   1 1 
        4  5146 1 1 72 TRP HB2  H  -5.356   5.298  -6.183 1.00 . A A . 72 TRP HB2  1 1 
        4  5147 1 1 72 TRP HB3  H  -4.071   4.305  -5.510 1.00 . A A . 72 TRP HB3  1 1 
        4  5148 1 1 72 TRP HD1  H  -5.533   7.881  -5.073 1.00 . A A . 72 TRP HD1  1 1 
        4  5149 1 1 72 TRP HE1  H  -5.183   8.574  -2.615 1.00 . A A . 72 TRP HE1  1 1 
        4  5150 1 1 72 TRP HE3  H  -2.871   3.819  -3.449 1.00 . A A . 72 TRP HE3  1 1 
        4  5151 1 1 72 TRP HH2  H  -2.680   5.567   0.445 1.00 . A A . 72 TRP HH2  1 1 
        4  5152 1 1 72 TRP HZ2  H  -3.953   7.532  -0.299 1.00 . A A . 72 TRP HZ2  1 1 
        4  5153 1 1 72 TRP HZ3  H  -2.150   3.746  -1.095 1.00 . A A . 72 TRP HZ3  1 1 
        4  5154 1 1 72 TRP N    N  -3.187   4.828  -7.859 1.00 . A A . 72 TRP N    1 1 
        4  5155 1 1 72 TRP NE1  N  -4.845   7.735  -3.000 1.00 . A A . 72 TRP NE1  1 1 
        4  5156 1 1 72 TRP O    O  -1.691   7.439  -6.146 1.00 . A A . 72 TRP O    1 1 
        4  5157 1 1 73 TYR C    C   0.960   6.366  -5.773 1.00 . A A . 73 TYR C    1 1 
        4  5158 1 1 73 TYR CA   C  -0.039   5.492  -4.981 1.00 . A A . 73 TYR CA   1 1 
        4  5159 1 1 73 TYR CB   C   0.602   4.136  -4.642 1.00 . A A . 73 TYR CB   1 1 
        4  5160 1 1 73 TYR CD1  C   1.885   4.331  -2.465 1.00 . A A . 73 TYR CD1  1 1 
        4  5161 1 1 73 TYR CD2  C   3.133   4.234  -4.498 1.00 . A A . 73 TYR CD2  1 1 
        4  5162 1 1 73 TYR CE1  C   3.058   4.418  -1.741 1.00 . A A . 73 TYR CE1  1 1 
        4  5163 1 1 73 TYR CE2  C   4.312   4.321  -3.781 1.00 . A A . 73 TYR CE2  1 1 
        4  5164 1 1 73 TYR CG   C   1.899   4.236  -3.854 1.00 . A A . 73 TYR CG   1 1 
        4  5165 1 1 73 TYR CZ   C   4.269   4.413  -2.403 1.00 . A A . 73 TYR CZ   1 1 
        4  5166 1 1 73 TYR H    H  -1.609   4.344  -5.834 1.00 . A A . 73 TYR H    1 1 
        4  5167 1 1 73 TYR HA   H  -0.279   5.999  -4.057 1.00 . A A . 73 TYR HA   1 1 
        4  5168 1 1 73 TYR HB2  H  -0.096   3.554  -4.058 1.00 . A A . 73 TYR HB2  1 1 
        4  5169 1 1 73 TYR HB3  H   0.812   3.607  -5.564 1.00 . A A . 73 TYR HB3  1 1 
        4  5170 1 1 73 TYR HD1  H   0.934   4.336  -1.949 1.00 . A A . 73 TYR HD1  1 1 
        4  5171 1 1 73 TYR HD2  H   3.164   4.160  -5.577 1.00 . A A . 73 TYR HD2  1 1 
        4  5172 1 1 73 TYR HE1  H   3.025   4.489  -0.664 1.00 . A A . 73 TYR HE1  1 1 
        4  5173 1 1 73 TYR HE2  H   5.258   4.319  -4.300 1.00 . A A . 73 TYR HE2  1 1 
        4  5174 1 1 73 TYR HH   H   5.399   3.910  -0.929 1.00 . A A . 73 TYR HH   1 1 
        4  5175 1 1 73 TYR N    N  -1.300   5.266  -5.704 1.00 . A A . 73 TYR N    1 1 
        4  5176 1 1 73 TYR O    O   1.527   7.321  -5.235 1.00 . A A . 73 TYR O    1 1 
        4  5177 1 1 73 TYR OH   O   5.439   4.503  -1.687 1.00 . A A . 73 TYR OH   1 1 
        4  5178 1 1 74 LYS C    C   1.861   8.227  -8.042 1.00 . A A . 74 LYS C    1 1 
        4  5179 1 1 74 LYS CA   C   2.158   6.722  -7.886 1.00 . A A . 74 LYS CA   1 1 
        4  5180 1 1 74 LYS CB   C   2.236   6.050  -9.265 1.00 . A A . 74 LYS CB   1 1 
        4  5181 1 1 74 LYS CD   C   2.785   3.941 -10.584 1.00 . A A . 74 LYS CD   1 1 
        4  5182 1 1 74 LYS CE   C   1.360   3.700 -11.073 1.00 . A A . 74 LYS CE   1 1 
        4  5183 1 1 74 LYS CG   C   2.814   4.633  -9.220 1.00 . A A . 74 LYS CG   1 1 
        4  5184 1 1 74 LYS H    H   0.637   5.304  -7.434 1.00 . A A . 74 LYS H    1 1 
        4  5185 1 1 74 LYS HA   H   3.117   6.616  -7.398 1.00 . A A . 74 LYS HA   1 1 
        4  5186 1 1 74 LYS HB2  H   1.241   6.000  -9.685 1.00 . A A . 74 LYS HB2  1 1 
        4  5187 1 1 74 LYS HB3  H   2.860   6.650  -9.913 1.00 . A A . 74 LYS HB3  1 1 
        4  5188 1 1 74 LYS HD2  H   3.300   4.562 -11.306 1.00 . A A . 74 LYS HD2  1 1 
        4  5189 1 1 74 LYS HD3  H   3.294   2.990 -10.503 1.00 . A A . 74 LYS HD3  1 1 
        4  5190 1 1 74 LYS HE2  H   0.817   3.162 -10.309 1.00 . A A . 74 LYS HE2  1 1 
        4  5191 1 1 74 LYS HE3  H   0.885   4.656 -11.245 1.00 . A A . 74 LYS HE3  1 1 
        4  5192 1 1 74 LYS HG2  H   3.839   4.686  -8.881 1.00 . A A . 74 LYS HG2  1 1 
        4  5193 1 1 74 LYS HG3  H   2.238   4.045  -8.519 1.00 . A A . 74 LYS HG3  1 1 
        4  5194 1 1 74 LYS HZ1  H   1.749   1.970 -12.182 1.00 . A A . 74 LYS HZ1  1 1 
        4  5195 1 1 74 LYS HZ2  H   1.855   3.402 -13.080 1.00 . A A . 74 LYS HZ2  1 1 
        4  5196 1 1 74 LYS HZ3  H   0.341   2.786 -12.649 1.00 . A A . 74 LYS HZ3  1 1 
        4  5197 1 1 74 LYS N    N   1.166   6.033  -7.047 1.00 . A A . 74 LYS N    1 1 
        4  5198 1 1 74 LYS NZ   N   1.325   2.909 -12.333 1.00 . A A . 74 LYS NZ   1 1 
        4  5199 1 1 74 LYS O    O   2.777   9.026  -8.254 1.00 . A A . 74 LYS O    1 1 
        4  5200 1 1 75 HIS C    C  -0.051  10.644  -6.652 1.00 . A A . 75 HIS C    1 1 
        4  5201 1 1 75 HIS CA   C   0.196  10.024  -8.041 1.00 . A A . 75 HIS CA   1 1 
        4  5202 1 1 75 HIS CB   C  -1.061  10.170  -8.910 1.00 . A A . 75 HIS CB   1 1 
        4  5203 1 1 75 HIS CD2  C  -1.161  12.633  -9.741 1.00 . A A . 75 HIS CD2  1 1 
        4  5204 1 1 75 HIS CE1  C  -2.833  13.311  -8.501 1.00 . A A . 75 HIS CE1  1 1 
        4  5205 1 1 75 HIS CG   C  -1.570  11.579  -8.995 1.00 . A A . 75 HIS CG   1 1 
        4  5206 1 1 75 HIS H    H  -0.107   7.929  -7.804 1.00 . A A . 75 HIS H    1 1 
        4  5207 1 1 75 HIS HA   H   1.009  10.559  -8.515 1.00 . A A . 75 HIS HA   1 1 
        4  5208 1 1 75 HIS HB2  H  -0.841   9.835  -9.914 1.00 . A A . 75 HIS HB2  1 1 
        4  5209 1 1 75 HIS HB3  H  -1.849   9.557  -8.498 1.00 . A A . 75 HIS HB3  1 1 
        4  5210 1 1 75 HIS HD1  H  -3.139  11.510  -7.591 1.00 . A A . 75 HIS HD1  1 1 
        4  5211 1 1 75 HIS HD2  H  -0.356  12.634 -10.463 1.00 . A A . 75 HIS HD2  1 1 
        4  5212 1 1 75 HIS HE1  H  -3.596  13.930  -8.052 1.00 . A A . 75 HIS HE1  1 1 
        4  5213 1 1 75 HIS HE2  H  -1.791  14.633  -9.660 1.00 . A A . 75 HIS HE2  1 1 
        4  5214 1 1 75 HIS N    N   0.587   8.610  -7.943 1.00 . A A . 75 HIS N    1 1 
        4  5215 1 1 75 HIS ND1  N  -2.618  12.042  -8.232 1.00 . A A . 75 HIS ND1  1 1 
        4  5216 1 1 75 HIS NE2  N  -1.963  13.697  -9.412 1.00 . A A . 75 HIS NE2  1 1 
        4  5217 1 1 75 HIS O    O   0.101  11.854  -6.470 1.00 . A A . 75 HIS O    1 1 
        4  5218 1 1 76 PHE C    C   0.314  11.138  -3.685 1.00 . A A . 76 PHE C    1 1 
        4  5219 1 1 76 PHE CA   C  -0.778  10.262  -4.330 1.00 . A A . 76 PHE CA   1 1 
        4  5220 1 1 76 PHE CB   C  -1.067   9.046  -3.437 1.00 . A A . 76 PHE CB   1 1 
        4  5221 1 1 76 PHE CD1  C  -2.501  10.105  -1.659 1.00 . A A . 76 PHE CD1  1 1 
        4  5222 1 1 76 PHE CD2  C  -0.481   9.022  -0.990 1.00 . A A . 76 PHE CD2  1 1 
        4  5223 1 1 76 PHE CE1  C  -2.767  10.424  -0.343 1.00 . A A . 76 PHE CE1  1 1 
        4  5224 1 1 76 PHE CE2  C  -0.745   9.340   0.327 1.00 . A A . 76 PHE CE2  1 1 
        4  5225 1 1 76 PHE CG   C  -1.355   9.399  -1.999 1.00 . A A . 76 PHE CG   1 1 
        4  5226 1 1 76 PHE CZ   C  -1.888  10.042   0.650 1.00 . A A . 76 PHE CZ   1 1 
        4  5227 1 1 76 PHE H    H  -0.456   8.850  -5.882 1.00 . A A . 76 PHE H    1 1 
        4  5228 1 1 76 PHE HA   H  -1.683  10.848  -4.415 1.00 . A A . 76 PHE HA   1 1 
        4  5229 1 1 76 PHE HB2  H  -1.929   8.522  -3.827 1.00 . A A . 76 PHE HB2  1 1 
        4  5230 1 1 76 PHE HB3  H  -0.213   8.382  -3.458 1.00 . A A . 76 PHE HB3  1 1 
        4  5231 1 1 76 PHE HD1  H  -3.191  10.406  -2.436 1.00 . A A . 76 PHE HD1  1 1 
        4  5232 1 1 76 PHE HD2  H   0.415   8.473  -1.242 1.00 . A A . 76 PHE HD2  1 1 
        4  5233 1 1 76 PHE HE1  H  -3.663  10.976  -0.091 1.00 . A A . 76 PHE HE1  1 1 
        4  5234 1 1 76 PHE HE2  H  -0.056   9.040   1.103 1.00 . A A . 76 PHE HE2  1 1 
        4  5235 1 1 76 PHE HZ   H  -2.097  10.292   1.680 1.00 . A A . 76 PHE HZ   1 1 
        4  5236 1 1 76 PHE N    N  -0.418   9.808  -5.684 1.00 . A A . 76 PHE N    1 1 
        4  5237 1 1 76 PHE O    O   0.022  12.179  -3.097 1.00 . A A . 76 PHE O    1 1 
        4  5238 1 1 77 LYS C    C   3.036  12.744  -3.976 1.00 . A A . 77 LYS C    1 1 
        4  5239 1 1 77 LYS CA   C   2.693  11.455  -3.200 1.00 . A A . 77 LYS CA   1 1 
        4  5240 1 1 77 LYS CB   C   3.942  10.560  -3.126 1.00 . A A . 77 LYS CB   1 1 
        4  5241 1 1 77 LYS CD   C   5.127   8.594  -2.082 1.00 . A A . 77 LYS CD   1 1 
        4  5242 1 1 77 LYS CE   C   5.122   7.569  -0.956 1.00 . A A . 77 LYS CE   1 1 
        4  5243 1 1 77 LYS CG   C   3.839   9.415  -2.121 1.00 . A A . 77 LYS CG   1 1 
        4  5244 1 1 77 LYS H    H   1.750   9.886  -4.290 1.00 . A A . 77 LYS H    1 1 
        4  5245 1 1 77 LYS HA   H   2.406  11.728  -2.193 1.00 . A A . 77 LYS HA   1 1 
        4  5246 1 1 77 LYS HB2  H   4.121  10.136  -4.104 1.00 . A A . 77 LYS HB2  1 1 
        4  5247 1 1 77 LYS HB3  H   4.792  11.170  -2.852 1.00 . A A . 77 LYS HB3  1 1 
        4  5248 1 1 77 LYS HD2  H   5.240   8.074  -3.023 1.00 . A A . 77 LYS HD2  1 1 
        4  5249 1 1 77 LYS HD3  H   5.965   9.265  -1.941 1.00 . A A . 77 LYS HD3  1 1 
        4  5250 1 1 77 LYS HE2  H   5.018   8.086  -0.013 1.00 . A A . 77 LYS HE2  1 1 
        4  5251 1 1 77 LYS HE3  H   4.281   6.904  -1.095 1.00 . A A . 77 LYS HE3  1 1 
        4  5252 1 1 77 LYS HG2  H   3.654   9.826  -1.137 1.00 . A A . 77 LYS HG2  1 1 
        4  5253 1 1 77 LYS HG3  H   3.019   8.770  -2.404 1.00 . A A . 77 LYS HG3  1 1 
        4  5254 1 1 77 LYS HZ1  H   6.408   6.188  -0.068 1.00 . A A . 77 LYS HZ1  1 1 
        4  5255 1 1 77 LYS HZ2  H   7.201   7.396  -0.944 1.00 . A A . 77 LYS HZ2  1 1 
        4  5256 1 1 77 LYS HZ3  H   6.414   6.134  -1.759 1.00 . A A . 77 LYS HZ3  1 1 
        4  5257 1 1 77 LYS N    N   1.570  10.715  -3.799 1.00 . A A . 77 LYS N    1 1 
        4  5258 1 1 77 LYS NZ   N   6.372   6.767  -0.931 1.00 . A A . 77 LYS NZ   1 1 
        4  5259 1 1 77 LYS O    O   3.904  13.506  -3.551 1.00 . A A . 77 LYS O    1 1 
        4  5260 1 1 78 LYS C    C   4.189  14.060  -6.377 1.00 . A A . 78 LYS C    1 1 
        4  5261 1 1 78 LYS CA   C   2.694  14.105  -5.999 1.00 . A A . 78 LYS CA   1 1 
        4  5262 1 1 78 LYS CB   C   2.333  15.449  -5.337 1.00 . A A . 78 LYS CB   1 1 
        4  5263 1 1 78 LYS CD   C   2.048  17.957  -5.595 1.00 . A A . 78 LYS CD   1 1 
        4  5264 1 1 78 LYS CE   C   3.099  18.310  -4.546 1.00 . A A . 78 LYS CE   1 1 
        4  5265 1 1 78 LYS CG   C   2.358  16.638  -6.298 1.00 . A A . 78 LYS CG   1 1 
        4  5266 1 1 78 LYS H    H   1.599  12.406  -5.333 1.00 . A A . 78 LYS H    1 1 
        4  5267 1 1 78 LYS HA   H   2.109  13.989  -6.900 1.00 . A A . 78 LYS HA   1 1 
        4  5268 1 1 78 LYS HB2  H   1.338  15.373  -4.919 1.00 . A A . 78 LYS HB2  1 1 
        4  5269 1 1 78 LYS HB3  H   3.033  15.642  -4.537 1.00 . A A . 78 LYS HB3  1 1 
        4  5270 1 1 78 LYS HD2  H   2.015  18.747  -6.332 1.00 . A A . 78 LYS HD2  1 1 
        4  5271 1 1 78 LYS HD3  H   1.083  17.877  -5.112 1.00 . A A . 78 LYS HD3  1 1 
        4  5272 1 1 78 LYS HE2  H   3.119  17.533  -3.794 1.00 . A A . 78 LYS HE2  1 1 
        4  5273 1 1 78 LYS HE3  H   4.063  18.367  -5.028 1.00 . A A . 78 LYS HE3  1 1 
        4  5274 1 1 78 LYS HG2  H   3.340  16.704  -6.745 1.00 . A A . 78 LYS HG2  1 1 
        4  5275 1 1 78 LYS HG3  H   1.623  16.472  -7.074 1.00 . A A . 78 LYS HG3  1 1 
        4  5276 1 1 78 LYS HZ1  H   3.561  19.837  -3.198 1.00 . A A . 78 LYS HZ1  1 1 
        4  5277 1 1 78 LYS HZ2  H   1.902  19.567  -3.387 1.00 . A A . 78 LYS HZ2  1 1 
        4  5278 1 1 78 LYS HZ3  H   2.770  20.370  -4.594 1.00 . A A . 78 LYS HZ3  1 1 
        4  5279 1 1 78 LYS N    N   2.357  12.984  -5.104 1.00 . A A . 78 LYS N    1 1 
        4  5280 1 1 78 LYS NZ   N   2.813  19.610  -3.885 1.00 . A A . 78 LYS NZ   1 1 
        4  5281 1 1 78 LYS O    O   4.835  15.084  -6.603 1.00 . A A . 78 LYS O    1 1 
        4  5282 1 1 79 THR C    C   6.462  12.613  -8.245 1.00 . A A . 79 THR C    1 1 
        4  5283 1 1 79 THR CA   C   6.150  12.619  -6.735 1.00 . A A . 79 THR CA   1 1 
        4  5284 1 1 79 THR CB   C   6.610  11.284  -6.090 1.00 . A A . 79 THR CB   1 1 
        4  5285 1 1 79 THR CG2  C   5.807  10.102  -6.632 1.00 . A A . 79 THR CG2  1 1 
        4  5286 1 1 79 THR H    H   4.135  12.071  -6.349 1.00 . A A . 79 THR H    1 1 
        4  5287 1 1 79 THR HA   H   6.706  13.424  -6.272 1.00 . A A . 79 THR HA   1 1 
        4  5288 1 1 79 THR HB   H   6.434  11.348  -5.024 1.00 . A A . 79 THR HB   1 1 
        4  5289 1 1 79 THR HG1  H   8.198  11.051  -7.255 1.00 . A A . 79 THR HG1  1 1 
        4  5290 1 1 79 THR HG21 H   4.753  10.265  -6.449 1.00 . A A . 79 THR HG21 1 1 
        4  5291 1 1 79 THR HG22 H   6.121   9.194  -6.137 1.00 . A A . 79 THR HG22 1 1 
        4  5292 1 1 79 THR HG23 H   5.976  10.007  -7.694 1.00 . A A . 79 THR HG23 1 1 
        4  5293 1 1 79 THR N    N   4.720  12.845  -6.469 1.00 . A A . 79 THR N    1 1 
        4  5294 1 1 79 THR O    O   7.290  11.836  -8.723 1.00 . A A . 79 THR O    1 1 
        4  5295 1 1 79 THR OG1  O   8.014  11.060  -6.307 1.00 . A A . 79 THR OG1  1 1 
        4  5296 1 1 80 LYS C    C   6.381  15.061 -10.824 1.00 . A A . 80 LYS C    1 1 
        4  5297 1 1 80 LYS CA   C   6.013  13.621 -10.436 1.00 . A A . 80 LYS CA   1 1 
        4  5298 1 1 80 LYS CB   C   4.744  13.180 -11.184 1.00 . A A . 80 LYS CB   1 1 
        4  5299 1 1 80 LYS CD   C   3.587  12.803 -13.401 1.00 . A A . 80 LYS CD   1 1 
        4  5300 1 1 80 LYS CE   C   3.721  12.876 -14.915 1.00 . A A . 80 LYS CE   1 1 
        4  5301 1 1 80 LYS CG   C   4.866  13.251 -12.705 1.00 . A A . 80 LYS CG   1 1 
        4  5302 1 1 80 LYS H    H   5.196  14.129  -8.543 1.00 . A A . 80 LYS H    1 1 
        4  5303 1 1 80 LYS HA   H   6.829  12.968 -10.713 1.00 . A A . 80 LYS HA   1 1 
        4  5304 1 1 80 LYS HB2  H   4.516  12.157 -10.912 1.00 . A A . 80 LYS HB2  1 1 
        4  5305 1 1 80 LYS HB3  H   3.919  13.813 -10.880 1.00 . A A . 80 LYS HB3  1 1 
        4  5306 1 1 80 LYS HD2  H   3.370  11.782 -13.119 1.00 . A A . 80 LYS HD2  1 1 
        4  5307 1 1 80 LYS HD3  H   2.772  13.443 -13.090 1.00 . A A . 80 LYS HD3  1 1 
        4  5308 1 1 80 LYS HE2  H   3.902  13.902 -15.201 1.00 . A A . 80 LYS HE2  1 1 
        4  5309 1 1 80 LYS HE3  H   4.556  12.264 -15.225 1.00 . A A . 80 LYS HE3  1 1 
        4  5310 1 1 80 LYS HG2  H   5.082  14.270 -12.992 1.00 . A A . 80 LYS HG2  1 1 
        4  5311 1 1 80 LYS HG3  H   5.679  12.609 -13.019 1.00 . A A . 80 LYS HG3  1 1 
        4  5312 1 1 80 LYS HZ1  H   2.293  11.416 -15.321 1.00 . A A . 80 LYS HZ1  1 1 
        4  5313 1 1 80 LYS HZ2  H   2.621  12.435 -16.630 1.00 . A A . 80 LYS HZ2  1 1 
        4  5314 1 1 80 LYS HZ3  H   1.684  12.990 -15.338 1.00 . A A . 80 LYS HZ3  1 1 
        4  5315 1 1 80 LYS N    N   5.814  13.509  -8.984 1.00 . A A . 80 LYS N    1 1 
        4  5316 1 1 80 LYS NZ   N   2.496  12.397 -15.598 1.00 . A A . 80 LYS NZ   1 1 
        4  5317 1 1 80 LYS O    O   5.826  16.019 -10.284 1.00 . A A . 80 LYS O    1 1 
        4  5318 1 1 81 ASP C    C   6.647  17.212 -13.044 1.00 . A A . 81 ASP C    1 1 
        4  5319 1 1 81 ASP CA   C   7.756  16.527 -12.225 1.00 . A A . 81 ASP CA   1 1 
        4  5320 1 1 81 ASP CB   C   9.032  16.394 -13.065 1.00 . A A . 81 ASP CB   1 1 
        4  5321 1 1 81 ASP CG   C  10.115  15.604 -12.350 1.00 . A A . 81 ASP CG   1 1 
        4  5322 1 1 81 ASP H    H   7.742  14.404 -12.135 1.00 . A A . 81 ASP H    1 1 
        4  5323 1 1 81 ASP HA   H   7.972  17.131 -11.353 1.00 . A A . 81 ASP HA   1 1 
        4  5324 1 1 81 ASP HB2  H   8.795  15.890 -13.993 1.00 . A A . 81 ASP HB2  1 1 
        4  5325 1 1 81 ASP HB3  H   9.414  17.381 -13.287 1.00 . A A . 81 ASP HB3  1 1 
        4  5326 1 1 81 ASP N    N   7.321  15.205 -11.756 1.00 . A A . 81 ASP N    1 1 
        4  5327 1 1 81 ASP O    O   6.051  18.196 -12.596 1.00 . A A . 81 ASP O    1 1 
        4  5328 1 1 81 ASP OD1  O  10.005  14.363 -12.288 1.00 . A A . 81 ASP OD1  1 1 
        4  5329 1 1 81 ASP OD2  O  11.079  16.216 -11.842 1.00 . A A . 81 ASP OD2  1 1 
        4  5330 1 1 82 MET C    C   5.588  18.590 -15.662 1.00 . A A . 82 MET C    1 1 
        4  5331 1 1 82 MET CA   C   5.306  17.169 -15.126 1.00 . A A . 82 MET CA   1 1 
        4  5332 1 1 82 MET CB   C   3.955  17.128 -14.392 1.00 . A A . 82 MET CB   1 1 
        4  5333 1 1 82 MET CE   C   0.101  18.244 -15.523 1.00 . A A . 82 MET CE   1 1 
        4  5334 1 1 82 MET CG   C   2.777  17.621 -15.221 1.00 . A A . 82 MET CG   1 1 
        4  5335 1 1 82 MET H    H   6.933  15.926 -14.555 1.00 . A A . 82 MET H    1 1 
        4  5336 1 1 82 MET HA   H   5.255  16.492 -15.970 1.00 . A A . 82 MET HA   1 1 
        4  5337 1 1 82 MET HB2  H   3.751  16.108 -14.096 1.00 . A A . 82 MET HB2  1 1 
        4  5338 1 1 82 MET HB3  H   4.022  17.740 -13.503 1.00 . A A . 82 MET HB3  1 1 
        4  5339 1 1 82 MET HE1  H   0.410  19.255 -15.744 1.00 . A A . 82 MET HE1  1 1 
        4  5340 1 1 82 MET HE2  H  -0.901  18.253 -15.122 1.00 . A A . 82 MET HE2  1 1 
        4  5341 1 1 82 MET HE3  H   0.121  17.655 -16.428 1.00 . A A . 82 MET HE3  1 1 
        4  5342 1 1 82 MET HG2  H   2.955  18.649 -15.502 1.00 . A A . 82 MET HG2  1 1 
        4  5343 1 1 82 MET HG3  H   2.699  17.014 -16.112 1.00 . A A . 82 MET HG3  1 1 
        4  5344 1 1 82 MET N    N   6.381  16.677 -14.246 1.00 . A A . 82 MET N    1 1 
        4  5345 1 1 82 MET O    O   6.028  19.475 -14.926 1.00 . A A . 82 MET O    1 1 
        4  5346 1 1 82 MET SD   S   1.218  17.529 -14.321 1.00 . A A . 82 MET SD   1 1 
        4  5347 1 1 83 MET C    C   4.395  21.105 -17.307 1.00 . A A . 83 MET C    1 1 
        4  5348 1 1 83 MET CA   C   5.552  20.110 -17.592 1.00 . A A . 83 MET CA   1 1 
        4  5349 1 1 83 MET CB   C   5.773  19.928 -19.108 1.00 . A A . 83 MET CB   1 1 
        4  5350 1 1 83 MET CE   C   4.918  20.620 -22.102 1.00 . A A . 83 MET CE   1 1 
        4  5351 1 1 83 MET CG   C   4.718  19.073 -19.805 1.00 . A A . 83 MET CG   1 1 
        4  5352 1 1 83 MET H    H   4.989  18.056 -17.494 1.00 . A A . 83 MET H    1 1 
        4  5353 1 1 83 MET HA   H   6.459  20.521 -17.166 1.00 . A A . 83 MET HA   1 1 
        4  5354 1 1 83 MET HB2  H   5.781  20.901 -19.579 1.00 . A A . 83 MET HB2  1 1 
        4  5355 1 1 83 MET HB3  H   6.737  19.463 -19.263 1.00 . A A . 83 MET HB3  1 1 
        4  5356 1 1 83 MET HE1  H   5.056  20.676 -23.172 1.00 . A A . 83 MET HE1  1 1 
        4  5357 1 1 83 MET HE2  H   5.692  21.192 -21.611 1.00 . A A . 83 MET HE2  1 1 
        4  5358 1 1 83 MET HE3  H   3.951  21.025 -21.843 1.00 . A A . 83 MET HE3  1 1 
        4  5359 1 1 83 MET HG2  H   4.722  18.088 -19.362 1.00 . A A . 83 MET HG2  1 1 
        4  5360 1 1 83 MET HG3  H   3.747  19.526 -19.655 1.00 . A A . 83 MET HG3  1 1 
        4  5361 1 1 83 MET N    N   5.329  18.799 -16.954 1.00 . A A . 83 MET N    1 1 
        4  5362 1 1 83 MET O    O   3.404  21.136 -18.068 1.00 . A A . 83 MET O    1 1 
        4  5363 1 1 83 MET OXT  O   4.494  21.868 -16.319 1.00 . A A . 83 MET OXT  1 1 
        4  5364 1 1 83 MET SD   S   5.011  18.906 -21.579 1.00 . A A . 83 MET SD   1 1 
        5  5365 1 1  1 MET C    C   0.171  -6.345  15.572 1.00 . A A .  1 MET C    1 1 
        5  5366 1 1  1 MET CA   C  -1.047  -6.746  14.725 1.00 . A A .  1 MET CA   1 1 
        5  5367 1 1  1 MET CB   C  -1.692  -5.494  14.110 1.00 . A A .  1 MET CB   1 1 
        5  5368 1 1  1 MET CE   C  -0.163  -2.391  11.774 1.00 . A A .  1 MET CE   1 1 
        5  5369 1 1  1 MET CG   C  -0.737  -4.637  13.286 1.00 . A A .  1 MET CG   1 1 
        5  5370 1 1  1 MET H1   H  -2.874  -7.741  14.960 1.00 . A A .  1 MET H1   1 1 
        5  5371 1 1  1 MET H2   H  -2.380  -6.892  16.333 1.00 . A A .  1 MET H2   1 1 
        5  5372 1 1  1 MET H3   H  -1.635  -8.356  15.936 1.00 . A A .  1 MET H3   1 1 
        5  5373 1 1  1 MET HA   H  -0.717  -7.400  13.930 1.00 . A A .  1 MET HA   1 1 
        5  5374 1 1  1 MET HB2  H  -2.503  -5.802  13.467 1.00 . A A .  1 MET HB2  1 1 
        5  5375 1 1  1 MET HB3  H  -2.091  -4.882  14.906 1.00 . A A .  1 MET HB3  1 1 
        5  5376 1 1  1 MET HE1  H  -0.497  -1.475  11.308 1.00 . A A .  1 MET HE1  1 1 
        5  5377 1 1  1 MET HE2  H   0.237  -3.053  11.019 1.00 . A A .  1 MET HE2  1 1 
        5  5378 1 1  1 MET HE3  H   0.604  -2.166  12.499 1.00 . A A .  1 MET HE3  1 1 
        5  5379 1 1  1 MET HG2  H   0.076  -4.310  13.921 1.00 . A A .  1 MET HG2  1 1 
        5  5380 1 1  1 MET HG3  H  -0.339  -5.234  12.477 1.00 . A A .  1 MET HG3  1 1 
        5  5381 1 1  1 MET N    N  -2.052  -7.484  15.544 1.00 . A A .  1 MET N    1 1 
        5  5382 1 1  1 MET O    O   0.032  -5.998  16.745 1.00 . A A .  1 MET O    1 1 
        5  5383 1 1  1 MET SD   S  -1.544  -3.183  12.591 1.00 . A A .  1 MET SD   1 1 
        5  5384 1 1  2 GLY C    C   3.856  -6.204  14.904 1.00 . A A .  2 GLY C    1 1 
        5  5385 1 1  2 GLY CA   C   2.570  -6.005  15.701 1.00 . A A .  2 GLY CA   1 1 
        5  5386 1 1  2 GLY H    H   1.430  -6.707  14.046 1.00 . A A .  2 GLY H    1 1 
        5  5387 1 1  2 GLY HA2  H   2.492  -4.960  15.966 1.00 . A A .  2 GLY HA2  1 1 
        5  5388 1 1  2 GLY HA3  H   2.631  -6.586  16.611 1.00 . A A .  2 GLY HA3  1 1 
        5  5389 1 1  2 GLY N    N   1.364  -6.398  14.977 1.00 . A A .  2 GLY N    1 1 
        5  5390 1 1  2 GLY O    O   3.912  -5.881  13.715 1.00 . A A .  2 GLY O    1 1 
        5  5391 1 1  3 HIS C    C   6.948  -5.616  14.753 1.00 . A A .  3 HIS C    1 1 
        5  5392 1 1  3 HIS CA   C   6.216  -6.955  14.967 1.00 . A A .  3 HIS CA   1 1 
        5  5393 1 1  3 HIS CB   C   6.109  -7.744  13.654 1.00 . A A .  3 HIS CB   1 1 
        5  5394 1 1  3 HIS CD2  C   5.818 -10.245  14.287 1.00 . A A .  3 HIS CD2  1 1 
        5  5395 1 1  3 HIS CE1  C   3.714 -10.476  13.731 1.00 . A A .  3 HIS CE1  1 1 
        5  5396 1 1  3 HIS CG   C   5.391  -9.052  13.813 1.00 . A A .  3 HIS CG   1 1 
        5  5397 1 1  3 HIS H    H   4.749  -7.011  16.504 1.00 . A A .  3 HIS H    1 1 
        5  5398 1 1  3 HIS HA   H   6.793  -7.539  15.672 1.00 . A A .  3 HIS HA   1 1 
        5  5399 1 1  3 HIS HB2  H   5.574  -7.155  12.923 1.00 . A A .  3 HIS HB2  1 1 
        5  5400 1 1  3 HIS HB3  H   7.103  -7.954  13.283 1.00 . A A .  3 HIS HB3  1 1 
        5  5401 1 1  3 HIS HD1  H   3.475  -8.552  13.095 1.00 . A A .  3 HIS HD1  1 1 
        5  5402 1 1  3 HIS HD2  H   6.811 -10.474  14.644 1.00 . A A .  3 HIS HD2  1 1 
        5  5403 1 1  3 HIS HE1  H   2.735 -10.902  13.563 1.00 . A A .  3 HIS HE1  1 1 
        5  5404 1 1  3 HIS HE2  H   4.794 -12.073  14.401 1.00 . A A .  3 HIS HE2  1 1 
        5  5405 1 1  3 HIS N    N   4.886  -6.745  15.569 1.00 . A A .  3 HIS N    1 1 
        5  5406 1 1  3 HIS ND1  N   4.067  -9.233  13.472 1.00 . A A .  3 HIS ND1  1 1 
        5  5407 1 1  3 HIS NE2  N   4.755 -11.110  14.225 1.00 . A A .  3 HIS NE2  1 1 
        5  5408 1 1  3 HIS O    O   8.039  -5.407  15.288 1.00 . A A .  3 HIS O    1 1 
        5  5409 1 1  4 HIS C    C   8.141  -3.138  13.080 1.00 . A A .  4 HIS C    1 1 
        5  5410 1 1  4 HIS CA   C   6.792  -3.324  13.822 1.00 . A A .  4 HIS CA   1 1 
        5  5411 1 1  4 HIS CB   C   6.861  -2.689  15.222 1.00 . A A .  4 HIS CB   1 1 
        5  5412 1 1  4 HIS CD2  C   6.600  -0.129  14.855 1.00 . A A .  4 HIS CD2  1 1 
        5  5413 1 1  4 HIS CE1  C   8.561   0.490  15.603 1.00 . A A .  4 HIS CE1  1 1 
        5  5414 1 1  4 HIS CG   C   7.266  -1.247  15.233 1.00 . A A .  4 HIS CG   1 1 
        5  5415 1 1  4 HIS H    H   5.585  -5.028  13.411 1.00 . A A .  4 HIS H    1 1 
        5  5416 1 1  4 HIS HA   H   6.030  -2.807  13.258 1.00 . A A .  4 HIS HA   1 1 
        5  5417 1 1  4 HIS HB2  H   5.892  -2.761  15.690 1.00 . A A .  4 HIS HB2  1 1 
        5  5418 1 1  4 HIS HB3  H   7.578  -3.237  15.819 1.00 . A A .  4 HIS HB3  1 1 
        5  5419 1 1  4 HIS HD1  H   9.203  -1.390  16.044 1.00 . A A .  4 HIS HD1  1 1 
        5  5420 1 1  4 HIS HD2  H   5.602  -0.084  14.442 1.00 . A A .  4 HIS HD2  1 1 
        5  5421 1 1  4 HIS HE1  H   9.407   1.097  15.890 1.00 . A A .  4 HIS HE1  1 1 
        5  5422 1 1  4 HIS HE2  H   7.148   1.875  15.124 1.00 . A A .  4 HIS HE2  1 1 
        5  5423 1 1  4 HIS N    N   6.354  -4.731  13.941 1.00 . A A .  4 HIS N    1 1 
        5  5424 1 1  4 HIS ND1  N   8.489  -0.818  15.694 1.00 . A A .  4 HIS ND1  1 1 
        5  5425 1 1  4 HIS NE2  N   7.431   0.937  15.097 1.00 . A A .  4 HIS NE2  1 1 
        5  5426 1 1  4 HIS O    O   8.341  -2.128  12.403 1.00 . A A .  4 HIS O    1 1 
        5  5427 1 1  5 HIS C    C  10.492  -4.056  11.143 1.00 . A A .  5 HIS C    1 1 
        5  5428 1 1  5 HIS CA   C  10.420  -3.952  12.676 1.00 . A A .  5 HIS CA   1 1 
        5  5429 1 1  5 HIS CB   C  11.345  -5.000  13.308 1.00 . A A .  5 HIS CB   1 1 
        5  5430 1 1  5 HIS CD2  C  12.503  -4.128  15.463 1.00 . A A .  5 HIS CD2  1 1 
        5  5431 1 1  5 HIS CE1  C  11.131  -4.999  16.929 1.00 . A A .  5 HIS CE1  1 1 
        5  5432 1 1  5 HIS CG   C  11.551  -4.807  14.779 1.00 . A A .  5 HIS CG   1 1 
        5  5433 1 1  5 HIS H    H   8.805  -4.931  13.647 1.00 . A A .  5 HIS H    1 1 
        5  5434 1 1  5 HIS HA   H  10.771  -2.969  12.965 1.00 . A A .  5 HIS HA   1 1 
        5  5435 1 1  5 HIS HB2  H  10.920  -5.984  13.161 1.00 . A A .  5 HIS HB2  1 1 
        5  5436 1 1  5 HIS HB3  H  12.313  -4.958  12.826 1.00 . A A .  5 HIS HB3  1 1 
        5  5437 1 1  5 HIS HD1  H   9.917  -5.886  15.554 1.00 . A A .  5 HIS HD1  1 1 
        5  5438 1 1  5 HIS HD2  H  13.332  -3.578  15.039 1.00 . A A .  5 HIS HD2  1 1 
        5  5439 1 1  5 HIS HE1  H  10.662  -5.272  17.864 1.00 . A A .  5 HIS HE1  1 1 
        5  5440 1 1  5 HIS HE2  H  12.788  -3.969  17.536 1.00 . A A .  5 HIS HE2  1 1 
        5  5441 1 1  5 HIS N    N   9.054  -4.099  13.202 1.00 . A A .  5 HIS N    1 1 
        5  5442 1 1  5 HIS ND1  N  10.710  -5.340  15.731 1.00 . A A .  5 HIS ND1  1 1 
        5  5443 1 1  5 HIS NE2  N  12.215  -4.267  16.796 1.00 . A A .  5 HIS NE2  1 1 
        5  5444 1 1  5 HIS O    O   9.780  -4.843  10.517 1.00 . A A .  5 HIS O    1 1 
        5  5445 1 1  6 HIS C    C  13.112  -2.815   8.867 1.00 . A A .  6 HIS C    1 1 
        5  5446 1 1  6 HIS CA   C  11.664  -3.260   9.121 1.00 . A A .  6 HIS CA   1 1 
        5  5447 1 1  6 HIS CB   C  10.711  -2.337   8.342 1.00 . A A .  6 HIS CB   1 1 
        5  5448 1 1  6 HIS CD2  C   8.151  -2.472   8.729 1.00 . A A .  6 HIS CD2  1 1 
        5  5449 1 1  6 HIS CE1  C   7.721  -4.143   7.387 1.00 . A A .  6 HIS CE1  1 1 
        5  5450 1 1  6 HIS CG   C   9.322  -2.869   8.185 1.00 . A A .  6 HIS CG   1 1 
        5  5451 1 1  6 HIS H    H  11.828  -2.575  11.119 1.00 . A A .  6 HIS H    1 1 
        5  5452 1 1  6 HIS HA   H  11.542  -4.275   8.769 1.00 . A A .  6 HIS HA   1 1 
        5  5453 1 1  6 HIS HB2  H  10.642  -1.388   8.856 1.00 . A A .  6 HIS HB2  1 1 
        5  5454 1 1  6 HIS HB3  H  11.114  -2.170   7.352 1.00 . A A .  6 HIS HB3  1 1 
        5  5455 1 1  6 HIS HD1  H   9.654  -4.431   6.815 1.00 . A A .  6 HIS HD1  1 1 
        5  5456 1 1  6 HIS HD2  H   8.014  -1.670   9.442 1.00 . A A .  6 HIS HD2  1 1 
        5  5457 1 1  6 HIS HE1  H   7.200  -4.910   6.833 1.00 . A A .  6 HIS HE1  1 1 
        5  5458 1 1  6 HIS HE2  H   6.222  -3.021   8.170 1.00 . A A .  6 HIS HE2  1 1 
        5  5459 1 1  6 HIS N    N  11.363  -3.232  10.560 1.00 . A A .  6 HIS N    1 1 
        5  5460 1 1  6 HIS ND1  N   9.013  -3.920   7.353 1.00 . A A .  6 HIS ND1  1 1 
        5  5461 1 1  6 HIS NE2  N   7.164  -3.277   8.213 1.00 . A A .  6 HIS NE2  1 1 
        5  5462 1 1  6 HIS O    O  13.921  -2.726   9.794 1.00 . A A .  6 HIS O    1 1 
        5  5463 1 1  7 HIS C    C  14.494  -0.881   6.145 1.00 . A A .  7 HIS C    1 1 
        5  5464 1 1  7 HIS CA   C  14.714  -1.951   7.221 1.00 . A A .  7 HIS CA   1 1 
        5  5465 1 1  7 HIS CB   C  15.686  -3.029   6.721 1.00 . A A .  7 HIS CB   1 1 
        5  5466 1 1  7 HIS CD2  C  14.549  -4.971   5.424 1.00 . A A .  7 HIS CD2  1 1 
        5  5467 1 1  7 HIS CE1  C  14.859  -4.226   3.389 1.00 . A A .  7 HIS CE1  1 1 
        5  5468 1 1  7 HIS CG   C  15.203  -3.789   5.520 1.00 . A A .  7 HIS CG   1 1 
        5  5469 1 1  7 HIS H    H  12.779  -2.757   6.896 1.00 . A A .  7 HIS H    1 1 
        5  5470 1 1  7 HIS HA   H  15.136  -1.474   8.098 1.00 . A A .  7 HIS HA   1 1 
        5  5471 1 1  7 HIS HB2  H  16.623  -2.562   6.459 1.00 . A A .  7 HIS HB2  1 1 
        5  5472 1 1  7 HIS HB3  H  15.857  -3.741   7.515 1.00 . A A .  7 HIS HB3  1 1 
        5  5473 1 1  7 HIS HD1  H  15.840  -2.523   3.948 1.00 . A A .  7 HIS HD1  1 1 
        5  5474 1 1  7 HIS HD2  H  14.247  -5.605   6.243 1.00 . A A .  7 HIS HD2  1 1 
        5  5475 1 1  7 HIS HE1  H  14.851  -4.145   2.312 1.00 . A A .  7 HIS HE1  1 1 
        5  5476 1 1  7 HIS HE2  H  14.067  -6.077   3.710 1.00 . A A .  7 HIS HE2  1 1 
        5  5477 1 1  7 HIS N    N  13.430  -2.548   7.602 1.00 . A A .  7 HIS N    1 1 
        5  5478 1 1  7 HIS ND1  N  15.382  -3.351   4.223 1.00 . A A .  7 HIS ND1  1 1 
        5  5479 1 1  7 HIS NE2  N  14.349  -5.216   4.088 1.00 . A A .  7 HIS NE2  1 1 
        5  5480 1 1  7 HIS O    O  13.383  -0.737   5.632 1.00 . A A .  7 HIS O    1 1 
        5  5481 1 1  8 HIS C    C  15.070   0.324   3.416 1.00 . A A .  8 HIS C    1 1 
        5  5482 1 1  8 HIS CA   C  15.413   0.925   4.791 1.00 . A A .  8 HIS CA   1 1 
        5  5483 1 1  8 HIS CB   C  16.697   1.769   4.720 1.00 . A A .  8 HIS CB   1 1 
        5  5484 1 1  8 HIS CD2  C  18.311   1.220   2.760 1.00 . A A .  8 HIS CD2  1 1 
        5  5485 1 1  8 HIS CE1  C  19.647  -0.162   3.805 1.00 . A A .  8 HIS CE1  1 1 
        5  5486 1 1  8 HIS CG   C  17.859   1.107   4.032 1.00 . A A .  8 HIS CG   1 1 
        5  5487 1 1  8 HIS H    H  16.405  -0.283   6.239 1.00 . A A .  8 HIS H    1 1 
        5  5488 1 1  8 HIS HA   H  14.593   1.565   5.095 1.00 . A A .  8 HIS HA   1 1 
        5  5489 1 1  8 HIS HB2  H  16.483   2.685   4.190 1.00 . A A .  8 HIS HB2  1 1 
        5  5490 1 1  8 HIS HB3  H  17.007   2.016   5.727 1.00 . A A .  8 HIS HB3  1 1 
        5  5491 1 1  8 HIS HD1  H  18.657  -0.072   5.593 1.00 . A A .  8 HIS HD1  1 1 
        5  5492 1 1  8 HIS HD2  H  17.875   1.823   1.975 1.00 . A A .  8 HIS HD2  1 1 
        5  5493 1 1  8 HIS HE1  H  20.452  -0.851   4.018 1.00 . A A .  8 HIS HE1  1 1 
        5  5494 1 1  8 HIS HE2  H  20.035   0.408   1.882 1.00 . A A .  8 HIS HE2  1 1 
        5  5495 1 1  8 HIS N    N  15.539  -0.130   5.802 1.00 . A A .  8 HIS N    1 1 
        5  5496 1 1  8 HIS ND1  N  18.720   0.231   4.659 1.00 . A A .  8 HIS ND1  1 1 
        5  5497 1 1  8 HIS NE2  N  19.421   0.423   2.650 1.00 . A A .  8 HIS NE2  1 1 
        5  5498 1 1  8 HIS O    O  15.625  -0.704   3.023 1.00 . A A .  8 HIS O    1 1 
        5  5499 1 1  9 SER C    C  13.676   1.464   0.295 1.00 . A A .  9 SER C    1 1 
        5  5500 1 1  9 SER CA   C  13.669   0.413   1.414 1.00 . A A .  9 SER CA   1 1 
        5  5501 1 1  9 SER CB   C  12.249  -0.150   1.583 1.00 . A A .  9 SER CB   1 1 
        5  5502 1 1  9 SER H    H  13.788   1.809   3.019 1.00 . A A .  9 SER H    1 1 
        5  5503 1 1  9 SER HA   H  14.329  -0.395   1.130 1.00 . A A .  9 SER HA   1 1 
        5  5504 1 1  9 SER HB2  H  11.909  -0.558   0.642 1.00 . A A .  9 SER HB2  1 1 
        5  5505 1 1  9 SER HB3  H  12.262  -0.933   2.329 1.00 . A A .  9 SER HB3  1 1 
        5  5506 1 1  9 SER HG   H  10.548   0.442   2.374 1.00 . A A .  9 SER HG   1 1 
        5  5507 1 1  9 SER N    N  14.153   0.959   2.692 1.00 . A A .  9 SER N    1 1 
        5  5508 1 1  9 SER O    O  13.251   2.603   0.488 1.00 . A A .  9 SER O    1 1 
        5  5509 1 1  9 SER OG   O  11.338   0.857   1.998 1.00 . A A .  9 SER OG   1 1 
        5  5510 1 1 10 HIS C    C  12.989   1.520  -3.005 1.00 . A A . 10 HIS C    1 1 
        5  5511 1 1 10 HIS CA   C  14.131   1.936  -2.067 1.00 . A A . 10 HIS CA   1 1 
        5  5512 1 1 10 HIS CB   C  15.471   1.862  -2.812 1.00 . A A . 10 HIS CB   1 1 
        5  5513 1 1 10 HIS CD2  C  17.084   3.395  -1.473 1.00 . A A . 10 HIS CD2  1 1 
        5  5514 1 1 10 HIS CE1  C  18.486   1.854  -0.799 1.00 . A A . 10 HIS CE1  1 1 
        5  5515 1 1 10 HIS CG   C  16.653   2.206  -1.961 1.00 . A A . 10 HIS CG   1 1 
        5  5516 1 1 10 HIS H    H  14.549   0.169  -0.957 1.00 . A A . 10 HIS H    1 1 
        5  5517 1 1 10 HIS HA   H  13.963   2.953  -1.741 1.00 . A A . 10 HIS HA   1 1 
        5  5518 1 1 10 HIS HB2  H  15.614   0.858  -3.185 1.00 . A A . 10 HIS HB2  1 1 
        5  5519 1 1 10 HIS HB3  H  15.451   2.548  -3.649 1.00 . A A . 10 HIS HB3  1 1 
        5  5520 1 1 10 HIS HD1  H  17.514   0.302  -1.701 1.00 . A A . 10 HIS HD1  1 1 
        5  5521 1 1 10 HIS HD2  H  16.622   4.359  -1.629 1.00 . A A . 10 HIS HD2  1 1 
        5  5522 1 1 10 HIS HE1  H  19.326   1.363  -0.334 1.00 . A A . 10 HIS HE1  1 1 
        5  5523 1 1 10 HIS HE2  H  18.671   3.786  -0.155 1.00 . A A . 10 HIS HE2  1 1 
        5  5524 1 1 10 HIS N    N  14.161   1.070  -0.881 1.00 . A A . 10 HIS N    1 1 
        5  5525 1 1 10 HIS ND1  N  17.554   1.267  -1.517 1.00 . A A . 10 HIS ND1  1 1 
        5  5526 1 1 10 HIS NE2  N  18.226   3.145  -0.753 1.00 . A A . 10 HIS NE2  1 1 
        5  5527 1 1 10 HIS O    O  13.003   1.829  -4.194 1.00 . A A . 10 HIS O    1 1 
        5  5528 1 1 11 MET C    C   9.820   1.421  -3.515 1.00 . A A . 11 MET C    1 1 
        5  5529 1 1 11 MET CA   C  10.859   0.322  -3.230 1.00 . A A . 11 MET CA   1 1 
        5  5530 1 1 11 MET CB   C  10.191  -0.842  -2.482 1.00 . A A . 11 MET CB   1 1 
        5  5531 1 1 11 MET CE   C  11.701  -4.475  -1.072 1.00 . A A . 11 MET CE   1 1 
        5  5532 1 1 11 MET CG   C  11.137  -1.998  -2.181 1.00 . A A . 11 MET CG   1 1 
        5  5533 1 1 11 MET H    H  12.028   0.645  -1.491 1.00 . A A . 11 MET H    1 1 
        5  5534 1 1 11 MET HA   H  11.242  -0.045  -4.173 1.00 . A A . 11 MET HA   1 1 
        5  5535 1 1 11 MET HB2  H   9.800  -0.473  -1.544 1.00 . A A . 11 MET HB2  1 1 
        5  5536 1 1 11 MET HB3  H   9.372  -1.221  -3.078 1.00 . A A . 11 MET HB3  1 1 
        5  5537 1 1 11 MET HE1  H  11.367  -5.347  -0.532 1.00 . A A . 11 MET HE1  1 1 
        5  5538 1 1 11 MET HE2  H  12.495  -3.991  -0.520 1.00 . A A . 11 MET HE2  1 1 
        5  5539 1 1 11 MET HE3  H  12.069  -4.773  -2.044 1.00 . A A . 11 MET HE3  1 1 
        5  5540 1 1 11 MET HG2  H  11.513  -2.393  -3.113 1.00 . A A . 11 MET HG2  1 1 
        5  5541 1 1 11 MET HG3  H  11.963  -1.627  -1.590 1.00 . A A . 11 MET HG3  1 1 
        5  5542 1 1 11 MET N    N  11.995   0.827  -2.450 1.00 . A A . 11 MET N    1 1 
        5  5543 1 1 11 MET O    O   8.977   1.267  -4.392 1.00 . A A . 11 MET O    1 1 
        5  5544 1 1 11 MET SD   S  10.334  -3.336  -1.275 1.00 . A A . 11 MET SD   1 1 
        5  5545 1 1 12 LEU C    C   8.834   4.149  -4.377 1.00 . A A . 12 LEU C    1 1 
        5  5546 1 1 12 LEU CA   C   8.920   3.628  -2.920 1.00 . A A . 12 LEU CA   1 1 
        5  5547 1 1 12 LEU CB   C   9.250   4.767  -1.943 1.00 . A A . 12 LEU CB   1 1 
        5  5548 1 1 12 LEU CD1  C   9.634   5.552   0.426 1.00 . A A . 12 LEU CD1  1 1 
        5  5549 1 1 12 LEU CD2  C   7.867   3.828  -0.051 1.00 . A A . 12 LEU CD2  1 1 
        5  5550 1 1 12 LEU CG   C   9.238   4.370  -0.456 1.00 . A A . 12 LEU CG   1 1 
        5  5551 1 1 12 LEU H    H  10.613   2.616  -2.120 1.00 . A A . 12 LEU H    1 1 
        5  5552 1 1 12 LEU HA   H   7.950   3.225  -2.656 1.00 . A A . 12 LEU HA   1 1 
        5  5553 1 1 12 LEU HB2  H  10.231   5.150  -2.189 1.00 . A A . 12 LEU HB2  1 1 
        5  5554 1 1 12 LEU HB3  H   8.528   5.559  -2.088 1.00 . A A . 12 LEU HB3  1 1 
        5  5555 1 1 12 LEU HD11 H   8.942   6.367   0.270 1.00 . A A . 12 LEU HD11 1 1 
        5  5556 1 1 12 LEU HD12 H  10.633   5.875   0.172 1.00 . A A . 12 LEU HD12 1 1 
        5  5557 1 1 12 LEU HD13 H   9.607   5.253   1.465 1.00 . A A . 12 LEU HD13 1 1 
        5  5558 1 1 12 LEU HD21 H   7.634   2.952  -0.642 1.00 . A A . 12 LEU HD21 1 1 
        5  5559 1 1 12 LEU HD22 H   7.113   4.586  -0.218 1.00 . A A . 12 LEU HD22 1 1 
        5  5560 1 1 12 LEU HD23 H   7.878   3.560   0.995 1.00 . A A . 12 LEU HD23 1 1 
        5  5561 1 1 12 LEU HG   H   9.966   3.586  -0.298 1.00 . A A . 12 LEU HG   1 1 
        5  5562 1 1 12 LEU N    N   9.892   2.531  -2.775 1.00 . A A . 12 LEU N    1 1 
        5  5563 1 1 12 LEU O    O   7.732   4.363  -4.894 1.00 . A A . 12 LEU O    1 1 
        5  5564 1 1 13 PRO C    C   9.703   3.321  -7.285 1.00 . A A . 13 PRO C    1 1 
        5  5565 1 1 13 PRO CA   C   9.991   4.624  -6.510 1.00 . A A . 13 PRO CA   1 1 
        5  5566 1 1 13 PRO CB   C  11.421   5.129  -6.800 1.00 . A A . 13 PRO CB   1 1 
        5  5567 1 1 13 PRO CD   C  11.337   4.500  -4.494 1.00 . A A . 13 PRO CD   1 1 
        5  5568 1 1 13 PRO CG   C  12.021   5.423  -5.463 1.00 . A A . 13 PRO CG   1 1 
        5  5569 1 1 13 PRO HA   H   9.270   5.381  -6.792 1.00 . A A . 13 PRO HA   1 1 
        5  5570 1 1 13 PRO HB2  H  11.980   4.362  -7.319 1.00 . A A . 13 PRO HB2  1 1 
        5  5571 1 1 13 PRO HB3  H  11.374   6.017  -7.415 1.00 . A A . 13 PRO HB3  1 1 
        5  5572 1 1 13 PRO HD2  H  11.827   3.535  -4.476 1.00 . A A . 13 PRO HD2  1 1 
        5  5573 1 1 13 PRO HD3  H  11.313   4.933  -3.506 1.00 . A A . 13 PRO HD3  1 1 
        5  5574 1 1 13 PRO HG2  H  13.085   5.227  -5.485 1.00 . A A . 13 PRO HG2  1 1 
        5  5575 1 1 13 PRO HG3  H  11.836   6.454  -5.193 1.00 . A A . 13 PRO HG3  1 1 
        5  5576 1 1 13 PRO N    N   9.981   4.392  -5.058 1.00 . A A . 13 PRO N    1 1 
        5  5577 1 1 13 PRO O    O  10.190   2.251  -6.911 1.00 . A A . 13 PRO O    1 1 
        5  5578 1 1 14 PRO C    C   9.745   1.401  -9.696 1.00 . A A . 14 PRO C    1 1 
        5  5579 1 1 14 PRO CA   C   8.529   2.177  -9.146 1.00 . A A . 14 PRO CA   1 1 
        5  5580 1 1 14 PRO CB   C   7.668   2.740 -10.292 1.00 . A A . 14 PRO CB   1 1 
        5  5581 1 1 14 PRO CD   C   8.277   4.599  -8.917 1.00 . A A . 14 PRO CD   1 1 
        5  5582 1 1 14 PRO CG   C   7.174   4.054  -9.781 1.00 . A A . 14 PRO CG   1 1 
        5  5583 1 1 14 PRO HA   H   7.928   1.503  -8.548 1.00 . A A . 14 PRO HA   1 1 
        5  5584 1 1 14 PRO HB2  H   8.275   2.865 -11.180 1.00 . A A . 14 PRO HB2  1 1 
        5  5585 1 1 14 PRO HB3  H   6.851   2.065 -10.502 1.00 . A A . 14 PRO HB3  1 1 
        5  5586 1 1 14 PRO HD2  H   8.984   5.160  -9.512 1.00 . A A . 14 PRO HD2  1 1 
        5  5587 1 1 14 PRO HD3  H   7.871   5.215  -8.128 1.00 . A A . 14 PRO HD3  1 1 
        5  5588 1 1 14 PRO HG2  H   6.978   4.725 -10.609 1.00 . A A . 14 PRO HG2  1 1 
        5  5589 1 1 14 PRO HG3  H   6.275   3.910  -9.196 1.00 . A A . 14 PRO HG3  1 1 
        5  5590 1 1 14 PRO N    N   8.899   3.378  -8.369 1.00 . A A . 14 PRO N    1 1 
        5  5591 1 1 14 PRO O    O  10.202   1.639 -10.820 1.00 . A A . 14 PRO O    1 1 
        5  5592 1 1 15 GLU C    C  11.094  -1.850  -9.006 1.00 . A A . 15 GLU C    1 1 
        5  5593 1 1 15 GLU CA   C  11.401  -0.369  -9.285 1.00 . A A . 15 GLU CA   1 1 
        5  5594 1 1 15 GLU CB   C  12.691   0.046  -8.557 1.00 . A A . 15 GLU CB   1 1 
        5  5595 1 1 15 GLU CD   C  15.146  -0.462  -8.115 1.00 . A A . 15 GLU CD   1 1 
        5  5596 1 1 15 GLU CG   C  13.905  -0.808  -8.925 1.00 . A A . 15 GLU CG   1 1 
        5  5597 1 1 15 GLU H    H   9.928   0.412  -7.968 1.00 . A A . 15 GLU H    1 1 
        5  5598 1 1 15 GLU HA   H  11.549  -0.244 -10.350 1.00 . A A . 15 GLU HA   1 1 
        5  5599 1 1 15 GLU HB2  H  12.913   1.075  -8.801 1.00 . A A . 15 GLU HB2  1 1 
        5  5600 1 1 15 GLU HB3  H  12.529  -0.034  -7.491 1.00 . A A . 15 GLU HB3  1 1 
        5  5601 1 1 15 GLU HG2  H  13.662  -1.848  -8.755 1.00 . A A . 15 GLU HG2  1 1 
        5  5602 1 1 15 GLU HG3  H  14.126  -0.664  -9.973 1.00 . A A . 15 GLU HG3  1 1 
        5  5603 1 1 15 GLU N    N  10.282   0.491  -8.880 1.00 . A A . 15 GLU N    1 1 
        5  5604 1 1 15 GLU O    O  10.684  -2.591  -9.903 1.00 . A A . 15 GLU O    1 1 
        5  5605 1 1 15 GLU OE1  O  15.858   0.492  -8.487 1.00 . A A . 15 GLU OE1  1 1 
        5  5606 1 1 15 GLU OE2  O  15.424  -1.155  -7.109 1.00 . A A . 15 GLU OE2  1 1 
        5  5607 1 1 16 GLN C    C   9.738  -3.820  -6.559 1.00 . A A . 16 GLN C    1 1 
        5  5608 1 1 16 GLN CA   C  11.050  -3.666  -7.352 1.00 . A A . 16 GLN CA   1 1 
        5  5609 1 1 16 GLN CB   C  12.257  -4.186  -6.544 1.00 . A A . 16 GLN CB   1 1 
        5  5610 1 1 16 GLN CD   C  13.922  -3.753  -4.668 1.00 . A A . 16 GLN CD   1 1 
        5  5611 1 1 16 GLN CG   C  12.638  -3.308  -5.353 1.00 . A A . 16 GLN CG   1 1 
        5  5612 1 1 16 GLN H    H  11.566  -1.626  -7.074 1.00 . A A . 16 GLN H    1 1 
        5  5613 1 1 16 GLN HA   H  10.968  -4.256  -8.257 1.00 . A A . 16 GLN HA   1 1 
        5  5614 1 1 16 GLN HB2  H  12.028  -5.174  -6.172 1.00 . A A . 16 GLN HB2  1 1 
        5  5615 1 1 16 GLN HB3  H  13.112  -4.251  -7.202 1.00 . A A . 16 GLN HB3  1 1 
        5  5616 1 1 16 GLN HE21 H  14.997  -2.561  -5.829 1.00 . A A . 16 GLN HE21 1 1 
        5  5617 1 1 16 GLN HE22 H  15.880  -3.496  -4.674 1.00 . A A . 16 GLN HE22 1 1 
        5  5618 1 1 16 GLN HG2  H  12.765  -2.291  -5.697 1.00 . A A . 16 GLN HG2  1 1 
        5  5619 1 1 16 GLN HG3  H  11.834  -3.339  -4.630 1.00 . A A . 16 GLN HG3  1 1 
        5  5620 1 1 16 GLN N    N  11.276  -2.270  -7.752 1.00 . A A . 16 GLN N    1 1 
        5  5621 1 1 16 GLN NE2  N  15.044  -3.217  -5.099 1.00 . A A . 16 GLN NE2  1 1 
        5  5622 1 1 16 GLN O    O   9.706  -3.682  -5.334 1.00 . A A . 16 GLN O    1 1 
        5  5623 1 1 16 GLN OE1  O  13.908  -4.565  -3.749 1.00 . A A . 16 GLN OE1  1 1 
        5  5624 1 1 17 TRP C    C   6.743  -5.642  -6.888 1.00 . A A . 17 TRP C    1 1 
        5  5625 1 1 17 TRP CA   C   7.322  -4.235  -6.668 1.00 . A A . 17 TRP CA   1 1 
        5  5626 1 1 17 TRP CB   C   6.358  -3.173  -7.225 1.00 . A A . 17 TRP CB   1 1 
        5  5627 1 1 17 TRP CD1  C   7.591  -0.924  -7.014 1.00 . A A . 17 TRP CD1  1 1 
        5  5628 1 1 17 TRP CD2  C   5.811  -1.132  -5.673 1.00 . A A . 17 TRP CD2  1 1 
        5  5629 1 1 17 TRP CE2  C   6.389   0.130  -5.458 1.00 . A A . 17 TRP CE2  1 1 
        5  5630 1 1 17 TRP CE3  C   4.675  -1.488  -4.940 1.00 . A A . 17 TRP CE3  1 1 
        5  5631 1 1 17 TRP CG   C   6.595  -1.796  -6.671 1.00 . A A . 17 TRP CG   1 1 
        5  5632 1 1 17 TRP CH2  C   4.760   0.670  -3.836 1.00 . A A . 17 TRP CH2  1 1 
        5  5633 1 1 17 TRP CZ2  C   5.873   1.042  -4.540 1.00 . A A . 17 TRP CZ2  1 1 
        5  5634 1 1 17 TRP CZ3  C   4.161  -0.583  -4.028 1.00 . A A . 17 TRP CZ3  1 1 
        5  5635 1 1 17 TRP H    H   8.737  -4.178  -8.249 1.00 . A A . 17 TRP H    1 1 
        5  5636 1 1 17 TRP HA   H   7.431  -4.074  -5.604 1.00 . A A . 17 TRP HA   1 1 
        5  5637 1 1 17 TRP HB2  H   6.467  -3.122  -8.298 1.00 . A A . 17 TRP HB2  1 1 
        5  5638 1 1 17 TRP HB3  H   5.342  -3.457  -6.985 1.00 . A A . 17 TRP HB3  1 1 
        5  5639 1 1 17 TRP HD1  H   8.356  -1.131  -7.750 1.00 . A A . 17 TRP HD1  1 1 
        5  5640 1 1 17 TRP HE1  H   8.072   1.009  -6.343 1.00 . A A . 17 TRP HE1  1 1 
        5  5641 1 1 17 TRP HE3  H   4.201  -2.449  -5.078 1.00 . A A . 17 TRP HE3  1 1 
        5  5642 1 1 17 TRP HH2  H   4.328   1.346  -3.112 1.00 . A A . 17 TRP HH2  1 1 
        5  5643 1 1 17 TRP HZ2  H   6.325   2.011  -4.382 1.00 . A A . 17 TRP HZ2  1 1 
        5  5644 1 1 17 TRP HZ3  H   3.282  -0.842  -3.450 1.00 . A A . 17 TRP HZ3  1 1 
        5  5645 1 1 17 TRP N    N   8.649  -4.084  -7.279 1.00 . A A . 17 TRP N    1 1 
        5  5646 1 1 17 TRP NE1  N   7.474   0.234  -6.286 1.00 . A A . 17 TRP NE1  1 1 
        5  5647 1 1 17 TRP O    O   6.306  -5.989  -7.990 1.00 . A A . 17 TRP O    1 1 
        5  5648 1 1 18 SER C    C   4.900  -7.812  -4.944 1.00 . A A . 18 SER C    1 1 
        5  5649 1 1 18 SER CA   C   6.148  -7.783  -5.840 1.00 . A A . 18 SER CA   1 1 
        5  5650 1 1 18 SER CB   C   7.160  -8.831  -5.362 1.00 . A A . 18 SER CB   1 1 
        5  5651 1 1 18 SER H    H   7.212  -6.142  -5.014 1.00 . A A . 18 SER H    1 1 
        5  5652 1 1 18 SER HA   H   5.854  -8.012  -6.855 1.00 . A A . 18 SER HA   1 1 
        5  5653 1 1 18 SER HB2  H   7.999  -8.855  -6.042 1.00 . A A . 18 SER HB2  1 1 
        5  5654 1 1 18 SER HB3  H   7.508  -8.569  -4.373 1.00 . A A . 18 SER HB3  1 1 
        5  5655 1 1 18 SER HG   H   7.191 -10.766  -5.696 1.00 . A A . 18 SER HG   1 1 
        5  5656 1 1 18 SER N    N   6.763  -6.448  -5.830 1.00 . A A . 18 SER N    1 1 
        5  5657 1 1 18 SER O    O   4.552  -6.811  -4.310 1.00 . A A . 18 SER O    1 1 
        5  5658 1 1 18 SER OG   O   6.579 -10.125  -5.314 1.00 . A A . 18 SER OG   1 1 
        5  5659 1 1 19 HIS C    C   3.282  -8.938  -2.571 1.00 . A A . 19 HIS C    1 1 
        5  5660 1 1 19 HIS CA   C   3.005  -9.103  -4.076 1.00 . A A . 19 HIS CA   1 1 
        5  5661 1 1 19 HIS CB   C   2.342 -10.456  -4.357 1.00 . A A . 19 HIS CB   1 1 
        5  5662 1 1 19 HIS CD2  C   0.977 -10.159  -6.545 1.00 . A A . 19 HIS CD2  1 1 
        5  5663 1 1 19 HIS CE1  C   2.205 -11.401  -7.861 1.00 . A A . 19 HIS CE1  1 1 
        5  5664 1 1 19 HIS CG   C   1.995 -10.653  -5.803 1.00 . A A . 19 HIS CG   1 1 
        5  5665 1 1 19 HIS H    H   4.594  -9.751  -5.341 1.00 . A A . 19 HIS H    1 1 
        5  5666 1 1 19 HIS HA   H   2.331  -8.315  -4.386 1.00 . A A . 19 HIS HA   1 1 
        5  5667 1 1 19 HIS HB2  H   3.012 -11.251  -4.062 1.00 . A A . 19 HIS HB2  1 1 
        5  5668 1 1 19 HIS HB3  H   1.427 -10.531  -3.784 1.00 . A A . 19 HIS HB3  1 1 
        5  5669 1 1 19 HIS HD1  H   3.559 -11.923  -6.427 1.00 . A A . 19 HIS HD1  1 1 
        5  5670 1 1 19 HIS HD2  H   0.194  -9.501  -6.199 1.00 . A A . 19 HIS HD2  1 1 
        5  5671 1 1 19 HIS HE1  H   2.583 -11.913  -8.733 1.00 . A A . 19 HIS HE1  1 1 
        5  5672 1 1 19 HIS HE2  H   0.707 -10.249  -8.618 1.00 . A A . 19 HIS HE2  1 1 
        5  5673 1 1 19 HIS N    N   4.238  -8.968  -4.867 1.00 . A A . 19 HIS N    1 1 
        5  5674 1 1 19 HIS ND1  N   2.743 -11.429  -6.661 1.00 . A A . 19 HIS ND1  1 1 
        5  5675 1 1 19 HIS NE2  N   1.131 -10.638  -7.823 1.00 . A A . 19 HIS NE2  1 1 
        5  5676 1 1 19 HIS O    O   2.443  -8.431  -1.823 1.00 . A A . 19 HIS O    1 1 
        5  5677 1 1 20 THR C    C   5.272  -7.720  -0.464 1.00 . A A . 20 THR C    1 1 
        5  5678 1 1 20 THR CA   C   4.893  -9.186  -0.737 1.00 . A A . 20 THR CA   1 1 
        5  5679 1 1 20 THR CB   C   6.098 -10.099  -0.394 1.00 . A A . 20 THR CB   1 1 
        5  5680 1 1 20 THR CG2  C   6.515  -9.948   1.067 1.00 . A A . 20 THR CG2  1 1 
        5  5681 1 1 20 THR H    H   5.061  -9.837  -2.757 1.00 . A A . 20 THR H    1 1 
        5  5682 1 1 20 THR HA   H   4.065  -9.460  -0.094 1.00 . A A . 20 THR HA   1 1 
        5  5683 1 1 20 THR HB   H   6.934  -9.820  -1.022 1.00 . A A . 20 THR HB   1 1 
        5  5684 1 1 20 THR HG1  H   4.997 -11.718  -0.117 1.00 . A A . 20 THR HG1  1 1 
        5  5685 1 1 20 THR HG21 H   6.783  -8.920   1.262 1.00 . A A . 20 THR HG21 1 1 
        5  5686 1 1 20 THR HG22 H   7.365 -10.585   1.267 1.00 . A A . 20 THR HG22 1 1 
        5  5687 1 1 20 THR HG23 H   5.694 -10.233   1.708 1.00 . A A . 20 THR HG23 1 1 
        5  5688 1 1 20 THR N    N   4.465  -9.370  -2.132 1.00 . A A . 20 THR N    1 1 
        5  5689 1 1 20 THR O    O   5.040  -7.196   0.631 1.00 . A A . 20 THR O    1 1 
        5  5690 1 1 20 THR OG1  O   5.761 -11.472  -0.653 1.00 . A A . 20 THR OG1  1 1 
        5  5691 1 1 21 THR C    C   5.049  -4.755  -1.013 1.00 . A A . 21 THR C    1 1 
        5  5692 1 1 21 THR CA   C   6.241  -5.649  -1.378 1.00 . A A . 21 THR CA   1 1 
        5  5693 1 1 21 THR CB   C   6.840  -5.133  -2.713 1.00 . A A . 21 THR CB   1 1 
        5  5694 1 1 21 THR CG2  C   7.286  -3.678  -2.600 1.00 . A A . 21 THR CG2  1 1 
        5  5695 1 1 21 THR H    H   6.019  -7.545  -2.310 1.00 . A A . 21 THR H    1 1 
        5  5696 1 1 21 THR HA   H   6.998  -5.562  -0.609 1.00 . A A . 21 THR HA   1 1 
        5  5697 1 1 21 THR HB   H   6.079  -5.199  -3.478 1.00 . A A . 21 THR HB   1 1 
        5  5698 1 1 21 THR HG1  H   8.773  -5.437  -3.003 1.00 . A A . 21 THR HG1  1 1 
        5  5699 1 1 21 THR HG21 H   6.437  -3.058  -2.357 1.00 . A A . 21 THR HG21 1 1 
        5  5700 1 1 21 THR HG22 H   7.707  -3.356  -3.540 1.00 . A A . 21 THR HG22 1 1 
        5  5701 1 1 21 THR HG23 H   8.032  -3.591  -1.824 1.00 . A A . 21 THR HG23 1 1 
        5  5702 1 1 21 THR N    N   5.848  -7.065  -1.474 1.00 . A A . 21 THR N    1 1 
        5  5703 1 1 21 THR O    O   5.072  -4.051  -0.003 1.00 . A A . 21 THR O    1 1 
        5  5704 1 1 21 THR OG1  O   7.958  -5.944  -3.107 1.00 . A A . 21 THR OG1  1 1 
        5  5705 1 1 22 VAL C    C   2.224  -4.140  -0.229 1.00 . A A . 22 VAL C    1 1 
        5  5706 1 1 22 VAL CA   C   2.804  -3.984  -1.647 1.00 . A A . 22 VAL CA   1 1 
        5  5707 1 1 22 VAL CB   C   1.708  -4.340  -2.688 1.00 . A A . 22 VAL CB   1 1 
        5  5708 1 1 22 VAL CG1  C   0.485  -3.435  -2.526 1.00 . A A . 22 VAL CG1  1 1 
        5  5709 1 1 22 VAL CG2  C   2.265  -4.255  -4.111 1.00 . A A . 22 VAL CG2  1 1 
        5  5710 1 1 22 VAL H    H   4.045  -5.410  -2.616 1.00 . A A . 22 VAL H    1 1 
        5  5711 1 1 22 VAL HA   H   3.084  -2.950  -1.796 1.00 . A A . 22 VAL HA   1 1 
        5  5712 1 1 22 VAL HB   H   1.394  -5.361  -2.512 1.00 . A A . 22 VAL HB   1 1 
        5  5713 1 1 22 VAL HG11 H   0.779  -2.402  -2.647 1.00 . A A . 22 VAL HG11 1 1 
        5  5714 1 1 22 VAL HG12 H   0.062  -3.573  -1.541 1.00 . A A . 22 VAL HG12 1 1 
        5  5715 1 1 22 VAL HG13 H  -0.255  -3.689  -3.271 1.00 . A A . 22 VAL HG13 1 1 
        5  5716 1 1 22 VAL HG21 H   2.627  -3.254  -4.300 1.00 . A A . 22 VAL HG21 1 1 
        5  5717 1 1 22 VAL HG22 H   1.486  -4.494  -4.820 1.00 . A A . 22 VAL HG22 1 1 
        5  5718 1 1 22 VAL HG23 H   3.079  -4.958  -4.223 1.00 . A A . 22 VAL HG23 1 1 
        5  5719 1 1 22 VAL N    N   4.005  -4.806  -1.843 1.00 . A A . 22 VAL N    1 1 
        5  5720 1 1 22 VAL O    O   1.832  -3.159   0.405 1.00 . A A . 22 VAL O    1 1 
        5  5721 1 1 23 ARG C    C   2.376  -4.883   2.703 1.00 . A A . 23 ARG C    1 1 
        5  5722 1 1 23 ARG CA   C   1.637  -5.656   1.599 1.00 . A A . 23 ARG CA   1 1 
        5  5723 1 1 23 ARG CB   C   1.699  -7.158   1.901 1.00 . A A . 23 ARG CB   1 1 
        5  5724 1 1 23 ARG CD   C   1.041  -9.036   3.466 1.00 . A A . 23 ARG CD   1 1 
        5  5725 1 1 23 ARG CG   C   0.851  -7.569   3.101 1.00 . A A . 23 ARG CG   1 1 
        5  5726 1 1 23 ARG CZ   C   0.074  -9.818   5.582 1.00 . A A . 23 ARG CZ   1 1 
        5  5727 1 1 23 ARG H    H   2.558  -6.112  -0.262 1.00 . A A . 23 ARG H    1 1 
        5  5728 1 1 23 ARG HA   H   0.601  -5.345   1.591 1.00 . A A . 23 ARG HA   1 1 
        5  5729 1 1 23 ARG HB2  H   1.352  -7.704   1.033 1.00 . A A . 23 ARG HB2  1 1 
        5  5730 1 1 23 ARG HB3  H   2.726  -7.434   2.099 1.00 . A A . 23 ARG HB3  1 1 
        5  5731 1 1 23 ARG HD2  H   1.068  -9.622   2.558 1.00 . A A . 23 ARG HD2  1 1 
        5  5732 1 1 23 ARG HD3  H   1.982  -9.148   3.990 1.00 . A A . 23 ARG HD3  1 1 
        5  5733 1 1 23 ARG HE   H  -0.914  -9.672   3.892 1.00 . A A . 23 ARG HE   1 1 
        5  5734 1 1 23 ARG HG2  H   1.129  -6.960   3.951 1.00 . A A . 23 ARG HG2  1 1 
        5  5735 1 1 23 ARG HG3  H  -0.190  -7.399   2.866 1.00 . A A . 23 ARG HG3  1 1 
        5  5736 1 1 23 ARG HH11 H   1.983  -9.257   5.735 1.00 . A A . 23 ARG HH11 1 1 
        5  5737 1 1 23 ARG HH12 H   1.249  -9.848   7.185 1.00 . A A . 23 ARG HH12 1 1 
        5  5738 1 1 23 ARG HH21 H  -1.810 -10.433   5.753 1.00 . A A . 23 ARG HH21 1 1 
        5  5739 1 1 23 ARG HH22 H  -0.860 -10.500   7.199 1.00 . A A . 23 ARG HH22 1 1 
        5  5740 1 1 23 ARG N    N   2.196  -5.374   0.271 1.00 . A A . 23 ARG N    1 1 
        5  5741 1 1 23 ARG NE   N  -0.041  -9.532   4.313 1.00 . A A . 23 ARG NE   1 1 
        5  5742 1 1 23 ARG NH1  N   1.190  -9.627   6.214 1.00 . A A . 23 ARG NH1  1 1 
        5  5743 1 1 23 ARG NH2  N  -0.942 -10.289   6.227 1.00 . A A . 23 ARG NH2  1 1 
        5  5744 1 1 23 ARG O    O   1.756  -4.178   3.502 1.00 . A A . 23 ARG O    1 1 
        5  5745 1 1 24 ASN C    C   4.626  -2.835   3.548 1.00 . A A . 24 ASN C    1 1 
        5  5746 1 1 24 ASN CA   C   4.525  -4.354   3.766 1.00 . A A . 24 ASN CA   1 1 
        5  5747 1 1 24 ASN CB   C   5.922  -4.982   3.821 1.00 . A A . 24 ASN CB   1 1 
        5  5748 1 1 24 ASN CG   C   5.877  -6.422   4.300 1.00 . A A . 24 ASN CG   1 1 
        5  5749 1 1 24 ASN H    H   4.148  -5.544   2.040 1.00 . A A . 24 ASN H    1 1 
        5  5750 1 1 24 ASN HA   H   4.037  -4.522   4.717 1.00 . A A . 24 ASN HA   1 1 
        5  5751 1 1 24 ASN HB2  H   6.360  -4.961   2.833 1.00 . A A . 24 ASN HB2  1 1 
        5  5752 1 1 24 ASN HB3  H   6.544  -4.413   4.498 1.00 . A A . 24 ASN HB3  1 1 
        5  5753 1 1 24 ASN HD21 H   5.780  -7.087   2.439 1.00 . A A . 24 ASN HD21 1 1 
        5  5754 1 1 24 ASN HD22 H   5.778  -8.295   3.673 1.00 . A A . 24 ASN HD22 1 1 
        5  5755 1 1 24 ASN N    N   3.705  -5.007   2.733 1.00 . A A . 24 ASN N    1 1 
        5  5756 1 1 24 ASN ND2  N   5.802  -7.359   3.377 1.00 . A A . 24 ASN ND2  1 1 
        5  5757 1 1 24 ASN O    O   5.242  -2.125   4.342 1.00 . A A . 24 ASN O    1 1 
        5  5758 1 1 24 ASN OD1  O   5.905  -6.692   5.497 1.00 . A A . 24 ASN OD1  1 1 
        5  5759 1 1 25 ALA C    C   2.517  -0.418   2.731 1.00 . A A . 25 ALA C    1 1 
        5  5760 1 1 25 ALA CA   C   3.889  -0.905   2.240 1.00 . A A . 25 ALA CA   1 1 
        5  5761 1 1 25 ALA CB   C   4.071  -0.579   0.761 1.00 . A A . 25 ALA CB   1 1 
        5  5762 1 1 25 ALA H    H   3.705  -2.969   1.782 1.00 . A A . 25 ALA H    1 1 
        5  5763 1 1 25 ALA HA   H   4.665  -0.397   2.798 1.00 . A A . 25 ALA HA   1 1 
        5  5764 1 1 25 ALA HB1  H   3.300  -1.073   0.185 1.00 . A A . 25 ALA HB1  1 1 
        5  5765 1 1 25 ALA HB2  H   5.041  -0.923   0.431 1.00 . A A . 25 ALA HB2  1 1 
        5  5766 1 1 25 ALA HB3  H   3.999   0.489   0.612 1.00 . A A . 25 ALA HB3  1 1 
        5  5767 1 1 25 ALA N    N   4.036  -2.347   2.463 1.00 . A A . 25 ALA N    1 1 
        5  5768 1 1 25 ALA O    O   2.338   0.750   3.066 1.00 . A A . 25 ALA O    1 1 
        5  5769 1 1 26 LEU C    C  -0.034  -1.146   4.690 1.00 . A A . 26 LEU C    1 1 
        5  5770 1 1 26 LEU CA   C   0.178  -1.016   3.168 1.00 . A A . 26 LEU CA   1 1 
        5  5771 1 1 26 LEU CB   C  -0.794  -1.938   2.396 1.00 . A A . 26 LEU CB   1 1 
        5  5772 1 1 26 LEU CD1  C  -3.047  -2.248   1.305 1.00 . A A . 26 LEU CD1  1 1 
        5  5773 1 1 26 LEU CD2  C  -2.929  -1.946   3.787 1.00 . A A . 26 LEU CD2  1 1 
        5  5774 1 1 26 LEU CG   C  -2.295  -1.566   2.444 1.00 . A A . 26 LEU CG   1 1 
        5  5775 1 1 26 LEU H    H   1.775  -2.261   2.540 1.00 . A A . 26 LEU H    1 1 
        5  5776 1 1 26 LEU HA   H  -0.015   0.009   2.881 1.00 . A A . 26 LEU HA   1 1 
        5  5777 1 1 26 LEU HB2  H  -0.486  -1.946   1.359 1.00 . A A . 26 LEU HB2  1 1 
        5  5778 1 1 26 LEU HB3  H  -0.684  -2.941   2.786 1.00 . A A . 26 LEU HB3  1 1 
        5  5779 1 1 26 LEU HD11 H  -4.088  -1.961   1.337 1.00 . A A . 26 LEU HD11 1 1 
        5  5780 1 1 26 LEU HD12 H  -2.967  -3.321   1.409 1.00 . A A . 26 LEU HD12 1 1 
        5  5781 1 1 26 LEU HD13 H  -2.621  -1.946   0.359 1.00 . A A . 26 LEU HD13 1 1 
        5  5782 1 1 26 LEU HD21 H  -3.982  -1.700   3.773 1.00 . A A . 26 LEU HD21 1 1 
        5  5783 1 1 26 LEU HD22 H  -2.446  -1.400   4.583 1.00 . A A . 26 LEU HD22 1 1 
        5  5784 1 1 26 LEU HD23 H  -2.810  -3.007   3.956 1.00 . A A . 26 LEU HD23 1 1 
        5  5785 1 1 26 LEU HG   H  -2.399  -0.497   2.315 1.00 . A A . 26 LEU HG   1 1 
        5  5786 1 1 26 LEU N    N   1.556  -1.338   2.783 1.00 . A A . 26 LEU N    1 1 
        5  5787 1 1 26 LEU O    O  -0.399  -0.177   5.361 1.00 . A A . 26 LEU O    1 1 
        5  5788 1 1 27 LYS C    C   0.593  -1.724   7.660 1.00 . A A . 27 LYS C    1 1 
        5  5789 1 1 27 LYS CA   C  -0.135  -2.632   6.645 1.00 . A A . 27 LYS CA   1 1 
        5  5790 1 1 27 LYS CB   C   0.077  -4.130   6.981 1.00 . A A . 27 LYS CB   1 1 
        5  5791 1 1 27 LYS CD   C   2.615  -4.189   7.323 1.00 . A A . 27 LYS CD   1 1 
        5  5792 1 1 27 LYS CE   C   2.510  -4.462   8.822 1.00 . A A . 27 LYS CE   1 1 
        5  5793 1 1 27 LYS CG   C   1.419  -4.731   6.540 1.00 . A A . 27 LYS CG   1 1 
        5  5794 1 1 27 LYS H    H   0.625  -3.043   4.692 1.00 . A A . 27 LYS H    1 1 
        5  5795 1 1 27 LYS HA   H  -1.192  -2.424   6.743 1.00 . A A . 27 LYS HA   1 1 
        5  5796 1 1 27 LYS HB2  H  -0.009  -4.258   8.050 1.00 . A A . 27 LYS HB2  1 1 
        5  5797 1 1 27 LYS HB3  H  -0.714  -4.697   6.507 1.00 . A A . 27 LYS HB3  1 1 
        5  5798 1 1 27 LYS HD2  H   3.516  -4.655   6.948 1.00 . A A . 27 LYS HD2  1 1 
        5  5799 1 1 27 LYS HD3  H   2.677  -3.120   7.167 1.00 . A A . 27 LYS HD3  1 1 
        5  5800 1 1 27 LYS HE2  H   1.610  -4.001   9.201 1.00 . A A . 27 LYS HE2  1 1 
        5  5801 1 1 27 LYS HE3  H   2.461  -5.532   8.980 1.00 . A A . 27 LYS HE3  1 1 
        5  5802 1 1 27 LYS HG2  H   1.378  -5.803   6.675 1.00 . A A . 27 LYS HG2  1 1 
        5  5803 1 1 27 LYS HG3  H   1.563  -4.515   5.491 1.00 . A A . 27 LYS HG3  1 1 
        5  5804 1 1 27 LYS HZ1  H   3.837  -2.921   9.304 1.00 . A A . 27 LYS HZ1  1 1 
        5  5805 1 1 27 LYS HZ2  H   4.535  -4.458   9.329 1.00 . A A . 27 LYS HZ2  1 1 
        5  5806 1 1 27 LYS HZ3  H   3.519  -3.971  10.588 1.00 . A A . 27 LYS HZ3  1 1 
        5  5807 1 1 27 LYS N    N   0.209  -2.343   5.240 1.00 . A A . 27 LYS N    1 1 
        5  5808 1 1 27 LYS NZ   N   3.681  -3.919   9.562 1.00 . A A . 27 LYS NZ   1 1 
        5  5809 1 1 27 LYS O    O   0.169  -1.613   8.807 1.00 . A A . 27 LYS O    1 1 
        5  5810 1 1 28 ASP C    C   1.685   1.234   8.159 1.00 . A A . 28 ASP C    1 1 
        5  5811 1 1 28 ASP CA   C   2.383  -0.137   8.127 1.00 . A A . 28 ASP CA   1 1 
        5  5812 1 1 28 ASP CB   C   3.850   0.003   7.712 1.00 . A A . 28 ASP CB   1 1 
        5  5813 1 1 28 ASP CG   C   4.645  -1.242   8.063 1.00 . A A . 28 ASP CG   1 1 
        5  5814 1 1 28 ASP H    H   2.018  -1.237   6.339 1.00 . A A . 28 ASP H    1 1 
        5  5815 1 1 28 ASP HA   H   2.350  -0.550   9.127 1.00 . A A . 28 ASP HA   1 1 
        5  5816 1 1 28 ASP HB2  H   3.908   0.167   6.644 1.00 . A A . 28 ASP HB2  1 1 
        5  5817 1 1 28 ASP HB3  H   4.289   0.847   8.226 1.00 . A A . 28 ASP HB3  1 1 
        5  5818 1 1 28 ASP N    N   1.680  -1.079   7.246 1.00 . A A . 28 ASP N    1 1 
        5  5819 1 1 28 ASP O    O   1.707   1.926   9.176 1.00 . A A . 28 ASP O    1 1 
        5  5820 1 1 28 ASP OD1  O   5.046  -1.389   9.237 1.00 . A A . 28 ASP OD1  1 1 
        5  5821 1 1 28 ASP OD2  O   4.847  -2.098   7.187 1.00 . A A . 28 ASP OD2  1 1 
        5  5822 1 1 29 LEU C    C  -1.118   2.623   7.668 1.00 . A A . 29 LEU C    1 1 
        5  5823 1 1 29 LEU CA   C   0.251   2.849   7.007 1.00 . A A . 29 LEU CA   1 1 
        5  5824 1 1 29 LEU CB   C   0.076   3.341   5.558 1.00 . A A . 29 LEU CB   1 1 
        5  5825 1 1 29 LEU CD1  C   1.524   5.402   5.764 1.00 . A A . 29 LEU CD1  1 1 
        5  5826 1 1 29 LEU CD2  C   2.530   3.257   4.929 1.00 . A A . 29 LEU CD2  1 1 
        5  5827 1 1 29 LEU CG   C   1.271   4.121   4.970 1.00 . A A . 29 LEU CG   1 1 
        5  5828 1 1 29 LEU H    H   1.140   1.073   6.237 1.00 . A A . 29 LEU H    1 1 
        5  5829 1 1 29 LEU HA   H   0.780   3.606   7.572 1.00 . A A . 29 LEU HA   1 1 
        5  5830 1 1 29 LEU HB2  H  -0.110   2.480   4.929 1.00 . A A . 29 LEU HB2  1 1 
        5  5831 1 1 29 LEU HB3  H  -0.793   3.982   5.520 1.00 . A A . 29 LEU HB3  1 1 
        5  5832 1 1 29 LEU HD11 H   0.640   6.023   5.740 1.00 . A A . 29 LEU HD11 1 1 
        5  5833 1 1 29 LEU HD12 H   2.352   5.941   5.325 1.00 . A A . 29 LEU HD12 1 1 
        5  5834 1 1 29 LEU HD13 H   1.760   5.152   6.789 1.00 . A A . 29 LEU HD13 1 1 
        5  5835 1 1 29 LEU HD21 H   2.811   2.977   5.935 1.00 . A A . 29 LEU HD21 1 1 
        5  5836 1 1 29 LEU HD22 H   3.335   3.814   4.471 1.00 . A A . 29 LEU HD22 1 1 
        5  5837 1 1 29 LEU HD23 H   2.337   2.367   4.350 1.00 . A A . 29 LEU HD23 1 1 
        5  5838 1 1 29 LEU HG   H   1.032   4.408   3.956 1.00 . A A . 29 LEU HG   1 1 
        5  5839 1 1 29 LEU N    N   1.059   1.620   7.049 1.00 . A A . 29 LEU N    1 1 
        5  5840 1 1 29 LEU O    O  -1.711   3.546   8.231 1.00 . A A . 29 LEU O    1 1 
        5  5841 1 1 30 LEU C    C  -2.767   1.199   9.804 1.00 . A A . 30 LEU C    1 1 
        5  5842 1 1 30 LEU CA   C  -2.854   0.992   8.275 1.00 . A A . 30 LEU CA   1 1 
        5  5843 1 1 30 LEU CB   C  -3.162  -0.481   7.956 1.00 . A A . 30 LEU CB   1 1 
        5  5844 1 1 30 LEU CD1  C  -5.673  -0.292   7.754 1.00 . A A . 30 LEU CD1  1 1 
        5  5845 1 1 30 LEU CD2  C  -4.624  -2.521   8.254 1.00 . A A . 30 LEU CD2  1 1 
        5  5846 1 1 30 LEU CG   C  -4.520  -1.009   8.455 1.00 . A A . 30 LEU CG   1 1 
        5  5847 1 1 30 LEU H    H  -1.114   0.712   7.086 1.00 . A A . 30 LEU H    1 1 
        5  5848 1 1 30 LEU HA   H  -3.650   1.612   7.884 1.00 . A A . 30 LEU HA   1 1 
        5  5849 1 1 30 LEU HB2  H  -3.125  -0.606   6.882 1.00 . A A . 30 LEU HB2  1 1 
        5  5850 1 1 30 LEU HB3  H  -2.381  -1.089   8.395 1.00 . A A . 30 LEU HB3  1 1 
        5  5851 1 1 30 LEU HD11 H  -5.623   0.765   7.967 1.00 . A A . 30 LEU HD11 1 1 
        5  5852 1 1 30 LEU HD12 H  -6.613  -0.687   8.110 1.00 . A A . 30 LEU HD12 1 1 
        5  5853 1 1 30 LEU HD13 H  -5.600  -0.448   6.687 1.00 . A A . 30 LEU HD13 1 1 
        5  5854 1 1 30 LEU HD21 H  -4.546  -2.754   7.200 1.00 . A A . 30 LEU HD21 1 1 
        5  5855 1 1 30 LEU HD22 H  -5.575  -2.872   8.629 1.00 . A A . 30 LEU HD22 1 1 
        5  5856 1 1 30 LEU HD23 H  -3.825  -3.013   8.789 1.00 . A A . 30 LEU HD23 1 1 
        5  5857 1 1 30 LEU HG   H  -4.605  -0.809   9.513 1.00 . A A . 30 LEU HG   1 1 
        5  5858 1 1 30 LEU N    N  -1.603   1.384   7.608 1.00 . A A . 30 LEU N    1 1 
        5  5859 1 1 30 LEU O    O  -3.782   1.256  10.499 1.00 . A A . 30 LEU O    1 1 
        5  5860 1 1 31 LYS C    C  -1.824   2.928  12.181 1.00 . A A . 31 LYS C    1 1 
        5  5861 1 1 31 LYS CA   C  -1.294   1.547  11.743 1.00 . A A . 31 LYS CA   1 1 
        5  5862 1 1 31 LYS CB   C   0.220   1.417  12.024 1.00 . A A . 31 LYS CB   1 1 
        5  5863 1 1 31 LYS CD   C   0.884   3.002  13.924 1.00 . A A . 31 LYS CD   1 1 
        5  5864 1 1 31 LYS CE   C   2.088   3.605  13.209 1.00 . A A . 31 LYS CE   1 1 
        5  5865 1 1 31 LYS CG   C   0.633   1.549  13.498 1.00 . A A . 31 LYS CG   1 1 
        5  5866 1 1 31 LYS H    H  -0.769   1.208   9.714 1.00 . A A . 31 LYS H    1 1 
        5  5867 1 1 31 LYS HA   H  -1.818   0.781  12.300 1.00 . A A . 31 LYS HA   1 1 
        5  5868 1 1 31 LYS HB2  H   0.547   0.447  11.675 1.00 . A A . 31 LYS HB2  1 1 
        5  5869 1 1 31 LYS HB3  H   0.740   2.177  11.456 1.00 . A A . 31 LYS HB3  1 1 
        5  5870 1 1 31 LYS HD2  H   0.012   3.593  13.692 1.00 . A A . 31 LYS HD2  1 1 
        5  5871 1 1 31 LYS HD3  H   1.063   3.027  14.990 1.00 . A A . 31 LYS HD3  1 1 
        5  5872 1 1 31 LYS HE2  H   2.967   3.031  13.464 1.00 . A A . 31 LYS HE2  1 1 
        5  5873 1 1 31 LYS HE3  H   1.922   3.553  12.142 1.00 . A A . 31 LYS HE3  1 1 
        5  5874 1 1 31 LYS HG2  H  -0.154   1.143  14.117 1.00 . A A . 31 LYS HG2  1 1 
        5  5875 1 1 31 LYS HG3  H   1.538   0.978  13.658 1.00 . A A . 31 LYS HG3  1 1 
        5  5876 1 1 31 LYS HZ1  H   1.471   5.595  13.375 1.00 . A A . 31 LYS HZ1  1 1 
        5  5877 1 1 31 LYS HZ2  H   3.123   5.415  13.067 1.00 . A A . 31 LYS HZ2  1 1 
        5  5878 1 1 31 LYS HZ3  H   2.512   5.101  14.611 1.00 . A A . 31 LYS HZ3  1 1 
        5  5879 1 1 31 LYS N    N  -1.538   1.304  10.314 1.00 . A A . 31 LYS N    1 1 
        5  5880 1 1 31 LYS NZ   N   2.314   5.026  13.593 1.00 . A A . 31 LYS NZ   1 1 
        5  5881 1 1 31 LYS O    O  -2.295   3.095  13.306 1.00 . A A . 31 LYS O    1 1 
        5  5882 1 1 32 ASP C    C  -3.616   5.567  11.207 1.00 . A A . 32 ASP C    1 1 
        5  5883 1 1 32 ASP CA   C  -2.152   5.289  11.593 1.00 . A A . 32 ASP CA   1 1 
        5  5884 1 1 32 ASP CB   C  -1.228   6.276  10.875 1.00 . A A . 32 ASP CB   1 1 
        5  5885 1 1 32 ASP CG   C   0.202   6.177  11.370 1.00 . A A . 32 ASP CG   1 1 
        5  5886 1 1 32 ASP H    H  -1.395   3.707  10.391 1.00 . A A . 32 ASP H    1 1 
        5  5887 1 1 32 ASP HA   H  -2.046   5.432  12.660 1.00 . A A . 32 ASP HA   1 1 
        5  5888 1 1 32 ASP HB2  H  -1.242   6.068   9.814 1.00 . A A . 32 ASP HB2  1 1 
        5  5889 1 1 32 ASP HB3  H  -1.582   7.285  11.044 1.00 . A A . 32 ASP HB3  1 1 
        5  5890 1 1 32 ASP N    N  -1.742   3.911  11.284 1.00 . A A . 32 ASP N    1 1 
        5  5891 1 1 32 ASP O    O  -4.261   6.457  11.775 1.00 . A A . 32 ASP O    1 1 
        5  5892 1 1 32 ASP OD1  O   0.505   6.750  12.438 1.00 . A A . 32 ASP OD1  1 1 
        5  5893 1 1 32 ASP OD2  O   1.032   5.517  10.710 1.00 . A A . 32 ASP OD2  1 1 
        5  5894 1 1 33 MET C    C  -6.190   3.625   9.535 1.00 . A A . 33 MET C    1 1 
        5  5895 1 1 33 MET CA   C  -5.517   4.988   9.773 1.00 . A A . 33 MET CA   1 1 
        5  5896 1 1 33 MET CB   C  -5.544   5.845   8.495 1.00 . A A . 33 MET CB   1 1 
        5  5897 1 1 33 MET CE   C  -6.271   6.799   5.604 1.00 . A A . 33 MET CE   1 1 
        5  5898 1 1 33 MET CG   C  -4.722   5.276   7.345 1.00 . A A . 33 MET CG   1 1 
        5  5899 1 1 33 MET H    H  -3.575   4.126   9.825 1.00 . A A . 33 MET H    1 1 
        5  5900 1 1 33 MET HA   H  -6.064   5.507  10.552 1.00 . A A . 33 MET HA   1 1 
        5  5901 1 1 33 MET HB2  H  -6.568   5.938   8.162 1.00 . A A . 33 MET HB2  1 1 
        5  5902 1 1 33 MET HB3  H  -5.163   6.830   8.729 1.00 . A A . 33 MET HB3  1 1 
        5  5903 1 1 33 MET HE1  H  -6.733   7.267   6.462 1.00 . A A . 33 MET HE1  1 1 
        5  5904 1 1 33 MET HE2  H  -6.791   5.883   5.368 1.00 . A A . 33 MET HE2  1 1 
        5  5905 1 1 33 MET HE3  H  -6.323   7.469   4.759 1.00 . A A . 33 MET HE3  1 1 
        5  5906 1 1 33 MET HG2  H  -3.733   5.030   7.709 1.00 . A A . 33 MET HG2  1 1 
        5  5907 1 1 33 MET HG3  H  -5.202   4.379   6.984 1.00 . A A . 33 MET HG3  1 1 
        5  5908 1 1 33 MET N    N  -4.133   4.818  10.238 1.00 . A A . 33 MET N    1 1 
        5  5909 1 1 33 MET O    O  -5.658   2.775   8.824 1.00 . A A . 33 MET O    1 1 
        5  5910 1 1 33 MET SD   S  -4.554   6.435   5.969 1.00 . A A . 33 MET SD   1 1 
        5  5911 1 1 34 ASN C    C  -8.763   1.827   8.788 1.00 . A A . 34 ASN C    1 1 
        5  5912 1 1 34 ASN CA   C  -8.042   2.126  10.118 1.00 . A A . 34 ASN CA   1 1 
        5  5913 1 1 34 ASN CB   C  -9.034   2.035  11.285 1.00 . A A . 34 ASN CB   1 1 
        5  5914 1 1 34 ASN CG   C  -8.372   2.332  12.618 1.00 . A A . 34 ASN CG   1 1 
        5  5915 1 1 34 ASN H    H  -7.791   4.181  10.593 1.00 . A A . 34 ASN H    1 1 
        5  5916 1 1 34 ASN HA   H  -7.281   1.372  10.263 1.00 . A A . 34 ASN HA   1 1 
        5  5917 1 1 34 ASN HB2  H  -9.832   2.747  11.131 1.00 . A A . 34 ASN HB2  1 1 
        5  5918 1 1 34 ASN HB3  H  -9.447   1.036  11.324 1.00 . A A . 34 ASN HB3  1 1 
        5  5919 1 1 34 ASN HD21 H  -7.705   0.474  12.741 1.00 . A A . 34 ASN HD21 1 1 
        5  5920 1 1 34 ASN HD22 H  -7.299   1.512  14.058 1.00 . A A . 34 ASN HD22 1 1 
        5  5921 1 1 34 ASN N    N  -7.368   3.431  10.130 1.00 . A A . 34 ASN N    1 1 
        5  5922 1 1 34 ASN ND2  N  -7.729   1.339  13.197 1.00 . A A . 34 ASN ND2  1 1 
        5  5923 1 1 34 ASN O    O  -8.872   2.679   7.903 1.00 . A A . 34 ASN O    1 1 
        5  5924 1 1 34 ASN OD1  O  -8.405   3.455  13.107 1.00 . A A . 34 ASN OD1  1 1 
        5  5925 1 1 35 GLN C    C -11.148   0.846   7.035 1.00 . A A . 35 GLN C    1 1 
        5  5926 1 1 35 GLN CA   C  -9.875   0.087   7.443 1.00 . A A . 35 GLN CA   1 1 
        5  5927 1 1 35 GLN CB   C -10.210  -1.401   7.609 1.00 . A A . 35 GLN CB   1 1 
        5  5928 1 1 35 GLN CD   C  -9.428  -3.704   8.311 1.00 . A A . 35 GLN CD   1 1 
        5  5929 1 1 35 GLN CG   C  -9.031  -2.257   8.062 1.00 . A A . 35 GLN CG   1 1 
        5  5930 1 1 35 GLN H    H  -9.250   0.014   9.467 1.00 . A A . 35 GLN H    1 1 
        5  5931 1 1 35 GLN HA   H  -9.143   0.191   6.656 1.00 . A A . 35 GLN HA   1 1 
        5  5932 1 1 35 GLN HB2  H -10.997  -1.498   8.344 1.00 . A A . 35 GLN HB2  1 1 
        5  5933 1 1 35 GLN HB3  H -10.565  -1.787   6.664 1.00 . A A . 35 GLN HB3  1 1 
        5  5934 1 1 35 GLN HE21 H  -9.003  -4.185   6.440 1.00 . A A . 35 GLN HE21 1 1 
        5  5935 1 1 35 GLN HE22 H  -9.579  -5.467   7.440 1.00 . A A . 35 GLN HE22 1 1 
        5  5936 1 1 35 GLN HG2  H  -8.266  -2.232   7.300 1.00 . A A . 35 GLN HG2  1 1 
        5  5937 1 1 35 GLN HG3  H  -8.634  -1.846   8.981 1.00 . A A . 35 GLN HG3  1 1 
        5  5938 1 1 35 GLN N    N  -9.276   0.601   8.683 1.00 . A A . 35 GLN N    1 1 
        5  5939 1 1 35 GLN NE2  N  -9.327  -4.534   7.294 1.00 . A A . 35 GLN NE2  1 1 
        5  5940 1 1 35 GLN O    O -11.299   1.225   5.877 1.00 . A A . 35 GLN O    1 1 
        5  5941 1 1 35 GLN OE1  O  -9.828  -4.071   9.411 1.00 . A A . 35 GLN OE1  1 1 
        5  5942 1 1 36 SER C    C -13.300   2.919   6.843 1.00 . A A . 36 SER C    1 1 
        5  5943 1 1 36 SER CA   C -13.382   1.640   7.699 1.00 . A A . 36 SER CA   1 1 
        5  5944 1 1 36 SER CB   C -14.136   1.933   9.004 1.00 . A A . 36 SER CB   1 1 
        5  5945 1 1 36 SER H    H -11.843   0.800   8.912 1.00 . A A . 36 SER H    1 1 
        5  5946 1 1 36 SER HA   H -13.942   0.902   7.143 1.00 . A A . 36 SER HA   1 1 
        5  5947 1 1 36 SER HB2  H -13.547   2.601   9.616 1.00 . A A . 36 SER HB2  1 1 
        5  5948 1 1 36 SER HB3  H -15.084   2.398   8.774 1.00 . A A . 36 SER HB3  1 1 
        5  5949 1 1 36 SER HG   H -14.992   0.177   9.246 1.00 . A A . 36 SER HG   1 1 
        5  5950 1 1 36 SER N    N -12.059   1.053   7.987 1.00 . A A . 36 SER N    1 1 
        5  5951 1 1 36 SER O    O -14.013   3.047   5.843 1.00 . A A . 36 SER O    1 1 
        5  5952 1 1 36 SER OG   O -14.381   0.738   9.740 1.00 . A A . 36 SER OG   1 1 
        5  5953 1 1 37 SER C    C -11.466   4.923   5.190 1.00 . A A . 37 SER C    1 1 
        5  5954 1 1 37 SER CA   C -12.271   5.118   6.484 1.00 . A A . 37 SER CA   1 1 
        5  5955 1 1 37 SER CB   C -11.585   6.180   7.354 1.00 . A A . 37 SER CB   1 1 
        5  5956 1 1 37 SER H    H -11.903   3.707   8.044 1.00 . A A . 37 SER H    1 1 
        5  5957 1 1 37 SER HA   H -13.259   5.474   6.221 1.00 . A A . 37 SER HA   1 1 
        5  5958 1 1 37 SER HB2  H -12.200   6.387   8.217 1.00 . A A . 37 SER HB2  1 1 
        5  5959 1 1 37 SER HB3  H -10.621   5.812   7.680 1.00 . A A . 37 SER HB3  1 1 
        5  5960 1 1 37 SER HG   H -10.733   7.930   7.083 1.00 . A A . 37 SER HG   1 1 
        5  5961 1 1 37 SER N    N -12.435   3.856   7.231 1.00 . A A . 37 SER N    1 1 
        5  5962 1 1 37 SER O    O -11.917   5.293   4.103 1.00 . A A . 37 SER O    1 1 
        5  5963 1 1 37 SER OG   O -11.391   7.389   6.633 1.00 . A A . 37 SER OG   1 1 
        5  5964 1 1 38 LEU C    C -10.090   3.374   3.009 1.00 . A A . 38 LEU C    1 1 
        5  5965 1 1 38 LEU CA   C  -9.387   4.126   4.153 1.00 . A A . 38 LEU CA   1 1 
        5  5966 1 1 38 LEU CB   C  -8.122   3.367   4.585 1.00 . A A . 38 LEU CB   1 1 
        5  5967 1 1 38 LEU CD1  C  -6.617   4.355   2.810 1.00 . A A . 38 LEU CD1  1 1 
        5  5968 1 1 38 LEU CD2  C  -5.936   2.244   3.999 1.00 . A A . 38 LEU CD2  1 1 
        5  5969 1 1 38 LEU CG   C  -7.110   3.065   3.463 1.00 . A A . 38 LEU CG   1 1 
        5  5970 1 1 38 LEU H    H  -9.988   4.016   6.192 1.00 . A A . 38 LEU H    1 1 
        5  5971 1 1 38 LEU HA   H  -9.095   5.105   3.792 1.00 . A A . 38 LEU HA   1 1 
        5  5972 1 1 38 LEU HB2  H  -7.621   3.951   5.346 1.00 . A A . 38 LEU HB2  1 1 
        5  5973 1 1 38 LEU HB3  H  -8.427   2.427   5.026 1.00 . A A . 38 LEU HB3  1 1 
        5  5974 1 1 38 LEU HD11 H  -7.453   4.875   2.363 1.00 . A A . 38 LEU HD11 1 1 
        5  5975 1 1 38 LEU HD12 H  -5.892   4.119   2.044 1.00 . A A . 38 LEU HD12 1 1 
        5  5976 1 1 38 LEU HD13 H  -6.158   4.988   3.556 1.00 . A A . 38 LEU HD13 1 1 
        5  5977 1 1 38 LEU HD21 H  -5.437   2.794   4.785 1.00 . A A . 38 LEU HD21 1 1 
        5  5978 1 1 38 LEU HD22 H  -5.238   2.047   3.198 1.00 . A A . 38 LEU HD22 1 1 
        5  5979 1 1 38 LEU HD23 H  -6.303   1.307   4.393 1.00 . A A . 38 LEU HD23 1 1 
        5  5980 1 1 38 LEU HG   H  -7.601   2.481   2.699 1.00 . A A . 38 LEU HG   1 1 
        5  5981 1 1 38 LEU N    N -10.276   4.329   5.308 1.00 . A A . 38 LEU N    1 1 
        5  5982 1 1 38 LEU O    O  -9.958   3.742   1.843 1.00 . A A . 38 LEU O    1 1 
        5  5983 1 1 39 ALA C    C -12.638   2.247   1.588 1.00 . A A . 39 ALA C    1 1 
        5  5984 1 1 39 ALA CA   C -11.539   1.498   2.362 1.00 . A A . 39 ALA CA   1 1 
        5  5985 1 1 39 ALA CB   C -12.127   0.274   3.047 1.00 . A A . 39 ALA CB   1 1 
        5  5986 1 1 39 ALA H    H -10.976   2.145   4.306 1.00 . A A . 39 ALA H    1 1 
        5  5987 1 1 39 ALA HA   H -10.794   1.154   1.656 1.00 . A A . 39 ALA HA   1 1 
        5  5988 1 1 39 ALA HB1  H -12.590  -0.366   2.308 1.00 . A A . 39 ALA HB1  1 1 
        5  5989 1 1 39 ALA HB2  H -12.870   0.584   3.768 1.00 . A A . 39 ALA HB2  1 1 
        5  5990 1 1 39 ALA HB3  H -11.342  -0.269   3.551 1.00 . A A . 39 ALA HB3  1 1 
        5  5991 1 1 39 ALA N    N -10.859   2.345   3.355 1.00 . A A . 39 ALA N    1 1 
        5  5992 1 1 39 ALA O    O -13.268   1.689   0.687 1.00 . A A . 39 ALA O    1 1 
        5  5993 1 1 40 LYS C    C -13.081   5.118   0.113 1.00 . A A . 40 LYS C    1 1 
        5  5994 1 1 40 LYS CA   C -13.818   4.356   1.221 1.00 . A A . 40 LYS CA   1 1 
        5  5995 1 1 40 LYS CB   C -14.487   5.365   2.163 1.00 . A A . 40 LYS CB   1 1 
        5  5996 1 1 40 LYS CD   C -15.971   5.800   4.172 1.00 . A A . 40 LYS CD   1 1 
        5  5997 1 1 40 LYS CE   C -16.820   6.863   3.463 1.00 . A A . 40 LYS CE   1 1 
        5  5998 1 1 40 LYS CG   C -15.403   4.748   3.212 1.00 . A A . 40 LYS CG   1 1 
        5  5999 1 1 40 LYS H    H -12.448   3.852   2.763 1.00 . A A . 40 LYS H    1 1 
        5  6000 1 1 40 LYS HA   H -14.579   3.729   0.773 1.00 . A A . 40 LYS HA   1 1 
        5  6001 1 1 40 LYS HB2  H -13.715   5.919   2.678 1.00 . A A . 40 LYS HB2  1 1 
        5  6002 1 1 40 LYS HB3  H -15.072   6.055   1.570 1.00 . A A . 40 LYS HB3  1 1 
        5  6003 1 1 40 LYS HD2  H -16.586   5.300   4.905 1.00 . A A . 40 LYS HD2  1 1 
        5  6004 1 1 40 LYS HD3  H -15.148   6.290   4.675 1.00 . A A . 40 LYS HD3  1 1 
        5  6005 1 1 40 LYS HE2  H -17.491   6.369   2.777 1.00 . A A . 40 LYS HE2  1 1 
        5  6006 1 1 40 LYS HE3  H -17.401   7.396   4.206 1.00 . A A . 40 LYS HE3  1 1 
        5  6007 1 1 40 LYS HG2  H -16.223   4.252   2.713 1.00 . A A . 40 LYS HG2  1 1 
        5  6008 1 1 40 LYS HG3  H -14.839   4.023   3.783 1.00 . A A . 40 LYS HG3  1 1 
        5  6009 1 1 40 LYS HZ1  H -16.603   8.602   2.325 1.00 . A A . 40 LYS HZ1  1 1 
        5  6010 1 1 40 LYS HZ2  H -15.513   7.384   1.906 1.00 . A A . 40 LYS HZ2  1 1 
        5  6011 1 1 40 LYS HZ3  H -15.282   8.279   3.320 1.00 . A A . 40 LYS HZ3  1 1 
        5  6012 1 1 40 LYS N    N -12.892   3.497   1.964 1.00 . A A . 40 LYS N    1 1 
        5  6013 1 1 40 LYS NZ   N -15.998   7.849   2.700 1.00 . A A . 40 LYS NZ   1 1 
        5  6014 1 1 40 LYS O    O -13.537   5.183  -1.031 1.00 . A A . 40 LYS O    1 1 
        5  6015 1 1 41 GLU C    C -10.190   5.703  -1.295 1.00 . A A . 41 GLU C    1 1 
        5  6016 1 1 41 GLU CA   C -11.162   6.542  -0.444 1.00 . A A . 41 GLU CA   1 1 
        5  6017 1 1 41 GLU CB   C -10.375   7.585   0.369 1.00 . A A . 41 GLU CB   1 1 
        5  6018 1 1 41 GLU CD   C -12.453   8.888   1.099 1.00 . A A . 41 GLU CD   1 1 
        5  6019 1 1 41 GLU CG   C -11.162   8.202   1.529 1.00 . A A . 41 GLU CG   1 1 
        5  6020 1 1 41 GLU H    H -11.599   5.551   1.380 1.00 . A A . 41 GLU H    1 1 
        5  6021 1 1 41 GLU HA   H -11.856   7.054  -1.099 1.00 . A A . 41 GLU HA   1 1 
        5  6022 1 1 41 GLU HB2  H  -9.493   7.111   0.781 1.00 . A A . 41 GLU HB2  1 1 
        5  6023 1 1 41 GLU HB3  H -10.066   8.382  -0.292 1.00 . A A . 41 GLU HB3  1 1 
        5  6024 1 1 41 GLU HG2  H -11.407   7.420   2.232 1.00 . A A . 41 GLU HG2  1 1 
        5  6025 1 1 41 GLU HG3  H -10.533   8.932   2.020 1.00 . A A . 41 GLU HG3  1 1 
        5  6026 1 1 41 GLU N    N -11.936   5.694   0.471 1.00 . A A . 41 GLU N    1 1 
        5  6027 1 1 41 GLU O    O  -9.738   6.135  -2.357 1.00 . A A . 41 GLU O    1 1 
        5  6028 1 1 41 GLU OE1  O -12.395  10.056   0.660 1.00 . A A . 41 GLU OE1  1 1 
        5  6029 1 1 41 GLU OE2  O -13.538   8.269   1.211 1.00 . A A . 41 GLU OE2  1 1 
        5  6030 1 1 42 CYS C    C  -9.654   2.661  -2.478 1.00 . A A . 42 CYS C    1 1 
        5  6031 1 1 42 CYS CA   C  -8.939   3.592  -1.488 1.00 . A A . 42 CYS CA   1 1 
        5  6032 1 1 42 CYS CB   C  -8.186   2.747  -0.456 1.00 . A A . 42 CYS CB   1 1 
        5  6033 1 1 42 CYS H    H -10.292   4.212   0.024 1.00 . A A . 42 CYS H    1 1 
        5  6034 1 1 42 CYS HA   H  -8.226   4.197  -2.028 1.00 . A A . 42 CYS HA   1 1 
        5  6035 1 1 42 CYS HB2  H  -7.576   3.396   0.153 1.00 . A A . 42 CYS HB2  1 1 
        5  6036 1 1 42 CYS HB3  H  -8.902   2.240   0.177 1.00 . A A . 42 CYS HB3  1 1 
        5  6037 1 1 42 CYS HG   H  -6.774   0.639  -0.211 1.00 . A A . 42 CYS HG   1 1 
        5  6038 1 1 42 CYS N    N  -9.878   4.502  -0.813 1.00 . A A . 42 CYS N    1 1 
        5  6039 1 1 42 CYS O    O -10.747   2.165  -2.199 1.00 . A A . 42 CYS O    1 1 
        5  6040 1 1 42 CYS SG   S  -7.098   1.489  -1.173 1.00 . A A . 42 CYS SG   1 1 
        5  6041 1 1 43 PRO C    C  -9.887   0.081  -4.075 1.00 . A A . 43 PRO C    1 1 
        5  6042 1 1 43 PRO CA   C  -9.594   1.478  -4.658 1.00 . A A . 43 PRO CA   1 1 
        5  6043 1 1 43 PRO CB   C  -8.478   1.398  -5.712 1.00 . A A . 43 PRO CB   1 1 
        5  6044 1 1 43 PRO CD   C  -7.802   3.060  -4.131 1.00 . A A . 43 PRO CD   1 1 
        5  6045 1 1 43 PRO CG   C  -7.755   2.698  -5.594 1.00 . A A . 43 PRO CG   1 1 
        5  6046 1 1 43 PRO HA   H -10.494   1.869  -5.113 1.00 . A A . 43 PRO HA   1 1 
        5  6047 1 1 43 PRO HB2  H  -7.827   0.562  -5.492 1.00 . A A . 43 PRO HB2  1 1 
        5  6048 1 1 43 PRO HB3  H  -8.912   1.273  -6.694 1.00 . A A . 43 PRO HB3  1 1 
        5  6049 1 1 43 PRO HD2  H  -6.945   2.654  -3.613 1.00 . A A . 43 PRO HD2  1 1 
        5  6050 1 1 43 PRO HD3  H  -7.846   4.133  -4.006 1.00 . A A . 43 PRO HD3  1 1 
        5  6051 1 1 43 PRO HG2  H  -6.729   2.584  -5.921 1.00 . A A . 43 PRO HG2  1 1 
        5  6052 1 1 43 PRO HG3  H  -8.256   3.453  -6.184 1.00 . A A . 43 PRO HG3  1 1 
        5  6053 1 1 43 PRO N    N  -9.049   2.421  -3.661 1.00 . A A . 43 PRO N    1 1 
        5  6054 1 1 43 PRO O    O -10.730  -0.658  -4.595 1.00 . A A . 43 PRO O    1 1 
        5  6055 1 1 44 LEU C    C -10.440  -1.500  -1.241 1.00 . A A . 44 LEU C    1 1 
        5  6056 1 1 44 LEU CA   C  -9.374  -1.578  -2.344 1.00 . A A . 44 LEU CA   1 1 
        5  6057 1 1 44 LEU CB   C  -8.053  -2.082  -1.745 1.00 . A A . 44 LEU CB   1 1 
        5  6058 1 1 44 LEU CD1  C  -5.669  -2.858  -2.046 1.00 . A A . 44 LEU CD1  1 1 
        5  6059 1 1 44 LEU CD2  C  -7.336  -3.195  -3.898 1.00 . A A . 44 LEU CD2  1 1 
        5  6060 1 1 44 LEU CG   C  -6.903  -2.289  -2.746 1.00 . A A . 44 LEU CG   1 1 
        5  6061 1 1 44 LEU H    H  -8.512   0.341  -2.644 1.00 . A A . 44 LEU H    1 1 
        5  6062 1 1 44 LEU HA   H  -9.706  -2.284  -3.093 1.00 . A A . 44 LEU HA   1 1 
        5  6063 1 1 44 LEU HB2  H  -7.727  -1.367  -1.000 1.00 . A A . 44 LEU HB2  1 1 
        5  6064 1 1 44 LEU HB3  H  -8.244  -3.025  -1.251 1.00 . A A . 44 LEU HB3  1 1 
        5  6065 1 1 44 LEU HD11 H  -5.361  -2.188  -1.256 1.00 . A A . 44 LEU HD11 1 1 
        5  6066 1 1 44 LEU HD12 H  -4.865  -2.962  -2.760 1.00 . A A . 44 LEU HD12 1 1 
        5  6067 1 1 44 LEU HD13 H  -5.905  -3.826  -1.626 1.00 . A A . 44 LEU HD13 1 1 
        5  6068 1 1 44 LEU HD21 H  -8.170  -2.745  -4.417 1.00 . A A . 44 LEU HD21 1 1 
        5  6069 1 1 44 LEU HD22 H  -7.632  -4.160  -3.510 1.00 . A A . 44 LEU HD22 1 1 
        5  6070 1 1 44 LEU HD23 H  -6.513  -3.323  -4.586 1.00 . A A . 44 LEU HD23 1 1 
        5  6071 1 1 44 LEU HG   H  -6.630  -1.330  -3.164 1.00 . A A . 44 LEU HG   1 1 
        5  6072 1 1 44 LEU N    N  -9.179  -0.282  -3.004 1.00 . A A . 44 LEU N    1 1 
        5  6073 1 1 44 LEU O    O -10.276  -0.784  -0.252 1.00 . A A . 44 LEU O    1 1 
        5  6074 1 1 45 SER C    C -12.132  -2.894   0.917 1.00 . A A . 45 SER C    1 1 
        5  6075 1 1 45 SER CA   C -12.606  -2.297  -0.417 1.00 . A A . 45 SER CA   1 1 
        5  6076 1 1 45 SER CB   C -13.793  -3.113  -0.942 1.00 . A A . 45 SER CB   1 1 
        5  6077 1 1 45 SER H    H -11.621  -2.764  -2.244 1.00 . A A . 45 SER H    1 1 
        5  6078 1 1 45 SER HA   H -12.935  -1.283  -0.241 1.00 . A A . 45 SER HA   1 1 
        5  6079 1 1 45 SER HB2  H -14.232  -2.602  -1.787 1.00 . A A . 45 SER HB2  1 1 
        5  6080 1 1 45 SER HB3  H -13.449  -4.089  -1.252 1.00 . A A . 45 SER HB3  1 1 
        5  6081 1 1 45 SER HG   H -15.633  -3.471  -0.355 1.00 . A A . 45 SER HG   1 1 
        5  6082 1 1 45 SER N    N -11.529  -2.247  -1.417 1.00 . A A . 45 SER N    1 1 
        5  6083 1 1 45 SER O    O -11.080  -3.538   0.995 1.00 . A A . 45 SER O    1 1 
        5  6084 1 1 45 SER OG   O -14.786  -3.274   0.062 1.00 . A A . 45 SER OG   1 1 
        5  6085 1 1 46 GLN C    C -12.363  -4.672   3.352 1.00 . A A . 46 GLN C    1 1 
        5  6086 1 1 46 GLN CA   C -12.597  -3.157   3.314 1.00 . A A . 46 GLN CA   1 1 
        5  6087 1 1 46 GLN CB   C -13.710  -2.765   4.299 1.00 . A A . 46 GLN CB   1 1 
        5  6088 1 1 46 GLN CD   C -14.467  -2.588   6.712 1.00 . A A . 46 GLN CD   1 1 
        5  6089 1 1 46 GLN CG   C -13.360  -3.016   5.762 1.00 . A A . 46 GLN CG   1 1 
        5  6090 1 1 46 GLN H    H -13.796  -2.240   1.816 1.00 . A A . 46 GLN H    1 1 
        5  6091 1 1 46 GLN HA   H -11.683  -2.657   3.607 1.00 . A A . 46 GLN HA   1 1 
        5  6092 1 1 46 GLN HB2  H -13.923  -1.712   4.178 1.00 . A A . 46 GLN HB2  1 1 
        5  6093 1 1 46 GLN HB3  H -14.599  -3.331   4.060 1.00 . A A . 46 GLN HB3  1 1 
        5  6094 1 1 46 GLN HE21 H -15.278  -4.390   6.632 1.00 . A A . 46 GLN HE21 1 1 
        5  6095 1 1 46 GLN HE22 H -16.086  -3.243   7.637 1.00 . A A . 46 GLN HE22 1 1 
        5  6096 1 1 46 GLN HG2  H -13.175  -4.072   5.901 1.00 . A A . 46 GLN HG2  1 1 
        5  6097 1 1 46 GLN HG3  H -12.463  -2.463   6.006 1.00 . A A . 46 GLN HG3  1 1 
        5  6098 1 1 46 GLN N    N -12.939  -2.699   1.961 1.00 . A A . 46 GLN N    1 1 
        5  6099 1 1 46 GLN NE2  N -15.366  -3.496   7.024 1.00 . A A . 46 GLN NE2  1 1 
        5  6100 1 1 46 GLN O    O -11.449  -5.150   4.023 1.00 . A A . 46 GLN O    1 1 
        5  6101 1 1 46 GLN OE1  O -14.518  -1.445   7.160 1.00 . A A . 46 GLN OE1  1 1 
        5  6102 1 1 47 SER C    C -11.678  -7.281   1.955 1.00 . A A . 47 SER C    1 1 
        5  6103 1 1 47 SER CA   C -13.047  -6.882   2.529 1.00 . A A . 47 SER CA   1 1 
        5  6104 1 1 47 SER CB   C -14.168  -7.484   1.668 1.00 . A A . 47 SER CB   1 1 
        5  6105 1 1 47 SER H    H -13.921  -4.979   2.132 1.00 . A A . 47 SER H    1 1 
        5  6106 1 1 47 SER HA   H -13.129  -7.277   3.532 1.00 . A A . 47 SER HA   1 1 
        5  6107 1 1 47 SER HB2  H -14.137  -7.045   0.680 1.00 . A A . 47 SER HB2  1 1 
        5  6108 1 1 47 SER HB3  H -14.023  -8.553   1.588 1.00 . A A . 47 SER HB3  1 1 
        5  6109 1 1 47 SER HG   H -16.129  -7.345   1.560 1.00 . A A . 47 SER HG   1 1 
        5  6110 1 1 47 SER N    N -13.188  -5.419   2.618 1.00 . A A . 47 SER N    1 1 
        5  6111 1 1 47 SER O    O -11.024  -8.192   2.461 1.00 . A A . 47 SER O    1 1 
        5  6112 1 1 47 SER OG   O -15.448  -7.240   2.237 1.00 . A A . 47 SER OG   1 1 
        5  6113 1 1 48 MET C    C  -8.799  -6.573   1.265 1.00 . A A . 48 MET C    1 1 
        5  6114 1 1 48 MET CA   C  -9.944  -6.848   0.278 1.00 . A A . 48 MET CA   1 1 
        5  6115 1 1 48 MET CB   C  -9.775  -5.987  -0.983 1.00 . A A . 48 MET CB   1 1 
        5  6116 1 1 48 MET CE   C -11.977  -8.038  -3.893 1.00 . A A . 48 MET CE   1 1 
        5  6117 1 1 48 MET CG   C -10.787  -6.301  -2.077 1.00 . A A . 48 MET CG   1 1 
        5  6118 1 1 48 MET H    H -11.817  -5.877   0.538 1.00 . A A . 48 MET H    1 1 
        5  6119 1 1 48 MET HA   H  -9.916  -7.890  -0.002 1.00 . A A . 48 MET HA   1 1 
        5  6120 1 1 48 MET HB2  H  -9.882  -4.946  -0.712 1.00 . A A . 48 MET HB2  1 1 
        5  6121 1 1 48 MET HB3  H  -8.783  -6.143  -1.384 1.00 . A A . 48 MET HB3  1 1 
        5  6122 1 1 48 MET HE1  H -11.807  -7.290  -4.655 1.00 . A A . 48 MET HE1  1 1 
        5  6123 1 1 48 MET HE2  H -12.914  -7.839  -3.394 1.00 . A A . 48 MET HE2  1 1 
        5  6124 1 1 48 MET HE3  H -12.014  -9.014  -4.353 1.00 . A A . 48 MET HE3  1 1 
        5  6125 1 1 48 MET HG2  H -11.782  -6.164  -1.679 1.00 . A A . 48 MET HG2  1 1 
        5  6126 1 1 48 MET HG3  H -10.635  -5.615  -2.898 1.00 . A A . 48 MET HG3  1 1 
        5  6127 1 1 48 MET N    N -11.249  -6.586   0.901 1.00 . A A . 48 MET N    1 1 
        5  6128 1 1 48 MET O    O  -7.983  -7.453   1.548 1.00 . A A . 48 MET O    1 1 
        5  6129 1 1 48 MET SD   S -10.639  -7.992  -2.697 1.00 . A A . 48 MET SD   1 1 
        5  6130 1 1 49 ILE C    C  -7.754  -5.936   3.994 1.00 . A A . 49 ILE C    1 1 
        5  6131 1 1 49 ILE CA   C  -7.749  -4.969   2.796 1.00 . A A . 49 ILE CA   1 1 
        5  6132 1 1 49 ILE CB   C  -7.986  -3.520   3.309 1.00 . A A . 49 ILE CB   1 1 
        5  6133 1 1 49 ILE CD1  C  -8.226  -1.086   2.544 1.00 . A A . 49 ILE CD1  1 1 
        5  6134 1 1 49 ILE CG1  C  -7.976  -2.525   2.134 1.00 . A A . 49 ILE CG1  1 1 
        5  6135 1 1 49 ILE CG2  C  -6.934  -3.133   4.351 1.00 . A A . 49 ILE CG2  1 1 
        5  6136 1 1 49 ILE H    H  -9.424  -4.687   1.513 1.00 . A A . 49 ILE H    1 1 
        5  6137 1 1 49 ILE HA   H  -6.778  -5.007   2.318 1.00 . A A . 49 ILE HA   1 1 
        5  6138 1 1 49 ILE HB   H  -8.954  -3.489   3.787 1.00 . A A . 49 ILE HB   1 1 
        5  6139 1 1 49 ILE HD11 H  -7.445  -0.762   3.218 1.00 . A A . 49 ILE HD11 1 1 
        5  6140 1 1 49 ILE HD12 H  -9.185  -1.011   3.040 1.00 . A A . 49 ILE HD12 1 1 
        5  6141 1 1 49 ILE HD13 H  -8.225  -0.460   1.666 1.00 . A A . 49 ILE HD13 1 1 
        5  6142 1 1 49 ILE HG12 H  -7.014  -2.562   1.644 1.00 . A A . 49 ILE HG12 1 1 
        5  6143 1 1 49 ILE HG13 H  -8.745  -2.803   1.425 1.00 . A A . 49 ILE HG13 1 1 
        5  6144 1 1 49 ILE HG21 H  -6.980  -3.821   5.183 1.00 . A A . 49 ILE HG21 1 1 
        5  6145 1 1 49 ILE HG22 H  -7.127  -2.131   4.706 1.00 . A A . 49 ILE HG22 1 1 
        5  6146 1 1 49 ILE HG23 H  -5.949  -3.172   3.906 1.00 . A A . 49 ILE HG23 1 1 
        5  6147 1 1 49 ILE N    N  -8.760  -5.352   1.799 1.00 . A A . 49 ILE N    1 1 
        5  6148 1 1 49 ILE O    O  -6.704  -6.298   4.528 1.00 . A A . 49 ILE O    1 1 
        5  6149 1 1 50 SER C    C  -8.387  -8.606   5.310 1.00 . A A . 50 SER C    1 1 
        5  6150 1 1 50 SER CA   C  -9.132  -7.279   5.521 1.00 . A A . 50 SER CA   1 1 
        5  6151 1 1 50 SER CB   C -10.625  -7.554   5.741 1.00 . A A . 50 SER CB   1 1 
        5  6152 1 1 50 SER H    H  -9.745  -6.053   3.899 1.00 . A A . 50 SER H    1 1 
        5  6153 1 1 50 SER HA   H  -8.736  -6.795   6.402 1.00 . A A . 50 SER HA   1 1 
        5  6154 1 1 50 SER HB2  H -11.138  -6.619   5.912 1.00 . A A . 50 SER HB2  1 1 
        5  6155 1 1 50 SER HB3  H -11.035  -8.030   4.860 1.00 . A A . 50 SER HB3  1 1 
        5  6156 1 1 50 SER HG   H -11.686  -8.863   6.743 1.00 . A A . 50 SER HG   1 1 
        5  6157 1 1 50 SER N    N  -8.953  -6.361   4.388 1.00 . A A . 50 SER N    1 1 
        5  6158 1 1 50 SER O    O  -7.502  -8.959   6.089 1.00 . A A . 50 SER O    1 1 
        5  6159 1 1 50 SER OG   O -10.842  -8.400   6.854 1.00 . A A . 50 SER OG   1 1 
        5  6160 1 1 51 SER C    C  -6.621 -10.569   3.761 1.00 . A A . 51 SER C    1 1 
        5  6161 1 1 51 SER CA   C  -8.142 -10.648   3.963 1.00 . A A . 51 SER CA   1 1 
        5  6162 1 1 51 SER CB   C  -8.796 -11.288   2.731 1.00 . A A . 51 SER CB   1 1 
        5  6163 1 1 51 SER H    H  -9.428  -8.979   3.636 1.00 . A A . 51 SER H    1 1 
        5  6164 1 1 51 SER HA   H  -8.337 -11.281   4.820 1.00 . A A . 51 SER HA   1 1 
        5  6165 1 1 51 SER HB2  H  -8.697 -10.623   1.884 1.00 . A A . 51 SER HB2  1 1 
        5  6166 1 1 51 SER HB3  H  -8.307 -12.226   2.510 1.00 . A A . 51 SER HB3  1 1 
        5  6167 1 1 51 SER HG   H -10.307 -12.480   3.110 1.00 . A A . 51 SER HG   1 1 
        5  6168 1 1 51 SER N    N  -8.742  -9.332   4.246 1.00 . A A . 51 SER N    1 1 
        5  6169 1 1 51 SER O    O  -5.891 -11.478   4.164 1.00 . A A . 51 SER O    1 1 
        5  6170 1 1 51 SER OG   O -10.173 -11.537   2.957 1.00 . A A . 51 SER OG   1 1 
        5  6171 1 1 52 ILE C    C  -3.925  -9.228   4.238 1.00 . A A . 52 ILE C    1 1 
        5  6172 1 1 52 ILE CA   C  -4.709  -9.285   2.912 1.00 . A A . 52 ILE CA   1 1 
        5  6173 1 1 52 ILE CB   C  -4.439  -7.993   2.091 1.00 . A A . 52 ILE CB   1 1 
        5  6174 1 1 52 ILE CD1  C  -4.937  -6.857  -0.153 1.00 . A A . 52 ILE CD1  1 1 
        5  6175 1 1 52 ILE CG1  C  -5.090  -8.102   0.701 1.00 . A A . 52 ILE CG1  1 1 
        5  6176 1 1 52 ILE CG2  C  -2.935  -7.727   1.964 1.00 . A A . 52 ILE CG2  1 1 
        5  6177 1 1 52 ILE H    H  -6.783  -8.805   2.824 1.00 . A A . 52 ILE H    1 1 
        5  6178 1 1 52 ILE HA   H  -4.351 -10.129   2.336 1.00 . A A . 52 ILE HA   1 1 
        5  6179 1 1 52 ILE HB   H  -4.881  -7.160   2.621 1.00 . A A . 52 ILE HB   1 1 
        5  6180 1 1 52 ILE HD11 H  -3.889  -6.652  -0.308 1.00 . A A . 52 ILE HD11 1 1 
        5  6181 1 1 52 ILE HD12 H  -5.399  -6.018   0.348 1.00 . A A . 52 ILE HD12 1 1 
        5  6182 1 1 52 ILE HD13 H  -5.419  -7.016  -1.106 1.00 . A A . 52 ILE HD13 1 1 
        5  6183 1 1 52 ILE HG12 H  -4.642  -8.924   0.161 1.00 . A A . 52 ILE HG12 1 1 
        5  6184 1 1 52 ILE HG13 H  -6.148  -8.293   0.820 1.00 . A A . 52 ILE HG13 1 1 
        5  6185 1 1 52 ILE HG21 H  -2.459  -8.569   1.484 1.00 . A A . 52 ILE HG21 1 1 
        5  6186 1 1 52 ILE HG22 H  -2.509  -7.585   2.946 1.00 . A A . 52 ILE HG22 1 1 
        5  6187 1 1 52 ILE HG23 H  -2.771  -6.837   1.371 1.00 . A A . 52 ILE HG23 1 1 
        5  6188 1 1 52 ILE N    N  -6.149  -9.485   3.141 1.00 . A A . 52 ILE N    1 1 
        5  6189 1 1 52 ILE O    O  -2.858  -9.834   4.368 1.00 . A A . 52 ILE O    1 1 
        5  6190 1 1 53 VAL C    C  -4.097  -9.656   7.388 1.00 . A A . 53 VAL C    1 1 
        5  6191 1 1 53 VAL CA   C  -3.827  -8.399   6.541 1.00 . A A . 53 VAL CA   1 1 
        5  6192 1 1 53 VAL CB   C  -4.330  -7.143   7.304 1.00 . A A . 53 VAL CB   1 1 
        5  6193 1 1 53 VAL CG1  C  -3.657  -7.024   8.672 1.00 . A A . 53 VAL CG1  1 1 
        5  6194 1 1 53 VAL CG2  C  -4.101  -5.882   6.473 1.00 . A A . 53 VAL CG2  1 1 
        5  6195 1 1 53 VAL H    H  -5.296  -8.015   5.048 1.00 . A A . 53 VAL H    1 1 
        5  6196 1 1 53 VAL HA   H  -2.760  -8.301   6.394 1.00 . A A . 53 VAL HA   1 1 
        5  6197 1 1 53 VAL HB   H  -5.395  -7.251   7.464 1.00 . A A . 53 VAL HB   1 1 
        5  6198 1 1 53 VAL HG11 H  -2.588  -6.930   8.543 1.00 . A A . 53 VAL HG11 1 1 
        5  6199 1 1 53 VAL HG12 H  -3.872  -7.905   9.259 1.00 . A A . 53 VAL HG12 1 1 
        5  6200 1 1 53 VAL HG13 H  -4.034  -6.151   9.185 1.00 . A A . 53 VAL HG13 1 1 
        5  6201 1 1 53 VAL HG21 H  -4.630  -5.967   5.534 1.00 . A A . 53 VAL HG21 1 1 
        5  6202 1 1 53 VAL HG22 H  -3.044  -5.762   6.280 1.00 . A A . 53 VAL HG22 1 1 
        5  6203 1 1 53 VAL HG23 H  -4.467  -5.020   7.011 1.00 . A A . 53 VAL HG23 1 1 
        5  6204 1 1 53 VAL N    N  -4.458  -8.501   5.218 1.00 . A A . 53 VAL N    1 1 
        5  6205 1 1 53 VAL O    O  -3.231 -10.117   8.134 1.00 . A A . 53 VAL O    1 1 
        5  6206 1 1 54 ASN C    C  -4.849 -12.622   7.653 1.00 . A A . 54 ASN C    1 1 
        5  6207 1 1 54 ASN CA   C  -5.714 -11.397   8.003 1.00 . A A . 54 ASN CA   1 1 
        5  6208 1 1 54 ASN CB   C  -7.192 -11.698   7.717 1.00 . A A . 54 ASN CB   1 1 
        5  6209 1 1 54 ASN CG   C  -7.718 -12.917   8.463 1.00 . A A . 54 ASN CG   1 1 
        5  6210 1 1 54 ASN H    H  -5.932  -9.805   6.619 1.00 . A A . 54 ASN H    1 1 
        5  6211 1 1 54 ASN HA   H  -5.599 -11.178   9.057 1.00 . A A . 54 ASN HA   1 1 
        5  6212 1 1 54 ASN HB2  H  -7.788 -10.846   8.006 1.00 . A A . 54 ASN HB2  1 1 
        5  6213 1 1 54 ASN HB3  H  -7.317 -11.870   6.656 1.00 . A A . 54 ASN HB3  1 1 
        5  6214 1 1 54 ASN HD21 H  -6.570 -12.526  10.029 1.00 . A A . 54 ASN HD21 1 1 
        5  6215 1 1 54 ASN HD22 H  -7.574 -13.923  10.155 1.00 . A A . 54 ASN HD22 1 1 
        5  6216 1 1 54 ASN N    N  -5.300 -10.208   7.250 1.00 . A A . 54 ASN N    1 1 
        5  6217 1 1 54 ASN ND2  N  -7.236 -13.144   9.667 1.00 . A A . 54 ASN ND2  1 1 
        5  6218 1 1 54 ASN O    O  -4.245 -13.244   8.532 1.00 . A A . 54 ASN O    1 1 
        5  6219 1 1 54 ASN OD1  O  -8.568 -13.647   7.962 1.00 . A A . 54 ASN OD1  1 1 
        5  6220 1 1 55 SER C    C  -2.594 -13.778   5.550 1.00 . A A . 55 SER C    1 1 
        5  6221 1 1 55 SER CA   C  -4.038 -14.139   5.911 1.00 . A A . 55 SER CA   1 1 
        5  6222 1 1 55 SER CB   C  -4.720 -14.792   4.700 1.00 . A A . 55 SER CB   1 1 
        5  6223 1 1 55 SER H    H  -5.265 -12.411   5.705 1.00 . A A . 55 SER H    1 1 
        5  6224 1 1 55 SER HA   H  -4.021 -14.856   6.723 1.00 . A A . 55 SER HA   1 1 
        5  6225 1 1 55 SER HB2  H  -5.722 -15.092   4.970 1.00 . A A . 55 SER HB2  1 1 
        5  6226 1 1 55 SER HB3  H  -4.763 -14.084   3.885 1.00 . A A . 55 SER HB3  1 1 
        5  6227 1 1 55 SER HG   H  -4.472 -16.352   3.532 1.00 . A A . 55 SER HG   1 1 
        5  6228 1 1 55 SER N    N  -4.795 -12.966   6.367 1.00 . A A . 55 SER N    1 1 
        5  6229 1 1 55 SER O    O  -2.337 -13.137   4.530 1.00 . A A . 55 SER O    1 1 
        5  6230 1 1 55 SER OG   O  -4.003 -15.941   4.267 1.00 . A A . 55 SER OG   1 1 
        5  6231 1 1 56 THR C    C   0.236 -14.872   4.955 1.00 . A A . 56 THR C    1 1 
        5  6232 1 1 56 THR CA   C  -0.222 -13.986   6.121 1.00 . A A . 56 THR CA   1 1 
        5  6233 1 1 56 THR CB   C   0.646 -14.317   7.355 1.00 . A A . 56 THR CB   1 1 
        5  6234 1 1 56 THR CG2  C   0.244 -13.461   8.553 1.00 . A A . 56 THR CG2  1 1 
        5  6235 1 1 56 THR H    H  -1.919 -14.614   7.239 1.00 . A A . 56 THR H    1 1 
        5  6236 1 1 56 THR HA   H  -0.067 -12.948   5.859 1.00 . A A . 56 THR HA   1 1 
        5  6237 1 1 56 THR HB   H   1.682 -14.113   7.119 1.00 . A A . 56 THR HB   1 1 
        5  6238 1 1 56 THR HG1  H   1.381 -16.121   7.703 1.00 . A A . 56 THR HG1  1 1 
        5  6239 1 1 56 THR HG21 H   0.850 -13.728   9.407 1.00 . A A . 56 THR HG21 1 1 
        5  6240 1 1 56 THR HG22 H  -0.797 -13.633   8.784 1.00 . A A . 56 THR HG22 1 1 
        5  6241 1 1 56 THR HG23 H   0.394 -12.417   8.319 1.00 . A A . 56 THR HG23 1 1 
        5  6242 1 1 56 THR N    N  -1.651 -14.182   6.398 1.00 . A A . 56 THR N    1 1 
        5  6243 1 1 56 THR O    O   1.185 -14.547   4.237 1.00 . A A . 56 THR O    1 1 
        5  6244 1 1 56 THR OG1  O   0.509 -15.707   7.691 1.00 . A A . 56 THR OG1  1 1 
        5  6245 1 1 57 TYR C    C  -1.098 -16.751   2.495 1.00 . A A . 57 TYR C    1 1 
        5  6246 1 1 57 TYR CA   C  -0.167 -16.954   3.706 1.00 . A A . 57 TYR CA   1 1 
        5  6247 1 1 57 TYR CB   C  -0.298 -18.388   4.250 1.00 . A A . 57 TYR CB   1 1 
        5  6248 1 1 57 TYR CD1  C  -1.812 -18.359   6.288 1.00 . A A . 57 TYR CD1  1 1 
        5  6249 1 1 57 TYR CD2  C  -2.693 -19.239   4.249 1.00 . A A . 57 TYR CD2  1 1 
        5  6250 1 1 57 TYR CE1  C  -3.014 -18.608   6.919 1.00 . A A . 57 TYR CE1  1 1 
        5  6251 1 1 57 TYR CE2  C  -3.900 -19.488   4.877 1.00 . A A . 57 TYR CE2  1 1 
        5  6252 1 1 57 TYR CG   C  -1.626 -18.670   4.941 1.00 . A A . 57 TYR CG   1 1 
        5  6253 1 1 57 TYR CZ   C  -4.054 -19.170   6.211 1.00 . A A . 57 TYR CZ   1 1 
        5  6254 1 1 57 TYR H    H  -1.204 -16.180   5.384 1.00 . A A . 57 TYR H    1 1 
        5  6255 1 1 57 TYR HA   H   0.854 -16.793   3.385 1.00 . A A . 57 TYR HA   1 1 
        5  6256 1 1 57 TYR HB2  H  -0.194 -19.088   3.431 1.00 . A A . 57 TYR HB2  1 1 
        5  6257 1 1 57 TYR HB3  H   0.492 -18.565   4.964 1.00 . A A . 57 TYR HB3  1 1 
        5  6258 1 1 57 TYR HD1  H  -0.996 -17.916   6.841 1.00 . A A . 57 TYR HD1  1 1 
        5  6259 1 1 57 TYR HD2  H  -2.571 -19.489   3.205 1.00 . A A . 57 TYR HD2  1 1 
        5  6260 1 1 57 TYR HE1  H  -3.137 -18.360   7.964 1.00 . A A . 57 TYR HE1  1 1 
        5  6261 1 1 57 TYR HE2  H  -4.716 -19.930   4.323 1.00 . A A . 57 TYR HE2  1 1 
        5  6262 1 1 57 TYR HH   H  -5.557 -18.598   7.274 1.00 . A A . 57 TYR HH   1 1 
        5  6263 1 1 57 TYR N    N  -0.462 -15.991   4.776 1.00 . A A . 57 TYR N    1 1 
        5  6264 1 1 57 TYR O    O  -1.395 -17.695   1.760 1.00 . A A . 57 TYR O    1 1 
        5  6265 1 1 57 TYR OH   O  -5.258 -19.411   6.839 1.00 . A A . 57 TYR OH   1 1 
        5  6266 1 1 58 TYR C    C  -1.829 -15.602  -0.190 1.00 . A A . 58 TYR C    1 1 
        5  6267 1 1 58 TYR CA   C  -2.421 -15.166   1.165 1.00 . A A . 58 TYR CA   1 1 
        5  6268 1 1 58 TYR CB   C  -2.686 -13.652   1.149 1.00 . A A . 58 TYR CB   1 1 
        5  6269 1 1 58 TYR CD1  C  -0.473 -12.615   1.829 1.00 . A A . 58 TYR CD1  1 1 
        5  6270 1 1 58 TYR CD2  C  -1.252 -12.233  -0.396 1.00 . A A . 58 TYR CD2  1 1 
        5  6271 1 1 58 TYR CE1  C   0.654 -11.862   1.564 1.00 . A A . 58 TYR CE1  1 1 
        5  6272 1 1 58 TYR CE2  C  -0.125 -11.480  -0.665 1.00 . A A . 58 TYR CE2  1 1 
        5  6273 1 1 58 TYR CG   C  -1.449 -12.814   0.857 1.00 . A A . 58 TYR CG   1 1 
        5  6274 1 1 58 TYR CZ   C   0.825 -11.299   0.317 1.00 . A A . 58 TYR CZ   1 1 
        5  6275 1 1 58 TYR H    H  -1.267 -14.804   2.910 1.00 . A A . 58 TYR H    1 1 
        5  6276 1 1 58 TYR HA   H  -3.359 -15.682   1.316 1.00 . A A . 58 TYR HA   1 1 
        5  6277 1 1 58 TYR HB2  H  -3.425 -13.430   0.392 1.00 . A A . 58 TYR HB2  1 1 
        5  6278 1 1 58 TYR HB3  H  -3.071 -13.352   2.115 1.00 . A A . 58 TYR HB3  1 1 
        5  6279 1 1 58 TYR HD1  H  -0.606 -13.058   2.806 1.00 . A A . 58 TYR HD1  1 1 
        5  6280 1 1 58 TYR HD2  H  -1.998 -12.377  -1.164 1.00 . A A . 58 TYR HD2  1 1 
        5  6281 1 1 58 TYR HE1  H   1.400 -11.720   2.333 1.00 . A A . 58 TYR HE1  1 1 
        5  6282 1 1 58 TYR HE2  H   0.009 -11.039  -1.644 1.00 . A A . 58 TYR HE2  1 1 
        5  6283 1 1 58 TYR HH   H   1.705  -9.775  -0.470 1.00 . A A . 58 TYR HH   1 1 
        5  6284 1 1 58 TYR N    N  -1.537 -15.511   2.288 1.00 . A A . 58 TYR N    1 1 
        5  6285 1 1 58 TYR O    O  -0.609 -15.598  -0.382 1.00 . A A . 58 TYR O    1 1 
        5  6286 1 1 58 TYR OH   O   1.950 -10.546   0.053 1.00 . A A . 58 TYR OH   1 1 
        5  6287 1 1 59 ALA C    C  -2.109 -15.128  -3.372 1.00 . A A . 59 ALA C    1 1 
        5  6288 1 1 59 ALA CA   C  -2.272 -16.363  -2.473 1.00 . A A . 59 ALA CA   1 1 
        5  6289 1 1 59 ALA CB   C  -3.274 -17.339  -3.082 1.00 . A A . 59 ALA CB   1 1 
        5  6290 1 1 59 ALA H    H  -3.655 -15.981  -0.906 1.00 . A A . 59 ALA H    1 1 
        5  6291 1 1 59 ALA HA   H  -1.316 -16.867  -2.390 1.00 . A A . 59 ALA HA   1 1 
        5  6292 1 1 59 ALA HB1  H  -2.919 -17.667  -4.049 1.00 . A A . 59 ALA HB1  1 1 
        5  6293 1 1 59 ALA HB2  H  -4.231 -16.850  -3.198 1.00 . A A . 59 ALA HB2  1 1 
        5  6294 1 1 59 ALA HB3  H  -3.384 -18.196  -2.433 1.00 . A A . 59 ALA HB3  1 1 
        5  6295 1 1 59 ALA N    N  -2.699 -15.975  -1.124 1.00 . A A . 59 ALA N    1 1 
        5  6296 1 1 59 ALA O    O  -2.777 -14.111  -3.173 1.00 . A A . 59 ALA O    1 1 
        5  6297 1 1 60 ASN C    C  -2.199 -13.751  -6.114 1.00 . A A . 60 ASN C    1 1 
        5  6298 1 1 60 ASN CA   C  -0.966 -14.083  -5.258 1.00 . A A . 60 ASN CA   1 1 
        5  6299 1 1 60 ASN CB   C   0.250 -14.370  -6.147 1.00 . A A . 60 ASN CB   1 1 
        5  6300 1 1 60 ASN CG   C   1.518 -14.569  -5.335 1.00 . A A . 60 ASN CG   1 1 
        5  6301 1 1 60 ASN H    H  -0.734 -16.056  -4.494 1.00 . A A . 60 ASN H    1 1 
        5  6302 1 1 60 ASN HA   H  -0.743 -13.224  -4.637 1.00 . A A . 60 ASN HA   1 1 
        5  6303 1 1 60 ASN HB2  H   0.067 -15.266  -6.724 1.00 . A A . 60 ASN HB2  1 1 
        5  6304 1 1 60 ASN HB3  H   0.404 -13.537  -6.822 1.00 . A A . 60 ASN HB3  1 1 
        5  6305 1 1 60 ASN HD21 H   2.270 -15.755  -6.725 1.00 . A A . 60 ASN HD21 1 1 
        5  6306 1 1 60 ASN HD22 H   3.268 -15.485  -5.343 1.00 . A A . 60 ASN HD22 1 1 
        5  6307 1 1 60 ASN N    N  -1.223 -15.215  -4.361 1.00 . A A . 60 ASN N    1 1 
        5  6308 1 1 60 ASN ND2  N   2.443 -15.349  -5.852 1.00 . A A . 60 ASN ND2  1 1 
        5  6309 1 1 60 ASN O    O  -2.498 -14.436  -7.094 1.00 . A A . 60 ASN O    1 1 
        5  6310 1 1 60 ASN OD1  O   1.665 -14.021  -4.245 1.00 . A A . 60 ASN OD1  1 1 
        5  6311 1 1 61 VAL C    C  -3.803 -11.720  -7.823 1.00 . A A . 61 VAL C    1 1 
        5  6312 1 1 61 VAL CA   C  -4.127 -12.257  -6.410 1.00 . A A . 61 VAL CA   1 1 
        5  6313 1 1 61 VAL CB   C  -4.851 -11.163  -5.578 1.00 . A A . 61 VAL CB   1 1 
        5  6314 1 1 61 VAL CG1  C  -3.989  -9.904  -5.460 1.00 . A A . 61 VAL CG1  1 1 
        5  6315 1 1 61 VAL CG2  C  -6.224 -10.839  -6.163 1.00 . A A . 61 VAL CG2  1 1 
        5  6316 1 1 61 VAL H    H  -2.639 -12.230  -4.901 1.00 . A A . 61 VAL H    1 1 
        5  6317 1 1 61 VAL HA   H  -4.792 -13.106  -6.503 1.00 . A A . 61 VAL HA   1 1 
        5  6318 1 1 61 VAL HB   H  -5.001 -11.552  -4.578 1.00 . A A . 61 VAL HB   1 1 
        5  6319 1 1 61 VAL HG11 H  -4.504  -9.166  -4.862 1.00 . A A . 61 VAL HG11 1 1 
        5  6320 1 1 61 VAL HG12 H  -3.801  -9.501  -6.445 1.00 . A A . 61 VAL HG12 1 1 
        5  6321 1 1 61 VAL HG13 H  -3.048 -10.153  -4.990 1.00 . A A . 61 VAL HG13 1 1 
        5  6322 1 1 61 VAL HG21 H  -6.106 -10.441  -7.163 1.00 . A A . 61 VAL HG21 1 1 
        5  6323 1 1 61 VAL HG22 H  -6.720 -10.107  -5.541 1.00 . A A . 61 VAL HG22 1 1 
        5  6324 1 1 61 VAL HG23 H  -6.821 -11.738  -6.203 1.00 . A A . 61 VAL HG23 1 1 
        5  6325 1 1 61 VAL N    N  -2.920 -12.707  -5.708 1.00 . A A . 61 VAL N    1 1 
        5  6326 1 1 61 VAL O    O  -2.665 -11.334  -8.104 1.00 . A A . 61 VAL O    1 1 
        5  6327 1 1 62 SER C    C  -4.014  -9.795 -10.099 1.00 . A A . 62 SER C    1 1 
        5  6328 1 1 62 SER CA   C  -4.638 -11.200 -10.083 1.00 . A A . 62 SER CA   1 1 
        5  6329 1 1 62 SER CB   C  -5.989 -11.164 -10.811 1.00 . A A . 62 SER CB   1 1 
        5  6330 1 1 62 SER H    H  -5.680 -12.068  -8.440 1.00 . A A . 62 SER H    1 1 
        5  6331 1 1 62 SER HA   H  -3.979 -11.879 -10.607 1.00 . A A . 62 SER HA   1 1 
        5  6332 1 1 62 SER HB2  H  -6.631 -10.433 -10.341 1.00 . A A . 62 SER HB2  1 1 
        5  6333 1 1 62 SER HB3  H  -5.833 -10.890 -11.845 1.00 . A A . 62 SER HB3  1 1 
        5  6334 1 1 62 SER HG   H  -6.416 -12.930 -11.566 1.00 . A A . 62 SER HG   1 1 
        5  6335 1 1 62 SER N    N  -4.806 -11.709  -8.708 1.00 . A A . 62 SER N    1 1 
        5  6336 1 1 62 SER O    O  -4.449  -8.899  -9.369 1.00 . A A . 62 SER O    1 1 
        5  6337 1 1 62 SER OG   O  -6.635 -12.427 -10.769 1.00 . A A . 62 SER OG   1 1 
        5  6338 1 1 63 ALA C    C  -3.117  -7.139 -11.355 1.00 . A A . 63 ALA C    1 1 
        5  6339 1 1 63 ALA CA   C  -2.246  -8.356 -11.004 1.00 . A A . 63 ALA CA   1 1 
        5  6340 1 1 63 ALA CB   C  -1.101  -8.486 -11.999 1.00 . A A . 63 ALA CB   1 1 
        5  6341 1 1 63 ALA H    H  -2.771 -10.333 -11.570 1.00 . A A . 63 ALA H    1 1 
        5  6342 1 1 63 ALA HA   H  -1.815  -8.197 -10.025 1.00 . A A . 63 ALA HA   1 1 
        5  6343 1 1 63 ALA HB1  H  -0.512  -9.360 -11.761 1.00 . A A . 63 ALA HB1  1 1 
        5  6344 1 1 63 ALA HB2  H  -0.475  -7.605 -11.946 1.00 . A A . 63 ALA HB2  1 1 
        5  6345 1 1 63 ALA HB3  H  -1.499  -8.582 -12.999 1.00 . A A . 63 ALA HB3  1 1 
        5  6346 1 1 63 ALA N    N  -3.010  -9.609 -10.954 1.00 . A A . 63 ALA N    1 1 
        5  6347 1 1 63 ALA O    O  -2.932  -6.064 -10.793 1.00 . A A . 63 ALA O    1 1 
        5  6348 1 1 64 ALA C    C  -5.490  -5.357 -11.614 1.00 . A A . 64 ALA C    1 1 
        5  6349 1 1 64 ALA CA   C  -4.914  -6.215 -12.755 1.00 . A A . 64 ALA CA   1 1 
        5  6350 1 1 64 ALA CB   C  -6.044  -6.762 -13.613 1.00 . A A . 64 ALA CB   1 1 
        5  6351 1 1 64 ALA H    H  -4.206  -8.218 -12.637 1.00 . A A . 64 ALA H    1 1 
        5  6352 1 1 64 ALA HA   H  -4.298  -5.584 -13.383 1.00 . A A . 64 ALA HA   1 1 
        5  6353 1 1 64 ALA HB1  H  -5.633  -7.362 -14.411 1.00 . A A . 64 ALA HB1  1 1 
        5  6354 1 1 64 ALA HB2  H  -6.606  -5.941 -14.035 1.00 . A A . 64 ALA HB2  1 1 
        5  6355 1 1 64 ALA HB3  H  -6.698  -7.371 -13.005 1.00 . A A . 64 ALA HB3  1 1 
        5  6356 1 1 64 ALA N    N  -4.068  -7.319 -12.270 1.00 . A A . 64 ALA N    1 1 
        5  6357 1 1 64 ALA O    O  -5.326  -4.136 -11.601 1.00 . A A . 64 ALA O    1 1 
        5  6358 1 1 65 LYS C    C  -5.710  -4.641  -8.619 1.00 . A A . 65 LYS C    1 1 
        5  6359 1 1 65 LYS CA   C  -6.773  -5.289  -9.529 1.00 . A A . 65 LYS CA   1 1 
        5  6360 1 1 65 LYS CB   C  -7.680  -6.248  -8.733 1.00 . A A . 65 LYS CB   1 1 
        5  6361 1 1 65 LYS CD   C  -7.861  -5.942  -6.199 1.00 . A A . 65 LYS CD   1 1 
        5  6362 1 1 65 LYS CE   C  -8.449  -7.233  -5.630 1.00 . A A . 65 LYS CE   1 1 
        5  6363 1 1 65 LYS CG   C  -8.441  -5.584  -7.574 1.00 . A A . 65 LYS CG   1 1 
        5  6364 1 1 65 LYS H    H  -6.228  -6.976 -10.702 1.00 . A A . 65 LYS H    1 1 
        5  6365 1 1 65 LYS HA   H  -7.385  -4.501  -9.947 1.00 . A A . 65 LYS HA   1 1 
        5  6366 1 1 65 LYS HB2  H  -8.407  -6.674  -9.412 1.00 . A A . 65 LYS HB2  1 1 
        5  6367 1 1 65 LYS HB3  H  -7.072  -7.046  -8.331 1.00 . A A . 65 LYS HB3  1 1 
        5  6368 1 1 65 LYS HD2  H  -6.790  -6.061  -6.291 1.00 . A A . 65 LYS HD2  1 1 
        5  6369 1 1 65 LYS HD3  H  -8.070  -5.133  -5.513 1.00 . A A . 65 LYS HD3  1 1 
        5  6370 1 1 65 LYS HE2  H  -7.945  -7.461  -4.702 1.00 . A A . 65 LYS HE2  1 1 
        5  6371 1 1 65 LYS HE3  H  -9.501  -7.075  -5.432 1.00 . A A . 65 LYS HE3  1 1 
        5  6372 1 1 65 LYS HG2  H  -8.395  -4.510  -7.697 1.00 . A A . 65 LYS HG2  1 1 
        5  6373 1 1 65 LYS HG3  H  -9.478  -5.899  -7.610 1.00 . A A . 65 LYS HG3  1 1 
        5  6374 1 1 65 LYS HZ1  H  -7.304  -8.526  -6.805 1.00 . A A . 65 LYS HZ1  1 1 
        5  6375 1 1 65 LYS HZ2  H  -8.851  -8.234  -7.419 1.00 . A A . 65 LYS HZ2  1 1 
        5  6376 1 1 65 LYS HZ3  H  -8.649  -9.259  -6.093 1.00 . A A . 65 LYS HZ3  1 1 
        5  6377 1 1 65 LYS N    N  -6.153  -6.003 -10.654 1.00 . A A . 65 LYS N    1 1 
        5  6378 1 1 65 LYS NZ   N  -8.301  -8.392  -6.549 1.00 . A A . 65 LYS NZ   1 1 
        5  6379 1 1 65 LYS O    O  -5.989  -3.679  -7.904 1.00 . A A . 65 LYS O    1 1 
        5  6380 1 1 66 CYS C    C  -2.760  -3.383  -8.627 1.00 . A A . 66 CYS C    1 1 
        5  6381 1 1 66 CYS CA   C  -3.373  -4.588  -7.895 1.00 . A A . 66 CYS CA   1 1 
        5  6382 1 1 66 CYS CB   C  -2.290  -5.642  -7.639 1.00 . A A . 66 CYS CB   1 1 
        5  6383 1 1 66 CYS H    H  -4.325  -5.953  -9.220 1.00 . A A . 66 CYS H    1 1 
        5  6384 1 1 66 CYS HA   H  -3.765  -4.252  -6.943 1.00 . A A . 66 CYS HA   1 1 
        5  6385 1 1 66 CYS HB2  H  -2.716  -6.453  -7.065 1.00 . A A . 66 CYS HB2  1 1 
        5  6386 1 1 66 CYS HB3  H  -1.938  -6.025  -8.586 1.00 . A A . 66 CYS HB3  1 1 
        5  6387 1 1 66 CYS HG   H  -0.868  -3.700  -6.797 1.00 . A A . 66 CYS HG   1 1 
        5  6388 1 1 66 CYS N    N  -4.487  -5.164  -8.660 1.00 . A A . 66 CYS N    1 1 
        5  6389 1 1 66 CYS O    O  -2.302  -2.424  -7.999 1.00 . A A . 66 CYS O    1 1 
        5  6390 1 1 66 CYS SG   S  -0.856  -5.024  -6.729 1.00 . A A . 66 CYS SG   1 1 
        5  6391 1 1 67 GLN C    C  -2.991  -1.034 -10.540 1.00 . A A . 67 GLN C    1 1 
        5  6392 1 1 67 GLN CA   C  -2.234  -2.345 -10.790 1.00 . A A . 67 GLN CA   1 1 
        5  6393 1 1 67 GLN CB   C  -2.319  -2.710 -12.281 1.00 . A A . 67 GLN CB   1 1 
        5  6394 1 1 67 GLN CD   C  -1.635  -4.283 -14.152 1.00 . A A . 67 GLN CD   1 1 
        5  6395 1 1 67 GLN CG   C  -1.516  -3.947 -12.672 1.00 . A A . 67 GLN CG   1 1 
        5  6396 1 1 67 GLN H    H  -3.145  -4.223 -10.402 1.00 . A A . 67 GLN H    1 1 
        5  6397 1 1 67 GLN HA   H  -1.196  -2.204 -10.522 1.00 . A A . 67 GLN HA   1 1 
        5  6398 1 1 67 GLN HB2  H  -3.354  -2.888 -12.535 1.00 . A A . 67 GLN HB2  1 1 
        5  6399 1 1 67 GLN HB3  H  -1.956  -1.873 -12.865 1.00 . A A . 67 GLN HB3  1 1 
        5  6400 1 1 67 GLN HE21 H   0.178  -5.078 -14.156 1.00 . A A . 67 GLN HE21 1 1 
        5  6401 1 1 67 GLN HE22 H  -0.664  -5.106 -15.663 1.00 . A A . 67 GLN HE22 1 1 
        5  6402 1 1 67 GLN HG2  H  -0.474  -3.772 -12.439 1.00 . A A . 67 GLN HG2  1 1 
        5  6403 1 1 67 GLN HG3  H  -1.873  -4.790 -12.098 1.00 . A A . 67 GLN HG3  1 1 
        5  6404 1 1 67 GLN N    N  -2.769  -3.432  -9.961 1.00 . A A . 67 GLN N    1 1 
        5  6405 1 1 67 GLN NE2  N  -0.605  -4.883 -14.713 1.00 . A A . 67 GLN NE2  1 1 
        5  6406 1 1 67 GLN O    O  -2.391   0.000 -10.241 1.00 . A A . 67 GLN O    1 1 
        5  6407 1 1 67 GLN OE1  O  -2.649  -4.005 -14.791 1.00 . A A . 67 GLN OE1  1 1 
        5  6408 1 1 68 GLU C    C  -5.164   0.576  -8.996 1.00 . A A . 68 GLU C    1 1 
        5  6409 1 1 68 GLU CA   C  -5.151   0.101 -10.458 1.00 . A A . 68 GLU CA   1 1 
        5  6410 1 1 68 GLU CB   C  -6.575  -0.151 -10.970 1.00 . A A . 68 GLU CB   1 1 
        5  6411 1 1 68 GLU CD   C  -5.956   0.725 -13.275 1.00 . A A . 68 GLU CD   1 1 
        5  6412 1 1 68 GLU CG   C  -6.641  -0.381 -12.480 1.00 . A A . 68 GLU CG   1 1 
        5  6413 1 1 68 GLU H    H  -4.744  -1.945 -10.867 1.00 . A A . 68 GLU H    1 1 
        5  6414 1 1 68 GLU HA   H  -4.714   0.890 -11.056 1.00 . A A . 68 GLU HA   1 1 
        5  6415 1 1 68 GLU HB2  H  -6.976  -1.023 -10.475 1.00 . A A . 68 GLU HB2  1 1 
        5  6416 1 1 68 GLU HB3  H  -7.192   0.704 -10.730 1.00 . A A . 68 GLU HB3  1 1 
        5  6417 1 1 68 GLU HG2  H  -6.163  -1.324 -12.708 1.00 . A A . 68 GLU HG2  1 1 
        5  6418 1 1 68 GLU HG3  H  -7.680  -0.430 -12.778 1.00 . A A . 68 GLU HG3  1 1 
        5  6419 1 1 68 GLU N    N  -4.317  -1.088 -10.648 1.00 . A A . 68 GLU N    1 1 
        5  6420 1 1 68 GLU O    O  -5.632   1.675  -8.699 1.00 . A A . 68 GLU O    1 1 
        5  6421 1 1 68 GLU OE1  O  -6.406   1.888 -13.198 1.00 . A A . 68 GLU OE1  1 1 
        5  6422 1 1 68 GLU OE2  O  -4.960   0.439 -13.973 1.00 . A A . 68 GLU OE2  1 1 
        5  6423 1 1 69 PHE C    C  -3.112   1.070  -6.709 1.00 . A A . 69 PHE C    1 1 
        5  6424 1 1 69 PHE CA   C  -4.385   0.215  -6.719 1.00 . A A . 69 PHE CA   1 1 
        5  6425 1 1 69 PHE CB   C  -4.243  -0.965  -5.748 1.00 . A A . 69 PHE CB   1 1 
        5  6426 1 1 69 PHE CD1  C  -4.567   0.303  -3.593 1.00 . A A . 69 PHE CD1  1 1 
        5  6427 1 1 69 PHE CD2  C  -2.588  -1.013  -3.847 1.00 . A A . 69 PHE CD2  1 1 
        5  6428 1 1 69 PHE CE1  C  -4.149   0.686  -2.332 1.00 . A A . 69 PHE CE1  1 1 
        5  6429 1 1 69 PHE CE2  C  -2.169  -0.630  -2.587 1.00 . A A . 69 PHE CE2  1 1 
        5  6430 1 1 69 PHE CG   C  -3.792  -0.553  -4.366 1.00 . A A . 69 PHE CG   1 1 
        5  6431 1 1 69 PHE CZ   C  -2.950   0.219  -1.828 1.00 . A A . 69 PHE CZ   1 1 
        5  6432 1 1 69 PHE H    H  -4.461  -1.176  -8.325 1.00 . A A . 69 PHE H    1 1 
        5  6433 1 1 69 PHE HA   H  -5.219   0.832  -6.407 1.00 . A A . 69 PHE HA   1 1 
        5  6434 1 1 69 PHE HB2  H  -5.199  -1.461  -5.650 1.00 . A A . 69 PHE HB2  1 1 
        5  6435 1 1 69 PHE HB3  H  -3.521  -1.667  -6.144 1.00 . A A . 69 PHE HB3  1 1 
        5  6436 1 1 69 PHE HD1  H  -5.504   0.670  -3.984 1.00 . A A . 69 PHE HD1  1 1 
        5  6437 1 1 69 PHE HD2  H  -1.975  -1.678  -4.438 1.00 . A A . 69 PHE HD2  1 1 
        5  6438 1 1 69 PHE HE1  H  -4.760   1.350  -1.740 1.00 . A A . 69 PHE HE1  1 1 
        5  6439 1 1 69 PHE HE2  H  -1.231  -0.997  -2.196 1.00 . A A . 69 PHE HE2  1 1 
        5  6440 1 1 69 PHE HZ   H  -2.624   0.516  -0.843 1.00 . A A . 69 PHE HZ   1 1 
        5  6441 1 1 69 PHE N    N  -4.655  -0.247  -8.083 1.00 . A A . 69 PHE N    1 1 
        5  6442 1 1 69 PHE O    O  -3.090   2.173  -6.156 1.00 . A A . 69 PHE O    1 1 
        5  6443 1 1 70 GLY C    C  -1.015   2.605  -8.279 1.00 . A A . 70 GLY C    1 1 
        5  6444 1 1 70 GLY CA   C  -0.817   1.312  -7.491 1.00 . A A . 70 GLY CA   1 1 
        5  6445 1 1 70 GLY H    H  -2.115  -0.356  -7.709 1.00 . A A . 70 GLY H    1 1 
        5  6446 1 1 70 GLY HA2  H  -0.434   1.557  -6.511 1.00 . A A . 70 GLY HA2  1 1 
        5  6447 1 1 70 GLY HA3  H  -0.092   0.696  -8.004 1.00 . A A . 70 GLY HA3  1 1 
        5  6448 1 1 70 GLY N    N  -2.054   0.552  -7.340 1.00 . A A . 70 GLY N    1 1 
        5  6449 1 1 70 GLY O    O  -0.258   3.564  -8.116 1.00 . A A . 70 GLY O    1 1 
        5  6450 1 1 71 ARG C    C  -2.598   5.025  -8.943 1.00 . A A . 71 ARG C    1 1 
        5  6451 1 1 71 ARG CA   C  -2.431   3.820  -9.887 1.00 . A A . 71 ARG CA   1 1 
        5  6452 1 1 71 ARG CB   C  -3.756   3.554 -10.618 1.00 . A A . 71 ARG CB   1 1 
        5  6453 1 1 71 ARG CD   C  -3.471   4.750 -12.826 1.00 . A A . 71 ARG CD   1 1 
        5  6454 1 1 71 ARG CG   C  -4.232   4.701 -11.508 1.00 . A A . 71 ARG CG   1 1 
        5  6455 1 1 71 ARG CZ   C  -2.996   3.250 -14.694 1.00 . A A . 71 ARG CZ   1 1 
        5  6456 1 1 71 ARG H    H  -2.532   1.784  -9.291 1.00 . A A . 71 ARG H    1 1 
        5  6457 1 1 71 ARG HA   H  -1.660   4.038 -10.612 1.00 . A A . 71 ARG HA   1 1 
        5  6458 1 1 71 ARG HB2  H  -3.641   2.674 -11.235 1.00 . A A . 71 ARG HB2  1 1 
        5  6459 1 1 71 ARG HB3  H  -4.524   3.360  -9.882 1.00 . A A . 71 ARG HB3  1 1 
        5  6460 1 1 71 ARG HD2  H  -3.836   5.586 -13.406 1.00 . A A . 71 ARG HD2  1 1 
        5  6461 1 1 71 ARG HD3  H  -2.420   4.887 -12.618 1.00 . A A . 71 ARG HD3  1 1 
        5  6462 1 1 71 ARG HE   H  -4.297   2.867 -13.273 1.00 . A A . 71 ARG HE   1 1 
        5  6463 1 1 71 ARG HG2  H  -5.284   4.569 -11.716 1.00 . A A . 71 ARG HG2  1 1 
        5  6464 1 1 71 ARG HG3  H  -4.084   5.634 -10.983 1.00 . A A . 71 ARG HG3  1 1 
        5  6465 1 1 71 ARG HH11 H  -1.982   4.962 -14.740 1.00 . A A . 71 ARG HH11 1 1 
        5  6466 1 1 71 ARG HH12 H  -1.657   3.861 -16.029 1.00 . A A . 71 ARG HH12 1 1 
        5  6467 1 1 71 ARG HH21 H  -3.859   1.477 -14.905 1.00 . A A . 71 ARG HH21 1 1 
        5  6468 1 1 71 ARG HH22 H  -2.714   1.908 -16.133 1.00 . A A . 71 ARG HH22 1 1 
        5  6469 1 1 71 ARG N    N  -2.035   2.617  -9.141 1.00 . A A . 71 ARG N    1 1 
        5  6470 1 1 71 ARG NE   N  -3.648   3.526 -13.601 1.00 . A A . 71 ARG NE   1 1 
        5  6471 1 1 71 ARG NH1  N  -2.147   4.091 -15.192 1.00 . A A . 71 ARG NH1  1 1 
        5  6472 1 1 71 ARG NH2  N  -3.202   2.126 -15.290 1.00 . A A . 71 ARG NH2  1 1 
        5  6473 1 1 71 ARG O    O  -1.797   5.966  -8.958 1.00 . A A . 71 ARG O    1 1 
        5  6474 1 1 72 TRP C    C  -2.760   6.123  -6.110 1.00 . A A . 72 TRP C    1 1 
        5  6475 1 1 72 TRP CA   C  -3.904   6.022  -7.126 1.00 . A A . 72 TRP CA   1 1 
        5  6476 1 1 72 TRP CB   C  -5.229   5.738  -6.403 1.00 . A A . 72 TRP CB   1 1 
        5  6477 1 1 72 TRP CD1  C  -6.015   7.973  -5.403 1.00 . A A . 72 TRP CD1  1 1 
        5  6478 1 1 72 TRP CD2  C  -5.386   6.457  -3.879 1.00 . A A . 72 TRP CD2  1 1 
        5  6479 1 1 72 TRP CE2  C  -5.790   7.627  -3.209 1.00 . A A . 72 TRP CE2  1 1 
        5  6480 1 1 72 TRP CE3  C  -4.951   5.365  -3.125 1.00 . A A . 72 TRP CE3  1 1 
        5  6481 1 1 72 TRP CG   C  -5.535   6.699  -5.285 1.00 . A A . 72 TRP CG   1 1 
        5  6482 1 1 72 TRP CH2  C  -5.340   6.648  -1.108 1.00 . A A . 72 TRP CH2  1 1 
        5  6483 1 1 72 TRP CZ2  C  -5.770   7.735  -1.821 1.00 . A A . 72 TRP CZ2  1 1 
        5  6484 1 1 72 TRP CZ3  C  -4.932   5.471  -1.748 1.00 . A A . 72 TRP CZ3  1 1 
        5  6485 1 1 72 TRP H    H  -4.272   4.228  -8.195 1.00 . A A . 72 TRP H    1 1 
        5  6486 1 1 72 TRP HA   H  -3.987   6.965  -7.649 1.00 . A A . 72 TRP HA   1 1 
        5  6487 1 1 72 TRP HB2  H  -6.037   5.793  -7.118 1.00 . A A . 72 TRP HB2  1 1 
        5  6488 1 1 72 TRP HB3  H  -5.197   4.741  -5.985 1.00 . A A . 72 TRP HB3  1 1 
        5  6489 1 1 72 TRP HD1  H  -6.232   8.456  -6.345 1.00 . A A . 72 TRP HD1  1 1 
        5  6490 1 1 72 TRP HE1  H  -6.493   9.447  -3.982 1.00 . A A . 72 TRP HE1  1 1 
        5  6491 1 1 72 TRP HE3  H  -4.633   4.451  -3.602 1.00 . A A . 72 TRP HE3  1 1 
        5  6492 1 1 72 TRP HH2  H  -5.308   6.689  -0.029 1.00 . A A . 72 TRP HH2  1 1 
        5  6493 1 1 72 TRP HZ2  H  -6.081   8.638  -1.313 1.00 . A A . 72 TRP HZ2  1 1 
        5  6494 1 1 72 TRP HZ3  H  -4.599   4.637  -1.150 1.00 . A A . 72 TRP HZ3  1 1 
        5  6495 1 1 72 TRP N    N  -3.645   4.980  -8.123 1.00 . A A . 72 TRP N    1 1 
        5  6496 1 1 72 TRP NE1  N  -6.165   8.538  -4.160 1.00 . A A . 72 TRP NE1  1 1 
        5  6497 1 1 72 TRP O    O  -2.361   7.220  -5.720 1.00 . A A . 72 TRP O    1 1 
        5  6498 1 1 73 TYR C    C   0.075   5.732  -5.092 1.00 . A A . 73 TYR C    1 1 
        5  6499 1 1 73 TYR CA   C  -1.170   4.917  -4.683 1.00 . A A . 73 TYR CA   1 1 
        5  6500 1 1 73 TYR CB   C  -0.788   3.457  -4.405 1.00 . A A . 73 TYR CB   1 1 
        5  6501 1 1 73 TYR CD1  C  -0.589   3.321  -1.886 1.00 . A A . 73 TYR CD1  1 1 
        5  6502 1 1 73 TYR CD2  C   1.391   3.013  -3.179 1.00 . A A . 73 TYR CD2  1 1 
        5  6503 1 1 73 TYR CE1  C   0.137   3.144  -0.724 1.00 . A A . 73 TYR CE1  1 1 
        5  6504 1 1 73 TYR CE2  C   2.124   2.835  -2.019 1.00 . A A . 73 TYR CE2  1 1 
        5  6505 1 1 73 TYR CG   C   0.022   3.259  -3.135 1.00 . A A . 73 TYR CG   1 1 
        5  6506 1 1 73 TYR CZ   C   1.490   2.902  -0.796 1.00 . A A . 73 TYR CZ   1 1 
        5  6507 1 1 73 TYR H    H  -2.554   4.134  -6.090 1.00 . A A . 73 TYR H    1 1 
        5  6508 1 1 73 TYR HA   H  -1.576   5.344  -3.777 1.00 . A A . 73 TYR HA   1 1 
        5  6509 1 1 73 TYR HB2  H  -1.691   2.869  -4.316 1.00 . A A . 73 TYR HB2  1 1 
        5  6510 1 1 73 TYR HB3  H  -0.206   3.080  -5.236 1.00 . A A . 73 TYR HB3  1 1 
        5  6511 1 1 73 TYR HD1  H  -1.651   3.510  -1.831 1.00 . A A . 73 TYR HD1  1 1 
        5  6512 1 1 73 TYR HD2  H   1.884   2.960  -4.140 1.00 . A A . 73 TYR HD2  1 1 
        5  6513 1 1 73 TYR HE1  H  -0.359   3.196   0.233 1.00 . A A . 73 TYR HE1  1 1 
        5  6514 1 1 73 TYR HE2  H   3.187   2.647  -2.074 1.00 . A A . 73 TYR HE2  1 1 
        5  6515 1 1 73 TYR HH   H   3.017   3.247   0.325 1.00 . A A . 73 TYR HH   1 1 
        5  6516 1 1 73 TYR N    N  -2.224   4.973  -5.703 1.00 . A A . 73 TYR N    1 1 
        5  6517 1 1 73 TYR O    O   0.678   6.412  -4.261 1.00 . A A . 73 TYR O    1 1 
        5  6518 1 1 73 TYR OH   O   2.214   2.725   0.362 1.00 . A A . 73 TYR OH   1 1 
        5  6519 1 1 74 LYS C    C   1.291   7.960  -6.799 1.00 . A A . 74 LYS C    1 1 
        5  6520 1 1 74 LYS CA   C   1.603   6.456  -6.862 1.00 . A A . 74 LYS CA   1 1 
        5  6521 1 1 74 LYS CB   C   1.993   6.051  -8.296 1.00 . A A . 74 LYS CB   1 1 
        5  6522 1 1 74 LYS CD   C   3.728   6.243 -10.160 1.00 . A A . 74 LYS CD   1 1 
        5  6523 1 1 74 LYS CE   C   2.734   6.511 -11.287 1.00 . A A . 74 LYS CE   1 1 
        5  6524 1 1 74 LYS CG   C   3.241   6.775  -8.808 1.00 . A A . 74 LYS CG   1 1 
        5  6525 1 1 74 LYS H    H  -0.023   5.079  -6.991 1.00 . A A . 74 LYS H    1 1 
        5  6526 1 1 74 LYS HA   H   2.440   6.256  -6.205 1.00 . A A . 74 LYS HA   1 1 
        5  6527 1 1 74 LYS HB2  H   2.182   4.986  -8.319 1.00 . A A . 74 LYS HB2  1 1 
        5  6528 1 1 74 LYS HB3  H   1.171   6.277  -8.961 1.00 . A A . 74 LYS HB3  1 1 
        5  6529 1 1 74 LYS HD2  H   4.665   6.723 -10.405 1.00 . A A . 74 LYS HD2  1 1 
        5  6530 1 1 74 LYS HD3  H   3.885   5.175 -10.078 1.00 . A A . 74 LYS HD3  1 1 
        5  6531 1 1 74 LYS HE2  H   1.833   5.947 -11.099 1.00 . A A . 74 LYS HE2  1 1 
        5  6532 1 1 74 LYS HE3  H   2.501   7.566 -11.304 1.00 . A A . 74 LYS HE3  1 1 
        5  6533 1 1 74 LYS HG2  H   3.016   7.826  -8.913 1.00 . A A . 74 LYS HG2  1 1 
        5  6534 1 1 74 LYS HG3  H   4.033   6.652  -8.083 1.00 . A A . 74 LYS HG3  1 1 
        5  6535 1 1 74 LYS HZ1  H   2.561   6.241 -13.357 1.00 . A A . 74 LYS HZ1  1 1 
        5  6536 1 1 74 LYS HZ2  H   3.575   5.116 -12.603 1.00 . A A . 74 LYS HZ2  1 1 
        5  6537 1 1 74 LYS HZ3  H   4.105   6.701 -12.855 1.00 . A A . 74 LYS HZ3  1 1 
        5  6538 1 1 74 LYS N    N   0.461   5.667  -6.371 1.00 . A A . 74 LYS N    1 1 
        5  6539 1 1 74 LYS NZ   N   3.280   6.114 -12.616 1.00 . A A . 74 LYS NZ   1 1 
        5  6540 1 1 74 LYS O    O   2.110   8.755  -6.336 1.00 . A A . 74 LYS O    1 1 
        5  6541 1 1 75 HIS C    C  -0.409  10.209  -5.695 1.00 . A A . 75 HIS C    1 1 
        5  6542 1 1 75 HIS CA   C  -0.354   9.739  -7.160 1.00 . A A . 75 HIS CA   1 1 
        5  6543 1 1 75 HIS CB   C  -1.732   9.911  -7.822 1.00 . A A . 75 HIS CB   1 1 
        5  6544 1 1 75 HIS CD2  C  -1.884   8.762 -10.146 1.00 . A A . 75 HIS CD2  1 1 
        5  6545 1 1 75 HIS CE1  C  -1.491  10.517 -11.393 1.00 . A A . 75 HIS CE1  1 1 
        5  6546 1 1 75 HIS CG   C  -1.701   9.816  -9.317 1.00 . A A . 75 HIS CG   1 1 
        5  6547 1 1 75 HIS H    H  -0.509   7.665  -7.629 1.00 . A A . 75 HIS H    1 1 
        5  6548 1 1 75 HIS HA   H   0.367  10.346  -7.690 1.00 . A A . 75 HIS HA   1 1 
        5  6549 1 1 75 HIS HB2  H  -2.399   9.145  -7.457 1.00 . A A . 75 HIS HB2  1 1 
        5  6550 1 1 75 HIS HB3  H  -2.133  10.881  -7.560 1.00 . A A . 75 HIS HB3  1 1 
        5  6551 1 1 75 HIS HD1  H  -1.286  11.818  -9.834 1.00 . A A . 75 HIS HD1  1 1 
        5  6552 1 1 75 HIS HD2  H  -2.101   7.747  -9.853 1.00 . A A . 75 HIS HD2  1 1 
        5  6553 1 1 75 HIS HE1  H  -1.332  11.154 -12.251 1.00 . A A . 75 HIS HE1  1 1 
        5  6554 1 1 75 HIS HE2  H  -1.678   8.664 -12.230 1.00 . A A . 75 HIS HE2  1 1 
        5  6555 1 1 75 HIS N    N   0.092   8.340  -7.246 1.00 . A A . 75 HIS N    1 1 
        5  6556 1 1 75 HIS ND1  N  -1.458  10.899 -10.135 1.00 . A A . 75 HIS ND1  1 1 
        5  6557 1 1 75 HIS NE2  N  -1.745   9.227 -11.429 1.00 . A A . 75 HIS NE2  1 1 
        5  6558 1 1 75 HIS O    O  -0.086  11.360  -5.386 1.00 . A A . 75 HIS O    1 1 
        5  6559 1 1 76 PHE C    C   0.560   9.852  -2.811 1.00 . A A . 76 PHE C    1 1 
        5  6560 1 1 76 PHE CA   C  -0.845   9.555  -3.361 1.00 . A A . 76 PHE CA   1 1 
        5  6561 1 1 76 PHE CB   C  -1.458   8.341  -2.641 1.00 . A A . 76 PHE CB   1 1 
        5  6562 1 1 76 PHE CD1  C  -2.271   9.252  -0.436 1.00 . A A . 76 PHE CD1  1 1 
        5  6563 1 1 76 PHE CD2  C  -0.509   7.640  -0.417 1.00 . A A . 76 PHE CD2  1 1 
        5  6564 1 1 76 PHE CE1  C  -2.230   9.315   0.945 1.00 . A A . 76 PHE CE1  1 1 
        5  6565 1 1 76 PHE CE2  C  -0.466   7.699   0.962 1.00 . A A . 76 PHE CE2  1 1 
        5  6566 1 1 76 PHE CG   C  -1.411   8.416  -1.134 1.00 . A A . 76 PHE CG   1 1 
        5  6567 1 1 76 PHE CZ   C  -1.327   8.538   1.643 1.00 . A A . 76 PHE CZ   1 1 
        5  6568 1 1 76 PHE H    H  -1.102   8.425  -5.131 1.00 . A A . 76 PHE H    1 1 
        5  6569 1 1 76 PHE HA   H  -1.474  10.417  -3.190 1.00 . A A . 76 PHE HA   1 1 
        5  6570 1 1 76 PHE HB2  H  -2.493   8.250  -2.932 1.00 . A A . 76 PHE HB2  1 1 
        5  6571 1 1 76 PHE HB3  H  -0.929   7.447  -2.947 1.00 . A A . 76 PHE HB3  1 1 
        5  6572 1 1 76 PHE HD1  H  -2.980   9.862  -0.981 1.00 . A A . 76 PHE HD1  1 1 
        5  6573 1 1 76 PHE HD2  H   0.168   6.987  -0.950 1.00 . A A . 76 PHE HD2  1 1 
        5  6574 1 1 76 PHE HE1  H  -2.905   9.974   1.478 1.00 . A A . 76 PHE HE1  1 1 
        5  6575 1 1 76 PHE HE2  H   0.242   7.089   1.506 1.00 . A A . 76 PHE HE2  1 1 
        5  6576 1 1 76 PHE HZ   H  -1.295   8.584   2.723 1.00 . A A . 76 PHE HZ   1 1 
        5  6577 1 1 76 PHE N    N  -0.811   9.300  -4.806 1.00 . A A . 76 PHE N    1 1 
        5  6578 1 1 76 PHE O    O   0.734  10.732  -1.966 1.00 . A A . 76 PHE O    1 1 
        5  6579 1 1 77 LYS C    C   3.540  10.607  -3.524 1.00 . A A . 77 LYS C    1 1 
        5  6580 1 1 77 LYS CA   C   2.951   9.342  -2.871 1.00 . A A . 77 LYS CA   1 1 
        5  6581 1 1 77 LYS CB   C   3.828   8.119  -3.194 1.00 . A A . 77 LYS CB   1 1 
        5  6582 1 1 77 LYS CD   C   4.385   5.699  -2.588 1.00 . A A . 77 LYS CD   1 1 
        5  6583 1 1 77 LYS CE   C   4.766   5.281  -4.012 1.00 . A A . 77 LYS CE   1 1 
        5  6584 1 1 77 LYS CG   C   3.346   6.826  -2.538 1.00 . A A . 77 LYS CG   1 1 
        5  6585 1 1 77 LYS H    H   1.365   8.402  -3.938 1.00 . A A . 77 LYS H    1 1 
        5  6586 1 1 77 LYS HA   H   2.943   9.488  -1.799 1.00 . A A . 77 LYS HA   1 1 
        5  6587 1 1 77 LYS HB2  H   3.839   7.974  -4.266 1.00 . A A . 77 LYS HB2  1 1 
        5  6588 1 1 77 LYS HB3  H   4.836   8.316  -2.857 1.00 . A A . 77 LYS HB3  1 1 
        5  6589 1 1 77 LYS HD2  H   5.277   6.031  -2.077 1.00 . A A . 77 LYS HD2  1 1 
        5  6590 1 1 77 LYS HD3  H   3.980   4.840  -2.071 1.00 . A A . 77 LYS HD3  1 1 
        5  6591 1 1 77 LYS HE2  H   5.172   4.281  -3.983 1.00 . A A . 77 LYS HE2  1 1 
        5  6592 1 1 77 LYS HE3  H   3.876   5.284  -4.627 1.00 . A A . 77 LYS HE3  1 1 
        5  6593 1 1 77 LYS HG2  H   3.111   7.029  -1.503 1.00 . A A . 77 LYS HG2  1 1 
        5  6594 1 1 77 LYS HG3  H   2.449   6.494  -3.045 1.00 . A A . 77 LYS HG3  1 1 
        5  6595 1 1 77 LYS HZ1  H   6.556   6.353  -3.954 1.00 . A A . 77 LYS HZ1  1 1 
        5  6596 1 1 77 LYS HZ2  H   5.346   7.101  -4.863 1.00 . A A . 77 LYS HZ2  1 1 
        5  6597 1 1 77 LYS HZ3  H   6.169   5.761  -5.484 1.00 . A A . 77 LYS HZ3  1 1 
        5  6598 1 1 77 LYS N    N   1.562   9.116  -3.293 1.00 . A A . 77 LYS N    1 1 
        5  6599 1 1 77 LYS NZ   N   5.777   6.186  -4.623 1.00 . A A . 77 LYS NZ   1 1 
        5  6600 1 1 77 LYS O    O   4.565  11.128  -3.075 1.00 . A A . 77 LYS O    1 1 
        5  6601 1 1 78 LYS C    C   2.617  13.551  -4.623 1.00 . A A . 78 LYS C    1 1 
        5  6602 1 1 78 LYS CA   C   3.311  12.331  -5.252 1.00 . A A . 78 LYS CA   1 1 
        5  6603 1 1 78 LYS CB   C   3.007  12.271  -6.760 1.00 . A A . 78 LYS CB   1 1 
        5  6604 1 1 78 LYS CD   C   3.453  11.167  -8.991 1.00 . A A . 78 LYS CD   1 1 
        5  6605 1 1 78 LYS CE   C   3.832  12.477  -9.676 1.00 . A A . 78 LYS CE   1 1 
        5  6606 1 1 78 LYS CG   C   3.781  11.184  -7.498 1.00 . A A . 78 LYS CG   1 1 
        5  6607 1 1 78 LYS H    H   2.130  10.589  -4.943 1.00 . A A . 78 LYS H    1 1 
        5  6608 1 1 78 LYS HA   H   4.379  12.437  -5.118 1.00 . A A . 78 LYS HA   1 1 
        5  6609 1 1 78 LYS HB2  H   1.950  12.086  -6.896 1.00 . A A . 78 LYS HB2  1 1 
        5  6610 1 1 78 LYS HB3  H   3.255  13.225  -7.205 1.00 . A A . 78 LYS HB3  1 1 
        5  6611 1 1 78 LYS HD2  H   3.999  10.360  -9.458 1.00 . A A . 78 LYS HD2  1 1 
        5  6612 1 1 78 LYS HD3  H   2.392  11.001  -9.114 1.00 . A A . 78 LYS HD3  1 1 
        5  6613 1 1 78 LYS HE2  H   3.266  13.283  -9.232 1.00 . A A . 78 LYS HE2  1 1 
        5  6614 1 1 78 LYS HE3  H   4.888  12.655  -9.530 1.00 . A A . 78 LYS HE3  1 1 
        5  6615 1 1 78 LYS HG2  H   4.839  11.360  -7.375 1.00 . A A . 78 LYS HG2  1 1 
        5  6616 1 1 78 LYS HG3  H   3.524  10.223  -7.072 1.00 . A A . 78 LYS HG3  1 1 
        5  6617 1 1 78 LYS HZ1  H   2.550  12.190 -11.299 1.00 . A A . 78 LYS HZ1  1 1 
        5  6618 1 1 78 LYS HZ2  H   4.147  11.726 -11.596 1.00 . A A . 78 LYS HZ2  1 1 
        5  6619 1 1 78 LYS HZ3  H   3.740  13.364 -11.566 1.00 . A A . 78 LYS HZ3  1 1 
        5  6620 1 1 78 LYS N    N   2.897  11.086  -4.590 1.00 . A A . 78 LYS N    1 1 
        5  6621 1 1 78 LYS NZ   N   3.548  12.438 -11.134 1.00 . A A . 78 LYS NZ   1 1 
        5  6622 1 1 78 LYS O    O   3.231  14.288  -3.848 1.00 . A A . 78 LYS O    1 1 
        5  6623 1 1 79 THR C    C  -0.849  14.982  -5.058 1.00 . A A . 79 THR C    1 1 
        5  6624 1 1 79 THR CA   C   0.556  14.896  -4.432 1.00 . A A . 79 THR CA   1 1 
        5  6625 1 1 79 THR CB   C   1.273  16.259  -4.660 1.00 . A A . 79 THR CB   1 1 
        5  6626 1 1 79 THR CG2  C   1.566  16.504  -6.139 1.00 . A A . 79 THR CG2  1 1 
        5  6627 1 1 79 THR H    H   0.885  13.095  -5.524 1.00 . A A . 79 THR H    1 1 
        5  6628 1 1 79 THR HA   H   0.444  14.755  -3.365 1.00 . A A . 79 THR HA   1 1 
        5  6629 1 1 79 THR HB   H   2.212  16.242  -4.123 1.00 . A A . 79 THR HB   1 1 
        5  6630 1 1 79 THR HG1  H   0.602  17.406  -3.190 1.00 . A A . 79 THR HG1  1 1 
        5  6631 1 1 79 THR HG21 H   0.638  16.524  -6.693 1.00 . A A . 79 THR HG21 1 1 
        5  6632 1 1 79 THR HG22 H   2.195  15.711  -6.520 1.00 . A A . 79 THR HG22 1 1 
        5  6633 1 1 79 THR HG23 H   2.073  17.451  -6.255 1.00 . A A . 79 THR HG23 1 1 
        5  6634 1 1 79 THR N    N   1.332  13.749  -4.949 1.00 . A A . 79 THR N    1 1 
        5  6635 1 1 79 THR O    O  -1.839  15.202  -4.358 1.00 . A A . 79 THR O    1 1 
        5  6636 1 1 79 THR OG1  O   0.469  17.336  -4.145 1.00 . A A . 79 THR OG1  1 1 
        5  6637 1 1 80 LYS C    C  -2.691  13.757  -7.821 1.00 . A A . 80 LYS C    1 1 
        5  6638 1 1 80 LYS CA   C  -2.195  15.027  -7.109 1.00 . A A . 80 LYS CA   1 1 
        5  6639 1 1 80 LYS CB   C  -1.987  16.153  -8.133 1.00 . A A . 80 LYS CB   1 1 
        5  6640 1 1 80 LYS CD   C  -2.948  17.657  -9.914 1.00 . A A . 80 LYS CD   1 1 
        5  6641 1 1 80 LYS CE   C  -4.178  18.043 -10.727 1.00 . A A . 80 LYS CE   1 1 
        5  6642 1 1 80 LYS CG   C  -3.231  16.514  -8.943 1.00 . A A . 80 LYS CG   1 1 
        5  6643 1 1 80 LYS H    H  -0.145  14.525  -6.876 1.00 . A A . 80 LYS H    1 1 
        5  6644 1 1 80 LYS HA   H  -2.945  15.342  -6.397 1.00 . A A . 80 LYS HA   1 1 
        5  6645 1 1 80 LYS HB2  H  -1.660  17.041  -7.608 1.00 . A A . 80 LYS HB2  1 1 
        5  6646 1 1 80 LYS HB3  H  -1.210  15.852  -8.823 1.00 . A A . 80 LYS HB3  1 1 
        5  6647 1 1 80 LYS HD2  H  -2.619  18.520  -9.351 1.00 . A A . 80 LYS HD2  1 1 
        5  6648 1 1 80 LYS HD3  H  -2.162  17.353 -10.593 1.00 . A A . 80 LYS HD3  1 1 
        5  6649 1 1 80 LYS HE2  H  -4.456  17.210 -11.356 1.00 . A A . 80 LYS HE2  1 1 
        5  6650 1 1 80 LYS HE3  H  -4.989  18.270 -10.049 1.00 . A A . 80 LYS HE3  1 1 
        5  6651 1 1 80 LYS HG2  H  -3.549  15.646  -9.505 1.00 . A A . 80 LYS HG2  1 1 
        5  6652 1 1 80 LYS HG3  H  -4.017  16.815  -8.264 1.00 . A A . 80 LYS HG3  1 1 
        5  6653 1 1 80 LYS HZ1  H  -4.770  19.484 -12.116 1.00 . A A . 80 LYS HZ1  1 1 
        5  6654 1 1 80 LYS HZ2  H  -3.150  19.025 -12.257 1.00 . A A . 80 LYS HZ2  1 1 
        5  6655 1 1 80 LYS HZ3  H  -3.636  20.042 -10.996 1.00 . A A . 80 LYS HZ3  1 1 
        5  6656 1 1 80 LYS N    N  -0.939  14.805  -6.378 1.00 . A A . 80 LYS N    1 1 
        5  6657 1 1 80 LYS NZ   N  -3.916  19.229 -11.583 1.00 . A A . 80 LYS NZ   1 1 
        5  6658 1 1 80 LYS O    O  -1.936  13.098  -8.541 1.00 . A A . 80 LYS O    1 1 
        5  6659 1 1 81 ASP C    C  -5.725  12.758  -9.244 1.00 . A A . 81 ASP C    1 1 
        5  6660 1 1 81 ASP CA   C  -4.605  12.286  -8.298 1.00 . A A . 81 ASP CA   1 1 
        5  6661 1 1 81 ASP CB   C  -5.165  11.289  -7.272 1.00 . A A . 81 ASP CB   1 1 
        5  6662 1 1 81 ASP CG   C  -6.300  11.871  -6.443 1.00 . A A . 81 ASP CG   1 1 
        5  6663 1 1 81 ASP H    H  -4.495  13.943  -6.972 1.00 . A A . 81 ASP H    1 1 
        5  6664 1 1 81 ASP HA   H  -3.847  11.787  -8.890 1.00 . A A . 81 ASP HA   1 1 
        5  6665 1 1 81 ASP HB2  H  -5.534  10.415  -7.792 1.00 . A A . 81 ASP HB2  1 1 
        5  6666 1 1 81 ASP HB3  H  -4.370  10.990  -6.603 1.00 . A A . 81 ASP HB3  1 1 
        5  6667 1 1 81 ASP N    N  -3.967  13.421  -7.614 1.00 . A A . 81 ASP N    1 1 
        5  6668 1 1 81 ASP O    O  -6.158  12.016 -10.128 1.00 . A A . 81 ASP O    1 1 
        5  6669 1 1 81 ASP OD1  O  -6.020  12.529  -5.419 1.00 . A A . 81 ASP OD1  1 1 
        5  6670 1 1 81 ASP OD2  O  -7.475  11.683  -6.814 1.00 . A A . 81 ASP OD2  1 1 
        5  6671 1 1 82 MET C    C  -6.872  14.679 -11.352 1.00 . A A . 82 MET C    1 1 
        5  6672 1 1 82 MET CA   C  -7.268  14.561  -9.868 1.00 . A A . 82 MET CA   1 1 
        5  6673 1 1 82 MET CB   C  -7.664  15.935  -9.310 1.00 . A A . 82 MET CB   1 1 
        5  6674 1 1 82 MET CE   C -10.711  18.639 -10.271 1.00 . A A . 82 MET CE   1 1 
        5  6675 1 1 82 MET CG   C  -8.849  16.586 -10.014 1.00 . A A . 82 MET CG   1 1 
        5  6676 1 1 82 MET H    H  -5.783  14.547  -8.353 1.00 . A A . 82 MET H    1 1 
        5  6677 1 1 82 MET HA   H  -8.117  13.895  -9.788 1.00 . A A . 82 MET HA   1 1 
        5  6678 1 1 82 MET HB2  H  -7.916  15.822  -8.266 1.00 . A A . 82 MET HB2  1 1 
        5  6679 1 1 82 MET HB3  H  -6.814  16.598  -9.393 1.00 . A A . 82 MET HB3  1 1 
        5  6680 1 1 82 MET HE1  H -11.073  19.606  -9.953 1.00 . A A . 82 MET HE1  1 1 
        5  6681 1 1 82 MET HE2  H -11.489  17.901 -10.139 1.00 . A A . 82 MET HE2  1 1 
        5  6682 1 1 82 MET HE3  H -10.431  18.685 -11.313 1.00 . A A . 82 MET HE3  1 1 
        5  6683 1 1 82 MET HG2  H  -8.600  16.735 -11.054 1.00 . A A . 82 MET HG2  1 1 
        5  6684 1 1 82 MET HG3  H  -9.704  15.929  -9.939 1.00 . A A . 82 MET HG3  1 1 
        5  6685 1 1 82 MET N    N  -6.183  13.997  -9.058 1.00 . A A . 82 MET N    1 1 
        5  6686 1 1 82 MET O    O  -5.956  15.423 -11.707 1.00 . A A . 82 MET O    1 1 
        5  6687 1 1 82 MET SD   S  -9.281  18.183  -9.289 1.00 . A A . 82 MET SD   1 1 
        5  6688 1 1 83 MET C    C  -8.125  14.974 -14.409 1.00 . A A . 83 MET C    1 1 
        5  6689 1 1 83 MET CA   C  -7.284  13.923 -13.651 1.00 . A A . 83 MET CA   1 1 
        5  6690 1 1 83 MET CB   C  -7.538  12.517 -14.215 1.00 . A A . 83 MET CB   1 1 
        5  6691 1 1 83 MET CE   C  -9.172  10.446 -16.050 1.00 . A A . 83 MET CE   1 1 
        5  6692 1 1 83 MET CG   C  -7.180  12.357 -15.687 1.00 . A A . 83 MET CG   1 1 
        5  6693 1 1 83 MET H    H  -8.309  13.390 -11.866 1.00 . A A . 83 MET H    1 1 
        5  6694 1 1 83 MET HA   H  -6.235  14.161 -13.778 1.00 . A A . 83 MET HA   1 1 
        5  6695 1 1 83 MET HB2  H  -6.951  11.808 -13.650 1.00 . A A . 83 MET HB2  1 1 
        5  6696 1 1 83 MET HB3  H  -8.584  12.277 -14.094 1.00 . A A . 83 MET HB3  1 1 
        5  6697 1 1 83 MET HE1  H  -9.419  10.552 -15.004 1.00 . A A . 83 MET HE1  1 1 
        5  6698 1 1 83 MET HE2  H  -9.459   9.461 -16.389 1.00 . A A . 83 MET HE2  1 1 
        5  6699 1 1 83 MET HE3  H  -9.703  11.193 -16.622 1.00 . A A . 83 MET HE3  1 1 
        5  6700 1 1 83 MET HG2  H  -7.809  13.013 -16.272 1.00 . A A . 83 MET HG2  1 1 
        5  6701 1 1 83 MET HG3  H  -6.145  12.636 -15.826 1.00 . A A . 83 MET HG3  1 1 
        5  6702 1 1 83 MET N    N  -7.572  13.939 -12.210 1.00 . A A . 83 MET N    1 1 
        5  6703 1 1 83 MET O    O  -9.322  14.717 -14.663 1.00 . A A . 83 MET O    1 1 
        5  6704 1 1 83 MET OXT  O  -7.583  16.051 -14.748 1.00 . A A . 83 MET OXT  1 1 
        5  6705 1 1 83 MET SD   S  -7.407  10.663 -16.274 1.00 . A A . 83 MET SD   1 1 
        6  6706 1 1  1 MET C    C  23.717  -3.968  15.346 1.00 . A A .  1 MET C    1 1 
        6  6707 1 1  1 MET CA   C  24.275  -4.915  16.419 1.00 . A A .  1 MET CA   1 1 
        6  6708 1 1  1 MET CB   C  24.139  -6.371  15.955 1.00 . A A .  1 MET CB   1 1 
        6  6709 1 1  1 MET CE   C  25.350  -9.011  14.709 1.00 . A A .  1 MET CE   1 1 
        6  6710 1 1  1 MET CG   C  24.785  -7.385  16.889 1.00 . A A .  1 MET CG   1 1 
        6  6711 1 1  1 MET H1   H  23.654  -3.733  18.025 1.00 . A A .  1 MET H1   1 1 
        6  6712 1 1  1 MET H2   H  24.009  -5.324  18.455 1.00 . A A .  1 MET H2   1 1 
        6  6713 1 1  1 MET H3   H  22.573  -4.969  17.636 1.00 . A A .  1 MET H3   1 1 
        6  6714 1 1  1 MET HA   H  25.324  -4.690  16.565 1.00 . A A .  1 MET HA   1 1 
        6  6715 1 1  1 MET HB2  H  23.090  -6.616  15.872 1.00 . A A .  1 MET HB2  1 1 
        6  6716 1 1  1 MET HB3  H  24.599  -6.472  14.981 1.00 . A A .  1 MET HB3  1 1 
        6  6717 1 1  1 MET HE1  H  26.386  -8.731  14.824 1.00 . A A .  1 MET HE1  1 1 
        6  6718 1 1  1 MET HE2  H  24.845  -8.279  14.094 1.00 . A A .  1 MET HE2  1 1 
        6  6719 1 1  1 MET HE3  H  25.290  -9.980  14.237 1.00 . A A .  1 MET HE3  1 1 
        6  6720 1 1  1 MET HG2  H  25.843  -7.175  16.955 1.00 . A A .  1 MET HG2  1 1 
        6  6721 1 1  1 MET HG3  H  24.338  -7.289  17.868 1.00 . A A .  1 MET HG3  1 1 
        6  6722 1 1  1 MET N    N  23.579  -4.722  17.721 1.00 . A A .  1 MET N    1 1 
        6  6723 1 1  1 MET O    O  24.433  -3.106  14.829 1.00 . A A .  1 MET O    1 1 
        6  6724 1 1  1 MET SD   S  24.567  -9.082  16.321 1.00 . A A .  1 MET SD   1 1 
        6  6725 1 1  2 GLY C    C  21.977  -3.674  12.597 1.00 . A A .  2 GLY C    1 1 
        6  6726 1 1  2 GLY CA   C  21.791  -3.243  14.051 1.00 . A A .  2 GLY CA   1 1 
        6  6727 1 1  2 GLY H    H  21.924  -4.870  15.417 1.00 . A A .  2 GLY H    1 1 
        6  6728 1 1  2 GLY HA2  H  20.733  -3.217  14.268 1.00 . A A .  2 GLY HA2  1 1 
        6  6729 1 1  2 GLY HA3  H  22.192  -2.247  14.175 1.00 . A A .  2 GLY HA3  1 1 
        6  6730 1 1  2 GLY N    N  22.438  -4.134  15.011 1.00 . A A .  2 GLY N    1 1 
        6  6731 1 1  2 GLY O    O  21.464  -4.718  12.186 1.00 . A A .  2 GLY O    1 1 
        6  6732 1 1  3 HIS C    C  21.705  -2.878   9.513 1.00 . A A .  3 HIS C    1 1 
        6  6733 1 1  3 HIS CA   C  22.955  -3.112  10.389 1.00 . A A .  3 HIS CA   1 1 
        6  6734 1 1  3 HIS CB   C  23.522  -4.523  10.149 1.00 . A A .  3 HIS CB   1 1 
        6  6735 1 1  3 HIS CD2  C  25.374  -5.235  11.831 1.00 . A A .  3 HIS CD2  1 1 
        6  6736 1 1  3 HIS CE1  C  27.117  -4.633  10.651 1.00 . A A .  3 HIS CE1  1 1 
        6  6737 1 1  3 HIS CG   C  24.917  -4.710  10.669 1.00 . A A .  3 HIS CG   1 1 
        6  6738 1 1  3 HIS H    H  23.090  -2.053  12.226 1.00 . A A .  3 HIS H    1 1 
        6  6739 1 1  3 HIS HA   H  23.705  -2.396  10.082 1.00 . A A .  3 HIS HA   1 1 
        6  6740 1 1  3 HIS HB2  H  22.884  -5.248  10.633 1.00 . A A .  3 HIS HB2  1 1 
        6  6741 1 1  3 HIS HB3  H  23.536  -4.723   9.085 1.00 . A A .  3 HIS HB3  1 1 
        6  6742 1 1  3 HIS HD1  H  26.038  -3.926   9.067 1.00 . A A .  3 HIS HD1  1 1 
        6  6743 1 1  3 HIS HD2  H  24.771  -5.630  12.639 1.00 . A A .  3 HIS HD2  1 1 
        6  6744 1 1  3 HIS HE1  H  28.135  -4.460  10.335 1.00 . A A .  3 HIS HE1  1 1 
        6  6745 1 1  3 HIS HE2  H  27.346  -5.704  12.370 1.00 . A A .  3 HIS HE2  1 1 
        6  6746 1 1  3 HIS N    N  22.706  -2.863  11.822 1.00 . A A .  3 HIS N    1 1 
        6  6747 1 1  3 HIS ND1  N  26.036  -4.341   9.957 1.00 . A A .  3 HIS ND1  1 1 
        6  6748 1 1  3 HIS NE2  N  26.748  -5.176  11.794 1.00 . A A .  3 HIS NE2  1 1 
        6  6749 1 1  3 HIS O    O  21.785  -2.187   8.495 1.00 . A A .  3 HIS O    1 1 
        6  6750 1 1  4 HIS C    C  18.845  -1.823   9.078 1.00 . A A .  4 HIS C    1 1 
        6  6751 1 1  4 HIS CA   C  19.316  -3.292   9.127 1.00 . A A .  4 HIS CA   1 1 
        6  6752 1 1  4 HIS CB   C  18.206  -4.202   9.690 1.00 . A A .  4 HIS CB   1 1 
        6  6753 1 1  4 HIS CD2  C  18.412  -4.210  12.282 1.00 . A A .  4 HIS CD2  1 1 
        6  6754 1 1  4 HIS CE1  C  16.570  -3.132  12.758 1.00 . A A .  4 HIS CE1  1 1 
        6  6755 1 1  4 HIS CG   C  17.810  -3.906  11.110 1.00 . A A .  4 HIS CG   1 1 
        6  6756 1 1  4 HIS H    H  20.555  -3.995  10.707 1.00 . A A .  4 HIS H    1 1 
        6  6757 1 1  4 HIS HA   H  19.528  -3.606   8.115 1.00 . A A .  4 HIS HA   1 1 
        6  6758 1 1  4 HIS HB2  H  17.324  -4.102   9.076 1.00 . A A .  4 HIS HB2  1 1 
        6  6759 1 1  4 HIS HB3  H  18.545  -5.229   9.650 1.00 . A A .  4 HIS HB3  1 1 
        6  6760 1 1  4 HIS HD1  H  15.994  -2.868  10.819 1.00 . A A .  4 HIS HD1  1 1 
        6  6761 1 1  4 HIS HD2  H  19.345  -4.746  12.403 1.00 . A A .  4 HIS HD2  1 1 
        6  6762 1 1  4 HIS HE1  H  15.770  -2.654  13.306 1.00 . A A .  4 HIS HE1  1 1 
        6  6763 1 1  4 HIS HE2  H  17.751  -3.883  14.244 1.00 . A A .  4 HIS HE2  1 1 
        6  6764 1 1  4 HIS N    N  20.561  -3.449   9.898 1.00 . A A .  4 HIS N    1 1 
        6  6765 1 1  4 HIS ND1  N  16.654  -3.230  11.448 1.00 . A A .  4 HIS ND1  1 1 
        6  6766 1 1  4 HIS NE2  N  17.621  -3.717  13.286 1.00 . A A .  4 HIS NE2  1 1 
        6  6767 1 1  4 HIS O    O  18.138  -1.345   9.967 1.00 . A A .  4 HIS O    1 1 
        6  6768 1 1  5 HIS C    C  17.909   0.508   6.699 1.00 . A A .  5 HIS C    1 1 
        6  6769 1 1  5 HIS CA   C  18.892   0.306   7.871 1.00 . A A .  5 HIS CA   1 1 
        6  6770 1 1  5 HIS CB   C  20.170   1.137   7.662 1.00 . A A .  5 HIS CB   1 1 
        6  6771 1 1  5 HIS CD2  C  19.976   3.565   6.745 1.00 . A A .  5 HIS CD2  1 1 
        6  6772 1 1  5 HIS CE1  C  19.475   4.574   8.621 1.00 . A A .  5 HIS CE1  1 1 
        6  6773 1 1  5 HIS CG   C  19.945   2.623   7.719 1.00 . A A .  5 HIS CG   1 1 
        6  6774 1 1  5 HIS H    H  19.803  -1.543   7.348 1.00 . A A .  5 HIS H    1 1 
        6  6775 1 1  5 HIS HA   H  18.409   0.632   8.782 1.00 . A A .  5 HIS HA   1 1 
        6  6776 1 1  5 HIS HB2  H  20.888   0.882   8.432 1.00 . A A .  5 HIS HB2  1 1 
        6  6777 1 1  5 HIS HB3  H  20.594   0.901   6.696 1.00 . A A .  5 HIS HB3  1 1 
        6  6778 1 1  5 HIS HD1  H  19.528   2.891   9.769 1.00 . A A .  5 HIS HD1  1 1 
        6  6779 1 1  5 HIS HD2  H  20.188   3.399   5.698 1.00 . A A .  5 HIS HD2  1 1 
        6  6780 1 1  5 HIS HE1  H  19.226   5.338   9.343 1.00 . A A .  5 HIS HE1  1 1 
        6  6781 1 1  5 HIS HE2  H  19.479   5.596   6.856 1.00 . A A .  5 HIS HE2  1 1 
        6  6782 1 1  5 HIS N    N  19.248  -1.111   8.030 1.00 . A A .  5 HIS N    1 1 
        6  6783 1 1  5 HIS ND1  N  19.630   3.295   8.881 1.00 . A A .  5 HIS ND1  1 1 
        6  6784 1 1  5 HIS NE2  N  19.679   4.766   7.335 1.00 . A A .  5 HIS NE2  1 1 
        6  6785 1 1  5 HIS O    O  17.816   1.599   6.137 1.00 . A A .  5 HIS O    1 1 
        6  6786 1 1  6 HIS C    C  16.961  -0.444   3.895 1.00 . A A .  6 HIS C    1 1 
        6  6787 1 1  6 HIS CA   C  16.211  -0.533   5.239 1.00 . A A .  6 HIS CA   1 1 
        6  6788 1 1  6 HIS CB   C  15.199   0.622   5.379 1.00 . A A .  6 HIS CB   1 1 
        6  6789 1 1  6 HIS CD2  C  13.791   0.506   3.193 1.00 . A A .  6 HIS CD2  1 1 
        6  6790 1 1  6 HIS CE1  C  11.840   0.101   4.101 1.00 . A A .  6 HIS CE1  1 1 
        6  6791 1 1  6 HIS CG   C  13.968   0.456   4.535 1.00 . A A .  6 HIS CG   1 1 
        6  6792 1 1  6 HIS H    H  17.242  -1.365   6.897 1.00 . A A .  6 HIS H    1 1 
        6  6793 1 1  6 HIS HA   H  15.672  -1.470   5.268 1.00 . A A .  6 HIS HA   1 1 
        6  6794 1 1  6 HIS HB2  H  14.885   0.691   6.412 1.00 . A A .  6 HIS HB2  1 1 
        6  6795 1 1  6 HIS HB3  H  15.678   1.550   5.095 1.00 . A A .  6 HIS HB3  1 1 
        6  6796 1 1  6 HIS HD1  H  12.519   0.110   6.025 1.00 . A A .  6 HIS HD1  1 1 
        6  6797 1 1  6 HIS HD2  H  14.556   0.690   2.450 1.00 . A A .  6 HIS HD2  1 1 
        6  6798 1 1  6 HIS HE1  H  10.785  -0.090   4.228 1.00 . A A .  6 HIS HE1  1 1 
        6  6799 1 1  6 HIS HE2  H  12.076   0.060   2.074 1.00 . A A .  6 HIS HE2  1 1 
        6  6800 1 1  6 HIS N    N  17.159  -0.548   6.366 1.00 . A A .  6 HIS N    1 1 
        6  6801 1 1  6 HIS ND1  N  12.725   0.201   5.069 1.00 . A A .  6 HIS ND1  1 1 
        6  6802 1 1  6 HIS NE2  N  12.458   0.280   2.952 1.00 . A A .  6 HIS NE2  1 1 
        6  6803 1 1  6 HIS O    O  17.752   0.475   3.669 1.00 . A A .  6 HIS O    1 1 
        6  6804 1 1  7 HIS C    C  17.057  -0.398   0.730 1.00 . A A .  7 HIS C    1 1 
        6  6805 1 1  7 HIS CA   C  17.451  -1.494   1.735 1.00 . A A .  7 HIS CA   1 1 
        6  6806 1 1  7 HIS CB   C  17.241  -2.875   1.098 1.00 . A A .  7 HIS CB   1 1 
        6  6807 1 1  7 HIS CD2  C  17.072  -4.893   2.720 1.00 . A A .  7 HIS CD2  1 1 
        6  6808 1 1  7 HIS CE1  C  19.199  -5.388   2.833 1.00 . A A .  7 HIS CE1  1 1 
        6  6809 1 1  7 HIS CG   C  17.736  -4.010   1.938 1.00 . A A .  7 HIS CG   1 1 
        6  6810 1 1  7 HIS H    H  15.997  -2.049   3.191 1.00 . A A .  7 HIS H    1 1 
        6  6811 1 1  7 HIS HA   H  18.501  -1.380   1.970 1.00 . A A .  7 HIS HA   1 1 
        6  6812 1 1  7 HIS HB2  H  16.185  -3.028   0.924 1.00 . A A .  7 HIS HB2  1 1 
        6  6813 1 1  7 HIS HB3  H  17.762  -2.910   0.150 1.00 . A A .  7 HIS HB3  1 1 
        6  6814 1 1  7 HIS HD1  H  19.811  -3.898   1.579 1.00 . A A .  7 HIS HD1  1 1 
        6  6815 1 1  7 HIS HD2  H  16.003  -4.925   2.887 1.00 . A A .  7 HIS HD2  1 1 
        6  6816 1 1  7 HIS HE1  H  20.130  -5.875   3.089 1.00 . A A .  7 HIS HE1  1 1 
        6  6817 1 1  7 HIS HE2  H  17.804  -6.579   3.723 1.00 . A A .  7 HIS HE2  1 1 
        6  6818 1 1  7 HIS N    N  16.706  -1.397   3.001 1.00 . A A .  7 HIS N    1 1 
        6  6819 1 1  7 HIS ND1  N  19.067  -4.351   2.035 1.00 . A A .  7 HIS ND1  1 1 
        6  6820 1 1  7 HIS NE2  N  18.007  -5.738   3.263 1.00 . A A .  7 HIS NE2  1 1 
        6  6821 1 1  7 HIS O    O  15.911   0.056   0.691 1.00 . A A .  7 HIS O    1 1 
        6  6822 1 1  8 HIS C    C  17.206   0.187  -2.398 1.00 . A A .  8 HIS C    1 1 
        6  6823 1 1  8 HIS CA   C  17.767   0.952  -1.185 1.00 . A A .  8 HIS CA   1 1 
        6  6824 1 1  8 HIS CB   C  19.057   1.689  -1.572 1.00 . A A .  8 HIS CB   1 1 
        6  6825 1 1  8 HIS CD2  C  19.548   3.862  -0.228 1.00 . A A .  8 HIS CD2  1 1 
        6  6826 1 1  8 HIS CE1  C  20.805   2.998   1.340 1.00 . A A .  8 HIS CE1  1 1 
        6  6827 1 1  8 HIS CG   C  19.639   2.531  -0.470 1.00 . A A .  8 HIS CG   1 1 
        6  6828 1 1  8 HIS H    H  18.941  -0.304   0.057 1.00 . A A .  8 HIS H    1 1 
        6  6829 1 1  8 HIS HA   H  17.032   1.673  -0.851 1.00 . A A .  8 HIS HA   1 1 
        6  6830 1 1  8 HIS HB2  H  19.805   0.965  -1.858 1.00 . A A .  8 HIS HB2  1 1 
        6  6831 1 1  8 HIS HB3  H  18.855   2.337  -2.414 1.00 . A A .  8 HIS HB3  1 1 
        6  6832 1 1  8 HIS HD1  H  20.692   1.080   0.648 1.00 . A A .  8 HIS HD1  1 1 
        6  6833 1 1  8 HIS HD2  H  19.002   4.585  -0.818 1.00 . A A .  8 HIS HD2  1 1 
        6  6834 1 1  8 HIS HE1  H  21.433   2.890   2.214 1.00 . A A .  8 HIS HE1  1 1 
        6  6835 1 1  8 HIS HE2  H  20.575   5.017   1.189 1.00 . A A .  8 HIS HE2  1 1 
        6  6836 1 1  8 HIS N    N  18.026   0.022  -0.085 1.00 . A A .  8 HIS N    1 1 
        6  6837 1 1  8 HIS ND1  N  20.434   2.023   0.535 1.00 . A A .  8 HIS ND1  1 1 
        6  6838 1 1  8 HIS NE2  N  20.284   4.123   0.903 1.00 . A A .  8 HIS NE2  1 1 
        6  6839 1 1  8 HIS O    O  17.936  -0.543  -3.076 1.00 . A A .  8 HIS O    1 1 
        6  6840 1 1  9 SER C    C  14.255   0.431  -4.523 1.00 . A A .  9 SER C    1 1 
        6  6841 1 1  9 SER CA   C  15.237  -0.433  -3.721 1.00 . A A .  9 SER CA   1 1 
        6  6842 1 1  9 SER CB   C  14.479  -1.625  -3.118 1.00 . A A .  9 SER CB   1 1 
        6  6843 1 1  9 SER H    H  15.385   0.971  -2.126 1.00 . A A .  9 SER H    1 1 
        6  6844 1 1  9 SER HA   H  15.994  -0.806  -4.395 1.00 . A A .  9 SER HA   1 1 
        6  6845 1 1  9 SER HB2  H  14.057  -2.224  -3.912 1.00 . A A .  9 SER HB2  1 1 
        6  6846 1 1  9 SER HB3  H  15.162  -2.229  -2.537 1.00 . A A .  9 SER HB3  1 1 
        6  6847 1 1  9 SER HG   H  13.490  -1.643  -1.421 1.00 . A A .  9 SER HG   1 1 
        6  6848 1 1  9 SER N    N  15.907   0.335  -2.657 1.00 . A A .  9 SER N    1 1 
        6  6849 1 1  9 SER O    O  14.146   1.639  -4.308 1.00 . A A .  9 SER O    1 1 
        6  6850 1 1  9 SER OG   O  13.427  -1.187  -2.273 1.00 . A A .  9 SER OG   1 1 
        6  6851 1 1 10 HIS C    C  11.180   0.636  -5.589 1.00 . A A . 10 HIS C    1 1 
        6  6852 1 1 10 HIS CA   C  12.552   0.498  -6.283 1.00 . A A . 10 HIS CA   1 1 
        6  6853 1 1 10 HIS CB   C  12.371  -0.247  -7.614 1.00 . A A . 10 HIS CB   1 1 
        6  6854 1 1 10 HIS CD2  C  14.308   0.378  -9.215 1.00 . A A . 10 HIS CD2  1 1 
        6  6855 1 1 10 HIS CE1  C  15.399  -1.516  -9.148 1.00 . A A . 10 HIS CE1  1 1 
        6  6856 1 1 10 HIS CG   C  13.637  -0.448  -8.382 1.00 . A A . 10 HIS CG   1 1 
        6  6857 1 1 10 HIS H    H  13.660  -1.171  -5.565 1.00 . A A . 10 HIS H    1 1 
        6  6858 1 1 10 HIS HA   H  12.938   1.485  -6.487 1.00 . A A . 10 HIS HA   1 1 
        6  6859 1 1 10 HIS HB2  H  11.949  -1.222  -7.417 1.00 . A A . 10 HIS HB2  1 1 
        6  6860 1 1 10 HIS HB3  H  11.688   0.312  -8.240 1.00 . A A . 10 HIS HB3  1 1 
        6  6861 1 1 10 HIS HD1  H  14.122  -2.429  -7.842 1.00 . A A . 10 HIS HD1  1 1 
        6  6862 1 1 10 HIS HD2  H  14.033   1.391  -9.473 1.00 . A A . 10 HIS HD2  1 1 
        6  6863 1 1 10 HIS HE1  H  16.134  -2.285  -9.332 1.00 . A A . 10 HIS HE1  1 1 
        6  6864 1 1 10 HIS HE2  H  15.943  -0.042 -10.448 1.00 . A A . 10 HIS HE2  1 1 
        6  6865 1 1 10 HIS N    N  13.529  -0.204  -5.441 1.00 . A A . 10 HIS N    1 1 
        6  6866 1 1 10 HIS ND1  N  14.350  -1.627  -8.362 1.00 . A A . 10 HIS ND1  1 1 
        6  6867 1 1 10 HIS NE2  N  15.398  -0.312  -9.678 1.00 . A A . 10 HIS NE2  1 1 
        6  6868 1 1 10 HIS O    O  10.164   0.793  -6.258 1.00 . A A . 10 HIS O    1 1 
        6  6869 1 1 11 MET C    C   9.344   2.158  -3.491 1.00 . A A . 11 MET C    1 1 
        6  6870 1 1 11 MET CA   C   9.880   0.712  -3.515 1.00 . A A . 11 MET CA   1 1 
        6  6871 1 1 11 MET CB   C  10.032   0.184  -2.083 1.00 . A A . 11 MET CB   1 1 
        6  6872 1 1 11 MET CE   C  10.461  -3.687  -0.564 1.00 . A A . 11 MET CE   1 1 
        6  6873 1 1 11 MET CG   C  10.240  -1.323  -2.001 1.00 . A A . 11 MET CG   1 1 
        6  6874 1 1 11 MET H    H  11.984   0.472  -3.759 1.00 . A A . 11 MET H    1 1 
        6  6875 1 1 11 MET HA   H   9.154   0.096  -4.029 1.00 . A A . 11 MET HA   1 1 
        6  6876 1 1 11 MET HB2  H  10.882   0.665  -1.621 1.00 . A A . 11 MET HB2  1 1 
        6  6877 1 1 11 MET HB3  H   9.142   0.429  -1.522 1.00 . A A . 11 MET HB3  1 1 
        6  6878 1 1 11 MET HE1  H  10.537  -4.188   0.390 1.00 . A A . 11 MET HE1  1 1 
        6  6879 1 1 11 MET HE2  H  11.353  -3.878  -1.140 1.00 . A A . 11 MET HE2  1 1 
        6  6880 1 1 11 MET HE3  H   9.600  -4.059  -1.099 1.00 . A A . 11 MET HE3  1 1 
        6  6881 1 1 11 MET HG2  H   9.428  -1.813  -2.521 1.00 . A A . 11 MET HG2  1 1 
        6  6882 1 1 11 MET HG3  H  11.176  -1.574  -2.482 1.00 . A A . 11 MET HG3  1 1 
        6  6883 1 1 11 MET N    N  11.148   0.593  -4.255 1.00 . A A . 11 MET N    1 1 
        6  6884 1 1 11 MET O    O   8.149   2.379  -3.278 1.00 . A A . 11 MET O    1 1 
        6  6885 1 1 11 MET SD   S  10.284  -1.923  -0.298 1.00 . A A . 11 MET SD   1 1 
        6  6886 1 1 12 LEU C    C   8.984   4.816  -5.044 1.00 . A A . 12 LEU C    1 1 
        6  6887 1 1 12 LEU CA   C   9.806   4.545  -3.760 1.00 . A A . 12 LEU CA   1 1 
        6  6888 1 1 12 LEU CB   C  11.020   5.498  -3.655 1.00 . A A . 12 LEU CB   1 1 
        6  6889 1 1 12 LEU CD1  C  12.274   4.221  -1.849 1.00 . A A . 12 LEU CD1  1 1 
        6  6890 1 1 12 LEU CD2  C  12.789   6.643  -2.264 1.00 . A A . 12 LEU CD2  1 1 
        6  6891 1 1 12 LEU CG   C  11.697   5.574  -2.269 1.00 . A A . 12 LEU CG   1 1 
        6  6892 1 1 12 LEU H    H  11.172   2.914  -3.800 1.00 . A A . 12 LEU H    1 1 
        6  6893 1 1 12 LEU HA   H   9.159   4.723  -2.911 1.00 . A A . 12 LEU HA   1 1 
        6  6894 1 1 12 LEU HB2  H  11.759   5.181  -4.377 1.00 . A A . 12 LEU HB2  1 1 
        6  6895 1 1 12 LEU HB3  H  10.691   6.493  -3.921 1.00 . A A . 12 LEU HB3  1 1 
        6  6896 1 1 12 LEU HD11 H  12.714   4.305  -0.866 1.00 . A A . 12 LEU HD11 1 1 
        6  6897 1 1 12 LEU HD12 H  13.034   3.918  -2.556 1.00 . A A . 12 LEU HD12 1 1 
        6  6898 1 1 12 LEU HD13 H  11.488   3.482  -1.829 1.00 . A A . 12 LEU HD13 1 1 
        6  6899 1 1 12 LEU HD21 H  12.349   7.607  -2.481 1.00 . A A . 12 LEU HD21 1 1 
        6  6900 1 1 12 LEU HD22 H  13.529   6.409  -3.017 1.00 . A A . 12 LEU HD22 1 1 
        6  6901 1 1 12 LEU HD23 H  13.260   6.674  -1.293 1.00 . A A . 12 LEU HD23 1 1 
        6  6902 1 1 12 LEU HG   H  10.955   5.855  -1.534 1.00 . A A . 12 LEU HG   1 1 
        6  6903 1 1 12 LEU N    N  10.226   3.138  -3.692 1.00 . A A . 12 LEU N    1 1 
        6  6904 1 1 12 LEU O    O   7.891   5.388  -4.972 1.00 . A A . 12 LEU O    1 1 
        6  6905 1 1 13 PRO C    C   7.836   3.157  -7.639 1.00 . A A . 13 PRO C    1 1 
        6  6906 1 1 13 PRO CA   C   8.697   4.438  -7.478 1.00 . A A . 13 PRO CA   1 1 
        6  6907 1 1 13 PRO CB   C   9.788   4.514  -8.552 1.00 . A A . 13 PRO CB   1 1 
        6  6908 1 1 13 PRO CD   C  10.881   3.973  -6.491 1.00 . A A . 13 PRO CD   1 1 
        6  6909 1 1 13 PRO CG   C  10.921   3.732  -7.981 1.00 . A A . 13 PRO CG   1 1 
        6  6910 1 1 13 PRO HA   H   8.061   5.311  -7.535 1.00 . A A . 13 PRO HA   1 1 
        6  6911 1 1 13 PRO HB2  H   9.428   4.082  -9.476 1.00 . A A . 13 PRO HB2  1 1 
        6  6912 1 1 13 PRO HB3  H  10.065   5.546  -8.717 1.00 . A A . 13 PRO HB3  1 1 
        6  6913 1 1 13 PRO HD2  H  11.094   3.060  -5.954 1.00 . A A . 13 PRO HD2  1 1 
        6  6914 1 1 13 PRO HD3  H  11.589   4.744  -6.215 1.00 . A A . 13 PRO HD3  1 1 
        6  6915 1 1 13 PRO HG2  H  10.787   2.679  -8.194 1.00 . A A . 13 PRO HG2  1 1 
        6  6916 1 1 13 PRO HG3  H  11.856   4.082  -8.394 1.00 . A A . 13 PRO HG3  1 1 
        6  6917 1 1 13 PRO N    N   9.492   4.424  -6.237 1.00 . A A . 13 PRO N    1 1 
        6  6918 1 1 13 PRO O    O   7.781   2.322  -6.733 1.00 . A A . 13 PRO O    1 1 
        6  6919 1 1 14 PRO C    C   7.393   0.589  -9.458 1.00 . A A . 14 PRO C    1 1 
        6  6920 1 1 14 PRO CA   C   6.412   1.729  -9.087 1.00 . A A . 14 PRO CA   1 1 
        6  6921 1 1 14 PRO CB   C   5.529   2.113 -10.287 1.00 . A A . 14 PRO CB   1 1 
        6  6922 1 1 14 PRO CD   C   6.865   4.028  -9.806 1.00 . A A . 14 PRO CD   1 1 
        6  6923 1 1 14 PRO CG   C   6.247   3.249 -10.933 1.00 . A A . 14 PRO CG   1 1 
        6  6924 1 1 14 PRO HA   H   5.788   1.406  -8.263 1.00 . A A . 14 PRO HA   1 1 
        6  6925 1 1 14 PRO HB2  H   5.432   1.271 -10.958 1.00 . A A . 14 PRO HB2  1 1 
        6  6926 1 1 14 PRO HB3  H   4.552   2.414  -9.936 1.00 . A A . 14 PRO HB3  1 1 
        6  6927 1 1 14 PRO HD2  H   7.792   4.486 -10.124 1.00 . A A . 14 PRO HD2  1 1 
        6  6928 1 1 14 PRO HD3  H   6.178   4.780  -9.442 1.00 . A A . 14 PRO HD3  1 1 
        6  6929 1 1 14 PRO HG2  H   7.013   2.871 -11.598 1.00 . A A . 14 PRO HG2  1 1 
        6  6930 1 1 14 PRO HG3  H   5.548   3.866 -11.480 1.00 . A A . 14 PRO HG3  1 1 
        6  6931 1 1 14 PRO N    N   7.109   2.997  -8.772 1.00 . A A . 14 PRO N    1 1 
        6  6932 1 1 14 PRO O    O   8.535   0.569  -8.995 1.00 . A A . 14 PRO O    1 1 
        6  6933 1 1 15 GLU C    C   8.035  -2.567  -9.732 1.00 . A A . 15 GLU C    1 1 
        6  6934 1 1 15 GLU CA   C   7.766  -1.475 -10.786 1.00 . A A . 15 GLU CA   1 1 
        6  6935 1 1 15 GLU CB   C   9.107  -0.948 -11.330 1.00 . A A . 15 GLU CB   1 1 
        6  6936 1 1 15 GLU CD   C  11.427  -1.549 -12.164 1.00 . A A . 15 GLU CD   1 1 
        6  6937 1 1 15 GLU CG   C  10.019  -2.044 -11.875 1.00 . A A . 15 GLU CG   1 1 
        6  6938 1 1 15 GLU H    H   5.979  -0.343 -10.534 1.00 . A A . 15 GLU H    1 1 
        6  6939 1 1 15 GLU HA   H   7.224  -1.927 -11.605 1.00 . A A . 15 GLU HA   1 1 
        6  6940 1 1 15 GLU HB2  H   8.908  -0.246 -12.127 1.00 . A A . 15 GLU HB2  1 1 
        6  6941 1 1 15 GLU HB3  H   9.629  -0.437 -10.533 1.00 . A A . 15 GLU HB3  1 1 
        6  6942 1 1 15 GLU HG2  H  10.075  -2.842 -11.148 1.00 . A A . 15 GLU HG2  1 1 
        6  6943 1 1 15 GLU HG3  H   9.593  -2.427 -12.792 1.00 . A A . 15 GLU HG3  1 1 
        6  6944 1 1 15 GLU N    N   6.924  -0.372 -10.271 1.00 . A A . 15 GLU N    1 1 
        6  6945 1 1 15 GLU O    O   7.765  -3.745  -9.969 1.00 . A A . 15 GLU O    1 1 
        6  6946 1 1 15 GLU OE1  O  11.591  -0.709 -13.071 1.00 . A A . 15 GLU OE1  1 1 
        6  6947 1 1 15 GLU OE2  O  12.376  -2.005 -11.491 1.00 . A A . 15 GLU OE2  1 1 
        6  6948 1 1 16 GLN C    C   7.787  -3.847  -6.866 1.00 . A A . 16 GLN C    1 1 
        6  6949 1 1 16 GLN CA   C   8.982  -3.139  -7.533 1.00 . A A . 16 GLN CA   1 1 
        6  6950 1 1 16 GLN CB   C   9.805  -2.410  -6.461 1.00 . A A . 16 GLN CB   1 1 
        6  6951 1 1 16 GLN CD   C  11.841  -3.915  -6.430 1.00 . A A . 16 GLN CD   1 1 
        6  6952 1 1 16 GLN CG   C  10.700  -3.321  -5.621 1.00 . A A . 16 GLN CG   1 1 
        6  6953 1 1 16 GLN H    H   8.690  -1.219  -8.408 1.00 . A A . 16 GLN H    1 1 
        6  6954 1 1 16 GLN HA   H   9.607  -3.884  -8.004 1.00 . A A . 16 GLN HA   1 1 
        6  6955 1 1 16 GLN HB2  H  10.435  -1.680  -6.947 1.00 . A A . 16 GLN HB2  1 1 
        6  6956 1 1 16 GLN HB3  H   9.129  -1.894  -5.794 1.00 . A A . 16 GLN HB3  1 1 
        6  6957 1 1 16 GLN HE21 H  10.743  -5.490  -6.907 1.00 . A A . 16 GLN HE21 1 1 
        6  6958 1 1 16 GLN HE22 H  12.339  -5.454  -7.564 1.00 . A A . 16 GLN HE22 1 1 
        6  6959 1 1 16 GLN HG2  H  11.119  -2.747  -4.809 1.00 . A A . 16 GLN HG2  1 1 
        6  6960 1 1 16 GLN HG3  H  10.101  -4.127  -5.219 1.00 . A A . 16 GLN HG3  1 1 
        6  6961 1 1 16 GLN N    N   8.565  -2.178  -8.572 1.00 . A A . 16 GLN N    1 1 
        6  6962 1 1 16 GLN NE2  N  11.619  -5.072  -7.020 1.00 . A A . 16 GLN NE2  1 1 
        6  6963 1 1 16 GLN O    O   7.962  -4.674  -5.969 1.00 . A A . 16 GLN O    1 1 
        6  6964 1 1 16 GLN OE1  O  12.917  -3.334  -6.526 1.00 . A A . 16 GLN OE1  1 1 
        6  6965 1 1 17 TRP C    C   4.817  -5.270  -7.469 1.00 . A A . 17 TRP C    1 1 
        6  6966 1 1 17 TRP CA   C   5.354  -4.049  -6.699 1.00 . A A . 17 TRP CA   1 1 
        6  6967 1 1 17 TRP CB   C   4.295  -2.941  -6.636 1.00 . A A . 17 TRP CB   1 1 
        6  6968 1 1 17 TRP CD1  C   5.654  -0.778  -6.400 1.00 . A A . 17 TRP CD1  1 1 
        6  6969 1 1 17 TRP CD2  C   4.395  -1.270  -4.614 1.00 . A A . 17 TRP CD2  1 1 
        6  6970 1 1 17 TRP CE2  C   5.088  -0.069  -4.361 1.00 . A A . 17 TRP CE2  1 1 
        6  6971 1 1 17 TRP CE3  C   3.538  -1.777  -3.631 1.00 . A A . 17 TRP CE3  1 1 
        6  6972 1 1 17 TRP CG   C   4.771  -1.706  -5.925 1.00 . A A . 17 TRP CG   1 1 
        6  6973 1 1 17 TRP CH2  C   4.103   0.111  -2.218 1.00 . A A . 17 TRP CH2  1 1 
        6  6974 1 1 17 TRP CZ2  C   4.950   0.630  -3.163 1.00 . A A . 17 TRP CZ2  1 1 
        6  6975 1 1 17 TRP CZ3  C   3.399  -1.081  -2.444 1.00 . A A . 17 TRP CZ3  1 1 
        6  6976 1 1 17 TRP H    H   6.503  -2.911  -8.066 1.00 . A A . 17 TRP H    1 1 
        6  6977 1 1 17 TRP HA   H   5.595  -4.357  -5.690 1.00 . A A . 17 TRP HA   1 1 
        6  6978 1 1 17 TRP HB2  H   4.014  -2.657  -7.641 1.00 . A A . 17 TRP HB2  1 1 
        6  6979 1 1 17 TRP HB3  H   3.423  -3.312  -6.116 1.00 . A A . 17 TRP HB3  1 1 
        6  6980 1 1 17 TRP HD1  H   6.125  -0.828  -7.369 1.00 . A A . 17 TRP HD1  1 1 
        6  6981 1 1 17 TRP HE1  H   6.443   0.986  -5.573 1.00 . A A . 17 TRP HE1  1 1 
        6  6982 1 1 17 TRP HE3  H   2.989  -2.695  -3.789 1.00 . A A . 17 TRP HE3  1 1 
        6  6983 1 1 17 TRP HH2  H   3.966   0.620  -1.274 1.00 . A A . 17 TRP HH2  1 1 
        6  6984 1 1 17 TRP HZ2  H   5.483   1.551  -2.974 1.00 . A A . 17 TRP HZ2  1 1 
        6  6985 1 1 17 TRP HZ3  H   2.744  -1.458  -1.672 1.00 . A A . 17 TRP HZ3  1 1 
        6  6986 1 1 17 TRP N    N   6.578  -3.520  -7.308 1.00 . A A . 17 TRP N    1 1 
        6  6987 1 1 17 TRP NE1  N   5.852   0.209  -5.464 1.00 . A A . 17 TRP NE1  1 1 
        6  6988 1 1 17 TRP O    O   4.922  -5.344  -8.696 1.00 . A A . 17 TRP O    1 1 
        6  6989 1 1 18 SER C    C   2.412  -7.899  -6.598 1.00 . A A . 18 SER C    1 1 
        6  6990 1 1 18 SER CA   C   3.698  -7.454  -7.329 1.00 . A A . 18 SER CA   1 1 
        6  6991 1 1 18 SER CB   C   4.754  -8.571  -7.279 1.00 . A A . 18 SER CB   1 1 
        6  6992 1 1 18 SER H    H   4.206  -6.110  -5.763 1.00 . A A . 18 SER H    1 1 
        6  6993 1 1 18 SER HA   H   3.454  -7.246  -8.361 1.00 . A A . 18 SER HA   1 1 
        6  6994 1 1 18 SER HB2  H   4.382  -9.439  -7.801 1.00 . A A . 18 SER HB2  1 1 
        6  6995 1 1 18 SER HB3  H   5.661  -8.227  -7.754 1.00 . A A . 18 SER HB3  1 1 
        6  6996 1 1 18 SER HG   H   5.691  -8.311  -5.571 1.00 . A A . 18 SER HG   1 1 
        6  6997 1 1 18 SER N    N   4.248  -6.225  -6.734 1.00 . A A . 18 SER N    1 1 
        6  6998 1 1 18 SER O    O   1.630  -7.062  -6.137 1.00 . A A . 18 SER O    1 1 
        6  6999 1 1 18 SER OG   O   5.054  -8.941  -5.941 1.00 . A A . 18 SER OG   1 1 
        6  7000 1 1 19 HIS C    C   0.767  -9.241  -4.432 1.00 . A A . 19 HIS C    1 1 
        6  7001 1 1 19 HIS CA   C   0.973  -9.767  -5.868 1.00 . A A . 19 HIS CA   1 1 
        6  7002 1 1 19 HIS CB   C   1.035 -11.304  -5.822 1.00 . A A . 19 HIS CB   1 1 
        6  7003 1 1 19 HIS CD2  C   0.355 -12.172  -8.177 1.00 . A A . 19 HIS CD2  1 1 
        6  7004 1 1 19 HIS CE1  C   2.276 -13.050  -8.753 1.00 . A A . 19 HIS CE1  1 1 
        6  7005 1 1 19 HIS CG   C   1.222 -11.962  -7.156 1.00 . A A . 19 HIS CG   1 1 
        6  7006 1 1 19 HIS H    H   2.848  -9.839  -6.873 1.00 . A A . 19 HIS H    1 1 
        6  7007 1 1 19 HIS HA   H   0.125  -9.471  -6.470 1.00 . A A . 19 HIS HA   1 1 
        6  7008 1 1 19 HIS HB2  H   1.858 -11.606  -5.190 1.00 . A A . 19 HIS HB2  1 1 
        6  7009 1 1 19 HIS HB3  H   0.113 -11.678  -5.397 1.00 . A A . 19 HIS HB3  1 1 
        6  7010 1 1 19 HIS HD1  H   3.248 -12.535  -7.030 1.00 . A A . 19 HIS HD1  1 1 
        6  7011 1 1 19 HIS HD2  H  -0.677 -11.860  -8.217 1.00 . A A . 19 HIS HD2  1 1 
        6  7012 1 1 19 HIS HE1  H   3.048 -13.554  -9.315 1.00 . A A . 19 HIS HE1  1 1 
        6  7013 1 1 19 HIS HE2  H   0.651 -13.199  -9.981 1.00 . A A . 19 HIS HE2  1 1 
        6  7014 1 1 19 HIS N    N   2.186  -9.217  -6.504 1.00 . A A . 19 HIS N    1 1 
        6  7015 1 1 19 HIS ND1  N   2.416 -12.525  -7.554 1.00 . A A . 19 HIS ND1  1 1 
        6  7016 1 1 19 HIS NE2  N   1.039 -12.850  -9.152 1.00 . A A . 19 HIS NE2  1 1 
        6  7017 1 1 19 HIS O    O  -0.223  -8.563  -4.143 1.00 . A A . 19 HIS O    1 1 
        6  7018 1 1 20 THR C    C   2.334  -8.090  -1.598 1.00 . A A . 20 THR C    1 1 
        6  7019 1 1 20 THR CA   C   1.545  -9.319  -2.098 1.00 . A A . 20 THR CA   1 1 
        6  7020 1 1 20 THR CB   C   1.989 -10.567  -1.286 1.00 . A A . 20 THR CB   1 1 
        6  7021 1 1 20 THR CG2  C   1.604 -10.457   0.188 1.00 . A A . 20 THR CG2  1 1 
        6  7022 1 1 20 THR H    H   2.540  -9.978  -3.864 1.00 . A A . 20 THR H    1 1 
        6  7023 1 1 20 THR HA   H   0.493  -9.155  -1.907 1.00 . A A . 20 THR HA   1 1 
        6  7024 1 1 20 THR HB   H   3.063 -10.660  -1.357 1.00 . A A . 20 THR HB   1 1 
        6  7025 1 1 20 THR HG1  H   1.962 -12.504  -1.691 1.00 . A A . 20 THR HG1  1 1 
        6  7026 1 1 20 THR HG21 H   2.091  -9.599   0.627 1.00 . A A . 20 THR HG21 1 1 
        6  7027 1 1 20 THR HG22 H   1.915 -11.352   0.711 1.00 . A A . 20 THR HG22 1 1 
        6  7028 1 1 20 THR HG23 H   0.533 -10.346   0.275 1.00 . A A . 20 THR HG23 1 1 
        6  7029 1 1 20 THR N    N   1.712  -9.560  -3.545 1.00 . A A . 20 THR N    1 1 
        6  7030 1 1 20 THR O    O   2.189  -7.682  -0.448 1.00 . A A . 20 THR O    1 1 
        6  7031 1 1 20 THR OG1  O   1.384 -11.746  -1.839 1.00 . A A . 20 THR OG1  1 1 
        6  7032 1 1 21 THR C    C   3.251  -5.233  -1.347 1.00 . A A . 21 THR C    1 1 
        6  7033 1 1 21 THR CA   C   4.014  -6.350  -2.088 1.00 . A A . 21 THR CA   1 1 
        6  7034 1 1 21 THR CB   C   4.699  -5.732  -3.331 1.00 . A A . 21 THR CB   1 1 
        6  7035 1 1 21 THR CG2  C   5.820  -4.771  -2.931 1.00 . A A . 21 THR CG2  1 1 
        6  7036 1 1 21 THR H    H   3.175  -7.817  -3.393 1.00 . A A . 21 THR H    1 1 
        6  7037 1 1 21 THR HA   H   4.785  -6.734  -1.435 1.00 . A A . 21 THR HA   1 1 
        6  7038 1 1 21 THR HB   H   3.959  -5.182  -3.897 1.00 . A A . 21 THR HB   1 1 
        6  7039 1 1 21 THR HG1  H   6.201  -6.760  -4.116 1.00 . A A . 21 THR HG1  1 1 
        6  7040 1 1 21 THR HG21 H   5.408  -3.959  -2.348 1.00 . A A . 21 THR HG21 1 1 
        6  7041 1 1 21 THR HG22 H   6.287  -4.373  -3.822 1.00 . A A . 21 THR HG22 1 1 
        6  7042 1 1 21 THR HG23 H   6.557  -5.299  -2.344 1.00 . A A . 21 THR HG23 1 1 
        6  7043 1 1 21 THR N    N   3.143  -7.486  -2.470 1.00 . A A . 21 THR N    1 1 
        6  7044 1 1 21 THR O    O   3.835  -4.485  -0.557 1.00 . A A . 21 THR O    1 1 
        6  7045 1 1 21 THR OG1  O   5.236  -6.770  -4.163 1.00 . A A . 21 THR OG1  1 1 
        6  7046 1 1 22 VAL C    C   1.071  -4.272   0.568 1.00 . A A . 22 VAL C    1 1 
        6  7047 1 1 22 VAL CA   C   1.097  -4.113  -0.965 1.00 . A A . 22 VAL CA   1 1 
        6  7048 1 1 22 VAL CB   C  -0.352  -4.172  -1.519 1.00 . A A . 22 VAL CB   1 1 
        6  7049 1 1 22 VAL CG1  C  -1.226  -3.087  -0.892 1.00 . A A . 22 VAL CG1  1 1 
        6  7050 1 1 22 VAL CG2  C  -0.346  -4.053  -3.043 1.00 . A A . 22 VAL CG2  1 1 
        6  7051 1 1 22 VAL H    H   1.543  -5.749  -2.245 1.00 . A A . 22 VAL H    1 1 
        6  7052 1 1 22 VAL HA   H   1.508  -3.142  -1.204 1.00 . A A . 22 VAL HA   1 1 
        6  7053 1 1 22 VAL HB   H  -0.775  -5.134  -1.260 1.00 . A A . 22 VAL HB   1 1 
        6  7054 1 1 22 VAL HG11 H  -2.232  -3.166  -1.280 1.00 . A A . 22 VAL HG11 1 1 
        6  7055 1 1 22 VAL HG12 H  -0.824  -2.113  -1.133 1.00 . A A . 22 VAL HG12 1 1 
        6  7056 1 1 22 VAL HG13 H  -1.245  -3.213   0.182 1.00 . A A . 22 VAL HG13 1 1 
        6  7057 1 1 22 VAL HG21 H   0.073  -3.097  -3.331 1.00 . A A . 22 VAL HG21 1 1 
        6  7058 1 1 22 VAL HG22 H  -1.358  -4.127  -3.416 1.00 . A A . 22 VAL HG22 1 1 
        6  7059 1 1 22 VAL HG23 H   0.251  -4.849  -3.468 1.00 . A A . 22 VAL HG23 1 1 
        6  7060 1 1 22 VAL N    N   1.947  -5.128  -1.606 1.00 . A A . 22 VAL N    1 1 
        6  7061 1 1 22 VAL O    O   0.964  -3.288   1.304 1.00 . A A . 22 VAL O    1 1 
        6  7062 1 1 23 ARG C    C   2.346  -5.032   3.192 1.00 . A A . 23 ARG C    1 1 
        6  7063 1 1 23 ARG CA   C   1.218  -5.801   2.485 1.00 . A A . 23 ARG CA   1 1 
        6  7064 1 1 23 ARG CB   C   1.384  -7.313   2.716 1.00 . A A . 23 ARG CB   1 1 
        6  7065 1 1 23 ARG CD   C   1.570  -9.213   4.373 1.00 . A A . 23 ARG CD   1 1 
        6  7066 1 1 23 ARG CG   C   1.495  -7.704   4.187 1.00 . A A . 23 ARG CG   1 1 
        6  7067 1 1 23 ARG CZ   C   0.901 -10.031   6.584 1.00 . A A . 23 ARG CZ   1 1 
        6  7068 1 1 23 ARG H    H   1.280  -6.255   0.409 1.00 . A A . 23 ARG H    1 1 
        6  7069 1 1 23 ARG HA   H   0.269  -5.487   2.898 1.00 . A A . 23 ARG HA   1 1 
        6  7070 1 1 23 ARG HB2  H   0.531  -7.823   2.294 1.00 . A A . 23 ARG HB2  1 1 
        6  7071 1 1 23 ARG HB3  H   2.278  -7.648   2.208 1.00 . A A . 23 ARG HB3  1 1 
        6  7072 1 1 23 ARG HD2  H   0.637  -9.655   4.050 1.00 . A A . 23 ARG HD2  1 1 
        6  7073 1 1 23 ARG HD3  H   2.379  -9.601   3.769 1.00 . A A . 23 ARG HD3  1 1 
        6  7074 1 1 23 ARG HE   H   2.719  -9.452   6.114 1.00 . A A . 23 ARG HE   1 1 
        6  7075 1 1 23 ARG HG2  H   2.387  -7.256   4.602 1.00 . A A . 23 ARG HG2  1 1 
        6  7076 1 1 23 ARG HG3  H   0.628  -7.328   4.713 1.00 . A A . 23 ARG HG3  1 1 
        6  7077 1 1 23 ARG HH11 H  -0.565 -10.037   5.229 1.00 . A A . 23 ARG HH11 1 1 
        6  7078 1 1 23 ARG HH12 H  -1.001 -10.578   6.813 1.00 . A A . 23 ARG HH12 1 1 
        6  7079 1 1 23 ARG HH21 H   2.152 -10.149   8.127 1.00 . A A . 23 ARG HH21 1 1 
        6  7080 1 1 23 ARG HH22 H   0.524 -10.636   8.443 1.00 . A A . 23 ARG HH22 1 1 
        6  7081 1 1 23 ARG N    N   1.194  -5.513   1.043 1.00 . A A . 23 ARG N    1 1 
        6  7082 1 1 23 ARG NE   N   1.811  -9.571   5.771 1.00 . A A . 23 ARG NE   1 1 
        6  7083 1 1 23 ARG NH1  N  -0.316 -10.231   6.179 1.00 . A A . 23 ARG NH1  1 1 
        6  7084 1 1 23 ARG NH2  N   1.215 -10.294   7.813 1.00 . A A . 23 ARG NH2  1 1 
        6  7085 1 1 23 ARG O    O   2.169  -4.534   4.305 1.00 . A A . 23 ARG O    1 1 
        6  7086 1 1 24 ASN C    C   4.362  -2.689   3.221 1.00 . A A . 24 ASN C    1 1 
        6  7087 1 1 24 ASN CA   C   4.655  -4.199   3.061 1.00 . A A . 24 ASN CA   1 1 
        6  7088 1 1 24 ASN CB   C   5.867  -4.415   2.142 1.00 . A A . 24 ASN CB   1 1 
        6  7089 1 1 24 ASN CG   C   7.157  -3.850   2.712 1.00 . A A . 24 ASN CG   1 1 
        6  7090 1 1 24 ASN H    H   3.566  -5.341   1.637 1.00 . A A . 24 ASN H    1 1 
        6  7091 1 1 24 ASN HA   H   4.877  -4.612   4.034 1.00 . A A . 24 ASN HA   1 1 
        6  7092 1 1 24 ASN HB2  H   6.006  -5.476   1.988 1.00 . A A . 24 ASN HB2  1 1 
        6  7093 1 1 24 ASN HB3  H   5.677  -3.943   1.189 1.00 . A A . 24 ASN HB3  1 1 
        6  7094 1 1 24 ASN HD21 H   7.794  -3.376   0.899 1.00 . A A . 24 ASN HD21 1 1 
        6  7095 1 1 24 ASN HD22 H   8.859  -2.990   2.202 1.00 . A A . 24 ASN HD22 1 1 
        6  7096 1 1 24 ASN N    N   3.493  -4.921   2.521 1.00 . A A . 24 ASN N    1 1 
        6  7097 1 1 24 ASN ND2  N   8.022  -3.356   1.850 1.00 . A A . 24 ASN ND2  1 1 
        6  7098 1 1 24 ASN O    O   5.143  -1.950   3.821 1.00 . A A . 24 ASN O    1 1 
        6  7099 1 1 24 ASN OD1  O   7.369  -3.846   3.918 1.00 . A A . 24 ASN OD1  1 1 
        6  7100 1 1 25 ALA C    C   1.629  -0.760   3.835 1.00 . A A . 25 ALA C    1 1 
        6  7101 1 1 25 ALA CA   C   2.790  -0.848   2.827 1.00 . A A . 25 ALA CA   1 1 
        6  7102 1 1 25 ALA CB   C   2.375  -0.266   1.478 1.00 . A A . 25 ALA CB   1 1 
        6  7103 1 1 25 ALA H    H   2.703  -2.848   2.123 1.00 . A A . 25 ALA H    1 1 
        6  7104 1 1 25 ALA HA   H   3.621  -0.266   3.201 1.00 . A A . 25 ALA HA   1 1 
        6  7105 1 1 25 ALA HB1  H   2.096   0.771   1.600 1.00 . A A . 25 ALA HB1  1 1 
        6  7106 1 1 25 ALA HB2  H   1.533  -0.822   1.087 1.00 . A A . 25 ALA HB2  1 1 
        6  7107 1 1 25 ALA HB3  H   3.201  -0.335   0.786 1.00 . A A . 25 ALA HB3  1 1 
        6  7108 1 1 25 ALA N    N   3.241  -2.236   2.664 1.00 . A A . 25 ALA N    1 1 
        6  7109 1 1 25 ALA O    O   1.551   0.175   4.638 1.00 . A A . 25 ALA O    1 1 
        6  7110 1 1 26 LEU C    C   0.000  -1.792   6.181 1.00 . A A . 26 LEU C    1 1 
        6  7111 1 1 26 LEU CA   C  -0.421  -1.803   4.702 1.00 . A A . 26 LEU CA   1 1 
        6  7112 1 1 26 LEU CB   C  -1.270  -3.050   4.412 1.00 . A A . 26 LEU CB   1 1 
        6  7113 1 1 26 LEU CD1  C  -2.690  -4.400   2.820 1.00 . A A . 26 LEU CD1  1 1 
        6  7114 1 1 26 LEU CD2  C  -2.759  -1.885   2.737 1.00 . A A . 26 LEU CD2  1 1 
        6  7115 1 1 26 LEU CG   C  -1.886  -3.113   3.002 1.00 . A A . 26 LEU CG   1 1 
        6  7116 1 1 26 LEU H    H   0.857  -2.470   3.140 1.00 . A A . 26 LEU H    1 1 
        6  7117 1 1 26 LEU HA   H  -1.022  -0.924   4.511 1.00 . A A . 26 LEU HA   1 1 
        6  7118 1 1 26 LEU HB2  H  -0.645  -3.921   4.548 1.00 . A A . 26 LEU HB2  1 1 
        6  7119 1 1 26 LEU HB3  H  -2.075  -3.089   5.134 1.00 . A A . 26 LEU HB3  1 1 
        6  7120 1 1 26 LEU HD11 H  -3.487  -4.438   3.550 1.00 . A A . 26 LEU HD11 1 1 
        6  7121 1 1 26 LEU HD12 H  -2.040  -5.253   2.955 1.00 . A A . 26 LEU HD12 1 1 
        6  7122 1 1 26 LEU HD13 H  -3.110  -4.425   1.826 1.00 . A A . 26 LEU HD13 1 1 
        6  7123 1 1 26 LEU HD21 H  -3.567  -1.854   3.455 1.00 . A A . 26 LEU HD21 1 1 
        6  7124 1 1 26 LEU HD22 H  -3.167  -1.943   1.739 1.00 . A A . 26 LEU HD22 1 1 
        6  7125 1 1 26 LEU HD23 H  -2.162  -0.989   2.829 1.00 . A A . 26 LEU HD23 1 1 
        6  7126 1 1 26 LEU HG   H  -1.089  -3.118   2.273 1.00 . A A . 26 LEU HG   1 1 
        6  7127 1 1 26 LEU N    N   0.738  -1.753   3.798 1.00 . A A . 26 LEU N    1 1 
        6  7128 1 1 26 LEU O    O  -0.719  -1.270   7.034 1.00 . A A . 26 LEU O    1 1 
        6  7129 1 1 27 LYS C    C   1.890  -0.986   8.454 1.00 . A A . 27 LYS C    1 1 
        6  7130 1 1 27 LYS CA   C   1.700  -2.395   7.852 1.00 . A A . 27 LYS CA   1 1 
        6  7131 1 1 27 LYS CB   C   3.008  -3.214   7.911 1.00 . A A . 27 LYS CB   1 1 
        6  7132 1 1 27 LYS CD   C   4.783  -1.633   6.974 1.00 . A A . 27 LYS CD   1 1 
        6  7133 1 1 27 LYS CE   C   5.724  -1.701   8.172 1.00 . A A . 27 LYS CE   1 1 
        6  7134 1 1 27 LYS CG   C   3.998  -2.931   6.777 1.00 . A A . 27 LYS CG   1 1 
        6  7135 1 1 27 LYS H    H   1.699  -2.764   5.753 1.00 . A A . 27 LYS H    1 1 
        6  7136 1 1 27 LYS HA   H   0.958  -2.907   8.449 1.00 . A A . 27 LYS HA   1 1 
        6  7137 1 1 27 LYS HB2  H   3.504  -3.010   8.850 1.00 . A A . 27 LYS HB2  1 1 
        6  7138 1 1 27 LYS HB3  H   2.755  -4.265   7.878 1.00 . A A . 27 LYS HB3  1 1 
        6  7139 1 1 27 LYS HD2  H   5.366  -1.444   6.086 1.00 . A A . 27 LYS HD2  1 1 
        6  7140 1 1 27 LYS HD3  H   4.082  -0.822   7.122 1.00 . A A . 27 LYS HD3  1 1 
        6  7141 1 1 27 LYS HE2  H   5.135  -1.753   9.075 1.00 . A A . 27 LYS HE2  1 1 
        6  7142 1 1 27 LYS HE3  H   6.336  -2.588   8.090 1.00 . A A . 27 LYS HE3  1 1 
        6  7143 1 1 27 LYS HG2  H   4.697  -3.751   6.713 1.00 . A A . 27 LYS HG2  1 1 
        6  7144 1 1 27 LYS HG3  H   3.445  -2.865   5.849 1.00 . A A . 27 LYS HG3  1 1 
        6  7145 1 1 27 LYS HZ1  H   7.281  -0.510   7.446 1.00 . A A . 27 LYS HZ1  1 1 
        6  7146 1 1 27 LYS HZ2  H   7.151  -0.515   9.131 1.00 . A A . 27 LYS HZ2  1 1 
        6  7147 1 1 27 LYS HZ3  H   6.048   0.363   8.201 1.00 . A A . 27 LYS HZ3  1 1 
        6  7148 1 1 27 LYS N    N   1.177  -2.355   6.475 1.00 . A A . 27 LYS N    1 1 
        6  7149 1 1 27 LYS NZ   N   6.612  -0.509   8.244 1.00 . A A . 27 LYS NZ   1 1 
        6  7150 1 1 27 LYS O    O   2.097  -0.845   9.661 1.00 . A A . 27 LYS O    1 1 
        6  7151 1 1 28 ASP C    C   0.412   2.062   7.862 1.00 . A A . 28 ASP C    1 1 
        6  7152 1 1 28 ASP CA   C   1.799   1.440   8.089 1.00 . A A . 28 ASP CA   1 1 
        6  7153 1 1 28 ASP CB   C   2.877   2.291   7.404 1.00 . A A . 28 ASP CB   1 1 
        6  7154 1 1 28 ASP CG   C   4.237   2.122   8.054 1.00 . A A . 28 ASP CG   1 1 
        6  7155 1 1 28 ASP H    H   1.845  -0.124   6.646 1.00 . A A . 28 ASP H    1 1 
        6  7156 1 1 28 ASP HA   H   1.991   1.429   9.155 1.00 . A A . 28 ASP HA   1 1 
        6  7157 1 1 28 ASP HB2  H   2.951   2.002   6.364 1.00 . A A . 28 ASP HB2  1 1 
        6  7158 1 1 28 ASP HB3  H   2.598   3.336   7.460 1.00 . A A . 28 ASP HB3  1 1 
        6  7159 1 1 28 ASP N    N   1.842   0.048   7.612 1.00 . A A . 28 ASP N    1 1 
        6  7160 1 1 28 ASP O    O  -0.174   2.639   8.778 1.00 . A A . 28 ASP O    1 1 
        6  7161 1 1 28 ASP OD1  O   4.364   2.454   9.254 1.00 . A A . 28 ASP OD1  1 1 
        6  7162 1 1 28 ASP OD2  O   5.178   1.654   7.385 1.00 . A A . 28 ASP OD2  1 1 
        6  7163 1 1 29 LEU C    C  -2.522   2.078   7.290 1.00 . A A . 29 LEU C    1 1 
        6  7164 1 1 29 LEU CA   C  -1.424   2.483   6.286 1.00 . A A . 29 LEU CA   1 1 
        6  7165 1 1 29 LEU CB   C  -1.818   2.032   4.870 1.00 . A A . 29 LEU CB   1 1 
        6  7166 1 1 29 LEU CD1  C  -1.306   1.895   2.404 1.00 . A A . 29 LEU CD1  1 1 
        6  7167 1 1 29 LEU CD2  C  -0.728   3.977   3.686 1.00 . A A . 29 LEU CD2  1 1 
        6  7168 1 1 29 LEU CG   C  -0.853   2.456   3.748 1.00 . A A . 29 LEU CG   1 1 
        6  7169 1 1 29 LEU H    H   0.402   1.438   5.961 1.00 . A A . 29 LEU H    1 1 
        6  7170 1 1 29 LEU HA   H  -1.332   3.559   6.294 1.00 . A A . 29 LEU HA   1 1 
        6  7171 1 1 29 LEU HB2  H  -1.887   0.951   4.867 1.00 . A A . 29 LEU HB2  1 1 
        6  7172 1 1 29 LEU HB3  H  -2.796   2.435   4.645 1.00 . A A . 29 LEU HB3  1 1 
        6  7173 1 1 29 LEU HD11 H  -1.308   0.814   2.446 1.00 . A A . 29 LEU HD11 1 1 
        6  7174 1 1 29 LEU HD12 H  -0.627   2.222   1.630 1.00 . A A . 29 LEU HD12 1 1 
        6  7175 1 1 29 LEU HD13 H  -2.304   2.247   2.181 1.00 . A A . 29 LEU HD13 1 1 
        6  7176 1 1 29 LEU HD21 H  -0.055   4.253   2.887 1.00 . A A . 29 LEU HD21 1 1 
        6  7177 1 1 29 LEU HD22 H  -0.337   4.346   4.624 1.00 . A A . 29 LEU HD22 1 1 
        6  7178 1 1 29 LEU HD23 H  -1.699   4.417   3.505 1.00 . A A . 29 LEU HD23 1 1 
        6  7179 1 1 29 LEU HG   H   0.128   2.052   3.959 1.00 . A A . 29 LEU HG   1 1 
        6  7180 1 1 29 LEU N    N  -0.111   1.922   6.644 1.00 . A A . 29 LEU N    1 1 
        6  7181 1 1 29 LEU O    O  -3.231   2.931   7.828 1.00 . A A . 29 LEU O    1 1 
        6  7182 1 1 30 LEU C    C  -3.260   0.478   9.937 1.00 . A A . 30 LEU C    1 1 
        6  7183 1 1 30 LEU CA   C  -3.666   0.257   8.466 1.00 . A A . 30 LEU CA   1 1 
        6  7184 1 1 30 LEU CB   C  -3.901  -1.237   8.190 1.00 . A A . 30 LEU CB   1 1 
        6  7185 1 1 30 LEU CD1  C  -6.393  -1.173   8.606 1.00 . A A . 30 LEU CD1  1 1 
        6  7186 1 1 30 LEU CD2  C  -5.168  -3.370   8.659 1.00 . A A . 30 LEU CD2  1 1 
        6  7187 1 1 30 LEU CG   C  -5.078  -1.873   8.952 1.00 . A A . 30 LEU CG   1 1 
        6  7188 1 1 30 LEU H    H  -2.037   0.146   7.105 1.00 . A A . 30 LEU H    1 1 
        6  7189 1 1 30 LEU HA   H  -4.587   0.795   8.278 1.00 . A A . 30 LEU HA   1 1 
        6  7190 1 1 30 LEU HB2  H  -4.074  -1.362   7.130 1.00 . A A . 30 LEU HB2  1 1 
        6  7191 1 1 30 LEU HB3  H  -2.999  -1.775   8.454 1.00 . A A . 30 LEU HB3  1 1 
        6  7192 1 1 30 LEU HD11 H  -6.330  -0.130   8.881 1.00 . A A . 30 LEU HD11 1 1 
        6  7193 1 1 30 LEU HD12 H  -7.204  -1.636   9.152 1.00 . A A . 30 LEU HD12 1 1 
        6  7194 1 1 30 LEU HD13 H  -6.582  -1.255   7.545 1.00 . A A . 30 LEU HD13 1 1 
        6  7195 1 1 30 LEU HD21 H  -5.338  -3.524   7.603 1.00 . A A . 30 LEU HD21 1 1 
        6  7196 1 1 30 LEU HD22 H  -5.983  -3.799   9.222 1.00 . A A . 30 LEU HD22 1 1 
        6  7197 1 1 30 LEU HD23 H  -4.242  -3.850   8.946 1.00 . A A . 30 LEU HD23 1 1 
        6  7198 1 1 30 LEU HG   H  -4.912  -1.753  10.014 1.00 . A A . 30 LEU HG   1 1 
        6  7199 1 1 30 LEU N    N  -2.646   0.777   7.544 1.00 . A A . 30 LEU N    1 1 
        6  7200 1 1 30 LEU O    O  -4.100   0.473  10.840 1.00 . A A . 30 LEU O    1 1 
        6  7201 1 1 31 LYS C    C  -1.877   2.325  12.013 1.00 . A A . 31 LYS C    1 1 
        6  7202 1 1 31 LYS CA   C  -1.447   0.936  11.520 1.00 . A A . 31 LYS CA   1 1 
        6  7203 1 1 31 LYS CB   C   0.090   0.794  11.533 1.00 . A A . 31 LYS CB   1 1 
        6  7204 1 1 31 LYS CD   C   1.228   2.469  13.089 1.00 . A A . 31 LYS CD   1 1 
        6  7205 1 1 31 LYS CE   C   2.346   2.833  12.114 1.00 . A A . 31 LYS CE   1 1 
        6  7206 1 1 31 LYS CG   C   0.752   1.025  12.898 1.00 . A A . 31 LYS CG   1 1 
        6  7207 1 1 31 LYS H    H  -1.338   0.656   9.418 1.00 . A A . 31 LYS H    1 1 
        6  7208 1 1 31 LYS HA   H  -1.872   0.192  12.180 1.00 . A A . 31 LYS HA   1 1 
        6  7209 1 1 31 LYS HB2  H   0.341  -0.205  11.208 1.00 . A A . 31 LYS HB2  1 1 
        6  7210 1 1 31 LYS HB3  H   0.509   1.500  10.829 1.00 . A A . 31 LYS HB3  1 1 
        6  7211 1 1 31 LYS HD2  H   0.395   3.139  12.930 1.00 . A A . 31 LYS HD2  1 1 
        6  7212 1 1 31 LYS HD3  H   1.594   2.586  14.100 1.00 . A A . 31 LYS HD3  1 1 
        6  7213 1 1 31 LYS HE2  H   3.196   2.193  12.303 1.00 . A A . 31 LYS HE2  1 1 
        6  7214 1 1 31 LYS HE3  H   1.993   2.675  11.106 1.00 . A A . 31 LYS HE3  1 1 
        6  7215 1 1 31 LYS HG2  H   0.038   0.793  13.675 1.00 . A A . 31 LYS HG2  1 1 
        6  7216 1 1 31 LYS HG3  H   1.602   0.364  12.987 1.00 . A A . 31 LYS HG3  1 1 
        6  7217 1 1 31 LYS HZ1  H   3.526   4.475  11.583 1.00 . A A . 31 LYS HZ1  1 1 
        6  7218 1 1 31 LYS HZ2  H   3.122   4.422  13.225 1.00 . A A . 31 LYS HZ2  1 1 
        6  7219 1 1 31 LYS HZ3  H   1.965   4.886  12.080 1.00 . A A . 31 LYS HZ3  1 1 
        6  7220 1 1 31 LYS N    N  -1.963   0.678  10.171 1.00 . A A . 31 LYS N    1 1 
        6  7221 1 1 31 LYS NZ   N   2.770   4.251  12.261 1.00 . A A . 31 LYS NZ   1 1 
        6  7222 1 1 31 LYS O    O  -2.256   2.495  13.173 1.00 . A A . 31 LYS O    1 1 
        6  7223 1 1 32 ASP C    C  -3.714   4.949  11.195 1.00 . A A . 32 ASP C    1 1 
        6  7224 1 1 32 ASP CA   C  -2.225   4.679  11.478 1.00 . A A . 32 ASP CA   1 1 
        6  7225 1 1 32 ASP CB   C  -1.350   5.692  10.733 1.00 . A A . 32 ASP CB   1 1 
        6  7226 1 1 32 ASP CG   C   0.103   5.611  11.166 1.00 . A A . 32 ASP CG   1 1 
        6  7227 1 1 32 ASP H    H  -1.512   3.123  10.216 1.00 . A A . 32 ASP H    1 1 
        6  7228 1 1 32 ASP HA   H  -2.057   4.799  12.541 1.00 . A A . 32 ASP HA   1 1 
        6  7229 1 1 32 ASP HB2  H  -1.408   5.498   9.670 1.00 . A A . 32 ASP HB2  1 1 
        6  7230 1 1 32 ASP HB3  H  -1.713   6.690  10.933 1.00 . A A . 32 ASP HB3  1 1 
        6  7231 1 1 32 ASP N    N  -1.831   3.313  11.126 1.00 . A A . 32 ASP N    1 1 
        6  7232 1 1 32 ASP O    O  -4.381   5.640  11.968 1.00 . A A . 32 ASP O    1 1 
        6  7233 1 1 32 ASP OD1  O   0.414   6.029  12.306 1.00 . A A . 32 ASP OD1  1 1 
        6  7234 1 1 32 ASP OD2  O   0.943   5.115  10.391 1.00 . A A . 32 ASP OD2  1 1 
        6  7235 1 1 33 MET C    C  -6.496   3.369   9.865 1.00 . A A . 33 MET C    1 1 
        6  7236 1 1 33 MET CA   C  -5.638   4.641   9.713 1.00 . A A . 33 MET CA   1 1 
        6  7237 1 1 33 MET CB   C  -5.711   5.164   8.270 1.00 . A A . 33 MET CB   1 1 
        6  7238 1 1 33 MET CE   C  -7.154   8.018   8.817 1.00 . A A . 33 MET CE   1 1 
        6  7239 1 1 33 MET CG   C  -7.129   5.433   7.784 1.00 . A A . 33 MET CG   1 1 
        6  7240 1 1 33 MET H    H  -3.673   3.842   9.526 1.00 . A A . 33 MET H    1 1 
        6  7241 1 1 33 MET HA   H  -6.035   5.400  10.374 1.00 . A A . 33 MET HA   1 1 
        6  7242 1 1 33 MET HB2  H  -5.152   6.087   8.204 1.00 . A A . 33 MET HB2  1 1 
        6  7243 1 1 33 MET HB3  H  -5.260   4.434   7.611 1.00 . A A . 33 MET HB3  1 1 
        6  7244 1 1 33 MET HE1  H  -7.602   8.747   9.475 1.00 . A A . 33 MET HE1  1 1 
        6  7245 1 1 33 MET HE2  H  -7.181   8.383   7.801 1.00 . A A . 33 MET HE2  1 1 
        6  7246 1 1 33 MET HE3  H  -6.128   7.850   9.111 1.00 . A A . 33 MET HE3  1 1 
        6  7247 1 1 33 MET HG2  H  -7.083   5.923   6.823 1.00 . A A . 33 MET HG2  1 1 
        6  7248 1 1 33 MET HG3  H  -7.646   4.490   7.680 1.00 . A A . 33 MET HG3  1 1 
        6  7249 1 1 33 MET N    N  -4.236   4.409  10.095 1.00 . A A . 33 MET N    1 1 
        6  7250 1 1 33 MET O    O  -6.020   2.254   9.656 1.00 . A A . 33 MET O    1 1 
        6  7251 1 1 33 MET SD   S  -8.065   6.478   8.920 1.00 . A A . 33 MET SD   1 1 
        6  7252 1 1 34 ASN C    C  -9.220   1.879   9.082 1.00 . A A . 34 ASN C    1 1 
        6  7253 1 1 34 ASN CA   C  -8.692   2.425  10.422 1.00 . A A . 34 ASN CA   1 1 
        6  7254 1 1 34 ASN CB   C  -9.860   2.854  11.318 1.00 . A A . 34 ASN CB   1 1 
        6  7255 1 1 34 ASN CG   C  -9.385   3.342  12.677 1.00 . A A . 34 ASN CG   1 1 
        6  7256 1 1 34 ASN H    H  -8.099   4.465  10.348 1.00 . A A . 34 ASN H    1 1 
        6  7257 1 1 34 ASN HA   H  -8.144   1.636  10.920 1.00 . A A . 34 ASN HA   1 1 
        6  7258 1 1 34 ASN HB2  H -10.404   3.653  10.835 1.00 . A A . 34 ASN HB2  1 1 
        6  7259 1 1 34 ASN HB3  H -10.521   2.013  11.466 1.00 . A A . 34 ASN HB3  1 1 
        6  7260 1 1 34 ASN HD21 H  -9.344   5.218  12.040 1.00 . A A . 34 ASN HD21 1 1 
        6  7261 1 1 34 ASN HD22 H  -8.875   4.966  13.681 1.00 . A A . 34 ASN HD22 1 1 
        6  7262 1 1 34 ASN N    N  -7.769   3.551  10.223 1.00 . A A . 34 ASN N    1 1 
        6  7263 1 1 34 ASN ND2  N  -9.180   4.638  12.810 1.00 . A A . 34 ASN ND2  1 1 
        6  7264 1 1 34 ASN O    O  -9.204   2.576   8.068 1.00 . A A . 34 ASN O    1 1 
        6  7265 1 1 34 ASN OD1  O  -9.209   2.561  13.606 1.00 . A A . 34 ASN OD1  1 1 
        6  7266 1 1 35 GLN C    C -11.075   0.739   6.988 1.00 . A A . 35 GLN C    1 1 
        6  7267 1 1 35 GLN CA   C -10.129  -0.080   7.885 1.00 . A A . 35 GLN CA   1 1 
        6  7268 1 1 35 GLN CB   C -10.812  -1.400   8.258 1.00 . A A . 35 GLN CB   1 1 
        6  7269 1 1 35 GLN CD   C -10.637  -3.663   9.399 1.00 . A A . 35 GLN CD   1 1 
        6  7270 1 1 35 GLN CG   C  -9.907  -2.395   8.979 1.00 . A A . 35 GLN CG   1 1 
        6  7271 1 1 35 GLN H    H  -9.821   0.193   9.972 1.00 . A A . 35 GLN H    1 1 
        6  7272 1 1 35 GLN HA   H  -9.232  -0.304   7.323 1.00 . A A . 35 GLN HA   1 1 
        6  7273 1 1 35 GLN HB2  H -11.655  -1.186   8.898 1.00 . A A . 35 GLN HB2  1 1 
        6  7274 1 1 35 GLN HB3  H -11.175  -1.871   7.352 1.00 . A A . 35 GLN HB3  1 1 
        6  7275 1 1 35 GLN HE21 H -11.911  -3.493   7.896 1.00 . A A . 35 GLN HE21 1 1 
        6  7276 1 1 35 GLN HE22 H -12.139  -4.857   8.925 1.00 . A A . 35 GLN HE22 1 1 
        6  7277 1 1 35 GLN HG2  H  -9.096  -2.665   8.319 1.00 . A A . 35 GLN HG2  1 1 
        6  7278 1 1 35 GLN HG3  H  -9.506  -1.921   9.864 1.00 . A A . 35 GLN HG3  1 1 
        6  7279 1 1 35 GLN N    N  -9.718   0.639   9.105 1.00 . A A . 35 GLN N    1 1 
        6  7280 1 1 35 GLN NE2  N -11.663  -4.040   8.666 1.00 . A A . 35 GLN NE2  1 1 
        6  7281 1 1 35 GLN O    O -10.717   1.101   5.866 1.00 . A A . 35 GLN O    1 1 
        6  7282 1 1 35 GLN OE1  O -10.278  -4.307  10.378 1.00 . A A . 35 GLN OE1  1 1 
        6  7283 1 1 36 SER C    C -12.824   3.093   6.189 1.00 . A A . 36 SER C    1 1 
        6  7284 1 1 36 SER CA   C -13.306   1.720   6.685 1.00 . A A . 36 SER CA   1 1 
        6  7285 1 1 36 SER CB   C -14.609   1.881   7.486 1.00 . A A . 36 SER CB   1 1 
        6  7286 1 1 36 SER H    H -12.496   0.748   8.403 1.00 . A A . 36 SER H    1 1 
        6  7287 1 1 36 SER HA   H -13.514   1.103   5.822 1.00 . A A . 36 SER HA   1 1 
        6  7288 1 1 36 SER HB2  H -14.397   2.385   8.418 1.00 . A A . 36 SER HB2  1 1 
        6  7289 1 1 36 SER HB3  H -15.313   2.468   6.913 1.00 . A A . 36 SER HB3  1 1 
        6  7290 1 1 36 SER HG   H -15.703   0.319   7.003 1.00 . A A . 36 SER HG   1 1 
        6  7291 1 1 36 SER N    N -12.282   1.020   7.483 1.00 . A A . 36 SER N    1 1 
        6  7292 1 1 36 SER O    O -13.141   3.502   5.073 1.00 . A A . 36 SER O    1 1 
        6  7293 1 1 36 SER OG   O -15.198   0.618   7.775 1.00 . A A . 36 SER OG   1 1 
        6  7294 1 1 37 SER C    C -10.421   5.031   5.585 1.00 . A A . 37 SER C    1 1 
        6  7295 1 1 37 SER CA   C -11.534   5.125   6.640 1.00 . A A . 37 SER CA   1 1 
        6  7296 1 1 37 SER CB   C -11.018   5.876   7.872 1.00 . A A . 37 SER CB   1 1 
        6  7297 1 1 37 SER H    H -11.817   3.420   7.888 1.00 . A A . 37 SER H    1 1 
        6  7298 1 1 37 SER HA   H -12.358   5.685   6.217 1.00 . A A . 37 SER HA   1 1 
        6  7299 1 1 37 SER HB2  H -11.820   5.979   8.588 1.00 . A A . 37 SER HB2  1 1 
        6  7300 1 1 37 SER HB3  H -10.207   5.318   8.319 1.00 . A A . 37 SER HB3  1 1 
        6  7301 1 1 37 SER HG   H  -9.722   7.344   7.996 1.00 . A A . 37 SER HG   1 1 
        6  7302 1 1 37 SER N    N -12.048   3.796   7.013 1.00 . A A . 37 SER N    1 1 
        6  7303 1 1 37 SER O    O -10.244   5.938   4.770 1.00 . A A . 37 SER O    1 1 
        6  7304 1 1 37 SER OG   O -10.547   7.171   7.527 1.00 . A A . 37 SER OG   1 1 
        6  7305 1 1 38 LEU C    C  -9.308   3.354   3.240 1.00 . A A . 38 LEU C    1 1 
        6  7306 1 1 38 LEU CA   C  -8.639   3.687   4.586 1.00 . A A . 38 LEU CA   1 1 
        6  7307 1 1 38 LEU CB   C  -7.704   2.544   5.045 1.00 . A A . 38 LEU CB   1 1 
        6  7308 1 1 38 LEU CD1  C  -6.532   1.876   2.882 1.00 . A A . 38 LEU CD1  1 1 
        6  7309 1 1 38 LEU CD2  C  -5.611   3.744   4.287 1.00 . A A . 38 LEU CD2  1 1 
        6  7310 1 1 38 LEU CG   C  -6.353   2.409   4.303 1.00 . A A . 38 LEU CG   1 1 
        6  7311 1 1 38 LEU H    H  -9.800   3.275   6.319 1.00 . A A . 38 LEU H    1 1 
        6  7312 1 1 38 LEU HA   H  -8.062   4.595   4.474 1.00 . A A . 38 LEU HA   1 1 
        6  7313 1 1 38 LEU HB2  H  -7.491   2.690   6.096 1.00 . A A . 38 LEU HB2  1 1 
        6  7314 1 1 38 LEU HB3  H  -8.239   1.611   4.941 1.00 . A A . 38 LEU HB3  1 1 
        6  7315 1 1 38 LEU HD11 H  -5.564   1.768   2.414 1.00 . A A . 38 LEU HD11 1 1 
        6  7316 1 1 38 LEU HD12 H  -7.132   2.566   2.307 1.00 . A A . 38 LEU HD12 1 1 
        6  7317 1 1 38 LEU HD13 H  -7.024   0.914   2.917 1.00 . A A . 38 LEU HD13 1 1 
        6  7318 1 1 38 LEU HD21 H  -5.441   4.074   5.301 1.00 . A A . 38 LEU HD21 1 1 
        6  7319 1 1 38 LEU HD22 H  -6.202   4.483   3.765 1.00 . A A . 38 LEU HD22 1 1 
        6  7320 1 1 38 LEU HD23 H  -4.662   3.623   3.785 1.00 . A A . 38 LEU HD23 1 1 
        6  7321 1 1 38 LEU HG   H  -5.735   1.699   4.838 1.00 . A A . 38 LEU HG   1 1 
        6  7322 1 1 38 LEU N    N  -9.667   3.934   5.604 1.00 . A A . 38 LEU N    1 1 
        6  7323 1 1 38 LEU O    O  -8.974   3.932   2.203 1.00 . A A . 38 LEU O    1 1 
        6  7324 1 1 39 ALA C    C -11.979   3.154   1.595 1.00 . A A . 39 ALA C    1 1 
        6  7325 1 1 39 ALA CA   C -11.022   2.042   2.072 1.00 . A A . 39 ALA CA   1 1 
        6  7326 1 1 39 ALA CB   C -11.796   0.755   2.335 1.00 . A A . 39 ALA CB   1 1 
        6  7327 1 1 39 ALA H    H -10.493   2.009   4.131 1.00 . A A . 39 ALA H    1 1 
        6  7328 1 1 39 ALA HA   H -10.305   1.843   1.285 1.00 . A A . 39 ALA HA   1 1 
        6  7329 1 1 39 ALA HB1  H -12.284   0.431   1.425 1.00 . A A . 39 ALA HB1  1 1 
        6  7330 1 1 39 ALA HB2  H -12.542   0.929   3.099 1.00 . A A . 39 ALA HB2  1 1 
        6  7331 1 1 39 ALA HB3  H -11.116  -0.016   2.668 1.00 . A A . 39 ALA HB3  1 1 
        6  7332 1 1 39 ALA N    N -10.275   2.437   3.274 1.00 . A A . 39 ALA N    1 1 
        6  7333 1 1 39 ALA O    O -12.558   3.062   0.513 1.00 . A A . 39 ALA O    1 1 
        6  7334 1 1 40 LYS C    C -12.608   5.976   0.729 1.00 . A A . 40 LYS C    1 1 
        6  7335 1 1 40 LYS CA   C -12.999   5.341   2.077 1.00 . A A . 40 LYS CA   1 1 
        6  7336 1 1 40 LYS CB   C -12.914   6.387   3.198 1.00 . A A . 40 LYS CB   1 1 
        6  7337 1 1 40 LYS CD   C -13.536   8.674   4.068 1.00 . A A . 40 LYS CD   1 1 
        6  7338 1 1 40 LYS CE   C -14.205  10.009   3.755 1.00 . A A . 40 LYS CE   1 1 
        6  7339 1 1 40 LYS CG   C -13.667   7.684   2.914 1.00 . A A . 40 LYS CG   1 1 
        6  7340 1 1 40 LYS H    H -11.682   4.186   3.278 1.00 . A A . 40 LYS H    1 1 
        6  7341 1 1 40 LYS HA   H -14.018   4.984   2.010 1.00 . A A . 40 LYS HA   1 1 
        6  7342 1 1 40 LYS HB2  H -13.317   5.957   4.103 1.00 . A A . 40 LYS HB2  1 1 
        6  7343 1 1 40 LYS HB3  H -11.873   6.632   3.363 1.00 . A A . 40 LYS HB3  1 1 
        6  7344 1 1 40 LYS HD2  H -13.999   8.250   4.948 1.00 . A A . 40 LYS HD2  1 1 
        6  7345 1 1 40 LYS HD3  H -12.485   8.846   4.264 1.00 . A A . 40 LYS HD3  1 1 
        6  7346 1 1 40 LYS HE2  H -14.112  10.654   4.616 1.00 . A A . 40 LYS HE2  1 1 
        6  7347 1 1 40 LYS HE3  H -13.702  10.461   2.913 1.00 . A A . 40 LYS HE3  1 1 
        6  7348 1 1 40 LYS HG2  H -13.265   8.136   2.018 1.00 . A A . 40 LYS HG2  1 1 
        6  7349 1 1 40 LYS HG3  H -14.714   7.455   2.764 1.00 . A A . 40 LYS HG3  1 1 
        6  7350 1 1 40 LYS HZ1  H -16.136   9.347   4.194 1.00 . A A . 40 LYS HZ1  1 1 
        6  7351 1 1 40 LYS HZ2  H -15.757   9.304   2.547 1.00 . A A . 40 LYS HZ2  1 1 
        6  7352 1 1 40 LYS HZ3  H -16.090  10.779   3.301 1.00 . A A . 40 LYS HZ3  1 1 
        6  7353 1 1 40 LYS N    N -12.142   4.192   2.412 1.00 . A A . 40 LYS N    1 1 
        6  7354 1 1 40 LYS NZ   N -15.646   9.850   3.427 1.00 . A A . 40 LYS NZ   1 1 
        6  7355 1 1 40 LYS O    O -13.425   6.060  -0.190 1.00 . A A . 40 LYS O    1 1 
        6  7356 1 1 41 GLU C    C  -9.949   6.093  -1.405 1.00 . A A . 41 GLU C    1 1 
        6  7357 1 1 41 GLU CA   C -10.867   7.042  -0.620 1.00 . A A . 41 GLU CA   1 1 
        6  7358 1 1 41 GLU CB   C -10.151   8.368  -0.312 1.00 . A A . 41 GLU CB   1 1 
        6  7359 1 1 41 GLU CD   C  -8.464   9.617   1.115 1.00 . A A . 41 GLU CD   1 1 
        6  7360 1 1 41 GLU CG   C  -9.036   8.258   0.728 1.00 . A A . 41 GLU CG   1 1 
        6  7361 1 1 41 GLU H    H -10.754   6.339   1.385 1.00 . A A . 41 GLU H    1 1 
        6  7362 1 1 41 GLU HA   H -11.730   7.257  -1.238 1.00 . A A . 41 GLU HA   1 1 
        6  7363 1 1 41 GLU HB2  H  -9.721   8.751  -1.228 1.00 . A A . 41 GLU HB2  1 1 
        6  7364 1 1 41 GLU HB3  H -10.882   9.077   0.049 1.00 . A A . 41 GLU HB3  1 1 
        6  7365 1 1 41 GLU HG2  H  -9.435   7.785   1.616 1.00 . A A . 41 GLU HG2  1 1 
        6  7366 1 1 41 GLU HG3  H  -8.242   7.645   0.323 1.00 . A A . 41 GLU HG3  1 1 
        6  7367 1 1 41 GLU N    N -11.360   6.423   0.619 1.00 . A A . 41 GLU N    1 1 
        6  7368 1 1 41 GLU O    O  -9.367   6.475  -2.423 1.00 . A A . 41 GLU O    1 1 
        6  7369 1 1 41 GLU OE1  O  -9.180  10.396   1.782 1.00 . A A . 41 GLU OE1  1 1 
        6  7370 1 1 41 GLU OE2  O  -7.304   9.914   0.750 1.00 . A A . 41 GLU OE2  1 1 
        6  7371 1 1 42 CYS C    C  -9.968   2.923  -2.494 1.00 . A A . 42 CYS C    1 1 
        6  7372 1 1 42 CYS CA   C  -9.054   3.825  -1.642 1.00 . A A . 42 CYS CA   1 1 
        6  7373 1 1 42 CYS CB   C  -8.266   2.967  -0.646 1.00 . A A . 42 CYS CB   1 1 
        6  7374 1 1 42 CYS H    H -10.290   4.614  -0.105 1.00 . A A . 42 CYS H    1 1 
        6  7375 1 1 42 CYS HA   H  -8.356   4.330  -2.295 1.00 . A A . 42 CYS HA   1 1 
        6  7376 1 1 42 CYS HB2  H  -7.589   3.601  -0.091 1.00 . A A . 42 CYS HB2  1 1 
        6  7377 1 1 42 CYS HB3  H  -8.957   2.499   0.042 1.00 . A A . 42 CYS HB3  1 1 
        6  7378 1 1 42 CYS HG   H  -6.510   1.123  -0.476 1.00 . A A . 42 CYS HG   1 1 
        6  7379 1 1 42 CYS N    N  -9.835   4.850  -0.940 1.00 . A A . 42 CYS N    1 1 
        6  7380 1 1 42 CYS O    O -11.008   2.464  -2.020 1.00 . A A . 42 CYS O    1 1 
        6  7381 1 1 42 CYS SG   S  -7.283   1.657  -1.414 1.00 . A A . 42 CYS SG   1 1 
        6  7382 1 1 43 PRO C    C -10.506   0.343  -4.223 1.00 . A A . 43 PRO C    1 1 
        6  7383 1 1 43 PRO CA   C -10.400   1.813  -4.676 1.00 . A A . 43 PRO CA   1 1 
        6  7384 1 1 43 PRO CB   C  -9.648   1.908  -6.020 1.00 . A A . 43 PRO CB   1 1 
        6  7385 1 1 43 PRO CD   C  -8.390   3.177  -4.428 1.00 . A A . 43 PRO CD   1 1 
        6  7386 1 1 43 PRO CG   C  -8.756   3.100  -5.885 1.00 . A A . 43 PRO CG   1 1 
        6  7387 1 1 43 PRO HA   H -11.397   2.214  -4.795 1.00 . A A . 43 PRO HA   1 1 
        6  7388 1 1 43 PRO HB2  H  -9.076   1.004  -6.186 1.00 . A A . 43 PRO HB2  1 1 
        6  7389 1 1 43 PRO HB3  H -10.359   2.038  -6.825 1.00 . A A . 43 PRO HB3  1 1 
        6  7390 1 1 43 PRO HD2  H  -7.533   2.552  -4.217 1.00 . A A . 43 PRO HD2  1 1 
        6  7391 1 1 43 PRO HD3  H  -8.196   4.200  -4.138 1.00 . A A . 43 PRO HD3  1 1 
        6  7392 1 1 43 PRO HG2  H  -7.870   2.971  -6.491 1.00 . A A . 43 PRO HG2  1 1 
        6  7393 1 1 43 PRO HG3  H  -9.288   3.993  -6.185 1.00 . A A . 43 PRO HG3  1 1 
        6  7394 1 1 43 PRO N    N  -9.596   2.660  -3.765 1.00 . A A . 43 PRO N    1 1 
        6  7395 1 1 43 PRO O    O -11.378  -0.393  -4.686 1.00 . A A . 43 PRO O    1 1 
        6  7396 1 1 44 LEU C    C -10.735  -1.737  -1.827 1.00 . A A . 44 LEU C    1 1 
        6  7397 1 1 44 LEU CA   C  -9.610  -1.473  -2.844 1.00 . A A . 44 LEU CA   1 1 
        6  7398 1 1 44 LEU CB   C  -8.250  -1.807  -2.211 1.00 . A A . 44 LEU CB   1 1 
        6  7399 1 1 44 LEU CD1  C  -5.746  -1.999  -2.392 1.00 . A A . 44 LEU CD1  1 1 
        6  7400 1 1 44 LEU CD2  C  -7.184  -2.558  -4.374 1.00 . A A . 44 LEU CD2  1 1 
        6  7401 1 1 44 LEU CG   C  -7.034  -1.668  -3.141 1.00 . A A . 44 LEU CG   1 1 
        6  7402 1 1 44 LEU H    H  -8.969   0.553  -2.958 1.00 . A A . 44 LEU H    1 1 
        6  7403 1 1 44 LEU HA   H  -9.761  -2.115  -3.701 1.00 . A A . 44 LEU HA   1 1 
        6  7404 1 1 44 LEU HB2  H  -8.103  -1.152  -1.362 1.00 . A A . 44 LEU HB2  1 1 
        6  7405 1 1 44 LEU HB3  H  -8.285  -2.827  -1.851 1.00 . A A . 44 LEU HB3  1 1 
        6  7406 1 1 44 LEU HD11 H  -4.904  -1.884  -3.057 1.00 . A A . 44 LEU HD11 1 1 
        6  7407 1 1 44 LEU HD12 H  -5.787  -3.018  -2.034 1.00 . A A . 44 LEU HD12 1 1 
        6  7408 1 1 44 LEU HD13 H  -5.634  -1.327  -1.552 1.00 . A A . 44 LEU HD13 1 1 
        6  7409 1 1 44 LEU HD21 H  -7.247  -3.594  -4.068 1.00 . A A . 44 LEU HD21 1 1 
        6  7410 1 1 44 LEU HD22 H  -6.327  -2.426  -5.019 1.00 . A A . 44 LEU HD22 1 1 
        6  7411 1 1 44 LEU HD23 H  -8.082  -2.286  -4.910 1.00 . A A . 44 LEU HD23 1 1 
        6  7412 1 1 44 LEU HG   H  -6.966  -0.643  -3.476 1.00 . A A . 44 LEU HG   1 1 
        6  7413 1 1 44 LEU N    N  -9.623  -0.082  -3.320 1.00 . A A . 44 LEU N    1 1 
        6  7414 1 1 44 LEU O    O -11.014  -0.905  -0.960 1.00 . A A . 44 LEU O    1 1 
        6  7415 1 1 45 SER C    C -11.914  -3.545   0.404 1.00 . A A . 45 SER C    1 1 
        6  7416 1 1 45 SER CA   C -12.457  -3.290  -1.014 1.00 . A A . 45 SER CA   1 1 
        6  7417 1 1 45 SER CB   C -13.185  -4.544  -1.524 1.00 . A A . 45 SER CB   1 1 
        6  7418 1 1 45 SER H    H -11.140  -3.506  -2.671 1.00 . A A . 45 SER H    1 1 
        6  7419 1 1 45 SER HA   H -13.163  -2.473  -0.968 1.00 . A A . 45 SER HA   1 1 
        6  7420 1 1 45 SER HB2  H -12.481  -5.364  -1.586 1.00 . A A . 45 SER HB2  1 1 
        6  7421 1 1 45 SER HB3  H -13.977  -4.803  -0.835 1.00 . A A . 45 SER HB3  1 1 
        6  7422 1 1 45 SER HG   H -13.964  -5.192  -3.205 1.00 . A A . 45 SER HG   1 1 
        6  7423 1 1 45 SER N    N -11.382  -2.899  -1.941 1.00 . A A . 45 SER N    1 1 
        6  7424 1 1 45 SER O    O -10.829  -4.108   0.577 1.00 . A A . 45 SER O    1 1 
        6  7425 1 1 45 SER OG   O -13.757  -4.335  -2.809 1.00 . A A . 45 SER OG   1 1 
        6  7426 1 1 46 GLN C    C -11.838  -4.613   3.256 1.00 . A A . 46 GLN C    1 1 
        6  7427 1 1 46 GLN CA   C -12.266  -3.201   2.812 1.00 . A A . 46 GLN CA   1 1 
        6  7428 1 1 46 GLN CB   C -13.399  -2.662   3.706 1.00 . A A . 46 GLN CB   1 1 
        6  7429 1 1 46 GLN CD   C -13.459  -3.783   5.998 1.00 . A A . 46 GLN CD   1 1 
        6  7430 1 1 46 GLN CG   C -13.060  -2.553   5.194 1.00 . A A . 46 GLN CG   1 1 
        6  7431 1 1 46 GLN H    H -13.599  -2.838   1.203 1.00 . A A . 46 GLN H    1 1 
        6  7432 1 1 46 GLN HA   H -11.414  -2.543   2.909 1.00 . A A . 46 GLN HA   1 1 
        6  7433 1 1 46 GLN HB2  H -13.672  -1.676   3.353 1.00 . A A . 46 GLN HB2  1 1 
        6  7434 1 1 46 GLN HB3  H -14.258  -3.311   3.603 1.00 . A A . 46 GLN HB3  1 1 
        6  7435 1 1 46 GLN HE21 H -11.677  -4.603   5.724 1.00 . A A . 46 GLN HE21 1 1 
        6  7436 1 1 46 GLN HE22 H -12.802  -5.525   6.659 1.00 . A A . 46 GLN HE22 1 1 
        6  7437 1 1 46 GLN HG2  H -11.994  -2.405   5.297 1.00 . A A . 46 GLN HG2  1 1 
        6  7438 1 1 46 GLN HG3  H -13.575  -1.693   5.603 1.00 . A A . 46 GLN HG3  1 1 
        6  7439 1 1 46 GLN N    N -12.695  -3.158   1.409 1.00 . A A . 46 GLN N    1 1 
        6  7440 1 1 46 GLN NE2  N -12.554  -4.730   6.140 1.00 . A A . 46 GLN NE2  1 1 
        6  7441 1 1 46 GLN O    O -10.798  -4.780   3.901 1.00 . A A . 46 GLN O    1 1 
        6  7442 1 1 46 GLN OE1  O -14.574  -3.876   6.502 1.00 . A A . 46 GLN OE1  1 1 
        6  7443 1 1 47 SER C    C -11.124  -7.567   2.501 1.00 . A A . 47 SER C    1 1 
        6  7444 1 1 47 SER CA   C -12.304  -7.008   3.309 1.00 . A A . 47 SER CA   1 1 
        6  7445 1 1 47 SER CB   C -13.520  -7.930   3.170 1.00 . A A . 47 SER CB   1 1 
        6  7446 1 1 47 SER H    H -13.447  -5.449   2.405 1.00 . A A . 47 SER H    1 1 
        6  7447 1 1 47 SER HA   H -12.012  -6.983   4.351 1.00 . A A . 47 SER HA   1 1 
        6  7448 1 1 47 SER HB2  H -13.939  -7.825   2.180 1.00 . A A . 47 SER HB2  1 1 
        6  7449 1 1 47 SER HB3  H -13.213  -8.955   3.321 1.00 . A A . 47 SER HB3  1 1 
        6  7450 1 1 47 SER HG   H -15.087  -6.910   3.774 1.00 . A A . 47 SER HG   1 1 
        6  7451 1 1 47 SER N    N -12.630  -5.627   2.920 1.00 . A A . 47 SER N    1 1 
        6  7452 1 1 47 SER O    O -10.370  -8.404   2.998 1.00 . A A . 47 SER O    1 1 
        6  7453 1 1 47 SER OG   O -14.523  -7.612   4.123 1.00 . A A . 47 SER OG   1 1 
        6  7454 1 1 48 MET C    C  -8.496  -6.983   1.114 1.00 . A A . 48 MET C    1 1 
        6  7455 1 1 48 MET CA   C  -9.789  -7.487   0.452 1.00 . A A . 48 MET CA   1 1 
        6  7456 1 1 48 MET CB   C  -9.897  -6.940  -0.979 1.00 . A A . 48 MET CB   1 1 
        6  7457 1 1 48 MET CE   C  -9.531  -7.738  -4.103 1.00 . A A . 48 MET CE   1 1 
        6  7458 1 1 48 MET CG   C -11.048  -7.534  -1.784 1.00 . A A . 48 MET CG   1 1 
        6  7459 1 1 48 MET H    H -11.646  -6.524   0.867 1.00 . A A . 48 MET H    1 1 
        6  7460 1 1 48 MET HA   H  -9.754  -8.569   0.410 1.00 . A A . 48 MET HA   1 1 
        6  7461 1 1 48 MET HB2  H -10.037  -5.869  -0.933 1.00 . A A . 48 MET HB2  1 1 
        6  7462 1 1 48 MET HB3  H  -8.977  -7.150  -1.503 1.00 . A A . 48 MET HB3  1 1 
        6  7463 1 1 48 MET HE1  H  -8.689  -7.343  -3.553 1.00 . A A . 48 MET HE1  1 1 
        6  7464 1 1 48 MET HE2  H  -9.410  -7.516  -5.153 1.00 . A A . 48 MET HE2  1 1 
        6  7465 1 1 48 MET HE3  H  -9.581  -8.808  -3.966 1.00 . A A . 48 MET HE3  1 1 
        6  7466 1 1 48 MET HG2  H -10.967  -8.612  -1.766 1.00 . A A . 48 MET HG2  1 1 
        6  7467 1 1 48 MET HG3  H -11.983  -7.238  -1.329 1.00 . A A . 48 MET HG3  1 1 
        6  7468 1 1 48 MET N    N -10.962  -7.112   1.255 1.00 . A A . 48 MET N    1 1 
        6  7469 1 1 48 MET O    O  -7.507  -7.713   1.207 1.00 . A A . 48 MET O    1 1 
        6  7470 1 1 48 MET SD   S -11.045  -6.985  -3.504 1.00 . A A . 48 MET SD   1 1 
        6  7471 1 1 49 ILE C    C  -7.120  -5.995   3.606 1.00 . A A . 49 ILE C    1 1 
        6  7472 1 1 49 ILE CA   C  -7.396  -5.164   2.339 1.00 . A A . 49 ILE CA   1 1 
        6  7473 1 1 49 ILE CB   C  -7.681  -3.692   2.741 1.00 . A A . 49 ILE CB   1 1 
        6  7474 1 1 49 ILE CD1  C  -8.323  -1.398   1.790 1.00 . A A . 49 ILE CD1  1 1 
        6  7475 1 1 49 ILE CG1  C  -7.942  -2.836   1.490 1.00 . A A . 49 ILE CG1  1 1 
        6  7476 1 1 49 ILE CG2  C  -6.516  -3.118   3.551 1.00 . A A . 49 ILE CG2  1 1 
        6  7477 1 1 49 ILE H    H  -9.308  -5.173   1.406 1.00 . A A . 49 ILE H    1 1 
        6  7478 1 1 49 ILE HA   H  -6.519  -5.184   1.707 1.00 . A A . 49 ILE HA   1 1 
        6  7479 1 1 49 ILE HB   H  -8.563  -3.678   3.367 1.00 . A A . 49 ILE HB   1 1 
        6  7480 1 1 49 ILE HD11 H  -9.238  -1.378   2.366 1.00 . A A . 49 ILE HD11 1 1 
        6  7481 1 1 49 ILE HD12 H  -8.472  -0.867   0.863 1.00 . A A . 49 ILE HD12 1 1 
        6  7482 1 1 49 ILE HD13 H  -7.532  -0.923   2.353 1.00 . A A . 49 ILE HD13 1 1 
        6  7483 1 1 49 ILE HG12 H  -7.051  -2.817   0.881 1.00 . A A . 49 ILE HG12 1 1 
        6  7484 1 1 49 ILE HG13 H  -8.749  -3.277   0.920 1.00 . A A . 49 ILE HG13 1 1 
        6  7485 1 1 49 ILE HG21 H  -6.371  -3.707   4.445 1.00 . A A . 49 ILE HG21 1 1 
        6  7486 1 1 49 ILE HG22 H  -6.737  -2.096   3.827 1.00 . A A . 49 ILE HG22 1 1 
        6  7487 1 1 49 ILE HG23 H  -5.615  -3.140   2.954 1.00 . A A . 49 ILE HG23 1 1 
        6  7488 1 1 49 ILE N    N  -8.519  -5.732   1.581 1.00 . A A . 49 ILE N    1 1 
        6  7489 1 1 49 ILE O    O  -5.976  -6.347   3.903 1.00 . A A . 49 ILE O    1 1 
        6  7490 1 1 50 SER C    C  -7.514  -8.546   5.215 1.00 . A A . 50 SER C    1 1 
        6  7491 1 1 50 SER CA   C  -8.089  -7.161   5.542 1.00 . A A . 50 SER CA   1 1 
        6  7492 1 1 50 SER CB   C  -9.464  -7.328   6.209 1.00 . A A . 50 SER CB   1 1 
        6  7493 1 1 50 SER H    H  -9.067  -5.972   4.068 1.00 . A A . 50 SER H    1 1 
        6  7494 1 1 50 SER HA   H  -7.424  -6.667   6.236 1.00 . A A . 50 SER HA   1 1 
        6  7495 1 1 50 SER HB2  H  -9.809  -6.368   6.564 1.00 . A A . 50 SER HB2  1 1 
        6  7496 1 1 50 SER HB3  H -10.169  -7.718   5.487 1.00 . A A . 50 SER HB3  1 1 
        6  7497 1 1 50 SER HG   H  -9.898  -7.859   8.053 1.00 . A A . 50 SER HG   1 1 
        6  7498 1 1 50 SER N    N  -8.189  -6.316   4.339 1.00 . A A . 50 SER N    1 1 
        6  7499 1 1 50 SER O    O  -6.765  -9.119   6.005 1.00 . A A . 50 SER O    1 1 
        6  7500 1 1 50 SER OG   O  -9.398  -8.224   7.312 1.00 . A A . 50 SER OG   1 1 
        6  7501 1 1 51 SER C    C  -5.859 -10.410   3.449 1.00 . A A . 51 SER C    1 1 
        6  7502 1 1 51 SER CA   C  -7.383 -10.397   3.615 1.00 . A A . 51 SER CA   1 1 
        6  7503 1 1 51 SER CB   C  -8.058 -10.834   2.305 1.00 . A A . 51 SER CB   1 1 
        6  7504 1 1 51 SER H    H  -8.473  -8.575   3.462 1.00 . A A . 51 SER H    1 1 
        6  7505 1 1 51 SER HA   H  -7.644 -11.106   4.388 1.00 . A A . 51 SER HA   1 1 
        6  7506 1 1 51 SER HB2  H  -7.955 -10.052   1.566 1.00 . A A . 51 SER HB2  1 1 
        6  7507 1 1 51 SER HB3  H  -7.585 -11.736   1.940 1.00 . A A . 51 SER HB3  1 1 
        6  7508 1 1 51 SER HG   H  -9.923 -10.260   2.572 1.00 . A A . 51 SER HG   1 1 
        6  7509 1 1 51 SER N    N  -7.870  -9.078   4.048 1.00 . A A . 51 SER N    1 1 
        6  7510 1 1 51 SER O    O  -5.185 -11.305   3.945 1.00 . A A . 51 SER O    1 1 
        6  7511 1 1 51 SER OG   O  -9.444 -11.094   2.500 1.00 . A A . 51 SER OG   1 1 
        6  7512 1 1 52 ILE C    C  -3.119  -9.247   3.959 1.00 . A A . 52 ILE C    1 1 
        6  7513 1 1 52 ILE CA   C  -3.857  -9.292   2.599 1.00 . A A . 52 ILE CA   1 1 
        6  7514 1 1 52 ILE CB   C  -3.493  -8.032   1.766 1.00 . A A . 52 ILE CB   1 1 
        6  7515 1 1 52 ILE CD1  C  -4.036  -6.790  -0.411 1.00 . A A . 52 ILE CD1  1 1 
        6  7516 1 1 52 ILE CG1  C  -4.276  -8.024   0.438 1.00 . A A . 52 ILE CG1  1 1 
        6  7517 1 1 52 ILE CG2  C  -1.987  -7.968   1.501 1.00 . A A . 52 ILE CG2  1 1 
        6  7518 1 1 52 ILE H    H  -5.894  -8.701   2.403 1.00 . A A . 52 ILE H    1 1 
        6  7519 1 1 52 ILE HA   H  -3.528 -10.169   2.052 1.00 . A A . 52 ILE HA   1 1 
        6  7520 1 1 52 ILE HB   H  -3.768  -7.159   2.340 1.00 . A A . 52 ILE HB   1 1 
        6  7521 1 1 52 ILE HD11 H  -4.616  -6.860  -1.320 1.00 . A A . 52 ILE HD11 1 1 
        6  7522 1 1 52 ILE HD12 H  -2.988  -6.722  -0.659 1.00 . A A . 52 ILE HD12 1 1 
        6  7523 1 1 52 ILE HD13 H  -4.334  -5.910   0.139 1.00 . A A . 52 ILE HD13 1 1 
        6  7524 1 1 52 ILE HG12 H  -3.991  -8.885  -0.150 1.00 . A A . 52 ILE HG12 1 1 
        6  7525 1 1 52 ILE HG13 H  -5.335  -8.077   0.652 1.00 . A A . 52 ILE HG13 1 1 
        6  7526 1 1 52 ILE HG21 H  -1.674  -8.855   0.970 1.00 . A A . 52 ILE HG21 1 1 
        6  7527 1 1 52 ILE HG22 H  -1.457  -7.908   2.441 1.00 . A A . 52 ILE HG22 1 1 
        6  7528 1 1 52 ILE HG23 H  -1.759  -7.093   0.907 1.00 . A A . 52 ILE HG23 1 1 
        6  7529 1 1 52 ILE N    N  -5.313  -9.396   2.783 1.00 . A A . 52 ILE N    1 1 
        6  7530 1 1 52 ILE O    O  -1.932  -9.571   4.054 1.00 . A A . 52 ILE O    1 1 
        6  7531 1 1 53 VAL C    C  -3.480 -10.111   7.134 1.00 . A A . 53 VAL C    1 1 
        6  7532 1 1 53 VAL CA   C  -3.281  -8.789   6.363 1.00 . A A . 53 VAL CA   1 1 
        6  7533 1 1 53 VAL CB   C  -3.912  -7.623   7.175 1.00 . A A . 53 VAL CB   1 1 
        6  7534 1 1 53 VAL CG1  C  -3.313  -7.539   8.579 1.00 . A A . 53 VAL CG1  1 1 
        6  7535 1 1 53 VAL CG2  C  -3.742  -6.299   6.431 1.00 . A A . 53 VAL CG2  1 1 
        6  7536 1 1 53 VAL H    H  -4.771  -8.579   4.864 1.00 . A A . 53 VAL H    1 1 
        6  7537 1 1 53 VAL HA   H  -2.218  -8.597   6.277 1.00 . A A . 53 VAL HA   1 1 
        6  7538 1 1 53 VAL HB   H  -4.973  -7.817   7.276 1.00 . A A . 53 VAL HB   1 1 
        6  7539 1 1 53 VAL HG11 H  -3.779  -6.731   9.124 1.00 . A A . 53 VAL HG11 1 1 
        6  7540 1 1 53 VAL HG12 H  -2.249  -7.357   8.507 1.00 . A A . 53 VAL HG12 1 1 
        6  7541 1 1 53 VAL HG13 H  -3.483  -8.469   9.101 1.00 . A A . 53 VAL HG13 1 1 
        6  7542 1 1 53 VAL HG21 H  -4.210  -5.503   6.994 1.00 . A A . 53 VAL HG21 1 1 
        6  7543 1 1 53 VAL HG22 H  -4.206  -6.369   5.458 1.00 . A A . 53 VAL HG22 1 1 
        6  7544 1 1 53 VAL HG23 H  -2.690  -6.085   6.312 1.00 . A A . 53 VAL HG23 1 1 
        6  7545 1 1 53 VAL N    N  -3.839  -8.850   5.007 1.00 . A A . 53 VAL N    1 1 
        6  7546 1 1 53 VAL O    O  -2.531 -10.657   7.699 1.00 . A A . 53 VAL O    1 1 
        6  7547 1 1 54 ASN C    C  -4.794 -13.148   7.269 1.00 . A A . 54 ASN C    1 1 
        6  7548 1 1 54 ASN CA   C  -5.056 -11.801   7.970 1.00 . A A . 54 ASN CA   1 1 
        6  7549 1 1 54 ASN CB   C  -6.527 -11.729   8.399 1.00 . A A . 54 ASN CB   1 1 
        6  7550 1 1 54 ASN CG   C  -6.809 -10.563   9.328 1.00 . A A . 54 ASN CG   1 1 
        6  7551 1 1 54 ASN H    H  -5.396 -10.229   6.573 1.00 . A A . 54 ASN H    1 1 
        6  7552 1 1 54 ASN HA   H  -4.442 -11.761   8.859 1.00 . A A . 54 ASN HA   1 1 
        6  7553 1 1 54 ASN HB2  H  -7.149 -11.625   7.522 1.00 . A A . 54 ASN HB2  1 1 
        6  7554 1 1 54 ASN HB3  H  -6.792 -12.644   8.913 1.00 . A A . 54 ASN HB3  1 1 
        6  7555 1 1 54 ASN HD21 H  -7.367  -9.418   7.810 1.00 . A A . 54 ASN HD21 1 1 
        6  7556 1 1 54 ASN HD22 H  -7.447  -8.693   9.375 1.00 . A A . 54 ASN HD22 1 1 
        6  7557 1 1 54 ASN N    N  -4.709 -10.631   7.141 1.00 . A A . 54 ASN N    1 1 
        6  7558 1 1 54 ASN ND2  N  -7.247  -9.447   8.781 1.00 . A A . 54 ASN ND2  1 1 
        6  7559 1 1 54 ASN O    O  -4.492 -14.144   7.928 1.00 . A A . 54 ASN O    1 1 
        6  7560 1 1 54 ASN OD1  O  -6.648 -10.669  10.539 1.00 . A A . 54 ASN OD1  1 1 
        6  7561 1 1 55 SER C    C  -3.311 -14.949   5.248 1.00 . A A . 55 SER C    1 1 
        6  7562 1 1 55 SER CA   C  -4.759 -14.445   5.196 1.00 . A A . 55 SER CA   1 1 
        6  7563 1 1 55 SER CB   C  -5.207 -14.282   3.734 1.00 . A A . 55 SER CB   1 1 
        6  7564 1 1 55 SER H    H  -5.122 -12.362   5.459 1.00 . A A . 55 SER H    1 1 
        6  7565 1 1 55 SER HA   H  -5.395 -15.184   5.667 1.00 . A A . 55 SER HA   1 1 
        6  7566 1 1 55 SER HB2  H  -4.634 -13.495   3.266 1.00 . A A . 55 SER HB2  1 1 
        6  7567 1 1 55 SER HB3  H  -5.047 -15.209   3.202 1.00 . A A . 55 SER HB3  1 1 
        6  7568 1 1 55 SER HG   H  -6.899 -13.670   4.522 1.00 . A A . 55 SER HG   1 1 
        6  7569 1 1 55 SER N    N  -4.923 -13.188   5.946 1.00 . A A . 55 SER N    1 1 
        6  7570 1 1 55 SER O    O  -2.374 -14.229   4.897 1.00 . A A . 55 SER O    1 1 
        6  7571 1 1 55 SER OG   O  -6.587 -13.947   3.654 1.00 . A A . 55 SER OG   1 1 
        6  7572 1 1 56 THR C    C  -1.245 -17.230   4.446 1.00 . A A . 56 THR C    1 1 
        6  7573 1 1 56 THR CA   C  -1.809 -16.809   5.810 1.00 . A A . 56 THR CA   1 1 
        6  7574 1 1 56 THR CB   C  -1.852 -18.051   6.729 1.00 . A A . 56 THR CB   1 1 
        6  7575 1 1 56 THR CG2  C  -2.237 -17.665   8.153 1.00 . A A . 56 THR CG2  1 1 
        6  7576 1 1 56 THR H    H  -3.928 -16.711   5.958 1.00 . A A . 56 THR H    1 1 
        6  7577 1 1 56 THR HA   H  -1.140 -16.082   6.255 1.00 . A A . 56 THR HA   1 1 
        6  7578 1 1 56 THR HB   H  -0.868 -18.503   6.748 1.00 . A A . 56 THR HB   1 1 
        6  7579 1 1 56 THR HG1  H  -2.361 -19.863   6.115 1.00 . A A . 56 THR HG1  1 1 
        6  7580 1 1 56 THR HG21 H  -1.484 -17.009   8.566 1.00 . A A . 56 THR HG21 1 1 
        6  7581 1 1 56 THR HG22 H  -2.309 -18.555   8.761 1.00 . A A . 56 THR HG22 1 1 
        6  7582 1 1 56 THR HG23 H  -3.191 -17.157   8.144 1.00 . A A . 56 THR HG23 1 1 
        6  7583 1 1 56 THR N    N  -3.139 -16.191   5.692 1.00 . A A . 56 THR N    1 1 
        6  7584 1 1 56 THR O    O  -0.054 -17.512   4.316 1.00 . A A . 56 THR O    1 1 
        6  7585 1 1 56 THR OG1  O  -2.796 -19.007   6.217 1.00 . A A . 56 THR OG1  1 1 
        6  7586 1 1 57 TYR C    C  -2.148 -16.602   1.058 1.00 . A A . 57 TYR C    1 1 
        6  7587 1 1 57 TYR CA   C  -1.698 -17.657   2.077 1.00 . A A . 57 TYR CA   1 1 
        6  7588 1 1 57 TYR CB   C  -2.278 -19.034   1.706 1.00 . A A . 57 TYR CB   1 1 
        6  7589 1 1 57 TYR CD1  C  -4.573 -19.140   2.783 1.00 . A A . 57 TYR CD1  1 1 
        6  7590 1 1 57 TYR CD2  C  -4.455 -19.030   0.402 1.00 . A A . 57 TYR CD2  1 1 
        6  7591 1 1 57 TYR CE1  C  -5.955 -19.170   2.715 1.00 . A A . 57 TYR CE1  1 1 
        6  7592 1 1 57 TYR CE2  C  -5.836 -19.060   0.328 1.00 . A A . 57 TYR CE2  1 1 
        6  7593 1 1 57 TYR CG   C  -3.798 -19.069   1.629 1.00 . A A . 57 TYR CG   1 1 
        6  7594 1 1 57 TYR CZ   C  -6.581 -19.129   1.486 1.00 . A A . 57 TYR CZ   1 1 
        6  7595 1 1 57 TYR H    H  -3.041 -17.041   3.598 1.00 . A A . 57 TYR H    1 1 
        6  7596 1 1 57 TYR HA   H  -0.618 -17.714   2.058 1.00 . A A . 57 TYR HA   1 1 
        6  7597 1 1 57 TYR HB2  H  -1.890 -19.331   0.740 1.00 . A A . 57 TYR HB2  1 1 
        6  7598 1 1 57 TYR HB3  H  -1.966 -19.758   2.446 1.00 . A A . 57 TYR HB3  1 1 
        6  7599 1 1 57 TYR HD1  H  -4.082 -19.173   3.745 1.00 . A A . 57 TYR HD1  1 1 
        6  7600 1 1 57 TYR HD2  H  -3.871 -18.975  -0.506 1.00 . A A . 57 TYR HD2  1 1 
        6  7601 1 1 57 TYR HE1  H  -6.539 -19.223   3.624 1.00 . A A . 57 TYR HE1  1 1 
        6  7602 1 1 57 TYR HE2  H  -6.324 -19.028  -0.637 1.00 . A A . 57 TYR HE2  1 1 
        6  7603 1 1 57 TYR HH   H  -8.330 -18.519   2.032 1.00 . A A . 57 TYR HH   1 1 
        6  7604 1 1 57 TYR N    N  -2.107 -17.277   3.434 1.00 . A A . 57 TYR N    1 1 
        6  7605 1 1 57 TYR O    O  -3.241 -16.044   1.169 1.00 . A A . 57 TYR O    1 1 
        6  7606 1 1 57 TYR OH   O  -7.957 -19.160   1.411 1.00 . A A . 57 TYR OH   1 1 
        6  7607 1 1 58 TYR C    C  -1.566 -15.958  -2.372 1.00 . A A . 58 TYR C    1 1 
        6  7608 1 1 58 TYR CA   C  -1.618 -15.334  -0.967 1.00 . A A . 58 TYR CA   1 1 
        6  7609 1 1 58 TYR CB   C  -0.665 -14.133  -0.871 1.00 . A A . 58 TYR CB   1 1 
        6  7610 1 1 58 TYR CD1  C  -1.398 -12.824   1.169 1.00 . A A . 58 TYR CD1  1 1 
        6  7611 1 1 58 TYR CD2  C   0.660 -14.027   1.275 1.00 . A A . 58 TYR CD2  1 1 
        6  7612 1 1 58 TYR CE1  C  -1.219 -12.401   2.472 1.00 . A A . 58 TYR CE1  1 1 
        6  7613 1 1 58 TYR CE2  C   0.847 -13.602   2.572 1.00 . A A . 58 TYR CE2  1 1 
        6  7614 1 1 58 TYR CG   C  -0.462 -13.645   0.547 1.00 . A A . 58 TYR CG   1 1 
        6  7615 1 1 58 TYR CZ   C  -0.096 -12.794   3.167 1.00 . A A . 58 TYR CZ   1 1 
        6  7616 1 1 58 TYR H    H  -0.442 -16.798   0.031 1.00 . A A . 58 TYR H    1 1 
        6  7617 1 1 58 TYR HA   H  -2.628 -14.985  -0.791 1.00 . A A . 58 TYR HA   1 1 
        6  7618 1 1 58 TYR HB2  H   0.300 -14.413  -1.269 1.00 . A A . 58 TYR HB2  1 1 
        6  7619 1 1 58 TYR HB3  H  -1.065 -13.315  -1.456 1.00 . A A . 58 TYR HB3  1 1 
        6  7620 1 1 58 TYR HD1  H  -2.278 -12.517   0.621 1.00 . A A . 58 TYR HD1  1 1 
        6  7621 1 1 58 TYR HD2  H   1.398 -14.664   0.807 1.00 . A A . 58 TYR HD2  1 1 
        6  7622 1 1 58 TYR HE1  H  -1.956 -11.764   2.940 1.00 . A A . 58 TYR HE1  1 1 
        6  7623 1 1 58 TYR HE2  H   1.726 -13.908   3.118 1.00 . A A . 58 TYR HE2  1 1 
        6  7624 1 1 58 TYR HH   H  -0.719 -12.586   4.969 1.00 . A A . 58 TYR HH   1 1 
        6  7625 1 1 58 TYR N    N  -1.300 -16.327   0.067 1.00 . A A . 58 TYR N    1 1 
        6  7626 1 1 58 TYR O    O  -2.547 -16.549  -2.815 1.00 . A A . 58 TYR O    1 1 
        6  7627 1 1 58 TYR OH   O   0.081 -12.384   4.467 1.00 . A A . 58 TYR OH   1 1 
        6  7628 1 1 59 ALA C    C  -1.264 -15.949  -5.424 1.00 . A A . 59 ALA C    1 1 
        6  7629 1 1 59 ALA CA   C  -0.212 -16.418  -4.396 1.00 . A A . 59 ALA CA   1 1 
        6  7630 1 1 59 ALA CB   C  -0.181 -17.943  -4.316 1.00 . A A . 59 ALA CB   1 1 
        6  7631 1 1 59 ALA H    H   0.329 -15.351  -2.639 1.00 . A A . 59 ALA H    1 1 
        6  7632 1 1 59 ALA HA   H   0.761 -16.092  -4.737 1.00 . A A . 59 ALA HA   1 1 
        6  7633 1 1 59 ALA HB1  H   0.056 -18.351  -5.290 1.00 . A A . 59 ALA HB1  1 1 
        6  7634 1 1 59 ALA HB2  H  -1.147 -18.310  -4.000 1.00 . A A . 59 ALA HB2  1 1 
        6  7635 1 1 59 ALA HB3  H   0.572 -18.253  -3.605 1.00 . A A . 59 ALA HB3  1 1 
        6  7636 1 1 59 ALA N    N  -0.415 -15.839  -3.053 1.00 . A A . 59 ALA N    1 1 
        6  7637 1 1 59 ALA O    O  -0.968 -15.144  -6.306 1.00 . A A . 59 ALA O    1 1 
        6  7638 1 1 60 ASN C    C  -3.914 -14.629  -6.219 1.00 . A A . 60 ASN C    1 1 
        6  7639 1 1 60 ASN CA   C  -3.589 -16.140  -6.218 1.00 . A A . 60 ASN CA   1 1 
        6  7640 1 1 60 ASN CB   C  -4.833 -16.958  -5.820 1.00 . A A . 60 ASN CB   1 1 
        6  7641 1 1 60 ASN CG   C  -5.897 -17.028  -6.908 1.00 . A A . 60 ASN CG   1 1 
        6  7642 1 1 60 ASN H    H  -2.658 -17.094  -4.568 1.00 . A A . 60 ASN H    1 1 
        6  7643 1 1 60 ASN HA   H  -3.284 -16.430  -7.212 1.00 . A A . 60 ASN HA   1 1 
        6  7644 1 1 60 ASN HB2  H  -4.526 -17.968  -5.588 1.00 . A A . 60 ASN HB2  1 1 
        6  7645 1 1 60 ASN HB3  H  -5.278 -16.520  -4.936 1.00 . A A . 60 ASN HB3  1 1 
        6  7646 1 1 60 ASN HD21 H  -6.483 -18.800  -6.258 1.00 . A A . 60 ASN HD21 1 1 
        6  7647 1 1 60 ASN HD22 H  -7.338 -18.175  -7.622 1.00 . A A . 60 ASN HD22 1 1 
        6  7648 1 1 60 ASN N    N  -2.487 -16.464  -5.299 1.00 . A A . 60 ASN N    1 1 
        6  7649 1 1 60 ASN ND2  N  -6.647 -18.110  -6.931 1.00 . A A . 60 ASN ND2  1 1 
        6  7650 1 1 60 ASN O    O  -4.515 -14.118  -7.168 1.00 . A A . 60 ASN O    1 1 
        6  7651 1 1 60 ASN OD1  O  -6.045 -16.124  -7.721 1.00 . A A . 60 ASN OD1  1 1 
        6  7652 1 1 61 VAL C    C  -3.326 -11.729  -6.333 1.00 . A A . 61 VAL C    1 1 
        6  7653 1 1 61 VAL CA   C  -3.748 -12.470  -5.051 1.00 . A A . 61 VAL CA   1 1 
        6  7654 1 1 61 VAL CB   C  -3.003 -11.861  -3.832 1.00 . A A . 61 VAL CB   1 1 
        6  7655 1 1 61 VAL CG1  C  -3.201 -10.345  -3.766 1.00 . A A . 61 VAL CG1  1 1 
        6  7656 1 1 61 VAL CG2  C  -3.472 -12.519  -2.535 1.00 . A A . 61 VAL CG2  1 1 
        6  7657 1 1 61 VAL H    H  -3.038 -14.379  -4.437 1.00 . A A . 61 VAL H    1 1 
        6  7658 1 1 61 VAL HA   H  -4.811 -12.324  -4.902 1.00 . A A . 61 VAL HA   1 1 
        6  7659 1 1 61 VAL HB   H  -1.945 -12.058  -3.949 1.00 . A A . 61 VAL HB   1 1 
        6  7660 1 1 61 VAL HG11 H  -4.253 -10.120  -3.668 1.00 . A A . 61 VAL HG11 1 1 
        6  7661 1 1 61 VAL HG12 H  -2.819  -9.890  -4.671 1.00 . A A . 61 VAL HG12 1 1 
        6  7662 1 1 61 VAL HG13 H  -2.668  -9.947  -2.914 1.00 . A A . 61 VAL HG13 1 1 
        6  7663 1 1 61 VAL HG21 H  -2.929 -12.098  -1.700 1.00 . A A . 61 VAL HG21 1 1 
        6  7664 1 1 61 VAL HG22 H  -3.286 -13.582  -2.584 1.00 . A A . 61 VAL HG22 1 1 
        6  7665 1 1 61 VAL HG23 H  -4.529 -12.344  -2.400 1.00 . A A . 61 VAL HG23 1 1 
        6  7666 1 1 61 VAL N    N  -3.509 -13.919  -5.161 1.00 . A A . 61 VAL N    1 1 
        6  7667 1 1 61 VAL O    O  -2.144 -11.675  -6.677 1.00 . A A . 61 VAL O    1 1 
        6  7668 1 1 62 SER C    C  -2.870  -9.643  -8.438 1.00 . A A . 62 SER C    1 1 
        6  7669 1 1 62 SER CA   C  -4.124 -10.527  -8.337 1.00 . A A . 62 SER CA   1 1 
        6  7670 1 1 62 SER CB   C  -5.352  -9.686  -8.705 1.00 . A A . 62 SER CB   1 1 
        6  7671 1 1 62 SER H    H  -5.214 -11.152  -6.624 1.00 . A A . 62 SER H    1 1 
        6  7672 1 1 62 SER HA   H  -4.037 -11.328  -9.058 1.00 . A A . 62 SER HA   1 1 
        6  7673 1 1 62 SER HB2  H  -6.195 -10.338  -8.879 1.00 . A A . 62 SER HB2  1 1 
        6  7674 1 1 62 SER HB3  H  -5.581  -9.012  -7.892 1.00 . A A . 62 SER HB3  1 1 
        6  7675 1 1 62 SER HG   H  -5.775  -9.154 -10.547 1.00 . A A . 62 SER HG   1 1 
        6  7676 1 1 62 SER N    N  -4.314 -11.151  -7.017 1.00 . A A . 62 SER N    1 1 
        6  7677 1 1 62 SER O    O  -2.625  -8.771  -7.593 1.00 . A A . 62 SER O    1 1 
        6  7678 1 1 62 SER OG   O  -5.118  -8.921  -9.877 1.00 . A A . 62 SER OG   1 1 
        6  7679 1 1 63 ALA C    C  -1.467  -7.723 -10.506 1.00 . A A . 63 ALA C    1 1 
        6  7680 1 1 63 ALA CA   C  -0.960  -9.011  -9.844 1.00 . A A . 63 ALA CA   1 1 
        6  7681 1 1 63 ALA CB   C   0.005  -9.740 -10.775 1.00 . A A . 63 ALA CB   1 1 
        6  7682 1 1 63 ALA H    H  -2.273 -10.663 -10.050 1.00 . A A . 63 ALA H    1 1 
        6  7683 1 1 63 ALA HA   H  -0.430  -8.758  -8.934 1.00 . A A . 63 ALA HA   1 1 
        6  7684 1 1 63 ALA HB1  H   0.382 -10.624 -10.283 1.00 . A A . 63 ALA HB1  1 1 
        6  7685 1 1 63 ALA HB2  H   0.831  -9.089 -11.022 1.00 . A A . 63 ALA HB2  1 1 
        6  7686 1 1 63 ALA HB3  H  -0.511 -10.026 -11.680 1.00 . A A . 63 ALA HB3  1 1 
        6  7687 1 1 63 ALA N    N  -2.086  -9.878  -9.490 1.00 . A A . 63 ALA N    1 1 
        6  7688 1 1 63 ALA O    O  -0.832  -6.676 -10.416 1.00 . A A . 63 ALA O    1 1 
        6  7689 1 1 64 ALA C    C  -3.569  -5.612 -10.623 1.00 . A A . 64 ALA C    1 1 
        6  7690 1 1 64 ALA CA   C  -3.290  -6.633 -11.728 1.00 . A A . 64 ALA CA   1 1 
        6  7691 1 1 64 ALA CB   C  -4.588  -7.031 -12.423 1.00 . A A . 64 ALA CB   1 1 
        6  7692 1 1 64 ALA H    H  -3.034  -8.698 -11.285 1.00 . A A . 64 ALA H    1 1 
        6  7693 1 1 64 ALA HA   H  -2.631  -6.190 -12.462 1.00 . A A . 64 ALA HA   1 1 
        6  7694 1 1 64 ALA HB1  H  -4.372  -7.734 -13.215 1.00 . A A . 64 ALA HB1  1 1 
        6  7695 1 1 64 ALA HB2  H  -5.059  -6.153 -12.843 1.00 . A A . 64 ALA HB2  1 1 
        6  7696 1 1 64 ALA HB3  H  -5.257  -7.491 -11.710 1.00 . A A . 64 ALA HB3  1 1 
        6  7697 1 1 64 ALA N    N  -2.623  -7.814 -11.168 1.00 . A A . 64 ALA N    1 1 
        6  7698 1 1 64 ALA O    O  -3.400  -4.404 -10.810 1.00 . A A . 64 ALA O    1 1 
        6  7699 1 1 65 LYS C    C  -2.969  -4.442  -7.932 1.00 . A A . 65 LYS C    1 1 
        6  7700 1 1 65 LYS CA   C  -4.195  -5.318  -8.256 1.00 . A A . 65 LYS CA   1 1 
        6  7701 1 1 65 LYS CB   C  -4.538  -6.255  -7.076 1.00 . A A . 65 LYS CB   1 1 
        6  7702 1 1 65 LYS CD   C  -3.594  -5.282  -4.897 1.00 . A A . 65 LYS CD   1 1 
        6  7703 1 1 65 LYS CE   C  -2.934  -6.554  -4.357 1.00 . A A . 65 LYS CE   1 1 
        6  7704 1 1 65 LYS CG   C  -4.845  -5.563  -5.742 1.00 . A A . 65 LYS CG   1 1 
        6  7705 1 1 65 LYS H    H  -4.152  -7.094  -9.417 1.00 . A A . 65 LYS H    1 1 
        6  7706 1 1 65 LYS HA   H  -5.040  -4.673  -8.447 1.00 . A A . 65 LYS HA   1 1 
        6  7707 1 1 65 LYS HB2  H  -5.405  -6.840  -7.348 1.00 . A A . 65 LYS HB2  1 1 
        6  7708 1 1 65 LYS HB3  H  -3.708  -6.930  -6.923 1.00 . A A . 65 LYS HB3  1 1 
        6  7709 1 1 65 LYS HD2  H  -2.875  -4.753  -5.505 1.00 . A A . 65 LYS HD2  1 1 
        6  7710 1 1 65 LYS HD3  H  -3.879  -4.657  -4.063 1.00 . A A . 65 LYS HD3  1 1 
        6  7711 1 1 65 LYS HE2  H  -2.222  -6.274  -3.594 1.00 . A A . 65 LYS HE2  1 1 
        6  7712 1 1 65 LYS HE3  H  -3.697  -7.182  -3.915 1.00 . A A . 65 LYS HE3  1 1 
        6  7713 1 1 65 LYS HG2  H  -5.340  -4.625  -5.944 1.00 . A A . 65 LYS HG2  1 1 
        6  7714 1 1 65 LYS HG3  H  -5.513  -6.198  -5.171 1.00 . A A . 65 LYS HG3  1 1 
        6  7715 1 1 65 LYS HZ1  H  -2.891  -7.694  -6.113 1.00 . A A . 65 LYS HZ1  1 1 
        6  7716 1 1 65 LYS HZ2  H  -1.717  -8.134  -4.978 1.00 . A A . 65 LYS HZ2  1 1 
        6  7717 1 1 65 LYS HZ3  H  -1.526  -6.725  -5.889 1.00 . A A . 65 LYS HZ3  1 1 
        6  7718 1 1 65 LYS N    N  -3.975  -6.129  -9.460 1.00 . A A . 65 LYS N    1 1 
        6  7719 1 1 65 LYS NZ   N  -2.219  -7.329  -5.409 1.00 . A A . 65 LYS NZ   1 1 
        6  7720 1 1 65 LYS O    O  -3.100  -3.370  -7.343 1.00 . A A . 65 LYS O    1 1 
        6  7721 1 1 66 CYS C    C  -0.576  -2.761  -8.761 1.00 . A A . 66 CYS C    1 1 
        6  7722 1 1 66 CYS CA   C  -0.537  -4.139  -8.096 1.00 . A A . 66 CYS CA   1 1 
        6  7723 1 1 66 CYS CB   C   0.680  -4.908  -8.612 1.00 . A A . 66 CYS CB   1 1 
        6  7724 1 1 66 CYS H    H  -1.729  -5.752  -8.810 1.00 . A A . 66 CYS H    1 1 
        6  7725 1 1 66 CYS HA   H  -0.434  -4.003  -7.027 1.00 . A A . 66 CYS HA   1 1 
        6  7726 1 1 66 CYS HB2  H   0.873  -5.746  -7.960 1.00 . A A . 66 CYS HB2  1 1 
        6  7727 1 1 66 CYS HB3  H   0.473  -5.273  -9.608 1.00 . A A . 66 CYS HB3  1 1 
        6  7728 1 1 66 CYS HG   H   1.907  -2.696  -8.265 1.00 . A A . 66 CYS HG   1 1 
        6  7729 1 1 66 CYS N    N  -1.776  -4.897  -8.331 1.00 . A A . 66 CYS N    1 1 
        6  7730 1 1 66 CYS O    O  -0.333  -1.746  -8.113 1.00 . A A . 66 CYS O    1 1 
        6  7731 1 1 66 CYS SG   S   2.191  -3.919  -8.693 1.00 . A A . 66 CYS SG   1 1 
        6  7732 1 1 67 GLN C    C  -2.174  -0.656 -10.458 1.00 . A A . 67 GLN C    1 1 
        6  7733 1 1 67 GLN CA   C  -0.913  -1.466 -10.802 1.00 . A A . 67 GLN CA   1 1 
        6  7734 1 1 67 GLN CB   C  -0.832  -1.726 -12.315 1.00 . A A . 67 GLN CB   1 1 
        6  7735 1 1 67 GLN CD   C   0.572   0.324 -12.884 1.00 . A A . 67 GLN CD   1 1 
        6  7736 1 1 67 GLN CG   C  -0.707  -0.457 -13.158 1.00 . A A . 67 GLN CG   1 1 
        6  7737 1 1 67 GLN H    H  -1.080  -3.567 -10.523 1.00 . A A . 67 GLN H    1 1 
        6  7738 1 1 67 GLN HA   H  -0.047  -0.890 -10.506 1.00 . A A . 67 GLN HA   1 1 
        6  7739 1 1 67 GLN HB2  H   0.025  -2.352 -12.514 1.00 . A A . 67 GLN HB2  1 1 
        6  7740 1 1 67 GLN HB3  H  -1.725  -2.252 -12.625 1.00 . A A . 67 GLN HB3  1 1 
        6  7741 1 1 67 GLN HE21 H   1.523  -0.671 -14.305 1.00 . A A . 67 GLN HE21 1 1 
        6  7742 1 1 67 GLN HE22 H   2.443   0.543 -13.487 1.00 . A A . 67 GLN HE22 1 1 
        6  7743 1 1 67 GLN HG2  H  -0.720  -0.733 -14.204 1.00 . A A . 67 GLN HG2  1 1 
        6  7744 1 1 67 GLN HG3  H  -1.554   0.182 -12.951 1.00 . A A . 67 GLN HG3  1 1 
        6  7745 1 1 67 GLN N    N  -0.876  -2.730 -10.058 1.00 . A A . 67 GLN N    1 1 
        6  7746 1 1 67 GLN NE2  N   1.619   0.031 -13.629 1.00 . A A . 67 GLN NE2  1 1 
        6  7747 1 1 67 GLN O    O  -2.175   0.571 -10.544 1.00 . A A . 67 GLN O    1 1 
        6  7748 1 1 67 GLN OE1  O   0.617   1.181 -12.012 1.00 . A A . 67 GLN OE1  1 1 
        6  7749 1 1 68 GLU C    C  -4.165   0.132  -8.306 1.00 . A A . 68 GLU C    1 1 
        6  7750 1 1 68 GLU CA   C  -4.458  -0.664  -9.591 1.00 . A A . 68 GLU CA   1 1 
        6  7751 1 1 68 GLU CB   C  -5.588  -1.671  -9.333 1.00 . A A . 68 GLU CB   1 1 
        6  7752 1 1 68 GLU CD   C  -7.235  -3.326 -10.323 1.00 . A A . 68 GLU CD   1 1 
        6  7753 1 1 68 GLU CG   C  -6.010  -2.459 -10.572 1.00 . A A . 68 GLU CG   1 1 
        6  7754 1 1 68 GLU H    H  -3.229  -2.324 -10.103 1.00 . A A . 68 GLU H    1 1 
        6  7755 1 1 68 GLU HA   H  -4.771   0.028 -10.362 1.00 . A A . 68 GLU HA   1 1 
        6  7756 1 1 68 GLU HB2  H  -5.260  -2.375  -8.582 1.00 . A A . 68 GLU HB2  1 1 
        6  7757 1 1 68 GLU HB3  H  -6.453  -1.140  -8.959 1.00 . A A . 68 GLU HB3  1 1 
        6  7758 1 1 68 GLU HG2  H  -6.234  -1.761 -11.368 1.00 . A A . 68 GLU HG2  1 1 
        6  7759 1 1 68 GLU HG3  H  -5.190  -3.095 -10.877 1.00 . A A . 68 GLU HG3  1 1 
        6  7760 1 1 68 GLU N    N  -3.247  -1.344 -10.065 1.00 . A A . 68 GLU N    1 1 
        6  7761 1 1 68 GLU O    O  -4.566   1.290  -8.167 1.00 . A A . 68 GLU O    1 1 
        6  7762 1 1 68 GLU OE1  O  -7.092  -4.430  -9.762 1.00 . A A . 68 GLU OE1  1 1 
        6  7763 1 1 68 GLU OE2  O  -8.356  -2.896 -10.676 1.00 . A A . 68 GLU OE2  1 1 
        6  7764 1 1 69 PHE C    C  -1.933   1.207  -6.461 1.00 . A A . 69 PHE C    1 1 
        6  7765 1 1 69 PHE CA   C  -3.010   0.159  -6.145 1.00 . A A . 69 PHE CA   1 1 
        6  7766 1 1 69 PHE CB   C  -2.468  -0.880  -5.147 1.00 . A A . 69 PHE CB   1 1 
        6  7767 1 1 69 PHE CD1  C  -2.769   0.197  -2.888 1.00 . A A . 69 PHE CD1  1 1 
        6  7768 1 1 69 PHE CD2  C  -0.545  -0.196  -3.664 1.00 . A A . 69 PHE CD2  1 1 
        6  7769 1 1 69 PHE CE1  C  -2.267   0.747  -1.722 1.00 . A A . 69 PHE CE1  1 1 
        6  7770 1 1 69 PHE CE2  C  -0.039   0.353  -2.502 1.00 . A A . 69 PHE CE2  1 1 
        6  7771 1 1 69 PHE CG   C  -1.916  -0.281  -3.873 1.00 . A A . 69 PHE CG   1 1 
        6  7772 1 1 69 PHE CZ   C  -0.900   0.825  -1.529 1.00 . A A . 69 PHE CZ   1 1 
        6  7773 1 1 69 PHE H    H  -3.253  -1.456  -7.502 1.00 . A A . 69 PHE H    1 1 
        6  7774 1 1 69 PHE HA   H  -3.864   0.657  -5.705 1.00 . A A . 69 PHE HA   1 1 
        6  7775 1 1 69 PHE HB2  H  -3.266  -1.556  -4.874 1.00 . A A . 69 PHE HB2  1 1 
        6  7776 1 1 69 PHE HB3  H  -1.677  -1.444  -5.622 1.00 . A A . 69 PHE HB3  1 1 
        6  7777 1 1 69 PHE HD1  H  -3.839   0.135  -3.037 1.00 . A A . 69 PHE HD1  1 1 
        6  7778 1 1 69 PHE HD2  H   0.131  -0.564  -4.423 1.00 . A A . 69 PHE HD2  1 1 
        6  7779 1 1 69 PHE HE1  H  -2.942   1.116  -0.963 1.00 . A A . 69 PHE HE1  1 1 
        6  7780 1 1 69 PHE HE2  H   1.029   0.411  -2.352 1.00 . A A . 69 PHE HE2  1 1 
        6  7781 1 1 69 PHE HZ   H  -0.506   1.255  -0.620 1.00 . A A . 69 PHE HZ   1 1 
        6  7782 1 1 69 PHE N    N  -3.464  -0.507  -7.370 1.00 . A A . 69 PHE N    1 1 
        6  7783 1 1 69 PHE O    O  -1.984   2.333  -5.968 1.00 . A A . 69 PHE O    1 1 
        6  7784 1 1 70 GLY C    C  -0.426   3.014  -8.355 1.00 . A A . 70 GLY C    1 1 
        6  7785 1 1 70 GLY CA   C   0.099   1.738  -7.704 1.00 . A A . 70 GLY CA   1 1 
        6  7786 1 1 70 GLY H    H  -0.967  -0.094  -7.632 1.00 . A A . 70 GLY H    1 1 
        6  7787 1 1 70 GLY HA2  H   0.681   2.006  -6.834 1.00 . A A . 70 GLY HA2  1 1 
        6  7788 1 1 70 GLY HA3  H   0.742   1.228  -8.407 1.00 . A A . 70 GLY HA3  1 1 
        6  7789 1 1 70 GLY N    N  -0.965   0.824  -7.296 1.00 . A A . 70 GLY N    1 1 
        6  7790 1 1 70 GLY O    O   0.119   4.093  -8.148 1.00 . A A . 70 GLY O    1 1 
        6  7791 1 1 71 ARG C    C  -2.541   5.088  -8.727 1.00 . A A . 71 ARG C    1 1 
        6  7792 1 1 71 ARG CA   C  -2.161   4.024  -9.772 1.00 . A A . 71 ARG CA   1 1 
        6  7793 1 1 71 ARG CB   C  -3.426   3.528 -10.486 1.00 . A A . 71 ARG CB   1 1 
        6  7794 1 1 71 ARG CD   C  -5.556   4.150 -11.681 1.00 . A A . 71 ARG CD   1 1 
        6  7795 1 1 71 ARG CG   C  -4.138   4.585 -11.321 1.00 . A A . 71 ARG CG   1 1 
        6  7796 1 1 71 ARG CZ   C  -6.422   1.861 -11.843 1.00 . A A . 71 ARG CZ   1 1 
        6  7797 1 1 71 ARG H    H  -1.832   1.978  -9.320 1.00 . A A . 71 ARG H    1 1 
        6  7798 1 1 71 ARG HA   H  -1.486   4.458 -10.499 1.00 . A A . 71 ARG HA   1 1 
        6  7799 1 1 71 ARG HB2  H  -3.155   2.709 -11.139 1.00 . A A . 71 ARG HB2  1 1 
        6  7800 1 1 71 ARG HB3  H  -4.120   3.160  -9.742 1.00 . A A . 71 ARG HB3  1 1 
        6  7801 1 1 71 ARG HD2  H  -6.166   4.183 -10.790 1.00 . A A . 71 ARG HD2  1 1 
        6  7802 1 1 71 ARG HD3  H  -5.955   4.838 -12.411 1.00 . A A . 71 ARG HD3  1 1 
        6  7803 1 1 71 ARG HE   H  -4.963   2.583 -12.955 1.00 . A A . 71 ARG HE   1 1 
        6  7804 1 1 71 ARG HG2  H  -4.187   5.506 -10.758 1.00 . A A . 71 ARG HG2  1 1 
        6  7805 1 1 71 ARG HG3  H  -3.578   4.749 -12.232 1.00 . A A . 71 ARG HG3  1 1 
        6  7806 1 1 71 ARG HH11 H  -7.307   2.993 -10.471 1.00 . A A . 71 ARG HH11 1 1 
        6  7807 1 1 71 ARG HH12 H  -7.898   1.373 -10.597 1.00 . A A . 71 ARG HH12 1 1 
        6  7808 1 1 71 ARG HH21 H  -5.719   0.509 -13.118 1.00 . A A . 71 ARG HH21 1 1 
        6  7809 1 1 71 ARG HH22 H  -7.014  -0.021 -12.097 1.00 . A A . 71 ARG HH22 1 1 
        6  7810 1 1 71 ARG N    N  -1.490   2.880  -9.143 1.00 . A A . 71 ARG N    1 1 
        6  7811 1 1 71 ARG NE   N  -5.596   2.797 -12.240 1.00 . A A . 71 ARG NE   1 1 
        6  7812 1 1 71 ARG NH1  N  -7.274   2.096 -10.900 1.00 . A A . 71 ARG NH1  1 1 
        6  7813 1 1 71 ARG NH2  N  -6.381   0.694 -12.394 1.00 . A A . 71 ARG NH2  1 1 
        6  7814 1 1 71 ARG O    O  -2.176   6.263  -8.844 1.00 . A A . 71 ARG O    1 1 
        6  7815 1 1 72 TRP C    C  -2.565   5.995  -5.737 1.00 . A A . 72 TRP C    1 1 
        6  7816 1 1 72 TRP CA   C  -3.731   5.537  -6.628 1.00 . A A . 72 TRP CA   1 1 
        6  7817 1 1 72 TRP CB   C  -4.783   4.800  -5.785 1.00 . A A . 72 TRP CB   1 1 
        6  7818 1 1 72 TRP CD1  C  -6.365   6.513  -4.708 1.00 . A A . 72 TRP CD1  1 1 
        6  7819 1 1 72 TRP CD2  C  -4.923   5.573  -3.276 1.00 . A A . 72 TRP CD2  1 1 
        6  7820 1 1 72 TRP CE2  C  -5.728   6.484  -2.570 1.00 . A A . 72 TRP CE2  1 1 
        6  7821 1 1 72 TRP CE3  C  -3.939   4.862  -2.581 1.00 . A A . 72 TRP CE3  1 1 
        6  7822 1 1 72 TRP CG   C  -5.344   5.608  -4.646 1.00 . A A . 72 TRP CG   1 1 
        6  7823 1 1 72 TRP CH2  C  -4.613   5.991  -0.543 1.00 . A A . 72 TRP CH2  1 1 
        6  7824 1 1 72 TRP CZ2  C  -5.582   6.703  -1.200 1.00 . A A . 72 TRP CZ2  1 1 
        6  7825 1 1 72 TRP CZ3  C  -3.796   5.077  -1.221 1.00 . A A . 72 TRP CZ3  1 1 
        6  7826 1 1 72 TRP H    H  -3.499   3.700  -7.663 1.00 . A A . 72 TRP H    1 1 
        6  7827 1 1 72 TRP HA   H  -4.188   6.402  -7.084 1.00 . A A . 72 TRP HA   1 1 
        6  7828 1 1 72 TRP HB2  H  -5.608   4.514  -6.423 1.00 . A A . 72 TRP HB2  1 1 
        6  7829 1 1 72 TRP HB3  H  -4.338   3.905  -5.372 1.00 . A A . 72 TRP HB3  1 1 
        6  7830 1 1 72 TRP HD1  H  -6.899   6.765  -5.613 1.00 . A A . 72 TRP HD1  1 1 
        6  7831 1 1 72 TRP HE1  H  -7.284   7.715  -3.253 1.00 . A A . 72 TRP HE1  1 1 
        6  7832 1 1 72 TRP HE3  H  -3.300   4.150  -3.087 1.00 . A A . 72 TRP HE3  1 1 
        6  7833 1 1 72 TRP HH2  H  -4.465   6.130   0.519 1.00 . A A . 72 TRP HH2  1 1 
        6  7834 1 1 72 TRP HZ2  H  -6.205   7.404  -0.663 1.00 . A A . 72 TRP HZ2  1 1 
        6  7835 1 1 72 TRP HZ3  H  -3.042   4.535  -0.668 1.00 . A A . 72 TRP HZ3  1 1 
        6  7836 1 1 72 TRP N    N  -3.267   4.652  -7.701 1.00 . A A . 72 TRP N    1 1 
        6  7837 1 1 72 TRP NE1  N  -6.599   7.045  -3.465 1.00 . A A . 72 TRP NE1  1 1 
        6  7838 1 1 72 TRP O    O  -2.433   7.180  -5.424 1.00 . A A . 72 TRP O    1 1 
        6  7839 1 1 73 TYR C    C   0.460   6.232  -5.055 1.00 . A A . 73 TYR C    1 1 
        6  7840 1 1 73 TYR CA   C  -0.601   5.301  -4.435 1.00 . A A . 73 TYR CA   1 1 
        6  7841 1 1 73 TYR CB   C   0.033   3.965  -4.018 1.00 . A A . 73 TYR CB   1 1 
        6  7842 1 1 73 TYR CD1  C   0.873   4.631  -1.720 1.00 . A A . 73 TYR CD1  1 1 
        6  7843 1 1 73 TYR CD2  C   2.427   3.663  -3.252 1.00 . A A . 73 TYR CD2  1 1 
        6  7844 1 1 73 TYR CE1  C   1.874   4.745  -0.774 1.00 . A A . 73 TYR CE1  1 1 
        6  7845 1 1 73 TYR CE2  C   3.431   3.776  -2.311 1.00 . A A . 73 TYR CE2  1 1 
        6  7846 1 1 73 TYR CG   C   1.131   4.087  -2.977 1.00 . A A . 73 TYR CG   1 1 
        6  7847 1 1 73 TYR CZ   C   3.150   4.316  -1.074 1.00 . A A . 73 TYR CZ   1 1 
        6  7848 1 1 73 TYR H    H  -1.848   4.135  -5.694 1.00 . A A . 73 TYR H    1 1 
        6  7849 1 1 73 TYR HA   H  -1.007   5.781  -3.555 1.00 . A A . 73 TYR HA   1 1 
        6  7850 1 1 73 TYR HB2  H  -0.735   3.323  -3.610 1.00 . A A . 73 TYR HB2  1 1 
        6  7851 1 1 73 TYR HB3  H   0.456   3.494  -4.895 1.00 . A A . 73 TYR HB3  1 1 
        6  7852 1 1 73 TYR HD1  H  -0.129   4.966  -1.486 1.00 . A A . 73 TYR HD1  1 1 
        6  7853 1 1 73 TYR HD2  H   2.646   3.238  -4.221 1.00 . A A . 73 TYR HD2  1 1 
        6  7854 1 1 73 TYR HE1  H   1.653   5.168   0.196 1.00 . A A . 73 TYR HE1  1 1 
        6  7855 1 1 73 TYR HE2  H   4.431   3.441  -2.544 1.00 . A A . 73 TYR HE2  1 1 
        6  7856 1 1 73 TYR HH   H   3.798   4.222   0.739 1.00 . A A . 73 TYR HH   1 1 
        6  7857 1 1 73 TYR N    N  -1.718   5.044  -5.354 1.00 . A A . 73 TYR N    1 1 
        6  7858 1 1 73 TYR O    O   1.094   7.019  -4.353 1.00 . A A . 73 TYR O    1 1 
        6  7859 1 1 73 TYR OH   O   4.151   4.434  -0.137 1.00 . A A . 73 TYR OH   1 1 
        6  7860 1 1 74 LYS C    C   1.022   8.451  -7.142 1.00 . A A . 74 LYS C    1 1 
        6  7861 1 1 74 LYS CA   C   1.586   7.024  -7.080 1.00 . A A . 74 LYS CA   1 1 
        6  7862 1 1 74 LYS CB   C   1.867   6.481  -8.492 1.00 . A A . 74 LYS CB   1 1 
        6  7863 1 1 74 LYS CD   C   3.319   6.582 -10.562 1.00 . A A . 74 LYS CD   1 1 
        6  7864 1 1 74 LYS CE   C   2.169   6.203 -11.494 1.00 . A A . 74 LYS CE   1 1 
        6  7865 1 1 74 LYS CG   C   2.839   7.324  -9.313 1.00 . A A . 74 LYS CG   1 1 
        6  7866 1 1 74 LYS H    H   0.167   5.450  -6.875 1.00 . A A . 74 LYS H    1 1 
        6  7867 1 1 74 LYS HA   H   2.513   7.043  -6.520 1.00 . A A . 74 LYS HA   1 1 
        6  7868 1 1 74 LYS HB2  H   2.274   5.485  -8.404 1.00 . A A . 74 LYS HB2  1 1 
        6  7869 1 1 74 LYS HB3  H   0.931   6.425  -9.032 1.00 . A A . 74 LYS HB3  1 1 
        6  7870 1 1 74 LYS HD2  H   4.006   7.219 -11.102 1.00 . A A . 74 LYS HD2  1 1 
        6  7871 1 1 74 LYS HD3  H   3.834   5.680 -10.257 1.00 . A A . 74 LYS HD3  1 1 
        6  7872 1 1 74 LYS HE2  H   2.556   5.577 -12.283 1.00 . A A . 74 LYS HE2  1 1 
        6  7873 1 1 74 LYS HE3  H   1.429   5.650 -10.930 1.00 . A A . 74 LYS HE3  1 1 
        6  7874 1 1 74 LYS HG2  H   2.343   8.236  -9.618 1.00 . A A . 74 LYS HG2  1 1 
        6  7875 1 1 74 LYS HG3  H   3.695   7.569  -8.699 1.00 . A A . 74 LYS HG3  1 1 
        6  7876 1 1 74 LYS HZ1  H   0.788   7.096 -12.775 1.00 . A A . 74 LYS HZ1  1 1 
        6  7877 1 1 74 LYS HZ2  H   2.229   7.962 -12.610 1.00 . A A . 74 LYS HZ2  1 1 
        6  7878 1 1 74 LYS HZ3  H   1.081   7.981 -11.365 1.00 . A A . 74 LYS HZ3  1 1 
        6  7879 1 1 74 LYS N    N   0.655   6.135  -6.369 1.00 . A A . 74 LYS N    1 1 
        6  7880 1 1 74 LYS NZ   N   1.521   7.393 -12.101 1.00 . A A . 74 LYS NZ   1 1 
        6  7881 1 1 74 LYS O    O   1.715   9.422  -6.831 1.00 . A A . 74 LYS O    1 1 
        6  7882 1 1 75 HIS C    C  -0.960  10.466  -6.097 1.00 . A A . 75 HIS C    1 1 
        6  7883 1 1 75 HIS CA   C  -0.954   9.855  -7.512 1.00 . A A . 75 HIS CA   1 1 
        6  7884 1 1 75 HIS CB   C  -2.396   9.658  -8.011 1.00 . A A . 75 HIS CB   1 1 
        6  7885 1 1 75 HIS CD2  C  -3.809  11.712  -7.264 1.00 . A A . 75 HIS CD2  1 1 
        6  7886 1 1 75 HIS CE1  C  -4.128  12.611  -9.237 1.00 . A A . 75 HIS CE1  1 1 
        6  7887 1 1 75 HIS CG   C  -3.176  10.931  -8.174 1.00 . A A . 75 HIS CG   1 1 
        6  7888 1 1 75 HIS H    H  -0.730   7.762  -7.812 1.00 . A A . 75 HIS H    1 1 
        6  7889 1 1 75 HIS HA   H  -0.433  10.523  -8.186 1.00 . A A . 75 HIS HA   1 1 
        6  7890 1 1 75 HIS HB2  H  -2.370   9.163  -8.970 1.00 . A A . 75 HIS HB2  1 1 
        6  7891 1 1 75 HIS HB3  H  -2.928   9.031  -7.308 1.00 . A A . 75 HIS HB3  1 1 
        6  7892 1 1 75 HIS HD1  H  -3.078  11.192 -10.264 1.00 . A A . 75 HIS HD1  1 1 
        6  7893 1 1 75 HIS HD2  H  -3.852  11.547  -6.197 1.00 . A A . 75 HIS HD2  1 1 
        6  7894 1 1 75 HIS HE1  H  -4.463  13.272 -10.023 1.00 . A A . 75 HIS HE1  1 1 
        6  7895 1 1 75 HIS HE2  H  -4.797  13.543  -7.544 1.00 . A A . 75 HIS HE2  1 1 
        6  7896 1 1 75 HIS N    N  -0.250   8.565  -7.517 1.00 . A A . 75 HIS N    1 1 
        6  7897 1 1 75 HIS ND1  N  -3.399  11.524  -9.400 1.00 . A A . 75 HIS ND1  1 1 
        6  7898 1 1 75 HIS NE2  N  -4.390  12.747  -7.954 1.00 . A A . 75 HIS NE2  1 1 
        6  7899 1 1 75 HIS O    O  -0.863  11.680  -5.928 1.00 . A A . 75 HIS O    1 1 
        6  7900 1 1 76 PHE C    C   0.246  10.627  -3.238 1.00 . A A . 76 PHE C    1 1 
        6  7901 1 1 76 PHE CA   C  -1.089   9.995  -3.682 1.00 . A A . 76 PHE CA   1 1 
        6  7902 1 1 76 PHE CB   C  -1.412   8.755  -2.828 1.00 . A A . 76 PHE CB   1 1 
        6  7903 1 1 76 PHE CD1  C  -2.658   9.537  -0.788 1.00 . A A . 76 PHE CD1  1 1 
        6  7904 1 1 76 PHE CD2  C  -0.440   8.698  -0.509 1.00 . A A . 76 PHE CD2  1 1 
        6  7905 1 1 76 PHE CE1  C  -2.748   9.756   0.572 1.00 . A A . 76 PHE CE1  1 1 
        6  7906 1 1 76 PHE CE2  C  -0.527   8.913   0.850 1.00 . A A . 76 PHE CE2  1 1 
        6  7907 1 1 76 PHE CG   C  -1.503   9.007  -1.346 1.00 . A A . 76 PHE CG   1 1 
        6  7908 1 1 76 PHE CZ   C  -1.681   9.444   1.391 1.00 . A A . 76 PHE CZ   1 1 
        6  7909 1 1 76 PHE H    H  -1.133   8.643  -5.313 1.00 . A A . 76 PHE H    1 1 
        6  7910 1 1 76 PHE HA   H  -1.880  10.723  -3.553 1.00 . A A . 76 PHE HA   1 1 
        6  7911 1 1 76 PHE HB2  H  -2.362   8.351  -3.145 1.00 . A A . 76 PHE HB2  1 1 
        6  7912 1 1 76 PHE HB3  H  -0.646   8.007  -2.990 1.00 . A A . 76 PHE HB3  1 1 
        6  7913 1 1 76 PHE HD1  H  -3.494   9.782  -1.427 1.00 . A A . 76 PHE HD1  1 1 
        6  7914 1 1 76 PHE HD2  H   0.466   8.286  -0.931 1.00 . A A . 76 PHE HD2  1 1 
        6  7915 1 1 76 PHE HE1  H  -3.651  10.171   0.994 1.00 . A A . 76 PHE HE1  1 1 
        6  7916 1 1 76 PHE HE2  H   0.306   8.668   1.490 1.00 . A A . 76 PHE HE2  1 1 
        6  7917 1 1 76 PHE HZ   H  -1.749   9.614   2.455 1.00 . A A . 76 PHE HZ   1 1 
        6  7918 1 1 76 PHE N    N  -1.065   9.595  -5.096 1.00 . A A . 76 PHE N    1 1 
        6  7919 1 1 76 PHE O    O   0.288  11.421  -2.296 1.00 . A A . 76 PHE O    1 1 
        6  7920 1 1 77 LYS C    C   3.130  11.913  -4.510 1.00 . A A . 77 LYS C    1 1 
        6  7921 1 1 77 LYS CA   C   2.670  10.779  -3.575 1.00 . A A . 77 LYS CA   1 1 
        6  7922 1 1 77 LYS CB   C   3.698   9.638  -3.634 1.00 . A A . 77 LYS CB   1 1 
        6  7923 1 1 77 LYS CD   C   4.470   7.383  -2.787 1.00 . A A . 77 LYS CD   1 1 
        6  7924 1 1 77 LYS CE   C   4.389   6.729  -4.161 1.00 . A A . 77 LYS CE   1 1 
        6  7925 1 1 77 LYS CG   C   3.445   8.508  -2.635 1.00 . A A . 77 LYS CG   1 1 
        6  7926 1 1 77 LYS H    H   1.240   9.643  -4.670 1.00 . A A . 77 LYS H    1 1 
        6  7927 1 1 77 LYS HA   H   2.632  11.160  -2.563 1.00 . A A . 77 LYS HA   1 1 
        6  7928 1 1 77 LYS HB2  H   3.688   9.217  -4.630 1.00 . A A . 77 LYS HB2  1 1 
        6  7929 1 1 77 LYS HB3  H   4.681  10.046  -3.440 1.00 . A A . 77 LYS HB3  1 1 
        6  7930 1 1 77 LYS HD2  H   5.462   7.789  -2.651 1.00 . A A . 77 LYS HD2  1 1 
        6  7931 1 1 77 LYS HD3  H   4.283   6.633  -2.031 1.00 . A A . 77 LYS HD3  1 1 
        6  7932 1 1 77 LYS HE2  H   3.427   6.248  -4.261 1.00 . A A . 77 LYS HE2  1 1 
        6  7933 1 1 77 LYS HE3  H   4.489   7.491  -4.918 1.00 . A A . 77 LYS HE3  1 1 
        6  7934 1 1 77 LYS HG2  H   3.508   8.905  -1.632 1.00 . A A . 77 LYS HG2  1 1 
        6  7935 1 1 77 LYS HG3  H   2.455   8.106  -2.803 1.00 . A A . 77 LYS HG3  1 1 
        6  7936 1 1 77 LYS HZ1  H   5.383   4.964  -3.642 1.00 . A A . 77 LYS HZ1  1 1 
        6  7937 1 1 77 LYS HZ2  H   6.392   6.155  -4.289 1.00 . A A . 77 LYS HZ2  1 1 
        6  7938 1 1 77 LYS HZ3  H   5.368   5.283  -5.301 1.00 . A A . 77 LYS HZ3  1 1 
        6  7939 1 1 77 LYS N    N   1.334  10.270  -3.920 1.00 . A A . 77 LYS N    1 1 
        6  7940 1 1 77 LYS NZ   N   5.456   5.711  -4.360 1.00 . A A . 77 LYS NZ   1 1 
        6  7941 1 1 77 LYS O    O   4.021  12.686  -4.151 1.00 . A A . 77 LYS O    1 1 
        6  7942 1 1 78 LYS C    C   4.353  12.495  -7.301 1.00 . A A . 78 LYS C    1 1 
        6  7943 1 1 78 LYS CA   C   2.973  12.918  -6.763 1.00 . A A . 78 LYS CA   1 1 
        6  7944 1 1 78 LYS CB   C   3.011  14.388  -6.292 1.00 . A A . 78 LYS CB   1 1 
        6  7945 1 1 78 LYS CD   C   0.825  15.066  -7.382 1.00 . A A . 78 LYS CD   1 1 
        6  7946 1 1 78 LYS CE   C  -0.449  15.899  -7.242 1.00 . A A . 78 LYS CE   1 1 
        6  7947 1 1 78 LYS CG   C   1.639  15.030  -6.085 1.00 . A A . 78 LYS CG   1 1 
        6  7948 1 1 78 LYS H    H   1.732  11.445  -5.862 1.00 . A A . 78 LYS H    1 1 
        6  7949 1 1 78 LYS HA   H   2.259  12.835  -7.573 1.00 . A A . 78 LYS HA   1 1 
        6  7950 1 1 78 LYS HB2  H   3.547  14.433  -5.355 1.00 . A A . 78 LYS HB2  1 1 
        6  7951 1 1 78 LYS HB3  H   3.550  14.974  -7.025 1.00 . A A . 78 LYS HB3  1 1 
        6  7952 1 1 78 LYS HD2  H   1.431  15.495  -8.166 1.00 . A A . 78 LYS HD2  1 1 
        6  7953 1 1 78 LYS HD3  H   0.552  14.055  -7.652 1.00 . A A . 78 LYS HD3  1 1 
        6  7954 1 1 78 LYS HE2  H  -1.063  15.743  -8.118 1.00 . A A . 78 LYS HE2  1 1 
        6  7955 1 1 78 LYS HE3  H  -0.988  15.568  -6.366 1.00 . A A . 78 LYS HE3  1 1 
        6  7956 1 1 78 LYS HG2  H   1.094  14.460  -5.346 1.00 . A A . 78 LYS HG2  1 1 
        6  7957 1 1 78 LYS HG3  H   1.778  16.041  -5.728 1.00 . A A . 78 LYS HG3  1 1 
        6  7958 1 1 78 LYS HZ1  H   0.477  17.525  -6.309 1.00 . A A . 78 LYS HZ1  1 1 
        6  7959 1 1 78 LYS HZ2  H  -1.039  17.886  -6.966 1.00 . A A . 78 LYS HZ2  1 1 
        6  7960 1 1 78 LYS HZ3  H   0.300  17.705  -7.979 1.00 . A A . 78 LYS HZ3  1 1 
        6  7961 1 1 78 LYS N    N   2.517  12.006  -5.695 1.00 . A A . 78 LYS N    1 1 
        6  7962 1 1 78 LYS NZ   N  -0.157  17.353  -7.113 1.00 . A A . 78 LYS NZ   1 1 
        6  7963 1 1 78 LYS O    O   4.464  12.005  -8.425 1.00 . A A . 78 LYS O    1 1 
        6  7964 1 1 79 THR C    C   7.380  13.157  -7.954 1.00 . A A . 79 THR C    1 1 
        6  7965 1 1 79 THR CA   C   6.776  12.295  -6.828 1.00 . A A . 79 THR CA   1 1 
        6  7966 1 1 79 THR CB   C   6.881  10.791  -7.213 1.00 . A A . 79 THR CB   1 1 
        6  7967 1 1 79 THR CG2  C   8.311  10.418  -7.604 1.00 . A A . 79 THR CG2  1 1 
        6  7968 1 1 79 THR H    H   5.232  13.113  -5.615 1.00 . A A . 79 THR H    1 1 
        6  7969 1 1 79 THR HA   H   7.372  12.445  -5.938 1.00 . A A . 79 THR HA   1 1 
        6  7970 1 1 79 THR HB   H   6.231  10.605  -8.058 1.00 . A A . 79 THR HB   1 1 
        6  7971 1 1 79 THR HG1  H   6.599  10.439  -5.281 1.00 . A A . 79 THR HG1  1 1 
        6  7972 1 1 79 THR HG21 H   8.593  10.959  -8.496 1.00 . A A . 79 THR HG21 1 1 
        6  7973 1 1 79 THR HG22 H   8.367   9.355  -7.798 1.00 . A A . 79 THR HG22 1 1 
        6  7974 1 1 79 THR HG23 H   8.986  10.673  -6.802 1.00 . A A . 79 THR HG23 1 1 
        6  7975 1 1 79 THR N    N   5.394  12.690  -6.485 1.00 . A A . 79 THR N    1 1 
        6  7976 1 1 79 THR O    O   8.375  13.856  -7.744 1.00 . A A . 79 THR O    1 1 
        6  7977 1 1 79 THR OG1  O   6.459   9.964  -6.113 1.00 . A A . 79 THR OG1  1 1 
        6  7978 1 1 80 LYS C    C   6.698  15.261 -10.368 1.00 . A A . 80 LYS C    1 1 
        6  7979 1 1 80 LYS CA   C   7.295  13.843 -10.304 1.00 . A A . 80 LYS CA   1 1 
        6  7980 1 1 80 LYS CB   C   6.963  13.073 -11.589 1.00 . A A . 80 LYS CB   1 1 
        6  7981 1 1 80 LYS CD   C   7.114  10.893 -12.871 1.00 . A A . 80 LYS CD   1 1 
        6  7982 1 1 80 LYS CE   C   7.822  11.521 -14.066 1.00 . A A . 80 LYS CE   1 1 
        6  7983 1 1 80 LYS CG   C   7.440  11.622 -11.568 1.00 . A A . 80 LYS CG   1 1 
        6  7984 1 1 80 LYS H    H   5.997  12.537  -9.255 1.00 . A A . 80 LYS H    1 1 
        6  7985 1 1 80 LYS HA   H   8.371  13.920 -10.213 1.00 . A A . 80 LYS HA   1 1 
        6  7986 1 1 80 LYS HB2  H   5.891  13.077 -11.729 1.00 . A A . 80 LYS HB2  1 1 
        6  7987 1 1 80 LYS HB3  H   7.429  13.573 -12.427 1.00 . A A . 80 LYS HB3  1 1 
        6  7988 1 1 80 LYS HD2  H   7.429   9.862 -12.782 1.00 . A A . 80 LYS HD2  1 1 
        6  7989 1 1 80 LYS HD3  H   6.046  10.929 -13.037 1.00 . A A . 80 LYS HD3  1 1 
        6  7990 1 1 80 LYS HE2  H   7.546  10.978 -14.958 1.00 . A A . 80 LYS HE2  1 1 
        6  7991 1 1 80 LYS HE3  H   7.506  12.550 -14.162 1.00 . A A . 80 LYS HE3  1 1 
        6  7992 1 1 80 LYS HG2  H   8.510  11.605 -11.416 1.00 . A A . 80 LYS HG2  1 1 
        6  7993 1 1 80 LYS HG3  H   6.954  11.107 -10.749 1.00 . A A . 80 LYS HG3  1 1 
        6  7994 1 1 80 LYS HZ1  H   9.629  10.496 -13.837 1.00 . A A . 80 LYS HZ1  1 1 
        6  7995 1 1 80 LYS HZ2  H   9.594  12.001 -13.066 1.00 . A A . 80 LYS HZ2  1 1 
        6  7996 1 1 80 LYS HZ3  H   9.758  11.915 -14.747 1.00 . A A . 80 LYS HZ3  1 1 
        6  7997 1 1 80 LYS N    N   6.792  13.097  -9.145 1.00 . A A . 80 LYS N    1 1 
        6  7998 1 1 80 LYS NZ   N   9.304  11.481 -13.919 1.00 . A A . 80 LYS NZ   1 1 
        6  7999 1 1 80 LYS O    O   5.478  15.431 -10.455 1.00 . A A . 80 LYS O    1 1 
        6  8000 1 1 81 ASP C    C   6.605  18.068 -11.774 1.00 . A A . 81 ASP C    1 1 
        6  8001 1 1 81 ASP CA   C   7.117  17.672 -10.379 1.00 . A A . 81 ASP CA   1 1 
        6  8002 1 1 81 ASP CB   C   8.242  18.610  -9.934 1.00 . A A . 81 ASP CB   1 1 
        6  8003 1 1 81 ASP CG   C   8.585  18.433  -8.464 1.00 . A A . 81 ASP CG   1 1 
        6  8004 1 1 81 ASP H    H   8.522  16.080 -10.283 1.00 . A A . 81 ASP H    1 1 
        6  8005 1 1 81 ASP HA   H   6.296  17.768  -9.680 1.00 . A A . 81 ASP HA   1 1 
        6  8006 1 1 81 ASP HB2  H   9.128  18.409 -10.523 1.00 . A A . 81 ASP HB2  1 1 
        6  8007 1 1 81 ASP HB3  H   7.937  19.634 -10.095 1.00 . A A . 81 ASP HB3  1 1 
        6  8008 1 1 81 ASP N    N   7.563  16.274 -10.338 1.00 . A A . 81 ASP N    1 1 
        6  8009 1 1 81 ASP O    O   7.331  18.636 -12.592 1.00 . A A . 81 ASP O    1 1 
        6  8010 1 1 81 ASP OD1  O   7.841  18.962  -7.612 1.00 . A A . 81 ASP OD1  1 1 
        6  8011 1 1 81 ASP OD2  O   9.586  17.755  -8.155 1.00 . A A . 81 ASP OD2  1 1 
        6  8012 1 1 82 MET C    C   3.220  18.473 -13.060 1.00 . A A . 82 MET C    1 1 
        6  8013 1 1 82 MET CA   C   4.687  18.079 -13.300 1.00 . A A . 82 MET CA   1 1 
        6  8014 1 1 82 MET CB   C   4.765  16.896 -14.274 1.00 . A A . 82 MET CB   1 1 
        6  8015 1 1 82 MET CE   C   3.642  12.890 -13.867 1.00 . A A . 82 MET CE   1 1 
        6  8016 1 1 82 MET CG   C   4.164  15.609 -13.722 1.00 . A A . 82 MET CG   1 1 
        6  8017 1 1 82 MET H    H   4.857  17.204 -11.371 1.00 . A A . 82 MET H    1 1 
        6  8018 1 1 82 MET HA   H   5.208  18.924 -13.728 1.00 . A A . 82 MET HA   1 1 
        6  8019 1 1 82 MET HB2  H   4.238  17.154 -15.181 1.00 . A A . 82 MET HB2  1 1 
        6  8020 1 1 82 MET HB3  H   5.802  16.710 -14.514 1.00 . A A . 82 MET HB3  1 1 
        6  8021 1 1 82 MET HE1  H   2.594  13.127 -13.749 1.00 . A A . 82 MET HE1  1 1 
        6  8022 1 1 82 MET HE2  H   4.103  12.805 -12.894 1.00 . A A . 82 MET HE2  1 1 
        6  8023 1 1 82 MET HE3  H   3.741  11.954 -14.397 1.00 . A A . 82 MET HE3  1 1 
        6  8024 1 1 82 MET HG2  H   4.605  15.402 -12.755 1.00 . A A . 82 MET HG2  1 1 
        6  8025 1 1 82 MET HG3  H   3.100  15.749 -13.605 1.00 . A A . 82 MET HG3  1 1 
        6  8026 1 1 82 MET N    N   5.350  17.726 -12.038 1.00 . A A . 82 MET N    1 1 
        6  8027 1 1 82 MET O    O   2.474  18.735 -14.002 1.00 . A A . 82 MET O    1 1 
        6  8028 1 1 82 MET SD   S   4.449  14.192 -14.801 1.00 . A A . 82 MET SD   1 1 
        6  8029 1 1 83 MET C    C   1.399  19.258  -9.909 1.00 . A A . 83 MET C    1 1 
        6  8030 1 1 83 MET CA   C   1.447  18.834 -11.390 1.00 . A A . 83 MET CA   1 1 
        6  8031 1 1 83 MET CB   C   0.528  17.622 -11.641 1.00 . A A . 83 MET CB   1 1 
        6  8032 1 1 83 MET CE   C  -3.101  18.353  -9.669 1.00 . A A . 83 MET CE   1 1 
        6  8033 1 1 83 MET CG   C  -0.954  17.879 -11.371 1.00 . A A . 83 MET CG   1 1 
        6  8034 1 1 83 MET H    H   3.487  18.339 -11.085 1.00 . A A . 83 MET H    1 1 
        6  8035 1 1 83 MET HA   H   1.112  19.663 -12.000 1.00 . A A . 83 MET HA   1 1 
        6  8036 1 1 83 MET HB2  H   0.631  17.321 -12.674 1.00 . A A . 83 MET HB2  1 1 
        6  8037 1 1 83 MET HB3  H   0.847  16.806 -11.008 1.00 . A A . 83 MET HB3  1 1 
        6  8038 1 1 83 MET HE1  H  -3.307  19.223 -10.275 1.00 . A A . 83 MET HE1  1 1 
        6  8039 1 1 83 MET HE2  H  -3.470  18.516  -8.668 1.00 . A A . 83 MET HE2  1 1 
        6  8040 1 1 83 MET HE3  H  -3.594  17.491 -10.098 1.00 . A A . 83 MET HE3  1 1 
        6  8041 1 1 83 MET HG2  H  -1.248  18.784 -11.883 1.00 . A A . 83 MET HG2  1 1 
        6  8042 1 1 83 MET HG3  H  -1.524  17.049 -11.762 1.00 . A A . 83 MET HG3  1 1 
        6  8043 1 1 83 MET N    N   2.827  18.516 -11.787 1.00 . A A . 83 MET N    1 1 
        6  8044 1 1 83 MET O    O   1.552  18.384  -9.024 1.00 . A A . 83 MET O    1 1 
        6  8045 1 1 83 MET OXT  O   1.235  20.468  -9.635 1.00 . A A . 83 MET OXT  1 1 
        6  8046 1 1 83 MET SD   S  -1.333  18.066  -9.615 1.00 . A A . 83 MET SD   1 1 
        7  8047 1 1  1 MET C    C   2.861   1.798  19.973 1.00 . A A .  1 MET C    1 1 
        7  8048 1 1  1 MET CA   C   1.692   2.314  20.828 1.00 . A A .  1 MET CA   1 1 
        7  8049 1 1  1 MET CB   C   0.523   1.317  20.789 1.00 . A A .  1 MET CB   1 1 
        7  8050 1 1  1 MET CE   C  -2.615   0.747  20.536 1.00 . A A .  1 MET CE   1 1 
        7  8051 1 1  1 MET CG   C  -0.102   1.138  19.410 1.00 . A A .  1 MET CG   1 1 
        7  8052 1 1  1 MET H1   H   2.024   4.348  20.466 1.00 . A A .  1 MET H1   1 1 
        7  8053 1 1  1 MET H2   H   0.441   3.987  20.942 1.00 . A A .  1 MET H2   1 1 
        7  8054 1 1  1 MET H3   H   0.954   3.623  19.374 1.00 . A A .  1 MET H3   1 1 
        7  8055 1 1  1 MET HA   H   2.035   2.411  21.850 1.00 . A A .  1 MET HA   1 1 
        7  8056 1 1  1 MET HB2  H   0.878   0.353  21.125 1.00 . A A .  1 MET HB2  1 1 
        7  8057 1 1  1 MET HB3  H  -0.245   1.658  21.466 1.00 . A A .  1 MET HB3  1 1 
        7  8058 1 1  1 MET HE1  H  -2.910   1.704  20.135 1.00 . A A .  1 MET HE1  1 1 
        7  8059 1 1  1 MET HE2  H  -2.140   0.890  21.497 1.00 . A A .  1 MET HE2  1 1 
        7  8060 1 1  1 MET HE3  H  -3.487   0.123  20.658 1.00 . A A .  1 MET HE3  1 1 
        7  8061 1 1  1 MET HG2  H  -0.475   2.093  19.068 1.00 . A A .  1 MET HG2  1 1 
        7  8062 1 1  1 MET HG3  H   0.657   0.786  18.728 1.00 . A A .  1 MET HG3  1 1 
        7  8063 1 1  1 MET N    N   1.247   3.660  20.370 1.00 . A A .  1 MET N    1 1 
        7  8064 1 1  1 MET O    O   2.805   1.841  18.745 1.00 . A A .  1 MET O    1 1 
        7  8065 1 1  1 MET SD   S  -1.464  -0.047  19.412 1.00 . A A .  1 MET SD   1 1 
        7  8066 1 1  2 GLY C    C   5.704   1.859  18.973 1.00 . A A .  2 GLY C    1 1 
        7  8067 1 1  2 GLY CA   C   5.094   0.822  19.917 1.00 . A A .  2 GLY CA   1 1 
        7  8068 1 1  2 GLY H    H   3.899   1.293  21.610 1.00 . A A .  2 GLY H    1 1 
        7  8069 1 1  2 GLY HA2  H   5.840   0.533  20.643 1.00 . A A .  2 GLY HA2  1 1 
        7  8070 1 1  2 GLY HA3  H   4.813  -0.053  19.345 1.00 . A A .  2 GLY HA3  1 1 
        7  8071 1 1  2 GLY N    N   3.917   1.316  20.630 1.00 . A A .  2 GLY N    1 1 
        7  8072 1 1  2 GLY O    O   6.447   2.739  19.407 1.00 . A A .  2 GLY O    1 1 
        7  8073 1 1  3 HIS C    C   7.315   2.711  16.341 1.00 . A A .  3 HIS C    1 1 
        7  8074 1 1  3 HIS CA   C   5.799   2.713  16.649 1.00 . A A .  3 HIS CA   1 1 
        7  8075 1 1  3 HIS CB   C   5.330   4.123  17.050 1.00 . A A .  3 HIS CB   1 1 
        7  8076 1 1  3 HIS CD2  C   6.425   5.961  15.570 1.00 . A A .  3 HIS CD2  1 1 
        7  8077 1 1  3 HIS CE1  C   4.752   6.303  14.207 1.00 . A A .  3 HIS CE1  1 1 
        7  8078 1 1  3 HIS CG   C   5.420   5.133  15.945 1.00 . A A .  3 HIS CG   1 1 
        7  8079 1 1  3 HIS H    H   4.900   0.939  17.392 1.00 . A A .  3 HIS H    1 1 
        7  8080 1 1  3 HIS HA   H   5.280   2.435  15.741 1.00 . A A .  3 HIS HA   1 1 
        7  8081 1 1  3 HIS HB2  H   4.298   4.074  17.365 1.00 . A A .  3 HIS HB2  1 1 
        7  8082 1 1  3 HIS HB3  H   5.933   4.478  17.875 1.00 . A A .  3 HIS HB3  1 1 
        7  8083 1 1  3 HIS HD1  H   3.507   4.942  15.080 1.00 . A A .  3 HIS HD1  1 1 
        7  8084 1 1  3 HIS HD2  H   7.395   6.046  16.041 1.00 . A A .  3 HIS HD2  1 1 
        7  8085 1 1  3 HIS HE1  H   4.142   6.696  13.409 1.00 . A A .  3 HIS HE1  1 1 
        7  8086 1 1  3 HIS HE2  H   6.422   7.466  14.116 1.00 . A A .  3 HIS HE2  1 1 
        7  8087 1 1  3 HIS N    N   5.409   1.729  17.675 1.00 . A A .  3 HIS N    1 1 
        7  8088 1 1  3 HIS ND1  N   4.387   5.378  15.068 1.00 . A A .  3 HIS ND1  1 1 
        7  8089 1 1  3 HIS NE2  N   5.982   6.675  14.489 1.00 . A A .  3 HIS NE2  1 1 
        7  8090 1 1  3 HIS O    O   7.737   3.259  15.319 1.00 . A A .  3 HIS O    1 1 
        7  8091 1 1  4 HIS C    C   9.922   1.464  15.604 1.00 . A A .  4 HIS C    1 1 
        7  8092 1 1  4 HIS CA   C   9.579   2.017  17.002 1.00 . A A .  4 HIS CA   1 1 
        7  8093 1 1  4 HIS CB   C  10.235   1.159  18.104 1.00 . A A .  4 HIS CB   1 1 
        7  8094 1 1  4 HIS CD2  C   9.448  -1.291  17.677 1.00 . A A .  4 HIS CD2  1 1 
        7  8095 1 1  4 HIS CE1  C   8.319  -1.584  19.531 1.00 . A A .  4 HIS CE1  1 1 
        7  8096 1 1  4 HIS CG   C   9.529  -0.139  18.389 1.00 . A A .  4 HIS CG   1 1 
        7  8097 1 1  4 HIS H    H   7.739   1.714  18.019 1.00 . A A .  4 HIS H    1 1 
        7  8098 1 1  4 HIS HA   H   9.972   3.023  17.072 1.00 . A A .  4 HIS HA   1 1 
        7  8099 1 1  4 HIS HB2  H  11.248   0.921  17.810 1.00 . A A .  4 HIS HB2  1 1 
        7  8100 1 1  4 HIS HB3  H  10.263   1.728  19.021 1.00 . A A .  4 HIS HB3  1 1 
        7  8101 1 1  4 HIS HD1  H   8.695   0.279  20.281 1.00 . A A .  4 HIS HD1  1 1 
        7  8102 1 1  4 HIS HD2  H   9.899  -1.482  16.715 1.00 . A A .  4 HIS HD2  1 1 
        7  8103 1 1  4 HIS HE1  H   7.716  -2.029  20.308 1.00 . A A .  4 HIS HE1  1 1 
        7  8104 1 1  4 HIS HE2  H   8.605  -3.134  18.230 1.00 . A A .  4 HIS HE2  1 1 
        7  8105 1 1  4 HIS N    N   8.124   2.103  17.213 1.00 . A A .  4 HIS N    1 1 
        7  8106 1 1  4 HIS ND1  N   8.810  -0.361  19.544 1.00 . A A .  4 HIS ND1  1 1 
        7  8107 1 1  4 HIS NE2  N   8.690  -2.171  18.412 1.00 . A A .  4 HIS NE2  1 1 
        7  8108 1 1  4 HIS O    O   9.495   0.371  15.230 1.00 . A A .  4 HIS O    1 1 
        7  8109 1 1  5 HIS C    C  12.542   1.901  13.184 1.00 . A A .  5 HIS C    1 1 
        7  8110 1 1  5 HIS CA   C  11.024   1.871  13.454 1.00 . A A .  5 HIS CA   1 1 
        7  8111 1 1  5 HIS CB   C  10.289   2.814  12.485 1.00 . A A .  5 HIS CB   1 1 
        7  8112 1 1  5 HIS CD2  C   9.800   5.123  13.588 1.00 . A A .  5 HIS CD2  1 1 
        7  8113 1 1  5 HIS CE1  C  11.410   6.270  12.642 1.00 . A A .  5 HIS CE1  1 1 
        7  8114 1 1  5 HIS CG   C  10.485   4.276  12.779 1.00 . A A .  5 HIS CG   1 1 
        7  8115 1 1  5 HIS H    H  11.093   3.039  15.225 1.00 . A A .  5 HIS H    1 1 
        7  8116 1 1  5 HIS HA   H  10.670   0.861  13.283 1.00 . A A .  5 HIS HA   1 1 
        7  8117 1 1  5 HIS HB2  H  10.645   2.631  11.481 1.00 . A A .  5 HIS HB2  1 1 
        7  8118 1 1  5 HIS HB3  H   9.230   2.604  12.523 1.00 . A A .  5 HIS HB3  1 1 
        7  8119 1 1  5 HIS HD1  H  12.151   4.705  11.563 1.00 . A A .  5 HIS HD1  1 1 
        7  8120 1 1  5 HIS HD2  H   8.944   4.876  14.199 1.00 . A A .  5 HIS HD2  1 1 
        7  8121 1 1  5 HIS HE1  H  12.068   7.080  12.359 1.00 . A A .  5 HIS HE1  1 1 
        7  8122 1 1  5 HIS HE2  H  10.233   7.117  14.082 1.00 . A A .  5 HIS HE2  1 1 
        7  8123 1 1  5 HIS N    N  10.706   2.223  14.842 1.00 . A A .  5 HIS N    1 1 
        7  8124 1 1  5 HIS ND1  N  11.483   5.031  12.205 1.00 . A A .  5 HIS ND1  1 1 
        7  8125 1 1  5 HIS NE2  N  10.398   6.357  13.483 1.00 . A A .  5 HIS NE2  1 1 
        7  8126 1 1  5 HIS O    O  13.137   2.967  13.031 1.00 . A A .  5 HIS O    1 1 
        7  8127 1 1  6 HIS C    C  14.797  -0.041  11.415 1.00 . A A .  6 HIS C    1 1 
        7  8128 1 1  6 HIS CA   C  14.592   0.590  12.808 1.00 . A A .  6 HIS CA   1 1 
        7  8129 1 1  6 HIS CB   C  15.329  -0.220  13.892 1.00 . A A .  6 HIS CB   1 1 
        7  8130 1 1  6 HIS CD2  C  14.693  -2.738  13.757 1.00 . A A .  6 HIS CD2  1 1 
        7  8131 1 1  6 HIS CE1  C  13.345  -2.815  15.479 1.00 . A A .  6 HIS CE1  1 1 
        7  8132 1 1  6 HIS CG   C  14.642  -1.493  14.288 1.00 . A A .  6 HIS CG   1 1 
        7  8133 1 1  6 HIS H    H  12.643  -0.090  13.351 1.00 . A A .  6 HIS H    1 1 
        7  8134 1 1  6 HIS HA   H  15.011   1.588  12.785 1.00 . A A .  6 HIS HA   1 1 
        7  8135 1 1  6 HIS HB2  H  16.315  -0.476  13.532 1.00 . A A .  6 HIS HB2  1 1 
        7  8136 1 1  6 HIS HB3  H  15.431   0.392  14.779 1.00 . A A .  6 HIS HB3  1 1 
        7  8137 1 1  6 HIS HD1  H  13.542  -0.841  15.968 1.00 . A A .  6 HIS HD1  1 1 
        7  8138 1 1  6 HIS HD2  H  15.266  -3.043  12.892 1.00 . A A .  6 HIS HD2  1 1 
        7  8139 1 1  6 HIS HE1  H  12.664  -3.177  16.236 1.00 . A A .  6 HIS HE1  1 1 
        7  8140 1 1  6 HIS HE2  H  13.797  -4.512  14.436 1.00 . A A .  6 HIS HE2  1 1 
        7  8141 1 1  6 HIS N    N  13.160   0.718  13.142 1.00 . A A .  6 HIS N    1 1 
        7  8142 1 1  6 HIS ND1  N  13.787  -1.580  15.367 1.00 . A A .  6 HIS ND1  1 1 
        7  8143 1 1  6 HIS NE2  N  13.878  -3.536  14.517 1.00 . A A .  6 HIS NE2  1 1 
        7  8144 1 1  6 HIS O    O  15.918  -0.368  11.019 1.00 . A A .  6 HIS O    1 1 
        7  8145 1 1  7 HIS C    C  12.850   0.260   8.411 1.00 . A A .  7 HIS C    1 1 
        7  8146 1 1  7 HIS CA   C  13.740  -0.645   9.277 1.00 . A A .  7 HIS CA   1 1 
        7  8147 1 1  7 HIS CB   C  13.292  -2.111   9.129 1.00 . A A .  7 HIS CB   1 1 
        7  8148 1 1  7 HIS CD2  C  15.514  -3.455   9.140 1.00 . A A .  7 HIS CD2  1 1 
        7  8149 1 1  7 HIS CE1  C  15.106  -4.734  10.869 1.00 . A A .  7 HIS CE1  1 1 
        7  8150 1 1  7 HIS CG   C  14.292  -3.115   9.618 1.00 . A A .  7 HIS CG   1 1 
        7  8151 1 1  7 HIS H    H  12.825  -0.030  11.090 1.00 . A A .  7 HIS H    1 1 
        7  8152 1 1  7 HIS HA   H  14.760  -0.553   8.931 1.00 . A A .  7 HIS HA   1 1 
        7  8153 1 1  7 HIS HB2  H  12.380  -2.260   9.688 1.00 . A A .  7 HIS HB2  1 1 
        7  8154 1 1  7 HIS HB3  H  13.102  -2.318   8.086 1.00 . A A .  7 HIS HB3  1 1 
        7  8155 1 1  7 HIS HD1  H  13.262  -3.943  11.262 1.00 . A A .  7 HIS HD1  1 1 
        7  8156 1 1  7 HIS HD2  H  16.016  -3.014   8.290 1.00 . A A .  7 HIS HD2  1 1 
        7  8157 1 1  7 HIS HE1  H  15.207  -5.483  11.641 1.00 . A A .  7 HIS HE1  1 1 
        7  8158 1 1  7 HIS HE2  H  16.781  -5.017   9.740 1.00 . A A .  7 HIS HE2  1 1 
        7  8159 1 1  7 HIS N    N  13.697  -0.210  10.680 1.00 . A A .  7 HIS N    1 1 
        7  8160 1 1  7 HIS ND1  N  14.070  -3.937  10.702 1.00 . A A .  7 HIS ND1  1 1 
        7  8161 1 1  7 HIS NE2  N  15.995  -4.463   9.938 1.00 . A A .  7 HIS NE2  1 1 
        7  8162 1 1  7 HIS O    O  11.723   0.582   8.792 1.00 . A A .  7 HIS O    1 1 
        7  8163 1 1  8 HIS C    C  12.437   0.887   4.964 1.00 . A A .  8 HIS C    1 1 
        7  8164 1 1  8 HIS CA   C  12.594   1.540   6.343 1.00 . A A .  8 HIS CA   1 1 
        7  8165 1 1  8 HIS CB   C  13.271   2.913   6.202 1.00 . A A .  8 HIS CB   1 1 
        7  8166 1 1  8 HIS CD2  C  15.794   2.479   5.736 1.00 . A A .  8 HIS CD2  1 1 
        7  8167 1 1  8 HIS CE1  C  15.846   3.172   3.662 1.00 . A A .  8 HIS CE1  1 1 
        7  8168 1 1  8 HIS CG   C  14.543   2.884   5.410 1.00 . A A .  8 HIS CG   1 1 
        7  8169 1 1  8 HIS H    H  14.261   0.391   6.996 1.00 . A A .  8 HIS H    1 1 
        7  8170 1 1  8 HIS HA   H  11.609   1.682   6.768 1.00 . A A .  8 HIS HA   1 1 
        7  8171 1 1  8 HIS HB2  H  12.592   3.591   5.706 1.00 . A A .  8 HIS HB2  1 1 
        7  8172 1 1  8 HIS HB3  H  13.498   3.300   7.185 1.00 . A A .  8 HIS HB3  1 1 
        7  8173 1 1  8 HIS HD1  H  13.866   3.674   3.577 1.00 . A A .  8 HIS HD1  1 1 
        7  8174 1 1  8 HIS HD2  H  16.111   2.076   6.690 1.00 . A A .  8 HIS HD2  1 1 
        7  8175 1 1  8 HIS HE1  H  16.195   3.427   2.673 1.00 . A A .  8 HIS HE1  1 1 
        7  8176 1 1  8 HIS HE2  H  17.488   2.313   4.511 1.00 . A A .  8 HIS HE2  1 1 
        7  8177 1 1  8 HIS N    N  13.357   0.675   7.251 1.00 . A A .  8 HIS N    1 1 
        7  8178 1 1  8 HIS ND1  N  14.615   3.313   4.105 1.00 . A A .  8 HIS ND1  1 1 
        7  8179 1 1  8 HIS NE2  N  16.582   2.669   4.629 1.00 . A A .  8 HIS NE2  1 1 
        7  8180 1 1  8 HIS O    O  13.283   0.101   4.536 1.00 . A A .  8 HIS O    1 1 
        7  8181 1 1  9 SER C    C  11.808   1.511   1.853 1.00 . A A .  9 SER C    1 1 
        7  8182 1 1  9 SER CA   C  11.100   0.682   2.930 1.00 . A A .  9 SER CA   1 1 
        7  8183 1 1  9 SER CB   C   9.591   0.644   2.641 1.00 . A A .  9 SER CB   1 1 
        7  8184 1 1  9 SER H    H  10.709   1.841   4.672 1.00 . A A .  9 SER H    1 1 
        7  8185 1 1  9 SER HA   H  11.485  -0.327   2.896 1.00 . A A .  9 SER HA   1 1 
        7  8186 1 1  9 SER HB2  H   9.104   0.005   3.364 1.00 . A A .  9 SER HB2  1 1 
        7  8187 1 1  9 SER HB3  H   9.185   1.643   2.714 1.00 . A A .  9 SER HB3  1 1 
        7  8188 1 1  9 SER HG   H   8.850  -0.697   1.411 1.00 . A A .  9 SER HG   1 1 
        7  8189 1 1  9 SER N    N  11.354   1.218   4.272 1.00 . A A .  9 SER N    1 1 
        7  8190 1 1  9 SER O    O  12.376   2.567   2.133 1.00 . A A .  9 SER O    1 1 
        7  8191 1 1  9 SER OG   O   9.327   0.139   1.337 1.00 . A A .  9 SER OG   1 1 
        7  8192 1 1 10 HIS C    C  11.263   2.054  -1.564 1.00 . A A . 10 HIS C    1 1 
        7  8193 1 1 10 HIS CA   C  12.353   1.745  -0.521 1.00 . A A . 10 HIS CA   1 1 
        7  8194 1 1 10 HIS CB   C  13.474   0.921  -1.171 1.00 . A A . 10 HIS CB   1 1 
        7  8195 1 1 10 HIS CD2  C  15.396   1.067   0.581 1.00 . A A . 10 HIS CD2  1 1 
        7  8196 1 1 10 HIS CE1  C  15.652  -1.076   0.940 1.00 . A A . 10 HIS CE1  1 1 
        7  8197 1 1 10 HIS CG   C  14.499   0.413  -0.199 1.00 . A A . 10 HIS CG   1 1 
        7  8198 1 1 10 HIS H    H  11.397   0.126   0.475 1.00 . A A . 10 HIS H    1 1 
        7  8199 1 1 10 HIS HA   H  12.764   2.677  -0.159 1.00 . A A . 10 HIS HA   1 1 
        7  8200 1 1 10 HIS HB2  H  13.040   0.067  -1.667 1.00 . A A . 10 HIS HB2  1 1 
        7  8201 1 1 10 HIS HB3  H  13.984   1.534  -1.903 1.00 . A A . 10 HIS HB3  1 1 
        7  8202 1 1 10 HIS HD1  H  14.185  -1.663  -0.354 1.00 . A A . 10 HIS HD1  1 1 
        7  8203 1 1 10 HIS HD2  H  15.536   2.136   0.643 1.00 . A A . 10 HIS HD2  1 1 
        7  8204 1 1 10 HIS HE1  H  16.014  -2.018   1.326 1.00 . A A . 10 HIS HE1  1 1 
        7  8205 1 1 10 HIS HE2  H  16.681   0.291   2.050 1.00 . A A . 10 HIS HE2  1 1 
        7  8206 1 1 10 HIS N    N  11.790   1.014   0.622 1.00 . A A . 10 HIS N    1 1 
        7  8207 1 1 10 HIS ND1  N  14.690  -0.928   0.053 1.00 . A A . 10 HIS ND1  1 1 
        7  8208 1 1 10 HIS NE2  N  16.097   0.114   1.279 1.00 . A A . 10 HIS NE2  1 1 
        7  8209 1 1 10 HIS O    O  11.544   2.613  -2.622 1.00 . A A . 10 HIS O    1 1 
        7  8210 1 1 11 MET C    C   8.154   3.139  -2.106 1.00 . A A . 11 MET C    1 1 
        7  8211 1 1 11 MET CA   C   8.899   1.794  -2.194 1.00 . A A . 11 MET CA   1 1 
        7  8212 1 1 11 MET CB   C   7.925   0.638  -1.946 1.00 . A A . 11 MET CB   1 1 
        7  8213 1 1 11 MET CE   C  10.570  -0.384  -3.948 1.00 . A A . 11 MET CE   1 1 
        7  8214 1 1 11 MET CG   C   8.556  -0.753  -2.020 1.00 . A A . 11 MET CG   1 1 
        7  8215 1 1 11 MET H    H   9.841   1.367  -0.335 1.00 . A A . 11 MET H    1 1 
        7  8216 1 1 11 MET HA   H   9.304   1.694  -3.192 1.00 . A A . 11 MET HA   1 1 
        7  8217 1 1 11 MET HB2  H   7.492   0.756  -0.962 1.00 . A A . 11 MET HB2  1 1 
        7  8218 1 1 11 MET HB3  H   7.132   0.686  -2.681 1.00 . A A . 11 MET HB3  1 1 
        7  8219 1 1 11 MET HE1  H  10.395   0.680  -3.895 1.00 . A A . 11 MET HE1  1 1 
        7  8220 1 1 11 MET HE2  H  10.968  -0.633  -4.921 1.00 . A A . 11 MET HE2  1 1 
        7  8221 1 1 11 MET HE3  H  11.280  -0.670  -3.186 1.00 . A A . 11 MET HE3  1 1 
        7  8222 1 1 11 MET HG2  H   9.443  -0.759  -1.403 1.00 . A A . 11 MET HG2  1 1 
        7  8223 1 1 11 MET HG3  H   7.849  -1.472  -1.628 1.00 . A A . 11 MET HG3  1 1 
        7  8224 1 1 11 MET N    N  10.018   1.700  -1.241 1.00 . A A . 11 MET N    1 1 
        7  8225 1 1 11 MET O    O   7.069   3.289  -2.665 1.00 . A A . 11 MET O    1 1 
        7  8226 1 1 11 MET SD   S   9.024  -1.260  -3.693 1.00 . A A . 11 MET SD   1 1 
        7  8227 1 1 12 LEU C    C   8.029   6.153  -2.664 1.00 . A A . 12 LEU C    1 1 
        7  8228 1 1 12 LEU CA   C   8.129   5.448  -1.286 1.00 . A A . 12 LEU CA   1 1 
        7  8229 1 1 12 LEU CB   C   8.897   6.325  -0.275 1.00 . A A . 12 LEU CB   1 1 
        7  8230 1 1 12 LEU CD1  C   9.571   4.551   1.409 1.00 . A A . 12 LEU CD1  1 1 
        7  8231 1 1 12 LEU CD2  C   9.365   6.946   2.131 1.00 . A A . 12 LEU CD2  1 1 
        7  8232 1 1 12 LEU CG   C   8.825   5.865   1.198 1.00 . A A . 12 LEU CG   1 1 
        7  8233 1 1 12 LEU H    H   9.587   3.931  -0.966 1.00 . A A . 12 LEU H    1 1 
        7  8234 1 1 12 LEU HA   H   7.122   5.302  -0.917 1.00 . A A . 12 LEU HA   1 1 
        7  8235 1 1 12 LEU HB2  H   9.937   6.354  -0.571 1.00 . A A . 12 LEU HB2  1 1 
        7  8236 1 1 12 LEU HB3  H   8.499   7.330  -0.333 1.00 . A A . 12 LEU HB3  1 1 
        7  8237 1 1 12 LEU HD11 H   9.495   4.255   2.445 1.00 . A A . 12 LEU HD11 1 1 
        7  8238 1 1 12 LEU HD12 H  10.613   4.678   1.148 1.00 . A A . 12 LEU HD12 1 1 
        7  8239 1 1 12 LEU HD13 H   9.136   3.784   0.784 1.00 . A A . 12 LEU HD13 1 1 
        7  8240 1 1 12 LEU HD21 H   9.273   6.617   3.156 1.00 . A A . 12 LEU HD21 1 1 
        7  8241 1 1 12 LEU HD22 H   8.801   7.856   1.994 1.00 . A A . 12 LEU HD22 1 1 
        7  8242 1 1 12 LEU HD23 H  10.406   7.133   1.906 1.00 . A A . 12 LEU HD23 1 1 
        7  8243 1 1 12 LEU HG   H   7.789   5.696   1.457 1.00 . A A . 12 LEU HG   1 1 
        7  8244 1 1 12 LEU N    N   8.735   4.111  -1.405 1.00 . A A . 12 LEU N    1 1 
        7  8245 1 1 12 LEU O    O   7.007   6.776  -2.974 1.00 . A A . 12 LEU O    1 1 
        7  8246 1 1 13 PRO C    C   8.405   5.350  -5.770 1.00 . A A . 13 PRO C    1 1 
        7  8247 1 1 13 PRO CA   C   9.005   6.487  -4.919 1.00 . A A . 13 PRO CA   1 1 
        7  8248 1 1 13 PRO CB   C  10.475   6.758  -5.322 1.00 . A A . 13 PRO CB   1 1 
        7  8249 1 1 13 PRO CD   C  10.470   5.718  -3.155 1.00 . A A . 13 PRO CD   1 1 
        7  8250 1 1 13 PRO CG   C  11.288   6.584  -4.072 1.00 . A A . 13 PRO CG   1 1 
        7  8251 1 1 13 PRO HA   H   8.416   7.385  -5.050 1.00 . A A . 13 PRO HA   1 1 
        7  8252 1 1 13 PRO HB2  H  10.781   6.054  -6.085 1.00 . A A . 13 PRO HB2  1 1 
        7  8253 1 1 13 PRO HB3  H  10.564   7.765  -5.709 1.00 . A A . 13 PRO HB3  1 1 
        7  8254 1 1 13 PRO HD2  H  10.644   4.671  -3.361 1.00 . A A . 13 PRO HD2  1 1 
        7  8255 1 1 13 PRO HD3  H  10.687   5.945  -2.121 1.00 . A A . 13 PRO HD3  1 1 
        7  8256 1 1 13 PRO HG2  H  12.227   6.101  -4.306 1.00 . A A . 13 PRO HG2  1 1 
        7  8257 1 1 13 PRO HG3  H  11.470   7.547  -3.615 1.00 . A A . 13 PRO HG3  1 1 
        7  8258 1 1 13 PRO N    N   9.095   6.104  -3.503 1.00 . A A . 13 PRO N    1 1 
        7  8259 1 1 13 PRO O    O   8.494   4.180  -5.395 1.00 . A A . 13 PRO O    1 1 
        7  8260 1 1 14 PRO C    C   8.210   3.620  -8.316 1.00 . A A . 14 PRO C    1 1 
        7  8261 1 1 14 PRO CA   C   7.180   4.639  -7.796 1.00 . A A . 14 PRO CA   1 1 
        7  8262 1 1 14 PRO CB   C   6.574   5.449  -8.956 1.00 . A A . 14 PRO CB   1 1 
        7  8263 1 1 14 PRO CD   C   7.602   7.023  -7.470 1.00 . A A . 14 PRO CD   1 1 
        7  8264 1 1 14 PRO CG   C   6.460   6.846  -8.434 1.00 . A A . 14 PRO CG   1 1 
        7  8265 1 1 14 PRO HA   H   6.392   4.108  -7.279 1.00 . A A . 14 PRO HA   1 1 
        7  8266 1 1 14 PRO HB2  H   7.229   5.402  -9.817 1.00 . A A . 14 PRO HB2  1 1 
        7  8267 1 1 14 PRO HB3  H   5.605   5.046  -9.214 1.00 . A A . 14 PRO HB3  1 1 
        7  8268 1 1 14 PRO HD2  H   8.493   7.354  -7.987 1.00 . A A . 14 PRO HD2  1 1 
        7  8269 1 1 14 PRO HD3  H   7.337   7.721  -6.688 1.00 . A A . 14 PRO HD3  1 1 
        7  8270 1 1 14 PRO HG2  H   6.541   7.551  -9.250 1.00 . A A . 14 PRO HG2  1 1 
        7  8271 1 1 14 PRO HG3  H   5.515   6.971  -7.923 1.00 . A A . 14 PRO HG3  1 1 
        7  8272 1 1 14 PRO N    N   7.781   5.665  -6.926 1.00 . A A . 14 PRO N    1 1 
        7  8273 1 1 14 PRO O    O   8.759   3.774  -9.411 1.00 . A A . 14 PRO O    1 1 
        7  8274 1 1 15 GLU C    C   8.908   0.135  -7.806 1.00 . A A . 15 GLU C    1 1 
        7  8275 1 1 15 GLU CA   C   9.473   1.566  -7.901 1.00 . A A . 15 GLU CA   1 1 
        7  8276 1 1 15 GLU CB   C  10.738   1.710  -7.037 1.00 . A A . 15 GLU CB   1 1 
        7  8277 1 1 15 GLU CD   C  13.168   1.054  -6.674 1.00 . A A . 15 GLU CD   1 1 
        7  8278 1 1 15 GLU CG   C  11.876   0.767  -7.429 1.00 . A A . 15 GLU CG   1 1 
        7  8279 1 1 15 GLU H    H   8.029   2.511  -6.656 1.00 . A A . 15 GLU H    1 1 
        7  8280 1 1 15 GLU HA   H   9.746   1.748  -8.933 1.00 . A A . 15 GLU HA   1 1 
        7  8281 1 1 15 GLU HB2  H  11.100   2.726  -7.122 1.00 . A A . 15 GLU HB2  1 1 
        7  8282 1 1 15 GLU HB3  H  10.479   1.519  -6.005 1.00 . A A . 15 GLU HB3  1 1 
        7  8283 1 1 15 GLU HG2  H  11.572  -0.249  -7.224 1.00 . A A . 15 GLU HG2  1 1 
        7  8284 1 1 15 GLU HG3  H  12.066   0.872  -8.490 1.00 . A A . 15 GLU HG3  1 1 
        7  8285 1 1 15 GLU N    N   8.484   2.582  -7.523 1.00 . A A . 15 GLU N    1 1 
        7  8286 1 1 15 GLU O    O   9.037  -0.531  -6.782 1.00 . A A . 15 GLU O    1 1 
        7  8287 1 1 15 GLU OE1  O  13.850   2.044  -7.015 1.00 . A A . 15 GLU OE1  1 1 
        7  8288 1 1 15 GLU OE2  O  13.513   0.295  -5.739 1.00 . A A . 15 GLU OE2  1 1 
        7  8289 1 1 16 GLN C    C   6.936  -2.208  -7.855 1.00 . A A . 16 GLN C    1 1 
        7  8290 1 1 16 GLN CA   C   7.791  -1.699  -9.038 1.00 . A A . 16 GLN CA   1 1 
        7  8291 1 1 16 GLN CB   C   8.995  -2.632  -9.262 1.00 . A A . 16 GLN CB   1 1 
        7  8292 1 1 16 GLN CD   C   8.811  -3.045 -11.768 1.00 . A A . 16 GLN CD   1 1 
        7  8293 1 1 16 GLN CG   C   9.654  -2.476 -10.632 1.00 . A A . 16 GLN CG   1 1 
        7  8294 1 1 16 GLN H    H   8.086   0.327  -9.618 1.00 . A A . 16 GLN H    1 1 
        7  8295 1 1 16 GLN HA   H   7.177  -1.728  -9.926 1.00 . A A . 16 GLN HA   1 1 
        7  8296 1 1 16 GLN HB2  H   9.740  -2.425  -8.506 1.00 . A A . 16 GLN HB2  1 1 
        7  8297 1 1 16 GLN HB3  H   8.669  -3.657  -9.159 1.00 . A A . 16 GLN HB3  1 1 
        7  8298 1 1 16 GLN HE21 H   8.143  -4.504 -10.597 1.00 . A A . 16 GLN HE21 1 1 
        7  8299 1 1 16 GLN HE22 H   7.557  -4.506 -12.222 1.00 . A A . 16 GLN HE22 1 1 
        7  8300 1 1 16 GLN HG2  H   9.822  -1.426 -10.820 1.00 . A A . 16 GLN HG2  1 1 
        7  8301 1 1 16 GLN HG3  H  10.605  -2.991 -10.619 1.00 . A A . 16 GLN HG3  1 1 
        7  8302 1 1 16 GLN N    N   8.259  -0.306  -8.888 1.00 . A A . 16 GLN N    1 1 
        7  8303 1 1 16 GLN NE2  N   8.096  -4.123 -11.500 1.00 . A A . 16 GLN NE2  1 1 
        7  8304 1 1 16 GLN O    O   7.451  -2.803  -6.906 1.00 . A A . 16 GLN O    1 1 
        7  8305 1 1 16 GLN OE1  O   8.821  -2.539 -12.888 1.00 . A A . 16 GLN OE1  1 1 
        7  8306 1 1 17 TRP C    C   4.311  -3.977  -7.272 1.00 . A A . 17 TRP C    1 1 
        7  8307 1 1 17 TRP CA   C   4.688  -2.523  -6.930 1.00 . A A . 17 TRP CA   1 1 
        7  8308 1 1 17 TRP CB   C   3.430  -1.648  -6.843 1.00 . A A . 17 TRP CB   1 1 
        7  8309 1 1 17 TRP CD1  C   3.933   0.868  -6.964 1.00 . A A . 17 TRP CD1  1 1 
        7  8310 1 1 17 TRP CD2  C   3.763   0.058  -4.884 1.00 . A A . 17 TRP CD2  1 1 
        7  8311 1 1 17 TRP CE2  C   4.035   1.438  -4.808 1.00 . A A . 17 TRP CE2  1 1 
        7  8312 1 1 17 TRP CE3  C   3.616  -0.665  -3.698 1.00 . A A . 17 TRP CE3  1 1 
        7  8313 1 1 17 TRP CG   C   3.695  -0.286  -6.271 1.00 . A A . 17 TRP CG   1 1 
        7  8314 1 1 17 TRP CH2  C   4.014   1.372  -2.447 1.00 . A A . 17 TRP CH2  1 1 
        7  8315 1 1 17 TRP CZ2  C   4.163   2.105  -3.594 1.00 . A A . 17 TRP CZ2  1 1 
        7  8316 1 1 17 TRP CZ3  C   3.743  -0.002  -2.491 1.00 . A A . 17 TRP CZ3  1 1 
        7  8317 1 1 17 TRP H    H   5.274  -1.434  -8.656 1.00 . A A . 17 TRP H    1 1 
        7  8318 1 1 17 TRP HA   H   5.186  -2.514  -5.967 1.00 . A A . 17 TRP HA   1 1 
        7  8319 1 1 17 TRP HB2  H   3.017  -1.521  -7.833 1.00 . A A . 17 TRP HB2  1 1 
        7  8320 1 1 17 TRP HB3  H   2.699  -2.138  -6.212 1.00 . A A . 17 TRP HB3  1 1 
        7  8321 1 1 17 TRP HD1  H   3.952   0.939  -8.041 1.00 . A A . 17 TRP HD1  1 1 
        7  8322 1 1 17 TRP HE1  H   4.316   2.836  -6.341 1.00 . A A . 17 TRP HE1  1 1 
        7  8323 1 1 17 TRP HE3  H   3.408  -1.726  -3.710 1.00 . A A . 17 TRP HE3  1 1 
        7  8324 1 1 17 TRP HH2  H   4.105   1.852  -1.484 1.00 . A A . 17 TRP HH2  1 1 
        7  8325 1 1 17 TRP HZ2  H   4.370   3.165  -3.545 1.00 . A A . 17 TRP HZ2  1 1 
        7  8326 1 1 17 TRP HZ3  H   3.633  -0.546  -1.563 1.00 . A A . 17 TRP HZ3  1 1 
        7  8327 1 1 17 TRP N    N   5.623  -1.981  -7.924 1.00 . A A . 17 TRP N    1 1 
        7  8328 1 1 17 TRP NE1  N   4.132   1.909  -6.090 1.00 . A A . 17 TRP NE1  1 1 
        7  8329 1 1 17 TRP O    O   3.621  -4.238  -8.257 1.00 . A A . 17 TRP O    1 1 
        7  8330 1 1 18 SER C    C   3.664  -7.047  -5.747 1.00 . A A . 18 SER C    1 1 
        7  8331 1 1 18 SER CA   C   4.605  -6.351  -6.743 1.00 . A A . 18 SER CA   1 1 
        7  8332 1 1 18 SER CB   C   5.975  -7.041  -6.708 1.00 . A A . 18 SER CB   1 1 
        7  8333 1 1 18 SER H    H   5.226  -4.649  -5.625 1.00 . A A . 18 SER H    1 1 
        7  8334 1 1 18 SER HA   H   4.192  -6.451  -7.738 1.00 . A A . 18 SER HA   1 1 
        7  8335 1 1 18 SER HB2  H   5.885  -8.051  -7.084 1.00 . A A . 18 SER HB2  1 1 
        7  8336 1 1 18 SER HB3  H   6.671  -6.490  -7.325 1.00 . A A . 18 SER HB3  1 1 
        7  8337 1 1 18 SER HG   H   7.431  -6.917  -5.394 1.00 . A A . 18 SER HG   1 1 
        7  8338 1 1 18 SER N    N   4.769  -4.919  -6.451 1.00 . A A . 18 SER N    1 1 
        7  8339 1 1 18 SER O    O   2.932  -6.404  -4.992 1.00 . A A . 18 SER O    1 1 
        7  8340 1 1 18 SER OG   O   6.481  -7.091  -5.383 1.00 . A A . 18 SER OG   1 1 
        7  8341 1 1 19 HIS C    C   3.313  -8.934  -3.368 1.00 . A A . 19 HIS C    1 1 
        7  8342 1 1 19 HIS CA   C   2.903  -9.197  -4.831 1.00 . A A . 19 HIS CA   1 1 
        7  8343 1 1 19 HIS CB   C   3.101 -10.681  -5.183 1.00 . A A . 19 HIS CB   1 1 
        7  8344 1 1 19 HIS CD2  C   1.061 -12.094  -4.411 1.00 . A A . 19 HIS CD2  1 1 
        7  8345 1 1 19 HIS CE1  C   1.984 -13.077  -2.690 1.00 . A A . 19 HIS CE1  1 1 
        7  8346 1 1 19 HIS CG   C   2.334 -11.642  -4.321 1.00 . A A . 19 HIS CG   1 1 
        7  8347 1 1 19 HIS H    H   4.246  -8.831  -6.427 1.00 . A A . 19 HIS H    1 1 
        7  8348 1 1 19 HIS HA   H   1.858  -8.941  -4.957 1.00 . A A . 19 HIS HA   1 1 
        7  8349 1 1 19 HIS HB2  H   2.792 -10.843  -6.205 1.00 . A A . 19 HIS HB2  1 1 
        7  8350 1 1 19 HIS HB3  H   4.150 -10.927  -5.094 1.00 . A A . 19 HIS HB3  1 1 
        7  8351 1 1 19 HIS HD1  H   3.805 -12.181  -2.909 1.00 . A A . 19 HIS HD1  1 1 
        7  8352 1 1 19 HIS HD2  H   0.329 -11.801  -5.151 1.00 . A A . 19 HIS HD2  1 1 
        7  8353 1 1 19 HIS HE1  H   2.137 -13.700  -1.821 1.00 . A A . 19 HIS HE1  1 1 
        7  8354 1 1 19 HIS HE2  H   0.155 -13.659  -3.358 1.00 . A A . 19 HIS HE2  1 1 
        7  8355 1 1 19 HIS N    N   3.686  -8.379  -5.762 1.00 . A A . 19 HIS N    1 1 
        7  8356 1 1 19 HIS ND1  N   2.881 -12.279  -3.230 1.00 . A A . 19 HIS ND1  1 1 
        7  8357 1 1 19 HIS NE2  N   0.870 -12.986  -3.384 1.00 . A A . 19 HIS NE2  1 1 
        7  8358 1 1 19 HIS O    O   2.492  -9.041  -2.454 1.00 . A A . 19 HIS O    1 1 
        7  8359 1 1 20 THR C    C   4.928  -6.917  -1.319 1.00 . A A . 20 THR C    1 1 
        7  8360 1 1 20 THR CA   C   5.127  -8.360  -1.810 1.00 . A A . 20 THR CA   1 1 
        7  8361 1 1 20 THR CB   C   6.640  -8.677  -1.763 1.00 . A A . 20 THR CB   1 1 
        7  8362 1 1 20 THR CG2  C   6.912 -10.144  -2.079 1.00 . A A . 20 THR CG2  1 1 
        7  8363 1 1 20 THR H    H   5.169  -8.445  -3.937 1.00 . A A . 20 THR H    1 1 
        7  8364 1 1 20 THR HA   H   4.622  -9.033  -1.130 1.00 . A A . 20 THR HA   1 1 
        7  8365 1 1 20 THR HB   H   7.007  -8.466  -0.770 1.00 . A A . 20 THR HB   1 1 
        7  8366 1 1 20 THR HG1  H   8.164  -8.281  -2.963 1.00 . A A . 20 THR HG1  1 1 
        7  8367 1 1 20 THR HG21 H   6.381 -10.768  -1.376 1.00 . A A . 20 THR HG21 1 1 
        7  8368 1 1 20 THR HG22 H   7.972 -10.340  -2.005 1.00 . A A . 20 THR HG22 1 1 
        7  8369 1 1 20 THR HG23 H   6.575 -10.366  -3.083 1.00 . A A . 20 THR HG23 1 1 
        7  8370 1 1 20 THR N    N   4.580  -8.577  -3.161 1.00 . A A . 20 THR N    1 1 
        7  8371 1 1 20 THR O    O   4.251  -6.680  -0.320 1.00 . A A . 20 THR O    1 1 
        7  8372 1 1 20 THR OG1  O   7.341  -7.847  -2.701 1.00 . A A . 20 THR OG1  1 1 
        7  8373 1 1 21 THR C    C   4.159  -4.013  -1.217 1.00 . A A . 21 THR C    1 1 
        7  8374 1 1 21 THR CA   C   5.543  -4.548  -1.624 1.00 . A A . 21 THR CA   1 1 
        7  8375 1 1 21 THR CB   C   6.099  -3.654  -2.755 1.00 . A A . 21 THR CB   1 1 
        7  8376 1 1 21 THR CG2  C   7.474  -4.135  -3.207 1.00 . A A . 21 THR CG2  1 1 
        7  8377 1 1 21 THR H    H   5.986  -6.223  -2.860 1.00 . A A . 21 THR H    1 1 
        7  8378 1 1 21 THR HA   H   6.210  -4.461  -0.776 1.00 . A A . 21 THR HA   1 1 
        7  8379 1 1 21 THR HB   H   6.193  -2.641  -2.383 1.00 . A A . 21 THR HB   1 1 
        7  8380 1 1 21 THR HG1  H   5.155  -2.770  -4.248 1.00 . A A . 21 THR HG1  1 1 
        7  8381 1 1 21 THR HG21 H   8.168  -4.078  -2.379 1.00 . A A . 21 THR HG21 1 1 
        7  8382 1 1 21 THR HG22 H   7.825  -3.509  -4.014 1.00 . A A . 21 THR HG22 1 1 
        7  8383 1 1 21 THR HG23 H   7.406  -5.157  -3.548 1.00 . A A . 21 THR HG23 1 1 
        7  8384 1 1 21 THR N    N   5.524  -5.965  -2.033 1.00 . A A . 21 THR N    1 1 
        7  8385 1 1 21 THR O    O   4.010  -3.380  -0.169 1.00 . A A . 21 THR O    1 1 
        7  8386 1 1 21 THR OG1  O   5.202  -3.658  -3.878 1.00 . A A . 21 THR OG1  1 1 
        7  8387 1 1 22 VAL C    C   1.247  -4.344  -0.429 1.00 . A A . 22 VAL C    1 1 
        7  8388 1 1 22 VAL CA   C   1.776  -3.820  -1.780 1.00 . A A . 22 VAL CA   1 1 
        7  8389 1 1 22 VAL CB   C   0.814  -4.251  -2.918 1.00 . A A . 22 VAL CB   1 1 
        7  8390 1 1 22 VAL CG1  C  -0.624  -3.810  -2.632 1.00 . A A . 22 VAL CG1  1 1 
        7  8391 1 1 22 VAL CG2  C   1.293  -3.693  -4.259 1.00 . A A . 22 VAL CG2  1 1 
        7  8392 1 1 22 VAL H    H   3.339  -4.764  -2.876 1.00 . A A . 22 VAL H    1 1 
        7  8393 1 1 22 VAL HA   H   1.791  -2.738  -1.744 1.00 . A A . 22 VAL HA   1 1 
        7  8394 1 1 22 VAL HB   H   0.827  -5.331  -2.981 1.00 . A A . 22 VAL HB   1 1 
        7  8395 1 1 22 VAL HG11 H  -1.273  -4.157  -3.424 1.00 . A A . 22 VAL HG11 1 1 
        7  8396 1 1 22 VAL HG12 H  -0.668  -2.732  -2.579 1.00 . A A . 22 VAL HG12 1 1 
        7  8397 1 1 22 VAL HG13 H  -0.953  -4.229  -1.692 1.00 . A A . 22 VAL HG13 1 1 
        7  8398 1 1 22 VAL HG21 H   2.274  -4.084  -4.482 1.00 . A A . 22 VAL HG21 1 1 
        7  8399 1 1 22 VAL HG22 H   1.342  -2.614  -4.206 1.00 . A A . 22 VAL HG22 1 1 
        7  8400 1 1 22 VAL HG23 H   0.605  -3.982  -5.039 1.00 . A A . 22 VAL HG23 1 1 
        7  8401 1 1 22 VAL N    N   3.151  -4.270  -2.050 1.00 . A A . 22 VAL N    1 1 
        7  8402 1 1 22 VAL O    O   0.431  -3.689   0.225 1.00 . A A . 22 VAL O    1 1 
        7  8403 1 1 23 ARG C    C   1.802  -5.263   2.451 1.00 . A A . 23 ARG C    1 1 
        7  8404 1 1 23 ARG CA   C   1.310  -6.111   1.270 1.00 . A A . 23 ARG CA   1 1 
        7  8405 1 1 23 ARG CB   C   1.861  -7.540   1.390 1.00 . A A . 23 ARG CB   1 1 
        7  8406 1 1 23 ARG CD   C   2.092  -9.648   2.766 1.00 . A A . 23 ARG CD   1 1 
        7  8407 1 1 23 ARG CG   C   1.449  -8.266   2.670 1.00 . A A . 23 ARG CG   1 1 
        7  8408 1 1 23 ARG CZ   C   1.907 -11.653   4.155 1.00 . A A . 23 ARG CZ   1 1 
        7  8409 1 1 23 ARG H    H   2.376  -5.993  -0.565 1.00 . A A . 23 ARG H    1 1 
        7  8410 1 1 23 ARG HA   H   0.229  -6.146   1.289 1.00 . A A . 23 ARG HA   1 1 
        7  8411 1 1 23 ARG HB2  H   1.512  -8.118   0.548 1.00 . A A . 23 ARG HB2  1 1 
        7  8412 1 1 23 ARG HB3  H   2.941  -7.497   1.359 1.00 . A A . 23 ARG HB3  1 1 
        7  8413 1 1 23 ARG HD2  H   1.848 -10.208   1.873 1.00 . A A . 23 ARG HD2  1 1 
        7  8414 1 1 23 ARG HD3  H   3.166  -9.529   2.831 1.00 . A A . 23 ARG HD3  1 1 
        7  8415 1 1 23 ARG HE   H   1.065  -9.924   4.577 1.00 . A A . 23 ARG HE   1 1 
        7  8416 1 1 23 ARG HG2  H   1.758  -7.679   3.522 1.00 . A A . 23 ARG HG2  1 1 
        7  8417 1 1 23 ARG HG3  H   0.373  -8.378   2.680 1.00 . A A . 23 ARG HG3  1 1 
        7  8418 1 1 23 ARG HH11 H   3.049 -11.859   2.541 1.00 . A A . 23 ARG HH11 1 1 
        7  8419 1 1 23 ARG HH12 H   2.889 -13.268   3.525 1.00 . A A . 23 ARG HH12 1 1 
        7  8420 1 1 23 ARG HH21 H   0.833 -11.743   5.828 1.00 . A A . 23 ARG HH21 1 1 
        7  8421 1 1 23 ARG HH22 H   1.615 -13.213   5.358 1.00 . A A . 23 ARG HH22 1 1 
        7  8422 1 1 23 ARG N    N   1.721  -5.519  -0.010 1.00 . A A . 23 ARG N    1 1 
        7  8423 1 1 23 ARG NE   N   1.627 -10.397   3.931 1.00 . A A . 23 ARG NE   1 1 
        7  8424 1 1 23 ARG NH1  N   2.671 -12.312   3.340 1.00 . A A . 23 ARG NH1  1 1 
        7  8425 1 1 23 ARG NH2  N   1.417 -12.249   5.195 1.00 . A A . 23 ARG NH2  1 1 
        7  8426 1 1 23 ARG O    O   1.015  -4.833   3.297 1.00 . A A . 23 ARG O    1 1 
        7  8427 1 1 24 ASN C    C   3.156  -2.773   3.563 1.00 . A A . 24 ASN C    1 1 
        7  8428 1 1 24 ASN CA   C   3.709  -4.207   3.563 1.00 . A A . 24 ASN CA   1 1 
        7  8429 1 1 24 ASN CB   C   5.232  -4.178   3.422 1.00 . A A . 24 ASN CB   1 1 
        7  8430 1 1 24 ASN CG   C   5.850  -5.561   3.514 1.00 . A A . 24 ASN CG   1 1 
        7  8431 1 1 24 ASN H    H   3.690  -5.386   1.792 1.00 . A A . 24 ASN H    1 1 
        7  8432 1 1 24 ASN HA   H   3.456  -4.674   4.507 1.00 . A A . 24 ASN HA   1 1 
        7  8433 1 1 24 ASN HB2  H   5.492  -3.750   2.464 1.00 . A A . 24 ASN HB2  1 1 
        7  8434 1 1 24 ASN HB3  H   5.649  -3.563   4.209 1.00 . A A . 24 ASN HB3  1 1 
        7  8435 1 1 24 ASN HD21 H   5.993  -5.407   5.485 1.00 . A A . 24 ASN HD21 1 1 
        7  8436 1 1 24 ASN HD22 H   6.572  -6.880   4.796 1.00 . A A . 24 ASN HD22 1 1 
        7  8437 1 1 24 ASN N    N   3.111  -5.014   2.495 1.00 . A A . 24 ASN N    1 1 
        7  8438 1 1 24 ASN ND2  N   6.169  -5.993   4.719 1.00 . A A . 24 ASN ND2  1 1 
        7  8439 1 1 24 ASN O    O   3.043  -2.142   4.616 1.00 . A A . 24 ASN O    1 1 
        7  8440 1 1 24 ASN OD1  O   6.038  -6.242   2.512 1.00 . A A . 24 ASN OD1  1 1 
        7  8441 1 1 25 ALA C    C   0.886  -0.834   2.970 1.00 . A A . 25 ALA C    1 1 
        7  8442 1 1 25 ALA CA   C   2.232  -0.932   2.236 1.00 . A A . 25 ALA CA   1 1 
        7  8443 1 1 25 ALA CB   C   2.065  -0.579   0.762 1.00 . A A . 25 ALA CB   1 1 
        7  8444 1 1 25 ALA H    H   2.981  -2.806   1.569 1.00 . A A . 25 ALA H    1 1 
        7  8445 1 1 25 ALA HA   H   2.920  -0.219   2.673 1.00 . A A . 25 ALA HA   1 1 
        7  8446 1 1 25 ALA HB1  H   1.363  -1.262   0.304 1.00 . A A . 25 ALA HB1  1 1 
        7  8447 1 1 25 ALA HB2  H   3.020  -0.659   0.263 1.00 . A A . 25 ALA HB2  1 1 
        7  8448 1 1 25 ALA HB3  H   1.696   0.431   0.670 1.00 . A A . 25 ALA HB3  1 1 
        7  8449 1 1 25 ALA N    N   2.822  -2.269   2.375 1.00 . A A . 25 ALA N    1 1 
        7  8450 1 1 25 ALA O    O   0.729  -0.031   3.890 1.00 . A A . 25 ALA O    1 1 
        7  8451 1 1 26 LEU C    C  -1.275  -1.972   4.726 1.00 . A A . 26 LEU C    1 1 
        7  8452 1 1 26 LEU CA   C  -1.398  -1.698   3.219 1.00 . A A . 26 LEU CA   1 1 
        7  8453 1 1 26 LEU CB   C  -2.292  -2.765   2.568 1.00 . A A . 26 LEU CB   1 1 
        7  8454 1 1 26 LEU CD1  C  -3.479  -3.666   0.532 1.00 . A A . 26 LEU CD1  1 1 
        7  8455 1 1 26 LEU CD2  C  -3.555  -1.206   1.040 1.00 . A A . 26 LEU CD2  1 1 
        7  8456 1 1 26 LEU CG   C  -2.712  -2.480   1.116 1.00 . A A . 26 LEU CG   1 1 
        7  8457 1 1 26 LEU H    H   0.100  -2.279   1.822 1.00 . A A . 26 LEU H    1 1 
        7  8458 1 1 26 LEU HA   H  -1.856  -0.728   3.080 1.00 . A A . 26 LEU HA   1 1 
        7  8459 1 1 26 LEU HB2  H  -1.763  -3.708   2.592 1.00 . A A . 26 LEU HB2  1 1 
        7  8460 1 1 26 LEU HB3  H  -3.190  -2.866   3.165 1.00 . A A . 26 LEU HB3  1 1 
        7  8461 1 1 26 LEU HD11 H  -3.755  -3.449  -0.491 1.00 . A A . 26 LEU HD11 1 1 
        7  8462 1 1 26 LEU HD12 H  -4.372  -3.842   1.115 1.00 . A A . 26 LEU HD12 1 1 
        7  8463 1 1 26 LEU HD13 H  -2.855  -4.548   0.556 1.00 . A A . 26 LEU HD13 1 1 
        7  8464 1 1 26 LEU HD21 H  -4.453  -1.329   1.631 1.00 . A A . 26 LEU HD21 1 1 
        7  8465 1 1 26 LEU HD22 H  -3.825  -1.011   0.012 1.00 . A A . 26 LEU HD22 1 1 
        7  8466 1 1 26 LEU HD23 H  -2.985  -0.374   1.425 1.00 . A A . 26 LEU HD23 1 1 
        7  8467 1 1 26 LEU HG   H  -1.826  -2.330   0.514 1.00 . A A . 26 LEU HG   1 1 
        7  8468 1 1 26 LEU N    N  -0.079  -1.667   2.568 1.00 . A A . 26 LEU N    1 1 
        7  8469 1 1 26 LEU O    O  -1.940  -1.332   5.541 1.00 . A A . 26 LEU O    1 1 
        7  8470 1 1 27 LYS C    C   0.326  -2.134   7.322 1.00 . A A . 27 LYS C    1 1 
        7  8471 1 1 27 LYS CA   C  -0.197  -3.313   6.476 1.00 . A A . 27 LYS CA   1 1 
        7  8472 1 1 27 LYS CB   C   0.783  -4.504   6.521 1.00 . A A . 27 LYS CB   1 1 
        7  8473 1 1 27 LYS CD   C   1.423  -4.693   8.982 1.00 . A A . 27 LYS CD   1 1 
        7  8474 1 1 27 LYS CE   C   1.404  -5.592  10.214 1.00 . A A . 27 LYS CE   1 1 
        7  8475 1 1 27 LYS CG   C   0.728  -5.354   7.795 1.00 . A A . 27 LYS CG   1 1 
        7  8476 1 1 27 LYS H    H   0.111  -3.368   4.378 1.00 . A A . 27 LYS H    1 1 
        7  8477 1 1 27 LYS HA   H  -1.152  -3.629   6.875 1.00 . A A . 27 LYS HA   1 1 
        7  8478 1 1 27 LYS HB2  H   0.571  -5.151   5.682 1.00 . A A . 27 LYS HB2  1 1 
        7  8479 1 1 27 LYS HB3  H   1.791  -4.124   6.414 1.00 . A A . 27 LYS HB3  1 1 
        7  8480 1 1 27 LYS HD2  H   2.449  -4.483   8.715 1.00 . A A . 27 LYS HD2  1 1 
        7  8481 1 1 27 LYS HD3  H   0.916  -3.766   9.215 1.00 . A A . 27 LYS HD3  1 1 
        7  8482 1 1 27 LYS HE2  H   0.378  -5.779  10.494 1.00 . A A . 27 LYS HE2  1 1 
        7  8483 1 1 27 LYS HE3  H   1.885  -6.528   9.969 1.00 . A A . 27 LYS HE3  1 1 
        7  8484 1 1 27 LYS HG2  H  -0.308  -5.525   8.052 1.00 . A A . 27 LYS HG2  1 1 
        7  8485 1 1 27 LYS HG3  H   1.206  -6.304   7.595 1.00 . A A . 27 LYS HG3  1 1 
        7  8486 1 1 27 LYS HZ1  H   3.094  -4.762  11.113 1.00 . A A . 27 LYS HZ1  1 1 
        7  8487 1 1 27 LYS HZ2  H   2.109  -5.626  12.176 1.00 . A A . 27 LYS HZ2  1 1 
        7  8488 1 1 27 LYS HZ3  H   1.640  -4.094  11.648 1.00 . A A . 27 LYS HZ3  1 1 
        7  8489 1 1 27 LYS N    N  -0.406  -2.916   5.079 1.00 . A A . 27 LYS N    1 1 
        7  8490 1 1 27 LYS NZ   N   2.110  -4.975  11.367 1.00 . A A . 27 LYS NZ   1 1 
        7  8491 1 1 27 LYS O    O  -0.101  -1.937   8.463 1.00 . A A . 27 LYS O    1 1 
        7  8492 1 1 28 ASP C    C   0.772   0.886   7.729 1.00 . A A . 28 ASP C    1 1 
        7  8493 1 1 28 ASP CA   C   1.828  -0.208   7.471 1.00 . A A . 28 ASP CA   1 1 
        7  8494 1 1 28 ASP CB   C   3.010   0.372   6.681 1.00 . A A . 28 ASP CB   1 1 
        7  8495 1 1 28 ASP CG   C   3.889   1.284   7.528 1.00 . A A . 28 ASP CG   1 1 
        7  8496 1 1 28 ASP H    H   1.536  -1.538   5.837 1.00 . A A . 28 ASP H    1 1 
        7  8497 1 1 28 ASP HA   H   2.188  -0.571   8.425 1.00 . A A . 28 ASP HA   1 1 
        7  8498 1 1 28 ASP HB2  H   3.616  -0.440   6.306 1.00 . A A . 28 ASP HB2  1 1 
        7  8499 1 1 28 ASP HB3  H   2.631   0.943   5.844 1.00 . A A . 28 ASP HB3  1 1 
        7  8500 1 1 28 ASP N    N   1.244  -1.348   6.756 1.00 . A A . 28 ASP N    1 1 
        7  8501 1 1 28 ASP O    O   0.552   1.291   8.871 1.00 . A A . 28 ASP O    1 1 
        7  8502 1 1 28 ASP OD1  O   3.419   2.364   7.941 1.00 . A A . 28 ASP OD1  1 1 
        7  8503 1 1 28 ASP OD2  O   5.060   0.925   7.786 1.00 . A A . 28 ASP OD2  1 1 
        7  8504 1 1 29 LEU C    C  -2.082   1.969   7.676 1.00 . A A . 29 LEU C    1 1 
        7  8505 1 1 29 LEU CA   C  -0.909   2.406   6.779 1.00 . A A . 29 LEU CA   1 1 
        7  8506 1 1 29 LEU CB   C  -1.434   2.814   5.385 1.00 . A A . 29 LEU CB   1 1 
        7  8507 1 1 29 LEU CD1  C  -0.250   5.048   5.282 1.00 . A A . 29 LEU CD1  1 1 
        7  8508 1 1 29 LEU CD2  C   0.812   3.035   4.217 1.00 . A A . 29 LEU CD2  1 1 
        7  8509 1 1 29 LEU CG   C  -0.507   3.731   4.553 1.00 . A A . 29 LEU CG   1 1 
        7  8510 1 1 29 LEU H    H   0.323   0.981   5.777 1.00 . A A . 29 LEU H    1 1 
        7  8511 1 1 29 LEU HA   H  -0.437   3.266   7.234 1.00 . A A . 29 LEU HA   1 1 
        7  8512 1 1 29 LEU HB2  H  -1.614   1.912   4.816 1.00 . A A . 29 LEU HB2  1 1 
        7  8513 1 1 29 LEU HB3  H  -2.377   3.324   5.516 1.00 . A A . 29 LEU HB3  1 1 
        7  8514 1 1 29 LEU HD11 H  -1.190   5.544   5.472 1.00 . A A . 29 LEU HD11 1 1 
        7  8515 1 1 29 LEU HD12 H   0.373   5.683   4.670 1.00 . A A . 29 LEU HD12 1 1 
        7  8516 1 1 29 LEU HD13 H   0.248   4.852   6.221 1.00 . A A . 29 LEU HD13 1 1 
        7  8517 1 1 29 LEU HD21 H   0.614   2.151   3.628 1.00 . A A . 29 LEU HD21 1 1 
        7  8518 1 1 29 LEU HD22 H   1.317   2.754   5.130 1.00 . A A . 29 LEU HD22 1 1 
        7  8519 1 1 29 LEU HD23 H   1.442   3.707   3.651 1.00 . A A . 29 LEU HD23 1 1 
        7  8520 1 1 29 LEU HG   H  -1.002   3.968   3.621 1.00 . A A . 29 LEU HG   1 1 
        7  8521 1 1 29 LEU N    N   0.116   1.352   6.663 1.00 . A A . 29 LEU N    1 1 
        7  8522 1 1 29 LEU O    O  -2.613   2.767   8.455 1.00 . A A . 29 LEU O    1 1 
        7  8523 1 1 30 LEU C    C  -3.252   0.150   9.877 1.00 . A A . 30 LEU C    1 1 
        7  8524 1 1 30 LEU CA   C  -3.579   0.142   8.371 1.00 . A A . 30 LEU CA   1 1 
        7  8525 1 1 30 LEU CB   C  -3.881  -1.294   7.911 1.00 . A A . 30 LEU CB   1 1 
        7  8526 1 1 30 LEU CD1  C  -6.388  -1.113   7.989 1.00 . A A . 30 LEU CD1  1 1 
        7  8527 1 1 30 LEU CD2  C  -5.302  -3.377   8.045 1.00 . A A . 30 LEU CD2  1 1 
        7  8528 1 1 30 LEU CG   C  -5.180  -1.911   8.462 1.00 . A A . 30 LEU CG   1 1 
        7  8529 1 1 30 LEU H    H  -2.000   0.105   6.943 1.00 . A A . 30 LEU H    1 1 
        7  8530 1 1 30 LEU HA   H  -4.451   0.757   8.200 1.00 . A A . 30 LEU HA   1 1 
        7  8531 1 1 30 LEU HB2  H  -3.934  -1.298   6.831 1.00 . A A . 30 LEU HB2  1 1 
        7  8532 1 1 30 LEU HB3  H  -3.056  -1.925   8.212 1.00 . A A . 30 LEU HB3  1 1 
        7  8533 1 1 30 LEU HD11 H  -6.317  -0.099   8.355 1.00 . A A . 30 LEU HD11 1 1 
        7  8534 1 1 30 LEU HD12 H  -7.291  -1.568   8.367 1.00 . A A . 30 LEU HD12 1 1 
        7  8535 1 1 30 LEU HD13 H  -6.416  -1.104   6.908 1.00 . A A . 30 LEU HD13 1 1 
        7  8536 1 1 30 LEU HD21 H  -4.443  -3.928   8.404 1.00 . A A . 30 LEU HD21 1 1 
        7  8537 1 1 30 LEU HD22 H  -5.347  -3.445   6.967 1.00 . A A . 30 LEU HD22 1 1 
        7  8538 1 1 30 LEU HD23 H  -6.200  -3.799   8.471 1.00 . A A . 30 LEU HD23 1 1 
        7  8539 1 1 30 LEU HG   H  -5.160  -1.870   9.543 1.00 . A A . 30 LEU HG   1 1 
        7  8540 1 1 30 LEU N    N  -2.470   0.695   7.574 1.00 . A A . 30 LEU N    1 1 
        7  8541 1 1 30 LEU O    O  -4.136   0.017  10.724 1.00 . A A . 30 LEU O    1 1 
        7  8542 1 1 31 LYS C    C  -1.834   1.671  12.280 1.00 . A A . 31 LYS C    1 1 
        7  8543 1 1 31 LYS CA   C  -1.501   0.333  11.586 1.00 . A A . 31 LYS CA   1 1 
        7  8544 1 1 31 LYS CB   C   0.022   0.072  11.615 1.00 . A A . 31 LYS CB   1 1 
        7  8545 1 1 31 LYS CD   C   2.308   0.721  12.500 1.00 . A A . 31 LYS CD   1 1 
        7  8546 1 1 31 LYS CE   C   2.836   0.958  11.088 1.00 . A A . 31 LYS CE   1 1 
        7  8547 1 1 31 LYS CG   C   0.801   0.938  12.606 1.00 . A A . 31 LYS CG   1 1 
        7  8548 1 1 31 LYS H    H  -1.310   0.376   9.472 1.00 . A A . 31 LYS H    1 1 
        7  8549 1 1 31 LYS HA   H  -1.999  -0.464  12.121 1.00 . A A . 31 LYS HA   1 1 
        7  8550 1 1 31 LYS HB2  H   0.189  -0.964  11.874 1.00 . A A . 31 LYS HB2  1 1 
        7  8551 1 1 31 LYS HB3  H   0.423   0.247  10.626 1.00 . A A . 31 LYS HB3  1 1 
        7  8552 1 1 31 LYS HD2  H   2.805   1.403  13.174 1.00 . A A . 31 LYS HD2  1 1 
        7  8553 1 1 31 LYS HD3  H   2.533  -0.297  12.792 1.00 . A A . 31 LYS HD3  1 1 
        7  8554 1 1 31 LYS HE2  H   3.914   0.888  11.107 1.00 . A A . 31 LYS HE2  1 1 
        7  8555 1 1 31 LYS HE3  H   2.442   0.192  10.435 1.00 . A A . 31 LYS HE3  1 1 
        7  8556 1 1 31 LYS HG2  H   0.584   1.977  12.406 1.00 . A A . 31 LYS HG2  1 1 
        7  8557 1 1 31 LYS HG3  H   0.482   0.692  13.609 1.00 . A A . 31 LYS HG3  1 1 
        7  8558 1 1 31 LYS HZ1  H   2.640   3.038  11.251 1.00 . A A . 31 LYS HZ1  1 1 
        7  8559 1 1 31 LYS HZ2  H   1.442   2.312  10.304 1.00 . A A . 31 LYS HZ2  1 1 
        7  8560 1 1 31 LYS HZ3  H   3.003   2.503   9.689 1.00 . A A . 31 LYS HZ3  1 1 
        7  8561 1 1 31 LYS N    N  -1.970   0.296  10.196 1.00 . A A . 31 LYS N    1 1 
        7  8562 1 1 31 LYS NZ   N   2.456   2.294  10.548 1.00 . A A . 31 LYS NZ   1 1 
        7  8563 1 1 31 LYS O    O  -2.188   1.698  13.463 1.00 . A A . 31 LYS O    1 1 
        7  8564 1 1 32 ASP C    C  -3.236   4.634  12.334 1.00 . A A . 32 ASP C    1 1 
        7  8565 1 1 32 ASP CA   C  -1.796   4.119  12.141 1.00 . A A . 32 ASP CA   1 1 
        7  8566 1 1 32 ASP CB   C  -1.001   5.101  11.279 1.00 . A A . 32 ASP CB   1 1 
        7  8567 1 1 32 ASP CG   C   0.396   4.583  10.978 1.00 . A A . 32 ASP CG   1 1 
        7  8568 1 1 32 ASP H    H  -1.603   2.688  10.570 1.00 . A A . 32 ASP H    1 1 
        7  8569 1 1 32 ASP HA   H  -1.326   4.064  13.113 1.00 . A A . 32 ASP HA   1 1 
        7  8570 1 1 32 ASP HB2  H  -1.522   5.256  10.345 1.00 . A A . 32 ASP HB2  1 1 
        7  8571 1 1 32 ASP HB3  H  -0.913   6.044  11.800 1.00 . A A . 32 ASP HB3  1 1 
        7  8572 1 1 32 ASP N    N  -1.730   2.774  11.542 1.00 . A A . 32 ASP N    1 1 
        7  8573 1 1 32 ASP O    O  -3.472   5.540  13.135 1.00 . A A . 32 ASP O    1 1 
        7  8574 1 1 32 ASP OD1  O   1.298   4.727  11.833 1.00 . A A . 32 ASP OD1  1 1 
        7  8575 1 1 32 ASP OD2  O   0.591   4.004   9.893 1.00 . A A . 32 ASP OD2  1 1 
        7  8576 1 1 33 MET C    C  -6.576   3.342  11.554 1.00 . A A . 33 MET C    1 1 
        7  8577 1 1 33 MET CA   C  -5.593   4.511  11.707 1.00 . A A . 33 MET CA   1 1 
        7  8578 1 1 33 MET CB   C  -5.872   5.582  10.644 1.00 . A A . 33 MET CB   1 1 
        7  8579 1 1 33 MET CE   C  -4.939   7.707   8.520 1.00 . A A . 33 MET CE   1 1 
        7  8580 1 1 33 MET CG   C  -5.647   5.113   9.213 1.00 . A A . 33 MET CG   1 1 
        7  8581 1 1 33 MET H    H  -3.968   3.325  11.009 1.00 . A A . 33 MET H    1 1 
        7  8582 1 1 33 MET HA   H  -5.737   4.949  12.686 1.00 . A A . 33 MET HA   1 1 
        7  8583 1 1 33 MET HB2  H  -6.899   5.904  10.734 1.00 . A A . 33 MET HB2  1 1 
        7  8584 1 1 33 MET HB3  H  -5.224   6.428  10.827 1.00 . A A . 33 MET HB3  1 1 
        7  8585 1 1 33 MET HE1  H  -5.067   8.562   7.871 1.00 . A A . 33 MET HE1  1 1 
        7  8586 1 1 33 MET HE2  H  -3.915   7.365   8.467 1.00 . A A . 33 MET HE2  1 1 
        7  8587 1 1 33 MET HE3  H  -5.171   7.990   9.535 1.00 . A A . 33 MET HE3  1 1 
        7  8588 1 1 33 MET HG2  H  -4.611   4.830   9.095 1.00 . A A . 33 MET HG2  1 1 
        7  8589 1 1 33 MET HG3  H  -6.275   4.254   9.023 1.00 . A A . 33 MET HG3  1 1 
        7  8590 1 1 33 MET N    N  -4.196   4.063  11.613 1.00 . A A . 33 MET N    1 1 
        7  8591 1 1 33 MET O    O  -6.177   2.180  11.517 1.00 . A A . 33 MET O    1 1 
        7  8592 1 1 33 MET SD   S  -6.037   6.389   7.999 1.00 . A A . 33 MET SD   1 1 
        7  8593 1 1 34 ASN C    C  -9.007   2.167   9.849 1.00 . A A . 34 ASN C    1 1 
        7  8594 1 1 34 ASN CA   C  -8.908   2.644  11.310 1.00 . A A . 34 ASN CA   1 1 
        7  8595 1 1 34 ASN CB   C -10.263   3.186  11.781 1.00 . A A . 34 ASN CB   1 1 
        7  8596 1 1 34 ASN CG   C -10.296   3.450  13.274 1.00 . A A . 34 ASN CG   1 1 
        7  8597 1 1 34 ASN H    H  -8.125   4.606  11.537 1.00 . A A . 34 ASN H    1 1 
        7  8598 1 1 34 ASN HA   H  -8.639   1.797  11.926 1.00 . A A . 34 ASN HA   1 1 
        7  8599 1 1 34 ASN HB2  H -10.473   4.113  11.268 1.00 . A A . 34 ASN HB2  1 1 
        7  8600 1 1 34 ASN HB3  H -11.035   2.469  11.543 1.00 . A A . 34 ASN HB3  1 1 
        7  8601 1 1 34 ASN HD21 H  -9.719   5.316  12.991 1.00 . A A . 34 ASN HD21 1 1 
        7  8602 1 1 34 ASN HD22 H  -9.977   4.847  14.630 1.00 . A A . 34 ASN HD22 1 1 
        7  8603 1 1 34 ASN N    N  -7.865   3.663  11.479 1.00 . A A . 34 ASN N    1 1 
        7  8604 1 1 34 ASN ND2  N  -9.965   4.658  13.669 1.00 . A A . 34 ASN ND2  1 1 
        7  8605 1 1 34 ASN O    O  -8.419   2.761   8.943 1.00 . A A . 34 ASN O    1 1 
        7  8606 1 1 34 ASN OD1  O -10.626   2.575  14.066 1.00 . A A . 34 ASN OD1  1 1 
        7  8607 1 1 35 GLN C    C -10.869   1.320   7.412 1.00 . A A . 35 GLN C    1 1 
        7  8608 1 1 35 GLN CA   C  -9.906   0.503   8.291 1.00 . A A . 35 GLN CA   1 1 
        7  8609 1 1 35 GLN CB   C -10.390  -0.956   8.404 1.00 . A A . 35 GLN CB   1 1 
        7  8610 1 1 35 GLN CD   C  -9.919  -3.268   9.368 1.00 . A A . 35 GLN CD   1 1 
        7  8611 1 1 35 GLN CG   C  -9.610  -1.778   9.428 1.00 . A A . 35 GLN CG   1 1 
        7  8612 1 1 35 GLN H    H -10.259   0.695  10.381 1.00 . A A . 35 GLN H    1 1 
        7  8613 1 1 35 GLN HA   H  -8.930   0.510   7.827 1.00 . A A . 35 GLN HA   1 1 
        7  8614 1 1 35 GLN HB2  H -11.432  -0.959   8.690 1.00 . A A . 35 GLN HB2  1 1 
        7  8615 1 1 35 GLN HB3  H -10.289  -1.435   7.439 1.00 . A A . 35 GLN HB3  1 1 
        7  8616 1 1 35 GLN HE21 H  -8.401  -3.577   8.135 1.00 . A A . 35 GLN HE21 1 1 
        7  8617 1 1 35 GLN HE22 H  -9.305  -4.978   8.585 1.00 . A A . 35 GLN HE22 1 1 
        7  8618 1 1 35 GLN HG2  H  -8.554  -1.641   9.250 1.00 . A A . 35 GLN HG2  1 1 
        7  8619 1 1 35 GLN HG3  H  -9.852  -1.416  10.417 1.00 . A A . 35 GLN HG3  1 1 
        7  8620 1 1 35 GLN N    N  -9.770   1.096   9.628 1.00 . A A . 35 GLN N    1 1 
        7  8621 1 1 35 GLN NE2  N  -9.132  -4.013   8.615 1.00 . A A . 35 GLN NE2  1 1 
        7  8622 1 1 35 GLN O    O -10.827   1.238   6.185 1.00 . A A . 35 GLN O    1 1 
        7  8623 1 1 35 GLN OE1  O -10.849  -3.748  10.005 1.00 . A A . 35 GLN OE1  1 1 
        7  8624 1 1 36 SER C    C -12.078   3.889   6.322 1.00 . A A . 36 SER C    1 1 
        7  8625 1 1 36 SER CA   C -12.717   2.954   7.365 1.00 . A A . 36 SER CA   1 1 
        7  8626 1 1 36 SER CB   C -13.511   3.789   8.386 1.00 . A A . 36 SER CB   1 1 
        7  8627 1 1 36 SER H    H -11.686   2.138   9.040 1.00 . A A . 36 SER H    1 1 
        7  8628 1 1 36 SER HA   H -13.404   2.292   6.856 1.00 . A A . 36 SER HA   1 1 
        7  8629 1 1 36 SER HB2  H -14.099   3.129   9.005 1.00 . A A . 36 SER HB2  1 1 
        7  8630 1 1 36 SER HB3  H -12.823   4.345   9.008 1.00 . A A . 36 SER HB3  1 1 
        7  8631 1 1 36 SER HG   H -14.320   5.565   8.180 1.00 . A A . 36 SER HG   1 1 
        7  8632 1 1 36 SER N    N -11.722   2.117   8.060 1.00 . A A . 36 SER N    1 1 
        7  8633 1 1 36 SER O    O -12.297   3.731   5.116 1.00 . A A . 36 SER O    1 1 
        7  8634 1 1 36 SER OG   O -14.386   4.704   7.746 1.00 . A A . 36 SER OG   1 1 
        7  8635 1 1 37 SER C    C  -9.837   5.223   4.792 1.00 . A A . 37 SER C    1 1 
        7  8636 1 1 37 SER CA   C -10.672   5.863   5.905 1.00 . A A . 37 SER CA   1 1 
        7  8637 1 1 37 SER CB   C  -9.786   6.829   6.702 1.00 . A A . 37 SER CB   1 1 
        7  8638 1 1 37 SER H    H -11.086   4.882   7.752 1.00 . A A . 37 SER H    1 1 
        7  8639 1 1 37 SER HA   H -11.478   6.423   5.454 1.00 . A A . 37 SER HA   1 1 
        7  8640 1 1 37 SER HB2  H -10.375   7.306   7.473 1.00 . A A . 37 SER HB2  1 1 
        7  8641 1 1 37 SER HB3  H  -8.975   6.280   7.159 1.00 . A A . 37 SER HB3  1 1 
        7  8642 1 1 37 SER HG   H  -8.462   7.489   5.400 1.00 . A A . 37 SER HG   1 1 
        7  8643 1 1 37 SER N    N -11.277   4.850   6.790 1.00 . A A . 37 SER N    1 1 
        7  8644 1 1 37 SER O    O -10.032   5.517   3.612 1.00 . A A . 37 SER O    1 1 
        7  8645 1 1 37 SER OG   O  -9.239   7.837   5.863 1.00 . A A . 37 SER OG   1 1 
        7  8646 1 1 38 LEU C    C  -8.830   2.966   3.103 1.00 . A A . 38 LEU C    1 1 
        7  8647 1 1 38 LEU CA   C  -8.030   3.677   4.213 1.00 . A A . 38 LEU CA   1 1 
        7  8648 1 1 38 LEU CB   C  -7.125   2.675   4.947 1.00 . A A . 38 LEU CB   1 1 
        7  8649 1 1 38 LEU CD1  C  -5.094   3.003   3.473 1.00 . A A . 38 LEU CD1  1 1 
        7  8650 1 1 38 LEU CD2  C  -5.295   0.938   4.895 1.00 . A A . 38 LEU CD2  1 1 
        7  8651 1 1 38 LEU CG   C  -6.057   1.980   4.077 1.00 . A A . 38 LEU CG   1 1 
        7  8652 1 1 38 LEU H    H  -8.825   4.137   6.126 1.00 . A A . 38 LEU H    1 1 
        7  8653 1 1 38 LEU HA   H  -7.411   4.439   3.757 1.00 . A A . 38 LEU HA   1 1 
        7  8654 1 1 38 LEU HB2  H  -6.621   3.201   5.747 1.00 . A A . 38 LEU HB2  1 1 
        7  8655 1 1 38 LEU HB3  H  -7.752   1.910   5.384 1.00 . A A . 38 LEU HB3  1 1 
        7  8656 1 1 38 LEU HD11 H  -4.622   3.569   4.263 1.00 . A A . 38 LEU HD11 1 1 
        7  8657 1 1 38 LEU HD12 H  -5.638   3.675   2.826 1.00 . A A . 38 LEU HD12 1 1 
        7  8658 1 1 38 LEU HD13 H  -4.336   2.488   2.899 1.00 . A A . 38 LEU HD13 1 1 
        7  8659 1 1 38 LEU HD21 H  -4.818   1.417   5.738 1.00 . A A . 38 LEU HD21 1 1 
        7  8660 1 1 38 LEU HD22 H  -4.544   0.471   4.273 1.00 . A A . 38 LEU HD22 1 1 
        7  8661 1 1 38 LEU HD23 H  -5.984   0.186   5.251 1.00 . A A . 38 LEU HD23 1 1 
        7  8662 1 1 38 LEU HG   H  -6.548   1.469   3.260 1.00 . A A . 38 LEU HG   1 1 
        7  8663 1 1 38 LEU N    N  -8.916   4.343   5.173 1.00 . A A . 38 LEU N    1 1 
        7  8664 1 1 38 LEU O    O  -8.454   3.010   1.930 1.00 . A A . 38 LEU O    1 1 
        7  8665 1 1 39 ALA C    C -11.571   2.571   1.597 1.00 . A A . 39 ALA C    1 1 
        7  8666 1 1 39 ALA CA   C -10.787   1.615   2.513 1.00 . A A . 39 ALA CA   1 1 
        7  8667 1 1 39 ALA CB   C -11.749   0.687   3.246 1.00 . A A . 39 ALA CB   1 1 
        7  8668 1 1 39 ALA H    H -10.201   2.338   4.426 1.00 . A A . 39 ALA H    1 1 
        7  8669 1 1 39 ALA HA   H -10.138   1.000   1.901 1.00 . A A . 39 ALA HA   1 1 
        7  8670 1 1 39 ALA HB1  H -12.319   0.115   2.527 1.00 . A A . 39 ALA HB1  1 1 
        7  8671 1 1 39 ALA HB2  H -12.424   1.274   3.852 1.00 . A A . 39 ALA HB2  1 1 
        7  8672 1 1 39 ALA HB3  H -11.190   0.014   3.880 1.00 . A A . 39 ALA HB3  1 1 
        7  8673 1 1 39 ALA N    N  -9.943   2.331   3.477 1.00 . A A . 39 ALA N    1 1 
        7  8674 1 1 39 ALA O    O -11.946   2.205   0.484 1.00 . A A . 39 ALA O    1 1 
        7  8675 1 1 40 LYS C    C -11.626   5.605   0.382 1.00 . A A . 40 LYS C    1 1 
        7  8676 1 1 40 LYS CA   C -12.570   4.785   1.275 1.00 . A A . 40 LYS CA   1 1 
        7  8677 1 1 40 LYS CB   C -13.380   5.729   2.175 1.00 . A A . 40 LYS CB   1 1 
        7  8678 1 1 40 LYS CD   C -15.463   6.043   3.565 1.00 . A A . 40 LYS CD   1 1 
        7  8679 1 1 40 LYS CE   C -16.172   6.858   2.484 1.00 . A A . 40 LYS CE   1 1 
        7  8680 1 1 40 LYS CG   C -14.491   5.035   2.958 1.00 . A A . 40 LYS CG   1 1 
        7  8681 1 1 40 LYS H    H -11.554   4.017   2.986 1.00 . A A . 40 LYS H    1 1 
        7  8682 1 1 40 LYS HA   H -13.259   4.250   0.633 1.00 . A A . 40 LYS HA   1 1 
        7  8683 1 1 40 LYS HB2  H -12.709   6.196   2.883 1.00 . A A . 40 LYS HB2  1 1 
        7  8684 1 1 40 LYS HB3  H -13.827   6.497   1.559 1.00 . A A . 40 LYS HB3  1 1 
        7  8685 1 1 40 LYS HD2  H -16.201   5.510   4.147 1.00 . A A . 40 LYS HD2  1 1 
        7  8686 1 1 40 LYS HD3  H -14.913   6.715   4.208 1.00 . A A . 40 LYS HD3  1 1 
        7  8687 1 1 40 LYS HE2  H -15.429   7.371   1.893 1.00 . A A . 40 LYS HE2  1 1 
        7  8688 1 1 40 LYS HE3  H -16.732   6.185   1.849 1.00 . A A . 40 LYS HE3  1 1 
        7  8689 1 1 40 LYS HG2  H -15.036   4.380   2.294 1.00 . A A . 40 LYS HG2  1 1 
        7  8690 1 1 40 LYS HG3  H -14.049   4.454   3.755 1.00 . A A . 40 LYS HG3  1 1 
        7  8691 1 1 40 LYS HZ1  H -16.579   8.545   3.647 1.00 . A A . 40 LYS HZ1  1 1 
        7  8692 1 1 40 LYS HZ2  H -17.827   7.401   3.637 1.00 . A A . 40 LYS HZ2  1 1 
        7  8693 1 1 40 LYS HZ3  H -17.571   8.390   2.291 1.00 . A A . 40 LYS HZ3  1 1 
        7  8694 1 1 40 LYS N    N -11.842   3.788   2.076 1.00 . A A . 40 LYS N    1 1 
        7  8695 1 1 40 LYS NZ   N -17.102   7.868   3.056 1.00 . A A . 40 LYS NZ   1 1 
        7  8696 1 1 40 LYS O    O -12.005   6.032  -0.710 1.00 . A A . 40 LYS O    1 1 
        7  8697 1 1 41 GLU C    C  -8.867   5.700  -1.085 1.00 . A A . 41 GLU C    1 1 
        7  8698 1 1 41 GLU CA   C  -9.408   6.573   0.059 1.00 . A A . 41 GLU CA   1 1 
        7  8699 1 1 41 GLU CB   C  -8.256   7.063   0.950 1.00 . A A . 41 GLU CB   1 1 
        7  8700 1 1 41 GLU CD   C  -7.512   8.641   2.800 1.00 . A A . 41 GLU CD   1 1 
        7  8701 1 1 41 GLU CG   C  -8.684   8.083   2.004 1.00 . A A . 41 GLU CG   1 1 
        7  8702 1 1 41 GLU H    H -10.167   5.528   1.751 1.00 . A A . 41 GLU H    1 1 
        7  8703 1 1 41 GLU HA   H  -9.904   7.433  -0.374 1.00 . A A . 41 GLU HA   1 1 
        7  8704 1 1 41 GLU HB2  H  -7.820   6.213   1.456 1.00 . A A . 41 GLU HB2  1 1 
        7  8705 1 1 41 GLU HB3  H  -7.502   7.520   0.323 1.00 . A A . 41 GLU HB3  1 1 
        7  8706 1 1 41 GLU HG2  H  -9.185   8.905   1.510 1.00 . A A . 41 GLU HG2  1 1 
        7  8707 1 1 41 GLU HG3  H  -9.372   7.607   2.687 1.00 . A A . 41 GLU HG3  1 1 
        7  8708 1 1 41 GLU N    N -10.404   5.842   0.852 1.00 . A A . 41 GLU N    1 1 
        7  8709 1 1 41 GLU O    O  -8.580   6.197  -2.176 1.00 . A A . 41 GLU O    1 1 
        7  8710 1 1 41 GLU OE1  O  -6.871   9.608   2.331 1.00 . A A . 41 GLU OE1  1 1 
        7  8711 1 1 41 GLU OE2  O  -7.234   8.126   3.904 1.00 . A A . 41 GLU OE2  1 1 
        7  8712 1 1 42 CYS C    C  -9.439   2.892  -2.677 1.00 . A A . 42 CYS C    1 1 
        7  8713 1 1 42 CYS CA   C  -8.273   3.441  -1.838 1.00 . A A . 42 CYS CA   1 1 
        7  8714 1 1 42 CYS CB   C  -7.548   2.272  -1.158 1.00 . A A . 42 CYS CB   1 1 
        7  8715 1 1 42 CYS H    H  -8.982   4.068   0.064 1.00 . A A . 42 CYS H    1 1 
        7  8716 1 1 42 CYS HA   H  -7.578   3.954  -2.487 1.00 . A A . 42 CYS HA   1 1 
        7  8717 1 1 42 CYS HB2  H  -8.247   1.744  -0.525 1.00 . A A . 42 CYS HB2  1 1 
        7  8718 1 1 42 CYS HB3  H  -7.177   1.596  -1.916 1.00 . A A . 42 CYS HB3  1 1 
        7  8719 1 1 42 CYS HG   H  -6.606   3.006   1.096 1.00 . A A . 42 CYS HG   1 1 
        7  8720 1 1 42 CYS N    N  -8.746   4.400  -0.829 1.00 . A A . 42 CYS N    1 1 
        7  8721 1 1 42 CYS O    O -10.498   2.573  -2.142 1.00 . A A . 42 CYS O    1 1 
        7  8722 1 1 42 CYS SG   S  -6.148   2.758  -0.125 1.00 . A A . 42 CYS SG   1 1 
        7  8723 1 1 43 PRO C    C -10.327   0.640  -4.818 1.00 . A A . 43 PRO C    1 1 
        7  8724 1 1 43 PRO CA   C -10.290   2.180  -4.889 1.00 . A A . 43 PRO CA   1 1 
        7  8725 1 1 43 PRO CB   C  -9.852   2.652  -6.281 1.00 . A A . 43 PRO CB   1 1 
        7  8726 1 1 43 PRO CD   C  -8.076   3.212  -4.768 1.00 . A A . 43 PRO CD   1 1 
        7  8727 1 1 43 PRO CG   C  -8.367   2.771  -6.182 1.00 . A A . 43 PRO CG   1 1 
        7  8728 1 1 43 PRO HA   H -11.275   2.572  -4.665 1.00 . A A . 43 PRO HA   1 1 
        7  8729 1 1 43 PRO HB2  H -10.146   1.925  -7.026 1.00 . A A . 43 PRO HB2  1 1 
        7  8730 1 1 43 PRO HB3  H -10.310   3.606  -6.502 1.00 . A A . 43 PRO HB3  1 1 
        7  8731 1 1 43 PRO HD2  H  -7.181   2.732  -4.399 1.00 . A A . 43 PRO HD2  1 1 
        7  8732 1 1 43 PRO HD3  H  -7.972   4.287  -4.720 1.00 . A A . 43 PRO HD3  1 1 
        7  8733 1 1 43 PRO HG2  H  -7.908   1.811  -6.378 1.00 . A A . 43 PRO HG2  1 1 
        7  8734 1 1 43 PRO HG3  H  -8.008   3.509  -6.887 1.00 . A A . 43 PRO HG3  1 1 
        7  8735 1 1 43 PRO N    N  -9.263   2.767  -4.010 1.00 . A A . 43 PRO N    1 1 
        7  8736 1 1 43 PRO O    O -11.102  -0.008  -5.528 1.00 . A A . 43 PRO O    1 1 
        7  8737 1 1 44 LEU C    C -10.610  -1.898  -2.939 1.00 . A A . 44 LEU C    1 1 
        7  8738 1 1 44 LEU CA   C  -9.431  -1.398  -3.786 1.00 . A A . 44 LEU CA   1 1 
        7  8739 1 1 44 LEU CB   C  -8.106  -1.830  -3.128 1.00 . A A . 44 LEU CB   1 1 
        7  8740 1 1 44 LEU CD1  C  -6.504  -0.230  -4.273 1.00 . A A . 44 LEU CD1  1 1 
        7  8741 1 1 44 LEU CD2  C  -5.662  -2.412  -3.348 1.00 . A A . 44 LEU CD2  1 1 
        7  8742 1 1 44 LEU CG   C  -6.841  -1.695  -3.999 1.00 . A A . 44 LEU CG   1 1 
        7  8743 1 1 44 LEU H    H  -8.888   0.624  -3.434 1.00 . A A . 44 LEU H    1 1 
        7  8744 1 1 44 LEU HA   H  -9.496  -1.851  -4.768 1.00 . A A . 44 LEU HA   1 1 
        7  8745 1 1 44 LEU HB2  H  -7.965  -1.240  -2.232 1.00 . A A . 44 LEU HB2  1 1 
        7  8746 1 1 44 LEU HB3  H  -8.200  -2.868  -2.837 1.00 . A A . 44 LEU HB3  1 1 
        7  8747 1 1 44 LEU HD11 H  -5.585  -0.171  -4.835 1.00 . A A . 44 LEU HD11 1 1 
        7  8748 1 1 44 LEU HD12 H  -6.386   0.297  -3.336 1.00 . A A . 44 LEU HD12 1 1 
        7  8749 1 1 44 LEU HD13 H  -7.303   0.225  -4.841 1.00 . A A . 44 LEU HD13 1 1 
        7  8750 1 1 44 LEU HD21 H  -5.903  -3.457  -3.221 1.00 . A A . 44 LEU HD21 1 1 
        7  8751 1 1 44 LEU HD22 H  -5.455  -1.969  -2.383 1.00 . A A . 44 LEU HD22 1 1 
        7  8752 1 1 44 LEU HD23 H  -4.791  -2.320  -3.980 1.00 . A A . 44 LEU HD23 1 1 
        7  8753 1 1 44 LEU HG   H  -7.025  -2.168  -4.953 1.00 . A A . 44 LEU HG   1 1 
        7  8754 1 1 44 LEU N    N  -9.483   0.059  -3.964 1.00 . A A . 44 LEU N    1 1 
        7  8755 1 1 44 LEU O    O -11.137  -1.173  -2.092 1.00 . A A . 44 LEU O    1 1 
        7  8756 1 1 45 SER C    C -11.813  -3.874  -0.928 1.00 . A A . 45 SER C    1 1 
        7  8757 1 1 45 SER CA   C -12.129  -3.749  -2.427 1.00 . A A . 45 SER CA   1 1 
        7  8758 1 1 45 SER CB   C -12.453  -5.137  -2.999 1.00 . A A . 45 SER CB   1 1 
        7  8759 1 1 45 SER H    H -10.545  -3.679  -3.843 1.00 . A A . 45 SER H    1 1 
        7  8760 1 1 45 SER HA   H -12.992  -3.109  -2.553 1.00 . A A . 45 SER HA   1 1 
        7  8761 1 1 45 SER HB2  H -11.599  -5.785  -2.867 1.00 . A A . 45 SER HB2  1 1 
        7  8762 1 1 45 SER HB3  H -13.302  -5.552  -2.474 1.00 . A A . 45 SER HB3  1 1 
        7  8763 1 1 45 SER HG   H -13.159  -5.904  -4.663 1.00 . A A . 45 SER HG   1 1 
        7  8764 1 1 45 SER N    N -11.011  -3.146  -3.165 1.00 . A A . 45 SER N    1 1 
        7  8765 1 1 45 SER O    O -10.681  -4.178  -0.547 1.00 . A A . 45 SER O    1 1 
        7  8766 1 1 45 SER OG   O -12.760  -5.069  -4.384 1.00 . A A . 45 SER OG   1 1 
        7  8767 1 1 46 GLN C    C -12.062  -5.103   1.786 1.00 . A A . 46 GLN C    1 1 
        7  8768 1 1 46 GLN CA   C -12.659  -3.745   1.375 1.00 . A A . 46 GLN CA   1 1 
        7  8769 1 1 46 GLN CB   C -14.020  -3.515   2.065 1.00 . A A . 46 GLN CB   1 1 
        7  8770 1 1 46 GLN CD   C -13.727  -4.626   4.358 1.00 . A A . 46 GLN CD   1 1 
        7  8771 1 1 46 GLN CG   C -13.957  -3.331   3.587 1.00 . A A . 46 GLN CG   1 1 
        7  8772 1 1 46 GLN H    H -13.709  -3.446  -0.451 1.00 . A A . 46 GLN H    1 1 
        7  8773 1 1 46 GLN HA   H -11.976  -2.959   1.673 1.00 . A A . 46 GLN HA   1 1 
        7  8774 1 1 46 GLN HB2  H -14.471  -2.627   1.645 1.00 . A A . 46 GLN HB2  1 1 
        7  8775 1 1 46 GLN HB3  H -14.662  -4.360   1.854 1.00 . A A . 46 GLN HB3  1 1 
        7  8776 1 1 46 GLN HE21 H -12.785  -3.646   5.791 1.00 . A A . 46 GLN HE21 1 1 
        7  8777 1 1 46 GLN HE22 H -12.943  -5.347   6.021 1.00 . A A . 46 GLN HE22 1 1 
        7  8778 1 1 46 GLN HG2  H -13.150  -2.650   3.818 1.00 . A A . 46 GLN HG2  1 1 
        7  8779 1 1 46 GLN HG3  H -14.890  -2.897   3.919 1.00 . A A . 46 GLN HG3  1 1 
        7  8780 1 1 46 GLN N    N -12.824  -3.663  -0.084 1.00 . A A . 46 GLN N    1 1 
        7  8781 1 1 46 GLN NE2  N -13.083  -4.529   5.502 1.00 . A A . 46 GLN NE2  1 1 
        7  8782 1 1 46 GLN O    O -11.160  -5.173   2.628 1.00 . A A . 46 GLN O    1 1 
        7  8783 1 1 46 GLN OE1  O -14.127  -5.703   3.930 1.00 . A A . 46 GLN OE1  1 1 
        7  8784 1 1 47 SER C    C -10.581  -7.694   1.132 1.00 . A A . 47 SER C    1 1 
        7  8785 1 1 47 SER CA   C -12.073  -7.537   1.464 1.00 . A A . 47 SER CA   1 1 
        7  8786 1 1 47 SER CB   C -12.890  -8.580   0.688 1.00 . A A . 47 SER CB   1 1 
        7  8787 1 1 47 SER H    H -13.303  -6.061   0.543 1.00 . A A . 47 SER H    1 1 
        7  8788 1 1 47 SER HA   H -12.205  -7.715   2.523 1.00 . A A . 47 SER HA   1 1 
        7  8789 1 1 47 SER HB2  H -12.873  -8.336  -0.363 1.00 . A A . 47 SER HB2  1 1 
        7  8790 1 1 47 SER HB3  H -12.457  -9.560   0.837 1.00 . A A . 47 SER HB3  1 1 
        7  8791 1 1 47 SER HG   H -14.367  -9.346   1.738 1.00 . A A . 47 SER HG   1 1 
        7  8792 1 1 47 SER N    N -12.566  -6.179   1.183 1.00 . A A . 47 SER N    1 1 
        7  8793 1 1 47 SER O    O  -9.902  -8.538   1.708 1.00 . A A . 47 SER O    1 1 
        7  8794 1 1 47 SER OG   O -14.241  -8.607   1.125 1.00 . A A . 47 SER OG   1 1 
        7  8795 1 1 48 MET C    C  -7.764  -6.412   0.995 1.00 . A A . 48 MET C    1 1 
        7  8796 1 1 48 MET CA   C  -8.645  -6.934  -0.151 1.00 . A A . 48 MET CA   1 1 
        7  8797 1 1 48 MET CB   C  -8.375  -6.125  -1.430 1.00 . A A . 48 MET CB   1 1 
        7  8798 1 1 48 MET CE   C  -9.685  -6.581  -5.373 1.00 . A A . 48 MET CE   1 1 
        7  8799 1 1 48 MET CG   C  -9.067  -6.677  -2.668 1.00 . A A . 48 MET CG   1 1 
        7  8800 1 1 48 MET H    H -10.650  -6.228  -0.231 1.00 . A A . 48 MET H    1 1 
        7  8801 1 1 48 MET HA   H  -8.392  -7.971  -0.334 1.00 . A A . 48 MET HA   1 1 
        7  8802 1 1 48 MET HB2  H  -8.715  -5.110  -1.278 1.00 . A A . 48 MET HB2  1 1 
        7  8803 1 1 48 MET HB3  H  -7.310  -6.113  -1.618 1.00 . A A . 48 MET HB3  1 1 
        7  8804 1 1 48 MET HE1  H  -9.284  -7.580  -5.440 1.00 . A A . 48 MET HE1  1 1 
        7  8805 1 1 48 MET HE2  H  -9.587  -6.089  -6.330 1.00 . A A . 48 MET HE2  1 1 
        7  8806 1 1 48 MET HE3  H -10.730  -6.629  -5.099 1.00 . A A . 48 MET HE3  1 1 
        7  8807 1 1 48 MET HG2  H  -8.693  -7.671  -2.864 1.00 . A A . 48 MET HG2  1 1 
        7  8808 1 1 48 MET HG3  H -10.130  -6.725  -2.479 1.00 . A A . 48 MET HG3  1 1 
        7  8809 1 1 48 MET N    N -10.068  -6.881   0.210 1.00 . A A . 48 MET N    1 1 
        7  8810 1 1 48 MET O    O  -6.989  -7.161   1.584 1.00 . A A . 48 MET O    1 1 
        7  8811 1 1 48 MET SD   S  -8.786  -5.656  -4.129 1.00 . A A . 48 MET SD   1 1 
        7  8812 1 1 49 ILE C    C  -7.189  -5.253   3.707 1.00 . A A . 49 ILE C    1 1 
        7  8813 1 1 49 ILE CA   C  -7.101  -4.491   2.369 1.00 . A A . 49 ILE CA   1 1 
        7  8814 1 1 49 ILE CB   C  -7.541  -3.019   2.590 1.00 . A A . 49 ILE CB   1 1 
        7  8815 1 1 49 ILE CD1  C  -7.930  -0.795   1.372 1.00 . A A . 49 ILE CD1  1 1 
        7  8816 1 1 49 ILE CG1  C  -7.469  -2.235   1.262 1.00 . A A . 49 ILE CG1  1 1 
        7  8817 1 1 49 ILE CG2  C  -6.681  -2.347   3.667 1.00 . A A . 49 ILE CG2  1 1 
        7  8818 1 1 49 ILE H    H  -8.582  -4.593   0.846 1.00 . A A . 49 ILE H    1 1 
        7  8819 1 1 49 ILE HA   H  -6.072  -4.490   2.037 1.00 . A A . 49 ILE HA   1 1 
        7  8820 1 1 49 ILE HB   H  -8.564  -3.024   2.938 1.00 . A A . 49 ILE HB   1 1 
        7  8821 1 1 49 ILE HD11 H  -7.888  -0.329   0.398 1.00 . A A . 49 ILE HD11 1 1 
        7  8822 1 1 49 ILE HD12 H  -7.285  -0.260   2.054 1.00 . A A . 49 ILE HD12 1 1 
        7  8823 1 1 49 ILE HD13 H  -8.945  -0.769   1.740 1.00 . A A . 49 ILE HD13 1 1 
        7  8824 1 1 49 ILE HG12 H  -6.448  -2.224   0.911 1.00 . A A . 49 ILE HG12 1 1 
        7  8825 1 1 49 ILE HG13 H  -8.091  -2.726   0.525 1.00 . A A . 49 ILE HG13 1 1 
        7  8826 1 1 49 ILE HG21 H  -6.781  -2.889   4.597 1.00 . A A . 49 ILE HG21 1 1 
        7  8827 1 1 49 ILE HG22 H  -7.013  -1.328   3.811 1.00 . A A . 49 ILE HG22 1 1 
        7  8828 1 1 49 ILE HG23 H  -5.644  -2.346   3.359 1.00 . A A . 49 ILE HG23 1 1 
        7  8829 1 1 49 ILE N    N  -7.910  -5.129   1.321 1.00 . A A . 49 ILE N    1 1 
        7  8830 1 1 49 ILE O    O  -6.222  -5.323   4.465 1.00 . A A . 49 ILE O    1 1 
        7  8831 1 1 50 SER C    C  -8.057  -8.016   5.161 1.00 . A A . 50 SER C    1 1 
        7  8832 1 1 50 SER CA   C  -8.578  -6.570   5.233 1.00 . A A . 50 SER CA   1 1 
        7  8833 1 1 50 SER CB   C -10.074  -6.582   5.580 1.00 . A A . 50 SER CB   1 1 
        7  8834 1 1 50 SER H    H  -9.083  -5.761   3.331 1.00 . A A . 50 SER H    1 1 
        7  8835 1 1 50 SER HA   H  -8.046  -6.053   6.020 1.00 . A A . 50 SER HA   1 1 
        7  8836 1 1 50 SER HB2  H -10.226  -7.126   6.501 1.00 . A A . 50 SER HB2  1 1 
        7  8837 1 1 50 SER HB3  H -10.421  -5.566   5.702 1.00 . A A . 50 SER HB3  1 1 
        7  8838 1 1 50 SER HG   H -11.381  -6.541   4.113 1.00 . A A . 50 SER HG   1 1 
        7  8839 1 1 50 SER N    N  -8.354  -5.832   3.982 1.00 . A A . 50 SER N    1 1 
        7  8840 1 1 50 SER O    O  -7.183  -8.414   5.934 1.00 . A A . 50 SER O    1 1 
        7  8841 1 1 50 SER OG   O -10.836  -7.205   4.555 1.00 . A A . 50 SER OG   1 1 
        7  8842 1 1 51 SER C    C  -6.840 -10.537   3.752 1.00 . A A . 51 SER C    1 1 
        7  8843 1 1 51 SER CA   C  -8.292 -10.240   4.156 1.00 . A A . 51 SER CA   1 1 
        7  8844 1 1 51 SER CB   C  -9.257 -10.947   3.199 1.00 . A A . 51 SER CB   1 1 
        7  8845 1 1 51 SER H    H  -9.198  -8.403   3.564 1.00 . A A . 51 SER H    1 1 
        7  8846 1 1 51 SER HA   H  -8.448 -10.640   5.148 1.00 . A A . 51 SER HA   1 1 
        7  8847 1 1 51 SER HB2  H -10.267 -10.631   3.413 1.00 . A A . 51 SER HB2  1 1 
        7  8848 1 1 51 SER HB3  H  -9.010 -10.683   2.181 1.00 . A A . 51 SER HB3  1 1 
        7  8849 1 1 51 SER HG   H  -9.570 -12.775   2.560 1.00 . A A . 51 SER HG   1 1 
        7  8850 1 1 51 SER N    N  -8.588  -8.798   4.223 1.00 . A A . 51 SER N    1 1 
        7  8851 1 1 51 SER O    O  -6.320 -11.604   4.066 1.00 . A A . 51 SER O    1 1 
        7  8852 1 1 51 SER OG   O  -9.187 -12.356   3.338 1.00 . A A . 51 SER OG   1 1 
        7  8853 1 1 52 ILE C    C  -3.877  -9.676   3.989 1.00 . A A . 52 ILE C    1 1 
        7  8854 1 1 52 ILE CA   C  -4.753  -9.777   2.730 1.00 . A A . 52 ILE CA   1 1 
        7  8855 1 1 52 ILE CB   C  -4.275  -8.744   1.674 1.00 . A A . 52 ILE CB   1 1 
        7  8856 1 1 52 ILE CD1  C  -4.579  -8.025  -0.765 1.00 . A A . 52 ILE CD1  1 1 
        7  8857 1 1 52 ILE CG1  C  -4.963  -9.008   0.324 1.00 . A A . 52 ILE CG1  1 1 
        7  8858 1 1 52 ILE CG2  C  -2.753  -8.779   1.520 1.00 . A A . 52 ILE CG2  1 1 
        7  8859 1 1 52 ILE H    H  -6.649  -8.793   2.774 1.00 . A A . 52 ILE H    1 1 
        7  8860 1 1 52 ILE HA   H  -4.634 -10.768   2.309 1.00 . A A . 52 ILE HA   1 1 
        7  8861 1 1 52 ILE HB   H  -4.553  -7.757   2.022 1.00 . A A . 52 ILE HB   1 1 
        7  8862 1 1 52 ILE HD11 H  -4.843  -7.024  -0.457 1.00 . A A . 52 ILE HD11 1 1 
        7  8863 1 1 52 ILE HD12 H  -5.108  -8.272  -1.673 1.00 . A A . 52 ILE HD12 1 1 
        7  8864 1 1 52 ILE HD13 H  -3.515  -8.079  -0.943 1.00 . A A . 52 ILE HD13 1 1 
        7  8865 1 1 52 ILE HG12 H  -4.702  -9.997  -0.019 1.00 . A A . 52 ILE HG12 1 1 
        7  8866 1 1 52 ILE HG13 H  -6.035  -8.951   0.458 1.00 . A A . 52 ILE HG13 1 1 
        7  8867 1 1 52 ILE HG21 H  -2.443  -9.766   1.205 1.00 . A A . 52 ILE HG21 1 1 
        7  8868 1 1 52 ILE HG22 H  -2.290  -8.541   2.465 1.00 . A A . 52 ILE HG22 1 1 
        7  8869 1 1 52 ILE HG23 H  -2.449  -8.054   0.779 1.00 . A A . 52 ILE HG23 1 1 
        7  8870 1 1 52 ILE N    N  -6.177  -9.605   3.065 1.00 . A A . 52 ILE N    1 1 
        7  8871 1 1 52 ILE O    O  -2.965 -10.482   4.196 1.00 . A A . 52 ILE O    1 1 
        7  8872 1 1 53 VAL C    C  -3.773  -9.654   7.086 1.00 . A A . 53 VAL C    1 1 
        7  8873 1 1 53 VAL CA   C  -3.440  -8.519   6.101 1.00 . A A . 53 VAL CA   1 1 
        7  8874 1 1 53 VAL CB   C  -3.758  -7.147   6.757 1.00 . A A . 53 VAL CB   1 1 
        7  8875 1 1 53 VAL CG1  C  -3.025  -6.987   8.089 1.00 . A A . 53 VAL CG1  1 1 
        7  8876 1 1 53 VAL CG2  C  -3.399  -6.006   5.806 1.00 . A A . 53 VAL CG2  1 1 
        7  8877 1 1 53 VAL H    H  -4.885  -8.062   4.611 1.00 . A A . 53 VAL H    1 1 
        7  8878 1 1 53 VAL HA   H  -2.381  -8.551   5.878 1.00 . A A . 53 VAL HA   1 1 
        7  8879 1 1 53 VAL HB   H  -4.821  -7.101   6.950 1.00 . A A . 53 VAL HB   1 1 
        7  8880 1 1 53 VAL HG11 H  -1.958  -7.057   7.927 1.00 . A A . 53 VAL HG11 1 1 
        7  8881 1 1 53 VAL HG12 H  -3.336  -7.765   8.770 1.00 . A A . 53 VAL HG12 1 1 
        7  8882 1 1 53 VAL HG13 H  -3.260  -6.022   8.516 1.00 . A A . 53 VAL HG13 1 1 
        7  8883 1 1 53 VAL HG21 H  -3.597  -5.058   6.288 1.00 . A A . 53 VAL HG21 1 1 
        7  8884 1 1 53 VAL HG22 H  -3.994  -6.081   4.907 1.00 . A A . 53 VAL HG22 1 1 
        7  8885 1 1 53 VAL HG23 H  -2.353  -6.065   5.549 1.00 . A A . 53 VAL HG23 1 1 
        7  8886 1 1 53 VAL N    N  -4.167  -8.689   4.837 1.00 . A A . 53 VAL N    1 1 
        7  8887 1 1 53 VAL O    O  -2.882 -10.226   7.719 1.00 . A A . 53 VAL O    1 1 
        7  8888 1 1 54 ASN C    C  -5.031 -12.437   7.525 1.00 . A A . 54 ASN C    1 1 
        7  8889 1 1 54 ASN CA   C  -5.517 -11.076   8.064 1.00 . A A . 54 ASN CA   1 1 
        7  8890 1 1 54 ASN CB   C  -7.047 -11.052   8.163 1.00 . A A . 54 ASN CB   1 1 
        7  8891 1 1 54 ASN CG   C  -7.579 -11.969   9.250 1.00 . A A . 54 ASN CG   1 1 
        7  8892 1 1 54 ASN H    H  -5.726  -9.461   6.700 1.00 . A A . 54 ASN H    1 1 
        7  8893 1 1 54 ASN HA   H  -5.097 -10.919   9.047 1.00 . A A . 54 ASN HA   1 1 
        7  8894 1 1 54 ASN HB2  H  -7.372 -10.044   8.380 1.00 . A A . 54 ASN HB2  1 1 
        7  8895 1 1 54 ASN HB3  H  -7.468 -11.363   7.217 1.00 . A A . 54 ASN HB3  1 1 
        7  8896 1 1 54 ASN HD21 H  -9.224 -12.307   8.215 1.00 . A A . 54 ASN HD21 1 1 
        7  8897 1 1 54 ASN HD22 H  -9.116 -13.108   9.738 1.00 . A A . 54 ASN HD22 1 1 
        7  8898 1 1 54 ASN N    N  -5.061  -9.978   7.202 1.00 . A A . 54 ASN N    1 1 
        7  8899 1 1 54 ASN ND2  N  -8.756 -12.516   9.043 1.00 . A A . 54 ASN ND2  1 1 
        7  8900 1 1 54 ASN O    O  -4.639 -13.316   8.291 1.00 . A A . 54 ASN O    1 1 
        7  8901 1 1 54 ASN OD1  O  -6.940 -12.175  10.275 1.00 . A A . 54 ASN OD1  1 1 
        7  8902 1 1 55 SER C    C  -5.357 -15.048   5.625 1.00 . A A . 55 SER C    1 1 
        7  8903 1 1 55 SER CA   C  -4.526 -13.758   5.474 1.00 . A A . 55 SER CA   1 1 
        7  8904 1 1 55 SER CB   C  -3.072 -14.023   5.904 1.00 . A A . 55 SER CB   1 1 
        7  8905 1 1 55 SER H    H  -5.518 -11.889   5.670 1.00 . A A . 55 SER H    1 1 
        7  8906 1 1 55 SER HA   H  -4.518 -13.495   4.427 1.00 . A A . 55 SER HA   1 1 
        7  8907 1 1 55 SER HB2  H  -3.047 -14.261   6.956 1.00 . A A . 55 SER HB2  1 1 
        7  8908 1 1 55 SER HB3  H  -2.676 -14.853   5.338 1.00 . A A . 55 SER HB3  1 1 
        7  8909 1 1 55 SER HG   H  -2.630 -12.348   4.969 1.00 . A A . 55 SER HG   1 1 
        7  8910 1 1 55 SER N    N  -5.087 -12.592   6.197 1.00 . A A . 55 SER N    1 1 
        7  8911 1 1 55 SER O    O  -5.766 -15.640   4.627 1.00 . A A . 55 SER O    1 1 
        7  8912 1 1 55 SER OG   O  -2.250 -12.886   5.677 1.00 . A A . 55 SER OG   1 1 
        7  8913 1 1 56 THR C    C  -7.305 -17.264   6.219 1.00 . A A . 56 THR C    1 1 
        7  8914 1 1 56 THR CA   C  -6.186 -16.789   7.178 1.00 . A A . 56 THR CA   1 1 
        7  8915 1 1 56 THR CB   C  -6.713 -16.845   8.634 1.00 . A A . 56 THR CB   1 1 
        7  8916 1 1 56 THR CG2  C  -7.746 -15.753   8.902 1.00 . A A . 56 THR CG2  1 1 
        7  8917 1 1 56 THR H    H  -5.392 -14.863   7.612 1.00 . A A . 56 THR H    1 1 
        7  8918 1 1 56 THR HA   H  -5.374 -17.500   7.110 1.00 . A A . 56 THR HA   1 1 
        7  8919 1 1 56 THR HB   H  -5.877 -16.692   9.302 1.00 . A A . 56 THR HB   1 1 
        7  8920 1 1 56 THR HG1  H  -6.680 -18.634   9.475 1.00 . A A . 56 THR HG1  1 1 
        7  8921 1 1 56 THR HG21 H  -8.100 -15.833   9.920 1.00 . A A . 56 THR HG21 1 1 
        7  8922 1 1 56 THR HG22 H  -8.579 -15.867   8.222 1.00 . A A . 56 THR HG22 1 1 
        7  8923 1 1 56 THR HG23 H  -7.294 -14.784   8.757 1.00 . A A . 56 THR HG23 1 1 
        7  8924 1 1 56 THR N    N  -5.610 -15.461   6.867 1.00 . A A . 56 THR N    1 1 
        7  8925 1 1 56 THR O    O  -7.209 -18.355   5.656 1.00 . A A . 56 THR O    1 1 
        7  8926 1 1 56 THR OG1  O  -7.283 -18.133   8.909 1.00 . A A . 56 THR OG1  1 1 
        7  8927 1 1 57 TYR C    C  -9.463 -16.507   3.756 1.00 . A A . 57 TYR C    1 1 
        7  8928 1 1 57 TYR CA   C  -9.525 -16.918   5.242 1.00 . A A . 57 TYR CA   1 1 
        7  8929 1 1 57 TYR CB   C -10.833 -16.410   5.888 1.00 . A A . 57 TYR CB   1 1 
        7  8930 1 1 57 TYR CD1  C -10.518 -13.960   6.503 1.00 . A A . 57 TYR CD1  1 1 
        7  8931 1 1 57 TYR CD2  C -12.023 -14.490   4.730 1.00 . A A . 57 TYR CD2  1 1 
        7  8932 1 1 57 TYR CE1  C -10.798 -12.615   6.341 1.00 . A A . 57 TYR CE1  1 1 
        7  8933 1 1 57 TYR CE2  C -12.305 -13.148   4.561 1.00 . A A . 57 TYR CE2  1 1 
        7  8934 1 1 57 TYR CG   C -11.123 -14.922   5.702 1.00 . A A . 57 TYR CG   1 1 
        7  8935 1 1 57 TYR CZ   C -11.693 -12.214   5.366 1.00 . A A . 57 TYR CZ   1 1 
        7  8936 1 1 57 TYR H    H  -8.343 -15.556   6.390 1.00 . A A . 57 TYR H    1 1 
        7  8937 1 1 57 TYR HA   H  -9.531 -17.999   5.284 1.00 . A A . 57 TYR HA   1 1 
        7  8938 1 1 57 TYR HB2  H -11.662 -16.959   5.464 1.00 . A A . 57 TYR HB2  1 1 
        7  8939 1 1 57 TYR HB3  H -10.795 -16.609   6.951 1.00 . A A . 57 TYR HB3  1 1 
        7  8940 1 1 57 TYR HD1  H  -9.816 -14.277   7.262 1.00 . A A . 57 TYR HD1  1 1 
        7  8941 1 1 57 TYR HD2  H -12.507 -15.224   4.099 1.00 . A A . 57 TYR HD2  1 1 
        7  8942 1 1 57 TYR HE1  H -10.318 -11.885   6.974 1.00 . A A . 57 TYR HE1  1 1 
        7  8943 1 1 57 TYR HE2  H -13.005 -12.837   3.799 1.00 . A A . 57 TYR HE2  1 1 
        7  8944 1 1 57 TYR HH   H -11.169 -10.362   5.268 1.00 . A A . 57 TYR HH   1 1 
        7  8945 1 1 57 TYR N    N  -8.353 -16.460   6.018 1.00 . A A . 57 TYR N    1 1 
        7  8946 1 1 57 TYR O    O -10.451 -16.629   3.024 1.00 . A A . 57 TYR O    1 1 
        7  8947 1 1 57 TYR OH   O -11.980 -10.873   5.201 1.00 . A A . 57 TYR OH   1 1 
        7  8948 1 1 58 TYR C    C  -7.585 -16.704   1.007 1.00 . A A . 58 TYR C    1 1 
        7  8949 1 1 58 TYR CA   C  -8.149 -15.591   1.913 1.00 . A A . 58 TYR CA   1 1 
        7  8950 1 1 58 TYR CB   C  -7.240 -14.355   1.873 1.00 . A A . 58 TYR CB   1 1 
        7  8951 1 1 58 TYR CD1  C  -8.445 -12.792   0.289 1.00 . A A . 58 TYR CD1  1 1 
        7  8952 1 1 58 TYR CD2  C  -6.305 -13.616  -0.360 1.00 . A A . 58 TYR CD2  1 1 
        7  8953 1 1 58 TYR CE1  C  -8.535 -12.079  -0.890 1.00 . A A . 58 TYR CE1  1 1 
        7  8954 1 1 58 TYR CE2  C  -6.389 -12.906  -1.540 1.00 . A A . 58 TYR CE2  1 1 
        7  8955 1 1 58 TYR CG   C  -7.328 -13.574   0.575 1.00 . A A . 58 TYR CG   1 1 
        7  8956 1 1 58 TYR CZ   C  -7.504 -12.138  -1.800 1.00 . A A . 58 TYR CZ   1 1 
        7  8957 1 1 58 TYR H    H  -7.521 -16.043   3.894 1.00 . A A . 58 TYR H    1 1 
        7  8958 1 1 58 TYR HA   H  -9.130 -15.313   1.552 1.00 . A A . 58 TYR HA   1 1 
        7  8959 1 1 58 TYR HB2  H  -7.513 -13.689   2.681 1.00 . A A . 58 TYR HB2  1 1 
        7  8960 1 1 58 TYR HB3  H  -6.213 -14.668   2.009 1.00 . A A . 58 TYR HB3  1 1 
        7  8961 1 1 58 TYR HD1  H  -9.254 -12.748   1.005 1.00 . A A . 58 TYR HD1  1 1 
        7  8962 1 1 58 TYR HD2  H  -5.430 -14.217  -0.155 1.00 . A A . 58 TYR HD2  1 1 
        7  8963 1 1 58 TYR HE1  H  -9.409 -11.477  -1.091 1.00 . A A . 58 TYR HE1  1 1 
        7  8964 1 1 58 TYR HE2  H  -5.582 -12.955  -2.255 1.00 . A A . 58 TYR HE2  1 1 
        7  8965 1 1 58 TYR HH   H  -7.487 -12.030  -3.718 1.00 . A A . 58 TYR HH   1 1 
        7  8966 1 1 58 TYR N    N  -8.299 -16.056   3.297 1.00 . A A . 58 TYR N    1 1 
        7  8967 1 1 58 TYR O    O  -6.519 -17.258   1.279 1.00 . A A . 58 TYR O    1 1 
        7  8968 1 1 58 TYR OH   O  -7.587 -11.427  -2.976 1.00 . A A . 58 TYR OH   1 1 
        7  8969 1 1 59 ALA C    C  -6.625 -17.781  -1.772 1.00 . A A . 59 ALA C    1 1 
        7  8970 1 1 59 ALA CA   C  -7.913 -18.107  -0.987 1.00 . A A . 59 ALA CA   1 1 
        7  8971 1 1 59 ALA CB   C  -9.054 -18.412  -1.949 1.00 . A A . 59 ALA CB   1 1 
        7  8972 1 1 59 ALA H    H  -9.134 -16.525  -0.249 1.00 . A A . 59 ALA H    1 1 
        7  8973 1 1 59 ALA HA   H  -7.738 -18.992  -0.391 1.00 . A A . 59 ALA HA   1 1 
        7  8974 1 1 59 ALA HB1  H  -9.231 -17.555  -2.582 1.00 . A A . 59 ALA HB1  1 1 
        7  8975 1 1 59 ALA HB2  H  -9.950 -18.634  -1.385 1.00 . A A . 59 ALA HB2  1 1 
        7  8976 1 1 59 ALA HB3  H  -8.796 -19.265  -2.561 1.00 . A A . 59 ALA HB3  1 1 
        7  8977 1 1 59 ALA N    N  -8.308 -17.023  -0.070 1.00 . A A . 59 ALA N    1 1 
        7  8978 1 1 59 ALA O    O  -5.546 -18.296  -1.465 1.00 . A A . 59 ALA O    1 1 
        7  8979 1 1 60 ASN C    C  -5.794 -15.092  -4.129 1.00 . A A . 60 ASN C    1 1 
        7  8980 1 1 60 ASN CA   C  -5.602 -16.527  -3.616 1.00 . A A . 60 ASN CA   1 1 
        7  8981 1 1 60 ASN CB   C  -5.419 -17.497  -4.791 1.00 . A A . 60 ASN CB   1 1 
        7  8982 1 1 60 ASN CG   C  -4.161 -17.214  -5.597 1.00 . A A . 60 ASN CG   1 1 
        7  8983 1 1 60 ASN H    H  -7.631 -16.557  -2.995 1.00 . A A . 60 ASN H    1 1 
        7  8984 1 1 60 ASN HA   H  -4.718 -16.555  -2.992 1.00 . A A . 60 ASN HA   1 1 
        7  8985 1 1 60 ASN HB2  H  -5.356 -18.505  -4.410 1.00 . A A . 60 ASN HB2  1 1 
        7  8986 1 1 60 ASN HB3  H  -6.274 -17.420  -5.449 1.00 . A A . 60 ASN HB3  1 1 
        7  8987 1 1 60 ASN HD21 H  -5.008 -17.926  -7.235 1.00 . A A . 60 ASN HD21 1 1 
        7  8988 1 1 60 ASN HD22 H  -3.389 -17.355  -7.408 1.00 . A A . 60 ASN HD22 1 1 
        7  8989 1 1 60 ASN N    N  -6.748 -16.930  -2.791 1.00 . A A . 60 ASN N    1 1 
        7  8990 1 1 60 ASN ND2  N  -4.189 -17.530  -6.873 1.00 . A A . 60 ASN ND2  1 1 
        7  8991 1 1 60 ASN O    O  -6.925 -14.634  -4.307 1.00 . A A . 60 ASN O    1 1 
        7  8992 1 1 60 ASN OD1  O  -3.169 -16.714  -5.073 1.00 . A A . 60 ASN OD1  1 1 
        7  8993 1 1 61 VAL C    C  -4.407 -12.716  -6.211 1.00 . A A . 61 VAL C    1 1 
        7  8994 1 1 61 VAL CA   C  -4.747 -12.964  -4.729 1.00 . A A . 61 VAL CA   1 1 
        7  8995 1 1 61 VAL CB   C  -3.799 -12.131  -3.823 1.00 . A A . 61 VAL CB   1 1 
        7  8996 1 1 61 VAL CG1  C  -2.358 -12.631  -3.915 1.00 . A A . 61 VAL CG1  1 1 
        7  8997 1 1 61 VAL CG2  C  -3.886 -10.643  -4.161 1.00 . A A . 61 VAL CG2  1 1 
        7  8998 1 1 61 VAL H    H  -3.823 -14.834  -4.321 1.00 . A A . 61 VAL H    1 1 
        7  8999 1 1 61 VAL HA   H  -5.759 -12.621  -4.550 1.00 . A A . 61 VAL HA   1 1 
        7  9000 1 1 61 VAL HB   H  -4.126 -12.258  -2.798 1.00 . A A . 61 VAL HB   1 1 
        7  9001 1 1 61 VAL HG11 H  -2.320 -13.674  -3.633 1.00 . A A . 61 VAL HG11 1 1 
        7  9002 1 1 61 VAL HG12 H  -1.733 -12.058  -3.245 1.00 . A A . 61 VAL HG12 1 1 
        7  9003 1 1 61 VAL HG13 H  -1.998 -12.519  -4.927 1.00 . A A . 61 VAL HG13 1 1 
        7  9004 1 1 61 VAL HG21 H  -4.910 -10.309  -4.058 1.00 . A A . 61 VAL HG21 1 1 
        7  9005 1 1 61 VAL HG22 H  -3.556 -10.482  -5.177 1.00 . A A . 61 VAL HG22 1 1 
        7  9006 1 1 61 VAL HG23 H  -3.259 -10.080  -3.485 1.00 . A A . 61 VAL HG23 1 1 
        7  9007 1 1 61 VAL N    N  -4.693 -14.387  -4.371 1.00 . A A . 61 VAL N    1 1 
        7  9008 1 1 61 VAL O    O  -3.403 -13.208  -6.728 1.00 . A A . 61 VAL O    1 1 
        7  9009 1 1 62 SER C    C  -4.097 -10.327  -8.333 1.00 . A A . 62 SER C    1 1 
        7  9010 1 1 62 SER CA   C  -5.021 -11.554  -8.284 1.00 . A A . 62 SER CA   1 1 
        7  9011 1 1 62 SER CB   C  -6.349 -11.238  -8.991 1.00 . A A . 62 SER CB   1 1 
        7  9012 1 1 62 SER H    H  -6.094 -11.670  -6.452 1.00 . A A . 62 SER H    1 1 
        7  9013 1 1 62 SER HA   H  -4.539 -12.378  -8.792 1.00 . A A . 62 SER HA   1 1 
        7  9014 1 1 62 SER HB2  H  -6.833 -10.411  -8.493 1.00 . A A . 62 SER HB2  1 1 
        7  9015 1 1 62 SER HB3  H  -6.151 -10.973 -10.019 1.00 . A A . 62 SER HB3  1 1 
        7  9016 1 1 62 SER HG   H  -7.717 -12.363  -8.137 1.00 . A A . 62 SER HG   1 1 
        7  9017 1 1 62 SER N    N  -5.267 -11.960  -6.892 1.00 . A A . 62 SER N    1 1 
        7  9018 1 1 62 SER O    O  -4.335  -9.337  -7.647 1.00 . A A . 62 SER O    1 1 
        7  9019 1 1 62 SER OG   O  -7.226 -12.356  -8.970 1.00 . A A . 62 SER OG   1 1 
        7  9020 1 1 63 ALA C    C  -2.633  -7.957  -9.637 1.00 . A A . 63 ALA C    1 1 
        7  9021 1 1 63 ALA CA   C  -2.039  -9.318  -9.223 1.00 . A A . 63 ALA CA   1 1 
        7  9022 1 1 63 ALA CB   C  -0.925  -9.719 -10.179 1.00 . A A . 63 ALA CB   1 1 
        7  9023 1 1 63 ALA H    H  -2.942 -11.181  -9.724 1.00 . A A . 63 ALA H    1 1 
        7  9024 1 1 63 ALA HA   H  -1.604  -9.215  -8.238 1.00 . A A . 63 ALA HA   1 1 
        7  9025 1 1 63 ALA HB1  H  -0.492 -10.655  -9.855 1.00 . A A . 63 ALA HB1  1 1 
        7  9026 1 1 63 ALA HB2  H  -0.162  -8.954 -10.189 1.00 . A A . 63 ALA HB2  1 1 
        7  9027 1 1 63 ALA HB3  H  -1.329  -9.838 -11.174 1.00 . A A . 63 ALA HB3  1 1 
        7  9028 1 1 63 ALA N    N  -3.048 -10.390  -9.152 1.00 . A A . 63 ALA N    1 1 
        7  9029 1 1 63 ALA O    O  -2.022  -6.910  -9.411 1.00 . A A . 63 ALA O    1 1 
        7  9030 1 1 64 ALA C    C  -4.571  -5.671  -9.589 1.00 . A A . 64 ALA C    1 1 
        7  9031 1 1 64 ALA CA   C  -4.500  -6.753 -10.686 1.00 . A A . 64 ALA CA   1 1 
        7  9032 1 1 64 ALA CB   C  -5.898  -7.087 -11.191 1.00 . A A . 64 ALA CB   1 1 
        7  9033 1 1 64 ALA H    H  -4.267  -8.840 -10.369 1.00 . A A . 64 ALA H    1 1 
        7  9034 1 1 64 ALA HA   H  -3.932  -6.364 -11.519 1.00 . A A . 64 ALA HA   1 1 
        7  9035 1 1 64 ALA HB1  H  -6.350  -6.203 -11.617 1.00 . A A . 64 ALA HB1  1 1 
        7  9036 1 1 64 ALA HB2  H  -6.504  -7.442 -10.372 1.00 . A A . 64 ALA HB2  1 1 
        7  9037 1 1 64 ALA HB3  H  -5.834  -7.855 -11.949 1.00 . A A . 64 ALA HB3  1 1 
        7  9038 1 1 64 ALA N    N  -3.828  -7.978 -10.226 1.00 . A A . 64 ALA N    1 1 
        7  9039 1 1 64 ALA O    O  -4.279  -4.500  -9.844 1.00 . A A . 64 ALA O    1 1 
        7  9040 1 1 65 LYS C    C  -3.703  -4.465  -6.888 1.00 . A A . 65 LYS C    1 1 
        7  9041 1 1 65 LYS CA   C  -5.054  -5.114  -7.248 1.00 . A A . 65 LYS CA   1 1 
        7  9042 1 1 65 LYS CB   C  -5.692  -5.781  -6.007 1.00 . A A . 65 LYS CB   1 1 
        7  9043 1 1 65 LYS CD   C  -3.746  -7.274  -5.298 1.00 . A A . 65 LYS CD   1 1 
        7  9044 1 1 65 LYS CE   C  -3.479  -6.535  -3.997 1.00 . A A . 65 LYS CE   1 1 
        7  9045 1 1 65 LYS CG   C  -5.215  -7.207  -5.708 1.00 . A A . 65 LYS CG   1 1 
        7  9046 1 1 65 LYS H    H  -5.155  -7.011  -8.216 1.00 . A A . 65 LYS H    1 1 
        7  9047 1 1 65 LYS HA   H  -5.714  -4.324  -7.578 1.00 . A A . 65 LYS HA   1 1 
        7  9048 1 1 65 LYS HB2  H  -5.481  -5.170  -5.140 1.00 . A A . 65 LYS HB2  1 1 
        7  9049 1 1 65 LYS HB3  H  -6.762  -5.811  -6.150 1.00 . A A . 65 LYS HB3  1 1 
        7  9050 1 1 65 LYS HD2  H  -3.464  -8.309  -5.173 1.00 . A A . 65 LYS HD2  1 1 
        7  9051 1 1 65 LYS HD3  H  -3.144  -6.832  -6.081 1.00 . A A . 65 LYS HD3  1 1 
        7  9052 1 1 65 LYS HE2  H  -3.712  -5.489  -4.129 1.00 . A A . 65 LYS HE2  1 1 
        7  9053 1 1 65 LYS HE3  H  -4.109  -6.950  -3.222 1.00 . A A . 65 LYS HE3  1 1 
        7  9054 1 1 65 LYS HG2  H  -5.814  -7.611  -4.904 1.00 . A A . 65 LYS HG2  1 1 
        7  9055 1 1 65 LYS HG3  H  -5.356  -7.811  -6.592 1.00 . A A . 65 LYS HG3  1 1 
        7  9056 1 1 65 LYS HZ1  H  -1.437  -6.355  -4.355 1.00 . A A . 65 LYS HZ1  1 1 
        7  9057 1 1 65 LYS HZ2  H  -1.851  -7.659  -3.367 1.00 . A A . 65 LYS HZ2  1 1 
        7  9058 1 1 65 LYS HZ3  H  -1.875  -6.089  -2.745 1.00 . A A . 65 LYS HZ3  1 1 
        7  9059 1 1 65 LYS N    N  -4.943  -6.065  -8.367 1.00 . A A . 65 LYS N    1 1 
        7  9060 1 1 65 LYS NZ   N  -2.063  -6.665  -3.587 1.00 . A A . 65 LYS NZ   1 1 
        7  9061 1 1 65 LYS O    O  -3.665  -3.403  -6.268 1.00 . A A . 65 LYS O    1 1 
        7  9062 1 1 66 CYS C    C  -0.964  -3.393  -7.983 1.00 . A A . 66 CYS C    1 1 
        7  9063 1 1 66 CYS CA   C  -1.261  -4.547  -7.024 1.00 . A A . 66 CYS CA   1 1 
        7  9064 1 1 66 CYS CB   C  -0.179  -5.631  -7.144 1.00 . A A . 66 CYS CB   1 1 
        7  9065 1 1 66 CYS H    H  -2.681  -5.959  -7.751 1.00 . A A . 66 CYS H    1 1 
        7  9066 1 1 66 CYS HA   H  -1.254  -4.163  -6.013 1.00 . A A . 66 CYS HA   1 1 
        7  9067 1 1 66 CYS HB2  H  -0.305  -6.154  -8.082 1.00 . A A . 66 CYS HB2  1 1 
        7  9068 1 1 66 CYS HB3  H   0.795  -5.164  -7.126 1.00 . A A . 66 CYS HB3  1 1 
        7  9069 1 1 66 CYS HG   H   1.025  -7.049  -5.398 1.00 . A A . 66 CYS HG   1 1 
        7  9070 1 1 66 CYS N    N  -2.598  -5.105  -7.275 1.00 . A A . 66 CYS N    1 1 
        7  9071 1 1 66 CYS O    O  -0.382  -2.383  -7.592 1.00 . A A . 66 CYS O    1 1 
        7  9072 1 1 66 CYS SG   S  -0.221  -6.865  -5.818 1.00 . A A . 66 CYS SG   1 1 
        7  9073 1 1 67 GLN C    C  -2.223  -1.325  -9.940 1.00 . A A . 67 GLN C    1 1 
        7  9074 1 1 67 GLN CA   C  -1.237  -2.467 -10.226 1.00 . A A . 67 GLN CA   1 1 
        7  9075 1 1 67 GLN CB   C  -1.444  -3.002 -11.650 1.00 . A A . 67 GLN CB   1 1 
        7  9076 1 1 67 GLN CD   C  -0.556  -4.460 -13.526 1.00 . A A . 67 GLN CD   1 1 
        7  9077 1 1 67 GLN CG   C  -0.401  -4.029 -12.077 1.00 . A A . 67 GLN CG   1 1 
        7  9078 1 1 67 GLN H    H  -1.790  -4.391  -9.511 1.00 . A A . 67 GLN H    1 1 
        7  9079 1 1 67 GLN HA   H  -0.230  -2.080 -10.143 1.00 . A A . 67 GLN HA   1 1 
        7  9080 1 1 67 GLN HB2  H  -2.420  -3.463 -11.711 1.00 . A A . 67 GLN HB2  1 1 
        7  9081 1 1 67 GLN HB3  H  -1.405  -2.173 -12.344 1.00 . A A . 67 GLN HB3  1 1 
        7  9082 1 1 67 GLN HE21 H  -1.751  -5.948 -12.995 1.00 . A A . 67 GLN HE21 1 1 
        7  9083 1 1 67 GLN HE22 H  -1.432  -5.800 -14.686 1.00 . A A . 67 GLN HE22 1 1 
        7  9084 1 1 67 GLN HG2  H   0.584  -3.600 -11.949 1.00 . A A . 67 GLN HG2  1 1 
        7  9085 1 1 67 GLN HG3  H  -0.494  -4.902 -11.445 1.00 . A A . 67 GLN HG3  1 1 
        7  9086 1 1 67 GLN N    N  -1.381  -3.541  -9.240 1.00 . A A . 67 GLN N    1 1 
        7  9087 1 1 67 GLN NE2  N  -1.326  -5.505 -13.758 1.00 . A A . 67 GLN NE2  1 1 
        7  9088 1 1 67 GLN O    O  -1.886  -0.150 -10.091 1.00 . A A . 67 GLN O    1 1 
        7  9089 1 1 67 GLN OE1  O   0.016  -3.859 -14.433 1.00 . A A . 67 GLN OE1  1 1 
        7  9090 1 1 68 GLU C    C  -3.934   0.161  -7.943 1.00 . A A . 68 GLU C    1 1 
        7  9091 1 1 68 GLU CA   C  -4.447  -0.680  -9.123 1.00 . A A . 68 GLU CA   1 1 
        7  9092 1 1 68 GLU CB   C  -5.761  -1.375  -8.732 1.00 . A A . 68 GLU CB   1 1 
        7  9093 1 1 68 GLU CD   C  -7.423   0.297  -9.692 1.00 . A A . 68 GLU CD   1 1 
        7  9094 1 1 68 GLU CG   C  -6.914  -0.413  -8.443 1.00 . A A . 68 GLU CG   1 1 
        7  9095 1 1 68 GLU H    H  -3.676  -2.631  -9.490 1.00 . A A . 68 GLU H    1 1 
        7  9096 1 1 68 GLU HA   H  -4.626  -0.031  -9.968 1.00 . A A . 68 GLU HA   1 1 
        7  9097 1 1 68 GLU HB2  H  -6.062  -2.030  -9.539 1.00 . A A . 68 GLU HB2  1 1 
        7  9098 1 1 68 GLU HB3  H  -5.589  -1.972  -7.848 1.00 . A A . 68 GLU HB3  1 1 
        7  9099 1 1 68 GLU HG2  H  -7.730  -0.972  -8.007 1.00 . A A . 68 GLU HG2  1 1 
        7  9100 1 1 68 GLU HG3  H  -6.575   0.332  -7.733 1.00 . A A . 68 GLU HG3  1 1 
        7  9101 1 1 68 GLU N    N  -3.443  -1.678  -9.522 1.00 . A A . 68 GLU N    1 1 
        7  9102 1 1 68 GLU O    O  -3.988   1.393  -7.966 1.00 . A A . 68 GLU O    1 1 
        7  9103 1 1 68 GLU OE1  O  -8.280  -0.278 -10.396 1.00 . A A . 68 GLU OE1  1 1 
        7  9104 1 1 68 GLU OE2  O  -6.969   1.429  -9.979 1.00 . A A . 68 GLU OE2  1 1 
        7  9105 1 1 69 PHE C    C  -1.575   0.941  -6.185 1.00 . A A . 69 PHE C    1 1 
        7  9106 1 1 69 PHE CA   C  -2.823   0.157  -5.761 1.00 . A A . 69 PHE CA   1 1 
        7  9107 1 1 69 PHE CB   C  -2.453  -0.857  -4.672 1.00 . A A . 69 PHE CB   1 1 
        7  9108 1 1 69 PHE CD1  C  -2.686   0.344  -2.471 1.00 . A A . 69 PHE CD1  1 1 
        7  9109 1 1 69 PHE CD2  C  -0.488  -0.192  -3.237 1.00 . A A . 69 PHE CD2  1 1 
        7  9110 1 1 69 PHE CE1  C  -2.149   0.929  -1.341 1.00 . A A . 69 PHE CE1  1 1 
        7  9111 1 1 69 PHE CE2  C   0.050   0.393  -2.107 1.00 . A A . 69 PHE CE2  1 1 
        7  9112 1 1 69 PHE CG   C  -1.863  -0.223  -3.435 1.00 . A A . 69 PHE CG   1 1 
        7  9113 1 1 69 PHE CZ   C  -0.781   0.953  -1.157 1.00 . A A . 69 PHE CZ   1 1 
        7  9114 1 1 69 PHE H    H  -3.493  -1.498  -6.911 1.00 . A A . 69 PHE H    1 1 
        7  9115 1 1 69 PHE HA   H  -3.551   0.850  -5.359 1.00 . A A . 69 PHE HA   1 1 
        7  9116 1 1 69 PHE HB2  H  -3.341  -1.400  -4.379 1.00 . A A . 69 PHE HB2  1 1 
        7  9117 1 1 69 PHE HB3  H  -1.729  -1.554  -5.070 1.00 . A A . 69 PHE HB3  1 1 
        7  9118 1 1 69 PHE HD1  H  -3.757   0.326  -2.611 1.00 . A A . 69 PHE HD1  1 1 
        7  9119 1 1 69 PHE HD2  H   0.166  -0.628  -3.980 1.00 . A A . 69 PHE HD2  1 1 
        7  9120 1 1 69 PHE HE1  H  -2.802   1.369  -0.599 1.00 . A A . 69 PHE HE1  1 1 
        7  9121 1 1 69 PHE HE2  H   1.122   0.411  -1.965 1.00 . A A . 69 PHE HE2  1 1 
        7  9122 1 1 69 PHE HZ   H  -0.361   1.410  -0.272 1.00 . A A . 69 PHE HZ   1 1 
        7  9123 1 1 69 PHE N    N  -3.437  -0.519  -6.908 1.00 . A A . 69 PHE N    1 1 
        7  9124 1 1 69 PHE O    O  -1.320   2.036  -5.685 1.00 . A A . 69 PHE O    1 1 
        7  9125 1 1 70 GLY C    C   0.029   2.390  -8.265 1.00 . A A . 70 GLY C    1 1 
        7  9126 1 1 70 GLY CA   C   0.376   1.049  -7.630 1.00 . A A . 70 GLY CA   1 1 
        7  9127 1 1 70 GLY H    H  -1.013  -0.537  -7.413 1.00 . A A . 70 GLY H    1 1 
        7  9128 1 1 70 GLY HA2  H   1.082   1.213  -6.827 1.00 . A A . 70 GLY HA2  1 1 
        7  9129 1 1 70 GLY HA3  H   0.840   0.420  -8.375 1.00 . A A . 70 GLY HA3  1 1 
        7  9130 1 1 70 GLY N    N  -0.796   0.366  -7.100 1.00 . A A . 70 GLY N    1 1 
        7  9131 1 1 70 GLY O    O   0.737   3.383  -8.076 1.00 . A A . 70 GLY O    1 1 
        7  9132 1 1 71 ARG C    C  -2.060   4.618  -8.512 1.00 . A A . 71 ARG C    1 1 
        7  9133 1 1 71 ARG CA   C  -1.581   3.652  -9.607 1.00 . A A . 71 ARG CA   1 1 
        7  9134 1 1 71 ARG CB   C  -2.741   3.352 -10.570 1.00 . A A . 71 ARG CB   1 1 
        7  9135 1 1 71 ARG CD   C  -4.560   4.312 -12.052 1.00 . A A . 71 ARG CD   1 1 
        7  9136 1 1 71 ARG CG   C  -3.288   4.597 -11.261 1.00 . A A . 71 ARG CG   1 1 
        7  9137 1 1 71 ARG CZ   C  -6.260   5.988 -12.619 1.00 . A A . 71 ARG CZ   1 1 
        7  9138 1 1 71 ARG H    H  -1.549   1.573  -9.187 1.00 . A A . 71 ARG H    1 1 
        7  9139 1 1 71 ARG HA   H  -0.775   4.119 -10.159 1.00 . A A . 71 ARG HA   1 1 
        7  9140 1 1 71 ARG HB2  H  -2.396   2.664 -11.330 1.00 . A A . 71 ARG HB2  1 1 
        7  9141 1 1 71 ARG HB3  H  -3.545   2.889 -10.016 1.00 . A A . 71 ARG HB3  1 1 
        7  9142 1 1 71 ARG HD2  H  -4.348   3.556 -12.795 1.00 . A A . 71 ARG HD2  1 1 
        7  9143 1 1 71 ARG HD3  H  -5.321   3.949 -11.375 1.00 . A A . 71 ARG HD3  1 1 
        7  9144 1 1 71 ARG HE   H  -4.418   5.995 -13.297 1.00 . A A . 71 ARG HE   1 1 
        7  9145 1 1 71 ARG HG2  H  -3.507   5.344 -10.512 1.00 . A A . 71 ARG HG2  1 1 
        7  9146 1 1 71 ARG HG3  H  -2.534   4.979 -11.937 1.00 . A A . 71 ARG HG3  1 1 
        7  9147 1 1 71 ARG HH11 H  -6.891   4.592 -11.352 1.00 . A A . 71 ARG HH11 1 1 
        7  9148 1 1 71 ARG HH12 H  -8.059   5.784 -11.801 1.00 . A A . 71 ARG HH12 1 1 
        7  9149 1 1 71 ARG HH21 H  -5.906   7.518 -13.833 1.00 . A A . 71 ARG HH21 1 1 
        7  9150 1 1 71 ARG HH22 H  -7.504   7.435 -13.175 1.00 . A A . 71 ARG HH22 1 1 
        7  9151 1 1 71 ARG N    N  -1.071   2.415  -9.018 1.00 . A A . 71 ARG N    1 1 
        7  9152 1 1 71 ARG NE   N  -5.049   5.516 -12.725 1.00 . A A . 71 ARG NE   1 1 
        7  9153 1 1 71 ARG NH1  N  -7.136   5.410 -11.864 1.00 . A A . 71 ARG NH1  1 1 
        7  9154 1 1 71 ARG NH2  N  -6.583   7.061 -13.258 1.00 . A A . 71 ARG NH2  1 1 
        7  9155 1 1 71 ARG O    O  -1.755   5.813  -8.545 1.00 . A A . 71 ARG O    1 1 
        7  9156 1 1 72 TRP C    C  -2.230   5.557  -5.630 1.00 . A A . 72 TRP C    1 1 
        7  9157 1 1 72 TRP CA   C  -3.345   4.889  -6.444 1.00 . A A . 72 TRP CA   1 1 
        7  9158 1 1 72 TRP CB   C  -4.220   4.035  -5.516 1.00 . A A . 72 TRP CB   1 1 
        7  9159 1 1 72 TRP CD1  C  -5.824   5.680  -4.382 1.00 . A A . 72 TRP CD1  1 1 
        7  9160 1 1 72 TRP CD2  C  -4.298   4.799  -3.001 1.00 . A A . 72 TRP CD2  1 1 
        7  9161 1 1 72 TRP CE2  C  -5.112   5.682  -2.268 1.00 . A A . 72 TRP CE2  1 1 
        7  9162 1 1 72 TRP CE3  C  -3.265   4.129  -2.339 1.00 . A A . 72 TRP CE3  1 1 
        7  9163 1 1 72 TRP CG   C  -4.773   4.811  -4.355 1.00 . A A . 72 TRP CG   1 1 
        7  9164 1 1 72 TRP CH2  C  -3.906   5.244  -0.286 1.00 . A A . 72 TRP CH2  1 1 
        7  9165 1 1 72 TRP CZ2  C  -4.925   5.913  -0.908 1.00 . A A . 72 TRP CZ2  1 1 
        7  9166 1 1 72 TRP CZ3  C  -3.080   4.360  -0.987 1.00 . A A . 72 TRP CZ3  1 1 
        7  9167 1 1 72 TRP H    H  -3.008   3.123  -7.573 1.00 . A A . 72 TRP H    1 1 
        7  9168 1 1 72 TRP HA   H  -3.962   5.666  -6.882 1.00 . A A . 72 TRP HA   1 1 
        7  9169 1 1 72 TRP HB2  H  -5.051   3.636  -6.081 1.00 . A A . 72 TRP HB2  1 1 
        7  9170 1 1 72 TRP HB3  H  -3.631   3.217  -5.125 1.00 . A A . 72 TRP HB3  1 1 
        7  9171 1 1 72 TRP HD1  H  -6.402   5.909  -5.266 1.00 . A A . 72 TRP HD1  1 1 
        7  9172 1 1 72 TRP HE1  H  -6.736   6.848  -2.896 1.00 . A A . 72 TRP HE1  1 1 
        7  9173 1 1 72 TRP HE3  H  -2.617   3.442  -2.864 1.00 . A A . 72 TRP HE3  1 1 
        7  9174 1 1 72 TRP HH2  H  -3.722   5.397   0.769 1.00 . A A . 72 TRP HH2  1 1 
        7  9175 1 1 72 TRP HZ2  H  -5.557   6.592  -0.354 1.00 . A A . 72 TRP HZ2  1 1 
        7  9176 1 1 72 TRP HZ3  H  -2.285   3.856  -0.460 1.00 . A A . 72 TRP HZ3  1 1 
        7  9177 1 1 72 TRP N    N  -2.807   4.084  -7.544 1.00 . A A . 72 TRP N    1 1 
        7  9178 1 1 72 TRP NE1  N  -6.036   6.202  -3.133 1.00 . A A . 72 TRP NE1  1 1 
        7  9179 1 1 72 TRP O    O  -2.168   6.779  -5.552 1.00 . A A . 72 TRP O    1 1 
        7  9180 1 1 73 TYR C    C   0.636   6.237  -4.972 1.00 . A A . 73 TYR C    1 1 
        7  9181 1 1 73 TYR CA   C  -0.271   5.275  -4.183 1.00 . A A . 73 TYR CA   1 1 
        7  9182 1 1 73 TYR CB   C   0.552   4.127  -3.575 1.00 . A A . 73 TYR CB   1 1 
        7  9183 1 1 73 TYR CD1  C   0.619   4.437  -1.064 1.00 . A A . 73 TYR CD1  1 1 
        7  9184 1 1 73 TYR CD2  C   2.590   4.962  -2.302 1.00 . A A . 73 TYR CD2  1 1 
        7  9185 1 1 73 TYR CE1  C   1.257   4.794   0.110 1.00 . A A . 73 TYR CE1  1 1 
        7  9186 1 1 73 TYR CE2  C   3.232   5.322  -1.131 1.00 . A A . 73 TYR CE2  1 1 
        7  9187 1 1 73 TYR CG   C   1.271   4.513  -2.291 1.00 . A A . 73 TYR CG   1 1 
        7  9188 1 1 73 TYR CZ   C   2.562   5.237   0.073 1.00 . A A . 73 TYR CZ   1 1 
        7  9189 1 1 73 TYR H    H  -1.419   3.782  -5.173 1.00 . A A . 73 TYR H    1 1 
        7  9190 1 1 73 TYR HA   H  -0.741   5.829  -3.382 1.00 . A A . 73 TYR HA   1 1 
        7  9191 1 1 73 TYR HB2  H  -0.106   3.298  -3.351 1.00 . A A . 73 TYR HB2  1 1 
        7  9192 1 1 73 TYR HB3  H   1.296   3.802  -4.290 1.00 . A A . 73 TYR HB3  1 1 
        7  9193 1 1 73 TYR HD1  H  -0.403   4.091  -1.034 1.00 . A A . 73 TYR HD1  1 1 
        7  9194 1 1 73 TYR HD2  H   3.114   5.031  -3.243 1.00 . A A . 73 TYR HD2  1 1 
        7  9195 1 1 73 TYR HE1  H   0.730   4.727   1.053 1.00 . A A . 73 TYR HE1  1 1 
        7  9196 1 1 73 TYR HE2  H   4.254   5.667  -1.161 1.00 . A A . 73 TYR HE2  1 1 
        7  9197 1 1 73 TYR HH   H   3.564   6.483   1.148 1.00 . A A . 73 TYR HH   1 1 
        7  9198 1 1 73 TYR N    N  -1.345   4.750  -5.038 1.00 . A A . 73 TYR N    1 1 
        7  9199 1 1 73 TYR O    O   1.160   7.208  -4.420 1.00 . A A . 73 TYR O    1 1 
        7  9200 1 1 73 TYR OH   O   3.198   5.597   1.242 1.00 . A A . 73 TYR OH   1 1 
        7  9201 1 1 74 LYS C    C   0.799   8.250  -7.207 1.00 . A A . 74 LYS C    1 1 
        7  9202 1 1 74 LYS CA   C   1.513   6.889  -7.164 1.00 . A A . 74 LYS CA   1 1 
        7  9203 1 1 74 LYS CB   C   1.604   6.310  -8.584 1.00 . A A . 74 LYS CB   1 1 
        7  9204 1 1 74 LYS CD   C   2.250   6.682 -11.009 1.00 . A A . 74 LYS CD   1 1 
        7  9205 1 1 74 LYS CE   C   3.017   5.367 -11.133 1.00 . A A . 74 LYS CE   1 1 
        7  9206 1 1 74 LYS CG   C   2.286   7.241  -9.588 1.00 . A A . 74 LYS CG   1 1 
        7  9207 1 1 74 LYS H    H   0.454   5.124  -6.631 1.00 . A A . 74 LYS H    1 1 
        7  9208 1 1 74 LYS HA   H   2.513   7.030  -6.774 1.00 . A A . 74 LYS HA   1 1 
        7  9209 1 1 74 LYS HB2  H   2.161   5.382  -8.546 1.00 . A A . 74 LYS HB2  1 1 
        7  9210 1 1 74 LYS HB3  H   0.604   6.102  -8.937 1.00 . A A . 74 LYS HB3  1 1 
        7  9211 1 1 74 LYS HD2  H   1.221   6.513 -11.291 1.00 . A A . 74 LYS HD2  1 1 
        7  9212 1 1 74 LYS HD3  H   2.690   7.408 -11.678 1.00 . A A . 74 LYS HD3  1 1 
        7  9213 1 1 74 LYS HE2  H   4.044   5.530 -10.841 1.00 . A A . 74 LYS HE2  1 1 
        7  9214 1 1 74 LYS HE3  H   2.568   4.638 -10.471 1.00 . A A . 74 LYS HE3  1 1 
        7  9215 1 1 74 LYS HG2  H   1.779   8.195  -9.580 1.00 . A A . 74 LYS HG2  1 1 
        7  9216 1 1 74 LYS HG3  H   3.317   7.381  -9.291 1.00 . A A . 74 LYS HG3  1 1 
        7  9217 1 1 74 LYS HZ1  H   3.390   5.540 -13.180 1.00 . A A . 74 LYS HZ1  1 1 
        7  9218 1 1 74 LYS HZ2  H   2.012   4.631 -12.809 1.00 . A A . 74 LYS HZ2  1 1 
        7  9219 1 1 74 LYS HZ3  H   3.551   3.965 -12.586 1.00 . A A . 74 LYS HZ3  1 1 
        7  9220 1 1 74 LYS N    N   0.806   5.967  -6.270 1.00 . A A . 74 LYS N    1 1 
        7  9221 1 1 74 LYS NZ   N   2.991   4.838 -12.523 1.00 . A A . 74 LYS NZ   1 1 
        7  9222 1 1 74 LYS O    O   1.412   9.289  -6.992 1.00 . A A . 74 LYS O    1 1 
        7  9223 1 1 75 HIS C    C  -1.462  10.104  -6.145 1.00 . A A . 75 HIS C    1 1 
        7  9224 1 1 75 HIS CA   C  -1.328   9.443  -7.531 1.00 . A A . 75 HIS CA   1 1 
        7  9225 1 1 75 HIS CB   C  -2.719   9.108  -8.095 1.00 . A A . 75 HIS CB   1 1 
        7  9226 1 1 75 HIS CD2  C  -3.614  11.390  -8.960 1.00 . A A . 75 HIS CD2  1 1 
        7  9227 1 1 75 HIS CE1  C  -5.388  11.539  -7.690 1.00 . A A . 75 HIS CE1  1 1 
        7  9228 1 1 75 HIS CG   C  -3.644  10.287  -8.175 1.00 . A A . 75 HIS CG   1 1 
        7  9229 1 1 75 HIS H    H  -0.940   7.355  -7.630 1.00 . A A . 75 HIS H    1 1 
        7  9230 1 1 75 HIS HA   H  -0.839  10.137  -8.200 1.00 . A A . 75 HIS HA   1 1 
        7  9231 1 1 75 HIS HB2  H  -2.607   8.709  -9.093 1.00 . A A . 75 HIS HB2  1 1 
        7  9232 1 1 75 HIS HB3  H  -3.183   8.360  -7.468 1.00 . A A . 75 HIS HB3  1 1 
        7  9233 1 1 75 HIS HD1  H  -5.071   9.779  -6.707 1.00 . A A . 75 HIS HD1  1 1 
        7  9234 1 1 75 HIS HD2  H  -2.863  11.630  -9.700 1.00 . A A . 75 HIS HD2  1 1 
        7  9235 1 1 75 HIS HE1  H  -6.298  11.900  -7.234 1.00 . A A . 75 HIS HE1  1 1 
        7  9236 1 1 75 HIS HE2  H  -4.818  13.102  -8.867 1.00 . A A . 75 HIS HE2  1 1 
        7  9237 1 1 75 HIS N    N  -0.509   8.224  -7.471 1.00 . A A . 75 HIS N    1 1 
        7  9238 1 1 75 HIS ND1  N  -4.770  10.416  -7.391 1.00 . A A . 75 HIS ND1  1 1 
        7  9239 1 1 75 HIS NE2  N  -4.709  12.151  -8.637 1.00 . A A . 75 HIS NE2  1 1 
        7  9240 1 1 75 HIS O    O  -1.571  11.325  -6.034 1.00 . A A . 75 HIS O    1 1 
        7  9241 1 1 76 PHE C    C  -0.448  10.703  -3.328 1.00 . A A . 76 PHE C    1 1 
        7  9242 1 1 76 PHE CA   C  -1.584   9.741  -3.717 1.00 . A A . 76 PHE CA   1 1 
        7  9243 1 1 76 PHE CB   C  -1.604   8.517  -2.784 1.00 . A A . 76 PHE CB   1 1 
        7  9244 1 1 76 PHE CD1  C  -3.092   9.153  -0.858 1.00 . A A . 76 PHE CD1  1 1 
        7  9245 1 1 76 PHE CD2  C  -0.769   8.819  -0.426 1.00 . A A . 76 PHE CD2  1 1 
        7  9246 1 1 76 PHE CE1  C  -3.300   9.439   0.475 1.00 . A A . 76 PHE CE1  1 1 
        7  9247 1 1 76 PHE CE2  C  -0.974   9.107   0.908 1.00 . A A . 76 PHE CE2  1 1 
        7  9248 1 1 76 PHE CG   C  -1.825   8.840  -1.328 1.00 . A A . 76 PHE CG   1 1 
        7  9249 1 1 76 PHE CZ   C  -2.241   9.416   1.359 1.00 . A A . 76 PHE CZ   1 1 
        7  9250 1 1 76 PHE H    H  -1.325   8.323  -5.268 1.00 . A A . 76 PHE H    1 1 
        7  9251 1 1 76 PHE HA   H  -2.530  10.261  -3.636 1.00 . A A . 76 PHE HA   1 1 
        7  9252 1 1 76 PHE HB2  H  -2.397   7.852  -3.095 1.00 . A A . 76 PHE HB2  1 1 
        7  9253 1 1 76 PHE HB3  H  -0.659   7.996  -2.869 1.00 . A A . 76 PHE HB3  1 1 
        7  9254 1 1 76 PHE HD1  H  -3.924   9.173  -1.546 1.00 . A A . 76 PHE HD1  1 1 
        7  9255 1 1 76 PHE HD2  H   0.224   8.575  -0.777 1.00 . A A . 76 PHE HD2  1 1 
        7  9256 1 1 76 PHE HE1  H  -4.294   9.683   0.827 1.00 . A A . 76 PHE HE1  1 1 
        7  9257 1 1 76 PHE HE2  H  -0.145   9.088   1.601 1.00 . A A . 76 PHE HE2  1 1 
        7  9258 1 1 76 PHE HZ   H  -2.404   9.640   2.404 1.00 . A A . 76 PHE HZ   1 1 
        7  9259 1 1 76 PHE N    N  -1.442   9.280  -5.102 1.00 . A A . 76 PHE N    1 1 
        7  9260 1 1 76 PHE O    O  -0.687  11.780  -2.776 1.00 . A A . 76 PHE O    1 1 
        7  9261 1 1 77 LYS C    C   2.287  12.009  -4.612 1.00 . A A . 77 LYS C    1 1 
        7  9262 1 1 77 LYS CA   C   1.968  11.145  -3.382 1.00 . A A . 77 LYS CA   1 1 
        7  9263 1 1 77 LYS CB   C   3.190  10.274  -3.036 1.00 . A A . 77 LYS CB   1 1 
        7  9264 1 1 77 LYS CD   C   4.256   8.605  -1.439 1.00 . A A . 77 LYS CD   1 1 
        7  9265 1 1 77 LYS CE   C   5.607   9.327  -1.443 1.00 . A A . 77 LYS CE   1 1 
        7  9266 1 1 77 LYS CG   C   3.071   9.542  -1.704 1.00 . A A . 77 LYS CG   1 1 
        7  9267 1 1 77 LYS H    H   0.915   9.392  -3.979 1.00 . A A . 77 LYS H    1 1 
        7  9268 1 1 77 LYS HA   H   1.754  11.795  -2.546 1.00 . A A . 77 LYS HA   1 1 
        7  9269 1 1 77 LYS HB2  H   3.324   9.536  -3.816 1.00 . A A . 77 LYS HB2  1 1 
        7  9270 1 1 77 LYS HB3  H   4.070  10.903  -2.999 1.00 . A A . 77 LYS HB3  1 1 
        7  9271 1 1 77 LYS HD2  H   4.116   8.138  -0.474 1.00 . A A . 77 LYS HD2  1 1 
        7  9272 1 1 77 LYS HD3  H   4.265   7.838  -2.203 1.00 . A A . 77 LYS HD3  1 1 
        7  9273 1 1 77 LYS HE2  H   5.469  10.330  -1.068 1.00 . A A . 77 LYS HE2  1 1 
        7  9274 1 1 77 LYS HE3  H   6.286   8.796  -0.790 1.00 . A A . 77 LYS HE3  1 1 
        7  9275 1 1 77 LYS HG2  H   3.022  10.272  -0.911 1.00 . A A . 77 LYS HG2  1 1 
        7  9276 1 1 77 LYS HG3  H   2.159   8.959  -1.709 1.00 . A A . 77 LYS HG3  1 1 
        7  9277 1 1 77 LYS HZ1  H   7.126   9.887  -2.764 1.00 . A A . 77 LYS HZ1  1 1 
        7  9278 1 1 77 LYS HZ2  H   5.585   9.914  -3.454 1.00 . A A . 77 LYS HZ2  1 1 
        7  9279 1 1 77 LYS HZ3  H   6.360   8.439  -3.181 1.00 . A A . 77 LYS HZ3  1 1 
        7  9280 1 1 77 LYS N    N   0.789  10.296  -3.613 1.00 . A A . 77 LYS N    1 1 
        7  9281 1 1 77 LYS NZ   N   6.209   9.398  -2.806 1.00 . A A . 77 LYS NZ   1 1 
        7  9282 1 1 77 LYS O    O   2.909  13.067  -4.495 1.00 . A A . 77 LYS O    1 1 
        7  9283 1 1 78 LYS C    C   3.716  11.969  -7.352 1.00 . A A . 78 LYS C    1 1 
        7  9284 1 1 78 LYS CA   C   2.210  12.124  -7.080 1.00 . A A . 78 LYS CA   1 1 
        7  9285 1 1 78 LYS CB   C   1.781  13.596  -7.206 1.00 . A A . 78 LYS CB   1 1 
        7  9286 1 1 78 LYS CD   C  -0.163  15.043  -7.952 1.00 . A A . 78 LYS CD   1 1 
        7  9287 1 1 78 LYS CE   C   0.127  14.878  -9.442 1.00 . A A . 78 LYS CE   1 1 
        7  9288 1 1 78 LYS CG   C   0.264  13.808  -7.163 1.00 . A A . 78 LYS CG   1 1 
        7  9289 1 1 78 LYS H    H   1.235  10.778  -5.771 1.00 . A A . 78 LYS H    1 1 
        7  9290 1 1 78 LYS HA   H   1.680  11.553  -7.832 1.00 . A A . 78 LYS HA   1 1 
        7  9291 1 1 78 LYS HB2  H   2.223  14.155  -6.394 1.00 . A A . 78 LYS HB2  1 1 
        7  9292 1 1 78 LYS HB3  H   2.154  13.988  -8.142 1.00 . A A . 78 LYS HB3  1 1 
        7  9293 1 1 78 LYS HD2  H  -1.225  15.196  -7.815 1.00 . A A . 78 LYS HD2  1 1 
        7  9294 1 1 78 LYS HD3  H   0.377  15.903  -7.579 1.00 . A A . 78 LYS HD3  1 1 
        7  9295 1 1 78 LYS HE2  H   1.181  14.681  -9.572 1.00 . A A . 78 LYS HE2  1 1 
        7  9296 1 1 78 LYS HE3  H  -0.442  14.039  -9.816 1.00 . A A . 78 LYS HE3  1 1 
        7  9297 1 1 78 LYS HG2  H  -0.224  12.940  -7.585 1.00 . A A . 78 LYS HG2  1 1 
        7  9298 1 1 78 LYS HG3  H  -0.044  13.926  -6.133 1.00 . A A . 78 LYS HG3  1 1 
        7  9299 1 1 78 LYS HZ1  H  -0.004  15.942 -11.229 1.00 . A A . 78 LYS HZ1  1 1 
        7  9300 1 1 78 LYS HZ2  H   0.299  16.912  -9.880 1.00 . A A . 78 LYS HZ2  1 1 
        7  9301 1 1 78 LYS HZ3  H  -1.250  16.285 -10.144 1.00 . A A . 78 LYS HZ3  1 1 
        7  9302 1 1 78 LYS N    N   1.842  11.545  -5.779 1.00 . A A . 78 LYS N    1 1 
        7  9303 1 1 78 LYS NZ   N  -0.232  16.088 -10.226 1.00 . A A . 78 LYS NZ   1 1 
        7  9304 1 1 78 LYS O    O   4.111  11.246  -8.269 1.00 . A A . 78 LYS O    1 1 
        7  9305 1 1 79 THR C    C   6.500  13.267  -7.934 1.00 . A A . 79 THR C    1 1 
        7  9306 1 1 79 THR CA   C   6.011  12.554  -6.664 1.00 . A A . 79 THR CA   1 1 
        7  9307 1 1 79 THR CB   C   6.513  11.081  -6.661 1.00 . A A . 79 THR CB   1 1 
        7  9308 1 1 79 THR CG2  C   8.036  11.007  -6.578 1.00 . A A . 79 THR CG2  1 1 
        7  9309 1 1 79 THR H    H   4.163  13.218  -5.856 1.00 . A A . 79 THR H    1 1 
        7  9310 1 1 79 THR HA   H   6.434  13.055  -5.803 1.00 . A A . 79 THR HA   1 1 
        7  9311 1 1 79 THR HB   H   6.195  10.611  -7.584 1.00 . A A . 79 THR HB   1 1 
        7  9312 1 1 79 THR HG1  H   5.037  10.094  -5.799 1.00 . A A . 79 THR HG1  1 1 
        7  9313 1 1 79 THR HG21 H   8.469  11.497  -7.438 1.00 . A A . 79 THR HG21 1 1 
        7  9314 1 1 79 THR HG22 H   8.347   9.972  -6.560 1.00 . A A . 79 THR HG22 1 1 
        7  9315 1 1 79 THR HG23 H   8.374  11.497  -5.676 1.00 . A A . 79 THR HG23 1 1 
        7  9316 1 1 79 THR N    N   4.546  12.637  -6.547 1.00 . A A . 79 THR N    1 1 
        7  9317 1 1 79 THR O    O   7.156  14.308  -7.861 1.00 . A A . 79 THR O    1 1 
        7  9318 1 1 79 THR OG1  O   5.932  10.357  -5.558 1.00 . A A . 79 THR OG1  1 1 
        7  9319 1 1 80 LYS C    C   5.313  13.099 -11.382 1.00 . A A . 80 LYS C    1 1 
        7  9320 1 1 80 LYS CA   C   6.458  13.335 -10.387 1.00 . A A . 80 LYS CA   1 1 
        7  9321 1 1 80 LYS CB   C   7.773  12.814 -10.990 1.00 . A A . 80 LYS CB   1 1 
        7  9322 1 1 80 LYS CD   C  10.287  12.980 -11.090 1.00 . A A . 80 LYS CD   1 1 
        7  9323 1 1 80 LYS CE   C  11.538  13.583 -10.470 1.00 . A A . 80 LYS CE   1 1 
        7  9324 1 1 80 LYS CG   C   9.031  13.327 -10.295 1.00 . A A . 80 LYS CG   1 1 
        7  9325 1 1 80 LYS H    H   5.718  11.833  -9.088 1.00 . A A . 80 LYS H    1 1 
        7  9326 1 1 80 LYS HA   H   6.550  14.400 -10.219 1.00 . A A . 80 LYS HA   1 1 
        7  9327 1 1 80 LYS HB2  H   7.775  11.734 -10.935 1.00 . A A . 80 LYS HB2  1 1 
        7  9328 1 1 80 LYS HB3  H   7.819  13.109 -12.030 1.00 . A A . 80 LYS HB3  1 1 
        7  9329 1 1 80 LYS HD2  H  10.398  11.906 -11.119 1.00 . A A . 80 LYS HD2  1 1 
        7  9330 1 1 80 LYS HD3  H  10.179  13.358 -12.099 1.00 . A A . 80 LYS HD3  1 1 
        7  9331 1 1 80 LYS HE2  H  11.391  14.647 -10.351 1.00 . A A . 80 LYS HE2  1 1 
        7  9332 1 1 80 LYS HE3  H  11.698  13.133  -9.500 1.00 . A A . 80 LYS HE3  1 1 
        7  9333 1 1 80 LYS HG2  H   8.963  14.402 -10.195 1.00 . A A . 80 LYS HG2  1 1 
        7  9334 1 1 80 LYS HG3  H   9.099  12.878  -9.313 1.00 . A A . 80 LYS HG3  1 1 
        7  9335 1 1 80 LYS HZ1  H  13.582  13.767 -10.858 1.00 . A A . 80 LYS HZ1  1 1 
        7  9336 1 1 80 LYS HZ2  H  12.618  13.799 -12.247 1.00 . A A . 80 LYS HZ2  1 1 
        7  9337 1 1 80 LYS HZ3  H  12.899  12.336 -11.451 1.00 . A A . 80 LYS HZ3  1 1 
        7  9338 1 1 80 LYS N    N   6.173  12.702  -9.096 1.00 . A A . 80 LYS N    1 1 
        7  9339 1 1 80 LYS NZ   N  12.741  13.355 -11.314 1.00 . A A . 80 LYS NZ   1 1 
        7  9340 1 1 80 LYS O    O   5.136  11.988 -11.889 1.00 . A A . 80 LYS O    1 1 
        7  9341 1 1 81 ASP C    C   4.157  13.736 -14.027 1.00 . A A . 81 ASP C    1 1 
        7  9342 1 1 81 ASP CA   C   3.498  14.092 -12.684 1.00 . A A . 81 ASP CA   1 1 
        7  9343 1 1 81 ASP CB   C   2.773  15.446 -12.773 1.00 . A A . 81 ASP CB   1 1 
        7  9344 1 1 81 ASP CG   C   1.457  15.365 -13.533 1.00 . A A . 81 ASP CG   1 1 
        7  9345 1 1 81 ASP H    H   4.619  14.958 -11.105 1.00 . A A . 81 ASP H    1 1 
        7  9346 1 1 81 ASP HA   H   2.788  13.319 -12.421 1.00 . A A . 81 ASP HA   1 1 
        7  9347 1 1 81 ASP HB2  H   2.568  15.802 -11.774 1.00 . A A . 81 ASP HB2  1 1 
        7  9348 1 1 81 ASP HB3  H   3.415  16.157 -13.274 1.00 . A A . 81 ASP HB3  1 1 
        7  9349 1 1 81 ASP N    N   4.523  14.144 -11.640 1.00 . A A . 81 ASP N    1 1 
        7  9350 1 1 81 ASP O    O   3.682  12.877 -14.770 1.00 . A A . 81 ASP O    1 1 
        7  9351 1 1 81 ASP OD1  O   1.475  15.372 -14.781 1.00 . A A . 81 ASP OD1  1 1 
        7  9352 1 1 81 ASP OD2  O   0.391  15.301 -12.881 1.00 . A A . 81 ASP OD2  1 1 
        7  9353 1 1 82 MET C    C   7.590  14.100 -15.091 1.00 . A A . 82 MET C    1 1 
        7  9354 1 1 82 MET CA   C   6.100  14.098 -15.483 1.00 . A A . 82 MET CA   1 1 
        7  9355 1 1 82 MET CB   C   5.848  15.117 -16.603 1.00 . A A . 82 MET CB   1 1 
        7  9356 1 1 82 MET CE   C   5.398  15.859 -19.628 1.00 . A A . 82 MET CE   1 1 
        7  9357 1 1 82 MET CG   C   4.423  15.103 -17.144 1.00 . A A . 82 MET CG   1 1 
        7  9358 1 1 82 MET H    H   5.545  15.137 -13.724 1.00 . A A . 82 MET H    1 1 
        7  9359 1 1 82 MET HA   H   5.835  13.110 -15.836 1.00 . A A . 82 MET HA   1 1 
        7  9360 1 1 82 MET HB2  H   6.055  16.109 -16.225 1.00 . A A . 82 MET HB2  1 1 
        7  9361 1 1 82 MET HB3  H   6.521  14.909 -17.422 1.00 . A A . 82 MET HB3  1 1 
        7  9362 1 1 82 MET HE1  H   5.226  14.840 -19.938 1.00 . A A . 82 MET HE1  1 1 
        7  9363 1 1 82 MET HE2  H   6.377  15.939 -19.181 1.00 . A A . 82 MET HE2  1 1 
        7  9364 1 1 82 MET HE3  H   5.342  16.514 -20.486 1.00 . A A . 82 MET HE3  1 1 
        7  9365 1 1 82 MET HG2  H   4.217  14.127 -17.558 1.00 . A A . 82 MET HG2  1 1 
        7  9366 1 1 82 MET HG3  H   3.739  15.296 -16.328 1.00 . A A . 82 MET HG3  1 1 
        7  9367 1 1 82 MET N    N   5.269  14.406 -14.317 1.00 . A A . 82 MET N    1 1 
        7  9368 1 1 82 MET O    O   7.934  14.366 -13.939 1.00 . A A . 82 MET O    1 1 
        7  9369 1 1 82 MET SD   S   4.152  16.339 -18.431 1.00 . A A . 82 MET SD   1 1 
        7  9370 1 1 83 MET C    C  10.554  15.162 -16.183 1.00 . A A . 83 MET C    1 1 
        7  9371 1 1 83 MET CA   C   9.923  13.813 -15.793 1.00 . A A . 83 MET CA   1 1 
        7  9372 1 1 83 MET CB   C  10.599  12.666 -16.560 1.00 . A A . 83 MET CB   1 1 
        7  9373 1 1 83 MET CE   C  10.238   8.517 -16.220 1.00 . A A . 83 MET CE   1 1 
        7  9374 1 1 83 MET CG   C  10.147  11.286 -16.107 1.00 . A A . 83 MET CG   1 1 
        7  9375 1 1 83 MET H    H   8.145  13.600 -16.948 1.00 . A A . 83 MET H    1 1 
        7  9376 1 1 83 MET HA   H  10.072  13.654 -14.731 1.00 . A A . 83 MET HA   1 1 
        7  9377 1 1 83 MET HB2  H  10.375  12.766 -17.614 1.00 . A A . 83 MET HB2  1 1 
        7  9378 1 1 83 MET HB3  H  11.670  12.733 -16.421 1.00 . A A . 83 MET HB3  1 1 
        7  9379 1 1 83 MET HE1  H   9.169   8.521 -16.378 1.00 . A A . 83 MET HE1  1 1 
        7  9380 1 1 83 MET HE2  H  10.445   8.541 -15.160 1.00 . A A . 83 MET HE2  1 1 
        7  9381 1 1 83 MET HE3  H  10.660   7.620 -16.649 1.00 . A A . 83 MET HE3  1 1 
        7  9382 1 1 83 MET HG2  H  10.364  11.177 -15.054 1.00 . A A . 83 MET HG2  1 1 
        7  9383 1 1 83 MET HG3  H   9.080  11.203 -16.263 1.00 . A A . 83 MET HG3  1 1 
        7  9384 1 1 83 MET N    N   8.470  13.810 -16.046 1.00 . A A . 83 MET N    1 1 
        7  9385 1 1 83 MET O    O  10.991  15.912 -15.280 1.00 . A A . 83 MET O    1 1 
        7  9386 1 1 83 MET OXT  O  10.590  15.475 -17.395 1.00 . A A . 83 MET OXT  1 1 
        7  9387 1 1 83 MET SD   S  10.966   9.953 -17.006 1.00 . A A . 83 MET SD   1 1 
        8  9388 1 1  1 MET C    C  18.607  -4.588   8.353 1.00 . A A .  1 MET C    1 1 
        8  9389 1 1  1 MET CA   C  18.172  -3.155   8.010 1.00 . A A .  1 MET CA   1 1 
        8  9390 1 1  1 MET CB   C  19.382  -2.335   7.539 1.00 . A A .  1 MET CB   1 1 
        8  9391 1 1  1 MET CE   C  20.760  -0.346   5.476 1.00 . A A .  1 MET CE   1 1 
        8  9392 1 1  1 MET CG   C  20.085  -2.910   6.317 1.00 . A A .  1 MET CG   1 1 
        8  9393 1 1  1 MET H1   H  17.258  -1.523   8.943 1.00 . A A .  1 MET H1   1 1 
        8  9394 1 1  1 MET H2   H  18.214  -2.456   9.980 1.00 . A A .  1 MET H2   1 1 
        8  9395 1 1  1 MET H3   H  16.697  -3.025   9.490 1.00 . A A .  1 MET H3   1 1 
        8  9396 1 1  1 MET HA   H  17.441  -3.194   7.214 1.00 . A A .  1 MET HA   1 1 
        8  9397 1 1  1 MET HB2  H  19.052  -1.334   7.299 1.00 . A A .  1 MET HB2  1 1 
        8  9398 1 1  1 MET HB3  H  20.099  -2.281   8.347 1.00 . A A .  1 MET HB3  1 1 
        8  9399 1 1  1 MET HE1  H  20.260   0.013   6.363 1.00 . A A .  1 MET HE1  1 1 
        8  9400 1 1  1 MET HE2  H  20.040  -0.455   4.677 1.00 . A A .  1 MET HE2  1 1 
        8  9401 1 1  1 MET HE3  H  21.522   0.360   5.180 1.00 . A A .  1 MET HE3  1 1 
        8  9402 1 1  1 MET HG2  H  20.416  -3.913   6.547 1.00 . A A .  1 MET HG2  1 1 
        8  9403 1 1  1 MET HG3  H  19.383  -2.945   5.495 1.00 . A A .  1 MET HG3  1 1 
        8  9404 1 1  1 MET N    N  17.540  -2.495   9.185 1.00 . A A .  1 MET N    1 1 
        8  9405 1 1  1 MET O    O  19.585  -4.790   9.073 1.00 . A A .  1 MET O    1 1 
        8  9406 1 1  1 MET SD   S  21.519  -1.935   5.816 1.00 . A A .  1 MET SD   1 1 
        8  9407 1 1  2 GLY C    C  18.447  -7.851   6.932 1.00 . A A .  2 GLY C    1 1 
        8  9408 1 1  2 GLY CA   C  18.176  -6.975   8.154 1.00 . A A .  2 GLY CA   1 1 
        8  9409 1 1  2 GLY H    H  17.166  -5.365   7.199 1.00 . A A .  2 GLY H    1 1 
        8  9410 1 1  2 GLY HA2  H  19.040  -7.013   8.805 1.00 . A A .  2 GLY HA2  1 1 
        8  9411 1 1  2 GLY HA3  H  17.329  -7.380   8.687 1.00 . A A .  2 GLY HA3  1 1 
        8  9412 1 1  2 GLY N    N  17.890  -5.579   7.825 1.00 . A A .  2 GLY N    1 1 
        8  9413 1 1  2 GLY O    O  19.510  -8.463   6.817 1.00 . A A .  2 GLY O    1 1 
        8  9414 1 1  3 HIS C    C  18.578  -8.236   3.785 1.00 . A A .  3 HIS C    1 1 
        8  9415 1 1  3 HIS CA   C  17.604  -8.799   4.841 1.00 . A A .  3 HIS CA   1 1 
        8  9416 1 1  3 HIS CB   C  16.218  -9.084   4.216 1.00 . A A .  3 HIS CB   1 1 
        8  9417 1 1  3 HIS CD2  C  15.643  -6.701   3.298 1.00 . A A .  3 HIS CD2  1 1 
        8  9418 1 1  3 HIS CE1  C  13.550  -6.619   3.929 1.00 . A A .  3 HIS CE1  1 1 
        8  9419 1 1  3 HIS CG   C  15.369  -7.867   3.940 1.00 . A A .  3 HIS CG   1 1 
        8  9420 1 1  3 HIS H    H  16.674  -7.382   6.132 1.00 . A A .  3 HIS H    1 1 
        8  9421 1 1  3 HIS HA   H  18.012  -9.737   5.190 1.00 . A A .  3 HIS HA   1 1 
        8  9422 1 1  3 HIS HB2  H  16.357  -9.601   3.278 1.00 . A A .  3 HIS HB2  1 1 
        8  9423 1 1  3 HIS HB3  H  15.664  -9.726   4.886 1.00 . A A .  3 HIS HB3  1 1 
        8  9424 1 1  3 HIS HD1  H  13.541  -8.463   4.813 1.00 . A A .  3 HIS HD1  1 1 
        8  9425 1 1  3 HIS HD2  H  16.590  -6.416   2.862 1.00 . A A .  3 HIS HD2  1 1 
        8  9426 1 1  3 HIS HE1  H  12.538  -6.278   4.089 1.00 . A A .  3 HIS HE1  1 1 
        8  9427 1 1  3 HIS HE2  H  14.423  -5.015   3.008 1.00 . A A .  3 HIS HE2  1 1 
        8  9428 1 1  3 HIS N    N  17.480  -7.924   6.016 1.00 . A A .  3 HIS N    1 1 
        8  9429 1 1  3 HIS ND1  N  14.046  -7.775   4.322 1.00 . A A .  3 HIS ND1  1 1 
        8  9430 1 1  3 HIS NE2  N  14.496  -5.950   3.309 1.00 . A A .  3 HIS NE2  1 1 
        8  9431 1 1  3 HIS O    O  18.158  -7.741   2.742 1.00 . A A .  3 HIS O    1 1 
        8  9432 1 1  4 HIS C    C  21.053  -8.809   1.900 1.00 . A A .  4 HIS C    1 1 
        8  9433 1 1  4 HIS CA   C  20.886  -7.835   3.089 1.00 . A A .  4 HIS CA   1 1 
        8  9434 1 1  4 HIS CB   C  22.239  -7.517   3.771 1.00 . A A .  4 HIS CB   1 1 
        8  9435 1 1  4 HIS CD2  C  22.525  -8.913   5.954 1.00 . A A .  4 HIS CD2  1 1 
        8  9436 1 1  4 HIS CE1  C  24.099 -10.268   5.262 1.00 . A A .  4 HIS CE1  1 1 
        8  9437 1 1  4 HIS CG   C  22.792  -8.597   4.661 1.00 . A A .  4 HIS CG   1 1 
        8  9438 1 1  4 HIS H    H  20.177  -8.700   4.907 1.00 . A A .  4 HIS H    1 1 
        8  9439 1 1  4 HIS HA   H  20.496  -6.907   2.686 1.00 . A A .  4 HIS HA   1 1 
        8  9440 1 1  4 HIS HB2  H  22.976  -7.323   3.005 1.00 . A A .  4 HIS HB2  1 1 
        8  9441 1 1  4 HIS HB3  H  22.123  -6.626   4.371 1.00 . A A .  4 HIS HB3  1 1 
        8  9442 1 1  4 HIS HD1  H  24.201  -9.498   3.371 1.00 . A A .  4 HIS HD1  1 1 
        8  9443 1 1  4 HIS HD2  H  21.796  -8.436   6.594 1.00 . A A .  4 HIS HD2  1 1 
        8  9444 1 1  4 HIS HE1  H  24.842 -11.051   5.235 1.00 . A A .  4 HIS HE1  1 1 
        8  9445 1 1  4 HIS HE2  H  23.299 -10.471   7.129 1.00 . A A .  4 HIS HE2  1 1 
        8  9446 1 1  4 HIS N    N  19.885  -8.319   4.052 1.00 . A A .  4 HIS N    1 1 
        8  9447 1 1  4 HIS ND1  N  23.784  -9.469   4.262 1.00 . A A .  4 HIS ND1  1 1 
        8  9448 1 1  4 HIS NE2  N  23.353  -9.952   6.298 1.00 . A A .  4 HIS NE2  1 1 
        8  9449 1 1  4 HIS O    O  22.068  -9.494   1.763 1.00 . A A .  4 HIS O    1 1 
        8  9450 1 1  5 HIS C    C  19.306  -8.881  -1.292 1.00 . A A .  5 HIS C    1 1 
        8  9451 1 1  5 HIS CA   C  19.997  -9.673  -0.170 1.00 . A A .  5 HIS CA   1 1 
        8  9452 1 1  5 HIS CB   C  19.267 -11.012   0.035 1.00 . A A .  5 HIS CB   1 1 
        8  9453 1 1  5 HIS CD2  C  20.079 -12.238   2.177 1.00 . A A .  5 HIS CD2  1 1 
        8  9454 1 1  5 HIS CE1  C  21.359 -13.731   1.216 1.00 . A A .  5 HIS CE1  1 1 
        8  9455 1 1  5 HIS CG   C  20.029 -12.019   0.842 1.00 . A A .  5 HIS CG   1 1 
        8  9456 1 1  5 HIS H    H  19.204  -8.360   1.292 1.00 . A A .  5 HIS H    1 1 
        8  9457 1 1  5 HIS HA   H  21.023  -9.863  -0.458 1.00 . A A .  5 HIS HA   1 1 
        8  9458 1 1  5 HIS HB2  H  18.330 -10.828   0.541 1.00 . A A .  5 HIS HB2  1 1 
        8  9459 1 1  5 HIS HB3  H  19.059 -11.452  -0.933 1.00 . A A .  5 HIS HB3  1 1 
        8  9460 1 1  5 HIS HD1  H  21.005 -13.092  -0.689 1.00 . A A .  5 HIS HD1  1 1 
        8  9461 1 1  5 HIS HD2  H  19.562 -11.675   2.940 1.00 . A A .  5 HIS HD2  1 1 
        8  9462 1 1  5 HIS HE1  H  22.029 -14.562   1.061 1.00 . A A .  5 HIS HE1  1 1 
        8  9463 1 1  5 HIS HE2  H  21.237 -13.617   3.250 1.00 . A A .  5 HIS HE2  1 1 
        8  9464 1 1  5 HIS N    N  20.008  -8.878   1.068 1.00 . A A .  5 HIS N    1 1 
        8  9465 1 1  5 HIS ND1  N  20.842 -12.973   0.272 1.00 . A A .  5 HIS ND1  1 1 
        8  9466 1 1  5 HIS NE2  N  20.912 -13.308   2.378 1.00 . A A .  5 HIS NE2  1 1 
        8  9467 1 1  5 HIS O    O  18.285  -8.234  -1.066 1.00 . A A .  5 HIS O    1 1 
        8  9468 1 1  6 HIS C    C  18.410  -8.952  -4.533 1.00 . A A .  6 HIS C    1 1 
        8  9469 1 1  6 HIS CA   C  19.352  -8.140  -3.619 1.00 . A A .  6 HIS CA   1 1 
        8  9470 1 1  6 HIS CB   C  20.534  -7.586  -4.430 1.00 . A A .  6 HIS CB   1 1 
        8  9471 1 1  6 HIS CD2  C  22.731  -7.462  -3.038 1.00 . A A .  6 HIS CD2  1 1 
        8  9472 1 1  6 HIS CE1  C  22.607  -5.361  -2.443 1.00 . A A .  6 HIS CE1  1 1 
        8  9473 1 1  6 HIS CG   C  21.595  -6.951  -3.581 1.00 . A A .  6 HIS CG   1 1 
        8  9474 1 1  6 HIS H    H  20.605  -9.558  -2.650 1.00 . A A .  6 HIS H    1 1 
        8  9475 1 1  6 HIS HA   H  18.798  -7.309  -3.206 1.00 . A A .  6 HIS HA   1 1 
        8  9476 1 1  6 HIS HB2  H  20.993  -8.392  -4.987 1.00 . A A .  6 HIS HB2  1 1 
        8  9477 1 1  6 HIS HB3  H  20.170  -6.841  -5.122 1.00 . A A .  6 HIS HB3  1 1 
        8  9478 1 1  6 HIS HD1  H  20.853  -4.985  -3.416 1.00 . A A .  6 HIS HD1  1 1 
        8  9479 1 1  6 HIS HD2  H  23.091  -8.476  -3.141 1.00 . A A .  6 HIS HD2  1 1 
        8  9480 1 1  6 HIS HE1  H  22.832  -4.404  -1.995 1.00 . A A .  6 HIS HE1  1 1 
        8  9481 1 1  6 HIS HE2  H  24.092  -6.562  -1.715 1.00 . A A .  6 HIS HE2  1 1 
        8  9482 1 1  6 HIS N    N  19.853  -8.947  -2.500 1.00 . A A .  6 HIS N    1 1 
        8  9483 1 1  6 HIS ND1  N  21.553  -5.632  -3.186 1.00 . A A .  6 HIS ND1  1 1 
        8  9484 1 1  6 HIS NE2  N  23.336  -6.451  -2.336 1.00 . A A .  6 HIS NE2  1 1 
        8  9485 1 1  6 HIS O    O  18.839  -9.509  -5.544 1.00 . A A .  6 HIS O    1 1 
        8  9486 1 1  7 HIS C    C  14.804  -8.927  -5.040 1.00 . A A .  7 HIS C    1 1 
        8  9487 1 1  7 HIS CA   C  16.115  -9.730  -4.972 1.00 . A A .  7 HIS CA   1 1 
        8  9488 1 1  7 HIS CB   C  15.843 -11.145  -4.440 1.00 . A A .  7 HIS CB   1 1 
        8  9489 1 1  7 HIS CD2  C  18.111 -12.371  -4.120 1.00 . A A .  7 HIS CD2  1 1 
        8  9490 1 1  7 HIS CE1  C  17.983 -13.712  -5.845 1.00 . A A .  7 HIS CE1  1 1 
        8  9491 1 1  7 HIS CG   C  16.938 -12.119  -4.746 1.00 . A A .  7 HIS CG   1 1 
        8  9492 1 1  7 HIS H    H  16.873  -8.691  -3.271 1.00 . A A .  7 HIS H    1 1 
        8  9493 1 1  7 HIS HA   H  16.510  -9.810  -5.978 1.00 . A A .  7 HIS HA   1 1 
        8  9494 1 1  7 HIS HB2  H  15.723 -11.102  -3.368 1.00 . A A .  7 HIS HB2  1 1 
        8  9495 1 1  7 HIS HB3  H  14.930 -11.521  -4.883 1.00 . A A .  7 HIS HB3  1 1 
        8  9496 1 1  7 HIS HD1  H  16.158 -13.045  -6.468 1.00 . A A .  7 HIS HD1  1 1 
        8  9497 1 1  7 HIS HD2  H  18.479 -11.882  -3.229 1.00 . A A .  7 HIS HD2  1 1 
        8  9498 1 1  7 HIS HE1  H  18.213 -14.475  -6.572 1.00 . A A .  7 HIS HE1  1 1 
        8  9499 1 1  7 HIS HE2  H  19.676 -13.633  -4.709 1.00 . A A .  7 HIS HE2  1 1 
        8  9500 1 1  7 HIS N    N  17.135  -9.054  -4.144 1.00 . A A .  7 HIS N    1 1 
        8  9501 1 1  7 HIS ND1  N  16.894 -12.977  -5.821 1.00 . A A .  7 HIS ND1  1 1 
        8  9502 1 1  7 HIS NE2  N  18.741 -13.366  -4.826 1.00 . A A .  7 HIS NE2  1 1 
        8  9503 1 1  7 HIS O    O  13.757  -9.461  -5.406 1.00 . A A .  7 HIS O    1 1 
        8  9504 1 1  8 HIS C    C  14.177  -5.277  -4.546 1.00 . A A .  8 HIS C    1 1 
        8  9505 1 1  8 HIS CA   C  13.741  -6.724  -4.821 1.00 . A A .  8 HIS CA   1 1 
        8  9506 1 1  8 HIS CB   C  12.565  -7.120  -3.904 1.00 . A A .  8 HIS CB   1 1 
        8  9507 1 1  8 HIS CD2  C  12.904  -6.043  -1.561 1.00 . A A .  8 HIS CD2  1 1 
        8  9508 1 1  8 HIS CE1  C  13.298  -7.868  -0.424 1.00 . A A .  8 HIS CE1  1 1 
        8  9509 1 1  8 HIS CG   C  12.860  -7.080  -2.433 1.00 . A A .  8 HIS CG   1 1 
        8  9510 1 1  8 HIS H    H  15.723  -7.302  -4.331 1.00 . A A .  8 HIS H    1 1 
        8  9511 1 1  8 HIS HA   H  13.409  -6.784  -5.851 1.00 . A A .  8 HIS HA   1 1 
        8  9512 1 1  8 HIS HB2  H  11.737  -6.450  -4.086 1.00 . A A .  8 HIS HB2  1 1 
        8  9513 1 1  8 HIS HB3  H  12.258  -8.126  -4.152 1.00 . A A .  8 HIS HB3  1 1 
        8  9514 1 1  8 HIS HD1  H  13.144  -9.129  -2.026 1.00 . A A .  8 HIS HD1  1 1 
        8  9515 1 1  8 HIS HD2  H  12.756  -4.997  -1.799 1.00 . A A .  8 HIS HD2  1 1 
        8  9516 1 1  8 HIS HE1  H  13.519  -8.545   0.388 1.00 . A A .  8 HIS HE1  1 1 
        8  9517 1 1  8 HIS HE2  H  13.108  -6.069   0.523 1.00 . A A .  8 HIS HE2  1 1 
        8  9518 1 1  8 HIS N    N  14.876  -7.645  -4.683 1.00 . A A .  8 HIS N    1 1 
        8  9519 1 1  8 HIS ND1  N  13.112  -8.208  -1.684 1.00 . A A .  8 HIS ND1  1 1 
        8  9520 1 1  8 HIS NE2  N  13.178  -6.563  -0.324 1.00 . A A .  8 HIS NE2  1 1 
        8  9521 1 1  8 HIS O    O  14.790  -4.983  -3.517 1.00 . A A .  8 HIS O    1 1 
        8  9522 1 1  9 SER C    C  13.382  -2.114  -6.321 1.00 . A A .  9 SER C    1 1 
        8  9523 1 1  9 SER CA   C  14.214  -2.958  -5.350 1.00 . A A .  9 SER CA   1 1 
        8  9524 1 1  9 SER CB   C  15.709  -2.741  -5.620 1.00 . A A .  9 SER CB   1 1 
        8  9525 1 1  9 SER H    H  13.387  -4.679  -6.279 1.00 . A A .  9 SER H    1 1 
        8  9526 1 1  9 SER HA   H  13.988  -2.648  -4.338 1.00 . A A .  9 SER HA   1 1 
        8  9527 1 1  9 SER HB2  H  15.944  -1.691  -5.513 1.00 . A A .  9 SER HB2  1 1 
        8  9528 1 1  9 SER HB3  H  16.287  -3.311  -4.909 1.00 . A A .  9 SER HB3  1 1 
        8  9529 1 1  9 SER HG   H  16.318  -4.086  -6.915 1.00 . A A .  9 SER HG   1 1 
        8  9530 1 1  9 SER N    N  13.866  -4.381  -5.477 1.00 . A A .  9 SER N    1 1 
        8  9531 1 1  9 SER O    O  12.619  -2.657  -7.117 1.00 . A A .  9 SER O    1 1 
        8  9532 1 1  9 SER OG   O  16.061  -3.155  -6.932 1.00 . A A .  9 SER OG   1 1 
        8  9533 1 1 10 HIS C    C  11.249   0.001  -6.962 1.00 . A A . 10 HIS C    1 1 
        8  9534 1 1 10 HIS CA   C  12.781   0.133  -7.132 1.00 . A A . 10 HIS CA   1 1 
        8  9535 1 1 10 HIS CB   C  13.175  -0.113  -8.599 1.00 . A A . 10 HIS CB   1 1 
        8  9536 1 1 10 HIS CD2  C  15.775  -0.290  -8.589 1.00 . A A . 10 HIS CD2  1 1 
        8  9537 1 1 10 HIS CE1  C  16.208   1.462  -9.829 1.00 . A A . 10 HIS CE1  1 1 
        8  9538 1 1 10 HIS CG   C  14.589   0.276  -8.926 1.00 . A A . 10 HIS CG   1 1 
        8  9539 1 1 10 HIS H    H  14.141  -0.408  -5.582 1.00 . A A . 10 HIS H    1 1 
        8  9540 1 1 10 HIS HA   H  13.066   1.141  -6.864 1.00 . A A . 10 HIS HA   1 1 
        8  9541 1 1 10 HIS HB2  H  13.061  -1.165  -8.826 1.00 . A A . 10 HIS HB2  1 1 
        8  9542 1 1 10 HIS HB3  H  12.518   0.457  -9.241 1.00 . A A . 10 HIS HB3  1 1 
        8  9543 1 1 10 HIS HD1  H  14.253   1.983 -10.112 1.00 . A A . 10 HIS HD1  1 1 
        8  9544 1 1 10 HIS HD2  H  15.914  -1.175  -7.981 1.00 . A A . 10 HIS HD2  1 1 
        8  9545 1 1 10 HIS HE1  H  16.734   2.224 -10.384 1.00 . A A . 10 HIS HE1  1 1 
        8  9546 1 1 10 HIS HE2  H  17.720   0.408  -8.953 1.00 . A A . 10 HIS HE2  1 1 
        8  9547 1 1 10 HIS N    N  13.521  -0.784  -6.245 1.00 . A A . 10 HIS N    1 1 
        8  9548 1 1 10 HIS ND1  N  14.902   1.368  -9.702 1.00 . A A . 10 HIS ND1  1 1 
        8  9549 1 1 10 HIS NE2  N  16.764   0.471  -9.164 1.00 . A A . 10 HIS NE2  1 1 
        8  9550 1 1 10 HIS O    O  10.481   0.424  -7.825 1.00 . A A . 10 HIS O    1 1 
        8  9551 1 1 11 MET C    C   8.777   0.393  -4.749 1.00 . A A . 11 MET C    1 1 
        8  9552 1 1 11 MET CA   C   9.378  -0.767  -5.565 1.00 . A A . 11 MET CA   1 1 
        8  9553 1 1 11 MET CB   C   9.160  -2.098  -4.828 1.00 . A A . 11 MET CB   1 1 
        8  9554 1 1 11 MET CE   C  10.323  -3.451  -1.048 1.00 . A A . 11 MET CE   1 1 
        8  9555 1 1 11 MET CG   C   9.801  -2.159  -3.447 1.00 . A A . 11 MET CG   1 1 
        8  9556 1 1 11 MET H    H  11.467  -0.866  -5.174 1.00 . A A . 11 MET H    1 1 
        8  9557 1 1 11 MET HA   H   8.869  -0.812  -6.517 1.00 . A A . 11 MET HA   1 1 
        8  9558 1 1 11 MET HB2  H   8.099  -2.263  -4.716 1.00 . A A . 11 MET HB2  1 1 
        8  9559 1 1 11 MET HB3  H   9.575  -2.898  -5.427 1.00 . A A . 11 MET HB3  1 1 
        8  9560 1 1 11 MET HE1  H   9.793  -2.657  -0.545 1.00 . A A . 11 MET HE1  1 1 
        8  9561 1 1 11 MET HE2  H  11.355  -3.164  -1.188 1.00 . A A . 11 MET HE2  1 1 
        8  9562 1 1 11 MET HE3  H  10.278  -4.350  -0.450 1.00 . A A . 11 MET HE3  1 1 
        8  9563 1 1 11 MET HG2  H  10.862  -1.977  -3.545 1.00 . A A . 11 MET HG2  1 1 
        8  9564 1 1 11 MET HG3  H   9.360  -1.391  -2.826 1.00 . A A . 11 MET HG3  1 1 
        8  9565 1 1 11 MET N    N  10.813  -0.566  -5.834 1.00 . A A . 11 MET N    1 1 
        8  9566 1 1 11 MET O    O   7.621   0.345  -4.341 1.00 . A A . 11 MET O    1 1 
        8  9567 1 1 11 MET SD   S   9.567  -3.757  -2.643 1.00 . A A . 11 MET SD   1 1 
        8  9568 1 1 12 LEU C    C   8.679   3.730  -4.799 1.00 . A A . 12 LEU C    1 1 
        8  9569 1 1 12 LEU CA   C   9.120   2.634  -3.795 1.00 . A A . 12 LEU CA   1 1 
        8  9570 1 1 12 LEU CB   C  10.210   3.180  -2.850 1.00 . A A . 12 LEU CB   1 1 
        8  9571 1 1 12 LEU CD1  C  11.361   1.021  -2.164 1.00 . A A . 12 LEU CD1  1 1 
        8  9572 1 1 12 LEU CD2  C  11.449   3.027  -0.656 1.00 . A A . 12 LEU CD2  1 1 
        8  9573 1 1 12 LEU CG   C  10.611   2.261  -1.675 1.00 . A A . 12 LEU CG   1 1 
        8  9574 1 1 12 LEU H    H  10.515   1.371  -4.781 1.00 . A A . 12 LEU H    1 1 
        8  9575 1 1 12 LEU HA   H   8.258   2.355  -3.203 1.00 . A A . 12 LEU HA   1 1 
        8  9576 1 1 12 LEU HB2  H  11.094   3.385  -3.436 1.00 . A A . 12 LEU HB2  1 1 
        8  9577 1 1 12 LEU HB3  H   9.855   4.115  -2.436 1.00 . A A . 12 LEU HB3  1 1 
        8  9578 1 1 12 LEU HD11 H  12.258   1.322  -2.685 1.00 . A A . 12 LEU HD11 1 1 
        8  9579 1 1 12 LEU HD12 H  10.728   0.458  -2.834 1.00 . A A . 12 LEU HD12 1 1 
        8  9580 1 1 12 LEU HD13 H  11.624   0.403  -1.318 1.00 . A A . 12 LEU HD13 1 1 
        8  9581 1 1 12 LEU HD21 H  11.717   2.368   0.157 1.00 . A A . 12 LEU HD21 1 1 
        8  9582 1 1 12 LEU HD22 H  10.876   3.859  -0.270 1.00 . A A . 12 LEU HD22 1 1 
        8  9583 1 1 12 LEU HD23 H  12.347   3.399  -1.129 1.00 . A A . 12 LEU HD23 1 1 
        8  9584 1 1 12 LEU HG   H   9.714   1.923  -1.175 1.00 . A A . 12 LEU HG   1 1 
        8  9585 1 1 12 LEU N    N   9.584   1.423  -4.495 1.00 . A A . 12 LEU N    1 1 
        8  9586 1 1 12 LEU O    O   7.658   4.394  -4.587 1.00 . A A . 12 LEU O    1 1 
        8  9587 1 1 13 PRO C    C   7.872   4.193  -7.815 1.00 . A A . 13 PRO C    1 1 
        8  9588 1 1 13 PRO CA   C   9.023   4.833  -7.001 1.00 . A A . 13 PRO CA   1 1 
        8  9589 1 1 13 PRO CB   C  10.297   4.972  -7.865 1.00 . A A . 13 PRO CB   1 1 
        8  9590 1 1 13 PRO CD   C  10.832   3.476  -6.100 1.00 . A A . 13 PRO CD   1 1 
        8  9591 1 1 13 PRO CG   C  11.417   4.528  -6.990 1.00 . A A . 13 PRO CG   1 1 
        8  9592 1 1 13 PRO HA   H   8.713   5.807  -6.647 1.00 . A A . 13 PRO HA   1 1 
        8  9593 1 1 13 PRO HB2  H  10.213   4.345  -8.743 1.00 . A A . 13 PRO HB2  1 1 
        8  9594 1 1 13 PRO HB3  H  10.419   6.003  -8.169 1.00 . A A . 13 PRO HB3  1 1 
        8  9595 1 1 13 PRO HD2  H  10.826   2.516  -6.596 1.00 . A A . 13 PRO HD2  1 1 
        8  9596 1 1 13 PRO HD3  H  11.376   3.419  -5.167 1.00 . A A . 13 PRO HD3  1 1 
        8  9597 1 1 13 PRO HG2  H  12.216   4.114  -7.589 1.00 . A A . 13 PRO HG2  1 1 
        8  9598 1 1 13 PRO HG3  H  11.780   5.359  -6.402 1.00 . A A . 13 PRO HG3  1 1 
        8  9599 1 1 13 PRO N    N   9.459   3.971  -5.884 1.00 . A A . 13 PRO N    1 1 
        8  9600 1 1 13 PRO O    O   7.472   3.058  -7.548 1.00 . A A . 13 PRO O    1 1 
        8  9601 1 1 14 PRO C    C   6.668   3.276 -10.673 1.00 . A A . 14 PRO C    1 1 
        8  9602 1 1 14 PRO CA   C   6.221   4.351  -9.659 1.00 . A A . 14 PRO CA   1 1 
        8  9603 1 1 14 PRO CB   C   5.709   5.600 -10.391 1.00 . A A . 14 PRO CB   1 1 
        8  9604 1 1 14 PRO CD   C   7.724   6.246  -9.278 1.00 . A A . 14 PRO CD   1 1 
        8  9605 1 1 14 PRO CG   C   6.913   6.468 -10.530 1.00 . A A . 14 PRO CG   1 1 
        8  9606 1 1 14 PRO HA   H   5.432   3.950  -9.039 1.00 . A A . 14 PRO HA   1 1 
        8  9607 1 1 14 PRO HB2  H   5.304   5.324 -11.357 1.00 . A A . 14 PRO HB2  1 1 
        8  9608 1 1 14 PRO HB3  H   4.942   6.082  -9.799 1.00 . A A . 14 PRO HB3  1 1 
        8  9609 1 1 14 PRO HD2  H   8.780   6.286  -9.501 1.00 . A A . 14 PRO HD2  1 1 
        8  9610 1 1 14 PRO HD3  H   7.470   6.981  -8.526 1.00 . A A . 14 PRO HD3  1 1 
        8  9611 1 1 14 PRO HG2  H   7.479   6.174 -11.404 1.00 . A A . 14 PRO HG2  1 1 
        8  9612 1 1 14 PRO HG3  H   6.617   7.504 -10.607 1.00 . A A . 14 PRO HG3  1 1 
        8  9613 1 1 14 PRO N    N   7.327   4.889  -8.840 1.00 . A A . 14 PRO N    1 1 
        8  9614 1 1 14 PRO O    O   6.014   3.069 -11.697 1.00 . A A . 14 PRO O    1 1 
        8  9615 1 1 15 GLU C    C   7.594   0.242 -11.248 1.00 . A A . 15 GLU C    1 1 
        8  9616 1 1 15 GLU CA   C   8.330   1.592 -11.302 1.00 . A A . 15 GLU CA   1 1 
        8  9617 1 1 15 GLU CB   C   9.826   1.403 -11.008 1.00 . A A . 15 GLU CB   1 1 
        8  9618 1 1 15 GLU CD   C  12.112   2.488 -10.835 1.00 . A A . 15 GLU CD   1 1 
        8  9619 1 1 15 GLU CG   C  10.642   2.681 -11.171 1.00 . A A . 15 GLU CG   1 1 
        8  9620 1 1 15 GLU H    H   8.184   2.708  -9.502 1.00 . A A . 15 GLU H    1 1 
        8  9621 1 1 15 GLU HA   H   8.227   1.993 -12.302 1.00 . A A . 15 GLU HA   1 1 
        8  9622 1 1 15 GLU HB2  H   9.942   1.052  -9.991 1.00 . A A . 15 GLU HB2  1 1 
        8  9623 1 1 15 GLU HB3  H  10.223   0.656 -11.685 1.00 . A A . 15 GLU HB3  1 1 
        8  9624 1 1 15 GLU HG2  H  10.565   3.012 -12.199 1.00 . A A . 15 GLU HG2  1 1 
        8  9625 1 1 15 GLU HG3  H  10.233   3.445 -10.523 1.00 . A A . 15 GLU HG3  1 1 
        8  9626 1 1 15 GLU N    N   7.757   2.574 -10.372 1.00 . A A . 15 GLU N    1 1 
        8  9627 1 1 15 GLU O    O   6.741  -0.045 -12.093 1.00 . A A . 15 GLU O    1 1 
        8  9628 1 1 15 GLU OE1  O  12.835   1.861 -11.637 1.00 . A A . 15 GLU OE1  1 1 
        8  9629 1 1 15 GLU OE2  O  12.559   2.965  -9.772 1.00 . A A . 15 GLU OE2  1 1 
        8  9630 1 1 16 GLN C    C   6.845  -2.236  -8.715 1.00 . A A . 16 GLN C    1 1 
        8  9631 1 1 16 GLN CA   C   7.308  -1.924 -10.145 1.00 . A A . 16 GLN CA   1 1 
        8  9632 1 1 16 GLN CB   C   8.289  -3.013 -10.612 1.00 . A A . 16 GLN CB   1 1 
        8  9633 1 1 16 GLN CD   C   9.406  -4.156 -12.573 1.00 . A A . 16 GLN CD   1 1 
        8  9634 1 1 16 GLN CG   C   8.654  -2.929 -12.091 1.00 . A A . 16 GLN CG   1 1 
        8  9635 1 1 16 GLN H    H   8.555  -0.296  -9.572 1.00 . A A . 16 GLN H    1 1 
        8  9636 1 1 16 GLN HA   H   6.441  -1.943 -10.793 1.00 . A A . 16 GLN HA   1 1 
        8  9637 1 1 16 GLN HB2  H   9.199  -2.932 -10.033 1.00 . A A . 16 GLN HB2  1 1 
        8  9638 1 1 16 GLN HB3  H   7.843  -3.980 -10.429 1.00 . A A . 16 GLN HB3  1 1 
        8  9639 1 1 16 GLN HE21 H   7.699  -5.046 -13.025 1.00 . A A . 16 GLN HE21 1 1 
        8  9640 1 1 16 GLN HE22 H   9.132  -5.958 -13.329 1.00 . A A . 16 GLN HE22 1 1 
        8  9641 1 1 16 GLN HG2  H   7.747  -2.830 -12.671 1.00 . A A . 16 GLN HG2  1 1 
        8  9642 1 1 16 GLN HG3  H   9.275  -2.057 -12.249 1.00 . A A . 16 GLN HG3  1 1 
        8  9643 1 1 16 GLN N    N   7.913  -0.588 -10.254 1.00 . A A . 16 GLN N    1 1 
        8  9644 1 1 16 GLN NE2  N   8.673  -5.153 -13.022 1.00 . A A . 16 GLN NE2  1 1 
        8  9645 1 1 16 GLN O    O   7.646  -2.278  -7.785 1.00 . A A . 16 GLN O    1 1 
        8  9646 1 1 16 GLN OE1  O  10.631  -4.216 -12.541 1.00 . A A . 16 GLN OE1  1 1 
        8  9647 1 1 17 TRP C    C   4.452  -4.303  -7.307 1.00 . A A . 17 TRP C    1 1 
        8  9648 1 1 17 TRP CA   C   4.962  -2.853  -7.264 1.00 . A A . 17 TRP CA   1 1 
        8  9649 1 1 17 TRP CB   C   3.825  -1.889  -6.889 1.00 . A A . 17 TRP CB   1 1 
        8  9650 1 1 17 TRP CD1  C   4.888   0.408  -7.338 1.00 . A A . 17 TRP CD1  1 1 
        8  9651 1 1 17 TRP CD2  C   4.267   0.080  -5.214 1.00 . A A . 17 TRP CD2  1 1 
        8  9652 1 1 17 TRP CE2  C   4.838   1.360  -5.321 1.00 . A A . 17 TRP CE2  1 1 
        8  9653 1 1 17 TRP CE3  C   3.799  -0.350  -3.967 1.00 . A A . 17 TRP CE3  1 1 
        8  9654 1 1 17 TRP CG   C   4.313  -0.517  -6.513 1.00 . A A . 17 TRP CG   1 1 
        8  9655 1 1 17 TRP CH2  C   4.485   1.770  -3.022 1.00 . A A . 17 TRP CH2  1 1 
        8  9656 1 1 17 TRP CZ2  C   4.952   2.215  -4.229 1.00 . A A . 17 TRP CZ2  1 1 
        8  9657 1 1 17 TRP CZ3  C   3.914   0.500  -2.886 1.00 . A A . 17 TRP CZ3  1 1 
        8  9658 1 1 17 TRP H    H   4.952  -2.378  -9.330 1.00 . A A . 17 TRP H    1 1 
        8  9659 1 1 17 TRP HA   H   5.740  -2.784  -6.516 1.00 . A A . 17 TRP HA   1 1 
        8  9660 1 1 17 TRP HB2  H   3.154  -1.784  -7.730 1.00 . A A . 17 TRP HB2  1 1 
        8  9661 1 1 17 TRP HB3  H   3.278  -2.293  -6.048 1.00 . A A . 17 TRP HB3  1 1 
        8  9662 1 1 17 TRP HD1  H   5.064   0.255  -8.394 1.00 . A A . 17 TRP HD1  1 1 
        8  9663 1 1 17 TRP HE1  H   5.646   2.335  -6.991 1.00 . A A . 17 TRP HE1  1 1 
        8  9664 1 1 17 TRP HE3  H   3.355  -1.328  -3.841 1.00 . A A . 17 TRP HE3  1 1 
        8  9665 1 1 17 TRP HH2  H   4.555   2.401  -2.149 1.00 . A A . 17 TRP HH2  1 1 
        8  9666 1 1 17 TRP HZ2  H   5.389   3.199  -4.315 1.00 . A A . 17 TRP HZ2  1 1 
        8  9667 1 1 17 TRP HZ3  H   3.559   0.185  -1.914 1.00 . A A . 17 TRP HZ3  1 1 
        8  9668 1 1 17 TRP N    N   5.543  -2.468  -8.557 1.00 . A A . 17 TRP N    1 1 
        8  9669 1 1 17 TRP NE1  N   5.213   1.535  -6.626 1.00 . A A . 17 TRP NE1  1 1 
        8  9670 1 1 17 TRP O    O   3.588  -4.644  -8.114 1.00 . A A . 17 TRP O    1 1 
        8  9671 1 1 18 SER C    C   3.710  -6.966  -5.292 1.00 . A A . 18 SER C    1 1 
        8  9672 1 1 18 SER CA   C   4.663  -6.589  -6.437 1.00 . A A . 18 SER CA   1 1 
        8  9673 1 1 18 SER CB   C   5.940  -7.434  -6.327 1.00 . A A . 18 SER CB   1 1 
        8  9674 1 1 18 SER H    H   5.652  -4.818  -5.790 1.00 . A A . 18 SER H    1 1 
        8  9675 1 1 18 SER HA   H   4.178  -6.818  -7.377 1.00 . A A . 18 SER HA   1 1 
        8  9676 1 1 18 SER HB2  H   6.564  -7.254  -7.191 1.00 . A A . 18 SER HB2  1 1 
        8  9677 1 1 18 SER HB3  H   6.478  -7.154  -5.432 1.00 . A A . 18 SER HB3  1 1 
        8  9678 1 1 18 SER HG   H   6.306  -9.313  -6.767 1.00 . A A . 18 SER HG   1 1 
        8  9679 1 1 18 SER N    N   5.003  -5.156  -6.442 1.00 . A A . 18 SER N    1 1 
        8  9680 1 1 18 SER O    O   3.440  -6.165  -4.392 1.00 . A A . 18 SER O    1 1 
        8  9681 1 1 18 SER OG   O   5.643  -8.824  -6.264 1.00 . A A . 18 SER OG   1 1 
        8  9682 1 1 19 HIS C    C   2.948  -8.562  -2.890 1.00 . A A . 19 HIS C    1 1 
        8  9683 1 1 19 HIS CA   C   2.333  -8.744  -4.287 1.00 . A A . 19 HIS CA   1 1 
        8  9684 1 1 19 HIS CB   C   2.058 -10.239  -4.526 1.00 . A A . 19 HIS CB   1 1 
        8  9685 1 1 19 HIS CD2  C  -0.057 -10.649  -5.971 1.00 . A A . 19 HIS CD2  1 1 
        8  9686 1 1 19 HIS CE1  C   0.927 -10.997  -7.890 1.00 . A A . 19 HIS CE1  1 1 
        8  9687 1 1 19 HIS CG   C   1.278 -10.530  -5.770 1.00 . A A . 19 HIS CG   1 1 
        8  9688 1 1 19 HIS H    H   3.460  -8.782  -6.093 1.00 . A A . 19 HIS H    1 1 
        8  9689 1 1 19 HIS HA   H   1.398  -8.205  -4.331 1.00 . A A . 19 HIS HA   1 1 
        8  9690 1 1 19 HIS HB2  H   3.000 -10.765  -4.597 1.00 . A A . 19 HIS HB2  1 1 
        8  9691 1 1 19 HIS HB3  H   1.500 -10.633  -3.686 1.00 . A A . 19 HIS HB3  1 1 
        8  9692 1 1 19 HIS HD1  H   2.826 -10.746  -7.187 1.00 . A A . 19 HIS HD1  1 1 
        8  9693 1 1 19 HIS HD2  H  -0.829 -10.534  -5.225 1.00 . A A . 19 HIS HD2  1 1 
        8  9694 1 1 19 HIS HE1  H   1.095 -11.205  -8.937 1.00 . A A . 19 HIS HE1  1 1 
        8  9695 1 1 19 HIS HE2  H  -1.064 -11.338  -7.668 1.00 . A A . 19 HIS HE2  1 1 
        8  9696 1 1 19 HIS N    N   3.216  -8.208  -5.334 1.00 . A A . 19 HIS N    1 1 
        8  9697 1 1 19 HIS ND1  N   1.863 -10.756  -6.997 1.00 . A A . 19 HIS ND1  1 1 
        8  9698 1 1 19 HIS NE2  N  -0.246 -10.942  -7.298 1.00 . A A . 19 HIS NE2  1 1 
        8  9699 1 1 19 HIS O    O   2.311  -8.022  -1.988 1.00 . A A . 19 HIS O    1 1 
        8  9700 1 1 20 THR C    C   5.043  -7.438  -1.007 1.00 . A A . 20 THR C    1 1 
        8  9701 1 1 20 THR CA   C   4.914  -8.901  -1.453 1.00 . A A . 20 THR CA   1 1 
        8  9702 1 1 20 THR CB   C   6.332  -9.521  -1.559 1.00 . A A . 20 THR CB   1 1 
        8  9703 1 1 20 THR CG2  C   7.030  -9.547  -0.202 1.00 . A A . 20 THR CG2  1 1 
        8  9704 1 1 20 THR H    H   4.643  -9.432  -3.495 1.00 . A A . 20 THR H    1 1 
        8  9705 1 1 20 THR HA   H   4.357  -9.450  -0.707 1.00 . A A . 20 THR HA   1 1 
        8  9706 1 1 20 THR HB   H   6.922  -8.923  -2.241 1.00 . A A . 20 THR HB   1 1 
        8  9707 1 1 20 THR HG1  H   7.110 -11.141  -2.383 1.00 . A A . 20 THR HG1  1 1 
        8  9708 1 1 20 THR HG21 H   7.113  -8.541   0.183 1.00 . A A . 20 THR HG21 1 1 
        8  9709 1 1 20 THR HG22 H   8.019  -9.972  -0.311 1.00 . A A . 20 THR HG22 1 1 
        8  9710 1 1 20 THR HG23 H   6.455 -10.150   0.487 1.00 . A A . 20 THR HG23 1 1 
        8  9711 1 1 20 THR N    N   4.194  -9.011  -2.732 1.00 . A A . 20 THR N    1 1 
        8  9712 1 1 20 THR O    O   4.856  -7.114   0.169 1.00 . A A . 20 THR O    1 1 
        8  9713 1 1 20 THR OG1  O   6.241 -10.858  -2.075 1.00 . A A . 20 THR OG1  1 1 
        8  9714 1 1 21 THR C    C   4.238  -4.546  -1.048 1.00 . A A . 21 THR C    1 1 
        8  9715 1 1 21 THR CA   C   5.500  -5.125  -1.700 1.00 . A A . 21 THR CA   1 1 
        8  9716 1 1 21 THR CB   C   5.789  -4.342  -3.008 1.00 . A A . 21 THR CB   1 1 
        8  9717 1 1 21 THR CG2  C   6.089  -2.872  -2.719 1.00 . A A . 21 THR CG2  1 1 
        8  9718 1 1 21 THR H    H   5.493  -6.892  -2.873 1.00 . A A . 21 THR H    1 1 
        8  9719 1 1 21 THR HA   H   6.342  -4.990  -1.031 1.00 . A A . 21 THR HA   1 1 
        8  9720 1 1 21 THR HB   H   4.914  -4.395  -3.642 1.00 . A A . 21 THR HB   1 1 
        8  9721 1 1 21 THR HG1  H   7.714  -4.474  -3.452 1.00 . A A . 21 THR HG1  1 1 
        8  9722 1 1 21 THR HG21 H   6.970  -2.799  -2.100 1.00 . A A . 21 THR HG21 1 1 
        8  9723 1 1 21 THR HG22 H   5.250  -2.425  -2.205 1.00 . A A . 21 THR HG22 1 1 
        8  9724 1 1 21 THR HG23 H   6.260  -2.349  -3.650 1.00 . A A . 21 THR HG23 1 1 
        8  9725 1 1 21 THR N    N   5.355  -6.563  -1.962 1.00 . A A . 21 THR N    1 1 
        8  9726 1 1 21 THR O    O   4.291  -3.999   0.051 1.00 . A A . 21 THR O    1 1 
        8  9727 1 1 21 THR OG1  O   6.901  -4.929  -3.706 1.00 . A A . 21 THR OG1  1 1 
        8  9728 1 1 22 VAL C    C   1.411  -4.880   0.085 1.00 . A A . 22 VAL C    1 1 
        8  9729 1 1 22 VAL CA   C   1.819  -4.187  -1.227 1.00 . A A . 22 VAL CA   1 1 
        8  9730 1 1 22 VAL CB   C   0.697  -4.387  -2.279 1.00 . A A . 22 VAL CB   1 1 
        8  9731 1 1 22 VAL CG1  C  -0.639  -3.839  -1.776 1.00 . A A . 22 VAL CG1  1 1 
        8  9732 1 1 22 VAL CG2  C   1.086  -3.740  -3.606 1.00 . A A . 22 VAL CG2  1 1 
        8  9733 1 1 22 VAL H    H   3.125  -5.161  -2.591 1.00 . A A . 22 VAL H    1 1 
        8  9734 1 1 22 VAL HA   H   1.929  -3.125  -1.044 1.00 . A A . 22 VAL HA   1 1 
        8  9735 1 1 22 VAL HB   H   0.580  -5.448  -2.447 1.00 . A A . 22 VAL HB   1 1 
        8  9736 1 1 22 VAL HG11 H  -1.395  -3.974  -2.538 1.00 . A A . 22 VAL HG11 1 1 
        8  9737 1 1 22 VAL HG12 H  -0.539  -2.787  -1.552 1.00 . A A . 22 VAL HG12 1 1 
        8  9738 1 1 22 VAL HG13 H  -0.935  -4.370  -0.881 1.00 . A A . 22 VAL HG13 1 1 
        8  9739 1 1 22 VAL HG21 H   1.246  -2.682  -3.460 1.00 . A A . 22 VAL HG21 1 1 
        8  9740 1 1 22 VAL HG22 H   0.293  -3.888  -4.326 1.00 . A A . 22 VAL HG22 1 1 
        8  9741 1 1 22 VAL HG23 H   1.996  -4.193  -3.975 1.00 . A A . 22 VAL HG23 1 1 
        8  9742 1 1 22 VAL N    N   3.103  -4.693  -1.728 1.00 . A A . 22 VAL N    1 1 
        8  9743 1 1 22 VAL O    O   0.967  -4.231   1.033 1.00 . A A . 22 VAL O    1 1 
        8  9744 1 1 23 ARG C    C   1.892  -6.503   2.577 1.00 . A A . 23 ARG C    1 1 
        8  9745 1 1 23 ARG CA   C   1.204  -7.010   1.295 1.00 . A A . 23 ARG CA   1 1 
        8  9746 1 1 23 ARG CB   C   1.559  -8.489   1.035 1.00 . A A . 23 ARG CB   1 1 
        8  9747 1 1 23 ARG CD   C   1.231  -9.617   3.299 1.00 . A A . 23 ARG CD   1 1 
        8  9748 1 1 23 ARG CG   C   0.757  -9.507   1.854 1.00 . A A . 23 ARG CG   1 1 
        8  9749 1 1 23 ARG CZ   C   0.983 -11.564   4.762 1.00 . A A . 23 ARG CZ   1 1 
        8  9750 1 1 23 ARG H    H   1.981  -6.650  -0.650 1.00 . A A . 23 ARG H    1 1 
        8  9751 1 1 23 ARG HA   H   0.134  -6.925   1.417 1.00 . A A . 23 ARG HA   1 1 
        8  9752 1 1 23 ARG HB2  H   1.392  -8.702  -0.010 1.00 . A A . 23 ARG HB2  1 1 
        8  9753 1 1 23 ARG HB3  H   2.609  -8.637   1.250 1.00 . A A . 23 ARG HB3  1 1 
        8  9754 1 1 23 ARG HD2  H   2.275  -9.899   3.305 1.00 . A A . 23 ARG HD2  1 1 
        8  9755 1 1 23 ARG HD3  H   1.117  -8.656   3.779 1.00 . A A . 23 ARG HD3  1 1 
        8  9756 1 1 23 ARG HE   H  -0.514 -10.552   4.004 1.00 . A A . 23 ARG HE   1 1 
        8  9757 1 1 23 ARG HG2  H  -0.280  -9.210   1.856 1.00 . A A . 23 ARG HG2  1 1 
        8  9758 1 1 23 ARG HG3  H   0.848 -10.477   1.383 1.00 . A A . 23 ARG HG3  1 1 
        8  9759 1 1 23 ARG HH11 H   2.876 -11.114   4.314 1.00 . A A . 23 ARG HH11 1 1 
        8  9760 1 1 23 ARG HH12 H   2.650 -12.451   5.388 1.00 . A A . 23 ARG HH12 1 1 
        8  9761 1 1 23 ARG HH21 H  -0.783 -12.274   5.337 1.00 . A A . 23 ARG HH21 1 1 
        8  9762 1 1 23 ARG HH22 H   0.602 -13.108   5.952 1.00 . A A . 23 ARG HH22 1 1 
        8  9763 1 1 23 ARG N    N   1.586  -6.202   0.128 1.00 . A A . 23 ARG N    1 1 
        8  9764 1 1 23 ARG NE   N   0.461 -10.612   4.043 1.00 . A A . 23 ARG NE   1 1 
        8  9765 1 1 23 ARG NH1  N   2.269 -11.723   4.823 1.00 . A A . 23 ARG NH1  1 1 
        8  9766 1 1 23 ARG NH2  N   0.209 -12.379   5.399 1.00 . A A . 23 ARG NH2  1 1 
        8  9767 1 1 23 ARG O    O   1.274  -6.440   3.642 1.00 . A A . 23 ARG O    1 1 
        8  9768 1 1 24 ASN C    C   3.715  -4.116   3.810 1.00 . A A . 24 ASN C    1 1 
        8  9769 1 1 24 ASN CA   C   3.928  -5.629   3.613 1.00 . A A . 24 ASN CA   1 1 
        8  9770 1 1 24 ASN CB   C   5.422  -5.938   3.448 1.00 . A A . 24 ASN CB   1 1 
        8  9771 1 1 24 ASN CG   C   5.696  -7.433   3.366 1.00 . A A . 24 ASN CG   1 1 
        8  9772 1 1 24 ASN H    H   3.613  -6.229   1.596 1.00 . A A . 24 ASN H    1 1 
        8  9773 1 1 24 ASN HA   H   3.568  -6.139   4.497 1.00 . A A . 24 ASN HA   1 1 
        8  9774 1 1 24 ASN HB2  H   5.782  -5.473   2.541 1.00 . A A . 24 ASN HB2  1 1 
        8  9775 1 1 24 ASN HB3  H   5.964  -5.536   4.292 1.00 . A A . 24 ASN HB3  1 1 
        8  9776 1 1 24 ASN HD21 H   7.381  -7.119   2.376 1.00 . A A . 24 ASN HD21 1 1 
        8  9777 1 1 24 ASN HD22 H   6.985  -8.768   2.692 1.00 . A A . 24 ASN HD22 1 1 
        8  9778 1 1 24 ASN N    N   3.169  -6.143   2.467 1.00 . A A . 24 ASN N    1 1 
        8  9779 1 1 24 ASN ND2  N   6.796  -7.811   2.748 1.00 . A A . 24 ASN ND2  1 1 
        8  9780 1 1 24 ASN O    O   3.760  -3.617   4.935 1.00 . A A . 24 ASN O    1 1 
        8  9781 1 1 24 ASN OD1  O   4.935  -8.247   3.882 1.00 . A A . 24 ASN OD1  1 1 
        8  9782 1 1 25 ALA C    C   1.969  -1.623   3.603 1.00 . A A . 25 ALA C    1 1 
        8  9783 1 1 25 ALA CA   C   3.229  -1.943   2.782 1.00 . A A . 25 ALA CA   1 1 
        8  9784 1 1 25 ALA CB   C   3.105  -1.367   1.373 1.00 . A A . 25 ALA CB   1 1 
        8  9785 1 1 25 ALA H    H   3.470  -3.835   1.843 1.00 . A A . 25 ALA H    1 1 
        8  9786 1 1 25 ALA HA   H   4.083  -1.481   3.257 1.00 . A A . 25 ALA HA   1 1 
        8  9787 1 1 25 ALA HB1  H   2.267  -1.825   0.869 1.00 . A A . 25 ALA HB1  1 1 
        8  9788 1 1 25 ALA HB2  H   4.012  -1.571   0.821 1.00 . A A . 25 ALA HB2  1 1 
        8  9789 1 1 25 ALA HB3  H   2.953  -0.299   1.429 1.00 . A A . 25 ALA HB3  1 1 
        8  9790 1 1 25 ALA N    N   3.477  -3.391   2.717 1.00 . A A . 25 ALA N    1 1 
        8  9791 1 1 25 ALA O    O   1.944  -0.665   4.383 1.00 . A A . 25 ALA O    1 1 
        8  9792 1 1 26 LEU C    C  -0.145  -2.353   5.682 1.00 . A A . 26 LEU C    1 1 
        8  9793 1 1 26 LEU CA   C  -0.333  -2.260   4.154 1.00 . A A . 26 LEU CA   1 1 
        8  9794 1 1 26 LEU CB   C  -1.364  -3.294   3.676 1.00 . A A . 26 LEU CB   1 1 
        8  9795 1 1 26 LEU CD1  C  -2.692  -4.323   1.787 1.00 . A A . 26 LEU CD1  1 1 
        8  9796 1 1 26 LEU CD2  C  -2.445  -1.824   1.931 1.00 . A A . 26 LEU CD2  1 1 
        8  9797 1 1 26 LEU CG   C  -1.775  -3.172   2.196 1.00 . A A . 26 LEU CG   1 1 
        8  9798 1 1 26 LEU H    H   1.016  -3.187   2.795 1.00 . A A . 26 LEU H    1 1 
        8  9799 1 1 26 LEU HA   H  -0.702  -1.270   3.917 1.00 . A A . 26 LEU HA   1 1 
        8  9800 1 1 26 LEU HB2  H  -0.951  -4.282   3.836 1.00 . A A . 26 LEU HB2  1 1 
        8  9801 1 1 26 LEU HB3  H  -2.254  -3.193   4.282 1.00 . A A . 26 LEU HB3  1 1 
        8  9802 1 1 26 LEU HD11 H  -3.590  -4.302   2.386 1.00 . A A . 26 LEU HD11 1 1 
        8  9803 1 1 26 LEU HD12 H  -2.180  -5.263   1.940 1.00 . A A . 26 LEU HD12 1 1 
        8  9804 1 1 26 LEU HD13 H  -2.953  -4.223   0.744 1.00 . A A . 26 LEU HD13 1 1 
        8  9805 1 1 26 LEU HD21 H  -3.299  -1.708   2.583 1.00 . A A . 26 LEU HD21 1 1 
        8  9806 1 1 26 LEU HD22 H  -2.771  -1.778   0.901 1.00 . A A . 26 LEU HD22 1 1 
        8  9807 1 1 26 LEU HD23 H  -1.739  -1.028   2.118 1.00 . A A . 26 LEU HD23 1 1 
        8  9808 1 1 26 LEU HG   H  -0.887  -3.227   1.581 1.00 . A A . 26 LEU HG   1 1 
        8  9809 1 1 26 LEU N    N   0.933  -2.441   3.432 1.00 . A A . 26 LEU N    1 1 
        8  9810 1 1 26 LEU O    O  -0.926  -1.780   6.443 1.00 . A A . 26 LEU O    1 1 
        8  9811 1 1 27 LYS C    C   1.441  -1.782   8.184 1.00 . A A . 27 LYS C    1 1 
        8  9812 1 1 27 LYS CA   C   1.223  -3.168   7.555 1.00 . A A . 27 LYS CA   1 1 
        8  9813 1 1 27 LYS CB   C   2.496  -4.009   7.762 1.00 . A A . 27 LYS CB   1 1 
        8  9814 1 1 27 LYS CD   C   1.424  -6.162   8.537 1.00 . A A . 27 LYS CD   1 1 
        8  9815 1 1 27 LYS CE   C   1.460  -7.683   8.440 1.00 . A A . 27 LYS CE   1 1 
        8  9816 1 1 27 LYS CG   C   2.332  -5.504   7.503 1.00 . A A . 27 LYS CG   1 1 
        8  9817 1 1 27 LYS H    H   1.468  -3.524   5.469 1.00 . A A . 27 LYS H    1 1 
        8  9818 1 1 27 LYS HA   H   0.395  -3.653   8.050 1.00 . A A . 27 LYS HA   1 1 
        8  9819 1 1 27 LYS HB2  H   3.263  -3.641   7.097 1.00 . A A . 27 LYS HB2  1 1 
        8  9820 1 1 27 LYS HB3  H   2.835  -3.880   8.783 1.00 . A A . 27 LYS HB3  1 1 
        8  9821 1 1 27 LYS HD2  H   1.749  -5.868   9.526 1.00 . A A . 27 LYS HD2  1 1 
        8  9822 1 1 27 LYS HD3  H   0.411  -5.822   8.376 1.00 . A A . 27 LYS HD3  1 1 
        8  9823 1 1 27 LYS HE2  H   0.726  -8.091   9.119 1.00 . A A . 27 LYS HE2  1 1 
        8  9824 1 1 27 LYS HE3  H   1.213  -7.975   7.429 1.00 . A A . 27 LYS HE3  1 1 
        8  9825 1 1 27 LYS HG2  H   1.902  -5.645   6.521 1.00 . A A . 27 LYS HG2  1 1 
        8  9826 1 1 27 LYS HG3  H   3.306  -5.974   7.540 1.00 . A A . 27 LYS HG3  1 1 
        8  9827 1 1 27 LYS HZ1  H   3.051  -7.970   9.764 1.00 . A A . 27 LYS HZ1  1 1 
        8  9828 1 1 27 LYS HZ2  H   3.524  -7.858   8.144 1.00 . A A . 27 LYS HZ2  1 1 
        8  9829 1 1 27 LYS HZ3  H   2.789  -9.266   8.719 1.00 . A A . 27 LYS HZ3  1 1 
        8  9830 1 1 27 LYS N    N   0.899  -3.063   6.122 1.00 . A A . 27 LYS N    1 1 
        8  9831 1 1 27 LYS NZ   N   2.798  -8.231   8.790 1.00 . A A . 27 LYS NZ   1 1 
        8  9832 1 1 27 LYS O    O   0.859  -1.450   9.216 1.00 . A A . 27 LYS O    1 1 
        8  9833 1 1 28 ASP C    C   1.580   1.387   7.841 1.00 . A A . 28 ASP C    1 1 
        8  9834 1 1 28 ASP CA   C   2.677   0.328   8.078 1.00 . A A . 28 ASP CA   1 1 
        8  9835 1 1 28 ASP CB   C   4.001   0.760   7.429 1.00 . A A . 28 ASP CB   1 1 
        8  9836 1 1 28 ASP CG   C   4.696   1.877   8.187 1.00 . A A . 28 ASP CG   1 1 
        8  9837 1 1 28 ASP H    H   2.654  -1.269   6.683 1.00 . A A . 28 ASP H    1 1 
        8  9838 1 1 28 ASP HA   H   2.830   0.217   9.142 1.00 . A A . 28 ASP HA   1 1 
        8  9839 1 1 28 ASP HB2  H   4.669  -0.091   7.389 1.00 . A A . 28 ASP HB2  1 1 
        8  9840 1 1 28 ASP HB3  H   3.804   1.097   6.421 1.00 . A A . 28 ASP HB3  1 1 
        8  9841 1 1 28 ASP N    N   2.286  -0.978   7.544 1.00 . A A . 28 ASP N    1 1 
        8  9842 1 1 28 ASP O    O   1.485   2.374   8.572 1.00 . A A . 28 ASP O    1 1 
        8  9843 1 1 28 ASP OD1  O   5.386   1.577   9.189 1.00 . A A . 28 ASP OD1  1 1 
        8  9844 1 1 28 ASP OD2  O   4.567   3.052   7.785 1.00 . A A . 28 ASP OD2  1 1 
        8  9845 1 1 29 LEU C    C  -1.575   1.920   7.310 1.00 . A A . 29 LEU C    1 1 
        8  9846 1 1 29 LEU CA   C  -0.311   2.112   6.445 1.00 . A A . 29 LEU CA   1 1 
        8  9847 1 1 29 LEU CB   C  -0.640   1.941   4.944 1.00 . A A . 29 LEU CB   1 1 
        8  9848 1 1 29 LEU CD1  C  -2.854   3.198   4.739 1.00 . A A . 29 LEU CD1  1 1 
        8  9849 1 1 29 LEU CD2  C  -0.678   4.426   4.466 1.00 . A A . 29 LEU CD2  1 1 
        8  9850 1 1 29 LEU CG   C  -1.406   3.099   4.256 1.00 . A A . 29 LEU CG   1 1 
        8  9851 1 1 29 LEU H    H   0.858   0.340   6.298 1.00 . A A . 29 LEU H    1 1 
        8  9852 1 1 29 LEU HA   H   0.068   3.111   6.607 1.00 . A A . 29 LEU HA   1 1 
        8  9853 1 1 29 LEU HB2  H   0.292   1.803   4.416 1.00 . A A . 29 LEU HB2  1 1 
        8  9854 1 1 29 LEU HB3  H  -1.226   1.039   4.830 1.00 . A A . 29 LEU HB3  1 1 
        8  9855 1 1 29 LEU HD11 H  -3.361   2.262   4.552 1.00 . A A . 29 LEU HD11 1 1 
        8  9856 1 1 29 LEU HD12 H  -3.359   3.992   4.208 1.00 . A A . 29 LEU HD12 1 1 
        8  9857 1 1 29 LEU HD13 H  -2.869   3.409   5.798 1.00 . A A . 29 LEU HD13 1 1 
        8  9858 1 1 29 LEU HD21 H  -1.213   5.215   3.956 1.00 . A A . 29 LEU HD21 1 1 
        8  9859 1 1 29 LEU HD22 H   0.324   4.354   4.066 1.00 . A A . 29 LEU HD22 1 1 
        8  9860 1 1 29 LEU HD23 H  -0.628   4.650   5.521 1.00 . A A . 29 LEU HD23 1 1 
        8  9861 1 1 29 LEU HG   H  -1.433   2.908   3.192 1.00 . A A . 29 LEU HG   1 1 
        8  9862 1 1 29 LEU N    N   0.750   1.163   6.821 1.00 . A A . 29 LEU N    1 1 
        8  9863 1 1 29 LEU O    O  -2.051   2.860   7.950 1.00 . A A . 29 LEU O    1 1 
        8  9864 1 1 30 LEU C    C  -3.235   0.512   9.564 1.00 . A A . 30 LEU C    1 1 
        8  9865 1 1 30 LEU CA   C  -3.374   0.410   8.028 1.00 . A A . 30 LEU CA   1 1 
        8  9866 1 1 30 LEU CB   C  -3.871  -0.990   7.632 1.00 . A A . 30 LEU CB   1 1 
        8  9867 1 1 30 LEU CD1  C  -6.327  -0.414   7.521 1.00 . A A . 30 LEU CD1  1 1 
        8  9868 1 1 30 LEU CD2  C  -5.612  -2.814   7.769 1.00 . A A . 30 LEU CD2  1 1 
        8  9869 1 1 30 LEU CG   C  -5.286  -1.361   8.114 1.00 . A A . 30 LEU CG   1 1 
        8  9870 1 1 30 LEU H    H  -1.638  -0.034   6.876 1.00 . A A . 30 LEU H    1 1 
        8  9871 1 1 30 LEU HA   H  -4.100   1.141   7.700 1.00 . A A . 30 LEU HA   1 1 
        8  9872 1 1 30 LEU HB2  H  -3.853  -1.062   6.552 1.00 . A A . 30 LEU HB2  1 1 
        8  9873 1 1 30 LEU HB3  H  -3.179  -1.719   8.031 1.00 . A A . 30 LEU HB3  1 1 
        8  9874 1 1 30 LEU HD11 H  -6.103   0.601   7.819 1.00 . A A . 30 LEU HD11 1 1 
        8  9875 1 1 30 LEU HD12 H  -7.308  -0.685   7.882 1.00 . A A . 30 LEU HD12 1 1 
        8  9876 1 1 30 LEU HD13 H  -6.310  -0.483   6.442 1.00 . A A . 30 LEU HD13 1 1 
        8  9877 1 1 30 LEU HD21 H  -4.884  -3.466   8.231 1.00 . A A . 30 LEU HD21 1 1 
        8  9878 1 1 30 LEU HD22 H  -5.584  -2.947   6.698 1.00 . A A . 30 LEU HD22 1 1 
        8  9879 1 1 30 LEU HD23 H  -6.597  -3.062   8.137 1.00 . A A . 30 LEU HD23 1 1 
        8  9880 1 1 30 LEU HG   H  -5.327  -1.259   9.188 1.00 . A A . 30 LEU HG   1 1 
        8  9881 1 1 30 LEU N    N  -2.106   0.698   7.333 1.00 . A A . 30 LEU N    1 1 
        8  9882 1 1 30 LEU O    O  -4.232   0.532  10.288 1.00 . A A . 30 LEU O    1 1 
        8  9883 1 1 31 LYS C    C  -2.532   1.716  12.227 1.00 . A A . 31 LYS C    1 1 
        8  9884 1 1 31 LYS CA   C  -1.697   0.651  11.483 1.00 . A A . 31 LYS CA   1 1 
        8  9885 1 1 31 LYS CB   C  -0.196   0.927  11.684 1.00 . A A . 31 LYS CB   1 1 
        8  9886 1 1 31 LYS CD   C   1.757   1.133  13.287 1.00 . A A . 31 LYS CD   1 1 
        8  9887 1 1 31 LYS CE   C   2.258   2.468  12.745 1.00 . A A . 31 LYS CE   1 1 
        8  9888 1 1 31 LYS CG   C   0.242   0.977  13.147 1.00 . A A . 31 LYS CG   1 1 
        8  9889 1 1 31 LYS H    H  -1.250   0.625   9.410 1.00 . A A . 31 LYS H    1 1 
        8  9890 1 1 31 LYS HA   H  -1.928  -0.319  11.899 1.00 . A A . 31 LYS HA   1 1 
        8  9891 1 1 31 LYS HB2  H   0.368   0.146  11.191 1.00 . A A . 31 LYS HB2  1 1 
        8  9892 1 1 31 LYS HB3  H   0.046   1.876  11.225 1.00 . A A . 31 LYS HB3  1 1 
        8  9893 1 1 31 LYS HD2  H   2.019   1.066  14.333 1.00 . A A . 31 LYS HD2  1 1 
        8  9894 1 1 31 LYS HD3  H   2.241   0.332  12.745 1.00 . A A . 31 LYS HD3  1 1 
        8  9895 1 1 31 LYS HE2  H   3.338   2.470  12.773 1.00 . A A . 31 LYS HE2  1 1 
        8  9896 1 1 31 LYS HE3  H   1.929   2.578  11.722 1.00 . A A . 31 LYS HE3  1 1 
        8  9897 1 1 31 LYS HG2  H  -0.242   1.814  13.628 1.00 . A A . 31 LYS HG2  1 1 
        8  9898 1 1 31 LYS HG3  H  -0.061   0.058  13.633 1.00 . A A . 31 LYS HG3  1 1 
        8  9899 1 1 31 LYS HZ1  H   2.145   4.508  13.162 1.00 . A A . 31 LYS HZ1  1 1 
        8  9900 1 1 31 LYS HZ2  H   2.052   3.525  14.532 1.00 . A A . 31 LYS HZ2  1 1 
        8  9901 1 1 31 LYS HZ3  H   0.720   3.666  13.497 1.00 . A A . 31 LYS HZ3  1 1 
        8  9902 1 1 31 LYS N    N  -1.995   0.600  10.043 1.00 . A A . 31 LYS N    1 1 
        8  9903 1 1 31 LYS NZ   N   1.759   3.620  13.540 1.00 . A A . 31 LYS NZ   1 1 
        8  9904 1 1 31 LYS O    O  -3.036   1.470  13.327 1.00 . A A . 31 LYS O    1 1 
        8  9905 1 1 32 ASP C    C  -4.654   4.427  11.528 1.00 . A A . 32 ASP C    1 1 
        8  9906 1 1 32 ASP CA   C  -3.376   4.012  12.281 1.00 . A A . 32 ASP CA   1 1 
        8  9907 1 1 32 ASP CB   C  -2.430   5.212  12.381 1.00 . A A . 32 ASP CB   1 1 
        8  9908 1 1 32 ASP CG   C  -1.044   4.812  12.843 1.00 . A A . 32 ASP CG   1 1 
        8  9909 1 1 32 ASP H    H  -2.313   3.019  10.724 1.00 . A A . 32 ASP H    1 1 
        8  9910 1 1 32 ASP HA   H  -3.648   3.698  13.279 1.00 . A A . 32 ASP HA   1 1 
        8  9911 1 1 32 ASP HB2  H  -2.349   5.683  11.410 1.00 . A A . 32 ASP HB2  1 1 
        8  9912 1 1 32 ASP HB3  H  -2.835   5.923  13.087 1.00 . A A . 32 ASP HB3  1 1 
        8  9913 1 1 32 ASP N    N  -2.682   2.893  11.623 1.00 . A A . 32 ASP N    1 1 
        8  9914 1 1 32 ASP O    O  -5.216   5.496  11.785 1.00 . A A . 32 ASP O    1 1 
        8  9915 1 1 32 ASP OD1  O  -0.868   4.515  14.040 1.00 . A A . 32 ASP OD1  1 1 
        8  9916 1 1 32 ASP OD2  O  -0.119   4.780  12.007 1.00 . A A . 32 ASP OD2  1 1 
        8  9917 1 1 33 MET C    C  -7.409   2.922   9.828 1.00 . A A . 33 MET C    1 1 
        8  9918 1 1 33 MET CA   C  -6.251   3.929   9.743 1.00 . A A . 33 MET CA   1 1 
        8  9919 1 1 33 MET CB   C  -5.752   4.040   8.293 1.00 . A A . 33 MET CB   1 1 
        8  9920 1 1 33 MET CE   C  -6.294   7.133   7.553 1.00 . A A . 33 MET CE   1 1 
        8  9921 1 1 33 MET CG   C  -6.836   4.418   7.293 1.00 . A A . 33 MET CG   1 1 
        8  9922 1 1 33 MET H    H  -4.726   2.679  10.555 1.00 . A A . 33 MET H    1 1 
        8  9923 1 1 33 MET HA   H  -6.619   4.898  10.053 1.00 . A A . 33 MET HA   1 1 
        8  9924 1 1 33 MET HB2  H  -4.977   4.791   8.250 1.00 . A A . 33 MET HB2  1 1 
        8  9925 1 1 33 MET HB3  H  -5.333   3.089   7.993 1.00 . A A . 33 MET HB3  1 1 
        8  9926 1 1 33 MET HE1  H  -6.655   8.135   7.731 1.00 . A A . 33 MET HE1  1 1 
        8  9927 1 1 33 MET HE2  H  -5.877   7.073   6.559 1.00 . A A . 33 MET HE2  1 1 
        8  9928 1 1 33 MET HE3  H  -5.531   6.890   8.279 1.00 . A A . 33 MET HE3  1 1 
        8  9929 1 1 33 MET HG2  H  -6.388   4.511   6.314 1.00 . A A . 33 MET HG2  1 1 
        8  9930 1 1 33 MET HG3  H  -7.579   3.633   7.272 1.00 . A A . 33 MET HG3  1 1 
        8  9931 1 1 33 MET N    N  -5.129   3.573  10.624 1.00 . A A . 33 MET N    1 1 
        8  9932 1 1 33 MET O    O  -7.197   1.709   9.899 1.00 . A A . 33 MET O    1 1 
        8  9933 1 1 33 MET SD   S  -7.654   5.976   7.703 1.00 . A A . 33 MET SD   1 1 
        8  9934 1 1 34 ASN C    C -10.272   2.311   8.339 1.00 . A A . 34 ASN C    1 1 
        8  9935 1 1 34 ASN CA   C  -9.845   2.603   9.789 1.00 . A A . 34 ASN CA   1 1 
        8  9936 1 1 34 ASN CB   C -10.986   3.299  10.544 1.00 . A A . 34 ASN CB   1 1 
        8  9937 1 1 34 ASN CG   C -10.642   3.560  11.998 1.00 . A A . 34 ASN CG   1 1 
        8  9938 1 1 34 ASN H    H  -8.740   4.417   9.813 1.00 . A A . 34 ASN H    1 1 
        8  9939 1 1 34 ASN HA   H  -9.614   1.668  10.281 1.00 . A A . 34 ASN HA   1 1 
        8  9940 1 1 34 ASN HB2  H -11.200   4.246  10.068 1.00 . A A . 34 ASN HB2  1 1 
        8  9941 1 1 34 ASN HB3  H -11.868   2.676  10.508 1.00 . A A . 34 ASN HB3  1 1 
        8  9942 1 1 34 ASN HD21 H -11.703   5.226  11.979 1.00 . A A . 34 ASN HD21 1 1 
        8  9943 1 1 34 ASN HD22 H -10.933   4.840  13.475 1.00 . A A . 34 ASN HD22 1 1 
        8  9944 1 1 34 ASN N    N  -8.639   3.439   9.811 1.00 . A A . 34 ASN N    1 1 
        8  9945 1 1 34 ASN ND2  N -11.144   4.650  12.538 1.00 . A A . 34 ASN ND2  1 1 
        8  9946 1 1 34 ASN O    O -10.335   3.218   7.508 1.00 . A A . 34 ASN O    1 1 
        8  9947 1 1 34 ASN OD1  O  -9.921   2.795  12.629 1.00 . A A . 34 ASN OD1  1 1 
        8  9948 1 1 35 GLN C    C -12.098   1.376   6.081 1.00 . A A . 35 GLN C    1 1 
        8  9949 1 1 35 GLN CA   C -10.883   0.632   6.666 1.00 . A A . 35 GLN CA   1 1 
        8  9950 1 1 35 GLN CB   C -11.110  -0.881   6.606 1.00 . A A . 35 GLN CB   1 1 
        8  9951 1 1 35 GLN CD   C -10.090  -3.182   6.889 1.00 . A A . 35 GLN CD   1 1 
        8  9952 1 1 35 GLN CG   C  -9.923  -1.692   7.113 1.00 . A A . 35 GLN CG   1 1 
        8  9953 1 1 35 GLN H    H -10.597   0.379   8.761 1.00 . A A . 35 GLN H    1 1 
        8  9954 1 1 35 GLN HA   H -10.020   0.871   6.060 1.00 . A A . 35 GLN HA   1 1 
        8  9955 1 1 35 GLN HB2  H -11.974  -1.129   7.209 1.00 . A A . 35 GLN HB2  1 1 
        8  9956 1 1 35 GLN HB3  H -11.303  -1.164   5.582 1.00 . A A . 35 GLN HB3  1 1 
        8  9957 1 1 35 GLN HE21 H  -9.184  -3.047   5.134 1.00 . A A . 35 GLN HE21 1 1 
        8  9958 1 1 35 GLN HE22 H  -9.696  -4.629   5.602 1.00 . A A . 35 GLN HE22 1 1 
        8  9959 1 1 35 GLN HG2  H  -9.034  -1.365   6.595 1.00 . A A . 35 GLN HG2  1 1 
        8  9960 1 1 35 GLN HG3  H  -9.804  -1.513   8.173 1.00 . A A . 35 GLN HG3  1 1 
        8  9961 1 1 35 GLN N    N -10.575   1.049   8.041 1.00 . A A . 35 GLN N    1 1 
        8  9962 1 1 35 GLN NE2  N  -9.613  -3.665   5.760 1.00 . A A . 35 GLN NE2  1 1 
        8  9963 1 1 35 GLN O    O -12.119   1.704   4.895 1.00 . A A . 35 GLN O    1 1 
        8  9964 1 1 35 GLN OE1  O -10.643  -3.895   7.722 1.00 . A A . 35 GLN OE1  1 1 
        8  9965 1 1 36 SER C    C -13.905   3.804   5.963 1.00 . A A . 36 SER C    1 1 
        8  9966 1 1 36 SER CA   C -14.288   2.403   6.463 1.00 . A A . 36 SER CA   1 1 
        8  9967 1 1 36 SER CB   C -15.322   2.520   7.592 1.00 . A A . 36 SER CB   1 1 
        8  9968 1 1 36 SER H    H -13.066   1.317   7.835 1.00 . A A . 36 SER H    1 1 
        8  9969 1 1 36 SER HA   H -14.733   1.858   5.642 1.00 . A A . 36 SER HA   1 1 
        8  9970 1 1 36 SER HB2  H -14.835   2.876   8.488 1.00 . A A . 36 SER HB2  1 1 
        8  9971 1 1 36 SER HB3  H -16.097   3.217   7.304 1.00 . A A . 36 SER HB3  1 1 
        8  9972 1 1 36 SER HG   H -15.990   1.147   8.827 1.00 . A A . 36 SER HG   1 1 
        8  9973 1 1 36 SER N    N -13.107   1.644   6.909 1.00 . A A . 36 SER N    1 1 
        8  9974 1 1 36 SER O    O -14.561   4.360   5.084 1.00 . A A . 36 SER O    1 1 
        8  9975 1 1 36 SER OG   O -15.921   1.265   7.870 1.00 . A A . 36 SER OG   1 1 
        8  9976 1 1 37 SER C    C -11.380   5.501   4.881 1.00 . A A . 37 SER C    1 1 
        8  9977 1 1 37 SER CA   C -12.323   5.669   6.082 1.00 . A A . 37 SER CA   1 1 
        8  9978 1 1 37 SER CB   C -11.585   6.375   7.230 1.00 . A A . 37 SER CB   1 1 
        8  9979 1 1 37 SER H    H -12.386   3.899   7.260 1.00 . A A . 37 SER H    1 1 
        8  9980 1 1 37 SER HA   H -13.166   6.276   5.781 1.00 . A A . 37 SER HA   1 1 
        8  9981 1 1 37 SER HB2  H -12.264   6.521   8.057 1.00 . A A . 37 SER HB2  1 1 
        8  9982 1 1 37 SER HB3  H -10.754   5.763   7.551 1.00 . A A . 37 SER HB3  1 1 
        8  9983 1 1 37 SER HG   H -10.329   7.871   7.369 1.00 . A A . 37 SER HG   1 1 
        8  9984 1 1 37 SER N    N -12.839   4.366   6.527 1.00 . A A . 37 SER N    1 1 
        8  9985 1 1 37 SER O    O -11.487   6.214   3.883 1.00 . A A . 37 SER O    1 1 
        8  9986 1 1 37 SER OG   O -11.089   7.639   6.824 1.00 . A A . 37 SER OG   1 1 
        8  9987 1 1 38 LEU C    C -10.202   3.872   2.591 1.00 . A A . 38 LEU C    1 1 
        8  9988 1 1 38 LEU CA   C  -9.506   4.238   3.913 1.00 . A A . 38 LEU CA   1 1 
        8  9989 1 1 38 LEU CB   C  -8.573   3.098   4.350 1.00 . A A . 38 LEU CB   1 1 
        8  9990 1 1 38 LEU CD1  C  -6.506   4.006   3.217 1.00 . A A . 38 LEU CD1  1 1 
        8  9991 1 1 38 LEU CD2  C  -6.608   1.577   3.879 1.00 . A A . 38 LEU CD2  1 1 
        8  9992 1 1 38 LEU CG   C  -7.412   2.785   3.388 1.00 . A A . 38 LEU CG   1 1 
        8  9993 1 1 38 LEU H    H -10.449   3.988   5.796 1.00 . A A . 38 LEU H    1 1 
        8  9994 1 1 38 LEU HA   H  -8.915   5.130   3.758 1.00 . A A . 38 LEU HA   1 1 
        8  9995 1 1 38 LEU HB2  H  -8.154   3.354   5.314 1.00 . A A . 38 LEU HB2  1 1 
        8  9996 1 1 38 LEU HB3  H  -9.170   2.202   4.465 1.00 . A A . 38 LEU HB3  1 1 
        8  9997 1 1 38 LEU HD11 H  -6.100   4.294   4.178 1.00 . A A . 38 LEU HD11 1 1 
        8  9998 1 1 38 LEU HD12 H  -7.079   4.828   2.809 1.00 . A A . 38 LEU HD12 1 1 
        8  9999 1 1 38 LEU HD13 H  -5.697   3.765   2.543 1.00 . A A . 38 LEU HD13 1 1 
        8 10000 1 1 38 LEU HD21 H  -6.218   1.779   4.867 1.00 . A A . 38 LEU HD21 1 1 
        8 10001 1 1 38 LEU HD22 H  -5.787   1.391   3.200 1.00 . A A . 38 LEU HD22 1 1 
        8 10002 1 1 38 LEU HD23 H  -7.245   0.707   3.915 1.00 . A A . 38 LEU HD23 1 1 
        8 10003 1 1 38 LEU HG   H  -7.819   2.539   2.417 1.00 . A A . 38 LEU HG   1 1 
        8 10004 1 1 38 LEU N    N -10.474   4.527   4.979 1.00 . A A . 38 LEU N    1 1 
        8 10005 1 1 38 LEU O    O  -9.677   4.137   1.508 1.00 . A A . 38 LEU O    1 1 
        8 10006 1 1 39 ALA C    C -12.510   4.162   0.652 1.00 . A A . 39 ALA C    1 1 
        8 10007 1 1 39 ALA CA   C -12.189   2.921   1.504 1.00 . A A . 39 ALA CA   1 1 
        8 10008 1 1 39 ALA CB   C -13.477   2.224   1.928 1.00 . A A . 39 ALA CB   1 1 
        8 10009 1 1 39 ALA H    H -11.734   3.040   3.574 1.00 . A A . 39 ALA H    1 1 
        8 10010 1 1 39 ALA HA   H -11.613   2.226   0.906 1.00 . A A . 39 ALA HA   1 1 
        8 10011 1 1 39 ALA HB1  H -14.034   1.925   1.051 1.00 . A A . 39 ALA HB1  1 1 
        8 10012 1 1 39 ALA HB2  H -14.076   2.903   2.519 1.00 . A A . 39 ALA HB2  1 1 
        8 10013 1 1 39 ALA HB3  H -13.239   1.351   2.518 1.00 . A A . 39 ALA HB3  1 1 
        8 10014 1 1 39 ALA N    N -11.389   3.268   2.687 1.00 . A A . 39 ALA N    1 1 
        8 10015 1 1 39 ALA O    O -12.698   4.067  -0.562 1.00 . A A . 39 ALA O    1 1 
        8 10016 1 1 40 LYS C    C -11.531   7.055  -0.132 1.00 . A A . 40 LYS C    1 1 
        8 10017 1 1 40 LYS CA   C -12.804   6.592   0.594 1.00 . A A . 40 LYS CA   1 1 
        8 10018 1 1 40 LYS CB   C -13.263   7.680   1.576 1.00 . A A . 40 LYS CB   1 1 
        8 10019 1 1 40 LYS CD   C -14.957   8.459   3.275 1.00 . A A . 40 LYS CD   1 1 
        8 10020 1 1 40 LYS CE   C -13.896   8.743   4.333 1.00 . A A . 40 LYS CE   1 1 
        8 10021 1 1 40 LYS CG   C -14.542   7.333   2.334 1.00 . A A . 40 LYS CG   1 1 
        8 10022 1 1 40 LYS H    H -12.467   5.335   2.273 1.00 . A A . 40 LYS H    1 1 
        8 10023 1 1 40 LYS HA   H -13.582   6.429  -0.140 1.00 . A A . 40 LYS HA   1 1 
        8 10024 1 1 40 LYS HB2  H -12.478   7.851   2.299 1.00 . A A . 40 LYS HB2  1 1 
        8 10025 1 1 40 LYS HB3  H -13.436   8.594   1.026 1.00 . A A . 40 LYS HB3  1 1 
        8 10026 1 1 40 LYS HD2  H -15.119   9.357   2.695 1.00 . A A . 40 LYS HD2  1 1 
        8 10027 1 1 40 LYS HD3  H -15.880   8.180   3.767 1.00 . A A . 40 LYS HD3  1 1 
        8 10028 1 1 40 LYS HE2  H -13.814   7.885   4.986 1.00 . A A . 40 LYS HE2  1 1 
        8 10029 1 1 40 LYS HE3  H -12.947   8.909   3.842 1.00 . A A . 40 LYS HE3  1 1 
        8 10030 1 1 40 LYS HG2  H -15.336   7.161   1.620 1.00 . A A . 40 LYS HG2  1 1 
        8 10031 1 1 40 LYS HG3  H -14.374   6.434   2.909 1.00 . A A . 40 LYS HG3  1 1 
        8 10032 1 1 40 LYS HZ1  H -14.302  10.779   4.545 1.00 . A A . 40 LYS HZ1  1 1 
        8 10033 1 1 40 LYS HZ2  H -13.491  10.102   5.864 1.00 . A A . 40 LYS HZ2  1 1 
        8 10034 1 1 40 LYS HZ3  H -15.139   9.802   5.638 1.00 . A A . 40 LYS HZ3  1 1 
        8 10035 1 1 40 LYS N    N -12.576   5.327   1.298 1.00 . A A . 40 LYS N    1 1 
        8 10036 1 1 40 LYS NZ   N -14.231   9.939   5.151 1.00 . A A . 40 LYS NZ   1 1 
        8 10037 1 1 40 LYS O    O -11.596   7.775  -1.134 1.00 . A A . 40 LYS O    1 1 
        8 10038 1 1 41 GLU C    C  -8.675   5.998  -1.306 1.00 . A A . 41 GLU C    1 1 
        8 10039 1 1 41 GLU CA   C  -9.076   6.985  -0.195 1.00 . A A . 41 GLU CA   1 1 
        8 10040 1 1 41 GLU CB   C  -8.001   7.000   0.905 1.00 . A A . 41 GLU CB   1 1 
        8 10041 1 1 41 GLU CD   C  -8.348   9.391   1.714 1.00 . A A . 41 GLU CD   1 1 
        8 10042 1 1 41 GLU CG   C  -8.318   7.914   2.087 1.00 . A A . 41 GLU CG   1 1 
        8 10043 1 1 41 GLU H    H -10.401   6.061   1.180 1.00 . A A . 41 GLU H    1 1 
        8 10044 1 1 41 GLU HA   H  -9.158   7.977  -0.621 1.00 . A A . 41 GLU HA   1 1 
        8 10045 1 1 41 GLU HB2  H  -7.880   5.994   1.284 1.00 . A A . 41 GLU HB2  1 1 
        8 10046 1 1 41 GLU HB3  H  -7.064   7.322   0.471 1.00 . A A . 41 GLU HB3  1 1 
        8 10047 1 1 41 GLU HG2  H  -9.284   7.639   2.487 1.00 . A A . 41 GLU HG2  1 1 
        8 10048 1 1 41 GLU HG3  H  -7.565   7.765   2.849 1.00 . A A . 41 GLU HG3  1 1 
        8 10049 1 1 41 GLU N    N -10.379   6.632   0.383 1.00 . A A . 41 GLU N    1 1 
        8 10050 1 1 41 GLU O    O  -8.692   6.337  -2.490 1.00 . A A . 41 GLU O    1 1 
        8 10051 1 1 41 GLU OE1  O  -9.424   9.893   1.322 1.00 . A A . 41 GLU OE1  1 1 
        8 10052 1 1 41 GLU OE2  O  -7.298  10.061   1.819 1.00 . A A . 41 GLU OE2  1 1 
        8 10053 1 1 42 CYS C    C  -9.048   2.899  -2.391 1.00 . A A . 42 CYS C    1 1 
        8 10054 1 1 42 CYS CA   C  -7.876   3.744  -1.864 1.00 . A A . 42 CYS CA   1 1 
        8 10055 1 1 42 CYS CB   C  -6.849   2.824  -1.192 1.00 . A A . 42 CYS CB   1 1 
        8 10056 1 1 42 CYS H    H  -8.404   4.540   0.037 1.00 . A A . 42 CYS H    1 1 
        8 10057 1 1 42 CYS HA   H  -7.405   4.248  -2.695 1.00 . A A . 42 CYS HA   1 1 
        8 10058 1 1 42 CYS HB2  H  -6.453   2.139  -1.929 1.00 . A A . 42 CYS HB2  1 1 
        8 10059 1 1 42 CYS HB3  H  -6.044   3.424  -0.794 1.00 . A A . 42 CYS HB3  1 1 
        8 10060 1 1 42 CYS HG   H  -8.849   2.000   0.159 1.00 . A A . 42 CYS HG   1 1 
        8 10061 1 1 42 CYS N    N  -8.336   4.769  -0.915 1.00 . A A . 42 CYS N    1 1 
        8 10062 1 1 42 CYS O    O  -9.925   2.497  -1.627 1.00 . A A . 42 CYS O    1 1 
        8 10063 1 1 42 CYS SG   S  -7.530   1.841   0.164 1.00 . A A . 42 CYS SG   1 1 
        8 10064 1 1 43 PRO C    C -10.055   0.289  -4.030 1.00 . A A . 43 PRO C    1 1 
        8 10065 1 1 43 PRO CA   C -10.139   1.802  -4.336 1.00 . A A . 43 PRO CA   1 1 
        8 10066 1 1 43 PRO CB   C  -9.939   2.054  -5.850 1.00 . A A . 43 PRO CB   1 1 
        8 10067 1 1 43 PRO CD   C  -8.070   3.021  -4.701 1.00 . A A . 43 PRO CD   1 1 
        8 10068 1 1 43 PRO CG   C  -8.890   3.119  -5.955 1.00 . A A . 43 PRO CG   1 1 
        8 10069 1 1 43 PRO HA   H -11.114   2.164  -4.041 1.00 . A A . 43 PRO HA   1 1 
        8 10070 1 1 43 PRO HB2  H  -9.619   1.142  -6.331 1.00 . A A . 43 PRO HB2  1 1 
        8 10071 1 1 43 PRO HB3  H -10.872   2.381  -6.287 1.00 . A A . 43 PRO HB3  1 1 
        8 10072 1 1 43 PRO HD2  H  -7.290   2.280  -4.813 1.00 . A A . 43 PRO HD2  1 1 
        8 10073 1 1 43 PRO HD3  H  -7.648   3.982  -4.445 1.00 . A A . 43 PRO HD3  1 1 
        8 10074 1 1 43 PRO HG2  H  -8.271   2.944  -6.825 1.00 . A A . 43 PRO HG2  1 1 
        8 10075 1 1 43 PRO HG3  H  -9.358   4.093  -6.021 1.00 . A A . 43 PRO HG3  1 1 
        8 10076 1 1 43 PRO N    N  -9.066   2.598  -3.706 1.00 . A A . 43 PRO N    1 1 
        8 10077 1 1 43 PRO O    O -10.72